4HGAA

Structure of the variant histone h3.3-h4 heterodimer in complex with its chaperone daxx
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
207
structure length
207
Chain Sequence
QDPSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDPALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the variant histone H3.3-H4 heterodimer in complex with its chaperone DAXX.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone/apoptosis
molecule keywords Death domain-associated protein 6
total genus 69
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2012-10-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2170 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4hgaA00
4H9SE 4H9OC 4H9RC 4H9QC 4H9NC 5KDMC 4HGAA 4H9PC
chains in the Genus database with same CATH superfamily
2UXXB 2XSBA 2ACXA 3LBXB 3AA7B 4P0BA 2V5DA 4DR1T 2M6BA 4TWHA 3RX6A 3P50A 3V5UA 3FBLA 2LRKA 2K48A 5JDHA 3BQKA 2CWOA 2BS3A 2WU2A 4HWHA 2CE7A 2X0YA 3H3MA 2EHOD 4WYVA 4AIUA 1DU2A 5AQIB 1HTJF 5F8PA 4LF6T 4B3RT 3NRXA 1QUUA 5HEJA 5LGUB 3ONLC 4JI6T 2UXBT 3RH3A 4KP3C 1FMWA 3IBPA 4UIGA 3EI0A 3HA4A 5ABFB 2Q9QA 2LOPA 3RYHE 2V7JA 3QC9A 5JR9A 2YN6A 2M67A 2VL0A 2JPFA 3FZHB 4IT4A 1J5WA 4NXNT 2L8KA 3EDUA 3O4XE 2JMKA 3HI2A 3IHRA 1LVKA 5AQFB 4B3MT 1KNPA 1NENA 2WS3A 4PFOA 1Z8UA 2SPCA 3P4QA 2FJAA 1BR2A 2LEHA 3HKEE 3C4XA 1HG5A 4DV6T 4NUUA 4COFA 2XAJB 3AVSA 2A72A 1YKHB 1G73A 3AB3B 2XQ7A 4QHOA 5LOVE 3X1DA 2QYWA 4CN4A 4YTNA 2IAKA 3PTRB 4QH4A 5HCJA 4YSXA 1N36T 3JAEA 4UV9B 2ODVA 2X67A 3J9X1 4LFBT 2YOEA 5L4EA 3PUXF 3ZJ1A 5HCMA 2PFVA 4DR5T 2K3WA 3PU8A 2MAWA 4OHFA 4UVCB 3K3NA 2PBIA 1UK5A 3VHLA 3N9LA 3AECA 5AQKB 3MACA 4YXDA 2A9UA 4EZ4A 4DBRA 3JC6C 2VKJA 3UULA 4L9IA 2VASA 2E5LT 4ZS2A 3PUWF 4H9RC 3S4UA 3AE5A 1WR6A 2MPKA 2CA5A 4WZXA 1G8XA 4JI5T 1HX8A 3EVYA 1XDPA 2KZ7B 2WDVA 3KV6A 3RPUA 1XMQT 5JR9B 2C5IT 4HFHA 2YINA 4I50E 5JDQA 2BKOA 1JNRA 4O4IE 3UUBA 1R8IA 1KFYA 3I1AA 1BR1A 1KF6A 1MMNA 2KWIB 1MMAA 3ESLA 3N9QA 4YTMA 3AEDA 4YTPA 5L2LA 3MXZA 4JBWF 3LSVA 1AJ3A 4YJ3E 1IJ5A 3ZT7A 2OLTA 2W63A 2Y48B 4B6XA 1D1CA 5CGMA 3GN5A 1M62A 4O4HE 1OEDC 3N2GE 2DCFA 3L09A 4PW8A 3TLVA 2LM9A 4YHHT 3ZN1B 1WFDA 2LSYA 3FHNA 4H9NC 4BJMA 2W62A 3O1JA 2V7KA 3U3IA 5LP6E 3O1IA 4QKNA 2A3DA 4IIJE 4DV3T 5ETWA 3RYIE 4KX6A 4U3CA 1ZOYA 2KLQA 1GQEA 3AA0B 3JC6D 2H89A 3WAKA 3AE9A 5BMVE 4ZXLA 3P8CD 2VKDA 4LF4T 4UVBB 3O1HA 2XASB 3PUVF 4AQFA 2VWAA 4AKHA 5IUXA 2LJLA 5LXTE 3KBTA 2UXNB 2V6XA 2V7LA 4P09A 2CMRA 4X1YE 3ZLIA 4AQGA 2UUCT 2ZM0A 3UT5E 4LF8T 2H88A 2KT9A 4NIQA 4GOUA 3QK6A 2QGSA 4GK0E 2V6YB 3LG7A 1E2AA 4C90A 2Z6EA 2I59A 4LF7T 3Q5DA 3AE2A 5LA6E 3UUXB 1T8BA 2G0UA 2WM9A 5FNVE 2RA1A 3R84B 4TV9E 3F57A 1UUSA 1KNRA 2PJQA 5KMGP 2HPJA 4H9SE 2CHOA 4JI1T 4LF9T 5LNKA 4G2AA 3CQCB 3Q5EA 4CI3B 2EHOA 2NWBA 2XQ4A 2XJ7A 3PURA 4CXWA 3MZKB 2XTLA 1NWMX 2FJEA 2KINB 4ILBA 5FXVA 4CI1B 5ADXL 4OYJA 4DV1T 1D0ZA 1V9DA 2X0HA 2XM2A 2XM1A 3AAIA 2H3RA 1ZHCA 3ANWA 5AQUB 3RKOA 2BZBA 5BR8T 3AE3A 2Q9QC 4AKIA 2BDEA 3NRYA 3L8RA 3ZEFB 3RI5A 4GYRA 2E9XC 3CX6B 3F2EA 4IDOA 5ABEA 3OBVE 4PJJA 4Z90A 4JI8T 4HFDA 2XAHB 5EK3A 2XQAA 4GIWA 1HNWT 2Q9QB 2DL1A 2EHOB 4TWDA 1BR4A 5CA1E 4IDZA 4U33A 3FZMB 4ZZBA 1XWMA 3KDSE 4H63H 3K1SA 2E5VA 5ABFA 4ZZCA 1S94A 3PUGA 4DR2T 2V1DB 3C50A 2X66A 5LBMA 2IC6A 3R6NA 3UTKA 4DR6T 5IHYA 4WW0A 5AQMB 1XDOA 1YW0A 2E8IA 1UURA 3FXDB 3K8PC 4K0UA 3ZCIA 2BVLA 3CPZA 4B3TT 2X68A 4H9PC 2CPTA 2V5CA 5HAXA 1X79A 4UV8B 2W61A 5ABGA 1SHZC 3P7IA 1J1JA 5FXZA 5JDGA 3CK6A 3QOFA 1D0YA 3VKHA 2UXCT 4AQYT 1U4QA 4PAGA 4EYUA 3GMIA 3N9PA 3ZCJA 5AQTB 3NVOA 3BQIA 5LJNA 2LM2A 2RP4A 2L3LA 1NAFA 5HXSA 3UUNA 5CA0E 2X9HA 5JVDE 2D9DA 4TV8E 3P4RA 4GK5E 3O9XA 2J62A 3PUZF 3JCFA 2UU9T 3MJXA 5EK4A 2JQKA 3PUSA 1FMVA 3SFEA 4DR7T 1HNXT 3A7MA 3FZFB 2VB6A 1YXRA 3UFGA 5L3EB 1X9BA 1VCTA 2W00A 2X9YA 3L39A 3SFDA 4YSZA 4ZHQE 4X66T 2KMFA 1XNQT 5JRCB 3PUAA 1MMGA 2H7VC 2JJ9A 5JDNA 4I55E 3MKDA 5HEOA 4L5GA 5LB7B 1VCSA 5JTGA 3NZPA 5IWAT 3SWHA 4XBFB 3RHWA 2E9XA 3E22E 2XAFB 4J2CA 4DV2T 1Y64B 1W09A 3C4WA 4HGAA 4FI5A 1T7SA 3ZYMA 1WYCA 5C3JA 4QWNB 3AE8A 2IMLA 3J7Yq 4AQFC 1IAPA 1Y01A 1O3XA 3PUYF 4TUYE 3DP7A 3L3PA 5EZYE 5FP3A 4IE7A 4ISSA 3C64A 2YU1A 1YKEB 1VOMA 2WZIA 4UF0B 4A98A 2WWUA 4DIDB 4YJ2E 4QXBB 2WCAA 2V7MA 2JQHA 2V8SV 3C4ZA 4EEBA 4GKJT 3VKGA 3ZC1A 4KI0F 4AKGA 2MYSA 3WI3A 2ODUA 1W0AA 2VK9A 5AQLB 1HS7A 5JDFA 2CXDA 4LF5T 2WDRA 3TLSA 3MA9A 4BA9A 2YDRA 1YQ3A 2BG9C 4NUVA 3FBZA 4HWDA 4O8SA 4TX5A 5DABA 3FZKB 4IGUA 4JEUB 4UVAB 1SUMB 4MBQA 2DWGA 4PK6A 2W0GA 3RF1A 2HHHT 2PTFA 3NKZA 4NPPA 3ZKRA 4DV0T 2WAUA 4JI4T 4JI0T 3ZC0A 2BVMA 2EHOC 3AA1B 3AEGA 3OKQA 3PJAA 1L0VA 4ERRA 2XQ6A 3DTOA 4PJNA 1KK7A 2CEAA 3CQGB 5KX5E 1I6ZA 5ABHA 2UUBT 2XSAA 3ANWB 3RIUA 2JRKA 1LKXA 2DNXA 2H7OA 5AQSB 4JUYA 1MNDA 2X9WA 3ZYKA 3AVRA 1QSDA 1D1AA 1HCIA 4MHCA 3SOLA 3AEEA 1WYBA 3GA8A 1N33T 3OYZA 3U78A 3RYCE 3KFWX 3D0TA 2R6GF 4QH1A 1MIWA 2E9XB 4TZ4C 2YEVC 3RIFA 4CQIA 5LJMA 5FL0A 2WZHA 4K0KT 3TLWA 2XAGB 1KNZA 2VQFT 1T98A 3PU3A 3N9MA 3AAAB 2AXDS 3CWZB 4X65T 2WWVA 3OPCA 3LK2B 1MNEA 2IDOB 4IREA 4A56A 3DJBA 4ZS3A 2WU5A 4OYKA 1Z0PA 4ADZA 3CX7B 4PJMA 2DWKA 5E0OA 1WRDA 2BS4A 3AEBA 4H63V 3UU5A 4HE8A 4WBNE 1HG2A 4MALA 4QXCB 1UX4A 5LG4A 3VRAA 3ABVA 5HEUA 1T72A 4EGWA 4IDQA 4O2BE 1HNZT 1UGOA 1FEWA 3CKDA 4BJNA 3ETVA 5L3DB 3E0ZA 3B13A 4U7IA 4EIWA 1YQ4A 2B1EA 4JEHB 1FIOA 4TNWA 4U31A 3ZMSB 2VVNA 4IDPA 3M65A 4ILCA 5AQRB 5FY7A 2WQYA 5FXWA 2W66A 4HEAA 2CM0A 2LHNA 3LK42 3QUJA 4ZI3D 5HXRA 4YSYA 5J1GA 1ZV4X 2YKSA 2E9XD 3P4PA 3TKLB 5LHGB 1LRZA 2DI4A 1W0BA 4PFPA 3RRCA 4I0UA 3QNUA 3ZSSA 3ZN0B 3N5LA 2XQ3A 1XZYA 5FY0A 2PG8A 2MOZA 3LK3B 5L3GB 4DV7T 4IE5A 1J5ET 3AE4A 2LHRA 3PV0F 3B57A 3N2KE 2DLRA 5AQHB 4ZI3C 4F8HA 3GN5B 2BS2A 3GWHA 2XHEB 3KVBA 4OK0A 4TN7B 2ZM8A 5C8YE 2J1DG 3P4SA 2ZLYA 4DVDA 2XAQB 2X0LB 1XNRT 3LBXA 2VKHA 4E7SA 3AE7A 2Y6XA 4WNKA 5FVLA 5JR9C 4YY3T 4LMJA 1M7KA 3CX8B 3QB5K 3ZMVB 2BKNA 4KHPT 5C2TA 4I4TE 4E7ZA 1HF8A 5JREA 4DNDA 3H37A 3SS1A 1OEDE 2VL8A 4IHJE 2BG9B 5GONE 5HXHA 2WMNA 4X20E 1HX1B 3A8YC 4QX8B 4ZEYA 3HKDE 3H3AA 1W9RA 2WY2A 1E7PA 2WDQA 3HKBE 4GYSA 4YLHA 3WAJA 4X64T 2JIWA 2CLYC 2LRLA 3EHZA 4PNIA 3RC3A 2LSIA 1SA0E 3IEEA 4QXHB 4XAXB 4CZZB 1B7TA 1IJ6A 2NR4A 4ANJA 5F3JA 2UUAT 2KWHA 3ONJA 4A5XA 4Z8XA 3RGLA 1D1BA 1UX5A 2RPAA 3E08A 4IE6A 3ZMTB 3W15B 4A97A 2JQ9A 4ISTA 4EV6A 5HXCA 4EEDA 5HWXA 2I0MA 2VQET 1HR0T 5J2TE 1FJGT 4TWFA 4JI2T 5DQWA 2LSKA 2NP9A 1CHUA 2X9XA 5LCYA 3LFMA 3PE0A 3RRWA 2P9BA 5CB4E 3Q5WA 2QA7A 4Q25A 2N2NA 3CIRA 3I0OA 5AQOB 3ZT5A 5AFUL 2KSRA 4HFIA 1ZP0A 2QVAA 2XY8B 4PK5A 5AQNB 2GK9A 5LGNB 4UELA 5KXJA 4KHZF 4NXMT 4KUMB 2ACZA 2WMOA 1QLBA 4DMWA 3SRZA 3UQ4A 2XZEA 4KBMB 3C98B 2ZM2A 2E2AA 3QB5A 5FKYA 2IHR1 1OEDA 1IBKT 3V5SA 5JDMA 4CN6A 1OWAA 4ZOLE 5J0ZA 2Q9QD 4HWCA 5L3FB 4IL9A 3MK7C 4O4JE 4PK4A 2ZM6T 4EZHA 3RC8A 5FXXA 5L4HA 3UU3A 1N34T 4U74A 4DBQA 1US7B 2C5JA 2CBJA 2HPLA 2XQYA 3OYXA 2D0TA 3CVRA 3NBXX 4H9QC 4M1PA 3HL6A 4QX7B 5H6QB 5H6RB 3T1HT 3NZQA 1YD8G 2W2UA 2L9QA 3PDYA 5AQQB 4U72A 4CI2B 5LG3A 2I6HA 2NW8A 3T8OA 5L47A 3I9WA 3AEFA 2FBWA 4X1IE 3RLFF 2CXFA 5FL1A 3Q9DA 2M6IA 2K9AA 2A2FX 1BR0A 3UU8A 4JYAT 2NTXA 4JLEA 4EOZB 5AQJB 3KV9A 4YHJA 1E1HB 5EK2A 2C0SA 3ZMUB 4HTEA 4CN1A 1S35A 4MFRA 5CJ5A 1IBMT 5M4YA 2LT3A 4EAHA 3ZMZB 2KXPB 2D0UA 2UXDT 2ES0A 2JMHA 2LKHA 2LSJA 2VURA 2CXLA 3K3OA 3KINB 1ZKEA 2BBJA 2OV9A 3AAEB 3PJAJ 4Z91A 3AEAA 2J4GA 2XQ8A 3FZLB 3VR8A 3KVAA 3TLUA 4TNVA 2LOSA 3NWIA 5L3BB 4O2AE 4CXXA 3RIUC 4B3ST 2MTQA 4DR4T 5LBQB 4YFSA 5J2UE 1KEYA 2OA5A 4LMLA 4HKAA 1ZEEA 3AA6B 2CBIA 4L0RA 4U2ZA 2WBLA 3UUMA 4AXPA 5A1LA 1EZ3A 5JDLA 5AQPB 4DUZT 2LE8A 4H9OC 4HN9A 1IBLT 4HFEA 4ZI2C 2IIUA 3K3QC 4O4LE 3EABA 1MIVA 3BK9A 3EUHA 4OFZA 5F5WA 5FVKA 3BQLA 3ZT6A 2KNDA 3AXJB 2D2SA 3JAFA 4JI3T 4I43B 3I0QA 3G06A 4PJLA 2IW5B 4EB6E 4U7YA 1LVFA 2IC9A 4G63A 2BKPA 3N9NA 4ZI2D 2YDSA 2JQQA 4IL4A 4WBOA 3VR9A 2FJDA 3T1YT 2V7IA 3VU7H 4BAYB 3JADA 2V6YA 4YT0A 4JI7T 2B76A 2XUEA 4UF0A 4EXTA 4JV5T 2J47A 5JQGE 2FJBA 3ONXA 1IZNB 3CMLA 4HWIB 3FB2A 4IDNA 5DJQC 4DV5T 4IE0A 5HWYA 5LMNT 1H7CA 3VRBA 5LGTB 2CLYB 4LMKA 1D0XA 1I94T 3KBUA 2W67A 1VRBA 5FY1A 5HEGA 3RQWA 3ZJ2A 1XMOT 4V1Av 5FYMA 2CWYA 2LLYA 4KMCA 3ZPOA 2F4VT 3RKGA 4DV4T 4ILUA 3IA3A 3RQUA 4DO0A 1CUNA 3ZYLA 4IE4A 2K5BB 5AQGB 2WSSV 4X62T 4HFBA 5DQVA 1U5PA 2BBHA 2YU2A 4AKRB 3Q2MA 2BG9E 2NW7A 2XQ5A 5LYJE 2NTYA 2C5KT 3LJCA 3LDQB 2VKOA 3TLTA 4GKKT 3P4WA 1MMDA 2K24A 4UXNB 5TAOA 3IF8B 4ASKA 2WP9A 5L3CB 3KV5A 3N2OA 4F6RC 2NOXA 2XQ9A 5LHIB 1WCRA 1OXZA 2Y8DA 3HR0A 2MBGA 3C51A 3RIAA 2DHRA 4HFVA 4AKLA 5HXEA 3UQ7A 4DUYT 4P0AA 4OX9T 4UR9A 3EDVA 3M3ZB 5FMNA 2W4XA 5LMUT 3B5MA 3OVUA 4FJOA 4ILAA 2YK0A 4DR3T 2HN1A 2LKGA 2QRXA 5IYZE 4AI6A 3F31A 2XPKA 2WB5A 1UCUA 2X51A 3UU6A 4C91A 3HKCE 2NW9A 4HFCA 3OTOT 2FUPA 4AISA 1JNZA 5HEHA 2V26A 3RYFE 4QH5A 5JRCA 3OJAA 1HFAA 3N9OA 4P1NA 3I9YA 2LSGA 2HH7A 4X1KE 5CFBA 3PUQA 4U2YA 4LFCT 3AE6A 4ZI7E 1SE7A 5JH7E 5LHHB 2N9DA 1WLXA 4EYYR 5KDMC 1WR0A 3A5XA 4DMVA 4XZCA 3UU4A 5AQVB 4HWFA 1N32T 4LFAT 2VVSA 1OEDB 2YDQA 3Q5XA 4UEMA 5HYAA 2HN2A 3ETUA 2BG9A 2AE9A 3AXJA 3UFEA 2N1GA 2CCQA 3ZSTA 3KV4A 2CHNA 3EAMA 4N78D 3CQXC 2D5UA 4X5TA 1NEKA 2ZMAA 2CRBA 4CXYA 1MIYA 3AE1A 4MLKA 2IUBA 3FXEB
chains in the Genus database with same CATH topology
2UXXB 3LBXB 2ACXA 3AA7B 4P0BA 3RX6A 3V5UA 3FBLA 5JDHA 2K48A 3BQKA 2CWOA 2CE7A 2EHOD 1HTJF 5F8PA 3NRXA 1QUUA 5LGUB 3RH3A 4KP3C 1FMWA 3IBPA 4UIGA 3HA4A 2Q9QA 2LOPA 3RYHE 2V7JA 3QC9A 5JR9A 2M67A 2JPFA 2L8KA 3EDUA 3O4XE 2JMKA 3HI2A 3IHRA 1LVKA 4PFOA 2SPCA 1BR2A 2LEHA 3HKEE 3C4XA 1HG5A 4NUUA 2XAJB 3AVSA 2A72A 1YKHB 1G73A 3AB3B 4QHOA 5LOVE 5KX5E 4CXYA 2IAKA 3PTRB 4UV9B 3J9X1 2ODVA 2X67A 3ZJ1A 2PFVA 3PU8A 4OHFA 4UVCB 3K3NA 2PBIA 3VHLA 3N9LA 3MACA 4EZ4A 4DBRA 3JC6C 2VKJA 3UULA 4L9IA 2VASA 4ZS2A 4H9RC 3S4UA 1WR6A 2CA5A 4CXWA 1G8XA 1HX8A 3EVYA 2KZ7B 3KV6A 3RPUA 5JR9B 2C5IT 4I50E 2YINA 5JDQA 4O4IE 3I1AA 1BR1A 1MMNA 2KWIB 1MMAA 3ESLA 3N9QA 5L2LA 3MXZA 1AJ3A 4YJ3E 1IJ5A 2W63A 2Y48B 4B6XA 1D1CA 3GN5A 4O4HE 3N2GE 2DCFA 3L09A 4PW8A 2LM9A 3ZN1B 3FHNA 2LSYA 4BJMA 4H9NC 2W62A 3O1JA 2V7KA 3U3IA 5LP6E 3O1IA 4QKNA 2A3DA 4IIJE 5ETWA 3RYIE 2KLQA 3AA0B 3WAKA 3JC6D 5BMVE 3P8CD 2VKDA 4UVBB 3O1HA 2XASB 4AQFA 2VWAA 4AKHA 2LJLA 5LXTE 3KBTA 2UXNB 4P09A 2V7LA 4X1YE 2CMRA 3ZLIA 4AQGA 2ZM0A 3UT5E 2KT9A 4GOUA 3QK6A 2QGSA 4GK0E 3LG7A 4C90A 2Z6EA 2I59A 5LA6E 3UUXB 2G0UA 2WM9A 5FNVE 3R84B 2RA1A 4TV9E 3F57A 2PJQA 5KMGP 2HPJA 4H9SE 5LNKA 4G2AA 3CQCB 4CI3B 2EHOA 2NWBA 3PURA 3MZKB 2XTLA 1NWMX 2KINB 4CI1B 5FXVA 5ADXL 4OYJA 1D0ZA 1V9DA 3AAIA 3RKOA 5LG4A 2H3RA 1ZHCA 3ANWA 2BZBA 2Q9QC 4AKIA 2BDEA 3NRYA 3ZEFB 4GYRA 2E9XC 3CX6B 3F2EA 3OBVE 4PJJA 2XAHB 5EK3A 4GIWA 2Q9QB 2EHOB 1BR4A 5CA1E 4IDZA 3KDSE 4H63H 1S94A 3PUGA 2V1DB 3C50A 2X66A 5LBMA 2IC6A 3R6NA 3UTKA 5IHYA 4WW0A 1YW0A 2E8IA 3K8PC 3FXDB 4K0UA 3ZCIA 2BVLA 3CPZA 2X68A 4H9PC 5HAXA 1X79A 4UV8B 2W61A 1SHZC 3P7IA 5FXZA 5JDGA 1D0YA 3VKHA 1U4QA 4PAGA 4EYUA 3GMIA 3N9PA 3ZCJA 3BQIA 5LJNA 2RP4A 2L3LA 1NAFA 5HXSA 3UUNA 5CA0E 2X9HA 5JVDE 4TV8E 4GK5E 3O9XA 3MJXA 5EK4A 3PUSA 1FMVA 2VB6A 5L3EB 2W00A 2X9YA 5JRCB 4ZHQE 2KMFA 3PUAA 1MMGA 2H7VC 2JJ9A 5JDNA 4I55E 3MKDA 4L5GA 4XBFB 3NZPA 3SWHA 2E9XA 3E22E 2XAFB 4J2CA 1Y64B 3C4WA 4HGAA 4FI5A 3ZYMA 1WYCA 4QWNB 3J7Yq 4AQFC 1IAPA 1O3XA 5EZYE 4TUYE 3DP7A 3L3PA 5FP3A 4IE7A 4ISSA 3C64A 2YU1A 1YKEB 1VOMA 4UF0B 2WWUA 4YJ2E 4QXBB 2V7MA 3VKGA 3C4ZA 3ZC1A 4AKGA 2MYSA 3WI3A 2ODUA 1HS7A 2VK9A 5JDFA 2CXDA 3MA9A 4BA9A 4NUVA 4O8SA 3FBZA 5DABA 4ZI7E 4TX5A 4IGUA 4JEUB 4UVAB 4MBQA 2DWGA 4PK6A 2W0GA 2WAUA 3ZC0A 2BVMA 2EHOC 3AA1B 3OKQA 4ERRA 3DTOA 4PJNA 1KK7A 2CEAA 3CQGB 3ANWB 2JRKA 1LKXA 2DNXA 2H7OA 4JUYA 1MNDA 2X9WA 3ZYKA 3AVRA 1QSDA 1D1AA 1HCIA 4MHCA 3SOLA 1WYBA 3GA8A 3OYZA 3RYCE 3KFWX 3D0TA 1MIWA 2E9XB 4TZ4C 2YEVC 4CQIA 5LJMA 2XAGB 1KNZA 1T98A 3PU3A 3N9MA 3AAAB 3CWZB 3LK2B 1MNEA 4A56A 3DJBA 4ZS3A 4OYKA 1Z0PA 4ADZA 3CX7B 4PJMA 2DWKA 5E0OA 1WRDA 4H63V 4WBNE 4HE8A 1HG2A 4MALA 4QXCB 4O2BE 1FEWA 3CKDA 4BJNA 3ETVA 5L3DB 3E0ZA 3B13A 4EIWA 2B1EA 4JEHB 1FIOA 3ZMSB 3M65A 5FY7A 5FXWA 4HEAA 2CM0A 2LHNA 3LK42 3QUJA 4ZI3D 5HXRA 5J1GA 1ZV4X 2E9XD 3TKLB 5LHGB 1LRZA 2DI4A 4PFPA 3RRCA 3ZN0B 3N5LA 5FY0A 5L3GB 2PG8A 2MOZA 3LK3B 4IE5A 2LHRA 3B57A 3N2KE 2DLRA 4ZI3C 3GN5B 3GWHA 2XHEB 3KVBA 4OK0A 4TN7B 2ZM8A 5C8YE 2J1DG 2ZLYA 4DVDA 2XAQB 2X0LB 3LBXA 2VKHA 4E7SA 4WNKA 2Y6XA 5JR9C 3CX8B 3ZMVB 4I4TE 4E7ZA 1HF8A 5JREA 4DNDA 3H37A 3SS1A 2VL8A 4IHJE 5HXHA 5GONE 2WMNA 4X20E 4QX8B 3HKDE 3H3AA 3HKBE 4GYSA 4YLHA 3WAJA 2CLYC 4PNIA 3RC3A 2LSIA 1SA0E 3IEEA 4QXHB 4XAXB 4CZZB 1B7TA 1IJ6A 4ANJA 5F3JA 2KWHA 4Z8XA 1D1BA 1UX5A 3E08A 4IE6A 3ZMTB 3W15B 5HWXA 4ISTA 5HXCA 5J2TE 5DQWA 2LSKA 2NP9A 5LCYA 2X9XA 3LFMA 3PE0A 3RRWA 2P9BA 5CB4E 3Q5WA 2QA7A 5AFUL 2N2NA 3I0OA 4PK5A 5LGNB 2GK9A 4UELA 4KUMB 2WMOA 4DMWA 3SRZA 4KBMB 3C98B 2ZM2A 3V5SA 5JDMA 1OWAA 4ZOLE 2Q9QD 5L3FB 3MK7C 4O4JE 4PK4A 4EZHA 3RC8A 5FXXA 4U74A 4DBQA 1US7B 2C5JA 2XQYA 2HPLA 3OYXA 4H9QC 2D0TA 3CVRA 3NBXX 4M1PA 4QX7B 3HL6A 5H6QB 5H6RB 3NZQA 1YD8G 2L9QA 3PDYA 4CI2B 4U72A 2NW8A 3T8OA 3I9WA 4X1IE 2CXFA 3Q9DA 2K9AA 2A2FX 1BR0A 2NTXA 4JLEA 4EOZB 3KV9A 4YHJA 1E1HB 5EK2A 2C0SA 3ZMUB 4HTEA 1S35A 4MFRA 5M4YA 2LT3A 4EAHA 3ZMZB 2KXPB 2D0UA 2ES0A 2JMHA 2LSJA 3K3OA 3KINB 2CXLA 1ZKEA 3AAEB 3KVAA 5L3BB 2LOSA 4O2AE 4CXXA 2MTQA 5LBQB 4YFSA 5J2UE 3U78A 2OA5A 3UUMA 4HKAA 1ZEEA 3AA6B 4L0RA 5A1LA 2WBLA 4AXPA 5JDLA 1EZ3A 2LE8A 4H9OC 4HN9A 4ZI2C 4O4LE 3K3QC 3EUHA 1MIVA 3BK9A 4OFZA 3BQLA 2KNDA 2D2SA 4I43B 3I0QA 4PJLA 2IW5B 4EB6E 1LVFA 2IC9A 4G63A 3N9NA 4ZI2D 2JQQA 4WBOA 2V7IA 3VU7H 4BAYB 4EXTA 2XUEA 4UF0A 5JQGE 3ONXA 1IZNB 3CMLA 3FB2A 5DJQC 4IE0A 5HWYA 1H7CA 5LGTB 2CLYB 1D0XA 3KBUA 1VRBA 5FY1A 3ZJ2A 4V1Av 5FYMA 2CWYA 3ZPOA 4KMCA 4ILUA 4DO0A 1CUNA 3ZYLA 4IE4A 2K5BB 2WSSV 5DQVA 1U5PA 2YU2A 4AKRB 3Q2MA 2NW7A 5LYJE 2NTYA 2C5KT 3LJCA 2VKOA 1MMDA 2K24A 4UXNB 5TAOA 3IF8B 4ASKA 5L3CB 5LHIB 3KV5A 3N2OA 4F6RC 2NOXA 1OXZA 2Y8DA 3HR0A 2MBGA 3C51A 4AKLA 2DHRA 4HFVA 5HXEA 4P0AA 3EDVA 5FMNA 4FJOA 2YK0A 4AI6A 5IYZE 3F31A 1UCUA 2X51A 4C91A 3HKCE 2NW9A 2V26A 3RYFE 5JRCA 3OJAA 1HFAA 3N9OA 3I9YA 2LSGA 2HH7A 4X1KE 3PUQA 5JH7E 5LHHB 2N9DA 1WLXA 4EYYR 5KDMC 3A5XA 4DMVA 4XZCA 4UEMA 3Q5XA 5HYAA 3ETUA 3UFEA 2N1GA 2CCQA 3KV4A 4N78D 3CQXC 2D5UA 2ZMAA 1MIYA 4MLKA 1UX4A 3FXEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9S E;  4H9O C;  4H9R C;  4H9Q C;  4H9N C;  5KDM C;  4HGA A;  4H9P C; 
#chains in the Genus database with same CATH topology
 2UXX B;  2XSB A;  2ACX A;  3LBX B;  3AA7 B;  4P0B A;  2V5D A;  4DR1 T;  2M6B A;  4TWH A;  3RX6 A;  3P50 A;  3V5U A;  3FBL A;  2LRK A;  2K48 A;  5JDH A;  3BQK A;  2CWO A;  2BS3 A;  2WU2 A;  4HWH A;  2CE7 A;  2X0Y A;  3H3M A;  2EHO D;  4WYV A;  4AIU A;  1DU2 A;  5AQI B;  1HTJ F;  5F8P A;  4LF6 T;  4B3R T;  3NRX A;  1QUU A;  5HEJ A;  5LGU B;  3ONL C;  4JI6 T;  2UXB T;  3RH3 A;  4KP3 C;  1FMW A;  3IBP A;  4UIG A;  3EI0 A;  3HA4 A;  5ABF B;  2Q9Q A;  2LOP A;  3RYH E;  2V7J A;  3QC9 A;  5JR9 A;  2YN6 A;  2M67 A;  2VL0 A;  2JPF A;  3FZH B;  4IT4 A;  1J5W A;  4NXN T;  2L8K A;  3EDU A;  3O4X E;  2JMK A;  3HI2 A;  3IHR A;  1LVK A;  5AQF B;  4B3M T;  1KNP A;  1NEN A;  2WS3 A;  4PFO A;  1Z8U A;  2SPC A;  3P4Q A;  2FJA A;  1BR2 A;  2LEH A;  3HKE E;  3C4X A;  1HG5 A;  4DV6 T;  4NUU A;  4COF A;  2XAJ B;  3AVS A;  2A72 A;  1YKH B;  1G73 A;  3AB3 B;  2XQ7 A;  4QHO A;  5LOV E;  3X1D A;  2QYW A;  4CN4 A;  4YTN A;  2IAK A;  3PTR B;  4QH4 A;  5HCJ A;  4YSX A;  1N36 T;  3JAE A;  4UV9 B;  2ODV A;  2X67 A;  3J9X 1;  4LFB T;  2YOE A;  5L4E A;  3PUX F;  3ZJ1 A;  5HCM A;  2PFV A;  4DR5 T;  2K3W A;  3PU8 A;  2MAW A;  4OHF A;  4UVC B;  3K3N A;  2PBI A;  1UK5 A;  3VHL A;  3N9L A;  3AEC A;  5AQK B;  3MAC A;  4YXD A;  2A9U A;  4EZ4 A;  4DBR A;  3JC6 C;  2VKJ A;  3UUL A;  4L9I A;  2VAS A;  2E5L T;  4ZS2 A;  3PUW F;  4H9R C;  3S4U A;  3AE5 A;  1WR6 A;  2MPK A;  2CA5 A;  4WZX A;  1G8X A;  4JI5 T;  1HX8 A;  3EVY A;  1XDP A;  2KZ7 B;  2WDV A;  3KV6 A;  3RPU A;  1XMQ T;  5JR9 B;  2C5I T;  4HFH A;  2YIN A;  4I50 E;  5JDQ A;  2BKO A;  1JNR A;  4O4I E;  3UUB A;  1R8I A;  1KFY A;  3I1A A;  1BR1 A;  1KF6 A;  1MMN A;  2KWI B;  1MMA A;  3ESL A;  3N9Q A;  4YTM A;  3AED A;  4YTP A;  5L2L A;  3MXZ A;  4JBW F;  3LSV A;  1AJ3 A;  4YJ3 E;  1IJ5 A;  3ZT7 A;  2OLT A;  2W63 A;  2Y48 B;  4B6X A;  1D1C A;  5CGM A;  3GN5 A;  1M62 A;  4O4H E;  1OED C;  3N2G E;  2DCF A;  3L09 A;  4PW8 A;  3TLV A;  2LM9 A;  4YHH T;  3ZN1 B;  1WFD A;  2LSY A;  3FHN A;  4H9N C;  4BJM A;  2W62 A;  3O1J A;  2V7K A;  3U3I A;  5LP6 E;  3O1I A;  4QKN A;  2A3D A;  4IIJ E;  4DV3 T;  5ETW A;  3RYI E;  4KX6 A;  4U3C A;  1ZOY A;  2KLQ A;  1GQE A;  3AA0 B;  3JC6 D;  2H89 A;  3WAK A;  3AE9 A;  5BMV E;  4ZXL A;  3P8C D;  2VKD A;  4LF4 T;  4UVB B;  3O1H A;  2XAS B;  3PUV F;  4AQF A;  2VWA A;  4AKH A;  5IUX A;  2LJL A;  5LXT E;  3KBT A;  2UXN B;  2V6X A;  2V7L A;  4P09 A;  2CMR A;  4X1Y E;  3ZLI A;  4AQG A;  2UUC T;  2ZM0 A;  3UT5 E;  4LF8 T;  2H88 A;  2KT9 A;  4NIQ A;  4GOU A;  3QK6 A;  2QGS A;  4GK0 E;  2V6Y B;  3LG7 A;  1E2A A;  4C90 A;  2Z6E A;  2I59 A;  4LF7 T;  3Q5D A;  3AE2 A;  5LA6 E;  3UUX B;  1T8B A;  2G0U A;  2WM9 A;  5FNV E;  2RA1 A;  3R84 B;  4TV9 E;  3F57 A;  1UUS A;  1KNR A;  2PJQ A;  5KMG P;  2HPJ A;  4H9S E;  2CHO A;  4JI1 T;  4LF9 T;  5LNK A;  4G2A A;  3CQC B;  3Q5E A;  4CI3 B;  2EHO A;  2NWB A;  2XQ4 A;  2XJ7 A;  3PUR A;  4CXW A;  3MZK B;  2XTL A;  1NWM X;  2FJE A;  2KIN B;  4ILB A;  5FXV A;  4CI1 B;  5ADX L;  4OYJ A;  4DV1 T;  1D0Z A;  1V9D A;  2X0H A;  2XM2 A;  2XM1 A;  3AAI A;  2H3R A;  1ZHC A;  3ANW A;  5AQU B;  3RKO A;  2BZB A;  5BR8 T;  3AE3 A;  2Q9Q C;  4AKI A;  2BDE A;  3NRY A;  3L8R A;  3ZEF B;  3RI5 A;  4GYR A;  2E9X C;  3CX6 B;  3F2E A;  4IDO A;  5ABE A;  3OBV E;  4PJJ A;  4Z90 A;  4JI8 T;  4HFD A;  2XAH B;  5EK3 A;  2XQA A;  4GIW A;  1HNW T;  2Q9Q B;  2DL1 A;  2EHO B;  4TWD A;  1BR4 A;  5CA1 E;  4IDZ A;  4U33 A;  3FZM B;  4ZZB A;  1XWM A;  3KDS E;  4H63 H;  3K1S A;  2E5V A;  5ABF A;  4ZZC A;  1S94 A;  3PUG A;  4DR2 T;  2V1D B;  3C50 A;  2X66 A;  5LBM A;  2IC6 A;  3R6N A;  3UTK A;  4DR6 T;  5IHY A;  4WW0 A;  5AQM B;  1XDO A;  1YW0 A;  2E8I A;  1UUR A;  3FXD B;  3K8P C;  4K0U A;  3ZCI A;  2BVL A;  3CPZ A;  4B3T T;  2X68 A;  4H9P C;  2CPT A;  2V5C A;  5HAX A;  1X79 A;  4UV8 B;  2W61 A;  5ABG A;  1SHZ C;  3P7I A;  1J1J A;  5FXZ A;  5JDG A;  3CK6 A;  3QOF A;  1D0Y A;  3VKH A;  2UXC T;  4AQY T;  1U4Q A;  4PAG A;  4EYU A;  3GMI A;  3N9P A;  3ZCJ A;  5AQT B;  3NVO A;  3BQI A;  5LJN A;  2LM2 A;  2RP4 A;  2L3L A;  1NAF A;  5HXS A;  3UUN A;  5CA0 E;  2X9H A;  5JVD E;  2D9D A;  4TV8 E;  3P4R A;  4GK5 E;  3O9X A;  2J62 A;  3PUZ F;  3JCF A;  2UU9 T;  3MJX A;  5EK4 A;  2JQK A;  3PUS A;  1FMV A;  3SFE A;  4DR7 T;  1HNX T;  3A7M A;  3FZF B;  2VB6 A;  1YXR A;  3UFG A;  5L3E B;  1X9B A;  1VCT A;  2W00 A;  2X9Y A;  3L39 A;  3SFD A;  4YSZ A;  4ZHQ E;  4X66 T;  2KMF A;  1XNQ T;  5JRC B;  3PUA A;  1MMG A;  2H7V C;  2JJ9 A;  5JDN A;  4I55 E;  3MKD A;  5HEO A;  4L5G A;  5LB7 B;  1VCS A;  5JTG A;  3NZP A;  5IWA T;  3SWH A;  4XBF B;  3RHW A;  2E9X A;  3E22 E;  2XAF B;  4J2C A;  4DV2 T;  1Y64 B;  1W09 A;  3C4W A;  4HGA A;  4FI5 A;  1T7S A;  3ZYM A;  1WYC A;  5C3J A;  4QWN B;  3AE8 A;  2IML A;  3J7Y q;  4AQF C;  1IAP A;  1Y01 A;  1O3X A;  3PUY F;  4TUY E;  3DP7 A;  3L3P A;  5EZY E;  5FP3 A;  4IE7 A;  4ISS A;  3C64 A;  2YU1 A;  1YKE B;  1VOM A;  2WZI A;  4UF0 B;  4A98 A;  2WWU A;  4DID B;  4YJ2 E;  4QXB B;  2WCA A;  2V7M A;  2JQH A;  2V8S V;  3C4Z A;  4EEB A;  4GKJ T;  3VKG A;  3ZC1 A;  4KI0 F;  4AKG A;  2MYS A;  3WI3 A;  2ODU A;  1W0A A;  2VK9 A;  5AQL B;  1HS7 A;  5JDF A;  2CXD A;  4LF5 T;  2WDR A;  3TLS A;  3MA9 A;  4BA9 A;  2YDR A;  1YQ3 A;  2BG9 C;  4NUV A;  3FBZ A;  4HWD A;  4O8S A;  4TX5 A;  5DAB A;  3FZK B;  4IGU A;  4JEU B;  4UVA B;  1SUM B;  4MBQ A;  2DWG A;  4PK6 A;  2W0G A;  3RF1 A;  2HHH T;  2PTF A;  3NKZ A;  4NPP A;  3ZKR A;  4DV0 T;  2WAU A;  4JI4 T;  4JI0 T;  3ZC0 A;  2BVM A;  2EHO C;  3AA1 B;  3AEG A;  3OKQ A;  3PJA A;  1L0V A;  4ERR A;  2XQ6 A;  3DTO A;  4PJN A;  1KK7 A;  2CEA A;  3CQG B;  5KX5 E;  1I6Z A;  5ABH A;  2UUB T;  2XSA A;  3ANW B;  3RIU A;  2JRK A;  1LKX A;  2DNX A;  2H7O A;  5AQS B;  4JUY A;  1MND A;  2X9W A;  3ZYK A;  3AVR A;  1QSD A;  1D1A A;  1HCI A;  4MHC A;  3SOL A;  3AEE A;  1WYB A;  3GA8 A;  1N33 T;  3OYZ A;  3U78 A;  3RYC E;  3KFW X;  3D0T A;  2R6G F;  4QH1 A;  1MIW A;  2E9X B;  4TZ4 C;  2YEV C;  3RIF A;  4CQI A;  5LJM A;  5FL0 A;  2WZH A;  4K0K T;  3TLW A;  2XAG B;  1KNZ A;  2VQF T;  1T98 A;  3PU3 A;  3N9M A;  3AAA B;  2AXD S;  3CWZ B;  4X65 T;  2WWV A;  3OPC A;  3LK2 B;  1MNE A;  2IDO B;  4IRE A;  4A56 A;  3DJB A;  4ZS3 A;  2WU5 A;  4OYK A;  1Z0P A;  4ADZ A;  3CX7 B;  4PJM A;  2DWK A;  5E0O A;  1WRD A;  2BS4 A;  3AEB A;  4H63 V;  3UU5 A;  4HE8 A;  4WBN E;  1HG2 A;  4MAL A;  4QXC B;  1UX4 A;  5LG4 A;  3VRA A;  3ABV A;  5HEU A;  1T72 A;  4EGW A;  4IDQ A;  4O2B E;  1HNZ T;  1UGO A;  1FEW A;  3CKD A;  4BJN A;  3ETV A;  5L3D B;  3E0Z A;  3B13 A;  4U7I A;  4EIW A;  1YQ4 A;  2B1E A;  4JEH B;  1FIO A;  4TNW A;  4U31 A;  3ZMS B;  2VVN A;  4IDP A;  3M65 A;  4ILC A;  5AQR B;  5FY7 A;  2WQY A;  5FXW A;  2W66 A;  4HEA A;  2CM0 A;  2LHN A;  3LK4 2;  3QUJ A;  4ZI3 D;  5HXR A;  4YSY A;  5J1G A;  1ZV4 X;  2YKS A;  2E9X D;  3P4P A;  3TKL B;  5LHG B;  1LRZ A;  2DI4 A;  1W0B A;  4PFP A;  3RRC A;  4I0U A;  3QNU A;  3ZSS A;  3ZN0 B;  3N5L A;  2XQ3 A;  1XZY A;  5FY0 A;  2PG8 A;  2MOZ A;  3LK3 B;  5L3G B;  4DV7 T;  4IE5 A;  1J5E T;  3AE4 A;  2LHR A;  3PV0 F;  3B57 A;  3N2K E;  2DLR A;  5AQH B;  4ZI3 C;  4F8H A;  3GN5 B;  2BS2 A;  3GWH A;  2XHE B;  3KVB A;  4OK0 A;  4TN7 B;  2ZM8 A;  5C8Y E;  2J1D G;  3P4S A;  2ZLY A;  4DVD A;  2XAQ B;  2X0L B;  1XNR T;  3LBX A;  2VKH A;  4E7S A;  3AE7 A;  2Y6X A;  4WNK A;  5FVL A;  5JR9 C;  4YY3 T;  4LMJ A;  1M7K A;  3CX8 B;  3QB5 K;  3ZMV B;  2BKN A;  4KHP T;  5C2T A;  4I4T E;  4E7Z A;  1HF8 A;  5JRE A;  4DND A;  3H37 A;  3SS1 A;  1OED E;  2VL8 A;  4IHJ E;  2BG9 B;  5GON E;  5HXH A;  2WMN A;  4X20 E;  1HX1 B;  3A8Y C;  4QX8 B;  4ZEY A;  3HKD E;  3H3A A;  1W9R A;  2WY2 A;  1E7P A;  2WDQ A;  3HKB E;  4GYS A;  4YLH A;  3WAJ A;  4X64 T;  2JIW A;  2CLY C;  2LRL A;  3EHZ A;  4PNI A;  3RC3 A;  2LSI A;  1SA0 E;  3IEE A;  4QXH B;  4XAX B;  4CZZ B;  1B7T A;  1IJ6 A;  2NR4 A;  4ANJ A;  5F3J A;  2UUA T;  2KWH A;  3ONJ A;  4A5X A;  4Z8X A;  3RGL A;  1D1B A;  1UX5 A;  2RPA A;  3E08 A;  4IE6 A;  3ZMT B;  3W15 B;  4A97 A;  2JQ9 A;  4IST A;  4EV6 A;  5HXC A;  4EED A;  5HWX A;  2I0M A;  2VQE T;  1HR0 T;  5J2T E;  1FJG T;  4TWF A;  4JI2 T;  5DQW A;  2LSK A;  2NP9 A;  1CHU A;  2X9X A;  5LCY A;  3LFM A;  3PE0 A;  3RRW A;  2P9B A;  5CB4 E;  3Q5W A;  2QA7 A;  4Q25 A;  2N2N A;  3CIR A;  3I0O A;  5AQO B;  3ZT5 A;  5AFU L;  2KSR A;  4HFI A;  1ZP0 A;  2QVA A;  2XY8 B;  4PK5 A;  5AQN B;  2GK9 A;  5LGN B;  4UEL A;  5KXJ A;  4KHZ F;  4NXM T;  4KUM B;  2ACZ A;  2WMO A;  1QLB A;  4DMW A;  3SRZ A;  3UQ4 A;  2XZE A;  4KBM B;  3C98 B;  2ZM2 A;  2E2A A;  3QB5 A;  5FKY A;  2IHR 1;  1OED A;  1IBK T;  3V5S A;  5JDM A;  4CN6 A;  1OWA A;  4ZOL E;  5J0Z A;  2Q9Q D;  4HWC A;  5L3F B;  4IL9 A;  3MK7 C;  4O4J E;  4PK4 A;  2ZM6 T;  4EZH A;  3RC8 A;  5FXX A;  5L4H A;  3UU3 A;  1N34 T;  4U74 A;  4DBQ A;  1US7 B;  2C5J A;  2CBJ A;  2HPL A;  2XQY A;  3OYX A;  2D0T A;  3CVR A;  3NBX X;  4H9Q C;  4M1P A;  3HL6 A;  4QX7 B;  5H6Q B;  5H6R B;  3T1H T;  3NZQ A;  1YD8 G;  2W2U A;  2L9Q A;  3PDY A;  5AQQ B;  4U72 A;  4CI2 B;  5LG3 A;  2I6H A;  2NW8 A;  3T8O A;  5L47 A;  3I9W A;  3AEF A;  2FBW A;  4X1I E;  3RLF F;  2CXF A;  5FL1 A;  3Q9D A;  2M6I A;  2K9A A;  2A2F X;  1BR0 A;  3UU8 A;  4JYA T;  2NTX A;  4JLE A;  4EOZ B;  5AQJ B;  3KV9 A;  4YHJ A;  1E1H B;  5EK2 A;  2C0S A;  3ZMU B;  4HTE A;  4CN1 A;  1S35 A;  4MFR A;  5CJ5 A;  1IBM T;  5M4Y A;  2LT3 A;  4EAH A;  3ZMZ B;  2KXP B;  2D0U A;  2UXD T;  2ES0 A;  2JMH A;  2LKH A;  2LSJ A;  2VUR A;  2CXL A;  3K3O A;  3KIN B;  1ZKE A;  2BBJ A;  2OV9 A;  3AAE B;  3PJA J;  4Z91 A;  3AEA A;  2J4G A;  2XQ8 A;  3FZL B;  3VR8 A;  3KVA A;  3TLU A;  4TNV A;  2LOS A;  3NWI A;  5L3B B;  4O2A E;  4CXX A;  3RIU C;  4B3S T;  2MTQ A;  4DR4 T;  5LBQ B;  4YFS A;  5J2U E;  1KEY A;  2OA5 A;  4LML A;  4HKA A;  1ZEE A;  3AA6 B;  2CBI A;  4L0R A;  4U2Z A;  2WBL A;  3UUM A;  4AXP A;  5A1L A;  1EZ3 A;  5JDL A;  5AQP B;  4DUZ T;  2LE8 A;  4H9O C;  4HN9 A;  1IBL T;  4HFE A;  4ZI2 C;  2IIU A;  3K3Q C;  4O4L E;  3EAB A;  1MIV A;  3BK9 A;  3EUH A;  4OFZ A;  5F5W A;  5FVK A;  3BQL A;  3ZT6 A;  2KND A;  3AXJ B;  2D2S A;  3JAF A;  4JI3 T;  4I43 B;  3I0Q A;  3G06 A;  4PJL A;  2IW5 B;  4EB6 E;  4U7Y A;  1LVF A;  2IC9 A;  4G63 A;  2BKP A;  3N9N A;  4ZI2 D;  2YDS A;  2JQQ A;  4IL4 A;  4WBO A;  3VR9 A;  2FJD A;  3T1Y T;  2V7I A;  3VU7 H;  4BAY B;  3JAD A;  2V6Y A;  4YT0 A;  4JI7 T;  2B76 A;  2XUE A;  4UF0 A;  4EXT A;  4JV5 T;  2J47 A;  5JQG E;  2FJB A;  3ONX A;  1IZN B;  3CML A;  4HWI B;  3FB2 A;  4IDN A;  5DJQ C;  4DV5 T;  4IE0 A;  5HWY A;  5LMN T;  1H7C A;  3VRB A;  5LGT B;  2CLY B;  4LMK A;  1D0X A;  1I94 T;  3KBU A;  2W67 A;  1VRB A;  5FY1 A;  5HEG A;  3RQW A;  3ZJ2 A;  1XMO T;  4V1A v;  5FYM A;  2CWY A;  2LLY A;  4KMC A;  3ZPO A;  2F4V T;  3RKG A;  4DV4 T;  4ILU A;  3IA3 A;  3RQU A;  4DO0 A;  1CUN A;  3ZYL A;  4IE4 A;  2K5B B;  5AQG B;  2WSS V;  4X62 T;  4HFB A;  5DQV A;  1U5P A;  2BBH A;  2YU2 A;  4AKR B;  3Q2M A;  2BG9 E;  2NW7 A;  2XQ5 A;  5LYJ E;  2NTY A;  2C5K T;  3LJC A;  3LDQ B;  2VKO A;  3TLT A;  4GKK T;  3P4W A;  1MMD A;  2K24 A;  4UXN B;  5TAO A;  3IF8 B;  4ASK A;  2WP9 A;  5L3C B;  3KV5 A;  3N2O A;  4F6R C;  2NOX A;  2XQ9 A;  5LHI B;  1WCR A;  1OXZ A;  2Y8D A;  3HR0 A;  2MBG A;  3C51 A;  3RIA A;  2DHR A;  4HFV A;  4AKL A;  5HXE A;  3UQ7 A;  4DUY T;  4P0A A;  4OX9 T;  4UR9 A;  3EDV A;  3M3Z B;  5FMN A;  2W4X A;  5LMU T;  3B5M A;  3OVU A;  4FJO A;  4ILA A;  2YK0 A;  4DR3 T;  2HN1 A;  2LKG A;  2QRX A;  5IYZ E;  4AI6 A;  3F31 A;  2XPK A;  2WB5 A;  1UCU A;  2X51 A;  3UU6 A;  4C91 A;  3HKC E;  2NW9 A;  4HFC A;  3OTO T;  2FUP A;  4AIS A;  1JNZ A;  5HEH A;  2V26 A;  3RYF E;  4QH5 A;  5JRC A;  3OJA A;  1HFA A;  3N9O A;  4P1N A;  3I9Y A;  2LSG A;  2HH7 A;  4X1K E;  5CFB A;  3PUQ A;  4U2Y A;  4LFC T;  3AE6 A;  4ZI7 E;  1SE7 A;  5JH7 E;  5LHH B;  2N9D A;  1WLX A;  4EYY R;  5KDM C;  1WR0 A;  3A5X A;  4DMV A;  4XZC A;  3UU4 A;  5AQV B;  4HWF A;  1N32 T;  4LFA T;  2VVS A;  1OED B;  2YDQ A;  3Q5X A;  4UEM A;  5HYA A;  2HN2 A;  3ETU A;  2BG9 A;  2AE9 A;  3AXJ A;  3UFE A;  2N1G A;  2CCQ A;  3ZST A;  3KV4 A;  2CHN A;  3EAM A;  4N78 D;  3CQX C;  2D5U A;  4X5T A;  1NEK A;  2ZMA A;  2CRB A;  4CXY A;  1MIY A;  3AE1 A;  4MLK A;  2IUB A;  3FXE B; 
#chains in the Genus database with same CATH homology
 2UXX B;  3LBX B;  2ACX A;  3AA7 B;  4P0B A;  3RX6 A;  3V5U A;  3FBL A;  5JDH A;  2K48 A;  3BQK A;  2CWO A;  2CE7 A;  2EHO D;  1HTJ F;  5F8P A;  3NRX A;  1QUU A;  5LGU B;  3RH3 A;  4KP3 C;  1FMW A;  3IBP A;  4UIG A;  3HA4 A;  2Q9Q A;  2LOP A;  3RYH E;  2V7J A;  3QC9 A;  5JR9 A;  2M67 A;  2JPF A;  2L8K A;  3EDU A;  3O4X E;  2JMK A;  3HI2 A;  3IHR A;  1LVK A;  4PFO A;  2SPC A;  1BR2 A;  2LEH A;  3HKE E;  3C4X A;  1HG5 A;  4NUU A;  2XAJ B;  3AVS A;  2A72 A;  1YKH B;  1G73 A;  3AB3 B;  4QHO A;  5LOV E;  5KX5 E;  4CXY A;  2IAK A;  3PTR B;  4UV9 B;  3J9X 1;  2ODV A;  2X67 A;  3ZJ1 A;  2PFV A;  3PU8 A;  4OHF A;  4UVC B;  3K3N A;  2PBI A;  3VHL A;  3N9L A;  3MAC A;  4EZ4 A;  4DBR A;  3JC6 C;  2VKJ A;  3UUL A;  4L9I A;  2VAS A;  4ZS2 A;  4H9R C;  3S4U A;  1WR6 A;  2CA5 A;  4CXW A;  1G8X A;  1HX8 A;  3EVY A;  2KZ7 B;  3KV6 A;  3RPU A;  5JR9 B;  2C5I T;  4I50 E;  2YIN A;  5JDQ A;  4O4I E;  3I1A A;  1BR1 A;  1MMN A;  2KWI B;  1MMA A;  3ESL A;  3N9Q A;  5L2L A;  3MXZ A;  1AJ3 A;  4YJ3 E;  1IJ5 A;  2W63 A;  2Y48 B;  4B6X A;  1D1C A;  3GN5 A;  4O4H E;  3N2G E;  2DCF A;  3L09 A;  4PW8 A;  2LM9 A;  3ZN1 B;  3FHN A;  2LSY A;  4BJM A;  4H9N C;  2W62 A;  3O1J A;  2V7K A;  3U3I A;  5LP6 E;  3O1I A;  4QKN A;  2A3D A;  4IIJ E;  5ETW A;  3RYI E;  2KLQ A;  3AA0 B;  3WAK A;  3JC6 D;  5BMV E;  3P8C D;  2VKD A;  4UVB B;  3O1H A;  2XAS B;  4AQF A;  2VWA A;  4AKH A;  2LJL A;  5LXT E;  3KBT A;  2UXN B;  4P09 A;  2V7L A;  4X1Y E;  2CMR A;  3ZLI A;  4AQG A;  2ZM0 A;  3UT5 E;  2KT9 A;  4GOU A;  3QK6 A;  2QGS A;  4GK0 E;  3LG7 A;  4C90 A;  2Z6E A;  2I59 A;  5LA6 E;  3UUX B;  2G0U A;  2WM9 A;  5FNV E;  3R84 B;  2RA1 A;  4TV9 E;  3F57 A;  2PJQ A;  5KMG P;  2HPJ A;  4H9S E;  5LNK A;  4G2A A;  3CQC B;  4CI3 B;  2EHO A;  2NWB A;  3PUR A;  3MZK B;  2XTL A;  1NWM X;  2KIN B;  4CI1 B;  5FXV A;  5ADX L;  4OYJ A;  1D0Z A;  1V9D A;  3AAI A;  3RKO A;  5LG4 A;  2H3R A;  1ZHC A;  3ANW A;  2BZB A;  2Q9Q C;  4AKI A;  2BDE A;  3NRY A;  3ZEF B;  4GYR A;  2E9X C;  3CX6 B;  3F2E A;  3OBV E;  4PJJ A;  2XAH B;  5EK3 A;  4GIW A;  2Q9Q B;  2EHO B;  1BR4 A;  5CA1 E;  4IDZ A;  3KDS E;  4H63 H;  1S94 A;  3PUG A;  2V1D B;  3C50 A;  2X66 A;  5LBM A;  2IC6 A;  3R6N A;  3UTK A;  5IHY A;  4WW0 A;  1YW0 A;  2E8I A;  3K8P C;  3FXD B;  4K0U A;  3ZCI A;  2BVL A;  3CPZ A;  2X68 A;  4H9P C;  5HAX A;  1X79 A;  4UV8 B;  2W61 A;  1SHZ C;  3P7I A;  5FXZ A;  5JDG A;  1D0Y A;  3VKH A;  1U4Q A;  4PAG A;  4EYU A;  3GMI A;  3N9P A;  3ZCJ A;  3BQI A;  5LJN A;  2RP4 A;  2L3L A;  1NAF A;  5HXS A;  3UUN A;  5CA0 E;  2X9H A;  5JVD E;  4TV8 E;  4GK5 E;  3O9X A;  3MJX A;  5EK4 A;  3PUS A;  1FMV A;  2VB6 A;  5L3E B;  2W00 A;  2X9Y A;  5JRC B;  4ZHQ E;  2KMF A;  3PUA A;  1MMG A;  2H7V C;  2JJ9 A;  5JDN A;  4I55 E;  3MKD A;  4L5G A;  4XBF B;  3NZP A;  3SWH A;  2E9X A;  3E22 E;  2XAF B;  4J2C A;  1Y64 B;  3C4W A;  4HGA A;  4FI5 A;  3ZYM A;  1WYC A;  4QWN B;  3J7Y q;  4AQF C;  1IAP A;  1O3X A;  5EZY E;  4TUY E;  3DP7 A;  3L3P A;  5FP3 A;  4IE7 A;  4ISS A;  3C64 A;  2YU1 A;  1YKE B;  1VOM A;  4UF0 B;  2WWU A;  4YJ2 E;  4QXB B;  2V7M A;  3VKG A;  3C4Z A;  3ZC1 A;  4AKG A;  2MYS A;  3WI3 A;  2ODU A;  1HS7 A;  2VK9 A;  5JDF A;  2CXD A;  3MA9 A;  4BA9 A;  4NUV A;  4O8S A;  3FBZ A;  5DAB A;  4ZI7 E;  4TX5 A;  4IGU A;  4JEU B;  4UVA B;  4MBQ A;  2DWG A;  4PK6 A;  2W0G A;  2WAU A;  3ZC0 A;  2BVM A;  2EHO C;  3AA1 B;  3OKQ A;  4ERR A;  3DTO A;  4PJN A;  1KK7 A;  2CEA A;  3CQG B;  3ANW B;  2JRK A;  1LKX A;  2DNX A;  2H7O A;  4JUY A;  1MND A;  2X9W A;  3ZYK A;  3AVR A;  1QSD A;  1D1A A;  1HCI A;  4MHC A;  3SOL A;  1WYB A;  3GA8 A;  3OYZ A;  3RYC E;  3KFW X;  3D0T A;  1MIW A;  2E9X B;  4TZ4 C;  2YEV C;  4CQI A;  5LJM A;  2XAG B;  1KNZ A;  1T98 A;  3PU3 A;  3N9M A;  3AAA B;  3CWZ B;  3LK2 B;  1MNE A;  4A56 A;  3DJB A;  4ZS3 A;  4OYK A;  1Z0P A;  4ADZ A;  3CX7 B;  4PJM A;  2DWK A;  5E0O A;  1WRD A;  4H63 V;  4WBN E;  4HE8 A;  1HG2 A;  4MAL A;  4QXC B;  4O2B E;  1FEW A;  3CKD A;  4BJN A;  3ETV A;  5L3D B;  3E0Z A;  3B13 A;  4EIW A;  2B1E A;  4JEH B;  1FIO A;  3ZMS B;  3M65 A;  5FY7 A;  5FXW A;  4HEA A;  2CM0 A;  2LHN A;  3LK4 2;  3QUJ A;  4ZI3 D;  5HXR A;  5J1G A;  1ZV4 X;  2E9X D;  3TKL B;  5LHG B;  1LRZ A;  2DI4 A;  4PFP A;  3RRC A;  3ZN0 B;  3N5L A;  5FY0 A;  5L3G B;  2PG8 A;  2MOZ A;  3LK3 B;  4IE5 A;  2LHR A;  3B57 A;  3N2K E;  2DLR A;  4ZI3 C;  3GN5 B;  3GWH A;  2XHE B;  3KVB A;  4OK0 A;  4TN7 B;  2ZM8 A;  5C8Y E;  2J1D G;  2ZLY A;  4DVD A;  2XAQ B;  2X0L B;  3LBX A;  2VKH A;  4E7S A;  4WNK A;  2Y6X A;  5JR9 C;  3CX8 B;  3ZMV B;  4I4T E;  4E7Z A;  1HF8 A;  5JRE A;  4DND A;  3H37 A;  3SS1 A;  2VL8 A;  4IHJ E;  5HXH A;  5GON E;  2WMN A;  4X20 E;  4QX8 B;  3HKD E;  3H3A A;  3HKB E;  4GYS A;  4YLH A;  3WAJ A;  2CLY C;  4PNI A;  3RC3 A;  2LSI A;  1SA0 E;  3IEE A;  4QXH B;  4XAX B;  4CZZ B;  1B7T A;  1IJ6 A;  4ANJ A;  5F3J A;  2KWH A;  4Z8X A;  1D1B A;  1UX5 A;  3E08 A;  4IE6 A;  3ZMT B;  3W15 B;  5HWX A;  4IST A;  5HXC A;  5J2T E;  5DQW A;  2LSK A;  2NP9 A;  5LCY A;  2X9X A;  3LFM A;  3PE0 A;  3RRW A;  2P9B A;  5CB4 E;  3Q5W A;  2QA7 A;  5AFU L;  2N2N A;  3I0O A;  4PK5 A;  5LGN B;  2GK9 A;  4UEL A;  4KUM B;  2WMO A;  4DMW A;  3SRZ A;  4KBM B;  3C98 B;  2ZM2 A;  3V5S A;  5JDM A;  1OWA A;  4ZOL E;  2Q9Q D;  5L3F B;  3MK7 C;  4O4J E;  4PK4 A;  4EZH A;  3RC8 A;  5FXX A;  4U74 A;  4DBQ A;  1US7 B;  2C5J A;  2XQY A;  2HPL A;  3OYX A;  4H9Q C;  2D0T A;  3CVR A;  3NBX X;  4M1P A;  4QX7 B;  3HL6 A;  5H6Q B;  5H6R B;  3NZQ A;  1YD8 G;  2L9Q A;  3PDY A;  4CI2 B;  4U72 A;  2NW8 A;  3T8O A;  3I9W A;  4X1I E;  2CXF A;  3Q9D A;  2K9A A;  2A2F X;  1BR0 A;  2NTX A;  4JLE A;  4EOZ B;  3KV9 A;  4YHJ A;  1E1H B;  5EK2 A;  2C0S A;  3ZMU B;  4HTE A;  1S35 A;  4MFR A;  5M4Y A;  2LT3 A;  4EAH A;  3ZMZ B;  2KXP B;  2D0U A;  2ES0 A;  2JMH A;  2LSJ A;  3K3O A;  3KIN B;  2CXL A;  1ZKE A;  3AAE B;  3KVA A;  5L3B B;  2LOS A;  4O2A E;  4CXX A;  2MTQ A;  5LBQ B;  4YFS A;  5J2U E;  3U78 A;  2OA5 A;  3UUM A;  4HKA A;  1ZEE A;  3AA6 B;  4L0R A;  5A1L A;  2WBL A;  4AXP A;  5JDL A;  1EZ3 A;  2LE8 A;  4H9O C;  4HN9 A;  4ZI2 C;  4O4L E;  3K3Q C;  3EUH A;  1MIV A;  3BK9 A;  4OFZ A;  3BQL A;  2KND A;  2D2S A;  4I43 B;  3I0Q A;  4PJL A;  2IW5 B;  4EB6 E;  1LVF A;  2IC9 A;  4G63 A;  3N9N A;  4ZI2 D;  2JQQ A;  4WBO A;  2V7I A;  3VU7 H;  4BAY B;  4EXT A;  2XUE A;  4UF0 A;  5JQG E;  3ONX A;  1IZN B;  3CML A;  3FB2 A;  5DJQ C;  4IE0 A;  5HWY A;  1H7C A;  5LGT B;  2CLY B;  1D0X A;  3KBU A;  1VRB A;  5FY1 A;  3ZJ2 A;  4V1A v;  5FYM A;  2CWY A;  3ZPO A;  4KMC A;  4ILU A;  4DO0 A;  1CUN A;  3ZYL A;  4IE4 A;  2K5B B;  2WSS V;  5DQV A;  1U5P A;  2YU2 A;  4AKR B;  3Q2M A;  2NW7 A;  5LYJ E;  2NTY A;  2C5K T;  3LJC A;  2VKO A;  1MMD A;  2K24 A;  4UXN B;  5TAO A;  3IF8 B;  4ASK A;  5L3C B;  5LHI B;  3KV5 A;  3N2O A;  4F6R C;  2NOX A;  1OXZ A;  2Y8D A;  3HR0 A;  2MBG A;  3C51 A;  4AKL A;  2DHR A;  4HFV A;  5HXE A;  4P0A A;  3EDV A;  5FMN A;  4FJO A;  2YK0 A;  4AI6 A;  5IYZ E;  3F31 A;  1UCU A;  2X51 A;  4C91 A;  3HKC E;  2NW9 A;  2V26 A;  3RYF E;  5JRC A;  3OJA A;  1HFA A;  3N9O A;  3I9Y A;  2LSG A;  2HH7 A;  4X1K E;  3PUQ A;  5JH7 E;  5LHH B;  2N9D A;  1WLX A;  4EYY R;  5KDM C;  3A5X A;  4DMV A;  4XZC A;  4UEM A;  3Q5X A;  5HYA A;  3ETU A;  3UFE A;  2N1G A;  2CCQ A;  3KV4 A;  4N78 D;  3CQX C;  2D5U A;  2ZMA A;  1MIY A;  4MLK A;  1UX4 A;  3FXE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...