4HGAA

Structure of the variant histone h3.3-h4 heterodimer in complex with its chaperone daxx
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
207
structure length
207
Chain Sequence
QDPSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDPALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone/apoptosis
molecule keywords Death domain-associated protein 6
publication title Structure of the variant histone H3.3-H4 heterodimer in complex with its chaperone DAXX.
pubmed doi rcsb
source organism Homo sapiens
total genus 69
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2012-10-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2170 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4hgaA00
4H9RC 5KDMC 4H9QC 4H9NC 4H9SE 4HGAA 4H9OC 4H9PC
chains in the Genus database with same CATH superfamily
2P9BA 2UXNB 3AE9A 3NWIA 3AA7B 3ZLIA 4F8HA 4YHJA 2LM9A 4DBRA 4J2CA 1LKXA 4JI5T 2L8KA 3AE1A 3FZFB 3P7IA 4KHPT 3O1HA 3AECA 1HX8A 2UXBT 4DV2T 3VR8A 3MKDA 3BQLA 4M1PA 4YJ3E 5H6RB 3CIRA 1X79A 3K3NA 2WB5A 3UU6A 4PK5A 2CWOA 3JCFA 4O8SA 4XBFB 5HXEA 4O4JE 2QGSA 2YKSA 4YLHA 2UUCT 1KNZA 2XSBA 4HWHA 4TV8E 2OLTA 4GOUA 2LOSA 3I0QA 3O1IA 3RHWA 4HFVA 2YINA 2X9WA 2IC6A 2V7JA 4QXBB 1KFYA 2QVAA 4YSXA 4H9QC 3JAEA 5HXHA 3OKQA 2CM0A 5JDHA 4ZZBA 3AXJB 2VQFT 2X0LB 5GONE 2NW8A 4ILBA 5AQTB 3Q2MA 4EZ4A 2XAQB 3H3AA 3QOFA 3FHNA 5FXVA 2VKDA 3A7MA 4PJLA 2CPTA 4YT0A 5DQWA 4HKAA 4KI0F 2HPLA 3EI0A 4AQGA 1UCUA 1D0XA 2BZBA 2W67A 3F2EA 3OJAA 5KX5E 2MPKA 4DR3T 2PJQA 2IUBA 3EVYA 4IDOA 4HN9A 2ODVA 1S94A 3N9QA 5FY0A 2Y6XA 3ZPOA 5CFBA 1GQEA 2L3LA 1NAFA 4HTEA 5H6QB 4YHHT 2X9XA 2XQ6A 3AAAB 2WQYA 2A9UA 4TNWA 3PUWF 3AA0B 4DMWA 3PUVF 1NEKA 2XQ9A 5CGMA 3UUMA 2Y8DA 1H7CA 4ILCA 2CRBA 5ETWA 4CN4A 5IYZE 1U5PA 3CVRA 3B57A 4JI4T 2WSSV 1JNRA 2XM1A 4PJNA 3VKHA 4MBQA 2VKOA 2XAJB 2W00A 3V5UA 3CX8B 4PK4A 5JREA 4CZZB 4IE7A 2WWUA 4IT4A 2C0SA 2FJEA 5ABFA 4NIQA 4UF0B 2VB6A 5JQGE 1HNXT 5HXRA 3C51A 5F5WA 5FVKA 4P09A 5IHYA 2UUBT 3N9MA 4IDPA 1HR0T 4K0UA 5FXXA 5KMGP 2XAHB 5LCYA 4OFZA 4BJMA 2C5IT 3HKEE 4HWCA 2UXDT 3ZYLA 2H7OA 4A97A 4EIWA 5LB7B 5JRCB 4DV4T 4P1NA 1HCIA 3W15B 4Z91A 4UV8B 3FBLA 1MMNA 4IE4A 2LSYA 1U4QA 1T72A 3IEEA 4ZXLA 2CXLA 4O4IE 2X9YA 5AQVB 2IAKA 5HCMA 1WR6A 3FXEB 3I9YA 3PUZF 3CPZA 2LRKA 2YK0A 4AKRB 3QC9A 3FZKB 3HI2A 4EAHA 3SS1A 2M67A 1D0ZA 4TWFA 1MIWA 3ZYMA 2EHOC 1IBMT 4B3MT 1HTJF 3RC3A 3RYCE 2KWHA 3AE2A 4H9OC 5FY7A 2YEVC 3UU4A 3AEBA 3U78A 5L4HA 2W66A 2X67A 4IGUA 1JNZA 1N32T 3FZMB 4AXPA 3PTRB 3QUJA 2YU1A 4ERRA 1M7KA 1XZYA 2JQ9A 5LJNA 2FUPA 3N9NA 4YJ2E 3N9PA 1Y01A 4LF9T 5TAOA 3RIAA 5EK3A 1WR0A 1CHUA 4COFA 3PUXF 4AKHA 3ZSTA 2JIWA 3U3IA 5FYMA 2BG9E 1AJ3A 3NKZA 3G06A 3K1SA 3PUYF 2NP9A 3ZMTB 4KBMB 5EZYE 2CXDA 3AXJA 3RC8A 4ZEYA 4QKNA 2KSRA 3PUAA 4BAYB 3RIUA 4GYRA 5EK2A 5AQPB 5FVLA 3GN5B 4O2BE 2H3RA 5KDMC 3AEFA 4EGWA 5JTGA 4HWIB 2JQHA 3KV9A 5L3FB 4A5XA 2BVMA 2XM2A 3ONXA 2X51A 3ABVA 4WZXA 2NTXA 2Q9QC 2RPAA 3PURA 4B3TT 4U33A 3P4QA 3H37A 3KV5A 2DLRA 5HYAA 4HFEA 4KUMB 2A3DA 5AQJB 5FL0A 2JQKA 3GMIA 1KF6A 5CB4E 4I55E 2IDOB 3ZYKA 2W63A 2WMNA 3FXDB 5FKYA 2XQ7A 3AVSA 3ZCJA 2JMKA 5ABHA 4JI7T 3AE5A 1ZOYA 4IL9A 4QXCB 4TNVA 5HAXA 4DR6T 4X64T 2V7MA 4H9NC 2HH7A 4DV3T 3P4RA 4CI2B 5HEHA 1UX4A 2BVLA 5AQKB 2V8SV 5JDMA 5HEOA 2A2FX 2X68A 2XTLA 3ZT5A 3KVBA 2KT9A 4HE8A 4DV6T 4A98A 4V1Av 3JC6D 4IDNA 2J62A 2EHOA 4LMKA 2WP9A 5LGTB 5C2TA 4JI3T 2B76A 3MZKB 1YD8G 5J2TE 2E8IA 5LJMA 1KNRA 5HEUA 1QSDA 1WLXA 3ONJA 1ZKEA 3ETVA 3MACA 1OEDA 2J4GA 1M62A 2H88A 5BR8T 1HG2A 2A72A 4BJNA 4EEDA 3RQUA 4U74A 3LJCA 2JJ9A 3VU7H 3UTKA 4F6RC 2VVNA 1W0BA 4WW0A 4EYUA 2LSKA 2N2NA 3AEAA 3WAKA 5L47A 3DP7A 5JRCA 4ANJA 4YSYA 5AQIB 3CK6A 3KVAA 3IA3A 2CXFA 4E7SA 2FBWA 3CWZB 4DO0A 3RIFA 2CBIA 4ZZCA 2X66A 4JI0T 2LEHA 3PUQA 4CXWA 4X62T 4H9RC 2YOEA 3JC6C 4HEAA 2XY8B 1W9RA 1MMGA 4JBWF 3UULA 2K5BB 2Q9QA 4DIDB 4NXNT 3OBVE 2KZ7B 3DJBA 2XHEB 1XMQT 5AQNB 1D1AA 1T7SA 3P4WA 5DABA 1EZ3A 2DWKA 3RPUA 1HS7A 2FJBA 3FZLB 5L3DB 4IHJE 3GA8A 4DNDA 5L3CB 3OTOT 1ZP0A 2QYWA 2VASA 4O4HE 4IL4A 1MMAA 4QWNB 2W2UA 1FMVA 4TUYE 4TZ4C 2V7KA 4IE0A 4AKLA 3F57A 4OYKA 3A8YC 1XMOT 4IE5A 5LG4A 1UURA 4QX7B 3AE4A 3B13A 3I9WA 2H89A 3F31A 4ILAA 4H9PC 3S4UA 3H3MA 2LT3A 4L9IA 4BA9A 4HGAA 4LF4T 2WY2A 4Z8XA 1IJ5A 1KEYA 2LRLA 5AQQB 3CX7B 3ZC1A 4B3RT 2LM2A 4MLKA 4JEHB 2VQET 3ZMUB 4TX5A 3ZN0B 5FXWA 4DUZT 3NZQA 4X65T 2AE9A 2VVSA 1OWAA 4AISA 1WFDA 2UUAT 2E5VA 2WM9A 3SWHA 3B5MA 3ZSSA 2E9XD 1YXRA 2BS4A 2E9XB 5HEJA 3AE6A 4DV1T 4DR7T 3RQWA 4H63H 2LJLA 2LOPA 1VCTA 3ZMSB 3ZT6A 3ANWA 4LF7T 2B1EA 1R8IA 2MTQA 3KV6A 3SRZA 4AKGA 4H63V 5AQRB 4JI2T 3LFMA 1J1JA 4HFBA 3R84B 3AE8A 1FJGT 3V5SA 4LFCT 4CN1A 5LGUB 2IMLA 5J2UE 4HFDA 3K3OA 4CXYA 2AXDS 2ACXA 1DU2A 2YDSA 4AQFC 4DR2T 3ZMVB 3RKGA 3C4XA 5LYJE 3Q9DA 3JAFA 1HNZT 3O9XA 2WDQA 1I6ZA 3K3QC 4ASKA 4A56A 2E5LT 3QNUA 4UVBB 2MOZA 2ODUA 4GYSA 4KHZF 4B3ST 4L5GA 1BR2A 3FB2A 2E2AA 3LBXB 2WMOA 1VRBA 3RRCA 2ZM2A 3R6NA 1UUSA 3O4XE 4H9SE 3CQXC 2JQQA 2XASB 1HNWT 2KWIB 3T1YT 3CKDA 2L9QA 4DV5T 3TLTA 3ZT7A 5AQOB 4KP3C 2E9XC 4C90A 4KMCA 4QHOA 2BDEA 3M65A 4QH4A 2LHRA 4ZS2A 1OEDE 4YTNA 3N9LA 3KV4A 5IUXA 3JADA 1LRZA 3RX6A 4OX9T 3LDQB 4HFCA 4UXNB 3LG7A 2LKHA 4IE6A 2PBIA 4UR9A 4U3CA 1HX1B 2BG9B 4P0BA 2M6BA 5JDFA 3HKBE 3QB5A 1MIVA 4DVDA 3O1JA 3EDVA 4U72A 2CHNA 1ZHCA 1SA0E 5F3JA 5JDGA 3L09A 4WYVA 3K8PC 2DCFA 2DNXA 3UQ4A 4AKIA 5LMUT 1UX5A 2KXPB 5LBMA 4G63A 2MBGA 4PJMA 2CMRA 2OV9A 5FL1A 2X0HA 3VR9A 5J0ZA 2XAFB 3M3ZB 2M6IA 5JH7E 1Z0PA 3UU3A 4JI1T 4LFBT 2NWBA 1QLBA 2V26A 1MNEA 3J9X1 2V6YB 5LGNB 5LHHB 3HL6A 2IHR1 2IW5B 3T8OA 4U2YA 3KBUA 5C8YE 4IDZA 2XQ4A 4JI6T 3E0ZA 5LBQB 2PTFA 4YXDA 3L39A 1X9BA 5HXCA 1XNRT 4UV9B 1IBKT 5L3BB 1SE7A 4EEBA 3AAIA 1HG5A 4X20E 2BG9C 2XQYA 2KMFA 3VRBA 4LF5T 2V7LA 2V5DA 4U31A 1IZNB 4OYJA 4YY3T 4HFHA 2UXCT 5LOVE 3ONLC 2N1GA 2D9DA 5LHGB 2E9XA 3C50A 4ILUA 3OYXA 2YN6A 4EXTA 1XDOA 1W09A 2D0UA 4U7YA 2W0GA 1QUUA 3TKLB 4MALA 5ABEA 2XQAA 5HEGA 2N9DA 4ZHQE 2X0YA 3J7Yq 2WDRA 5JDQA 4X1KE 1E1HB 4YSZA 4JUYA 3ZJ2A 4PJJA 5AQHB 1BR1A 3ZJ1A 5ABFB 1WYCA 2XUEA 3RKOA 3TLVA 4UF0A 4PNIA 4EV6A 2XPKA 4WBOA 3ZC0A 5LNKA 4YTMA 1FIOA 2BKPA 1N34T 3CMLA 4QH5A 5JDNA 1B7TA 3AA1B 1LVKA 4GK5E 5EK4A 3KINB 3LBXA 2HN2A 4NPPA 1IBLT 2CEAA 3AAEB 3VKGA 4ADZA 4DV0T 2W61A 2YU2A 4EYYR 2D2SA 4FJOA 1YQ4A 3X1DA 1HFAA 4AQYT 3PU3A 3PE0A 2K3WA 2BBHA 3CX6B 1YW0A 5DQVA 4XAXB 1NENA 2WBLA 3C4WA 3N5LA 4ISSA 2JMHA 2D5UA 2CE7A 1J5WA 2SPCA 3FZHB 4WNKA 4PW8A 5AQFB 3HKCE 3EABA 4B6XA 4YTPA 5LG3A 2CCQA 2H7VC 2DI4A 4XZCA 1CUNA 2WZIA 1N36T 2NOXA 4LMLA 2VKJA 4PFOA 4U2ZA 3MXZA 3N2OA 3CQCB 3DTOA 4DR4T 2WWVA 3RGLA 1US7B 2K48A 3RYFE 5L2LA 2BG9A 5LP6E 2I59A 4AI6A 4IREA 2VL8A 2BBJA 1UGOA 5FY1A 2BS3A 1IAPA 3A5XA 4C91A 1D1CA 4N78D 5IWAT 2VL0A 2WU5A 4UVCB 3RYHE 3CQGB 3RYIE 1HF8A 5HWXA 4OK0A 3RH3A 3Q5EA 2LSIA 2GK9A 5KXJA 2XJ7A 3QK6A 2DWGA 1Y64B 3AEGA 5AQUB 4KX6A 4GKJT 3ESLA 2NR4A 4EOZB 5L4EA 4CXXA 4LF8T 2DL1A 4E7ZA 2V6YA 4DR1T 4X66T 3GN5A 3VHLA 4OHFA 5F8PA 2ES0A 5L3EB 2QRXA 1WRDA 4EZHA 3N2GE 2WAUA 5HXSA 3IHRA 1I94T 1IJ6A 2CWYA 3WAJA 5LMNT 4Q25A 2BS2A 2MAWA 5FXZA 4CQIA 3OPCA 3PUSA 3IBPA 3MA9A 3BK9A 3PJAA 4TWHA 3PJAJ 3UFGA 4GK0E 4JI8T 2C5JA 4X1YE 3N2KE 3C98B 3RF1A 4CI3B 4DR5T 3P8CD 1T8BA 3I1AA 3EUHA 3UUNA 4PAGA 3L8RA 4FI5A 4UVAB 3NBXX 1WYBA 2NW7A 1ZEEA 1UK5A 5HWYA 4WBNE 2EHOD 2VWAA 2LHNA 4TV9E 2EHOB 2LLYA 3QB5K 4X5TA 1S35A 2XQ8A 5CJ5A 4U7IA 3RIUC 5JVDE 2D0TA 2MYSA 4PK6A 3SOLA 5JDLA 2WS3A 3FBZA 3NRYA 3EHZA 3E22E 4NXMT 2CLYB 5A1LA 5JR9B 1OEDB 3WI3A 1MMDA 4LF6T 4CI1B 5DJQC 3HR0A 4ZI3D 2XSAA 2HHHT 3E08A 1L0VA 4I4TE 2BKNA 3LK2B 2WCAA 3UQ7A 1WCRA 4MFRA 2V7IA 4HWFA 5M4YA 3NRXA 3MK7C 2IC9A 3C4ZA 3UU8A 3P50A 3OVUA 3RI5A 3RRWA 3N9OA 2ACZA 4YFSA 1FMWA 1Z8UA 5CA0E 5BMVE 3AVRA 2RP4A 2IIUA 1FEWA 1V9DA 4NUVA 3EDUA 4QX8B 2HPJA 3AB3B 2F4VT 5C3JA 2UXXB 3PUGA 2KINB 3HA4A 1YQ3A 3PDYA 3C64A 3UT5E 2PG8A 3AEEA 3SFEA 1XDPA 3PU8A 2Q9QD 2JPFA 2NTYA 2FJDA 2Q9QB 3ZN1B 2YDQA 2X9HA 3UUBA 1SUMB 2K24A 2C5KT 2CLYC 5JR9C 2R6GF 4ZS3A 4ZI7E 1OEDC 4JLEA 1G73A 2LE8A 1XNQT 1YKEB 4DUYT 2UU9T 3LK42 3LK3B 4ZI3C 4UELA 3UUXB 2W62A 2VKHA 1YKHB 4X1IE 4ZOLE 3ETUA 2LKGA 4O4LE 5FNVE 3AE3A 2FJAA 3L3PA 4HWDA 3NZPA 3OYZA 5AQGB 3I0OA 4IDQA 4AQFA 4GKKT 4DV7T 4I50E 1OXZA 3Q5DA 5ABGA 3RLFF 4LFAT 3KDSE 4I0UA 3SFDA 2JRKA 4I43B 1BR0A 2VK9A 2V1DB 5HCJA 5AFUL 1MIYA 3ZMZB 4ISTA 1E7PA 3AE7A 4AIUA 4JYAT 4PFPA 3ZEFB 2WDVA 3IF8B 4O2AE 1E2AA 1D1BA 3TLUA 2V6XA 3PV0F 2XAGB 1KNPA 2OA5A 3LSVA 4TN7B 4TWDA 2XQ3A 5AQLB 4ZI2D 2PFVA 5ADXL 4JV5T 1G8XA 3MJXA 2YDRA 5J1GA 3ZCIA 4MHCA 2XZEA 2KNDA 1VCSA 2ZMAA 3ANWB 4UIGA 3NVOA 1W0AA 4QH1A 2I0MA 2ZM6T 1O3XA 2ZLYA 4DMVA 3Q5WA 2CHOA 4JEUB 2Z6EA 3HKDE 2Y48B 2K9AA 3Q5XA 4L0RA 3T1HT 4LMJA 1XWMA 1LVFA 2WZHA 3BQIA 4G2AA 3VRAA 2V5CA 3TLWA 5AQSB 2CBJA 3EAMA 4IIJE 3UFEA 1KK7A 5LA6E 5LXTE 1J5ET 3KFWX 2RA1A 5FP3A 2J47A 2J1DG 4K0KT 1N33T 2I6HA 1T98A 3TLSA 4GIWA 5FMNA 2LSJA 2ZM0A 4UEMA 3D0TA 5JR9A 1ZV4X 4Z90A 3AEDA 2LSGA 2G0UA 2WU2A 2KLQA 2VURA 2ZM8A 2NW9A 4HFIA 4EB6E 5LHIB 2QA7A 3KBTA 1D0YA 3BQKA 3P4PA 4ZI2C 3ZKRA 1VOMA 4CN6A 3AA6B 3P4SA 2BKOA 5AQMB 4DBQA 5CA1E 3UU5A 1SHZC 1MNDA 4P0AA 4NUUA 2CA5A 2DHRA 2W4XA 3GWHA 4QXHB 2XQ5A 5L3GB 1BR4A 2HN1A 5E0OA 1NWMX
chains in the Genus database with same CATH topology
2DLRA 5HYAA 2P9BA 2UXNB 1LRZA 4KUMB 2A3DA 5FXZA 3RX6A 3AA7B 4CQIA 3ZLIA 3GMIA 4YHJA 3PUSA 5CB4E 4I55E 3IBPA 2LM9A 3MA9A 4J2CA 3BK9A 3ZYKA 4DBRA 2W63A 2WMNA 3FXDB 1LKXA 4UXNB 3AVSA 2L8KA 3LG7A 3ZCJA 3P7IA 4GK0E 2JMKA 4IE6A 2PBIA 3O1HA 1HX8A 2C5JA 3MKDA 3BQLA 4QXCB 4M1PA 4P0BA 4X1YE 3N2KE 3C98B 5HAXA 5JDFA 4CI3B 3HKBE 3P8CD 4YJ3E 3I1AA 2V7MA 4H9NC 3EUHA 1MIVA 2HH7A 3UUNA 4PAGA 4DVDA 4CI2B 1UX4A 2BVLA 3O1JA 3EDVA 4U72A 5H6RB 1X79A 5JDMA 2A2FX 1ZHCA 3K3NA 1SA0E 2X68A 5F3JA 5JDGA 2XTLA 3L09A 3K8PC 4FI5A 4UVAB 4PK5A 2DCFA 3KVBA 2CWOA 2KT9A 4O8SA 4XBFB 4HE8A 4O4JE 5HXEA 2QGSA 4V1Av 3NBXX 3JC6D 1WYBA 2DNXA 2NW7A 4YLHA 1KNZA 1ZEEA 5HWYA 4WBNE 4TV8E 2EHOD 2VWAA 4AKIA 2LHNA 4TV9E 2EHOB 1UX5A 4GOUA 2LOSA 3I0QA 2KXPB 3O1IA 1S35A 2EHOA 4HFVA 2YINA 5LBMA 4G63A 5JVDE 2D0TA 2X9WA 2IC6A 2V7JA 2MYSA 4PK6A 2MBGA 4QXBB 3SOLA 5LGTB 4PJMA 5JDLA 2CMRA 3FBZA 3NRYA 3E22E 3MZKB 1YD8G 4H9QC 5J2TE 2E8IA 2CLYB 5LJMA 5HXHA 3OKQA 5A1LA 5JR9B 2CM0A 5JDHA 1QSDA 2XAFB 1WLXA 3WI3A 1MMDA 1ZKEA 3ETVA 3MACA 2X0LB 5JH7E 5GONE 1Z0PA 2NW8A 4CI1B 5DJQC 3HR0A 3Q2MA 2NWBA 4ZI3D 4EZ4A 1HG2A 1MNEA 2A72A 2V26A 3E08A 3J9X1 4BJNA 2XAQB 3H3AA 4I4TE 5LGNB 5LHHB 4U74A 3FHNA 3HL6A 3LJCA 3LK2B 5FXVA 2VKDA 2IW5B 3T8OA 2JJ9A 4PJLA 3KBUA 5DQWA 4HKAA 3VU7H 3UTKA 4IDZA 2HPLA 4F6RC 4AQGA 1UCUA 5C8YE 4MFRA 4WW0A 4EYUA 2V7IA 1D0XA 5M4YA 2LSKA 2N2NA 3NRXA 2BZBA 3MK7C 2IC9A 3C4ZA 3E0ZA 3F2EA 3WAKA 5LBQB 3OJAA 3DP7A 5HXCA 5JRCA 4UV9B 4ANJA 5KX5E 5L3BB 3AAIA 1HG5A 4X20E 3RRWA 3N9OA 4YFSA 1FMWA 2XQYA 5CA0E 5BMVE 3AVRA 2PJQA 2RP4A 3KVAA 2KMFA 2CXFA 1FEWA 4E7SA 3EVYA 1V9DA 3CWZB 4DO0A 4NUVA 3EDUA 2V7LA 4QX8B 2X66A 2HPJA 4HN9A 1IZNB 2ODVA 2LEHA 1S94A 3PUQA 4OYJA 3AB3B 3N9QA 4CXWA 2UXXB 3PUGA 5LOVE 2KINB 3HA4A 3PDYA 3C64A 5FY0A 3UT5E 2Y6XA 3ZPOA 4H9RC 2N1GA 3JC6C 2PG8A 5LHGB 4HEAA 2E9XA 3C50A 4ILUA 3OYXA 4EXTA 3PU8A 2L3LA 2Q9QD 1NAFA 2JPFA 2NTYA 2Q9QB 4HTEA 1MMGA 5H6QB 3ZN1B 3N9LA 3UULA 2K5BB 2Q9QA 2X9HA 2D0UA 2X9XA 3AAAB 2W0GA 1QUUA 3TKLB 3OBVE 2K24A 2KZ7B 2C5KT 3DJBA 4MALA 3AA0B 4DMWA 2XHEB 2CLYC 3UUMA 5JR9C 2Y8DA 1H7CA 4ZS3A 1D1AA 4ZI7E 5ETWA 4JLEA 1G73A 2N9DA 5DABA 4ZHQE 1EZ3A 2DWKA 2LE8A 1U5PA 5IYZE 3RPUA 1HS7A 1YKEB 3CVRA 3B57A 3J7Yq 5JDQA 2WSSV 3VKHA 4PJNA 5L3DB 4IHJE 4MBQA 3LK42 2VKOA 3LK3B 4ZI3C 4X1KE 1E1HB 2XAJB 3GA8A 2W00A 4DNDA 3V5UA 4UELA 3CX8B 4PK4A 4JUYA 4CZZB 4IE7A 5JREA 3ZJ2A 5L3CB 3UUXB 2W62A 2WWUA 4PJJA 1BR1A 2C0SA 2VKHA 3ZJ1A 1WYCA 1YKHB 2XUEA 4X1IE 4ZOLE 3RKOA 4UF0B 3ETUA 2VASA 2VB6A 4UF0A 4PNIA 4O4HE 5JQGE 4WBOA 5HXRA 1MMAA 4O4LE 4QWNB 5FNVE 3C51A 3ZC0A 5LNKA 1FMVA 3L3PA 4TUYE 1FIOA 4TZ4C 2V7KA 4IE0A 4AKLA 3NZPA 4P09A 5IHYA 3N9MA 3CMLA 3OYZA 3F57A 5JDNA 4OYKA 3I0OA 3WAJA 1B7TA 4IE5A 5LG4A 3AA1B 4AQFA 4K0UA 1LVKA 4GK5E 5FXXA 5KMGP 2XAHB 4I50E 4QX7B 3KINB 4OFZA 1OXZA 5EK4A 5LCYA 3B13A 3LBXA 3I9WA 2CEAA 4BJMA 3F31A 2C5IT 3AAEB 3KDSE 3HKEE 3VKGA 4H9PC 3S4UA 2LT3A 4ADZA 4L9IA 4BA9A 4HGAA 2JRKA 4I43B 2W61A 2H7OA 2YU2A 3ZYLA 4EYYR 1BR0A 2D2SA 2VK9A 4EIWA 4FJOA 2V1DB 4Z8XA 1IJ5A 5JRCB 5AFUL 1HCIA 1MIYA 3W15B 3CX7B 3ZMZB 4UV8B 4ISTA 1HFAA 3FBLA 3ZC1A 1MMNA 4IE4A 4MLKA 3PU3A 3PE0A 4JEHB 2LSYA 1U4QA 4PFPA 3ZMUB 3ZEFB 3CX6B 1YW0A 3IEEA 5DQVA 3IF8B 4XAXB 2CXLA 4O4IE 4O2AE 4TX5A 3ZN0B 5FXWA 2WBLA 1D1BA 3C4WA 3N5LA 3NZQA 2X9YA 4ISSA 2XAGB 2JMHA 2IAKA 1OWAA 1WR6A 2D5UA 2CE7A 3FXEB 2SPCA 2OA5A 3I9YA 4TN7B 4WNKA 3CPZA 4PW8A 4ZI2D 2YK0A 2PFVA 3QC9A 4AKRB 3HKCE 5ADXL 2WM9A 3HI2A 3SWHA 4B6XA 4EAHA 1G8XA 2CCQA 2E9XD 3SS1A 2H7VC 2DI4A 3MJXA 2E9XB 2M67A 4XZCA 1D0ZA 5J1GA 1MIWA 3ZCIA 3ZYMA 2EHOC 4MHCA 4H63H 2KNDA 2LJLA 1CUNA 2LOPA 1HTJF 3RC3A 2ZMAA 3ANWB 3ZMSB 2NOXA 4UIGA 3ANWA 3RYCE 2B1EA 2KWHA 2VKJA 4PFOA 2MTQA 4H9OC 3MXZA 3KV6A 3CQCB 3N2OA 3DTOA 1O3XA 2ZLYA 4DMVA 3Q5WA 4JEUB 3SRZA 4AKGA 2Z6EA 4H63V 5FY7A 2YEVC 3HKDE 1US7B 3H37A 3LFMA 2Y48B 2K48A 3RYFE 5L2LA 3U78A 2I59A 5LP6E 2X67A 2K9AA 4IGUA 3R84B 4AI6A 3V5SA 3Q5XA 4L0RA 5LGUB 2VL8A 5FY1A 5J2UE 4AXPA 3PTRB 3QUJA 2YU1A 4ERRA 3K3OA 4CXYA 1LVFA 1IAPA 3A5XA 3N9NA 3BQIA 4C91A 4YJ2E 4G2AA 5LJNA 1D1CA 3N9PA 4N78D 2ACXA 4UVCB 5TAOA 3RYHE 4IIJE 3UFEA 4AQFC 1KK7A 5LA6E 5EK3A 3ZMVB 5LXTE 3CQGB 3KFWX 3RYIE 2RA1A 3C4XA 5LYJE 3Q9DA 1HF8A 5HWXA 4OK0A 5FP3A 4AKHA 3RH3A 2J1DG 2LSIA 2GK9A 3O9XA 3QK6A 1T98A 3U3IA 5FYMA 3K3QC 4ASKA 2DWGA 1Y64B 4A56A 4GIWA 1AJ3A 4UVBB 2MOZA 5FMNA 2LSJA 2NP9A 3ZMTB 2ODUA 2ZM0A 4UEMA 3D0TA 5JR9A 1ZV4X 4KBMB 2LSGA 2G0UA 4GYSA 2CXDA 5EZYE 3ESLA 4L5GA 1BR2A 3FB2A 2KLQA 3RC8A 4QKNA 3LBXB 3PUAA 2WMOA 1VRBA 3RRCA 4BAYB 4EOZB 2ZM8A 2ZM2A 4GYRA 2NW9A 4CXXA 5EK2A 3R6NA 4EB6E 3O4XE 5LHIB 2QA7A 4H9SE 3CQXC 1D0YA 3KBTA 2JQQA 4E7ZA 3GN5B 2XASB 4O2BE 2H3RA 2KWIB 3BQKA 3CKDA 5KDMC 2L9QA 3GN5A 3VHLA 3KV9A 5L3FB 4ZI2C 4OHFA 1VOMA 5F8PA 2ES0A 5L3EB 3AA6B 4KP3C 2E9XC 1WRDA 2BVMA 4C90A 3ONXA 4DBQA 4KMCA 5CA1E 2X51A 4QHOA 4EZHA 2BDEA 3N2GE 2WAUA 1SHZC 1MNDA 4P0AA 4NUUA 2CA5A 2DHRA 3GWHA 3M65A 4QXHB 2NTXA 2Q9QC 5HXSA 3IHRA 3PURA 5L3GB 2LHRA 1BR4A 5E0OA 4ZS2A 1IJ6A 2CWYA 1NWMX 3KV4A 3KV5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9R C;  5KDM C;  4H9Q C;  4H9N C;  4H9S E;  4HGA A;  4H9O C;  4H9P C; 
#chains in the Genus database with same CATH topology
 2P9B A;  2UXN B;  3AE9 A;  3NWI A;  3AA7 B;  3ZLI A;  4F8H A;  4YHJ A;  2LM9 A;  4DBR A;  4J2C A;  1LKX A;  4JI5 T;  2L8K A;  3AE1 A;  3FZF B;  3P7I A;  4KHP T;  3O1H A;  3AEC A;  1HX8 A;  2UXB T;  4DV2 T;  3VR8 A;  3MKD A;  3BQL A;  4M1P A;  4YJ3 E;  5H6R B;  3CIR A;  1X79 A;  3K3N A;  2WB5 A;  3UU6 A;  4PK5 A;  2CWO A;  3JCF A;  4O8S A;  4XBF B;  5HXE A;  4O4J E;  2QGS A;  2YKS A;  4YLH A;  2UUC T;  1KNZ A;  2XSB A;  4HWH A;  4TV8 E;  2OLT A;  4GOU A;  2LOS A;  3I0Q A;  3O1I A;  3RHW A;  4HFV A;  2YIN A;  2X9W A;  2IC6 A;  2V7J A;  4QXB B;  1KFY A;  2QVA A;  4YSX A;  4H9Q C;  3JAE A;  5HXH A;  3OKQ A;  2CM0 A;  5JDH A;  4ZZB A;  3AXJ B;  2VQF T;  2X0L B;  5GON E;  2NW8 A;  4ILB A;  5AQT B;  3Q2M A;  4EZ4 A;  2XAQ B;  3H3A A;  3QOF A;  3FHN A;  5FXV A;  2VKD A;  3A7M A;  4PJL A;  2CPT A;  4YT0 A;  5DQW A;  4HKA A;  4KI0 F;  2HPL A;  3EI0 A;  4AQG A;  1UCU A;  1D0X A;  2BZB A;  2W67 A;  3F2E A;  3OJA A;  5KX5 E;  2MPK A;  4DR3 T;  2PJQ A;  2IUB A;  3EVY A;  4IDO A;  4HN9 A;  2ODV A;  1S94 A;  3N9Q A;  5FY0 A;  2Y6X A;  3ZPO A;  5CFB A;  1GQE A;  2L3L A;  1NAF A;  4HTE A;  5H6Q B;  4YHH T;  2X9X A;  2XQ6 A;  3AAA B;  2WQY A;  2A9U A;  4TNW A;  3PUW F;  3AA0 B;  4DMW A;  3PUV F;  1NEK A;  2XQ9 A;  5CGM A;  3UUM A;  2Y8D A;  1H7C A;  4ILC A;  2CRB A;  5ETW A;  4CN4 A;  5IYZ E;  1U5P A;  3CVR A;  3B57 A;  4JI4 T;  2WSS V;  1JNR A;  2XM1 A;  4PJN A;  3VKH A;  4MBQ A;  2VKO A;  2XAJ B;  2W00 A;  3V5U A;  3CX8 B;  4PK4 A;  5JRE A;  4CZZ B;  4IE7 A;  2WWU A;  4IT4 A;  2C0S A;  2FJE A;  5ABF A;  4NIQ A;  4UF0 B;  2VB6 A;  5JQG E;  1HNX T;  5HXR A;  3C51 A;  5F5W A;  5FVK A;  4P09 A;  5IHY A;  2UUB T;  3N9M A;  4IDP A;  1HR0 T;  4K0U A;  5FXX A;  5KMG P;  2XAH B;  5LCY A;  4OFZ A;  4BJM A;  2C5I T;  3HKE E;  4HWC A;  2UXD T;  3ZYL A;  2H7O A;  4A97 A;  4EIW A;  5LB7 B;  5JRC B;  4DV4 T;  4P1N A;  1HCI A;  3W15 B;  4Z91 A;  4UV8 B;  3FBL A;  1MMN A;  4IE4 A;  2LSY A;  1U4Q A;  1T72 A;  3IEE A;  4ZXL A;  2CXL A;  4O4I E;  2X9Y A;  5AQV B;  2IAK A;  5HCM A;  1WR6 A;  3FXE B;  3I9Y A;  3PUZ F;  3CPZ A;  2LRK A;  2YK0 A;  4AKR B;  3QC9 A;  3FZK B;  3HI2 A;  4EAH A;  3SS1 A;  2M67 A;  1D0Z A;  4TWF A;  1MIW A;  3ZYM A;  2EHO C;  1IBM T;  4B3M T;  1HTJ F;  3RC3 A;  3RYC E;  2KWH A;  3AE2 A;  4H9O C;  5FY7 A;  2YEV C;  3UU4 A;  3AEB A;  3U78 A;  5L4H A;  2W66 A;  2X67 A;  4IGU A;  1JNZ A;  1N32 T;  3FZM B;  4AXP A;  3PTR B;  3QUJ A;  2YU1 A;  4ERR A;  1M7K A;  1XZY A;  2JQ9 A;  5LJN A;  2FUP A;  3N9N A;  4YJ2 E;  3N9P A;  1Y01 A;  4LF9 T;  5TAO A;  3RIA A;  5EK3 A;  1WR0 A;  1CHU A;  4COF A;  3PUX F;  4AKH A;  3ZST A;  2JIW A;  3U3I A;  5FYM A;  2BG9 E;  1AJ3 A;  3NKZ A;  3G06 A;  3K1S A;  3PUY F;  2NP9 A;  3ZMT B;  4KBM B;  5EZY E;  2CXD A;  3AXJ A;  3RC8 A;  4ZEY A;  4QKN A;  2KSR A;  3PUA A;  4BAY B;  3RIU A;  4GYR A;  5EK2 A;  5AQP B;  5FVL A;  3GN5 B;  4O2B E;  2H3R A;  5KDM C;  3AEF A;  4EGW A;  5JTG A;  4HWI B;  2JQH A;  3KV9 A;  5L3F B;  4A5X A;  2BVM A;  2XM2 A;  3ONX A;  2X51 A;  3ABV A;  4WZX A;  2NTX A;  2Q9Q C;  2RPA A;  3PUR A;  4B3T T;  4U33 A;  3P4Q A;  3H37 A;  3KV5 A;  2DLR A;  5HYA A;  4HFE A;  4KUM B;  2A3D A;  5AQJ B;  5FL0 A;  2JQK A;  3GMI A;  1KF6 A;  5CB4 E;  4I55 E;  2IDO B;  3ZYK A;  2W63 A;  2WMN A;  3FXD B;  5FKY A;  2XQ7 A;  3AVS A;  3ZCJ A;  2JMK A;  5ABH A;  4JI7 T;  3AE5 A;  1ZOY A;  4IL9 A;  4QXC B;  4TNV A;  5HAX A;  4DR6 T;  4X64 T;  2V7M A;  4H9N C;  2HH7 A;  4DV3 T;  3P4R A;  4CI2 B;  5HEH A;  1UX4 A;  2BVL A;  5AQK B;  2V8S V;  5JDM A;  5HEO A;  2A2F X;  2X68 A;  2XTL A;  3ZT5 A;  3KVB A;  2KT9 A;  4HE8 A;  4DV6 T;  4A98 A;  4V1A v;  3JC6 D;  4IDN A;  2J62 A;  2EHO A;  4LMK A;  2WP9 A;  5LGT B;  5C2T A;  4JI3 T;  2B76 A;  3MZK B;  1YD8 G;  5J2T E;  2E8I A;  5LJM A;  1KNR A;  5HEU A;  1QSD A;  1WLX A;  3ONJ A;  1ZKE A;  3ETV A;  3MAC A;  1OED A;  2J4G A;  1M62 A;  2H88 A;  5BR8 T;  1HG2 A;  2A72 A;  4BJN A;  4EED A;  3RQU A;  4U74 A;  3LJC A;  2JJ9 A;  3VU7 H;  3UTK A;  4F6R C;  2VVN A;  1W0B A;  4WW0 A;  4EYU A;  2LSK A;  2N2N A;  3AEA A;  3WAK A;  5L47 A;  3DP7 A;  5JRC A;  4ANJ A;  4YSY A;  5AQI B;  3CK6 A;  3KVA A;  3IA3 A;  2CXF A;  4E7S A;  2FBW A;  3CWZ B;  4DO0 A;  3RIF A;  2CBI A;  4ZZC A;  2X66 A;  4JI0 T;  2LEH A;  3PUQ A;  4CXW A;  4X62 T;  4H9R C;  2YOE A;  3JC6 C;  4HEA A;  2XY8 B;  1W9R A;  1MMG A;  4JBW F;  3UUL A;  2K5B B;  2Q9Q A;  4DID B;  4NXN T;  3OBV E;  2KZ7 B;  3DJB A;  2XHE B;  1XMQ T;  5AQN B;  1D1A A;  1T7S A;  3P4W A;  5DAB A;  1EZ3 A;  2DWK A;  3RPU A;  1HS7 A;  2FJB A;  3FZL B;  5L3D B;  4IHJ E;  3GA8 A;  4DND A;  5L3C B;  3OTO T;  1ZP0 A;  2QYW A;  2VAS A;  4O4H E;  4IL4 A;  1MMA A;  4QWN B;  2W2U A;  1FMV A;  4TUY E;  4TZ4 C;  2V7K A;  4IE0 A;  4AKL A;  3F57 A;  4OYK A;  3A8Y C;  1XMO T;  4IE5 A;  5LG4 A;  1UUR A;  4QX7 B;  3AE4 A;  3B13 A;  3I9W A;  2H89 A;  3F31 A;  4ILA A;  4H9P C;  3S4U A;  3H3M A;  2LT3 A;  4L9I A;  4BA9 A;  4HGA A;  4LF4 T;  2WY2 A;  4Z8X A;  1IJ5 A;  1KEY A;  2LRL A;  5AQQ B;  3CX7 B;  3ZC1 A;  4B3R T;  2LM2 A;  4MLK A;  4JEH B;  2VQE T;  3ZMU B;  4TX5 A;  3ZN0 B;  5FXW A;  4DUZ T;  3NZQ A;  4X65 T;  2AE9 A;  2VVS A;  1OWA A;  4AIS A;  1WFD A;  2UUA T;  2E5V A;  2WM9 A;  3SWH A;  3B5M A;  3ZSS A;  2E9X D;  1YXR A;  2BS4 A;  2E9X B;  5HEJ A;  3AE6 A;  4DV1 T;  4DR7 T;  3RQW A;  4H63 H;  2LJL A;  2LOP A;  1VCT A;  3ZMS B;  3ZT6 A;  3ANW A;  4LF7 T;  2B1E A;  1R8I A;  2MTQ A;  3KV6 A;  3SRZ A;  4AKG A;  4H63 V;  5AQR B;  4JI2 T;  3LFM A;  1J1J A;  4HFB A;  3R84 B;  3AE8 A;  1FJG T;  3V5S A;  4LFC T;  4CN1 A;  5LGU B;  2IML A;  5J2U E;  4HFD A;  3K3O A;  4CXY A;  2AXD S;  2ACX A;  1DU2 A;  2YDS A;  4AQF C;  4DR2 T;  3ZMV B;  3RKG A;  3C4X A;  5LYJ E;  3Q9D A;  3JAF A;  1HNZ T;  3O9X A;  2WDQ A;  1I6Z A;  3K3Q C;  4ASK A;  4A56 A;  2E5L T;  3QNU A;  4UVB B;  2MOZ A;  2ODU A;  4GYS A;  4KHZ F;  4B3S T;  4L5G A;  1BR2 A;  3FB2 A;  2E2A A;  3LBX B;  2WMO A;  1VRB A;  3RRC A;  2ZM2 A;  3R6N A;  1UUS A;  3O4X E;  4H9S E;  3CQX C;  2JQQ A;  2XAS B;  1HNW T;  2KWI B;  3T1Y T;  3CKD A;  2L9Q A;  4DV5 T;  3TLT A;  3ZT7 A;  5AQO B;  4KP3 C;  2E9X C;  4C90 A;  4KMC A;  4QHO A;  2BDE A;  3M65 A;  4QH4 A;  2LHR A;  4ZS2 A;  1OED E;  4YTN A;  3N9L A;  3KV4 A;  5IUX A;  3JAD A;  1LRZ A;  3RX6 A;  4OX9 T;  3LDQ B;  4HFC A;  4UXN B;  3LG7 A;  2LKH A;  4IE6 A;  2PBI A;  4UR9 A;  4U3C A;  1HX1 B;  2BG9 B;  4P0B A;  2M6B A;  5JDF A;  3HKB E;  3QB5 A;  1MIV A;  4DVD A;  3O1J A;  3EDV A;  4U72 A;  2CHN A;  1ZHC A;  1SA0 E;  5F3J A;  5JDG A;  3L09 A;  4WYV A;  3K8P C;  2DCF A;  2DNX A;  3UQ4 A;  4AKI A;  5LMU T;  1UX5 A;  2KXP B;  5LBM A;  4G63 A;  2MBG A;  4PJM A;  2CMR A;  2OV9 A;  5FL1 A;  2X0H A;  3VR9 A;  5J0Z A;  2XAF B;  3M3Z B;  2M6I A;  5JH7 E;  1Z0P A;  3UU3 A;  4JI1 T;  4LFB T;  2NWB A;  1QLB A;  2V26 A;  1MNE A;  3J9X 1;  2V6Y B;  5LGN B;  5LHH B;  3HL6 A;  2IHR 1;  2IW5 B;  3T8O A;  4U2Y A;  3KBU A;  5C8Y E;  4IDZ A;  2XQ4 A;  4JI6 T;  3E0Z A;  5LBQ B;  2PTF A;  4YXD A;  3L39 A;  1X9B A;  5HXC A;  1XNR T;  4UV9 B;  1IBK T;  5L3B B;  1SE7 A;  4EEB A;  3AAI A;  1HG5 A;  4X20 E;  2BG9 C;  2XQY A;  2KMF A;  3VRB A;  4LF5 T;  2V7L A;  2V5D A;  4U31 A;  1IZN B;  4OYJ A;  4YY3 T;  4HFH A;  2UXC T;  5LOV E;  3ONL C;  2N1G A;  2D9D A;  5LHG B;  2E9X A;  3C50 A;  4ILU A;  3OYX A;  2YN6 A;  4EXT A;  1XDO A;  1W09 A;  2D0U A;  4U7Y A;  2W0G A;  1QUU A;  3TKL B;  4MAL A;  5ABE A;  2XQA A;  5HEG A;  2N9D A;  4ZHQ E;  2X0Y A;  3J7Y q;  2WDR A;  5JDQ A;  4X1K E;  1E1H B;  4YSZ A;  4JUY A;  3ZJ2 A;  4PJJ A;  5AQH B;  1BR1 A;  3ZJ1 A;  5ABF B;  1WYC A;  2XUE A;  3RKO A;  3TLV A;  4UF0 A;  4PNI A;  4EV6 A;  2XPK A;  4WBO A;  3ZC0 A;  5LNK A;  4YTM A;  1FIO A;  2BKP A;  1N34 T;  3CML A;  4QH5 A;  5JDN A;  1B7T A;  3AA1 B;  1LVK A;  4GK5 E;  5EK4 A;  3KIN B;  3LBX A;  2HN2 A;  4NPP A;  1IBL T;  2CEA A;  3AAE B;  3VKG A;  4ADZ A;  4DV0 T;  2W61 A;  2YU2 A;  4EYY R;  2D2S A;  4FJO A;  1YQ4 A;  3X1D A;  1HFA A;  4AQY T;  3PU3 A;  3PE0 A;  2K3W A;  2BBH A;  3CX6 B;  1YW0 A;  5DQV A;  4XAX B;  1NEN A;  2WBL A;  3C4W A;  3N5L A;  4ISS A;  2JMH A;  2D5U A;  2CE7 A;  1J5W A;  2SPC A;  3FZH B;  4WNK A;  4PW8 A;  5AQF B;  3HKC E;  3EAB A;  4B6X A;  4YTP A;  5LG3 A;  2CCQ A;  2H7V C;  2DI4 A;  4XZC A;  1CUN A;  2WZI A;  1N36 T;  2NOX A;  4LML A;  2VKJ A;  4PFO A;  4U2Z A;  3MXZ A;  3N2O A;  3CQC B;  3DTO A;  4DR4 T;  2WWV A;  3RGL A;  1US7 B;  2K48 A;  3RYF E;  5L2L A;  2BG9 A;  5LP6 E;  2I59 A;  4AI6 A;  4IRE A;  2VL8 A;  2BBJ A;  1UGO A;  5FY1 A;  2BS3 A;  1IAP A;  3A5X A;  4C91 A;  1D1C A;  4N78 D;  5IWA T;  2VL0 A;  2WU5 A;  4UVC B;  3RYH E;  3CQG B;  3RYI E;  1HF8 A;  5HWX A;  4OK0 A;  3RH3 A;  3Q5E A;  2LSI A;  2GK9 A;  5KXJ A;  2XJ7 A;  3QK6 A;  2DWG A;  1Y64 B;  3AEG A;  5AQU B;  4KX6 A;  4GKJ T;  3ESL A;  2NR4 A;  4EOZ B;  5L4E A;  4CXX A;  4LF8 T;  2DL1 A;  4E7Z A;  2V6Y A;  4DR1 T;  4X66 T;  3GN5 A;  3VHL A;  4OHF A;  5F8P A;  2ES0 A;  5L3E B;  2QRX A;  1WRD A;  4EZH A;  3N2G E;  2WAU A;  5HXS A;  3IHR A;  1I94 T;  1IJ6 A;  2CWY A;  3WAJ A;  5LMN T;  4Q25 A;  2BS2 A;  2MAW A;  5FXZ A;  4CQI A;  3OPC A;  3PUS A;  3IBP A;  3MA9 A;  3BK9 A;  3PJA A;  4TWH A;  3PJA J;  3UFG A;  4GK0 E;  4JI8 T;  2C5J A;  4X1Y E;  3N2K E;  3C98 B;  3RF1 A;  4CI3 B;  4DR5 T;  3P8C D;  1T8B A;  3I1A A;  3EUH A;  3UUN A;  4PAG A;  3L8R A;  4FI5 A;  4UVA B;  3NBX X;  1WYB A;  2NW7 A;  1ZEE A;  1UK5 A;  5HWY A;  4WBN E;  2EHO D;  2VWA A;  2LHN A;  4TV9 E;  2EHO B;  2LLY A;  3QB5 K;  4X5T A;  1S35 A;  2XQ8 A;  5CJ5 A;  4U7I A;  3RIU C;  5JVD E;  2D0T A;  2MYS A;  4PK6 A;  3SOL A;  5JDL A;  2WS3 A;  3FBZ A;  3NRY A;  3EHZ A;  3E22 E;  4NXM T;  2CLY B;  5A1L A;  5JR9 B;  1OED B;  3WI3 A;  1MMD A;  4LF6 T;  4CI1 B;  5DJQ C;  3HR0 A;  4ZI3 D;  2XSA A;  2HHH T;  3E08 A;  1L0V A;  4I4T E;  2BKN A;  3LK2 B;  2WCA A;  3UQ7 A;  1WCR A;  4MFR A;  2V7I A;  4HWF A;  5M4Y A;  3NRX A;  3MK7 C;  2IC9 A;  3C4Z A;  3UU8 A;  3P50 A;  3OVU A;  3RI5 A;  3RRW A;  3N9O A;  2ACZ A;  4YFS A;  1FMW A;  1Z8U A;  5CA0 E;  5BMV E;  3AVR A;  2RP4 A;  2IIU A;  1FEW A;  1V9D A;  4NUV A;  3EDU A;  4QX8 B;  2HPJ A;  3AB3 B;  2F4V T;  5C3J A;  2UXX B;  3PUG A;  2KIN B;  3HA4 A;  1YQ3 A;  3PDY A;  3C64 A;  3UT5 E;  2PG8 A;  3AEE A;  3SFE A;  1XDP A;  3PU8 A;  2Q9Q D;  2JPF A;  2NTY A;  2FJD A;  2Q9Q B;  3ZN1 B;  2YDQ A;  2X9H A;  3UUB A;  1SUM B;  2K24 A;  2C5K T;  2CLY C;  5JR9 C;  2R6G F;  4ZS3 A;  4ZI7 E;  1OED C;  4JLE A;  1G73 A;  2LE8 A;  1XNQ T;  1YKE B;  4DUY T;  2UU9 T;  3LK4 2;  3LK3 B;  4ZI3 C;  4UEL A;  3UUX B;  2W62 A;  2VKH A;  1YKH B;  4X1I E;  4ZOL E;  3ETU A;  2LKG A;  4O4L E;  5FNV E;  3AE3 A;  2FJA A;  3L3P A;  4HWD A;  3NZP A;  3OYZ A;  5AQG B;  3I0O A;  4IDQ A;  4AQF A;  4GKK T;  4DV7 T;  4I50 E;  1OXZ A;  3Q5D A;  5ABG A;  3RLF F;  4LFA T;  3KDS E;  4I0U A;  3SFD A;  2JRK A;  4I43 B;  1BR0 A;  2VK9 A;  2V1D B;  5HCJ A;  5AFU L;  1MIY A;  3ZMZ B;  4IST A;  1E7P A;  3AE7 A;  4AIU A;  4JYA T;  4PFP A;  3ZEF B;  2WDV A;  3IF8 B;  4O2A E;  1E2A A;  1D1B A;  3TLU A;  2V6X A;  3PV0 F;  2XAG B;  1KNP A;  2OA5 A;  3LSV A;  4TN7 B;  4TWD A;  2XQ3 A;  5AQL B;  4ZI2 D;  2PFV A;  5ADX L;  4JV5 T;  1G8X A;  3MJX A;  2YDR A;  5J1G A;  3ZCI A;  4MHC A;  2XZE A;  2KND A;  1VCS A;  2ZMA A;  3ANW B;  4UIG A;  3NVO A;  1W0A A;  4QH1 A;  2I0M A;  2ZM6 T;  1O3X A;  2ZLY A;  4DMV A;  3Q5W A;  2CHO A;  4JEU B;  2Z6E A;  3HKD E;  2Y48 B;  2K9A A;  3Q5X A;  4L0R A;  3T1H T;  4LMJ A;  1XWM A;  1LVF A;  2WZH A;  3BQI A;  4G2A A;  3VRA A;  2V5C A;  3TLW A;  5AQS B;  2CBJ A;  3EAM A;  4IIJ E;  3UFE A;  1KK7 A;  5LA6 E;  5LXT E;  1J5E T;  3KFW X;  2RA1 A;  5FP3 A;  2J47 A;  2J1D G;  4K0K T;  1N33 T;  2I6H A;  1T98 A;  3TLS A;  4GIW A;  5FMN A;  2LSJ A;  2ZM0 A;  4UEM A;  3D0T A;  5JR9 A;  1ZV4 X;  4Z90 A;  3AED A;  2LSG A;  2G0U A;  2WU2 A;  2KLQ A;  2VUR A;  2ZM8 A;  2NW9 A;  4HFI A;  4EB6 E;  5LHI B;  2QA7 A;  3KBT A;  1D0Y A;  3BQK A;  3P4P A;  4ZI2 C;  3ZKR A;  1VOM A;  4CN6 A;  3AA6 B;  3P4S A;  2BKO A;  5AQM B;  4DBQ A;  5CA1 E;  3UU5 A;  1SHZ C;  1MND A;  4P0A A;  4NUU A;  2CA5 A;  2DHR A;  2W4X A;  3GWH A;  4QXH B;  2XQ5 A;  5L3G B;  1BR4 A;  2HN1 A;  5E0O A;  1NWM X; 
#chains in the Genus database with same CATH homology
 2DLR A;  5HYA A;  2P9B A;  2UXN B;  1LRZ A;  4KUM B;  2A3D A;  5FXZ A;  3RX6 A;  3AA7 B;  4CQI A;  3ZLI A;  3GMI A;  4YHJ A;  3PUS A;  5CB4 E;  4I55 E;  3IBP A;  2LM9 A;  3MA9 A;  4J2C A;  3BK9 A;  3ZYK A;  4DBR A;  2W63 A;  2WMN A;  3FXD B;  1LKX A;  4UXN B;  3AVS A;  2L8K A;  3LG7 A;  3ZCJ A;  3P7I A;  4GK0 E;  2JMK A;  4IE6 A;  2PBI A;  3O1H A;  1HX8 A;  2C5J A;  3MKD A;  3BQL A;  4QXC B;  4M1P A;  4P0B A;  4X1Y E;  3N2K E;  3C98 B;  5HAX A;  5JDF A;  4CI3 B;  3HKB E;  3P8C D;  4YJ3 E;  3I1A A;  2V7M A;  4H9N C;  3EUH A;  1MIV A;  2HH7 A;  3UUN A;  4PAG A;  4DVD A;  4CI2 B;  1UX4 A;  2BVL A;  3O1J A;  3EDV A;  4U72 A;  5H6R B;  1X79 A;  5JDM A;  2A2F X;  1ZHC A;  3K3N A;  1SA0 E;  2X68 A;  5F3J A;  5JDG A;  2XTL A;  3L09 A;  3K8P C;  4FI5 A;  4UVA B;  4PK5 A;  2DCF A;  3KVB A;  2CWO A;  2KT9 A;  4O8S A;  4XBF B;  4HE8 A;  4O4J E;  5HXE A;  2QGS A;  4V1A v;  3NBX X;  3JC6 D;  1WYB A;  2DNX A;  2NW7 A;  4YLH A;  1KNZ A;  1ZEE A;  5HWY A;  4WBN E;  4TV8 E;  2EHO D;  2VWA A;  4AKI A;  2LHN A;  4TV9 E;  2EHO B;  1UX5 A;  4GOU A;  2LOS A;  3I0Q A;  2KXP B;  3O1I A;  1S35 A;  2EHO A;  4HFV A;  2YIN A;  5LBM A;  4G63 A;  5JVD E;  2D0T A;  2X9W A;  2IC6 A;  2V7J A;  2MYS A;  4PK6 A;  2MBG A;  4QXB B;  3SOL A;  5LGT B;  4PJM A;  5JDL A;  2CMR A;  3FBZ A;  3NRY A;  3E22 E;  3MZK B;  1YD8 G;  4H9Q C;  5J2T E;  2E8I A;  2CLY B;  5LJM A;  5HXH A;  3OKQ A;  5A1L A;  5JR9 B;  2CM0 A;  5JDH A;  1QSD A;  2XAF B;  1WLX A;  3WI3 A;  1MMD A;  1ZKE A;  3ETV A;  3MAC A;  2X0L B;  5JH7 E;  5GON E;  1Z0P A;  2NW8 A;  4CI1 B;  5DJQ C;  3HR0 A;  3Q2M A;  2NWB A;  4ZI3 D;  4EZ4 A;  1HG2 A;  1MNE A;  2A72 A;  2V26 A;  3E08 A;  3J9X 1;  4BJN A;  2XAQ B;  3H3A A;  4I4T E;  5LGN B;  5LHH B;  4U74 A;  3FHN A;  3HL6 A;  3LJC A;  3LK2 B;  5FXV A;  2VKD A;  2IW5 B;  3T8O A;  2JJ9 A;  4PJL A;  3KBU A;  5DQW A;  4HKA A;  3VU7 H;  3UTK A;  4IDZ A;  2HPL A;  4F6R C;  4AQG A;  1UCU A;  5C8Y E;  4MFR A;  4WW0 A;  4EYU A;  2V7I A;  1D0X A;  5M4Y A;  2LSK A;  2N2N A;  3NRX A;  2BZB A;  3MK7 C;  2IC9 A;  3C4Z A;  3E0Z A;  3F2E A;  3WAK A;  5LBQ B;  3OJA A;  3DP7 A;  5HXC A;  5JRC A;  4UV9 B;  4ANJ A;  5KX5 E;  5L3B B;  3AAI A;  1HG5 A;  4X20 E;  3RRW A;  3N9O A;  4YFS A;  1FMW A;  2XQY A;  5CA0 E;  5BMV E;  3AVR A;  2PJQ A;  2RP4 A;  3KVA A;  2KMF A;  2CXF A;  1FEW A;  4E7S A;  3EVY A;  1V9D A;  3CWZ B;  4DO0 A;  4NUV A;  3EDU A;  2V7L A;  4QX8 B;  2X66 A;  2HPJ A;  4HN9 A;  1IZN B;  2ODV A;  2LEH A;  1S94 A;  3PUQ A;  4OYJ A;  3AB3 B;  3N9Q A;  4CXW A;  2UXX B;  3PUG A;  5LOV E;  2KIN B;  3HA4 A;  3PDY A;  3C64 A;  5FY0 A;  3UT5 E;  2Y6X A;  3ZPO A;  4H9R C;  2N1G A;  3JC6 C;  2PG8 A;  5LHG B;  4HEA A;  2E9X A;  3C50 A;  4ILU A;  3OYX A;  4EXT A;  3PU8 A;  2L3L A;  2Q9Q D;  1NAF A;  2JPF A;  2NTY A;  2Q9Q B;  4HTE A;  1MMG A;  5H6Q B;  3ZN1 B;  3N9L A;  3UUL A;  2K5B B;  2Q9Q A;  2X9H A;  2D0U A;  2X9X A;  3AAA B;  2W0G A;  1QUU A;  3TKL B;  3OBV E;  2K24 A;  2KZ7 B;  2C5K T;  3DJB A;  4MAL A;  3AA0 B;  4DMW A;  2XHE B;  2CLY C;  3UUM A;  5JR9 C;  2Y8D A;  1H7C A;  4ZS3 A;  1D1A A;  4ZI7 E;  5ETW A;  4JLE A;  1G73 A;  2N9D A;  5DAB A;  4ZHQ E;  1EZ3 A;  2DWK A;  2LE8 A;  1U5P A;  5IYZ E;  3RPU A;  1HS7 A;  1YKE B;  3CVR A;  3B57 A;  3J7Y q;  5JDQ A;  2WSS V;  3VKH A;  4PJN A;  5L3D B;  4IHJ E;  4MBQ A;  3LK4 2;  2VKO A;  3LK3 B;  4ZI3 C;  4X1K E;  1E1H B;  2XAJ B;  3GA8 A;  2W00 A;  4DND A;  3V5U A;  4UEL A;  3CX8 B;  4PK4 A;  4JUY A;  4CZZ B;  4IE7 A;  5JRE A;  3ZJ2 A;  5L3C B;  3UUX B;  2W62 A;  2WWU A;  4PJJ A;  1BR1 A;  2C0S A;  2VKH A;  3ZJ1 A;  1WYC A;  1YKH B;  2XUE A;  4X1I E;  4ZOL E;  3RKO A;  4UF0 B;  3ETU A;  2VAS A;  2VB6 A;  4UF0 A;  4PNI A;  4O4H E;  5JQG E;  4WBO A;  5HXR A;  1MMA A;  4O4L E;  4QWN B;  5FNV E;  3C51 A;  3ZC0 A;  5LNK A;  1FMV A;  3L3P A;  4TUY E;  1FIO A;  4TZ4 C;  2V7K A;  4IE0 A;  4AKL A;  3NZP A;  4P09 A;  5IHY A;  3N9M A;  3CML A;  3OYZ A;  3F57 A;  5JDN A;  4OYK A;  3I0O A;  3WAJ A;  1B7T A;  4IE5 A;  5LG4 A;  3AA1 B;  4AQF A;  4K0U A;  1LVK A;  4GK5 E;  5FXX A;  5KMG P;  2XAH B;  4I50 E;  4QX7 B;  3KIN B;  4OFZ A;  1OXZ A;  5EK4 A;  5LCY A;  3B13 A;  3LBX A;  3I9W A;  2CEA A;  4BJM A;  3F31 A;  2C5I T;  3AAE B;  3KDS E;  3HKE E;  3VKG A;  4H9P C;  3S4U A;  2LT3 A;  4ADZ A;  4L9I A;  4BA9 A;  4HGA A;  2JRK A;  4I43 B;  2W61 A;  2H7O A;  2YU2 A;  3ZYL A;  4EYY R;  1BR0 A;  2D2S A;  2VK9 A;  4EIW A;  4FJO A;  2V1D B;  4Z8X A;  1IJ5 A;  5JRC B;  5AFU L;  1HCI A;  1MIY A;  3W15 B;  3CX7 B;  3ZMZ B;  4UV8 B;  4IST A;  1HFA A;  3FBL A;  3ZC1 A;  1MMN A;  4IE4 A;  4MLK A;  3PU3 A;  3PE0 A;  4JEH B;  2LSY A;  1U4Q A;  4PFP A;  3ZMU B;  3ZEF B;  3CX6 B;  1YW0 A;  3IEE A;  5DQV A;  3IF8 B;  4XAX B;  2CXL A;  4O4I E;  4O2A E;  4TX5 A;  3ZN0 B;  5FXW A;  2WBL A;  1D1B A;  3C4W A;  3N5L A;  3NZQ A;  2X9Y A;  4ISS A;  2XAG B;  2JMH A;  2IAK A;  1OWA A;  1WR6 A;  2D5U A;  2CE7 A;  3FXE B;  2SPC A;  2OA5 A;  3I9Y A;  4TN7 B;  4WNK A;  3CPZ A;  4PW8 A;  4ZI2 D;  2YK0 A;  2PFV A;  3QC9 A;  4AKR B;  3HKC E;  5ADX L;  2WM9 A;  3HI2 A;  3SWH A;  4B6X A;  4EAH A;  1G8X A;  2CCQ A;  2E9X D;  3SS1 A;  2H7V C;  2DI4 A;  3MJX A;  2E9X B;  2M67 A;  4XZC A;  1D0Z A;  5J1G A;  1MIW A;  3ZCI A;  3ZYM A;  2EHO C;  4MHC A;  4H63 H;  2KND A;  2LJL A;  1CUN A;  2LOP A;  1HTJ F;  3RC3 A;  2ZMA A;  3ANW B;  3ZMS B;  2NOX A;  4UIG A;  3ANW A;  3RYC E;  2B1E A;  2KWH A;  2VKJ A;  4PFO A;  2MTQ A;  4H9O C;  3MXZ A;  3KV6 A;  3CQC B;  3N2O A;  3DTO A;  1O3X A;  2ZLY A;  4DMV A;  3Q5W A;  4JEU B;  3SRZ A;  4AKG A;  2Z6E A;  4H63 V;  5FY7 A;  2YEV C;  3HKD E;  1US7 B;  3H37 A;  3LFM A;  2Y48 B;  2K48 A;  3RYF E;  5L2L A;  3U78 A;  2I59 A;  5LP6 E;  2X67 A;  2K9A A;  4IGU A;  3R84 B;  4AI6 A;  3V5S A;  3Q5X A;  4L0R A;  5LGU B;  2VL8 A;  5FY1 A;  5J2U E;  4AXP A;  3PTR B;  3QUJ A;  2YU1 A;  4ERR A;  3K3O A;  4CXY A;  1LVF A;  1IAP A;  3A5X A;  3N9N A;  3BQI A;  4C91 A;  4YJ2 E;  4G2A A;  5LJN A;  1D1C A;  3N9P A;  4N78 D;  2ACX A;  4UVC B;  5TAO A;  3RYH E;  4IIJ E;  3UFE A;  4AQF C;  1KK7 A;  5LA6 E;  5EK3 A;  3ZMV B;  5LXT E;  3CQG B;  3KFW X;  3RYI E;  2RA1 A;  3C4X A;  5LYJ E;  3Q9D A;  1HF8 A;  5HWX A;  4OK0 A;  5FP3 A;  4AKH A;  3RH3 A;  2J1D G;  2LSI A;  2GK9 A;  3O9X A;  3QK6 A;  1T98 A;  3U3I A;  5FYM A;  3K3Q C;  4ASK A;  2DWG A;  1Y64 B;  4A56 A;  4GIW A;  1AJ3 A;  4UVB B;  2MOZ A;  5FMN A;  2LSJ A;  2NP9 A;  3ZMT B;  2ODU A;  2ZM0 A;  4UEM A;  3D0T A;  5JR9 A;  1ZV4 X;  4KBM B;  2LSG A;  2G0U A;  4GYS A;  2CXD A;  5EZY E;  3ESL A;  4L5G A;  1BR2 A;  3FB2 A;  2KLQ A;  3RC8 A;  4QKN A;  3LBX B;  3PUA A;  2WMO A;  1VRB A;  3RRC A;  4BAY B;  4EOZ B;  2ZM8 A;  2ZM2 A;  4GYR A;  2NW9 A;  4CXX A;  5EK2 A;  3R6N A;  4EB6 E;  3O4X E;  5LHI B;  2QA7 A;  4H9S E;  3CQX C;  1D0Y A;  3KBT A;  2JQQ A;  4E7Z A;  3GN5 B;  2XAS B;  4O2B E;  2H3R A;  2KWI B;  3BQK A;  3CKD A;  5KDM C;  2L9Q A;  3GN5 A;  3VHL A;  3KV9 A;  5L3F B;  4ZI2 C;  4OHF A;  1VOM A;  5F8P A;  2ES0 A;  5L3E B;  3AA6 B;  4KP3 C;  2E9X C;  1WRD A;  2BVM A;  4C90 A;  3ONX A;  4DBQ A;  4KMC A;  5CA1 E;  2X51 A;  4QHO A;  4EZH A;  2BDE A;  3N2G E;  2WAU A;  1SHZ C;  1MND A;  4P0A A;  4NUU A;  2CA5 A;  2DHR A;  3GWH A;  3M65 A;  4QXH B;  2NTX A;  2Q9Q C;  5HXS A;  3IHR A;  3PUR A;  5L3G B;  2LHR A;  1BR4 A;  5E0O A;  4ZS2 A;  1IJ6 A;  2CWY A;  1NWM X;  3KV4 A;  3KV5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...