4HGAA

Structure of the variant histone h3.3-h4 heterodimer in complex with its chaperone daxx
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
207
structure length
207
Chain Sequence
b'QDPSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDPALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Death domain-associated protein 6
publication title Structure of the variant histone H3.3-H4 heterodimer in complex with its chaperone DAXX.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone/apoptosis
total genus 69
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2012-10-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2170 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4hgaA00
4H9PC 5KDMC 4H9NC 4H9OC 4H9QC 4HGAA 4H9RC 4H9SE
chains in the Genus database with same CATH superfamily
1M7KA 4PK5A 2HPLA 3FZKB 1BR4A 5FP3A 3PUGA 2LSKA 2VKJA 4QWNB 3LG7A 3DJBA 1UCUA 4QHOA 2UXXB 4YJ2E 3EABA 4H9OC 4X66T 1AJ3A 5JDGA 1FMVA 3RRWA 2XQ4A 1BR2A 1MIWA 2CWYA 5HYAA 3V5SA 3ZEFB 1EZ3A 2A72A 4CZZB 4HKAA 3PUWF 3OTOT 1MMDA 2QRXA 4MFRA 4UF0A 2K48A 1WR6A 5AQUB 2I6HA 4E7SA 1XMQT 1VCSA 4EYYR 2XAJB 2Y48B 3FZHB 2V8SV 3J9X1 2V26A 2CMRA 2NR4A 2XQ8A 1XNQT 2V7KA 3AE8A 4U72A 2V1DB 2XZEA 3NKZA 4IE7A 2JQQA 3IBPA 4IT4A 5LGNB 5ABFB 4EAHA 3C4XA 2FJDA 1VCTA 2BBHA 1HCIA 3ZMUB 2N2NA 1ZP0A 3HKDE 3CQXC 4LF8T 2Q9QA 2YDRA 4KP3C 4B3TT 3O9XA 5JDNA 2NWBA 1Y64B 3UU5A 2BVLA 4C91A 4HE8A 2QYWA 2FJAA 4JBWF 3PJAA 2XQ6A 3E0ZA 4IE5A 3W15B 3AB3B 4TWDA 5AQOB 4HGAA 4ILBA 3TLVA 4AQGA 4WYVA 4ZOLE 4AKRB 4DBQA 2VQFT 2A9UA 5JDQA 4IGUA 1IZNB 3P50A 3NRYA 4NUVA 2VASA 3E08A 1W9RA 2K24A 3GN5A 1YQ3A 3HKEE 5CA0E 2LRKA 3ZYKA 4OYJA 4X20E 4O4IE 4TX5A 2JMHA 5HEJA 3CKDA 2JQHA 1GQEA 2I59A 3AE1A 1NENA 3TLUA 4NIQA 2ACZA 4YTPA 4HFDA 5M4YA 4B3ST 3BQLA 5AFUL 5JR9C 3QNUA 2E9XA 3MA9A 2CXFA 3HKBE 4ADZA 3B13A 5FL0A 2E8IA 4X65T 5FY7A 5LB7B 3C51A 3L8RA 4B6XA 4NUUA 1M62A 5L2LA 3AVSA 2GK9A 5JQGE 4YXDA 1D0ZA 4DV0T 5LMUT 5AQMB 2IC9A 4AXPA 3PUQA 4ZI2D 5H6QB 3EDUA 3L09A 5L4HA 5JDHA 4HFCA 5F3JA 1KNRA 3P4PA 2MBGA 2WWVA 4UR9A 2DI4A 4G2AA 2BKOA 2LM2A 5LGUB 4M1PA 2XHEB 1QLBA 1L0VA 2LHRA 5AQJB 2M6IA 4CXWA 3KBTA 3PUSA 1XDPA 1W0BA 5EK2A 4XBFB 3ZJ2A 4WNKA 4GKJT 4KI0F 3UU8A 2F4VT 1ZV4X 4ZI3D 4GK0E 1MNDA 2H7OA 4EEDA 4JI3T 3RIFA 4PJLA 3UU4A 4X5TA 3UU6A 4DR6T 4EV6A 2C0SA 1E2AA 2BS2A 2XUEA 3PUAA 2IC6A 4U7YA 3CIRA 1XMOT 2ZM8A 3IHRA 1OXZA 5LCYA 5AQGB 2P9BA 4CN4A 3N2KE 2PBIA 2V7LA 2CLYB 1G8XA 4C90A 4DR1T 3R6NA 2HH7A 2LSGA 2W00A 1O3XA 5L3CB 1MMAA 2K5BB 2R6GF 2V5DA 4CXYA 3AXJB 4H9PC 3PUYF 1D1AA 2HN2A 2B76A 2IHR1 2AE9A 3PURA 4ZZCA 5L3BB 5HXCA 4HEAA 3OVUA 3FXEB 4COFA 1YKEB 4PAGA 3RKOA 4AI6A 1QUUA 4OK0A 4IIJE 4DR2T 2WCAA 5HWXA 2RP4A 2VL0A 2IDOB 4KX6A 4YSYA 4A56A 1OWAA 2G0UA 1JNZA 4U31A 2L9QA 3CX7B 4JI7T 5CA1E 1UUSA 3QUJA 4YT0A 2OV9A 4I50E 1UX4A 4UIGA 2XAQB 5FKYA 5AQQB 5IWAT 3C50A 3JC6D 3H3MA 3IA3A 5LA6E 4TWHA 3UUBA 3F57A 1J5ET 4QH1A 4AKGA 3O1JA 1W0AA 3EUHA 1HNWT 3S4UA 4P0BA 3KBUA 4DMWA 4LMJA 4O4LE 2LOSA 4PJNA 4F6RC 4O2AE 4UF0B 4MHCA 2JQKA 4MLKA 3UQ4A 5LOVE 4IDPA 2CE7A 2MYSA 1X79A 3UU3A 4GIWA 4LFBT 3CK6A 3OYXA 3UUXB 2BBJA 4DNDA 5F5WA 4ZI7E 1WYBA 4FJOA 4H63V 3LDQB 3VHLA 2DNXA 2LJLA 3KVAA 4Q25A 3TKLB 2LEHA 5FYMA 3C98B 4ZS2A 3RYFE 2D9DA 3ONJA 3VR8A 1S94A 2Q9QB 5KXJA 4A97A 1FMWA 1MIVA 5J1GA 2WU5A 1J1JA 3N2OA 4H63H 4ISSA 3DP7A 5HXRA 2YDQA 2AXDS 2M67A 2BKNA 2X0HA 5CJ5A 2X9XA 4LF9T 2WZIA 2A2FX 3K3NA 2DL1A 3VRAA 5A1LA 4GYSA 1WYCA 5JR9A 2ZM2A 3GN5B 3I9YA 3FBLA 3TLSA 3OJAA 4EZHA 4XAXB 2V7IA 5ABHA 4E7ZA 5E0OA 5KDMC 3ZPOA 2WS3A 3KV9A 3UFEA 3FZLB 3RGLA 4HWCA 4IDQA 3PUZF 1YKHB 2FJBA 3Q9DA 5JDMA 2BG9C 3PUVF 2FJEA 5KMGP 4JUYA 5ETWA 3VRBA 1CUNA 2EHOC 2E9XB 2NTXA 4GKKT 2LE8A 3F31A 3K1SA 3RPUA 3CX8B 2QGSA 2V6YA 1UX5A 4YHJA 4AKLA 2FUPA 2CWOA 4H9RC 3LK42 1D1BA 2UXCT 2J62A 3NWIA 2YDSA 2EHOD 3ZJ1A 4DBRA 2XM2A 2X67A 3H37A 5JVDE 5C8YE 3JADA 5JH7E 1BR0A 4PK6A 5CGMA 3FZFB 4I4TE 2DWGA 4EEBA 2W67A 2WM9A 2LLYA 3SFDA 3O4XE 2CXDA 4HFVA 2BVMA 3EDVA 4DO0A 2UXNB 2WB5A 4CN6A 2HHHT 1B7TA 5JDFA 4UV8B 2V6XA 5AQTB 3QOFA 5HCJA 5TAOA 2LRLA 1ZKEA 3AA0B 4LF5T 2W62A 3T1HT 2PG8A 2KT9A 4EZ4A 4LF4T 3AE7A 2VVNA 1SE7A 4AKIA 3UULA 1MMGA 3QB5K 4X64T 4IE4A 4YJ3E 1HNZT 4HN9A 4JV5T 1LVKA 2NP9A 4J2CA 4H9NC 4HWIB 2A3DA 2C5JA 2WP9A 3O1IA 3QB5A 1V9DA 2B1EA 3AE6A 2VKHA 2VQET 3T1YT 1D0XA 5F8PA 4KMCA 2IUBA 2WZHA 5AQKB 5GONE 1KFYA 2C5IT 3KV4A 2KSRA 2C5KT 3AEFA 5HEOA 4DV2T 5C3JA 2WY2A 2CCQA 1U5PA 3AE9A 2XQ3A 1IBKT 4JLEA 2WMOA 3KVBA 3RI5A 1W09A 2LKHA 3AEEA 2OLTA 5AQNB 5JREA 2VKOA 2VVSA 4LMLA 4UVCB 2JMKA 4KHPT 2MPKA 4UEMA 2LKGA 2Y6XA 4CXXA 2LHNA 3AE4A 4PJMA 2UU9T 5IUXA 1NWMX 2IAKA 1N36T 4ZI2C 1HNXT 3N9NA 4GYRA 2W4XA 1YW0A 3KV5A 4IE0A 4WBOA 5BR8T 4AIUA 4JI8T 4KBMB 3CQGB 1HF8A 1Z0PA 2CM0A 3MK7C 3AE3A 3H3AA 4ZS3A 3A8YC 2VKDA 4Z8XA 2WDRA 4ZI3C 3OKQA 3RQWA 2ACXA 5AQPB 4N78D 2ES0A 3LBXA 4X1YE 3K3QC 4JI2T 2XQ5A 4U33A 3SOLA 3CVRA 3MACA 4UELA 1HG2A 3AA1B 2XTLA 3LSVA 4U3CA 1E1HB 2KZ7B 4H9QC 1IAPA 4XZCA 2XAFB 4OHFA 1NEKA 2BG9A 1OEDC 3WAJA 3D0TA 3UTKA 4ZXLA 4GOUA 5JR9B 2EHOA 5HXHA 4LF6T 4I0UA 3ZCIA 2D5UA 3PU8A 4I43B 3NZQA 3EI0A 3RF1A 3FHNA 1KF6A 3RC8A 4L5GA 3U78A 4CN1A 3UFGA 2UUBT 3LFMA 2MOZA 3HA4A 3RRCA 3PV0F 2UUCT 1KEYA 4A98A 4YTNA 1FIOA 2X0LB 3JC6C 5L3FB 1JNRA 1UGOA 2V6YB 4PNIA 3UT5E 1US7B 1WR0A 4O8SA 4CQIA 5J2TE 1SA0E 1R8IA 4QXCB 1XDOA 1HFAA 2VL8A 5LBMA 5HAXA 2N1GA 4LFAT 3PJAJ 1I94T 2BKPA 2N9DA 2VK9A 4H9SE 3AEBA 3RYIE 4O4HE 4PJJA 3G06A 4BA9A 3A7MA 2JRKA 5HEHA 2KXPB 3ZLIA 3C64A 4PFPA 5L3DB 5DQWA 5FNVE 3KFWX 4IE6A 2MTQA 5CFBA 3PDYA 4ZEYA 5L3EB 3ZT6A 2YINA 5L3GB 3SFEA 2J4GA 3R84B 1XNRT 4JI1T 4HFEA 1IJ6A 1N32T 1D1CA 2XQ9A 3RH3A 3ONXA 4PW8A 2Q9QD 2ODUA 5LJMA 2JPFA 4EIWA 3AECA 1DU2A 3MZKB 5FXXA 4X1KE 3HL6A 4DR5T 3OYZA 1T72A 4V1Av 3ABVA 3ZYLA 2XSAA 4O4JE 3HKCE 5LG3A 1Y01A 3Q5EA 3ZSTA 4NXMT 3ANWA 4UV9B 2CEAA 4JEUB 4G63A 4DR4T 4QH5A 4PK4A 5IHYA 5LHGB 4JI5T 1LRZA 2LT3A 2X68A 3C4ZA 4IL9A 2XJ7A 4TUYE 3RQUA 4JI4T 3SS1A 1I6ZA 1UK5A 1YD8G 5KX5E 2NW7A 3EAMA 4BJMA 2XY8B 3AVRA 3B57A 3FB2A 3AE2A 3M65A 2DLRA 3EVYA 4HFHA 4OFZA 2X9HA 3Q5DA 3C4WA 1H7CA 2J47A 3N9PA 3GMIA 4YY3T 3CX6B 5IYZE 2CBJA 3VKHA 4QXHB 4MALA 4HWHA 2FBWA 2E5VA 2XM1A 3UQ7A 2YK0A 3N9QA 4OX9T 3ZKRA 4ILUA 5C2TA 4CI1B 3AAIA 3RHWA 5DQVA 5FVKA 4JI6T 2YN6A 3F2EA 3ZC1A 1BR1A 2IMLA 4LMKA 3OPCA 3UUMA 5LXTE 3SRZA 4MBQA 2YKSA 4I55E 1WLXA 4BAYB 4AQYT 4ILCA 1E7PA 2WU2A 3ZN1B 3GWHA 4ANJA 4IDZA 3PTRB 1MMNA 4F8HA 2CPTA 4ILAA 4YTMA 3J7Yq 4YHHT 4TNWA 5HCMA 1LKXA 1N34T 4L9IA 5BMVE 5H6RB 5ABEA 3Q5WA 3CWZB 1OEDA 2YOEA 5JDLA 4DV4T 5J0ZA 5L4EA 3LBXB 4DMVA 4U2YA 4Z91A 3ZMVB 3N5LA 1NAFA 2PFVA 2XQAA 3L3PA 5LYJE 3AAEB 5FXVA 3LJCA 3BQKA 2LSJA 2XQ7A 3U3IA 3ZMTB 3P4SA 3RC3A 4QH4A 4EGWA 3MXZA 4EB6E 4CI3B 1S35A 2BG9B 1Z8UA 2D0UA 2Y8DA 3N9OA 2BS3A 2E2AA 2VWAA 1KNPA 3ZSSA 2EHOB 2W0GA 2L8KA 5DJQC 4QX8B 2XSBA 3VKGA 4CI2B 2X0YA 5FY1A 5LNKA 1SHZC 3EHZA 3P4RA 4WW0A 4YFSA 4EOZB 4ISTA 3HR0A 2NOXA 3CQCB 4JEHB 4A5XA 4ASKA 1YXRA 1ZEEA 2WWUA 5JRCA 2QA7A 4NPPA 1WFDA 4TV9E 4X1IE 4U74A 5LHHB 2UXDT 2LOPA 5ADXL 2V5CA 1HX8A 1N33T 3IEEA 1XZYA 5LP6E 4TN7B 4GK5E 4DIDB 3FXDB 3N2GE 4UVAB 2IW5B 3PU3A 3TLWA 2H7VC 1LVFA 4EYUA 2CRBA 4HFIA 4TWFA 3KDSE 2K3WA 4DR7T 2NW9A 2V7JA 5FY0A 5HEUA 4YSZA 2NW8A 3M3ZB 5LG4A 2YU1A 2D2SA 3K8PC 1WCRA 4IHJE 3RIUC 2UUAT 3P4QA 1FEWA 1KNZA 3LK2B 4TZ4C 2BDEA 4TNVA 2ODVA 5FXZA 2NTYA 1IJ5A 4IDNA 2HN1A 2J1DG 3K3OA 3ZT7A 2ZM0A 2RA1A 5HWYA 2HPJA 4X62T 4OYKA 3HI2A 3O1HA 3Q5XA 2WBLA 4HWDA 4DV1T 1ZOYA 3RYHE 2WDVA 4DV5T 2CLYC 2X9YA 2ZMAA 3ETUA 3ZYMA 2V7MA 3T8OA 3ZMSB 3I0OA 4K0UA 5DABA 3JAFA 3L39A 4AQFC 2XASB 4WBNE 4DUYT 3ANWB 1WRDA 4P09A 3RYCE 4QKNA 3BQIA 5LJNA 3ZT5A 5ABGA 3IF8B 2BG9E 5AQIB 5LGTB 1VOMA 2KLQA 2JIWA 2W61A 2WMNA 3UUNA 3AEDA 2KINB 3N9MA 2CBIA 5AQLB 5J2UE 2ZLYA 3ETVA 2XAGB 3I1AA 5HXEA 2XPKA 4NXNT 2DWKA 1HX1B 1MNEA 4B3RT 4U7IA 4FI5A 2YU2A 2KNDA 2H89A 2W63A 2JJ9A 3P8CD 1J5WA 3QC9A 3DTOA 3KV6A 5AQFB 3ESLA 5FVLA 4ZZBA 4JI0T 3V5UA 5ABFA 2XQYA 5FMNA 2BZBA 1KK7A 2YEVC 3TLTA 4LFCT 3ZCJA 2KWHA 2SPCA 3RKGA 3ZN0B 1T8BA 2KWIB 3RX6A 3E22E 2DCFA 3I9WA 4AISA 4PFOA 2ZM6T 2CA5A 2BS4A 2WSSV 3BK9A 2L3LA 4HFBA 5LHIB 2VB6A 2LSIA 2PTFA 2RPAA 1ZHCA 1HR0T 1OEDB 2H3RA 3NRXA 3B5MA 2XAHB 5AQVB 2CXLA 3A5XA 1HTJF 1XWMA 2Q9QC 4TV8E 3P7IA 3P4WA 3KINB 2CHOA 3AEAA 2E5LT 4WZXA 1UURA 2UXBT 5FXWA 5FL1A 3AAAB 5HEGA 4L0RA 5EK3A 2WAUA 3NVOA 5AQSB 1QSDA 1VRBA 3LK3B 1IBLT 2I0MA 4DV3T 4KHZF 2KMFA 4DV7T 5L47A 1D0YA 1CHUA 2M6BA 5AQHB 3I0QA 4O2BE 2JQ9A 4B3MT 2Z6EA 3MJXA 3SWHA 2CHNA 5EZYE 4ZHQE 3FBZA 1X9BA 4YLHA 3CMLA 4K0KT 1FJGT 4IREA 4QX7B 3N9LA 2D0TA 5JTGA 1SUMB 4HTEA 3MKDA 5EK4A 3WAKA 4LF7T 3JCFA 5JRCB 5AQRB 2IIUA 3RIAA 3FZMB 1YQ4A 3RLFF 3ONLC 4EXTA 2E9XC 1T7SA 4P1NA 1G73A 3AA7B 4YSXA 4HWFA 4Z90A 4DVDA 3OBVE 3RIUA 1HG5A 3QK6A 4DR3T 2WDQA 3X1DA 3PE0A 2X66A 4IL4A 2LM9A 2E9XD 3AA6B 3NZPA 2MAWA 2H88A 3VU7H 5LMNT 3CPZA 2PJQA 2W2UA 4DUZT 4U2ZA 2LSYA 4QXBB 2W66A 3AE5A 4JYAT 4IDOA 1T98A 3ZC0A 1U4QA 5LBQB 4AKHA 1IBMT 3NBXX 1MIYA 1HS7A 4UXNB 3PUXF 5CB4E 2X9WA 2WQYA 4DV6T 2VURA 3AXJA 4ERRA 4AQFA 4KUMB 3Q2MA 2K9AA 2DHRA 2QVAA 2OA5A 4UVBB 3GA8A 3WI3A 3AEGA 4P0AA 5HXSA 2X51A 3VR9A 1OEDE 3ZMZB 3JAEA 4BJNA
chains in the Genus database with same CATH topology
2MYSA 4PK5A 2HPLA 2IW5B 3WAJA 3D0TA 3UTKA 3PU3A 1X79A 4GIWA 1BR4A 5FP3A 4GOUA 3PUGA 2EHOA 3OYXA 4DNDA 2H7VC 2LSKA 3UUXB 1LVFA 5JR9B 4EYUA 3KDSE 5HXHA 2NW9A 1WYBA 2VKJA 4FJOA 4QWNB 2V7JA 4ZI7E 4H63V 3VHLA 5FY0A 3ZCIA 3LG7A 2D5UA 2NW8A 3DJBA 3PU8A 2DNXA 2LJLA 1UCUA 3KVAA 3TKLB 4QHOA 5LG4A 2UXXB 4I43B 3NZQA 2YU1A 4H9OC 4YJ2E 2LEHA 5FYMA 2D2SA 1AJ3A 3C98B 4ZS2A 3K8PC 3FHNA 5JDGA 1FMVA 3RC8A 4IHJE 4L5GA 3RRWA 3RYFE 3U78A 1FEWA 1KNZA 3LK2B 4TZ4C 2BDEA 1S94A 2MOZA 3LFMA 1BR2A 1MIWA 2CWYA 2ODVA 3HA4A 5FXZA 3RRCA 2Q9QB 2NTYA 5HYAA 1IJ5A 1FMWA 3V5SA 1MIVA 3ZEFB 1EZ3A 2A72A 5J1GA 2J1DG 4CZZB 3K3OA 4HKAA 1FIOA 2ZM0A 1MMDA 2RA1A 2X0LB 5HWYA 2HPJA 3JC6C 5L3FB 4OYKA 3HI2A 3O1HA 4MFRA 4PNIA 3N2OA 4UF0A 2K48A 3Q5XA 4H63H 1US7B 2WBLA 3UT5E 4O8SA 4ISSA 4CQIA 1WR6A 1SA0E 3DP7A 4QXCB 5HXRA 3RYHE 2M67A 4E7SA 5J2TE 1HFAA 2VL8A 5LBMA 5HAXA 2N1GA 2CLYC 4EYYR 2X9XA 2X9YA 2XAJB 2Y48B 2N9DA 2A2FX 2ZMAA 3K3NA 3ETUA 3ZYMA 2VK9A 5A1LA 4GYSA 3J9X1 4H9SE 2V26A 1WYCA 5JR9A 2V7MA 3T8OA 2CMRA 2ZM2A 3GN5B 3I0OA 3I9YA 3ZMSB 4K0UA 5DABA 3RYIE 3FBLA 2V7KA 4U72A 3OJAA 2V1DB 4AQFC 4O4HE 4PJJA 4XAXB 2XASB 4EZHA 4WBNE 2V7IA 4E7ZA 5E0OA 3ANWB 5KDMC 4IE7A 1WRDA 4P09A 4BA9A 2JQQA 3IBPA 3ZPOA 3RYCE 5LGNB 2JRKA 4EAHA 3KV9A 2KXPB 3ZLIA 3C64A 4QKNA 3UFEA 3BQIA 4PFPA 5L3DB 5DQWA 5LJNA 5FNVE 3C4XA 3IF8B 3KFWX 1YKHB 4IE6A 1HCIA 2MTQA 5LGTB 3ZMUB 2N2NA 3PDYA 5L3EB 3HKDE 3CQXC 1VOMA 2CE7A 3Q9DA 5L3GB 2YINA 2KLQA 5JDMA 2W61A 2Q9QA 3R84B 2WMNA 4KP3C 3UUNA 5KMGP 4JUYA 5ETWA 3O9XA 5JDNA 2KINB 2NWBA 1IJ6A 1Y64B 2BVLA 4C91A 1CUNA 4HE8A 2EHOC 2E9XB 2NTXA 1D1CA 2LE8A 3N9MA 3F31A 3RPUA 3RH3A 5J2UE 3CX8B 2ZLYA 2QGSA 3ETVA 3ONXA 4PW8A 1UX5A 2Q9QD 2ODUA 3E0ZA 4YHJA 4AKLA 2XAGB 3I1AA 4IE5A 5LJMA 5HXEA 2CWOA 3W15B 3AB3B 2JPFA 4EIWA 4HGAA 4H9RC 3MZKB 4AQGA 2DWKA 3LK42 1D1BA 5FXXA 4X1KE 1MNEA 3HL6A 4ZOLE 4AKRB 3OYZA 4DBQA 4FI5A 2YU2A 2KNDA 5JDQA 4IGUA 4V1Av 1IZNB 2W63A 3NRYA 4NUVA 2VASA 3ZYLA 2EHOD 3E08A 2K24A 4O4JE 2JJ9A 3ZJ1A 3HKCE 3GN5A 3P8CD 4DBRA 3QC9A 3DTOA 3KV6A 2X67A 3H37A 3HKEE 3ESLA 5CA0E 5JVDE 3ANWA 5C8YE 3ZYKA 5JH7E 4UV9B 3V5UA 2XQYA 2CEAA 1BR0A 4JEUB 4G63A 4PK6A 5FMNA 4OYJA 4X20E 2BZBA 1KK7A 4I4TE 2YEVC 4O4IE 3ZCJA 2KWHA 2DWGA 4TX5A 2JMHA 3CKDA 4PK4A 5IHYA 5LHGB 2I59A 2SPCA 1LRZA 2LT3A 2WM9A 2X68A 3C4ZA 3ZN0B 3RX6A 2KWIB 3E22E 2DCFA 3O4XE 3I9WA 4TUYE 2CXDA 3SS1A 4PFOA 4HFVA 2BVMA 3EDVA 4DO0A 2UXNB 5M4YA 1YD8G 3BQLA 5KX5E 2NW7A 5AFUL 4BJMA 5JR9C 2E9XA 3MA9A 2CXFA 3HKBE 2CA5A 4ADZA 3B13A 3AVRA 3B57A 2E8IA 2WSSV 3BK9A 1B7TA 5FY7A 5JDFA 2L3LA 3C51A 3FB2A 4UV8B 4B6XA 4NUUA 5L2LA 3M65A 5TAOA 5LHIB 2DLRA 2VB6A 2GK9A 3AVSA 3EVYA 5JQGE 2LSIA 4OFZA 1ZHCA 2X9HA 1ZKEA 3C4WA 1H7CA 3N9PA 1D0ZA 3GMIA 3AA0B 3CX6B 5IYZE 2H3RA 3NRXA 2XAHB 2W62A 2IC9A 2PG8A 2KT9A 3VKHA 2CXLA 3A5XA 4QXHB 4AXPA 1HTJF 3PUQA 4MALA 4EZ4A 4ZI2D 5H6QB 4TV8E 2Q9QC 3P7IA 3EDUA 3L09A 5JDHA 2YK0A 3N9QA 4AKIA 5F3JA 3KINB 3UULA 4ILUA 2MBGA 4UVAB 4CI1B 3AAIA 1MMGA 2DI4A 4G2AA 5DQVA 5FXWA 4IE4A 4YJ3E 3F2EA 3ZC1A 3AAAB 4M1PA 5LGUB 2XHEB 2LHRA 4HN9A 4L0RA 5EK3A 1BR1A 3KBTA 4CXWA 1LVKA 2NP9A 2WAUA 4J2CA 4H9NC 3PUSA 2A3DA 1QSDA 1VRBA 2C5JA 3UUMA 5EK2A 5LXTE 3LK3B 3O1IA 4XBFB 3SRZA 3ZJ2A 1V9DA 4WNKA 4MBQA 2B1EA 2KMFA 4I55E 1WLXA 2VKHA 4BAYB 1D0YA 1ZV4X 4ZI3D 4GK0E 3ZN1B 1MNDA 3I0QA 1D0XA 2H7OA 5F8PA 4O2BE 3GWHA 4PJLA 4ANJA 4IDZA 2Z6EA 3PTRB 1MMNA 4KMCA 3MJXA 3SWHA 5EZYE 4ZHQE 3FBZA 5GONE 2C5IT 3KV4A 3J7Yq 2C0SA 2C5KT 2XUEA 3PUAA 2IC6A 2ZM8A 3IHRA 1LKXA 1OXZA 3CMLA 4YLHA 4L9IA 5LCYA 5BMVE 4QX7B 2P9BA 3N9LA 2CCQA 2D0TA 5H6RB 1U5PA 3N2KE 3Q5WA 2PBIA 4JLEA 2V7LA 2CLYB 1G8XA 2WMOA 3CWZB 3KVBA 4C90A 4HTEA 5JDLA 3R6NA 2HH7A 2LSGA 3MKDA 5EK4A 3WAKA 2W00A 1O3XA 5L3CB 5JREA 1MMAA 3LBXB 2VKOA 4DMVA 2K5BB 4UVCB 2JMKA 5JRCB 4CXYA 3ZMVB 4H9PC 3N5LA 1D1AA 1NAFA 4UEMA 2Y6XA 4CXXA 2PFVA 2LHNA 2E9XC 3L3PA 4EXTA 5LYJE 3AAEB 1G73A 3AA7B 5FXVA 4PJMA 3LJCA 3PURA 3BQKA 5L3BB 5HXCA 4HEAA 2LSJA 3FXEB 3U3IA 1YKEB 4PAGA 3ZMTB 3RKOA 4DVDA 3OBVE 1NWMX 4AI6A 2IAKA 3RC3A 1HG5A 3QK6A 4ZI2C 3N9NA 3MXZA 1QUUA 4OK0A 4IIJE 4GYRA 4EB6E 4CI3B 1YW0A 1S35A 3KV5A 4IE0A 5HWXA 2RP4A 3PE0A 2X66A 2D0UA 4WBOA 2Y8DA 4A56A 1OWAA 3N9OA 2G0UA 2VWAA 2LM9A 2E9XD 2EHOB 3AA6B 2L9QA 3CX7B 2W0GA 4KBMB 2L8KA 5CA1E 3CQGB 3NZPA 4QX8B 5DJQC 3VKGA 4CI2B 3QUJA 3VU7H 1HF8A 5FY1A 4I50E 5LNKA 1UX4A 1Z0PA 2CM0A 3MK7C 1SHZC 3CPZA 2PJQA 4WW0A 2LSYA 4QXBB 4YFSA 4EOZB 3H3AA 4ZS3A 4UIGA 2VKDA 4ISTA 2XAQB 1T98A 3HR0A 4Z8XA 3ZC0A 1U4QA 3C50A 5LBQB 3JC6D 4ZI3C 4AKHA 2NOXA 3CQCB 3OKQA 3NBXX 1MIYA 4JEHB 2ACXA 5LA6E 4N78D 4ASKA 1HS7A 3F57A 2ES0A 3LBXA 4AKGA 4UXNB 1ZEEA 5CB4E 2WWUA 5JRCA 4X1YE 2X9WA 3K3QC 3O1JA 2QA7A 3EUHA 3SOLA 4ERRA 4AQFA 3S4UA 4TV9E 4P0BA 3KBUA 4DMWA 3CVRA 4X1IE 4U74A 3MACA 4KUMB 4O4LE 4UELA 3Q2MA 2K9AA 2LOPA 5LHHB 2DHRA 1HG2A 5ADXL 3AA1B 2OA5A 2XTLA 2LOSA 4PJNA 1HX8A 4F6RC 4UVBB 3GA8A 3WI3A 3IEEA 4O2AE 4UF0B 5LP6E 4P0AA 4MHCA 1E1HB 4TN7B 4GK5E 5HXSA 2X51A 2KZ7B 4MLKA 4H9QC 3FXDB 3ZMZB 1IAPA 3N2GE 5LOVE 4XZCA 4BJNA 2XAFB 4OHFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9P C;  5KDM C;  4H9N C;  4H9O C;  4H9Q C;  4HGA A;  4H9R C;  4H9S E; 
#chains in the Genus database with same CATH topology
 1M7K A;  4PK5 A;  2HPL A;  3FZK B;  1BR4 A;  5FP3 A;  3PUG A;  2LSK A;  2VKJ A;  4QWN B;  3LG7 A;  3DJB A;  1UCU A;  4QHO A;  2UXX B;  4YJ2 E;  3EAB A;  4H9O C;  4X66 T;  1AJ3 A;  5JDG A;  1FMV A;  3RRW A;  2XQ4 A;  1BR2 A;  1MIW A;  2CWY A;  5HYA A;  3V5S A;  3ZEF B;  1EZ3 A;  2A72 A;  4CZZ B;  4HKA A;  3PUW F;  3OTO T;  1MMD A;  2QRX A;  4MFR A;  4UF0 A;  2K48 A;  1WR6 A;  5AQU B;  2I6H A;  4E7S A;  1XMQ T;  1VCS A;  4EYY R;  2XAJ B;  2Y48 B;  3FZH B;  2V8S V;  3J9X 1;  2V26 A;  2CMR A;  2NR4 A;  2XQ8 A;  1XNQ T;  2V7K A;  3AE8 A;  4U72 A;  2V1D B;  2XZE A;  3NKZ A;  4IE7 A;  2JQQ A;  3IBP A;  4IT4 A;  5LGN B;  5ABF B;  4EAH A;  3C4X A;  2FJD A;  1VCT A;  2BBH A;  1HCI A;  3ZMU B;  2N2N A;  1ZP0 A;  3HKD E;  3CQX C;  4LF8 T;  2Q9Q A;  2YDR A;  4KP3 C;  4B3T T;  3O9X A;  5JDN A;  2NWB A;  1Y64 B;  3UU5 A;  2BVL A;  4C91 A;  4HE8 A;  2QYW A;  2FJA A;  4JBW F;  3PJA A;  2XQ6 A;  3E0Z A;  4IE5 A;  3W15 B;  3AB3 B;  4TWD A;  5AQO B;  4HGA A;  4ILB A;  3TLV A;  4AQG A;  4WYV A;  4ZOL E;  4AKR B;  4DBQ A;  2VQF T;  2A9U A;  5JDQ A;  4IGU A;  1IZN B;  3P50 A;  3NRY A;  4NUV A;  2VAS A;  3E08 A;  1W9R A;  2K24 A;  3GN5 A;  1YQ3 A;  3HKE E;  5CA0 E;  2LRK A;  3ZYK A;  4OYJ A;  4X20 E;  4O4I E;  4TX5 A;  2JMH A;  5HEJ A;  3CKD A;  2JQH A;  1GQE A;  2I59 A;  3AE1 A;  1NEN A;  3TLU A;  4NIQ A;  2ACZ A;  4YTP A;  4HFD A;  5M4Y A;  4B3S T;  3BQL A;  5AFU L;  5JR9 C;  3QNU A;  2E9X A;  3MA9 A;  2CXF A;  3HKB E;  4ADZ A;  3B13 A;  5FL0 A;  2E8I A;  4X65 T;  5FY7 A;  5LB7 B;  3C51 A;  3L8R A;  4B6X A;  4NUU A;  1M62 A;  5L2L A;  3AVS A;  2GK9 A;  5JQG E;  4YXD A;  1D0Z A;  4DV0 T;  5LMU T;  5AQM B;  2IC9 A;  4AXP A;  3PUQ A;  4ZI2 D;  5H6Q B;  3EDU A;  3L09 A;  5L4H A;  5JDH A;  4HFC A;  5F3J A;  1KNR A;  3P4P A;  2MBG A;  2WWV A;  4UR9 A;  2DI4 A;  4G2A A;  2BKO A;  2LM2 A;  5LGU B;  4M1P A;  2XHE B;  1QLB A;  1L0V A;  2LHR A;  5AQJ B;  2M6I A;  4CXW A;  3KBT A;  3PUS A;  1XDP A;  1W0B A;  5EK2 A;  4XBF B;  3ZJ2 A;  4WNK A;  4GKJ T;  4KI0 F;  3UU8 A;  2F4V T;  1ZV4 X;  4ZI3 D;  4GK0 E;  1MND A;  2H7O A;  4EED A;  4JI3 T;  3RIF A;  4PJL A;  3UU4 A;  4X5T A;  3UU6 A;  4DR6 T;  4EV6 A;  2C0S A;  1E2A A;  2BS2 A;  2XUE A;  3PUA A;  2IC6 A;  4U7Y A;  3CIR A;  1XMO T;  2ZM8 A;  3IHR A;  1OXZ A;  5LCY A;  5AQG B;  2P9B A;  4CN4 A;  3N2K E;  2PBI A;  2V7L A;  2CLY B;  1G8X A;  4C90 A;  4DR1 T;  3R6N A;  2HH7 A;  2LSG A;  2W00 A;  1O3X A;  5L3C B;  1MMA A;  2K5B B;  2R6G F;  2V5D A;  4CXY A;  3AXJ B;  4H9P C;  3PUY F;  1D1A A;  2HN2 A;  2B76 A;  2IHR 1;  2AE9 A;  3PUR A;  4ZZC A;  5L3B B;  5HXC A;  4HEA A;  3OVU A;  3FXE B;  4COF A;  1YKE B;  4PAG A;  3RKO A;  4AI6 A;  1QUU A;  4OK0 A;  4IIJ E;  4DR2 T;  2WCA A;  5HWX A;  2RP4 A;  2VL0 A;  2IDO B;  4KX6 A;  4YSY A;  4A56 A;  1OWA A;  2G0U A;  1JNZ A;  4U31 A;  2L9Q A;  3CX7 B;  4JI7 T;  5CA1 E;  1UUS A;  3QUJ A;  4YT0 A;  2OV9 A;  4I50 E;  1UX4 A;  4UIG A;  2XAQ B;  5FKY A;  5AQQ B;  5IWA T;  3C50 A;  3JC6 D;  3H3M A;  3IA3 A;  5LA6 E;  4TWH A;  3UUB A;  3F57 A;  1J5E T;  4QH1 A;  4AKG A;  3O1J A;  1W0A A;  3EUH A;  1HNW T;  3S4U A;  4P0B A;  3KBU A;  4DMW A;  4LMJ A;  4O4L E;  2LOS A;  4PJN A;  4F6R C;  4O2A E;  4UF0 B;  4MHC A;  2JQK A;  4MLK A;  3UQ4 A;  5LOV E;  4IDP A;  2CE7 A;  2MYS A;  1X79 A;  3UU3 A;  4GIW A;  4LFB T;  3CK6 A;  3OYX A;  3UUX B;  2BBJ A;  4DND A;  5F5W A;  4ZI7 E;  1WYB A;  4FJO A;  4H63 V;  3LDQ B;  3VHL A;  2DNX A;  2LJL A;  3KVA A;  4Q25 A;  3TKL B;  2LEH A;  5FYM A;  3C98 B;  4ZS2 A;  3RYF E;  2D9D A;  3ONJ A;  3VR8 A;  1S94 A;  2Q9Q B;  5KXJ A;  4A97 A;  1FMW A;  1MIV A;  5J1G A;  2WU5 A;  1J1J A;  3N2O A;  4H63 H;  4ISS A;  3DP7 A;  5HXR A;  2YDQ A;  2AXD S;  2M67 A;  2BKN A;  2X0H A;  5CJ5 A;  2X9X A;  4LF9 T;  2WZI A;  2A2F X;  3K3N A;  2DL1 A;  3VRA A;  5A1L A;  4GYS A;  1WYC A;  5JR9 A;  2ZM2 A;  3GN5 B;  3I9Y A;  3FBL A;  3TLS A;  3OJA A;  4EZH A;  4XAX B;  2V7I A;  5ABH A;  4E7Z A;  5E0O A;  5KDM C;  3ZPO A;  2WS3 A;  3KV9 A;  3UFE A;  3FZL B;  3RGL A;  4HWC A;  4IDQ A;  3PUZ F;  1YKH B;  2FJB A;  3Q9D A;  5JDM A;  2BG9 C;  3PUV F;  2FJE A;  5KMG P;  4JUY A;  5ETW A;  3VRB A;  1CUN A;  2EHO C;  2E9X B;  2NTX A;  4GKK T;  2LE8 A;  3F31 A;  3K1S A;  3RPU A;  3CX8 B;  2QGS A;  2V6Y A;  1UX5 A;  4YHJ A;  4AKL A;  2FUP A;  2CWO A;  4H9R C;  3LK4 2;  1D1B A;  2UXC T;  2J62 A;  3NWI A;  2YDS A;  2EHO D;  3ZJ1 A;  4DBR A;  2XM2 A;  2X67 A;  3H37 A;  5JVD E;  5C8Y E;  3JAD A;  5JH7 E;  1BR0 A;  4PK6 A;  5CGM A;  3FZF B;  4I4T E;  2DWG A;  4EEB A;  2W67 A;  2WM9 A;  2LLY A;  3SFD A;  3O4X E;  2CXD A;  4HFV A;  2BVM A;  3EDV A;  4DO0 A;  2UXN B;  2WB5 A;  4CN6 A;  2HHH T;  1B7T A;  5JDF A;  4UV8 B;  2V6X A;  5AQT B;  3QOF A;  5HCJ A;  5TAO A;  2LRL A;  1ZKE A;  3AA0 B;  4LF5 T;  2W62 A;  3T1H T;  2PG8 A;  2KT9 A;  4EZ4 A;  4LF4 T;  3AE7 A;  2VVN A;  1SE7 A;  4AKI A;  3UUL A;  1MMG A;  3QB5 K;  4X64 T;  4IE4 A;  4YJ3 E;  1HNZ T;  4HN9 A;  4JV5 T;  1LVK A;  2NP9 A;  4J2C A;  4H9N C;  4HWI B;  2A3D A;  2C5J A;  2WP9 A;  3O1I A;  3QB5 A;  1V9D A;  2B1E A;  3AE6 A;  2VKH A;  2VQE T;  3T1Y T;  1D0X A;  5F8P A;  4KMC A;  2IUB A;  2WZH A;  5AQK B;  5GON E;  1KFY A;  2C5I T;  3KV4 A;  2KSR A;  2C5K T;  3AEF A;  5HEO A;  4DV2 T;  5C3J A;  2WY2 A;  2CCQ A;  1U5P A;  3AE9 A;  2XQ3 A;  1IBK T;  4JLE A;  2WMO A;  3KVB A;  3RI5 A;  1W09 A;  2LKH A;  3AEE A;  2OLT A;  5AQN B;  5JRE A;  2VKO A;  2VVS A;  4LML A;  4UVC B;  2JMK A;  4KHP T;  2MPK A;  4UEM A;  2LKG A;  2Y6X A;  4CXX A;  2LHN A;  3AE4 A;  4PJM A;  2UU9 T;  5IUX A;  1NWM X;  2IAK A;  1N36 T;  4ZI2 C;  1HNX T;  3N9N A;  4GYR A;  2W4X A;  1YW0 A;  3KV5 A;  4IE0 A;  4WBO A;  5BR8 T;  4AIU A;  4JI8 T;  4KBM B;  3CQG B;  1HF8 A;  1Z0P A;  2CM0 A;  3MK7 C;  3AE3 A;  3H3A A;  4ZS3 A;  3A8Y C;  2VKD A;  4Z8X A;  2WDR A;  4ZI3 C;  3OKQ A;  3RQW A;  2ACX A;  5AQP B;  4N78 D;  2ES0 A;  3LBX A;  4X1Y E;  3K3Q C;  4JI2 T;  2XQ5 A;  4U33 A;  3SOL A;  3CVR A;  3MAC A;  4UEL A;  1HG2 A;  3AA1 B;  2XTL A;  3LSV A;  4U3C A;  1E1H B;  2KZ7 B;  4H9Q C;  1IAP A;  4XZC A;  2XAF B;  4OHF A;  1NEK A;  2BG9 A;  1OED C;  3WAJ A;  3D0T A;  3UTK A;  4ZXL A;  4GOU A;  5JR9 B;  2EHO A;  5HXH A;  4LF6 T;  4I0U A;  3ZCI A;  2D5U A;  3PU8 A;  4I43 B;  3NZQ A;  3EI0 A;  3RF1 A;  3FHN A;  1KF6 A;  3RC8 A;  4L5G A;  3U78 A;  4CN1 A;  3UFG A;  2UUB T;  3LFM A;  2MOZ A;  3HA4 A;  3RRC A;  3PV0 F;  2UUC T;  1KEY A;  4A98 A;  4YTN A;  1FIO A;  2X0L B;  3JC6 C;  5L3F B;  1JNR A;  1UGO A;  2V6Y B;  4PNI A;  3UT5 E;  1US7 B;  1WR0 A;  4O8S A;  4CQI A;  5J2T E;  1SA0 E;  1R8I A;  4QXC B;  1XDO A;  1HFA A;  2VL8 A;  5LBM A;  5HAX A;  2N1G A;  4LFA T;  3PJA J;  1I94 T;  2BKP A;  2N9D A;  2VK9 A;  4H9S E;  3AEB A;  3RYI E;  4O4H E;  4PJJ A;  3G06 A;  4BA9 A;  3A7M A;  2JRK A;  5HEH A;  2KXP B;  3ZLI A;  3C64 A;  4PFP A;  5L3D B;  5DQW A;  5FNV E;  3KFW X;  4IE6 A;  2MTQ A;  5CFB A;  3PDY A;  4ZEY A;  5L3E B;  3ZT6 A;  2YIN A;  5L3G B;  3SFE A;  2J4G A;  3R84 B;  1XNR T;  4JI1 T;  4HFE A;  1IJ6 A;  1N32 T;  1D1C A;  2XQ9 A;  3RH3 A;  3ONX A;  4PW8 A;  2Q9Q D;  2ODU A;  5LJM A;  2JPF A;  4EIW A;  3AEC A;  1DU2 A;  3MZK B;  5FXX A;  4X1K E;  3HL6 A;  4DR5 T;  3OYZ A;  1T72 A;  4V1A v;  3ABV A;  3ZYL A;  2XSA A;  4O4J E;  3HKC E;  5LG3 A;  1Y01 A;  3Q5E A;  3ZST A;  4NXM T;  3ANW A;  4UV9 B;  2CEA A;  4JEU B;  4G63 A;  4DR4 T;  4QH5 A;  4PK4 A;  5IHY A;  5LHG B;  4JI5 T;  1LRZ A;  2LT3 A;  2X68 A;  3C4Z A;  4IL9 A;  2XJ7 A;  4TUY E;  3RQU A;  4JI4 T;  3SS1 A;  1I6Z A;  1UK5 A;  1YD8 G;  5KX5 E;  2NW7 A;  3EAM A;  4BJM A;  2XY8 B;  3AVR A;  3B57 A;  3FB2 A;  3AE2 A;  3M65 A;  2DLR A;  3EVY A;  4HFH A;  4OFZ A;  2X9H A;  3Q5D A;  3C4W A;  1H7C A;  2J47 A;  3N9P A;  3GMI A;  4YY3 T;  3CX6 B;  5IYZ E;  2CBJ A;  3VKH A;  4QXH B;  4MAL A;  4HWH A;  2FBW A;  2E5V A;  2XM1 A;  3UQ7 A;  2YK0 A;  3N9Q A;  4OX9 T;  3ZKR A;  4ILU A;  5C2T A;  4CI1 B;  3AAI A;  3RHW A;  5DQV A;  5FVK A;  4JI6 T;  2YN6 A;  3F2E A;  3ZC1 A;  1BR1 A;  2IML A;  4LMK A;  3OPC A;  3UUM A;  5LXT E;  3SRZ A;  4MBQ A;  2YKS A;  4I55 E;  1WLX A;  4BAY B;  4AQY T;  4ILC A;  1E7P A;  2WU2 A;  3ZN1 B;  3GWH A;  4ANJ A;  4IDZ A;  3PTR B;  1MMN A;  4F8H A;  2CPT A;  4ILA A;  4YTM A;  3J7Y q;  4YHH T;  4TNW A;  5HCM A;  1LKX A;  1N34 T;  4L9I A;  5BMV E;  5H6R B;  5ABE A;  3Q5W A;  3CWZ B;  1OED A;  2YOE A;  5JDL A;  4DV4 T;  5J0Z A;  5L4E A;  3LBX B;  4DMV A;  4U2Y A;  4Z91 A;  3ZMV B;  3N5L A;  1NAF A;  2PFV A;  2XQA A;  3L3P A;  5LYJ E;  3AAE B;  5FXV A;  3LJC A;  3BQK A;  2LSJ A;  2XQ7 A;  3U3I A;  3ZMT B;  3P4S A;  3RC3 A;  4QH4 A;  4EGW A;  3MXZ A;  4EB6 E;  4CI3 B;  1S35 A;  2BG9 B;  1Z8U A;  2D0U A;  2Y8D A;  3N9O A;  2BS3 A;  2E2A A;  2VWA A;  1KNP A;  3ZSS A;  2EHO B;  2W0G A;  2L8K A;  5DJQ C;  4QX8 B;  2XSB A;  3VKG A;  4CI2 B;  2X0Y A;  5FY1 A;  5LNK A;  1SHZ C;  3EHZ A;  3P4R A;  4WW0 A;  4YFS A;  4EOZ B;  4IST A;  3HR0 A;  2NOX A;  3CQC B;  4JEH B;  4A5X A;  4ASK A;  1YXR A;  1ZEE A;  2WWU A;  5JRC A;  2QA7 A;  4NPP A;  1WFD A;  4TV9 E;  4X1I E;  4U74 A;  5LHH B;  2UXD T;  2LOP A;  5ADX L;  2V5C A;  1HX8 A;  1N33 T;  3IEE A;  1XZY A;  5LP6 E;  4TN7 B;  4GK5 E;  4DID B;  3FXD B;  3N2G E;  4UVA B;  2IW5 B;  3PU3 A;  3TLW A;  2H7V C;  1LVF A;  4EYU A;  2CRB A;  4HFI A;  4TWF A;  3KDS E;  2K3W A;  4DR7 T;  2NW9 A;  2V7J A;  5FY0 A;  5HEU A;  4YSZ A;  2NW8 A;  3M3Z B;  5LG4 A;  2YU1 A;  2D2S A;  3K8P C;  1WCR A;  4IHJ E;  3RIU C;  2UUA T;  3P4Q A;  1FEW A;  1KNZ A;  3LK2 B;  4TZ4 C;  2BDE A;  4TNV A;  2ODV A;  5FXZ A;  2NTY A;  1IJ5 A;  4IDN A;  2HN1 A;  2J1D G;  3K3O A;  3ZT7 A;  2ZM0 A;  2RA1 A;  5HWY A;  2HPJ A;  4X62 T;  4OYK A;  3HI2 A;  3O1H A;  3Q5X A;  2WBL A;  4HWD A;  4DV1 T;  1ZOY A;  3RYH E;  2WDV A;  4DV5 T;  2CLY C;  2X9Y A;  2ZMA A;  3ETU A;  3ZYM A;  2V7M A;  3T8O A;  3ZMS B;  3I0O A;  4K0U A;  5DAB A;  3JAF A;  3L39 A;  4AQF C;  2XAS B;  4WBN E;  4DUY T;  3ANW B;  1WRD A;  4P09 A;  3RYC E;  4QKN A;  3BQI A;  5LJN A;  3ZT5 A;  5ABG A;  3IF8 B;  2BG9 E;  5AQI B;  5LGT B;  1VOM A;  2KLQ A;  2JIW A;  2W61 A;  2WMN A;  3UUN A;  3AED A;  2KIN B;  3N9M A;  2CBI A;  5AQL B;  5J2U E;  2ZLY A;  3ETV A;  2XAG B;  3I1A A;  5HXE A;  2XPK A;  4NXN T;  2DWK A;  1HX1 B;  1MNE A;  4B3R T;  4U7I A;  4FI5 A;  2YU2 A;  2KND A;  2H89 A;  2W63 A;  2JJ9 A;  3P8C D;  1J5W A;  3QC9 A;  3DTO A;  3KV6 A;  5AQF B;  3ESL A;  5FVL A;  4ZZB A;  4JI0 T;  3V5U A;  5ABF A;  2XQY A;  5FMN A;  2BZB A;  1KK7 A;  2YEV C;  3TLT A;  4LFC T;  3ZCJ A;  2KWH A;  2SPC A;  3RKG A;  3ZN0 B;  1T8B A;  2KWI B;  3RX6 A;  3E22 E;  2DCF A;  3I9W A;  4AIS A;  4PFO A;  2ZM6 T;  2CA5 A;  2BS4 A;  2WSS V;  3BK9 A;  2L3L A;  4HFB A;  5LHI B;  2VB6 A;  2LSI A;  2PTF A;  2RPA A;  1ZHC A;  1HR0 T;  1OED B;  2H3R A;  3NRX A;  3B5M A;  2XAH B;  5AQV B;  2CXL A;  3A5X A;  1HTJ F;  1XWM A;  2Q9Q C;  4TV8 E;  3P7I A;  3P4W A;  3KIN B;  2CHO A;  3AEA A;  2E5L T;  4WZX A;  1UUR A;  2UXB T;  5FXW A;  5FL1 A;  3AAA B;  5HEG A;  4L0R A;  5EK3 A;  2WAU A;  3NVO A;  5AQS B;  1QSD A;  1VRB A;  3LK3 B;  1IBL T;  2I0M A;  4DV3 T;  4KHZ F;  2KMF A;  4DV7 T;  5L47 A;  1D0Y A;  1CHU A;  2M6B A;  5AQH B;  3I0Q A;  4O2B E;  2JQ9 A;  4B3M T;  2Z6E A;  3MJX A;  3SWH A;  2CHN A;  5EZY E;  4ZHQ E;  3FBZ A;  1X9B A;  4YLH A;  3CML A;  4K0K T;  1FJG T;  4IRE A;  4QX7 B;  3N9L A;  2D0T A;  5JTG A;  1SUM B;  4HTE A;  3MKD A;  5EK4 A;  3WAK A;  4LF7 T;  3JCF A;  5JRC B;  5AQR B;  2IIU A;  3RIA A;  3FZM B;  1YQ4 A;  3RLF F;  3ONL C;  4EXT A;  2E9X C;  1T7S A;  4P1N A;  1G73 A;  3AA7 B;  4YSX A;  4HWF A;  4Z90 A;  4DVD A;  3OBV E;  3RIU A;  1HG5 A;  3QK6 A;  4DR3 T;  2WDQ A;  3X1D A;  3PE0 A;  2X66 A;  4IL4 A;  2LM9 A;  2E9X D;  3AA6 B;  3NZP A;  2MAW A;  2H88 A;  3VU7 H;  5LMN T;  3CPZ A;  2PJQ A;  2W2U A;  4DUZ T;  4U2Z A;  2LSY A;  4QXB B;  2W66 A;  3AE5 A;  4JYA T;  4IDO A;  1T98 A;  3ZC0 A;  1U4Q A;  5LBQ B;  4AKH A;  1IBM T;  3NBX X;  1MIY A;  1HS7 A;  4UXN B;  3PUX F;  5CB4 E;  2X9W A;  2WQY A;  4DV6 T;  2VUR A;  3AXJ A;  4ERR A;  4AQF A;  4KUM B;  3Q2M A;  2K9A A;  2DHR A;  2QVA A;  2OA5 A;  4UVB B;  3GA8 A;  3WI3 A;  3AEG A;  4P0A A;  5HXS A;  2X51 A;  3VR9 A;  1OED E;  3ZMZ B;  3JAE A;  4BJN A; 
#chains in the Genus database with same CATH homology
 2MYS A;  4PK5 A;  2HPL A;  2IW5 B;  3WAJ A;  3D0T A;  3UTK A;  3PU3 A;  1X79 A;  4GIW A;  1BR4 A;  5FP3 A;  4GOU A;  3PUG A;  2EHO A;  3OYX A;  4DND A;  2H7V C;  2LSK A;  3UUX B;  1LVF A;  5JR9 B;  4EYU A;  3KDS E;  5HXH A;  2NW9 A;  1WYB A;  2VKJ A;  4FJO A;  4QWN B;  2V7J A;  4ZI7 E;  4H63 V;  3VHL A;  5FY0 A;  3ZCI A;  3LG7 A;  2D5U A;  2NW8 A;  3DJB A;  3PU8 A;  2DNX A;  2LJL A;  1UCU A;  3KVA A;  3TKL B;  4QHO A;  5LG4 A;  2UXX B;  4I43 B;  3NZQ A;  2YU1 A;  4H9O C;  4YJ2 E;  2LEH A;  5FYM A;  2D2S A;  1AJ3 A;  3C98 B;  4ZS2 A;  3K8P C;  3FHN A;  5JDG A;  1FMV A;  3RC8 A;  4IHJ E;  4L5G A;  3RRW A;  3RYF E;  3U78 A;  1FEW A;  1KNZ A;  3LK2 B;  4TZ4 C;  2BDE A;  1S94 A;  2MOZ A;  3LFM A;  1BR2 A;  1MIW A;  2CWY A;  2ODV A;  3HA4 A;  5FXZ A;  3RRC A;  2Q9Q B;  2NTY A;  5HYA A;  1IJ5 A;  1FMW A;  3V5S A;  1MIV A;  3ZEF B;  1EZ3 A;  2A72 A;  5J1G A;  2J1D G;  4CZZ B;  3K3O A;  4HKA A;  1FIO A;  2ZM0 A;  1MMD A;  2RA1 A;  2X0L B;  5HWY A;  2HPJ A;  3JC6 C;  5L3F B;  4OYK A;  3HI2 A;  3O1H A;  4MFR A;  4PNI A;  3N2O A;  4UF0 A;  2K48 A;  3Q5X A;  4H63 H;  1US7 B;  2WBL A;  3UT5 E;  4O8S A;  4ISS A;  4CQI A;  1WR6 A;  1SA0 E;  3DP7 A;  4QXC B;  5HXR A;  3RYH E;  2M67 A;  4E7S A;  5J2T E;  1HFA A;  2VL8 A;  5LBM A;  5HAX A;  2N1G A;  2CLY C;  4EYY R;  2X9X A;  2X9Y A;  2XAJ B;  2Y48 B;  2N9D A;  2A2F X;  2ZMA A;  3K3N A;  3ETU A;  3ZYM A;  2VK9 A;  5A1L A;  4GYS A;  3J9X 1;  4H9S E;  2V26 A;  1WYC A;  5JR9 A;  2V7M A;  3T8O A;  2CMR A;  2ZM2 A;  3GN5 B;  3I0O A;  3I9Y A;  3ZMS B;  4K0U A;  5DAB A;  3RYI E;  3FBL A;  2V7K A;  4U72 A;  3OJA A;  2V1D B;  4AQF C;  4O4H E;  4PJJ A;  4XAX B;  2XAS B;  4EZH A;  4WBN E;  2V7I A;  4E7Z A;  5E0O A;  3ANW B;  5KDM C;  4IE7 A;  1WRD A;  4P09 A;  4BA9 A;  2JQQ A;  3IBP A;  3ZPO A;  3RYC E;  5LGN B;  2JRK A;  4EAH A;  3KV9 A;  2KXP B;  3ZLI A;  3C64 A;  4QKN A;  3UFE A;  3BQI A;  4PFP A;  5L3D B;  5DQW A;  5LJN A;  5FNV E;  3C4X A;  3IF8 B;  3KFW X;  1YKH B;  4IE6 A;  1HCI A;  2MTQ A;  5LGT B;  3ZMU B;  2N2N A;  3PDY A;  5L3E B;  3HKD E;  3CQX C;  1VOM A;  2CE7 A;  3Q9D A;  5L3G B;  2YIN A;  2KLQ A;  5JDM A;  2W61 A;  2Q9Q A;  3R84 B;  2WMN A;  4KP3 C;  3UUN A;  5KMG P;  4JUY A;  5ETW A;  3O9X A;  5JDN A;  2KIN B;  2NWB A;  1IJ6 A;  1Y64 B;  2BVL A;  4C91 A;  1CUN A;  4HE8 A;  2EHO C;  2E9X B;  2NTX A;  1D1C A;  2LE8 A;  3N9M A;  3F31 A;  3RPU A;  3RH3 A;  5J2U E;  3CX8 B;  2ZLY A;  2QGS A;  3ETV A;  3ONX A;  4PW8 A;  1UX5 A;  2Q9Q D;  2ODU A;  3E0Z A;  4YHJ A;  4AKL A;  2XAG B;  3I1A A;  4IE5 A;  5LJM A;  5HXE A;  2CWO A;  3W15 B;  3AB3 B;  2JPF A;  4EIW A;  4HGA A;  4H9R C;  3MZK B;  4AQG A;  2DWK A;  3LK4 2;  1D1B A;  5FXX A;  4X1K E;  1MNE A;  3HL6 A;  4ZOL E;  4AKR B;  3OYZ A;  4DBQ A;  4FI5 A;  2YU2 A;  2KND A;  5JDQ A;  4IGU A;  4V1A v;  1IZN B;  2W63 A;  3NRY A;  4NUV A;  2VAS A;  3ZYL A;  2EHO D;  3E08 A;  2K24 A;  4O4J E;  2JJ9 A;  3ZJ1 A;  3HKC E;  3GN5 A;  3P8C D;  4DBR A;  3QC9 A;  3DTO A;  3KV6 A;  2X67 A;  3H37 A;  3HKE E;  3ESL A;  5CA0 E;  5JVD E;  3ANW A;  5C8Y E;  3ZYK A;  5JH7 E;  4UV9 B;  3V5U A;  2XQY A;  2CEA A;  1BR0 A;  4JEU B;  4G63 A;  4PK6 A;  5FMN A;  4OYJ A;  4X20 E;  2BZB A;  1KK7 A;  4I4T E;  2YEV C;  4O4I E;  3ZCJ A;  2KWH A;  2DWG A;  4TX5 A;  2JMH A;  3CKD A;  4PK4 A;  5IHY A;  5LHG B;  2I59 A;  2SPC A;  1LRZ A;  2LT3 A;  2WM9 A;  2X68 A;  3C4Z A;  3ZN0 B;  3RX6 A;  2KWI B;  3E22 E;  2DCF A;  3O4X E;  3I9W A;  4TUY E;  2CXD A;  3SS1 A;  4PFO A;  4HFV A;  2BVM A;  3EDV A;  4DO0 A;  2UXN B;  5M4Y A;  1YD8 G;  3BQL A;  5KX5 E;  2NW7 A;  5AFU L;  4BJM A;  5JR9 C;  2E9X A;  3MA9 A;  2CXF A;  3HKB E;  2CA5 A;  4ADZ A;  3B13 A;  3AVR A;  3B57 A;  2E8I A;  2WSS V;  3BK9 A;  1B7T A;  5FY7 A;  5JDF A;  2L3L A;  3C51 A;  3FB2 A;  4UV8 B;  4B6X A;  4NUU A;  5L2L A;  3M65 A;  5TAO A;  5LHI B;  2DLR A;  2VB6 A;  2GK9 A;  3AVS A;  3EVY A;  5JQG E;  2LSI A;  4OFZ A;  1ZHC A;  2X9H A;  1ZKE A;  3C4W A;  1H7C A;  3N9P A;  1D0Z A;  3GMI A;  3AA0 B;  3CX6 B;  5IYZ E;  2H3R A;  3NRX A;  2XAH B;  2W62 A;  2IC9 A;  2PG8 A;  2KT9 A;  3VKH A;  2CXL A;  3A5X A;  4QXH B;  4AXP A;  1HTJ F;  3PUQ A;  4MAL A;  4EZ4 A;  4ZI2 D;  5H6Q B;  4TV8 E;  2Q9Q C;  3P7I A;  3EDU A;  3L09 A;  5JDH A;  2YK0 A;  3N9Q A;  4AKI A;  5F3J A;  3KIN B;  3UUL A;  4ILU A;  2MBG A;  4UVA B;  4CI1 B;  3AAI A;  1MMG A;  2DI4 A;  4G2A A;  5DQV A;  5FXW A;  4IE4 A;  4YJ3 E;  3F2E A;  3ZC1 A;  3AAA B;  4M1P A;  5LGU B;  2XHE B;  2LHR A;  4HN9 A;  4L0R A;  5EK3 A;  1BR1 A;  3KBT A;  4CXW A;  1LVK A;  2NP9 A;  2WAU A;  4J2C A;  4H9N C;  3PUS A;  2A3D A;  1QSD A;  1VRB A;  2C5J A;  3UUM A;  5EK2 A;  5LXT E;  3LK3 B;  3O1I A;  4XBF B;  3SRZ A;  3ZJ2 A;  1V9D A;  4WNK A;  4MBQ A;  2B1E A;  2KMF A;  4I55 E;  1WLX A;  2VKH A;  4BAY B;  1D0Y A;  1ZV4 X;  4ZI3 D;  4GK0 E;  3ZN1 B;  1MND A;  3I0Q A;  1D0X A;  2H7O A;  5F8P A;  4O2B E;  3GWH A;  4PJL A;  4ANJ A;  4IDZ A;  2Z6E A;  3PTR B;  1MMN A;  4KMC A;  3MJX A;  3SWH A;  5EZY E;  4ZHQ E;  3FBZ A;  5GON E;  2C5I T;  3KV4 A;  3J7Y q;  2C0S A;  2C5K T;  2XUE A;  3PUA A;  2IC6 A;  2ZM8 A;  3IHR A;  1LKX A;  1OXZ A;  3CML A;  4YLH A;  4L9I A;  5LCY A;  5BMV E;  4QX7 B;  2P9B A;  3N9L A;  2CCQ A;  2D0T A;  5H6R B;  1U5P A;  3N2K E;  3Q5W A;  2PBI A;  4JLE A;  2V7L A;  2CLY B;  1G8X A;  2WMO A;  3CWZ B;  3KVB A;  4C90 A;  4HTE A;  5JDL A;  3R6N A;  2HH7 A;  2LSG A;  3MKD A;  5EK4 A;  3WAK A;  2W00 A;  1O3X A;  5L3C B;  5JRE A;  1MMA A;  3LBX B;  2VKO A;  4DMV A;  2K5B B;  4UVC B;  2JMK A;  5JRC B;  4CXY A;  3ZMV B;  4H9P C;  3N5L A;  1D1A A;  1NAF A;  4UEM A;  2Y6X A;  4CXX A;  2PFV A;  2LHN A;  2E9X C;  3L3P A;  4EXT A;  5LYJ E;  3AAE B;  1G73 A;  3AA7 B;  5FXV A;  4PJM A;  3LJC A;  3PUR A;  3BQK A;  5L3B B;  5HXC A;  4HEA A;  2LSJ A;  3FXE B;  3U3I A;  1YKE B;  4PAG A;  3ZMT B;  3RKO A;  4DVD A;  3OBV E;  1NWM X;  4AI6 A;  2IAK A;  3RC3 A;  1HG5 A;  3QK6 A;  4ZI2 C;  3N9N A;  3MXZ A;  1QUU A;  4OK0 A;  4IIJ E;  4GYR A;  4EB6 E;  4CI3 B;  1YW0 A;  1S35 A;  3KV5 A;  4IE0 A;  5HWX A;  2RP4 A;  3PE0 A;  2X66 A;  2D0U A;  4WBO A;  2Y8D A;  4A56 A;  1OWA A;  3N9O A;  2G0U A;  2VWA A;  2LM9 A;  2E9X D;  2EHO B;  3AA6 B;  2L9Q A;  3CX7 B;  2W0G A;  4KBM B;  2L8K A;  5CA1 E;  3CQG B;  3NZP A;  4QX8 B;  5DJQ C;  3VKG A;  4CI2 B;  3QUJ A;  3VU7 H;  1HF8 A;  5FY1 A;  4I50 E;  5LNK A;  1UX4 A;  1Z0P A;  2CM0 A;  3MK7 C;  1SHZ C;  3CPZ A;  2PJQ A;  4WW0 A;  2LSY A;  4QXB B;  4YFS A;  4EOZ B;  3H3A A;  4ZS3 A;  4UIG A;  2VKD A;  4IST A;  2XAQ B;  1T98 A;  3HR0 A;  4Z8X A;  3ZC0 A;  1U4Q A;  3C50 A;  5LBQ B;  3JC6 D;  4ZI3 C;  4AKH A;  2NOX A;  3CQC B;  3OKQ A;  3NBX X;  1MIY A;  4JEH B;  2ACX A;  5LA6 E;  4N78 D;  4ASK A;  1HS7 A;  3F57 A;  2ES0 A;  3LBX A;  4AKG A;  4UXN B;  1ZEE A;  5CB4 E;  2WWU A;  5JRC A;  4X1Y E;  2X9W A;  3K3Q C;  3O1J A;  2QA7 A;  3EUH A;  3SOL A;  4ERR A;  4AQF A;  3S4U A;  4TV9 E;  4P0B A;  3KBU A;  4DMW A;  3CVR A;  4X1I E;  4U74 A;  3MAC A;  4KUM B;  4O4L E;  4UEL A;  3Q2M A;  2K9A A;  2LOP A;  5LHH B;  2DHR A;  1HG2 A;  5ADX L;  3AA1 B;  2OA5 A;  2XTL A;  2LOS A;  4PJN A;  1HX8 A;  4F6R C;  4UVB B;  3GA8 A;  3WI3 A;  3IEE A;  4O2A E;  4UF0 B;  5LP6 E;  4P0A A;  4MHC A;  1E1H B;  4TN7 B;  4GK5 E;  5HXS A;  2X51 A;  2KZ7 B;  4MLK A;  4H9Q C;  3FXD B;  3ZMZ B;  1IAP A;  3N2G E;  5LOV E;  4XZC A;  4BJN A;  2XAF B;  4OHF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...