4HGAA

Structure of the variant histone h3.3-h4 heterodimer in complex with its chaperone daxx
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
207
structure length
207
Chain Sequence
QDPSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDPALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the variant histone H3.3-H4 heterodimer in complex with its chaperone DAXX.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone/apoptosis
molecule keywords Death domain-associated protein 6
total genus 69
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2012-10-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2170 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4hgaA00
4H9NC 4H9SE 4HGAA 5KDMC 4H9RC 4H9PC 4H9OC 4H9QC
chains in the Genus database with same CATH superfamily
4B6XA 3GWHA 1YW0A 1D0XA 1IBKT 4LF5T 2VB6A 3EI0A 3AXJB 1LKXA 4DR5T 2YDQA 4QWNB 4IE4A 4TV9E 4NUUA 4DV1T 2CXLA 2NW8A 4ZZBA 5AQPB 2PBIA 5LHGB 2X9HA 5JR9A 4DV4T 3BK9A 3OVUA 2CXFA 2R6GF 3OJAA 3ZT6A 2BS4A 2JMHA 2JPFA 2WWUA 2ZMAA 3A5XA 2FBWA 2XQ3A 3HKDE 3PU3A 3PUYF 4IIJE 4EXTA 5L4HA 2RP4A 4KX6A 5C8YE 4EEDA 3IEEA 3MA9A 4UXNB 3ZPOA 4C91A 2WWVA 4N78D 2P9BA 2UXXB 3FHNA 3OTOT 5HCJA 5AQOB 5LG4A 1WYCA 2BS3A 2N9DA 2K5BB 3ABVA 3Q9DA 1HG2A 2XSAA 4HFDA 4O2BE 4TWFA 4AISA 4COFA 4YFSA 4I50E 5JDFA 1ZP0A 1VRBA 4L5GA 4AKHA 2W66A 4YHHT 1ZEEA 2X68A 2D2SA 2YK0A 3Q5WA 2PTFA 4I43B 2NW9A 3Q5EA 4JI5T 1KK7A 5JDMA 4MHCA 3WAJA 3AA7B 3F31A 3NKZA 4DVDA 3JC6D 1YD8G 4AQGA 3AAIA 4DMWA 4ZEYA 4GK5E 3ZJ1A 4YTNA 3BQKA 3C51A 2EHOC 4GYRA 3J9X1 3RGLA 1IBMT 2MAWA 3UU4A 3KINB 3P8CD 4PNIA 4H9SE 4UELA 4X1KE 5BR8T 1E7PA 5L47A 4LFAT 3ZCIA 2V7KA 5EK2A 3JAFA 2CWYA 2RPAA 2XASB 3HKEE 4U33A 2WZIA 4Z8XA 4YSXA 1Y64B 4JI0T 2UXBT 2G0UA 2VVNA 5AFUL 3L3PA 3CK6A 4E7ZA 3ZT5A 3LK2B 3QB5A 2FJAA 1W9RA 5HEHA 2V7IA 3H3MA 5LNKA 3FBLA 3RLFF 4HGAA 3AVRA 2LRKA 2DI4A 2DWGA 1SE7A 2XAHB 4HTEA 3IBPA 5DQVA 4BJMA 4CI1B 2IUBA 1D1BA 2JQ9A 1NWMX 2V7MA 1OEDB 2KXPB 5JVDE 3RI5A 4KI0F 3ZMVB 2B76A 2WMOA 4UVBB 4O4IE 1L0VA 1N34T 2UUCT 5LBQB 5LJNA 4DV6T 1KNZA 3UFEA 5LHIB 2ZM8A 2QGSA 4UR9A 4PJJA 4G63A 4UF0B 3JAEA 4UEMA 3ZT7A 2PFVA 3VHLA 2LHNA 3CQCB 3ZMUB 2E9XB 4H9RC 2X9WA 4EGWA 1HNXT 2ACZA 4IL4A 4H63H 3U78A 3AA1B 2WMNA 4NXMT 2E9XC 3N2OA 4ZS3A 2LOSA 4TWHA 1LRZA 1UK5A 2YKSA 2KT9A 2LLYA 4H9PC 1NAFA 4HFBA 2VWAA 1ZHCA 4OYKA 2I0MA 4YJ3E 2J4GA 3M65A 3K3NA 4HFHA 4WYVA 2M6IA 4E7SA 5L3BB 5LXTE 1MMNA 2CXDA 3EAMA 5AQHB 5FXVA 2HH7A 4U3CA 5F5WA 3RIFA 2H3RA 5ABEA 3TLWA 4YTPA 3AEGA 5HXHA 4DR2T 1IBLT 3W15B 4XZCA 4BA9A 4JYAT 2MPKA 3FXEB 1MMGA 2ES0A 1UX5A 3T1YT 1HNWT 2W61A 1W0BA 4QX7B 2JJ9A 2BBHA 2KSRA 1SHZC 2YINA 1VCSA 4HWDA 3LBXA 4UVCB 1YXRA 4QXHB 2BVMA 2KWIB 5AQGB 5LA6E 4ILBA 2PG8A 4X65T 4CI3B 4XAXB 2OV9A 1YQ4A 1JNRA 4EYYR 3UQ7A 3ZYKA 1KEYA 4WNKA 3IHRA 1WRDA 3AA0B 3AE6A 3RIUA 4AI6A 4X62T 4DO0A 3ETUA 4LFCT 2BS2A 4IDOA 3RRCA 3D0TA 4JLEA 4UIGA 4YSYA 4DBQA 3ZJ2A 5FL1A 1N33T 2WDVA 3FZLB 3N9LA 5LJMA 4JI1T 4H9OC 3KV4A 1S94A 3SFEA 3VKGA 3AXJA 4ISSA 5AQIB 2M67A 4L9IA 2BKOA 2NTXA 1J1JA 1HCIA 1O3XA 2Q9QD 2LM2A 2YU1A 2ZM2A 3O1JA 3O4XE 4PW8A 4TUYE 1WCRA 2NWBA 3SWHA 3NRXA 3TLVA 3UU6A 4AKIA 1HFAA 1X79A 2V26A 2CLYC 4IGUA 3HL6A 2LRLA 4O2AE 4EV6A 4HWHA 3N9OA 4ZI3D 2QYWA 2XQ4A 4H9QC 3RPUA 2XJ7A 3L09A 1KNPA 3DTOA 1H7CA 2LOPA 4HFEA 2BG9C 4K0UA 5HEJA 2NOXA 2AXDS 4PK4A 4EB6E 3CIRA 3ANWB 4YJ2E 4TV8E 3PU8A 4HFCA 4HN9A 2BDEA 1LVFA 3OYZA 5L4EA 4KHPT 2VASA 1ZOYA 2NR4A 3AE9A 4FI5A 5KX5E 2HN1A 2W63A 4EYUA 4K0KT 4UV9B 1BR1A 3RKGA 2N2NA 5FYMA 1G73A 5ADXL 4YHJA 2L9QA 5LGTB 1XDPA 3AE5A 2VURA 3PURA 2IIUA 4PJLA 5HXSA 4IDZA 3RX6A 4JBWF 4NXNT 3RC8A 3FBZA 4DV0T 2HPJA 2XAQB 2IHR1 4QKNA 2XQ7A 3MACA 2V5CA 3PUWF 3UU3A 2DL1A 4U31A 5KDMC 2Y48B 5L3DB 2V6YA 4GIWA 3ANWA 3PUZF 2E8IA 4GKKT 2A9UA 4JI3T 4JV5T 2C5KT 5E0OA 2FJBA 4DNDA 1T72A 5AQTB 4PFOA 3X1DA 4EEBA 5JDQA 2WY2A 4TN7B 1G8XA 1U5PA 3AAEB 1KFYA 5EK4A 2BBJA 1T8BA 3AE3A 3P4RA 2XTLA 5H6QB 5AQMB 3F57A 2BG9B 3KFWX 2FJEA 4HEAA 5FVLA 5CFBA 1BR0A 1OWAA 2ODUA 2WZHA 4GK0E 2XHEB 5ETWA 5FXZA 2DCFA 3SS1A 4A5XA 4AIUA 3UUNA 5L3FB 4B3TT 2LJLA 2D9DA 1HX1B 3L8RA 5IUXA 3ZSTA 2OA5A 4P0AA 5LG3A 4DBRA 4Z90A 4EZ4A 4X66T 4DV2T 3QUJA 3LJCA 4Q25A 3RQWA 4V1Av 1WYBA 5EK3A 5AQFB 1HF8A 4IE7A 2CM0A 4O4JE 2E5VA 3IA3A 5LB7B 3BQLA 3AE4A 5CJ5A 3KDSE 5LGUB 1UGOA 4YTMA 2EHOA 4WW0A 2DHRA 2HN2A 2E9XD 5ABHA 5AQSB 5FVKA 5FMNA 1IAPA 4HWIB 1HR0T 3RKOA 4OFZA 4H9NC 1UX4A 5F8PA 2CHNA 5JDLA 3ONXA 5AQQB 3KVAA 5ABGA 4AKGA 3CX6B 4QH1A 4CQIA 4HFVA 2V7LA 3AEBA 1KF6A 2B1EA 3PJAA 4O4LE 4MBQA 5A1LA 3LK3B 5ABFA 2A2FX 3AAAB 4EIWA 4JI4T 2JQQA 4KMCA 2VKJA 4BAYB 1EZ3A 1SA0E 1T7SA 4GOUA 4ISTA 4P1NA 5LOVE 2XQAA 1ZKEA 1NENA 5FXXA 3ZN0B 2HHHT 4KHZF 3RYIE 5HXEA 4PJNA 3LDQB 4FJOA 4B3ST 5KXJA 4DUZT 3A8YC 4I4TE 2EHOB 4AQFA 2WDRA 3N5LA 3NRYA 4UVAB 2MTQA 4ZI3C 1MMDA 4DR3T 3FXDB 1UUSA 4L0RA 2XAFB 3AB3B 4IDQA 4LMLA 3LSVA 1I6ZA 1W09A 1BR4A 3TLSA 3GMIA 2X66A 4IREA 2K3WA 5J0ZA 5C2TA 5AQRB 2Q9QC 4JEUB 1XMQT 1B7TA 1VOMA 3JADA 4NPPA 2WDQA 2X0YA 2E2AA 3N9NA 4TNVA 3UUBA 2ACXA 5J2UE 2QVAA 2MYSA 1UURA 2KLQA 3AE8A 3EDUA 3PV0F 4PK6A 3UQ4A 1U4QA 3RYHE 5KMGP 3NVOA 5M4YA 4DUYT 2E9XA 2CPTA 4I55E 5FY0A 3VRAA 2JIWA 4MLKA 5FL0A 4A56A 5LCYA 3PTRB 4ANJA 3P4PA 2VQFT 2LM9A 3HKCE 5C3JA 2BKNA 5JRCA 4XBFB 2IAKA 2YEVC 4DV3T 2XAJB 2IDOB 3MZKB 4O8SA 3O1IA 3OYXA 1CUNA 2YDSA 2VVSA 2XQ9A 4ILAA 5JDGA 3C4ZA 3SRZA 5LYJE 1FJGT 3VKHA 4CN4A 1J5ET 4B3RT 4GYSA 1M62A 4DR7T 2CLYB 1QSDA 2XUEA 3I1AA 2K48A 4JI7T 1MIVA 2BZBA 2MOZA 4ILUA 5AQJB 4ILCA 4EZHA 4WBNE 2J62A 5IWAT 2W00A 2CWOA 3HA4A 3ZKRA 1MMAA 4TX5A 5AQLB 2ODVA 1XDOA 2W4XA 4ZI2D 2CRBA 3R6NA 4LFBT 1VCTA 2AE9A 4NIQA 2WP9A 3PUGA 1ZV4X 4QH4A 5IYZE 4PJMA 3PUSA 2VKOA 3ZYLA 3HR0A 3RYCE 4PFPA 4CI2B 3FZKB 2YDRA 4CN1A 4ASKA 4ZI7E 4F6RC 3P7IA 2UUBT 2X0HA 3E0ZA 1QLBA 2L3LA 3AEAA 1D1AA 2JQHA 4X1YE 3ZN1B 2W67A 3G06A 5LGNB 4DV5T 3LK42 5TAOA 4IE6A 4IE0A 1XNQT 3EHZA 5HWYA 1Y01A 2XM2A 3FZFB 3UU5A 5AQUB 1IJ6A 2YN6A 4TNWA 3T1HT 1N32T 2CA5A 4AXPA 4LF6T 4M1PA 4WBOA 5HXCA 1HNZT 4JI2T 2WU5A 1HX8A 2NP9A 2H7VC 3CX8B 1GQEA 2C5JA 3KBUA 3TLUA 2Y8DA 2YOEA 5CA0E 3B13A 3UT5E 3V5SA 1N36T 2XAGB 2LT3A 3ZSSA 1MIYA 4QH5A 4LF9T 2UXDT 4DR4T 4AQFC 1OEDA 3N2KE 4MFRA 3ZLIA 2V6YB 1W0AA 3SOLA 4LF4T 1HG5A 4PK5A 3EUHA 2H89A 2VQET 5AQVB 1R8IA 3FZMB 1WFDA 3LG7A 2V7JA 3GN5A 5LMUT 2XQ8A 5GONE 2IMLA 5JDHA 3ZEFB 2JRKA 2A72A 2WU2A 3RC3A 2XZEA 4IT4A 3S4UA 3SFDA 4IL9A 3JC6C 4HFIA 4U72A 5LHHB 3P4WA 2WQYA 1XWMA 5HCMA 2LE8A 4WZXA 2I59A 2CE7A 4IDNA 1FMVA 2K24A 3DJBA 5H6RB 4ZHQE 3JCFA 5CGMA 2V6XA 4X5TA 3AE2A 5BMVE 4JI6T 5DABA 3AVSA 4X64T 3LFMA 3AE1A 2EHOD 1MIWA 5HAXA 2XQ6A 2XSBA 2X0LB 4ZOLE 3UFGA 4HWFA 3LBXB 5L3CB 1OXZA 4P0BA 2Q9QB 2BG9E 3GN5B 4PAGA 5LMNT 4B3MT 2X51A 3MK7C 2VK9A 2LKGA 3B57A 3P50A 1XMOT 3ETVA 2W62A 4CZZB 1SUMB 2V1DB 2UXNB 3ZMZB 4ERRA 5JR9B 2CMRA 2YU2A 2C0SA 2ZM6T 1FIOA 3CMLA 3E22E 2XQ5A 3BQIA 3VU7H 5JQGE 3PDYA 4U74A 2DLRA 4NUVA 2CEAA 3KV6A 3U3IA 2XQYA 3PJAJ 3EDVA 3O9XA 4F8HA 3MKDA 3AA6B 5LP6E 5FKYA 2J47A 3UUMA 3Q5DA 1YKHB 4ZI2C 3UUXB 1I94T 2KZ7B 2ZM0A 1D0YA 1CHUA 3WAKA 3KBTA 4ADZA 4QXBB 1Z0PA 2I6HA 2J1DG 4U2YA 3PUQA 4P09A 5AQKB 2LSGA 2Q9QA 1MNDA 2DWKA 3C4XA 3I9YA 3QOFA 5CB4E 3I0QA 1Z8UA 2BVLA 4HWCA 2OLTA 3T8OA 1IJ5A 2ZLYA 3K8PC 2PJQA 2LSJA 3AECA 3OBVE 2Y6XA 4X20E 5FP3A 5JTGA 2UU9T 5L3EB 2XM1A 3N9PA 3ZC0A 4JUYA 3FZHB 3CKDA 3C4WA 3CVRA 3PE0A 2XY8B 4CXXA 1WR0A 3EVYA 1YKEB 4G2AA 4UF0A 5JH7E 1YQ3A 1FEWA 4DV7T 4ZS2A 2D0TA 2QA7A 3Q5XA 4U7YA 4LF7T 1AJ3A 3MJXA 4YY3T 4GKJT 4QHOA 5ABFB 2L8KA 3K1SA 1XNRT 2CHOA 3CQGB 3UTKA 2GK9A 4IDPA 4AKLA 4ZXLA 2X9YA 5L3GB 1E2AA 1HTJF 2E5LT 3WI3A 2VL8A 3KVBA 2W2UA 2KNDA 3NZPA 2C5IT 3CX7B 1BR2A 2WM9A 3ESLA 2MBGA 3N9MA 3O1HA 3KV9A 3RQUA 1WR6A 2IC9A 5EZYE 5JREA 5HEUA 3C64A 2X9XA 3Q2MA 3CPZA 4CXWA 5F3JA 2IC6A 2LSIA 2DNXA 1S35A 3F2EA 3N9QA 3OPCA 3AE7A 3K3OA 4KP3C 4LMJA 4OHFA 2UXCT 3QC9A 4QXCB 2UUAT 4JI8T 4IHJE 5DJQC 4EOZB 3TKLB 1OEDE 5HEOA 5LBMA 3FB2A 3P4SA 2VKDA 3OKQA 3UULA 2SPCA 3ZMSB 5HYAA 2F4VT 2K9AA 3L39A 2CCQA 4TWDA 2WBLA 4OK0A 5HEGA 3P4QA 2JQKA 3QK6A 5HWXA 4DR1T 2HPLA 5L2LA 3ZMTB 1MNEA 1T98A 5J1GA 3H3AA 1NEKA 3ZCJA 4HE8A 3RH3A 3N2GE 2WSSV 4KBMB 3RHWA 2WS3A 3ONLC 2BG9A 3M3ZB 3RIUC 3UU8A 3VR8A 3VR9A 1JNZA 3NZQA 3ZC1A 4DMVA 5FY1A 4UV8B 5CA1E 3B5MA 2KWHA 2LSKA 5FY7A 2BKPA 3QB5K 4YXDA 2NW7A 3KV5A 3GA8A 1D1CA 2A3DA 2H7OA 4QX8B 1KNRA 3VRBA 4OYJA 4YT0A 1FMWA 2FJDA 2LHRA 2N1GA 2NTYA 2KINB 2WB5A 2LEHA 4HKAA 3RYFE 4MALA 4CXYA 3RIAA 5DQWA 3QNUA 1OEDC 5FXWA 2IW5B 3V5UA 1X9BA 2KMFA 2D0UA 2RA1A 2XPKA 3NBXX 2WAUA 1D0ZA 4Z91A 3R84B 1IZNB 4LMKA 2V8SV 1M7KA 1WLXA 3AEFA 3CWZB 3PUXF 3RF1A 3PUAA 2VKHA 5FNVE 3TLTA 3K3QC 4U7IA 4U2ZA 4ZZCA 2X67A 4TZ4C 4YLHA 1DU2A 3HKBE 1J5WA 4AKRB 1UCUA 4AQYT 4A98A 2FUPA 5J2TE 2W0GA 3J7Yq 4X1IE 1HS7A 3ONJA 4JEHB 2CBIA 3C50A 1XZYA 1E1HB 5JDNA 2VL0A 4O4HE 4J2CA 4BJNA 3CQXC 3E08A 1QUUA 4A97A 3AEDA 5HXRA 3A7MA 3C98B 3PUVF 3AEEA 3EABA 3IF8B 1US7B 4DIDB 2WCAA 5JR9C 5JRCB 4H63V 3I0OA 2D5UA 4IE5A 2CBJA 2QRXA 4KUMB 2JMKA 2M6BA 3MXZA 3NWIA 4LF8T 4OX9T 4DR6T 1LVKA 2H88A 4CN6A 4EAHA 2Z6EA 4I0UA 5AQNB 3ZYMA 3RRWA 5IHYA 3I9WA 4C90A 3DP7A 4YSZA 2LSYA 3HI2A 3H37A 1V9DA 2V5DA 2LKHA
chains in the Genus database with same CATH topology
4B6XA 3GWHA 1YW0A 1D0XA 2VB6A 1LKXA 4QWNB 4IE4A 4TV9E 4NUUA 2CXLA 2NW8A 5LHGB 2PBIA 2X9HA 5JR9A 3BK9A 2CXFA 3OJAA 3A5XA 2JMHA 2JPFA 2WWUA 2ZMAA 3HKDE 4IIJE 1KNZA 4EXTA 3PU3A 5C8YE 2RP4A 3IEEA 3MA9A 4UXNB 3ZPOA 4C91A 4N78D 2P9BA 2UXXB 3FHNA 5LG4A 1WYCA 2N9DA 3Q9DA 2K5BB 4O2BE 1HG2A 4YFSA 4I50E 5JDFA 1VRBA 4L5GA 4AKHA 1ZEEA 2X68A 2D2SA 2YK0A 3Q5WA 4I43B 2NW9A 1KK7A 5JDMA 4MHCA 3WAJA 3AA7B 3F31A 4DVDA 4DMWA 3JC6D 1YD8G 4AQGA 3AAIA 4GK5E 3BQKA 3C51A 2EHOC 4GYRA 3J9X1 3KINB 3P8CD 4PNIA 4H9SE 4UELA 4X1KE 3ZCIA 2V7KA 5EK2A 2CWYA 2XASB 3HKEE 4Z8XA 1Y64B 2G0UA 5AFUL 3L3PA 4E7ZA 3LK2B 2V7IA 5LNKA 3FBLA 4HGAA 3AVRA 2DI4A 2DWGA 2XAHB 4HTEA 5DQVA 3IBPA 4CI1B 4BJMA 1D1BA 1NWMX 2V7MA 5JVDE 2KXPB 3ZMVB 4UVBB 2WMOA 4O4IE 5LBQB 5LJNA 3UFEA 5LHIB 2ZM8A 2QGSA 4PJJA 4G63A 4UF0B 4UEMA 2PFVA 3VHLA 2LHNA 3CQCB 3ZMUB 2E9XB 4H9RC 2X9WA 3U78A 4H63H 3AA1B 2WMNA 2E9XC 3N2OA 4ZS3A 2LOSA 1LRZA 4H9PC 2KT9A 4OYKA 1NAFA 4YJ3E 2VWAA 1ZHCA 3M65A 3K3NA 5LXTE 4E7SA 5L3BB 1MMNA 2CXDA 5FXVA 2HH7A 2H3RA 5HXHA 3W15B 4XZCA 4BA9A 3FXEB 1MMGA 2ES0A 1UX5A 2W61A 4QX7B 2JJ9A 2YINA 4UVCB 1SHZC 3LBXA 4QXHB 2BVMA 2KWIB 5LA6E 2PG8A 4CI3B 4XAXB 4EYYR 3ZYKA 4WNKA 3IHRA 1WRDA 3AA0B 4AI6A 4DO0A 3ETUA 3RRCA 3D0TA 4JLEA 4UIGA 4DBQA 3ZJ2A 3N9LA 5LJMA 4H9OC 3KV4A 1S94A 3VKGA 4ISSA 2M67A 4L9IA 2NTXA 1HCIA 2Q9QD 1O3XA 2YU1A 3O4XE 3O1JA 2ZM2A 4PW8A 4EIWA 4TUYE 3SWHA 2NWBA 5L3FB 3NRXA 4AKIA 1HFAA 1X79A 2V26A 2CLYC 4IGUA 3HL6A 4O2AE 1V9DA 3N9OA 4ZI3D 4H9QC 3RPUA 3L09A 3DTOA 1H7CA 2LOPA 4K0UA 2NOXA 4PK4A 4EB6E 3ANWB 4YJ2E 4TV8E 3PU8A 4HN9A 2BDEA 1LVFA 3OYZA 2VASA 4FI5A 5KX5E 2W63A 4EYUA 4UV9B 1BR1A 2N2NA 5FYMA 1G73A 5ADXL 4YHJA 2L9QA 5LGTB 3PURA 4PJLA 5HXSA 4IDZA 3RX6A 3RC8A 3FBZA 2HPJA 2XAQB 4QKNA 5KDMC 3MACA 5L3DB 2Y48B 4GIWA 3ANWA 2E8IA 2C5KT 5E0OA 4DNDA 5JDQA 4PFOA 4TN7B 1G8XA 1U5PA 3AAEB 5EK4A 5H6QB 2XTLA 3F57A 3KFWX 4HEAA 1BR0A 1OWAA 2ODUA 4GK0E 5FXZA 2XHEB 5ETWA 3SS1A 2DCFA 3UUNA 2LJLA 2OA5A 4P0AA 4DBRA 4EZ4A 3QUJA 3LJCA 4V1Av 1WYBA 5EK3A 1HF8A 4IE7A 2CM0A 4O4JE 3BQLA 3KDSE 5LGUB 2EHOA 4WW0A 2DHRA 2E9XD 5FMNA 1IAPA 3RKOA 4OFZA 4H9NC 1UX4A 5F8PA 5JDLA 3ONXA 3KVAA 4AKGA 3CX6B 4CQIA 4HFVA 2V7LA 2B1EA 4O4LE 4MBQA 5A1LA 3LK3B 2A2FX 3AAAB 2JQQA 4KMCA 2VKJA 4BAYB 1EZ3A 1SA0E 4GOUA 4ISTA 5LOVE 1ZKEA 5FXXA 3ZN0B 3RYIE 5HXEA 4PJNA 4FJOA 4I4TE 2EHOB 4AQFA 3N5LA 3NRYA 4UVAB 2MTQA 4ZI3C 1MMDA 3FXDB 4L0RA 2XAFB 3AB3B 1BR4A 3GMIA 2X66A 2Q9QC 4JEUB 1B7TA 1VOMA 3N9NA 2ACXA 5J2UE 2MYSA 2KLQA 3EDUA 5KMGP 4PK6A 1U4QA 3RYHE 5M4YA 2E9XA 4I55E 5FY0A 4MLKA 4A56A 5LCYA 3PTRB 4ANJA 2LM9A 3HKCE 5JRCA 4XBFB 2IAKA 2YEVC 2XAJB 3MZKB 4O8SA 3O1IA 3OYXA 1CUNA 5LYJE 5JDGA 3C4ZA 3SRZA 3VKHA 4GYSA 2CLYB 1QSDA 2XUEA 3I1AA 2K48A 1MIVA 2BZBA 2MOZA 4ILUA 4EZHA 4WBNE 2W00A 2CWOA 3HA4A 1MMAA 4TX5A 2ODVA 4ZI2D 3R6NA 3PUGA 1ZV4X 5IYZE 4PJMA 3PUSA 2VKOA 3ZYLA 3HR0A 3RYCE 4PFPA 4CI2B 4ASKA 4ZI7E 4F6RC 3P7IA 3E0ZA 2L3LA 1D1AA 4X1YE 3ZN1B 5LGNB 3LK42 5TAOA 4IE6A 4IE0A 5HWYA 1IJ6A 2CA5A 4AXPA 4M1PA 4WBOA 5HXCA 1HX8A 2NP9A 2H7VC 3CX8B 5CA0E 2C5JA 3KBUA 2Y8DA 3B13A 3UT5E 2XAGB 2LT3A 1MIYA 4AQFC 3N2KE 4MFRA 3ZLIA 3SOLA 1HG5A 4PK5A 3EUHA 3LG7A 2V7JA 3GN5A 5GONE 5JDHA 3ZEFB 2JRKA 2A72A 3RC3A 3S4UA 3JC6C 4U72A 5LHHB 2LE8A 2I59A 2CE7A 1FMVA 2K24A 3DJBA 5H6RB 4ZHQE 5BMVE 5DABA 3AVSA 3LFMA 5HAXA 2EHOD 1MIWA 2X0LB 4ZOLE 5L3CB 3LBXB 1OXZA 4P0BA 2Q9QB 3GN5B 4PAGA 2X51A 3MK7C 2VK9A 3B57A 3ETVA 2W62A 4CZZB 2V1DB 2UXNB 3ZMZB 4ERRA 5JR9B 2CMRA 2YU2A 2C0SA 1FIOA 3CMLA 3E22E 3BQIA 3VU7H 5JQGE 3PDYA 4U74A 2DLRA 4NUVA 2CEAA 3KV6A 3U3IA 2XQYA 3EDVA 3O9XA 3MKDA 3AA6B 5LP6E 3UUMA 4ZI2C 1YKHB 3UUXB 2KZ7B 2ZM0A 1D0YA 4ADZA 3WAKA 3KBTA 4QXBB 1Z0PA 3V5UA 2J1DG 3PUQA 4P09A 5CB4E 2LSGA 2Q9QA 1MNDA 2DWKA 3C4XA 3I9YA 3ZJ1A 3I0QA 2BVLA 3T8OA 1IJ5A 2ZLYA 3K8PC 2PJQA 2LSJA 3OBVE 4X20E 2Y6XA 5FP3A 3ZC0A 5L3EB 3N9PA 4JUYA 3CKDA 3C4WA 3CVRA 3PE0A 4CXXA 3EVYA 1YKEB 4G2AA 4UF0A 5JH7E 1FEWA 4ZS2A 2D0TA 2QA7A 3Q5XA 1AJ3A 3MJXA 4QHOA 2L8KA 3CQGB 3UTKA 2GK9A 4AKLA 2X9YA 5L3GB 1HTJF 3WI3A 2VL8A 3KVBA 2KNDA 3NZPA 2C5IT 3CX7B 1BR2A 2WM9A 3ESLA 2MBGA 3N9MA 3O1HA 3KV9A 5JREA 1WR6A 2IC9A 5EZYE 3C64A 3Q2MA 3CPZA 4CXWA 5F3JA 2IC6A 2LSIA 2DNXA 1S35A 3F2EA 3N9QA 4KP3C 4OHFA 3K3OA 3QC9A 4QXCB 4IHJE 5DJQC 4EOZB 3TKLB 5LBMA 3FB2A 2VKDA 3OKQA 3UULA 2SPCA 3ZMSB 5HYAA 2K9AA 2CCQA 2WBLA 4OK0A 3QK6A 5HWXA 2HPLA 5L2LA 3ZMTB 1MNEA 1T98A 5J1GA 3H3AA 3ZCJA 4HE8A 3RH3A 3N2GE 2WSSV 4KBMB 3NZQA 3ZC1A 4DMVA 5FY1A 4UV8B 5CA1E 2KWHA 2LSKA 5FY7A 2NW7A 3KV5A 3GA8A 1D1CA 2A3DA 2H7OA 4QX8B 4OYJA 1FMWA 3RYFE 2LHRA 2N1GA 2NTYA 2KINB 3V5SA 2LEHA 4HKAA 4CXYA 4MALA 5DQWA 5FXWA 2IW5B 2KMFA 2D0UA 2RA1A 3NBXX 2WAUA 1D0ZA 3R84B 1IZNB 3CWZB 1WLXA 3PUAA 2VKHA 5FNVE 3K3QC 2X67A 4TZ4C 4YLHA 3HKBE 4AKRB 1UCUA 5J2TE 2W0GA 3J7Yq 4X1IE 1HS7A 4JEHB 3C50A 1E1HB 5JDNA 4O4HE 4J2CA 4BJNA 3CQXC 3E08A 1QUUA 5HXRA 3C98B 3IF8B 1US7B 5JR9C 5JRCB 4H63V 3I0OA 2D5UA 4IE5A 4KUMB 2JMKA 3MXZA 1LVKA 4EAHA 2Z6EA 3ZYMA 3RRWA 5IHYA 3I9WA 4C90A 3DP7A 2LSYA 3HI2A 3H37A 2X9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9N C;  4H9S E;  4HGA A;  5KDM C;  4H9R C;  4H9P C;  4H9O C;  4H9Q C; 
#chains in the Genus database with same CATH topology
 4B6X A;  3GWH A;  1YW0 A;  1D0X A;  1IBK T;  4LF5 T;  2VB6 A;  3EI0 A;  3AXJ B;  1LKX A;  4DR5 T;  2YDQ A;  4QWN B;  4IE4 A;  4TV9 E;  4NUU A;  4DV1 T;  2CXL A;  2NW8 A;  4ZZB A;  5AQP B;  2PBI A;  5LHG B;  2X9H A;  5JR9 A;  4DV4 T;  3BK9 A;  3OVU A;  2CXF A;  2R6G F;  3OJA A;  3ZT6 A;  2BS4 A;  2JMH A;  2JPF A;  2WWU A;  2ZMA A;  3A5X A;  2FBW A;  2XQ3 A;  3HKD E;  3PU3 A;  3PUY F;  4IIJ E;  4EXT A;  5L4H A;  2RP4 A;  4KX6 A;  5C8Y E;  4EED A;  3IEE A;  3MA9 A;  4UXN B;  3ZPO A;  4C91 A;  2WWV A;  4N78 D;  2P9B A;  2UXX B;  3FHN A;  3OTO T;  5HCJ A;  5AQO B;  5LG4 A;  1WYC A;  2BS3 A;  2N9D A;  2K5B B;  3ABV A;  3Q9D A;  1HG2 A;  2XSA A;  4HFD A;  4O2B E;  4TWF A;  4AIS A;  4COF A;  4YFS A;  4I50 E;  5JDF A;  1ZP0 A;  1VRB A;  4L5G A;  4AKH A;  2W66 A;  4YHH T;  1ZEE A;  2X68 A;  2D2S A;  2YK0 A;  3Q5W A;  2PTF A;  4I43 B;  2NW9 A;  3Q5E A;  4JI5 T;  1KK7 A;  5JDM A;  4MHC A;  3WAJ A;  3AA7 B;  3F31 A;  3NKZ A;  4DVD A;  3JC6 D;  1YD8 G;  4AQG A;  3AAI A;  4DMW A;  4ZEY A;  4GK5 E;  3ZJ1 A;  4YTN A;  3BQK A;  3C51 A;  2EHO C;  4GYR A;  3J9X 1;  3RGL A;  1IBM T;  2MAW A;  3UU4 A;  3KIN B;  3P8C D;  4PNI A;  4H9S E;  4UEL A;  4X1K E;  5BR8 T;  1E7P A;  5L47 A;  4LFA T;  3ZCI A;  2V7K A;  5EK2 A;  3JAF A;  2CWY A;  2RPA A;  2XAS B;  3HKE E;  4U33 A;  2WZI A;  4Z8X A;  4YSX A;  1Y64 B;  4JI0 T;  2UXB T;  2G0U A;  2VVN A;  5AFU L;  3L3P A;  3CK6 A;  4E7Z A;  3ZT5 A;  3LK2 B;  3QB5 A;  2FJA A;  1W9R A;  5HEH A;  2V7I A;  3H3M A;  5LNK A;  3FBL A;  3RLF F;  4HGA A;  3AVR A;  2LRK A;  2DI4 A;  2DWG A;  1SE7 A;  2XAH B;  4HTE A;  3IBP A;  5DQV A;  4BJM A;  4CI1 B;  2IUB A;  1D1B A;  2JQ9 A;  1NWM X;  2V7M A;  1OED B;  2KXP B;  5JVD E;  3RI5 A;  4KI0 F;  3ZMV B;  2B76 A;  2WMO A;  4UVB B;  4O4I E;  1L0V A;  1N34 T;  2UUC T;  5LBQ B;  5LJN A;  4DV6 T;  1KNZ A;  3UFE A;  5LHI B;  2ZM8 A;  2QGS A;  4UR9 A;  4PJJ A;  4G63 A;  4UF0 B;  3JAE A;  4UEM A;  3ZT7 A;  2PFV A;  3VHL A;  2LHN A;  3CQC B;  3ZMU B;  2E9X B;  4H9R C;  2X9W A;  4EGW A;  1HNX T;  2ACZ A;  4IL4 A;  4H63 H;  3U78 A;  3AA1 B;  2WMN A;  4NXM T;  2E9X C;  3N2O A;  4ZS3 A;  2LOS A;  4TWH A;  1LRZ A;  1UK5 A;  2YKS A;  2KT9 A;  2LLY A;  4H9P C;  1NAF A;  4HFB A;  2VWA A;  1ZHC A;  4OYK A;  2I0M A;  4YJ3 E;  2J4G A;  3M65 A;  3K3N A;  4HFH A;  4WYV A;  2M6I A;  4E7S A;  5L3B B;  5LXT E;  1MMN A;  2CXD A;  3EAM A;  5AQH B;  5FXV A;  2HH7 A;  4U3C A;  5F5W A;  3RIF A;  2H3R A;  5ABE A;  3TLW A;  4YTP A;  3AEG A;  5HXH A;  4DR2 T;  1IBL T;  3W15 B;  4XZC A;  4BA9 A;  4JYA T;  2MPK A;  3FXE B;  1MMG A;  2ES0 A;  1UX5 A;  3T1Y T;  1HNW T;  2W61 A;  1W0B A;  4QX7 B;  2JJ9 A;  2BBH A;  2KSR A;  1SHZ C;  2YIN A;  1VCS A;  4HWD A;  3LBX A;  4UVC B;  1YXR A;  4QXH B;  2BVM A;  2KWI B;  5AQG B;  5LA6 E;  4ILB A;  2PG8 A;  4X65 T;  4CI3 B;  4XAX B;  2OV9 A;  1YQ4 A;  1JNR A;  4EYY R;  3UQ7 A;  3ZYK A;  1KEY A;  4WNK A;  3IHR A;  1WRD A;  3AA0 B;  3AE6 A;  3RIU A;  4AI6 A;  4X62 T;  4DO0 A;  3ETU A;  4LFC T;  2BS2 A;  4IDO A;  3RRC A;  3D0T A;  4JLE A;  4UIG A;  4YSY A;  4DBQ A;  3ZJ2 A;  5FL1 A;  1N33 T;  2WDV A;  3FZL B;  3N9L A;  5LJM A;  4JI1 T;  4H9O C;  3KV4 A;  1S94 A;  3SFE A;  3VKG A;  3AXJ A;  4ISS A;  5AQI B;  2M67 A;  4L9I A;  2BKO A;  2NTX A;  1J1J A;  1HCI A;  1O3X A;  2Q9Q D;  2LM2 A;  2YU1 A;  2ZM2 A;  3O1J A;  3O4X E;  4PW8 A;  4TUY E;  1WCR A;  2NWB A;  3SWH A;  3NRX A;  3TLV A;  3UU6 A;  4AKI A;  1HFA A;  1X79 A;  2V26 A;  2CLY C;  4IGU A;  3HL6 A;  2LRL A;  4O2A E;  4EV6 A;  4HWH A;  3N9O A;  4ZI3 D;  2QYW A;  2XQ4 A;  4H9Q C;  3RPU A;  2XJ7 A;  3L09 A;  1KNP A;  3DTO A;  1H7C A;  2LOP A;  4HFE A;  2BG9 C;  4K0U A;  5HEJ A;  2NOX A;  2AXD S;  4PK4 A;  4EB6 E;  3CIR A;  3ANW B;  4YJ2 E;  4TV8 E;  3PU8 A;  4HFC A;  4HN9 A;  2BDE A;  1LVF A;  3OYZ A;  5L4E A;  4KHP T;  2VAS A;  1ZOY A;  2NR4 A;  3AE9 A;  4FI5 A;  5KX5 E;  2HN1 A;  2W63 A;  4EYU A;  4K0K T;  4UV9 B;  1BR1 A;  3RKG A;  2N2N A;  5FYM A;  1G73 A;  5ADX L;  4YHJ A;  2L9Q A;  5LGT B;  1XDP A;  3AE5 A;  2VUR A;  3PUR A;  2IIU A;  4PJL A;  5HXS A;  4IDZ A;  3RX6 A;  4JBW F;  4NXN T;  3RC8 A;  3FBZ A;  4DV0 T;  2HPJ A;  2XAQ B;  2IHR 1;  4QKN A;  2XQ7 A;  3MAC A;  2V5C A;  3PUW F;  3UU3 A;  2DL1 A;  4U31 A;  5KDM C;  2Y48 B;  5L3D B;  2V6Y A;  4GIW A;  3ANW A;  3PUZ F;  2E8I A;  4GKK T;  2A9U A;  4JI3 T;  4JV5 T;  2C5K T;  5E0O A;  2FJB A;  4DND A;  1T72 A;  5AQT B;  4PFO A;  3X1D A;  4EEB A;  5JDQ A;  2WY2 A;  4TN7 B;  1G8X A;  1U5P A;  3AAE B;  1KFY A;  5EK4 A;  2BBJ A;  1T8B A;  3AE3 A;  3P4R A;  2XTL A;  5H6Q B;  5AQM B;  3F57 A;  2BG9 B;  3KFW X;  2FJE A;  4HEA A;  5FVL A;  5CFB A;  1BR0 A;  1OWA A;  2ODU A;  2WZH A;  4GK0 E;  2XHE B;  5ETW A;  5FXZ A;  2DCF A;  3SS1 A;  4A5X A;  4AIU A;  3UUN A;  5L3F B;  4B3T T;  2LJL A;  2D9D A;  1HX1 B;  3L8R A;  5IUX A;  3ZST A;  2OA5 A;  4P0A A;  5LG3 A;  4DBR A;  4Z90 A;  4EZ4 A;  4X66 T;  4DV2 T;  3QUJ A;  3LJC A;  4Q25 A;  3RQW A;  4V1A v;  1WYB A;  5EK3 A;  5AQF B;  1HF8 A;  4IE7 A;  2CM0 A;  4O4J E;  2E5V A;  3IA3 A;  5LB7 B;  3BQL A;  3AE4 A;  5CJ5 A;  3KDS E;  5LGU B;  1UGO A;  4YTM A;  2EHO A;  4WW0 A;  2DHR A;  2HN2 A;  2E9X D;  5ABH A;  5AQS B;  5FVK A;  5FMN A;  1IAP A;  4HWI B;  1HR0 T;  3RKO A;  4OFZ A;  4H9N C;  1UX4 A;  5F8P A;  2CHN A;  5JDL A;  3ONX A;  5AQQ B;  3KVA A;  5ABG A;  4AKG A;  3CX6 B;  4QH1 A;  4CQI A;  4HFV A;  2V7L A;  3AEB A;  1KF6 A;  2B1E A;  3PJA A;  4O4L E;  4MBQ A;  5A1L A;  3LK3 B;  5ABF A;  2A2F X;  3AAA B;  4EIW A;  4JI4 T;  2JQQ A;  4KMC A;  2VKJ A;  4BAY B;  1EZ3 A;  1SA0 E;  1T7S A;  4GOU A;  4IST A;  4P1N A;  5LOV E;  2XQA A;  1ZKE A;  1NEN A;  5FXX A;  3ZN0 B;  2HHH T;  4KHZ F;  3RYI E;  5HXE A;  4PJN A;  3LDQ B;  4FJO A;  4B3S T;  5KXJ A;  4DUZ T;  3A8Y C;  4I4T E;  2EHO B;  4AQF A;  2WDR A;  3N5L A;  3NRY A;  4UVA B;  2MTQ A;  4ZI3 C;  1MMD A;  4DR3 T;  3FXD B;  1UUS A;  4L0R A;  2XAF B;  3AB3 B;  4IDQ A;  4LML A;  3LSV A;  1I6Z A;  1W09 A;  1BR4 A;  3TLS A;  3GMI A;  2X66 A;  4IRE A;  2K3W A;  5J0Z A;  5C2T A;  5AQR B;  2Q9Q C;  4JEU B;  1XMQ T;  1B7T A;  1VOM A;  3JAD A;  4NPP A;  2WDQ A;  2X0Y A;  2E2A A;  3N9N A;  4TNV A;  3UUB A;  2ACX A;  5J2U E;  2QVA A;  2MYS A;  1UUR A;  2KLQ A;  3AE8 A;  3EDU A;  3PV0 F;  4PK6 A;  3UQ4 A;  1U4Q A;  3RYH E;  5KMG P;  3NVO A;  5M4Y A;  4DUY T;  2E9X A;  2CPT A;  4I55 E;  5FY0 A;  3VRA A;  2JIW A;  4MLK A;  5FL0 A;  4A56 A;  5LCY A;  3PTR B;  4ANJ A;  3P4P A;  2VQF T;  2LM9 A;  3HKC E;  5C3J A;  2BKN A;  5JRC A;  4XBF B;  2IAK A;  2YEV C;  4DV3 T;  2XAJ B;  2IDO B;  3MZK B;  4O8S A;  3O1I A;  3OYX A;  1CUN A;  2YDS A;  2VVS A;  2XQ9 A;  4ILA A;  5JDG A;  3C4Z A;  3SRZ A;  5LYJ E;  1FJG T;  3VKH A;  4CN4 A;  1J5E T;  4B3R T;  4GYS A;  1M62 A;  4DR7 T;  2CLY B;  1QSD A;  2XUE A;  3I1A A;  2K48 A;  4JI7 T;  1MIV A;  2BZB A;  2MOZ A;  4ILU A;  5AQJ B;  4ILC A;  4EZH A;  4WBN E;  2J62 A;  5IWA T;  2W00 A;  2CWO A;  3HA4 A;  3ZKR A;  1MMA A;  4TX5 A;  5AQL B;  2ODV A;  1XDO A;  2W4X A;  4ZI2 D;  2CRB A;  3R6N A;  4LFB T;  1VCT A;  2AE9 A;  4NIQ A;  2WP9 A;  3PUG A;  1ZV4 X;  4QH4 A;  5IYZ E;  4PJM A;  3PUS A;  2VKO A;  3ZYL A;  3HR0 A;  3RYC E;  4PFP A;  4CI2 B;  3FZK B;  2YDR A;  4CN1 A;  4ASK A;  4ZI7 E;  4F6R C;  3P7I A;  2UUB T;  2X0H A;  3E0Z A;  1QLB A;  2L3L A;  3AEA A;  1D1A A;  2JQH A;  4X1Y E;  3ZN1 B;  2W67 A;  3G06 A;  5LGN B;  4DV5 T;  3LK4 2;  5TAO A;  4IE6 A;  4IE0 A;  1XNQ T;  3EHZ A;  5HWY A;  1Y01 A;  2XM2 A;  3FZF B;  3UU5 A;  5AQU B;  1IJ6 A;  2YN6 A;  4TNW A;  3T1H T;  1N32 T;  2CA5 A;  4AXP A;  4LF6 T;  4M1P A;  4WBO A;  5HXC A;  1HNZ T;  4JI2 T;  2WU5 A;  1HX8 A;  2NP9 A;  2H7V C;  3CX8 B;  1GQE A;  2C5J A;  3KBU A;  3TLU A;  2Y8D A;  2YOE A;  5CA0 E;  3B13 A;  3UT5 E;  3V5S A;  1N36 T;  2XAG B;  2LT3 A;  3ZSS A;  1MIY A;  4QH5 A;  4LF9 T;  2UXD T;  4DR4 T;  4AQF C;  1OED A;  3N2K E;  4MFR A;  3ZLI A;  2V6Y B;  1W0A A;  3SOL A;  4LF4 T;  1HG5 A;  4PK5 A;  3EUH A;  2H89 A;  2VQE T;  5AQV B;  1R8I A;  3FZM B;  1WFD A;  3LG7 A;  2V7J A;  3GN5 A;  5LMU T;  2XQ8 A;  5GON E;  2IML A;  5JDH A;  3ZEF B;  2JRK A;  2A72 A;  2WU2 A;  3RC3 A;  2XZE A;  4IT4 A;  3S4U A;  3SFD A;  4IL9 A;  3JC6 C;  4HFI A;  4U72 A;  5LHH B;  3P4W A;  2WQY A;  1XWM A;  5HCM A;  2LE8 A;  4WZX A;  2I59 A;  2CE7 A;  4IDN A;  1FMV A;  2K24 A;  3DJB A;  5H6R B;  4ZHQ E;  3JCF A;  5CGM A;  2V6X A;  4X5T A;  3AE2 A;  5BMV E;  4JI6 T;  5DAB A;  3AVS A;  4X64 T;  3LFM A;  3AE1 A;  2EHO D;  1MIW A;  5HAX A;  2XQ6 A;  2XSB A;  2X0L B;  4ZOL E;  3UFG A;  4HWF A;  3LBX B;  5L3C B;  1OXZ A;  4P0B A;  2Q9Q B;  2BG9 E;  3GN5 B;  4PAG A;  5LMN T;  4B3M T;  2X51 A;  3MK7 C;  2VK9 A;  2LKG A;  3B57 A;  3P50 A;  1XMO T;  3ETV A;  2W62 A;  4CZZ B;  1SUM B;  2V1D B;  2UXN B;  3ZMZ B;  4ERR A;  5JR9 B;  2CMR A;  2YU2 A;  2C0S A;  2ZM6 T;  1FIO A;  3CML A;  3E22 E;  2XQ5 A;  3BQI A;  3VU7 H;  5JQG E;  3PDY A;  4U74 A;  2DLR A;  4NUV A;  2CEA A;  3KV6 A;  3U3I A;  2XQY A;  3PJA J;  3EDV A;  3O9X A;  4F8H A;  3MKD A;  3AA6 B;  5LP6 E;  5FKY A;  2J47 A;  3UUM A;  3Q5D A;  1YKH B;  4ZI2 C;  3UUX B;  1I94 T;  2KZ7 B;  2ZM0 A;  1D0Y A;  1CHU A;  3WAK A;  3KBT A;  4ADZ A;  4QXB B;  1Z0P A;  2I6H A;  2J1D G;  4U2Y A;  3PUQ A;  4P09 A;  5AQK B;  2LSG A;  2Q9Q A;  1MND A;  2DWK A;  3C4X A;  3I9Y A;  3QOF A;  5CB4 E;  3I0Q A;  1Z8U A;  2BVL A;  4HWC A;  2OLT A;  3T8O A;  1IJ5 A;  2ZLY A;  3K8P C;  2PJQ A;  2LSJ A;  3AEC A;  3OBV E;  2Y6X A;  4X20 E;  5FP3 A;  5JTG A;  2UU9 T;  5L3E B;  2XM1 A;  3N9P A;  3ZC0 A;  4JUY A;  3FZH B;  3CKD A;  3C4W A;  3CVR A;  3PE0 A;  2XY8 B;  4CXX A;  1WR0 A;  3EVY A;  1YKE B;  4G2A A;  4UF0 A;  5JH7 E;  1YQ3 A;  1FEW A;  4DV7 T;  4ZS2 A;  2D0T A;  2QA7 A;  3Q5X A;  4U7Y A;  4LF7 T;  1AJ3 A;  3MJX A;  4YY3 T;  4GKJ T;  4QHO A;  5ABF B;  2L8K A;  3K1S A;  1XNR T;  2CHO A;  3CQG B;  3UTK A;  2GK9 A;  4IDP A;  4AKL A;  4ZXL A;  2X9Y A;  5L3G B;  1E2A A;  1HTJ F;  2E5L T;  3WI3 A;  2VL8 A;  3KVB A;  2W2U A;  2KND A;  3NZP A;  2C5I T;  3CX7 B;  1BR2 A;  2WM9 A;  3ESL A;  2MBG A;  3N9M A;  3O1H A;  3KV9 A;  3RQU A;  1WR6 A;  2IC9 A;  5EZY E;  5JRE A;  5HEU A;  3C64 A;  2X9X A;  3Q2M A;  3CPZ A;  4CXW A;  5F3J A;  2IC6 A;  2LSI A;  2DNX A;  1S35 A;  3F2E A;  3N9Q A;  3OPC A;  3AE7 A;  3K3O A;  4KP3 C;  4LMJ A;  4OHF A;  2UXC T;  3QC9 A;  4QXC B;  2UUA T;  4JI8 T;  4IHJ E;  5DJQ C;  4EOZ B;  3TKL B;  1OED E;  5HEO A;  5LBM A;  3FB2 A;  3P4S A;  2VKD A;  3OKQ A;  3UUL A;  2SPC A;  3ZMS B;  5HYA A;  2F4V T;  2K9A A;  3L39 A;  2CCQ A;  4TWD A;  2WBL A;  4OK0 A;  5HEG A;  3P4Q A;  2JQK A;  3QK6 A;  5HWX A;  4DR1 T;  2HPL A;  5L2L A;  3ZMT B;  1MNE A;  1T98 A;  5J1G A;  3H3A A;  1NEK A;  3ZCJ A;  4HE8 A;  3RH3 A;  3N2G E;  2WSS V;  4KBM B;  3RHW A;  2WS3 A;  3ONL C;  2BG9 A;  3M3Z B;  3RIU C;  3UU8 A;  3VR8 A;  3VR9 A;  1JNZ A;  3NZQ A;  3ZC1 A;  4DMV A;  5FY1 A;  4UV8 B;  5CA1 E;  3B5M A;  2KWH A;  2LSK A;  5FY7 A;  2BKP A;  3QB5 K;  4YXD A;  2NW7 A;  3KV5 A;  3GA8 A;  1D1C A;  2A3D A;  2H7O A;  4QX8 B;  1KNR A;  3VRB A;  4OYJ A;  4YT0 A;  1FMW A;  2FJD A;  2LHR A;  2N1G A;  2NTY A;  2KIN B;  2WB5 A;  2LEH A;  4HKA A;  3RYF E;  4MAL A;  4CXY A;  3RIA A;  5DQW A;  3QNU A;  1OED C;  5FXW A;  2IW5 B;  3V5U A;  1X9B A;  2KMF A;  2D0U A;  2RA1 A;  2XPK A;  3NBX X;  2WAU A;  1D0Z A;  4Z91 A;  3R84 B;  1IZN B;  4LMK A;  2V8S V;  1M7K A;  1WLX A;  3AEF A;  3CWZ B;  3PUX F;  3RF1 A;  3PUA A;  2VKH A;  5FNV E;  3TLT A;  3K3Q C;  4U7I A;  4U2Z A;  4ZZC A;  2X67 A;  4TZ4 C;  4YLH A;  1DU2 A;  3HKB E;  1J5W A;  4AKR B;  1UCU A;  4AQY T;  4A98 A;  2FUP A;  5J2T E;  2W0G A;  3J7Y q;  4X1I E;  1HS7 A;  3ONJ A;  4JEH B;  2CBI A;  3C50 A;  1XZY A;  1E1H B;  5JDN A;  2VL0 A;  4O4H E;  4J2C A;  4BJN A;  3CQX C;  3E08 A;  1QUU A;  4A97 A;  3AED A;  5HXR A;  3A7M A;  3C98 B;  3PUV F;  3AEE A;  3EAB A;  3IF8 B;  1US7 B;  4DID B;  2WCA A;  5JR9 C;  5JRC B;  4H63 V;  3I0O A;  2D5U A;  4IE5 A;  2CBJ A;  2QRX A;  4KUM B;  2JMK A;  2M6B A;  3MXZ A;  3NWI A;  4LF8 T;  4OX9 T;  4DR6 T;  1LVK A;  2H88 A;  4CN6 A;  4EAH A;  2Z6E A;  4I0U A;  5AQN B;  3ZYM A;  3RRW A;  5IHY A;  3I9W A;  4C90 A;  3DP7 A;  4YSZ A;  2LSY A;  3HI2 A;  3H37 A;  1V9D A;  2V5D A;  2LKH A; 
#chains in the Genus database with same CATH homology
 4B6X A;  3GWH A;  1YW0 A;  1D0X A;  2VB6 A;  1LKX A;  4QWN B;  4IE4 A;  4TV9 E;  4NUU A;  2CXL A;  2NW8 A;  5LHG B;  2PBI A;  2X9H A;  5JR9 A;  3BK9 A;  2CXF A;  3OJA A;  3A5X A;  2JMH A;  2JPF A;  2WWU A;  2ZMA A;  3HKD E;  4IIJ E;  1KNZ A;  4EXT A;  3PU3 A;  5C8Y E;  2RP4 A;  3IEE A;  3MA9 A;  4UXN B;  3ZPO A;  4C91 A;  4N78 D;  2P9B A;  2UXX B;  3FHN A;  5LG4 A;  1WYC A;  2N9D A;  3Q9D A;  2K5B B;  4O2B E;  1HG2 A;  4YFS A;  4I50 E;  5JDF A;  1VRB A;  4L5G A;  4AKH A;  1ZEE A;  2X68 A;  2D2S A;  2YK0 A;  3Q5W A;  4I43 B;  2NW9 A;  1KK7 A;  5JDM A;  4MHC A;  3WAJ A;  3AA7 B;  3F31 A;  4DVD A;  4DMW A;  3JC6 D;  1YD8 G;  4AQG A;  3AAI A;  4GK5 E;  3BQK A;  3C51 A;  2EHO C;  4GYR A;  3J9X 1;  3KIN B;  3P8C D;  4PNI A;  4H9S E;  4UEL A;  4X1K E;  3ZCI A;  2V7K A;  5EK2 A;  2CWY A;  2XAS B;  3HKE E;  4Z8X A;  1Y64 B;  2G0U A;  5AFU L;  3L3P A;  4E7Z A;  3LK2 B;  2V7I A;  5LNK A;  3FBL A;  4HGA A;  3AVR A;  2DI4 A;  2DWG A;  2XAH B;  4HTE A;  5DQV A;  3IBP A;  4CI1 B;  4BJM A;  1D1B A;  1NWM X;  2V7M A;  5JVD E;  2KXP B;  3ZMV B;  4UVB B;  2WMO A;  4O4I E;  5LBQ B;  5LJN A;  3UFE A;  5LHI B;  2ZM8 A;  2QGS A;  4PJJ A;  4G63 A;  4UF0 B;  4UEM A;  2PFV A;  3VHL A;  2LHN A;  3CQC B;  3ZMU B;  2E9X B;  4H9R C;  2X9W A;  3U78 A;  4H63 H;  3AA1 B;  2WMN A;  2E9X C;  3N2O A;  4ZS3 A;  2LOS A;  1LRZ A;  4H9P C;  2KT9 A;  4OYK A;  1NAF A;  4YJ3 E;  2VWA A;  1ZHC A;  3M65 A;  3K3N A;  5LXT E;  4E7S A;  5L3B B;  1MMN A;  2CXD A;  5FXV A;  2HH7 A;  2H3R A;  5HXH A;  3W15 B;  4XZC A;  4BA9 A;  3FXE B;  1MMG A;  2ES0 A;  1UX5 A;  2W61 A;  4QX7 B;  2JJ9 A;  2YIN A;  4UVC B;  1SHZ C;  3LBX A;  4QXH B;  2BVM A;  2KWI B;  5LA6 E;  2PG8 A;  4CI3 B;  4XAX B;  4EYY R;  3ZYK A;  4WNK A;  3IHR A;  1WRD A;  3AA0 B;  4AI6 A;  4DO0 A;  3ETU A;  3RRC A;  3D0T A;  4JLE A;  4UIG A;  4DBQ A;  3ZJ2 A;  3N9L A;  5LJM A;  4H9O C;  3KV4 A;  1S94 A;  3VKG A;  4ISS A;  2M67 A;  4L9I A;  2NTX A;  1HCI A;  2Q9Q D;  1O3X A;  2YU1 A;  3O4X E;  3O1J A;  2ZM2 A;  4PW8 A;  4EIW A;  4TUY E;  3SWH A;  2NWB A;  5L3F B;  3NRX A;  4AKI A;  1HFA A;  1X79 A;  2V26 A;  2CLY C;  4IGU A;  3HL6 A;  4O2A E;  1V9D A;  3N9O A;  4ZI3 D;  4H9Q C;  3RPU A;  3L09 A;  3DTO A;  1H7C A;  2LOP A;  4K0U A;  2NOX A;  4PK4 A;  4EB6 E;  3ANW B;  4YJ2 E;  4TV8 E;  3PU8 A;  4HN9 A;  2BDE A;  1LVF A;  3OYZ A;  2VAS A;  4FI5 A;  5KX5 E;  2W63 A;  4EYU A;  4UV9 B;  1BR1 A;  2N2N A;  5FYM A;  1G73 A;  5ADX L;  4YHJ A;  2L9Q A;  5LGT B;  3PUR A;  4PJL A;  5HXS A;  4IDZ A;  3RX6 A;  3RC8 A;  3FBZ A;  2HPJ A;  2XAQ B;  4QKN A;  5KDM C;  3MAC A;  5L3D B;  2Y48 B;  4GIW A;  3ANW A;  2E8I A;  2C5K T;  5E0O A;  4DND A;  5JDQ A;  4PFO A;  4TN7 B;  1G8X A;  1U5P A;  3AAE B;  5EK4 A;  5H6Q B;  2XTL A;  3F57 A;  3KFW X;  4HEA A;  1BR0 A;  1OWA A;  2ODU A;  4GK0 E;  5FXZ A;  2XHE B;  5ETW A;  3SS1 A;  2DCF A;  3UUN A;  2LJL A;  2OA5 A;  4P0A A;  4DBR A;  4EZ4 A;  3QUJ A;  3LJC A;  4V1A v;  1WYB A;  5EK3 A;  1HF8 A;  4IE7 A;  2CM0 A;  4O4J E;  3BQL A;  3KDS E;  5LGU B;  2EHO A;  4WW0 A;  2DHR A;  2E9X D;  5FMN A;  1IAP A;  3RKO A;  4OFZ A;  4H9N C;  1UX4 A;  5F8P A;  5JDL A;  3ONX A;  3KVA A;  4AKG A;  3CX6 B;  4CQI A;  4HFV A;  2V7L A;  2B1E A;  4O4L E;  4MBQ A;  5A1L A;  3LK3 B;  2A2F X;  3AAA B;  2JQQ A;  4KMC A;  2VKJ A;  4BAY B;  1EZ3 A;  1SA0 E;  4GOU A;  4IST A;  5LOV E;  1ZKE A;  5FXX A;  3ZN0 B;  3RYI E;  5HXE A;  4PJN A;  4FJO A;  4I4T E;  2EHO B;  4AQF A;  3N5L A;  3NRY A;  4UVA B;  2MTQ A;  4ZI3 C;  1MMD A;  3FXD B;  4L0R A;  2XAF B;  3AB3 B;  1BR4 A;  3GMI A;  2X66 A;  2Q9Q C;  4JEU B;  1B7T A;  1VOM A;  3N9N A;  2ACX A;  5J2U E;  2MYS A;  2KLQ A;  3EDU A;  5KMG P;  4PK6 A;  1U4Q A;  3RYH E;  5M4Y A;  2E9X A;  4I55 E;  5FY0 A;  4MLK A;  4A56 A;  5LCY A;  3PTR B;  4ANJ A;  2LM9 A;  3HKC E;  5JRC A;  4XBF B;  2IAK A;  2YEV C;  2XAJ B;  3MZK B;  4O8S A;  3O1I A;  3OYX A;  1CUN A;  5LYJ E;  5JDG A;  3C4Z A;  3SRZ A;  3VKH A;  4GYS A;  2CLY B;  1QSD A;  2XUE A;  3I1A A;  2K48 A;  1MIV A;  2BZB A;  2MOZ A;  4ILU A;  4EZH A;  4WBN E;  2W00 A;  2CWO A;  3HA4 A;  1MMA A;  4TX5 A;  2ODV A;  4ZI2 D;  3R6N A;  3PUG A;  1ZV4 X;  5IYZ E;  4PJM A;  3PUS A;  2VKO A;  3ZYL A;  3HR0 A;  3RYC E;  4PFP A;  4CI2 B;  4ASK A;  4ZI7 E;  4F6R C;  3P7I A;  3E0Z A;  2L3L A;  1D1A A;  4X1Y E;  3ZN1 B;  5LGN B;  3LK4 2;  5TAO A;  4IE6 A;  4IE0 A;  5HWY A;  1IJ6 A;  2CA5 A;  4AXP A;  4M1P A;  4WBO A;  5HXC A;  1HX8 A;  2NP9 A;  2H7V C;  3CX8 B;  5CA0 E;  2C5J A;  3KBU A;  2Y8D A;  3B13 A;  3UT5 E;  2XAG B;  2LT3 A;  1MIY A;  4AQF C;  3N2K E;  4MFR A;  3ZLI A;  3SOL A;  1HG5 A;  4PK5 A;  3EUH A;  3LG7 A;  2V7J A;  3GN5 A;  5GON E;  5JDH A;  3ZEF B;  2JRK A;  2A72 A;  3RC3 A;  3S4U A;  3JC6 C;  4U72 A;  5LHH B;  2LE8 A;  2I59 A;  2CE7 A;  1FMV A;  2K24 A;  3DJB A;  5H6R B;  4ZHQ E;  5BMV E;  5DAB A;  3AVS A;  3LFM A;  5HAX A;  2EHO D;  1MIW A;  2X0L B;  4ZOL E;  5L3C B;  3LBX B;  1OXZ A;  4P0B A;  2Q9Q B;  3GN5 B;  4PAG A;  2X51 A;  3MK7 C;  2VK9 A;  3B57 A;  3ETV A;  2W62 A;  4CZZ B;  2V1D B;  2UXN B;  3ZMZ B;  4ERR A;  5JR9 B;  2CMR A;  2YU2 A;  2C0S A;  1FIO A;  3CML A;  3E22 E;  3BQI A;  3VU7 H;  5JQG E;  3PDY A;  4U74 A;  2DLR A;  4NUV A;  2CEA A;  3KV6 A;  3U3I A;  2XQY A;  3EDV A;  3O9X A;  3MKD A;  3AA6 B;  5LP6 E;  3UUM A;  4ZI2 C;  1YKH B;  3UUX B;  2KZ7 B;  2ZM0 A;  1D0Y A;  4ADZ A;  3WAK A;  3KBT A;  4QXB B;  1Z0P A;  3V5U A;  2J1D G;  3PUQ A;  4P09 A;  5CB4 E;  2LSG A;  2Q9Q A;  1MND A;  2DWK A;  3C4X A;  3I9Y A;  3ZJ1 A;  3I0Q A;  2BVL A;  3T8O A;  1IJ5 A;  2ZLY A;  3K8P C;  2PJQ A;  2LSJ A;  3OBV E;  4X20 E;  2Y6X A;  5FP3 A;  3ZC0 A;  5L3E B;  3N9P A;  4JUY A;  3CKD A;  3C4W A;  3CVR A;  3PE0 A;  4CXX A;  3EVY A;  1YKE B;  4G2A A;  4UF0 A;  5JH7 E;  1FEW A;  4ZS2 A;  2D0T A;  2QA7 A;  3Q5X A;  1AJ3 A;  3MJX A;  4QHO A;  2L8K A;  3CQG B;  3UTK A;  2GK9 A;  4AKL A;  2X9Y A;  5L3G B;  1HTJ F;  3WI3 A;  2VL8 A;  3KVB A;  2KND A;  3NZP A;  2C5I T;  3CX7 B;  1BR2 A;  2WM9 A;  3ESL A;  2MBG A;  3N9M A;  3O1H A;  3KV9 A;  5JRE A;  1WR6 A;  2IC9 A;  5EZY E;  3C64 A;  3Q2M A;  3CPZ A;  4CXW A;  5F3J A;  2IC6 A;  2LSI A;  2DNX A;  1S35 A;  3F2E A;  3N9Q A;  4KP3 C;  4OHF A;  3K3O A;  3QC9 A;  4QXC B;  4IHJ E;  5DJQ C;  4EOZ B;  3TKL B;  5LBM A;  3FB2 A;  2VKD A;  3OKQ A;  3UUL A;  2SPC A;  3ZMS B;  5HYA A;  2K9A A;  2CCQ A;  2WBL A;  4OK0 A;  3QK6 A;  5HWX A;  2HPL A;  5L2L A;  3ZMT B;  1MNE A;  1T98 A;  5J1G A;  3H3A A;  3ZCJ A;  4HE8 A;  3RH3 A;  3N2G E;  2WSS V;  4KBM B;  3NZQ A;  3ZC1 A;  4DMV A;  5FY1 A;  4UV8 B;  5CA1 E;  2KWH A;  2LSK A;  5FY7 A;  2NW7 A;  3KV5 A;  3GA8 A;  1D1C A;  2A3D A;  2H7O A;  4QX8 B;  4OYJ A;  1FMW A;  3RYF E;  2LHR A;  2N1G A;  2NTY A;  2KIN B;  3V5S A;  2LEH A;  4HKA A;  4CXY A;  4MAL A;  5DQW A;  5FXW A;  2IW5 B;  2KMF A;  2D0U A;  2RA1 A;  3NBX X;  2WAU A;  1D0Z A;  3R84 B;  1IZN B;  3CWZ B;  1WLX A;  3PUA A;  2VKH A;  5FNV E;  3K3Q C;  2X67 A;  4TZ4 C;  4YLH A;  3HKB E;  4AKR B;  1UCU A;  5J2T E;  2W0G A;  3J7Y q;  4X1I E;  1HS7 A;  4JEH B;  3C50 A;  1E1H B;  5JDN A;  4O4H E;  4J2C A;  4BJN A;  3CQX C;  3E08 A;  1QUU A;  5HXR A;  3C98 B;  3IF8 B;  1US7 B;  5JR9 C;  5JRC B;  4H63 V;  3I0O A;  2D5U A;  4IE5 A;  4KUM B;  2JMK A;  3MXZ A;  1LVK A;  4EAH A;  2Z6E A;  3ZYM A;  3RRW A;  5IHY A;  3I9W A;  4C90 A;  3DP7 A;  2LSY A;  3HI2 A;  3H37 A;  2X9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...