4HGAA

Structure of the variant histone h3.3-h4 heterodimer in complex with its chaperone daxx
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
207
structure length
207
Chain Sequence
b'QDPSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDPALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Death domain-associated protein 6
molecule tags Chaperone/apoptosis
source organism Homo sapiens
publication title Structure of the variant histone H3.3-H4 heterodimer in complex with its chaperone DAXX.
pubmed doi rcsb
total genus 69
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2012-10-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2170 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4hgaA00
5KDMC 4H9PC 4H9QC 4HGAA 4H9RC 4H9NC 4H9OC 4H9SE
chains in the Genus database with same CATH superfamily
2BDEA 3QOFA 5J0ZA 3EUHA 4HFCA 2D0TA 1MNEA 2G0UA 5HWYA 2E9XC 2J1DG 3Q5EA 5LXTE 5LG4A 4DBQA 4DR1T 2DL1A 5JRCB 1UURA 3WAJA 5DQWA 2WP9A 5C8YE 3AEDA 4PJLA 4LFBT 4QH4A 1H7CA 3NZQA 1HG5A 5FXZA 3IBPA 4I0UA 3RF1A 3MA9A 3AE3A 3FZKB 1QLBA 4O2BE 4X1YE 3EI0A 4IE7A 4WZXA 2V8SV 4EEDA 2K48A 3Q5DA 4DR2T 1N34T 5JR9C 2GK9A 4DV4T 3KV6A 1HS7A 4MALA 2YU2A 2UU9T 2ZMAA 4EZ4A 1MIWA 3N5LA 4EYUA 2LKGA 2XSAA 1XDPA 3V5UA 5AQQB 5EK4A 2XQ5A 2XY8B 3EAMA 3NVOA 5FMNA 4YSZA 3HA4A 2ZM2A 3BQKA 2BZBA 4X1KE 5AQLB 3ONJA 5LBMA 3VR8A 5LJNA 5JREA 3RYIE 1J1JA 4LMKA 2LM9A 2DNXA 5L47A 4B3ST 3C64A 5HXRA 3N9MA 4WW0A 3P4WA 3TLWA 3DP7A 4DR4T 2LM2A 3AE7A 3AE1A 2VKHA 1WCRA 3HKCE 2V26A 2WBLA 1CUNA 3NWIA 1W0BA 4U3CA 3AEAA 1LKXA 3M3ZB 5FL0A 3ZMZB 4YHHT 2MBGA 3P4PA 3F2EA 2NW9A 3KV4A 5BR8T 5IWAT 4IE4A 2X0YA 5LHHB 2Q9QA 1NEKA 1MNDA 4HWDA 2WSSV 4EYYR 1XWMA 2ZM8A 2F4VT 2LRKA 3IF8B 2L3LA 4OX9T 3I0OA 2KWHA 2LE8A 4U33A 4UV8B 4C91A 2XQ6A 4U31A 4WYVA 1Z0PA 2C5KT 2IHR1 4Q25A 4WBOA 4O4LE 3SWHA 4TWFA 5JVDE 1D0XA 4TWHA 5AQPB 3E0ZA 2K3WA 1HNXT 4QHOA 4QXCB 4ANJA 5J2UE 5HCJA 3PV0F 4DR6T 2VL8A 1KNPA 2YDQA 3MXZA 3CIRA 3ZYKA 4ZOLE 3KDSE 1T98A 3RLFF 2JQQA 3LSVA 2CEAA 2LKHA 4AQGA 3FXEB 2XM2A 2OA5A 1G8XA 4NIQA 4UVCB 3GWHA 4M1PA 2V6YB 2FJBA 2BG9A 5CA1E 2XTLA 1IBKT 3L3PA 3VU7H 2L8KA 3UU4A 4A56A 4DMVA 2IIUA 3GN5A 3K1SA 5EK2A 1YW0A 3PDYA 4H9SE 4UVBB 1Y01A 3RC3A 2BKOA 2X9HA 1D0ZA 2XQ4A 3HKEE 2X9XA 4AKRB 4DNDA 1W9RA 2W62A 4I55E 5F8PA 4QKNA 2A2FX 5LP6E 4I43B 2YOEA 4KX6A 4OYJA 4AQFC 2BG9E 2BG9B 3T1HT 4AQFA 4DIDB 3QC9A 4AKLA 4GKJT 2XQYA 4UR9A 5LGUB 2B1EA 2SPCA 4OYKA 3CK6A 2C5IT 2NWBA 3AB3B 4ZI7E 3OBVE 4ILBA 4ZI2C 4DUZT 3H37A 2JMKA 4U2ZA 1S94A 1R8IA 5LGTB 4LF8T 1YKEB 4WBNE 2CBJA 3UQ4A 1KK7A 2V5DA 3RRCA 1G73A 2WDQA 2WDRA 2WZIA 1OWAA 4KHZF 3TLVA 4LF7T 2CA5A 1OEDB 4IL4A 3CX8B 4PFPA 5ETWA 5KMGP 1MIVA 1V9DA 3ZYMA 2QVAA 5H6RB 3KV9A 4B3TT 2WDVA 2Q9QB 3UU5A 2W61A 3FZLB 3AXJB 2WQYA 4LMLA 2WAUA 3RIAA 3I1AA 2JQHA 3PJAJ 2CCQA 3B5MA 4ERRA 1FEWA 3NRXA 4NXMT 5BMVE 2UXCT 2AE9A 5C2TA 5ABFB 1UX5A 5FXVA 4JI5T 2CXLA 2V7MA 3E08A 3TKLB 4DR7T 1WRDA 2BG9C 3NZPA 1LRZA 2VURA 1BR2A 4QWNB 4YTPA 1IZNB 4CN4A 2XJ7A 1T7SA 2C5JA 1SE7A 3JAEA 2BS3A 1D1CA 2JRKA 3PUAA 4KI0F 1WLXA 5EK3A 4CXWA 2QGSA 1J5WA 5JDQA 4JI2T 5CGMA 2WS3A 2CRBA 2WCAA 3N2GE 4EZHA 2KXPB 4QXHB 2IAKA 1HCIA 2UUCT 2WM9A 2CXFA 3AA0B 3N9LA 4H9NC 4U7IA 4IE0A 3AE8A 3N9PA 1IJ6A 3OYXA 3E22E 2LJLA 3N9OA 5HWXA 5L3GB 4IDPA 1SHZC 5J2TE 3CQCB 2VWAA 3PUQA 2WB5A 2E9XA 4DV2T 4G2AA 3QK6A 2I6HA 2LOPA 5FYMA 3UU8A 5L4EA 3FXDB 3IHRA 2ZLYA 5FNVE 4L9IA 4B3RT 1QSDA 2KMFA 2DHRA 4IDNA 5JDNA 2V6XA 1KF6A 2DCFA 2YDSA 3A5XA 3FHNA 3HL6A 4H63H 3ZKRA 4EAHA 4ZI2D 2CWOA 3ONXA 3AVRA 4P1NA 4DBRA 4HWHA 1MMDA 2NTYA 5CJ5A 4TNWA 1BR4A 4AISA 5JR9B 3RHWA 2H89A 5JR9A 4NUUA 5ADXL 1IJ5A 2D9DA 3ZN0B 4BA9A 2CHNA 3TLSA 4ILUA 3PJAA 2D5UA 4GK5E 4KUMB 1OEDC 5HXCA 1US7B 3CX7B 3J7Yq 2VKDA 2CWYA 3FBLA 3JAFA 2WU5A 3EHZA 2E9XD 1WFDA 3ZPOA 2FJDA 4IDOA 1ZP0A 3RKOA 4YHJA 2E9XB 2WMOA 2YINA 3GMIA 3JADA 2JQ9A 3M65A 3MJXA 4OHFA 4KP3C 4CXXA 5HXHA 1Y64B 4DUYT 4GIWA 2VQET 1KFYA 4B6XA 2UUAT 1XNRT 3K3NA 5L3FB 1Z8UA 1W0AA 2VASA 3AEGA 4XAXB 2CPTA 5FL1A 2A3DA 4HFEA 3FZHB 2X9YA 3PUXF 1NAFA 2KSRA 2LSGA 3EDUA 3ZYLA 3K3QC 2X67A 1ZOYA 1ZKEA 2N2NA 3P8CD 3KBTA 4XZCA 2NTXA 2E5VA 2LSKA 5LOVE 3AE9A 5C3JA 5M4YA 3RIUA 4ZZCA 4L0RA 4HWFA 4TN7B 3HKBE 2X51A 4DVDA 2LSYA 1XZYA 3NBXX 4HTEA 1OEDE 2VB6A 3CQGB 3KBUA 2CBIA 3MZKB 2WWVA 2ACZA 2YDRA 3CQXC 2JQKA 3OVUA 3KINB 4JUYA 4EOZB 5AQFB 2XQ7A 2DI4A 5L3EB 4ISSA 2NW7A 3AA6B 3KVBA 3L09A 4HE8A 2FBWA 3ZT7A 4ADZA 3UULA 1WYBA 2C0SA 2FUPA 2FJEA 1CHUA 2MOZA 3PUVF 1ZHCA 4YSXA 3QNUA 1OEDA 3BK9A 2PJQA 5HEOA 4F6RC 1N33T 3P4RA 2EHOA 4ILCA 1FMVA 2W0GA 3LDQB 4G63A 4L5GA 3ZMUB 3RIFA 4PNIA 2IC9A 3QUJA 3FB2A 4J2CA 2CLYC 5HAXA 3EDVA 3K3OA 3O4XE 4ZXLA 4GYRA 5GONE 5FXXA 2KNDA 1UCUA 4UXNB 4XBFB 3I0QA 1UK5A 4YJ3E 4AQYT 4YTMA 1HNZT 2JPFA 5FVKA 5L4HA 5LG3A 2IDOB 3AVSA 1D1BA 2UXXB 4ZEYA 1IBLT 2NOXA 2XUEA 3JC6C 4QXBB 1HX1B 5LJMA 3ZMVB 4IGUA 3ZSTA 2Y6XA 2XASB 3RX6A 4EIWA 3AE6A 5ABFA 5L3CB 2XAFB 1MMAA 3AE4A 5JDGA 4P0AA 2BBHA 2K9AA 3GN5B 3L39A 2ZM0A 3VHLA 2AXDS 4GYSA 1UUSA 3UFEA 4CN6A 4NXNT 3LK42 3N2OA 4U74A 3ZT5A 2ACXA 5LB7B 3T1YT 1B7TA 4KMCA 3ZCJA 4YY3T 2I0MA 3ANWA 3ETUA 3C51A 3P4QA 2VKJA 4H9OC 3Q2MA 1JNRA 4BJNA 5CA0E 4O4IE 2FJAA 2M6BA 4TUYE 2LEHA 5FXWA 3AAIA 3G06A 3NRYA 5A1LA 4BAYB 4GK0E 2KT9A 4I4TE 3OPCA 5JDFA 4JV5T 2XAGB 4IT4A 4CZZB 4YT0A 1M7KA 4H9PC 3AEFA 2V7JA 3PUGA 3PUYF 4MBQA 3FBZA 3ZT6A 5LHGB 4PK5A 1YXRA 5L2LA 4DR3T 1ZV4X 2QYWA 3ONLC 2MTQA 4IE5A 4LF5T 2P9BA 4UEMA 3SFEA 3WAKA 3OTOT 3UFGA 2KWIB 2PBIA 3RI5A 3JC6D 4QX7B 4HWIB 2V1DB 3LJCA 4H9RC 2NR4A 1I6ZA 1X79A 2A9UA 3RRWA 2J4GA 1HFAA 2BKNA 2PTFA 2YKSA 4HFDA 5JDHA 2YU1A 3UUXB 5LMNT 4IE6A 4MFRA 3VKHA 3ESLA 5J1GA 4E7ZA 5CFBA 4AXPA 1HG2A 1NENA 4X66T 4BJMA 2CHOA 2WMNA 4MHCA 5JDLA 4NUVA 4AKGA 5AQNB 4F8HA 4IL9A 4PW8A 5EZYE 3CWZB 2M67A 2UXDT 2WWUA 5AQVB 3R6NA 2W63A 4C90A 4LFAT 3UU3A 5KXJA 3CX6B 3HR0A 1NWMX 3N9NA 2CMRA 3RQWA 4P09A 3RPUA 4QH5A 2ODUA 5DQVA 2A72A 2D2SA 3LG7A 4FJOA 3FZFB 3KVAA 2L9QA 4OFZA 4ZI3C 3DTOA 4PJJA 4YJ2E 4KBMB 2BVLA 2EHOB 4DO0A 3QB5K 2H3RA 2J47A 2R6GF 2VKOA 4Z91A 2N1GA 3RYFE 4GKKT 3F31A 3TLUA 3F57A 4DV7T 2UUBT 2OLTA 5KDMC 3VKGA 5HEUA 1LVKA 3AAEB 2JJ9A 3AAAB 2W66A 1D0YA 4GOUA 2XZEA 1N32T 2LLYA 2VL0A 5H6QB 4CQIA 2QA7A 2XAJB 4ZHQE 1XNQT 3AEEA 4ISTA 4JLEA 4CI3B 3C4WA 5IUXA 1S35A 4JEUB 2H7VC 4EEBA 1EZ3A 4QH1A 2WZHA 3KV5A 4YXDA 3PU8A 5LCYA 3A7MA 2W67A 1GQEA 5LMUT 1UX4A 3UT5E 5ABHA 3EABA 4H63V 1T72A 3VRBA 3LBXA 2B76A 2E2AA 4A5XA 5AQRB 4K0UA 3K8PC 1XMOT 3O1JA 4A98A 1O3XA 2CXDA 2YK0A 4N78D 5IYZE 1MMNA 4O2AE 3V5SA 2DWGA 2V7LA 2YEVC 4HFVA 4HKAA 3LFMA 4COFA 5ABGA 4AKIA 3VR9A 2LSIA 5HYAA 4EXTA 5HXEA 5AFUL 4ILAA 2NP9A 2BVMA 2PG8A 2OV9A 3CKDA 3GA8A 4CN1A 4X65T 4JI1T 4IIJE 3I9YA 5CB4E 2IMLA 2PFVA 3JCFA 3SRZA 2VQFT 5L3BB 5FP3A 2MYSA 1IBMT 3N9QA 4LMJA 3B57A 1N36T 5JRCA 3B13A 3PE0A 4HFIA 2KLQA 2Q9QC 3O9XA 5ABEA 4Z90A 3Q9DA 3UU6A 2XAQB 1U5PA 2N9DA 2Z6EA 4YFSA 5DJQC 4PK4A 2RP4A 3AE2A 4V1Av 5AQSB 4DV6T 2H88A 2JIWA 2IUBA 4FI5A 4X20E 4X62T 4AI6A 2WY2A 4TNVA 3RYCE 2X66A 5AQGB 3ZJ2A 3EVYA 3WI3A 3MKDA 4UIGA 3LK2B 1ZEEA 3ZMSB 3ZEFB 3UUNA 4LF9T 4IHJE 5HEGA 1FJGT 5FKYA 3ZJ1A 3PUWF 3UUMA 3P7IA 5LA6E 4I50E 1OXZA 3O1IA 4K0KT 1WR0A 4QX8B 5LGNB 1KNZA 4HFBA 1HX8A 4NPPA 5HCMA 3NKZA 1FMWA 4TZ4C 3SFDA 4LF6T 3P4SA 4DR5T 2HPJA 4X64T 4JYAT 2QRXA 4IDZA 4TWDA 2E8IA 5FVLA 4ZI3D 1MMGA 1L0VA 3O1HA 2RPAA 1IAPA 2W00A 2X9WA 3PUZF 4HGAA 3D0TA 4OK0A 4WNKA 5JTGA 5AQMB 3ZCIA 1DU2A 1FIOA 4U72A 2CLYB 4DMWA 2K24A 1KEYA 2MAWA 5DABA 5FY1A 4ZS2A 2LHRA 4PJMA 2WU2A 3OJAA 3Q5XA 4JEHB 2XHEB 5LBQB 5F3JA 4HEAA 4IDQA 5AQTB 3S4UA 3AXJA 4PJNA 3X1DA 3VRAA 3OYZA 2VVNA 2W4XA 2BBJA 2KZ7B 1WR6A 3CVRA 1JNZA 2HH7A 4KHPT 4JI8T 4LFCT 1VCSA 2XAHB 3P50A 2XM1A 3H3AA 4MLKA 3UUBA 2NW8A 5L3DB 1U4QA 3OKQA 4PFOA 4O4HE 2XQAA 4JBWF 1VRBA 4O4JE 3PU3A 5HXSA 1D1AA 1HTJF 4U2YA 5LNKA 3ZC1A 4JI7T 3RKGA 4UF0A 2V5CA 3ANWB 4HFHA 4UELA 3RQUA 3MK7C 3FZMB 5LYJE 1I94T 3RC8A 1VOMA 1YQ3A 1HF8A 2HPLA 2LSJA 2Q9QD 3AEBA 4TV8E 3RYHE 2XQ3A 2LRLA 4CI2B 4JI3T 1E1HB 2XPKA 2E5LT 2DWKA 3C50A 3I9WA 3ZMTB 5AQIB 5JQGE 4P0BA 5F5WA 5AQUB 3A8YC 3W15B 1T8BA 2LHNA 4CI1B 4CXYA 4LF4T 5AQOB 2ODVA 2Y48B 4YLHA 1AJ3A 3PTRB 2V6YA 4HWCA 3CPZA 3J9X1 1XMQT 4E7SA 2D0UA 2BS4A 2BKPA 2EHOD 2LOSA 1BR1A 3LK3B 4YSYA 4B3MT 1UGOA 1YKHB 4UF0B 3RIUC 3Q5WA 1J5ET 3C4ZA 3N2KE 3IEEA 4TX5A 4Z8XA 2X0HA 2J62A 4DV5T 2UXBT 2VK9A 2DLRA 1XDOA 2LT3A 3IA3A 3SOLA 1BR0A 4EB6E 3ETVA 5AQKB 2X0LB 4PK6A 2HHHT 3CMLA 3HKDE 1M62A 2V7KA 1WYCA 1YQ4A 2CM0A 3C4XA 3KFWX 2Y8DA 1YD8G 3MACA 3QB5A 3T8OA 4A97A 4ASKA 4IREA 5AQHB 5E0OA 3UQ7A 5KX5E 3L8RA 4X1IE 3UTKA 3U78A 5HEHA 2ZM6T 3ZN1B 3DJBA 2MPKA 2YN6A 4PAGA 1MIYA 2EHOC 3ZLIA 4AIUA 1QUUA 5JDMA 5FY7A 2H7OA 1HNWT 5AQJB 4AKHA 4DV0T 4X5TA 1SUMB 2V7IA 4JI0T 4DV3T 2UXNB 1LVFA 4H9QC 3AECA 2IC6A 3TLTA 3ZSSA 3PUSA 3BQIA 5JH7E 3U3IA 4TV9E 3PURA 3HI2A 2HN2A 4ZS3A 3RGLA 1KNRA 4UV9B 2VVSA 3C98B 2JMHA 5HEJA 3ZC0A 4U7YA 2RA1A 2IW5B 1X9BA 2CE7A 1W09A 2XQ9A 4UVAB 1VCTA 2I59A 2XSBA 2XQ8A 4HN9A 2HN1A 2K5BB 5TAOA 3H3MA 4JI4T 2X68A 4EGWA 2BS2A 3LBXB 2M6IA 3AE5A 1SA0E 4O8SA 5IHYA 4ZZBA 1E2AA 4YTNA 3AA7B 4DV1T 5FY0A 2KINB 3BQLA 3AA1B 3R84B 2W2UA 2ES0A 1HR0T 4JI6T 4EV6A 5LHIB 3ABVA 3SS1A 1E7PA 3RH3A
chains in the Genus database with same CATH topology
2BDEA 3EUHA 5LXTE 2D0TA 1MNEA 2G0UA 5HWYA 2E9XC 2J1DG 5LG4A 4DBQA 5JRCB 3WAJA 5DQWA 5C8YE 4PJLA 1H7CA 3NZQA 1HG5A 5FXZA 3IBPA 3MA9A 4O2BE 4X1YE 4IE7A 2K48A 5JR9C 2GK9A 3KV6A 1HS7A 4MALA 2YU2A 2ZMAA 4EZ4A 1MIWA 3N5LA 4EYUA 3V5UA 5EK4A 5FMNA 3HA4A 2ZM2A 3BQKA 2BZBA 4X1KE 5LBMA 5LJNA 5JREA 3RYIE 2LM9A 2DNXA 3C64A 5HXRA 3N9MA 4WW0A 3DP7A 3HKCE 2VKHA 2V26A 2WBLA 1CUNA 1LKXA 3ZMZB 2MBGA 3F2EA 2NW9A 3KV4A 4IE4A 5LHHB 2Q9QA 1MNDA 2WSSV 4EYYR 2ZM8A 3IF8B 2L3LA 3I0OA 2KWHA 2LE8A 4C91A 4UV8B 1Z0PA 2C5KT 4WBOA 3SWHA 4O4LE 5JVDE 1D0XA 3E0ZA 4QHOA 4QXCB 4ANJA 5J2UE 2VL8A 3MXZA 3ZYKA 4ZOLE 3KDSE 1T98A 2JQQA 2CEAA 4AQGA 3FXEB 2OA5A 1G8XA 4UVCB 3GWHA 4M1PA 5CA1E 2XTLA 3L3PA 3VU7H 2L8KA 4A56A 4DMVA 3GN5A 5EK2A 1YW0A 3PDYA 4H9SE 4UVBB 3RC3A 5KDMC 2X9HA 1D0ZA 3HKEE 4DNDA 2X9XA 4AKRB 2W62A 4I55E 5F8PA 4QKNA 2A2FX 5LP6E 4I43B 4AQFC 4OYJA 4AQFA 3QC9A 4AKLA 2XQYA 5LGUB 2B1EA 2SPCA 4OYKA 2C5IT 2NWBA 3AB3B 4ZI7E 3OBVE 4ZI2C 3H37A 2JMKA 1S94A 5LGTB 4WBNE 1YKEB 1KK7A 3RRCA 1G73A 1OWAA 2CA5A 5ETWA 5KMGP 3CX8B 4PFPA 1MIVA 1V9DA 3ZYMA 5H6RB 3KV9A 2Q9QB 2W61A 2WAUA 3I1AA 2CCQA 4ERRA 1FEWA 3NRXA 5BMVE 1UX5A 5FXVA 2CXLA 2V7MA 3E08A 3TKLB 1WRDA 3NZPA 1LRZA 4QWNB 1BR2A 1IZNB 2C5JA 2JRKA 1D1CA 3PUAA 5EK3A 1WLXA 4CXWA 2QGSA 5JDQA 3N2GE 4EZHA 2KXPB 4QXHB 2IAKA 1HCIA 2WM9A 2CXFA 3AA0B 3N9LA 4H9NC 4IE0A 3N9PA 1IJ6A 3OYXA 3E22E 2LJLA 3N9OA 5HWXA 5L3GB 5J2TE 1SHZC 3CQCB 2VWAA 3PUQA 2E9XA 4G2AA 3QK6A 2LOPA 5FYMA 3FXDB 3IHRA 2ZLYA 5FNVE 4L9IA 1QSDA 2KMFA 2DHRA 5JDNA 2DCFA 3A5XA 3FHNA 4H63H 3HL6A 4ZI2D 4EAHA 2CWOA 3ONXA 3AVRA 4DBRA 1MMDA 2NTYA 5JR9B 1BR4A 5ADXL 5JR9A 4NUUA 1IJ5A 3ZN0B 4BA9A 4ILUA 2D5UA 4GK5E 4KUMB 5HXCA 1US7B 3CX7B 3J7Yq 2VKDA 2CWYA 3FBLA 2E9XD 3ZPOA 3RKOA 4YHJA 2E9XB 2WMOA 2YINA 3GMIA 3M65A 3MJXA 4OHFA 4KP3C 4CXXA 5HXHA 1Y64B 4GIWA 4B6XA 3K3NA 5L3FB 2VASA 4XAXB 2A3DA 2X9YA 1NAFA 2LSGA 3EDUA 3K3QC 2X67A 1ZKEA 2N2NA 3P8CD 3KBTA 4XZCA 2NTXA 5M4YA 2LSKA 5LOVE 4L0RA 4TN7B 3HKBE 2X51A 4DVDA 2LSYA 3NBXX 4HTEA 3KBUA 2VB6A 3CQGB 3MZKB 3ZYLA 3CQXC 4JUYA 3KINB 4EOZB 2DI4A 5L3EB 4ISSA 2NW7A 3AA6B 3KVBA 3L09A 4HE8A 4ADZA 3UULA 1WYBA 2C0SA 2MOZA 1ZHCA 3BK9A 2PJQA 4F6RC 2EHOA 4L5GA 1FMVA 2W0GA 4G63A 3ZMUB 4PNIA 2IC9A 3QUJA 3FB2A 4J2CA 2CLYC 5HAXA 3EDVA 3K3OA 3O4XE 4GYRA 5GONE 5FXXA 2KNDA 1UCUA 4UXNB 4XBFB 3I0QA 4YJ3E 2JPFA 3AVSA 1D1BA 2UXXB 2NOXA 2XUEA 3JC6C 4QXBB 5LJMA 3ZMVB 4IGUA 2Y6XA 2XASB 3RX6A 4EIWA 5L3CB 2XAFB 1MMAA 5JDGA 4P0AA 2K9AA 3GN5B 2ZM0A 3VHLA 4GYSA 3UFEA 3LK42 3N2OA 4U74A 2ACXA 1B7TA 4KMCA 3ZCJA 3ETUA 3ANWA 3C51A 2VKJA 4H9OC 3Q2MA 4BJNA 5CA0E 4O4IE 4TUYE 2LEHA 5FXWA 3AAIA 3NRYA 5A1LA 4BAYB 4GK0E 2KT9A 4I4TE 5JDFA 2XAGB 4CZZB 4H9PC 2V7JA 3PUGA 4MBQA 5L2LA 3FBZA 5LHGB 4PK5A 1ZV4X 4IE5A 2MTQA 2P9BA 4UEMA 3WAKA 2KWIB 2PBIA 3JC6D 4QX7B 2V1DB 3LJCA 4H9RC 1X79A 3RRWA 1HFAA 5JDHA 2YU1A 3UUXB 4IE6A 4MFRA 3VKHA 3ESLA 5J1GA 4E7ZA 4AXPA 1HG2A 4BJMA 2WMNA 4MHCA 5JDLA 4NUVA 4AKGA 4PW8A 5EZYE 3CWZB 2M67A 2WWUA 3R6NA 4C90A 2W63A 3CX6B 3HR0A 1NWMX 3N9NA 2CMRA 4P09A 3RPUA 2ODUA 5DQVA 2A72A 2D2SA 3LG7A 4FJOA 3KVAA 2L9QA 4OFZA 4ZI3C 3DTOA 4PJJA 4YJ2E 4KBMB 2BVLA 2EHOB 4DO0A 2H3RA 2VKOA 3RYFE 2N1GA 3F31A 3F57A 3VKGA 1LVKA 3AAEB 2JJ9A 3AAAB 1D0YA 4GOUA 4ZHQE 5H6QB 4CQIA 2QA7A 2XAJB 4ISTA 4JLEA 4CI3B 3C4WA 1S35A 4JEUB 2H7VC 1EZ3A 3KV5A 3PU8A 5LCYA 1UX4A 3UT5E 4H63V 3LBXA 4K0UA 3K8PC 3O1JA 1O3XA 2CXDA 2YK0A 4N78D 5IYZE 1MMNA 4O2AE 3V5SA 2DWGA 2V7LA 2YEVC 4HFVA 4HKAA 3LFMA 4AKIA 2LSIA 5HYAA 4EXTA 5HXEA 5AFUL 2NP9A 2BVMA 2PG8A 3CKDA 3GA8A 4IIJE 3I9YA 5CB4E 2PFVA 3SRZA 5L3BB 5FP3A 2MYSA 3N9QA 3B57A 5JRCA 3B13A 3PE0A 3O9XA 2KLQA 2Q9QC 3Q9DA 2XAQB 1U5PA 2N9DA 2Z6EA 4YFSA 5DJQC 4PK4A 2RP4A 4V1Av 4FI5A 4X20E 4AI6A 3RYCE 2X66A 3ZJ2A 3EVYA 3WI3A 3MKDA 4UIGA 3LK2B 1ZEEA 3ZMSB 3ZEFB 3UUNA 4IHJE 3ZJ1A 3UUMA 3P7IA 5LA6E 4I50E 1OXZA 3O1IA 4QX8B 5LGNB 1KNZA 1HX8A 4TZ4C 1FMWA 2HPJA 4IDZA 2E8IA 4ZI3D 1MMGA 3O1HA 2W00A 1IAPA 2X9WA 4WNKA 4HGAA 3D0TA 4OK0A 3ZCIA 1FIOA 4U72A 2CLYB 4DMWA 2K24A 5DABA 5FY1A 4ZS2A 2LHRA 4PJMA 3OJAA 3Q5XA 4JEHB 2XHEB 5LBQB 5F3JA 4HEAA 3S4UA 4PJNA 3OYZA 2KZ7B 1WR6A 3CVRA 2HH7A 2XAHB 3H3AA 4MLKA 2NW8A 5L3DB 1U4QA 3OKQA 4PFOA 4O4HE 1VRBA 4O4JE 3PU3A 5HXSA 1D1AA 1HTJF 5LNKA 3ZC1A 4UF0A 3ANWB 4UELA 3RC8A 3MK7C 5LYJE 1VOMA 1HF8A 2HPLA 2LSJA 2Q9QD 4TV8E 3RYHE 4CI2B 1E1HB 2DWKA 3C50A 3I9WA 3ZMTB 5JQGE 4P0BA 3W15B 2LHNA 4CI1B 4CXYA 1AJ3A 2ODVA 2Y48B 4YLHA 3PTRB 3CPZA 3J9X1 4E7SA 2D0UA 2EHOD 2LOSA 3LK3B 1BR1A 1YKHB 4UF0B 3Q5WA 3C4ZA 3N2KE 3IEEA 4TX5A 4Z8XA 2VK9A 2DLRA 2LT3A 3SOLA 1BR0A 4EB6E 3ETVA 2X0LB 4PK6A 3CMLA 3HKDE 2V7KA 1WYCA 3C4XA 2CM0A 3KFWX 2Y8DA 1YD8G 3MACA 3T8OA 4ASKA 5E0OA 5KX5E 4X1IE 3UTKA 3U78A 3ZN1B 3DJBA 3ZLIA 4PAGA 1MIYA 2EHOC 1QUUA 5JDMA 5FY7A 2H7OA 4AKHA 2V7IA 2UXNB 1LVFA 4H9QC 2IC6A 3PUSA 3BQIA 5JH7E 3U3IA 4TV9E 3PURA 3HI2A 4ZS3A 4UV9B 3C98B 2JMHA 3ZC0A 2RA1A 2IW5B 2CE7A 4UVAB 2I59A 4HN9A 2K5BB 5TAOA 2X68A 3LBXB 1SA0E 4O8SA 5IHYA 3AA7B 5FY0A 2KINB 3BQLA 3AA1B 3R84B 2ES0A 5LHIB 3SS1A 3RH3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KDM C;  4H9P C;  4H9Q C;  4HGA A;  4H9R C;  4H9N C;  4H9O C;  4H9S E; 
#chains in the Genus database with same CATH topology
 2BDE A;  3QOF A;  5J0Z A;  3EUH A;  4HFC A;  2D0T A;  1MNE A;  2G0U A;  5HWY A;  2E9X C;  2J1D G;  3Q5E A;  5LXT E;  5LG4 A;  4DBQ A;  4DR1 T;  2DL1 A;  5JRC B;  1UUR A;  3WAJ A;  5DQW A;  2WP9 A;  5C8Y E;  3AED A;  4PJL A;  4LFB T;  4QH4 A;  1H7C A;  3NZQ A;  1HG5 A;  5FXZ A;  3IBP A;  4I0U A;  3RF1 A;  3MA9 A;  3AE3 A;  3FZK B;  1QLB A;  4O2B E;  4X1Y E;  3EI0 A;  4IE7 A;  4WZX A;  2V8S V;  4EED A;  2K48 A;  3Q5D A;  4DR2 T;  1N34 T;  5JR9 C;  2GK9 A;  4DV4 T;  3KV6 A;  1HS7 A;  4MAL A;  2YU2 A;  2UU9 T;  2ZMA A;  4EZ4 A;  1MIW A;  3N5L A;  4EYU A;  2LKG A;  2XSA A;  1XDP A;  3V5U A;  5AQQ B;  5EK4 A;  2XQ5 A;  2XY8 B;  3EAM A;  3NVO A;  5FMN A;  4YSZ A;  3HA4 A;  2ZM2 A;  3BQK A;  2BZB A;  4X1K E;  5AQL B;  3ONJ A;  5LBM A;  3VR8 A;  5LJN A;  5JRE A;  3RYI E;  1J1J A;  4LMK A;  2LM9 A;  2DNX A;  5L47 A;  4B3S T;  3C64 A;  5HXR A;  3N9M A;  4WW0 A;  3P4W A;  3TLW A;  3DP7 A;  4DR4 T;  2LM2 A;  3AE7 A;  3AE1 A;  2VKH A;  1WCR A;  3HKC E;  2V26 A;  2WBL A;  1CUN A;  3NWI A;  1W0B A;  4U3C A;  3AEA A;  1LKX A;  3M3Z B;  5FL0 A;  3ZMZ B;  4YHH T;  2MBG A;  3P4P A;  3F2E A;  2NW9 A;  3KV4 A;  5BR8 T;  5IWA T;  4IE4 A;  2X0Y A;  5LHH B;  2Q9Q A;  1NEK A;  1MND A;  4HWD A;  2WSS V;  4EYY R;  1XWM A;  2ZM8 A;  2F4V T;  2LRK A;  3IF8 B;  2L3L A;  4OX9 T;  3I0O A;  2KWH A;  2LE8 A;  4U33 A;  4UV8 B;  4C91 A;  2XQ6 A;  4U31 A;  4WYV A;  1Z0P A;  2C5K T;  2IHR 1;  4Q25 A;  4WBO A;  4O4L E;  3SWH A;  4TWF A;  5JVD E;  1D0X A;  4TWH A;  5AQP B;  3E0Z A;  2K3W A;  1HNX T;  4QHO A;  4QXC B;  4ANJ A;  5J2U E;  5HCJ A;  3PV0 F;  4DR6 T;  2VL8 A;  1KNP A;  2YDQ A;  3MXZ A;  3CIR A;  3ZYK A;  4ZOL E;  3KDS E;  1T98 A;  3RLF F;  2JQQ A;  3LSV A;  2CEA A;  2LKH A;  4AQG A;  3FXE B;  2XM2 A;  2OA5 A;  1G8X A;  4NIQ A;  4UVC B;  3GWH A;  4M1P A;  2V6Y B;  2FJB A;  2BG9 A;  5CA1 E;  2XTL A;  1IBK T;  3L3P A;  3VU7 H;  2L8K A;  3UU4 A;  4A56 A;  4DMV A;  2IIU A;  3GN5 A;  3K1S A;  5EK2 A;  1YW0 A;  3PDY A;  4H9S E;  4UVB B;  1Y01 A;  3RC3 A;  2BKO A;  2X9H A;  1D0Z A;  2XQ4 A;  3HKE E;  2X9X A;  4AKR B;  4DND A;  1W9R A;  2W62 A;  4I55 E;  5F8P A;  4QKN A;  2A2F X;  5LP6 E;  4I43 B;  2YOE A;  4KX6 A;  4OYJ A;  4AQF C;  2BG9 E;  2BG9 B;  3T1H T;  4AQF A;  4DID B;  3QC9 A;  4AKL A;  4GKJ T;  2XQY A;  4UR9 A;  5LGU B;  2B1E A;  2SPC A;  4OYK A;  3CK6 A;  2C5I T;  2NWB A;  3AB3 B;  4ZI7 E;  3OBV E;  4ILB A;  4ZI2 C;  4DUZ T;  3H37 A;  2JMK A;  4U2Z A;  1S94 A;  1R8I A;  5LGT B;  4LF8 T;  1YKE B;  4WBN E;  2CBJ A;  3UQ4 A;  1KK7 A;  2V5D A;  3RRC A;  1G73 A;  2WDQ A;  2WDR A;  2WZI A;  1OWA A;  4KHZ F;  3TLV A;  4LF7 T;  2CA5 A;  1OED B;  4IL4 A;  3CX8 B;  4PFP A;  5ETW A;  5KMG P;  1MIV A;  1V9D A;  3ZYM A;  2QVA A;  5H6R B;  3KV9 A;  4B3T T;  2WDV A;  2Q9Q B;  3UU5 A;  2W61 A;  3FZL B;  3AXJ B;  2WQY A;  4LML A;  2WAU A;  3RIA A;  3I1A A;  2JQH A;  3PJA J;  2CCQ A;  3B5M A;  4ERR A;  1FEW A;  3NRX A;  4NXM T;  5BMV E;  2UXC T;  2AE9 A;  5C2T A;  5ABF B;  1UX5 A;  5FXV A;  4JI5 T;  2CXL A;  2V7M A;  3E08 A;  3TKL B;  4DR7 T;  1WRD A;  2BG9 C;  3NZP A;  1LRZ A;  2VUR A;  1BR2 A;  4QWN B;  4YTP A;  1IZN B;  4CN4 A;  2XJ7 A;  1T7S A;  2C5J A;  1SE7 A;  3JAE A;  2BS3 A;  1D1C A;  2JRK A;  3PUA A;  4KI0 F;  1WLX A;  5EK3 A;  4CXW A;  2QGS A;  1J5W A;  5JDQ A;  4JI2 T;  5CGM A;  2WS3 A;  2CRB A;  2WCA A;  3N2G E;  4EZH A;  2KXP B;  4QXH B;  2IAK A;  1HCI A;  2UUC T;  2WM9 A;  2CXF A;  3AA0 B;  3N9L A;  4H9N C;  4U7I A;  4IE0 A;  3AE8 A;  3N9P A;  1IJ6 A;  3OYX A;  3E22 E;  2LJL A;  3N9O A;  5HWX A;  5L3G B;  4IDP A;  1SHZ C;  5J2T E;  3CQC B;  2VWA A;  3PUQ A;  2WB5 A;  2E9X A;  4DV2 T;  4G2A A;  3QK6 A;  2I6H A;  2LOP A;  5FYM A;  3UU8 A;  5L4E A;  3FXD B;  3IHR A;  2ZLY A;  5FNV E;  4L9I A;  4B3R T;  1QSD A;  2KMF A;  2DHR A;  4IDN A;  5JDN A;  2V6X A;  1KF6 A;  2DCF A;  2YDS A;  3A5X A;  3FHN A;  3HL6 A;  4H63 H;  3ZKR A;  4EAH A;  4ZI2 D;  2CWO A;  3ONX A;  3AVR A;  4P1N A;  4DBR A;  4HWH A;  1MMD A;  2NTY A;  5CJ5 A;  4TNW A;  1BR4 A;  4AIS A;  5JR9 B;  3RHW A;  2H89 A;  5JR9 A;  4NUU A;  5ADX L;  1IJ5 A;  2D9D A;  3ZN0 B;  4BA9 A;  2CHN A;  3TLS A;  4ILU A;  3PJA A;  2D5U A;  4GK5 E;  4KUM B;  1OED C;  5HXC A;  1US7 B;  3CX7 B;  3J7Y q;  2VKD A;  2CWY A;  3FBL A;  3JAF A;  2WU5 A;  3EHZ A;  2E9X D;  1WFD A;  3ZPO A;  2FJD A;  4IDO A;  1ZP0 A;  3RKO A;  4YHJ A;  2E9X B;  2WMO A;  2YIN A;  3GMI A;  3JAD A;  2JQ9 A;  3M65 A;  3MJX A;  4OHF A;  4KP3 C;  4CXX A;  5HXH A;  1Y64 B;  4DUY T;  4GIW A;  2VQE T;  1KFY A;  4B6X A;  2UUA T;  1XNR T;  3K3N A;  5L3F B;  1Z8U A;  1W0A A;  2VAS A;  3AEG A;  4XAX B;  2CPT A;  5FL1 A;  2A3D A;  4HFE A;  3FZH B;  2X9Y A;  3PUX F;  1NAF A;  2KSR A;  2LSG A;  3EDU A;  3ZYL A;  3K3Q C;  2X67 A;  1ZOY A;  1ZKE A;  2N2N A;  3P8C D;  3KBT A;  4XZC A;  2NTX A;  2E5V A;  2LSK A;  5LOV E;  3AE9 A;  5C3J A;  5M4Y A;  3RIU A;  4ZZC A;  4L0R A;  4HWF A;  4TN7 B;  3HKB E;  2X51 A;  4DVD A;  2LSY A;  1XZY A;  3NBX X;  4HTE A;  1OED E;  2VB6 A;  3CQG B;  3KBU A;  2CBI A;  3MZK B;  2WWV A;  2ACZ A;  2YDR A;  3CQX C;  2JQK A;  3OVU A;  3KIN B;  4JUY A;  4EOZ B;  5AQF B;  2XQ7 A;  2DI4 A;  5L3E B;  4ISS A;  2NW7 A;  3AA6 B;  3KVB A;  3L09 A;  4HE8 A;  2FBW A;  3ZT7 A;  4ADZ A;  3UUL A;  1WYB A;  2C0S A;  2FUP A;  2FJE A;  1CHU A;  2MOZ A;  3PUV F;  1ZHC A;  4YSX A;  3QNU A;  1OED A;  3BK9 A;  2PJQ A;  5HEO A;  4F6R C;  1N33 T;  3P4R A;  2EHO A;  4ILC A;  1FMV A;  2W0G A;  3LDQ B;  4G63 A;  4L5G A;  3ZMU B;  3RIF A;  4PNI A;  2IC9 A;  3QUJ A;  3FB2 A;  4J2C A;  2CLY C;  5HAX A;  3EDV A;  3K3O A;  3O4X E;  4ZXL A;  4GYR A;  5GON E;  5FXX A;  2KND A;  1UCU A;  4UXN B;  4XBF B;  3I0Q A;  1UK5 A;  4YJ3 E;  4AQY T;  4YTM A;  1HNZ T;  2JPF A;  5FVK A;  5L4H A;  5LG3 A;  2IDO B;  3AVS A;  1D1B A;  2UXX B;  4ZEY A;  1IBL T;  2NOX A;  2XUE A;  3JC6 C;  4QXB B;  1HX1 B;  5LJM A;  3ZMV B;  4IGU A;  3ZST A;  2Y6X A;  2XAS B;  3RX6 A;  4EIW A;  3AE6 A;  5ABF A;  5L3C B;  2XAF B;  1MMA A;  3AE4 A;  5JDG A;  4P0A A;  2BBH A;  2K9A A;  3GN5 B;  3L39 A;  2ZM0 A;  3VHL A;  2AXD S;  4GYS A;  1UUS A;  3UFE A;  4CN6 A;  4NXN T;  3LK4 2;  3N2O A;  4U74 A;  3ZT5 A;  2ACX A;  5LB7 B;  3T1Y T;  1B7T A;  4KMC A;  3ZCJ A;  4YY3 T;  2I0M A;  3ANW A;  3ETU A;  3C51 A;  3P4Q A;  2VKJ A;  4H9O C;  3Q2M A;  1JNR A;  4BJN A;  5CA0 E;  4O4I E;  2FJA A;  2M6B A;  4TUY E;  2LEH A;  5FXW A;  3AAI A;  3G06 A;  3NRY A;  5A1L A;  4BAY B;  4GK0 E;  2KT9 A;  4I4T E;  3OPC A;  5JDF A;  4JV5 T;  2XAG B;  4IT4 A;  4CZZ B;  4YT0 A;  1M7K A;  4H9P C;  3AEF A;  2V7J A;  3PUG A;  3PUY F;  4MBQ A;  3FBZ A;  3ZT6 A;  5LHG B;  4PK5 A;  1YXR A;  5L2L A;  4DR3 T;  1ZV4 X;  2QYW A;  3ONL C;  2MTQ A;  4IE5 A;  4LF5 T;  2P9B A;  4UEM A;  3SFE A;  3WAK A;  3OTO T;  3UFG A;  2KWI B;  2PBI A;  3RI5 A;  3JC6 D;  4QX7 B;  4HWI B;  2V1D B;  3LJC A;  4H9R C;  2NR4 A;  1I6Z A;  1X79 A;  2A9U A;  3RRW A;  2J4G A;  1HFA A;  2BKN A;  2PTF A;  2YKS A;  4HFD A;  5JDH A;  2YU1 A;  3UUX B;  5LMN T;  4IE6 A;  4MFR A;  3VKH A;  3ESL A;  5J1G A;  4E7Z A;  5CFB A;  4AXP A;  1HG2 A;  1NEN A;  4X66 T;  4BJM A;  2CHO A;  2WMN A;  4MHC A;  5JDL A;  4NUV A;  4AKG A;  5AQN B;  4F8H A;  4IL9 A;  4PW8 A;  5EZY E;  3CWZ B;  2M67 A;  2UXD T;  2WWU A;  5AQV B;  3R6N A;  2W63 A;  4C90 A;  4LFA T;  3UU3 A;  5KXJ A;  3CX6 B;  3HR0 A;  1NWM X;  3N9N A;  2CMR A;  3RQW A;  4P09 A;  3RPU A;  4QH5 A;  2ODU A;  5DQV A;  2A72 A;  2D2S A;  3LG7 A;  4FJO A;  3FZF B;  3KVA A;  2L9Q A;  4OFZ A;  4ZI3 C;  3DTO A;  4PJJ A;  4YJ2 E;  4KBM B;  2BVL A;  2EHO B;  4DO0 A;  3QB5 K;  2H3R A;  2J47 A;  2R6G F;  2VKO A;  4Z91 A;  2N1G A;  3RYF E;  4GKK T;  3F31 A;  3TLU A;  3F57 A;  4DV7 T;  2UUB T;  2OLT A;  5KDM C;  3VKG A;  5HEU A;  1LVK A;  3AAE B;  2JJ9 A;  3AAA B;  2W66 A;  1D0Y A;  4GOU A;  2XZE A;  1N32 T;  2LLY A;  2VL0 A;  5H6Q B;  4CQI A;  2QA7 A;  2XAJ B;  4ZHQ E;  1XNQ T;  3AEE A;  4IST A;  4JLE A;  4CI3 B;  3C4W A;  5IUX A;  1S35 A;  4JEU B;  2H7V C;  4EEB A;  1EZ3 A;  4QH1 A;  2WZH A;  3KV5 A;  4YXD A;  3PU8 A;  5LCY A;  3A7M A;  2W67 A;  1GQE A;  5LMU T;  1UX4 A;  3UT5 E;  5ABH A;  3EAB A;  4H63 V;  1T72 A;  3VRB A;  3LBX A;  2B76 A;  2E2A A;  4A5X A;  5AQR B;  4K0U A;  3K8P C;  1XMO T;  3O1J A;  4A98 A;  1O3X A;  2CXD A;  2YK0 A;  4N78 D;  5IYZ E;  1MMN A;  4O2A E;  3V5S A;  2DWG A;  2V7L A;  2YEV C;  4HFV A;  4HKA A;  3LFM A;  4COF A;  5ABG A;  4AKI A;  3VR9 A;  2LSI A;  5HYA A;  4EXT A;  5HXE A;  5AFU L;  4ILA A;  2NP9 A;  2BVM A;  2PG8 A;  2OV9 A;  3CKD A;  3GA8 A;  4CN1 A;  4X65 T;  4JI1 T;  4IIJ E;  3I9Y A;  5CB4 E;  2IML A;  2PFV A;  3JCF A;  3SRZ A;  2VQF T;  5L3B B;  5FP3 A;  2MYS A;  1IBM T;  3N9Q A;  4LMJ A;  3B57 A;  1N36 T;  5JRC A;  3B13 A;  3PE0 A;  4HFI A;  2KLQ A;  2Q9Q C;  3O9X A;  5ABE A;  4Z90 A;  3Q9D A;  3UU6 A;  2XAQ B;  1U5P A;  2N9D A;  2Z6E A;  4YFS A;  5DJQ C;  4PK4 A;  2RP4 A;  3AE2 A;  4V1A v;  5AQS B;  4DV6 T;  2H88 A;  2JIW A;  2IUB A;  4FI5 A;  4X20 E;  4X62 T;  4AI6 A;  2WY2 A;  4TNV A;  3RYC E;  2X66 A;  5AQG B;  3ZJ2 A;  3EVY A;  3WI3 A;  3MKD A;  4UIG A;  3LK2 B;  1ZEE A;  3ZMS B;  3ZEF B;  3UUN A;  4LF9 T;  4IHJ E;  5HEG A;  1FJG T;  5FKY A;  3ZJ1 A;  3PUW F;  3UUM A;  3P7I A;  5LA6 E;  4I50 E;  1OXZ A;  3O1I A;  4K0K T;  1WR0 A;  4QX8 B;  5LGN B;  1KNZ A;  4HFB A;  1HX8 A;  4NPP A;  5HCM A;  3NKZ A;  1FMW A;  4TZ4 C;  3SFD A;  4LF6 T;  3P4S A;  4DR5 T;  2HPJ A;  4X64 T;  4JYA T;  2QRX A;  4IDZ A;  4TWD A;  2E8I A;  5FVL A;  4ZI3 D;  1MMG A;  1L0V A;  3O1H A;  2RPA A;  1IAP A;  2W00 A;  2X9W A;  3PUZ F;  4HGA A;  3D0T A;  4OK0 A;  4WNK A;  5JTG A;  5AQM B;  3ZCI A;  1DU2 A;  1FIO A;  4U72 A;  2CLY B;  4DMW A;  2K24 A;  1KEY A;  2MAW A;  5DAB A;  5FY1 A;  4ZS2 A;  2LHR A;  4PJM A;  2WU2 A;  3OJA A;  3Q5X A;  4JEH B;  2XHE B;  5LBQ B;  5F3J A;  4HEA A;  4IDQ A;  5AQT B;  3S4U A;  3AXJ A;  4PJN A;  3X1D A;  3VRA A;  3OYZ A;  2VVN A;  2W4X A;  2BBJ A;  2KZ7 B;  1WR6 A;  3CVR A;  1JNZ A;  2HH7 A;  4KHP T;  4JI8 T;  4LFC T;  1VCS A;  2XAH B;  3P50 A;  2XM1 A;  3H3A A;  4MLK A;  3UUB A;  2NW8 A;  5L3D B;  1U4Q A;  3OKQ A;  4PFO A;  4O4H E;  2XQA A;  4JBW F;  1VRB A;  4O4J E;  3PU3 A;  5HXS A;  1D1A A;  1HTJ F;  4U2Y A;  5LNK A;  3ZC1 A;  4JI7 T;  3RKG A;  4UF0 A;  2V5C A;  3ANW B;  4HFH A;  4UEL A;  3RQU A;  3MK7 C;  3FZM B;  5LYJ E;  1I94 T;  3RC8 A;  1VOM A;  1YQ3 A;  1HF8 A;  2HPL A;  2LSJ A;  2Q9Q D;  3AEB A;  4TV8 E;  3RYH E;  2XQ3 A;  2LRL A;  4CI2 B;  4JI3 T;  1E1H B;  2XPK A;  2E5L T;  2DWK A;  3C50 A;  3I9W A;  3ZMT B;  5AQI B;  5JQG E;  4P0B A;  5F5W A;  5AQU B;  3A8Y C;  3W15 B;  1T8B A;  2LHN A;  4CI1 B;  4CXY A;  4LF4 T;  5AQO B;  2ODV A;  2Y48 B;  4YLH A;  1AJ3 A;  3PTR B;  2V6Y A;  4HWC A;  3CPZ A;  3J9X 1;  1XMQ T;  4E7S A;  2D0U A;  2BS4 A;  2BKP A;  2EHO D;  2LOS A;  1BR1 A;  3LK3 B;  4YSY A;  4B3M T;  1UGO A;  1YKH B;  4UF0 B;  3RIU C;  3Q5W A;  1J5E T;  3C4Z A;  3N2K E;  3IEE A;  4TX5 A;  4Z8X A;  2X0H A;  2J62 A;  4DV5 T;  2UXB T;  2VK9 A;  2DLR A;  1XDO A;  2LT3 A;  3IA3 A;  3SOL A;  1BR0 A;  4EB6 E;  3ETV A;  5AQK B;  2X0L B;  4PK6 A;  2HHH T;  3CML A;  3HKD E;  1M62 A;  2V7K A;  1WYC A;  1YQ4 A;  2CM0 A;  3C4X A;  3KFW X;  2Y8D A;  1YD8 G;  3MAC A;  3QB5 A;  3T8O A;  4A97 A;  4ASK A;  4IRE A;  5AQH B;  5E0O A;  3UQ7 A;  5KX5 E;  3L8R A;  4X1I E;  3UTK A;  3U78 A;  5HEH A;  2ZM6 T;  3ZN1 B;  3DJB A;  2MPK A;  2YN6 A;  4PAG A;  1MIY A;  2EHO C;  3ZLI A;  4AIU A;  1QUU A;  5JDM A;  5FY7 A;  2H7O A;  1HNW T;  5AQJ B;  4AKH A;  4DV0 T;  4X5T A;  1SUM B;  2V7I A;  4JI0 T;  4DV3 T;  2UXN B;  1LVF A;  4H9Q C;  3AEC A;  2IC6 A;  3TLT A;  3ZSS A;  3PUS A;  3BQI A;  5JH7 E;  3U3I A;  4TV9 E;  3PUR A;  3HI2 A;  2HN2 A;  4ZS3 A;  3RGL A;  1KNR A;  4UV9 B;  2VVS A;  3C98 B;  2JMH A;  5HEJ A;  3ZC0 A;  4U7Y A;  2RA1 A;  2IW5 B;  1X9B A;  2CE7 A;  1W09 A;  2XQ9 A;  4UVA B;  1VCT A;  2I59 A;  2XSB A;  2XQ8 A;  4HN9 A;  2HN1 A;  2K5B B;  5TAO A;  3H3M A;  4JI4 T;  2X68 A;  4EGW A;  2BS2 A;  3LBX B;  2M6I A;  3AE5 A;  1SA0 E;  4O8S A;  5IHY A;  4ZZB A;  1E2A A;  4YTN A;  3AA7 B;  4DV1 T;  5FY0 A;  2KIN B;  3BQL A;  3AA1 B;  3R84 B;  2W2U A;  2ES0 A;  1HR0 T;  4JI6 T;  4EV6 A;  5LHI B;  3ABV A;  3SS1 A;  1E7P A;  3RH3 A; 
#chains in the Genus database with same CATH homology
 2BDE A;  3EUH A;  5LXT E;  2D0T A;  1MNE A;  2G0U A;  5HWY A;  2E9X C;  2J1D G;  5LG4 A;  4DBQ A;  5JRC B;  3WAJ A;  5DQW A;  5C8Y E;  4PJL A;  1H7C A;  3NZQ A;  1HG5 A;  5FXZ A;  3IBP A;  3MA9 A;  4O2B E;  4X1Y E;  4IE7 A;  2K48 A;  5JR9 C;  2GK9 A;  3KV6 A;  1HS7 A;  4MAL A;  2YU2 A;  2ZMA A;  4EZ4 A;  1MIW A;  3N5L A;  4EYU A;  3V5U A;  5EK4 A;  5FMN A;  3HA4 A;  2ZM2 A;  3BQK A;  2BZB A;  4X1K E;  5LBM A;  5LJN A;  5JRE A;  3RYI E;  2LM9 A;  2DNX A;  3C64 A;  5HXR A;  3N9M A;  4WW0 A;  3DP7 A;  3HKC E;  2VKH A;  2V26 A;  2WBL A;  1CUN A;  1LKX A;  3ZMZ B;  2MBG A;  3F2E A;  2NW9 A;  3KV4 A;  4IE4 A;  5LHH B;  2Q9Q A;  1MND A;  2WSS V;  4EYY R;  2ZM8 A;  3IF8 B;  2L3L A;  3I0O A;  2KWH A;  2LE8 A;  4C91 A;  4UV8 B;  1Z0P A;  2C5K T;  4WBO A;  3SWH A;  4O4L E;  5JVD E;  1D0X A;  3E0Z A;  4QHO A;  4QXC B;  4ANJ A;  5J2U E;  2VL8 A;  3MXZ A;  3ZYK A;  4ZOL E;  3KDS E;  1T98 A;  2JQQ A;  2CEA A;  4AQG A;  3FXE B;  2OA5 A;  1G8X A;  4UVC B;  3GWH A;  4M1P A;  5CA1 E;  2XTL A;  3L3P A;  3VU7 H;  2L8K A;  4A56 A;  4DMV A;  3GN5 A;  5EK2 A;  1YW0 A;  3PDY A;  4H9S E;  4UVB B;  3RC3 A;  5KDM C;  2X9H A;  1D0Z A;  3HKE E;  4DND A;  2X9X A;  4AKR B;  2W62 A;  4I55 E;  5F8P A;  4QKN A;  2A2F X;  5LP6 E;  4I43 B;  4AQF C;  4OYJ A;  4AQF A;  3QC9 A;  4AKL A;  2XQY A;  5LGU B;  2B1E A;  2SPC A;  4OYK A;  2C5I T;  2NWB A;  3AB3 B;  4ZI7 E;  3OBV E;  4ZI2 C;  3H37 A;  2JMK A;  1S94 A;  5LGT B;  4WBN E;  1YKE B;  1KK7 A;  3RRC A;  1G73 A;  1OWA A;  2CA5 A;  5ETW A;  5KMG P;  3CX8 B;  4PFP A;  1MIV A;  1V9D A;  3ZYM A;  5H6R B;  3KV9 A;  2Q9Q B;  2W61 A;  2WAU A;  3I1A A;  2CCQ A;  4ERR A;  1FEW A;  3NRX A;  5BMV E;  1UX5 A;  5FXV A;  2CXL A;  2V7M A;  3E08 A;  3TKL B;  1WRD A;  3NZP A;  1LRZ A;  4QWN B;  1BR2 A;  1IZN B;  2C5J A;  2JRK A;  1D1C A;  3PUA A;  5EK3 A;  1WLX A;  4CXW A;  2QGS A;  5JDQ A;  3N2G E;  4EZH A;  2KXP B;  4QXH B;  2IAK A;  1HCI A;  2WM9 A;  2CXF A;  3AA0 B;  3N9L A;  4H9N C;  4IE0 A;  3N9P A;  1IJ6 A;  3OYX A;  3E22 E;  2LJL A;  3N9O A;  5HWX A;  5L3G B;  5J2T E;  1SHZ C;  3CQC B;  2VWA A;  3PUQ A;  2E9X A;  4G2A A;  3QK6 A;  2LOP A;  5FYM A;  3FXD B;  3IHR A;  2ZLY A;  5FNV E;  4L9I A;  1QSD A;  2KMF A;  2DHR A;  5JDN A;  2DCF A;  3A5X A;  3FHN A;  4H63 H;  3HL6 A;  4ZI2 D;  4EAH A;  2CWO A;  3ONX A;  3AVR A;  4DBR A;  1MMD A;  2NTY A;  5JR9 B;  1BR4 A;  5ADX L;  5JR9 A;  4NUU A;  1IJ5 A;  3ZN0 B;  4BA9 A;  4ILU A;  2D5U A;  4GK5 E;  4KUM B;  5HXC A;  1US7 B;  3CX7 B;  3J7Y q;  2VKD A;  2CWY A;  3FBL A;  2E9X D;  3ZPO A;  3RKO A;  4YHJ A;  2E9X B;  2WMO A;  2YIN A;  3GMI A;  3M65 A;  3MJX A;  4OHF A;  4KP3 C;  4CXX A;  5HXH A;  1Y64 B;  4GIW A;  4B6X A;  3K3N A;  5L3F B;  2VAS A;  4XAX B;  2A3D A;  2X9Y A;  1NAF A;  2LSG A;  3EDU A;  3K3Q C;  2X67 A;  1ZKE A;  2N2N A;  3P8C D;  3KBT A;  4XZC A;  2NTX A;  5M4Y A;  2LSK A;  5LOV E;  4L0R A;  4TN7 B;  3HKB E;  2X51 A;  4DVD A;  2LSY A;  3NBX X;  4HTE A;  3KBU A;  2VB6 A;  3CQG B;  3MZK B;  3ZYL A;  3CQX C;  4JUY A;  3KIN B;  4EOZ B;  2DI4 A;  5L3E B;  4ISS A;  2NW7 A;  3AA6 B;  3KVB A;  3L09 A;  4HE8 A;  4ADZ A;  3UUL A;  1WYB A;  2C0S A;  2MOZ A;  1ZHC A;  3BK9 A;  2PJQ A;  4F6R C;  2EHO A;  4L5G A;  1FMV A;  2W0G A;  4G63 A;  3ZMU B;  4PNI A;  2IC9 A;  3QUJ A;  3FB2 A;  4J2C A;  2CLY C;  5HAX A;  3EDV A;  3K3O A;  3O4X E;  4GYR A;  5GON E;  5FXX A;  2KND A;  1UCU A;  4UXN B;  4XBF B;  3I0Q A;  4YJ3 E;  2JPF A;  3AVS A;  1D1B A;  2UXX B;  2NOX A;  2XUE A;  3JC6 C;  4QXB B;  5LJM A;  3ZMV B;  4IGU A;  2Y6X A;  2XAS B;  3RX6 A;  4EIW A;  5L3C B;  2XAF B;  1MMA A;  5JDG A;  4P0A A;  2K9A A;  3GN5 B;  2ZM0 A;  3VHL A;  4GYS A;  3UFE A;  3LK4 2;  3N2O A;  4U74 A;  2ACX A;  1B7T A;  4KMC A;  3ZCJ A;  3ETU A;  3ANW A;  3C51 A;  2VKJ A;  4H9O C;  3Q2M A;  4BJN A;  5CA0 E;  4O4I E;  4TUY E;  2LEH A;  5FXW A;  3AAI A;  3NRY A;  5A1L A;  4BAY B;  4GK0 E;  2KT9 A;  4I4T E;  5JDF A;  2XAG B;  4CZZ B;  4H9P C;  2V7J A;  3PUG A;  4MBQ A;  5L2L A;  3FBZ A;  5LHG B;  4PK5 A;  1ZV4 X;  4IE5 A;  2MTQ A;  2P9B A;  4UEM A;  3WAK A;  2KWI B;  2PBI A;  3JC6 D;  4QX7 B;  2V1D B;  3LJC A;  4H9R C;  1X79 A;  3RRW A;  1HFA A;  5JDH A;  2YU1 A;  3UUX B;  4IE6 A;  4MFR A;  3VKH A;  3ESL A;  5J1G A;  4E7Z A;  4AXP A;  1HG2 A;  4BJM A;  2WMN A;  4MHC A;  5JDL A;  4NUV A;  4AKG A;  4PW8 A;  5EZY E;  3CWZ B;  2M67 A;  2WWU A;  3R6N A;  4C90 A;  2W63 A;  3CX6 B;  3HR0 A;  1NWM X;  3N9N A;  2CMR A;  4P09 A;  3RPU A;  2ODU A;  5DQV A;  2A72 A;  2D2S A;  3LG7 A;  4FJO A;  3KVA A;  2L9Q A;  4OFZ A;  4ZI3 C;  3DTO A;  4PJJ A;  4YJ2 E;  4KBM B;  2BVL A;  2EHO B;  4DO0 A;  2H3R A;  2VKO A;  3RYF E;  2N1G A;  3F31 A;  3F57 A;  3VKG A;  1LVK A;  3AAE B;  2JJ9 A;  3AAA B;  1D0Y A;  4GOU A;  4ZHQ E;  5H6Q B;  4CQI A;  2QA7 A;  2XAJ B;  4IST A;  4JLE A;  4CI3 B;  3C4W A;  1S35 A;  4JEU B;  2H7V C;  1EZ3 A;  3KV5 A;  3PU8 A;  5LCY A;  1UX4 A;  3UT5 E;  4H63 V;  3LBX A;  4K0U A;  3K8P C;  3O1J A;  1O3X A;  2CXD A;  2YK0 A;  4N78 D;  5IYZ E;  1MMN A;  4O2A E;  3V5S A;  2DWG A;  2V7L A;  2YEV C;  4HFV A;  4HKA A;  3LFM A;  4AKI A;  2LSI A;  5HYA A;  4EXT A;  5HXE A;  5AFU L;  2NP9 A;  2BVM A;  2PG8 A;  3CKD A;  3GA8 A;  4IIJ E;  3I9Y A;  5CB4 E;  2PFV A;  3SRZ A;  5L3B B;  5FP3 A;  2MYS A;  3N9Q A;  3B57 A;  5JRC A;  3B13 A;  3PE0 A;  3O9X A;  2KLQ A;  2Q9Q C;  3Q9D A;  2XAQ B;  1U5P A;  2N9D A;  2Z6E A;  4YFS A;  5DJQ C;  4PK4 A;  2RP4 A;  4V1A v;  4FI5 A;  4X20 E;  4AI6 A;  3RYC E;  2X66 A;  3ZJ2 A;  3EVY A;  3WI3 A;  3MKD A;  4UIG A;  3LK2 B;  1ZEE A;  3ZMS B;  3ZEF B;  3UUN A;  4IHJ E;  3ZJ1 A;  3UUM A;  3P7I A;  5LA6 E;  4I50 E;  1OXZ A;  3O1I A;  4QX8 B;  5LGN B;  1KNZ A;  1HX8 A;  4TZ4 C;  1FMW A;  2HPJ A;  4IDZ A;  2E8I A;  4ZI3 D;  1MMG A;  3O1H A;  2W00 A;  1IAP A;  2X9W A;  4WNK A;  4HGA A;  3D0T A;  4OK0 A;  3ZCI A;  1FIO A;  4U72 A;  2CLY B;  4DMW A;  2K24 A;  5DAB A;  5FY1 A;  4ZS2 A;  2LHR A;  4PJM A;  3OJA A;  3Q5X A;  4JEH B;  2XHE B;  5LBQ B;  5F3J A;  4HEA A;  3S4U A;  4PJN A;  3OYZ A;  2KZ7 B;  1WR6 A;  3CVR A;  2HH7 A;  2XAH B;  3H3A A;  4MLK A;  2NW8 A;  5L3D B;  1U4Q A;  3OKQ A;  4PFO A;  4O4H E;  1VRB A;  4O4J E;  3PU3 A;  5HXS A;  1D1A A;  1HTJ F;  5LNK A;  3ZC1 A;  4UF0 A;  3ANW B;  4UEL A;  3RC8 A;  3MK7 C;  5LYJ E;  1VOM A;  1HF8 A;  2HPL A;  2LSJ A;  2Q9Q D;  4TV8 E;  3RYH E;  4CI2 B;  1E1H B;  2DWK A;  3C50 A;  3I9W A;  3ZMT B;  5JQG E;  4P0B A;  3W15 B;  2LHN A;  4CI1 B;  4CXY A;  1AJ3 A;  2ODV A;  2Y48 B;  4YLH A;  3PTR B;  3CPZ A;  3J9X 1;  4E7S A;  2D0U A;  2EHO D;  2LOS A;  3LK3 B;  1BR1 A;  1YKH B;  4UF0 B;  3Q5W A;  3C4Z A;  3N2K E;  3IEE A;  4TX5 A;  4Z8X A;  2VK9 A;  2DLR A;  2LT3 A;  3SOL A;  1BR0 A;  4EB6 E;  3ETV A;  2X0L B;  4PK6 A;  3CML A;  3HKD E;  2V7K A;  1WYC A;  3C4X A;  2CM0 A;  3KFW X;  2Y8D A;  1YD8 G;  3MAC A;  3T8O A;  4ASK A;  5E0O A;  5KX5 E;  4X1I E;  3UTK A;  3U78 A;  3ZN1 B;  3DJB A;  3ZLI A;  4PAG A;  1MIY A;  2EHO C;  1QUU A;  5JDM A;  5FY7 A;  2H7O A;  4AKH A;  2V7I A;  2UXN B;  1LVF A;  4H9Q C;  2IC6 A;  3PUS A;  3BQI A;  5JH7 E;  3U3I A;  4TV9 E;  3PUR A;  3HI2 A;  4ZS3 A;  4UV9 B;  3C98 B;  2JMH A;  3ZC0 A;  2RA1 A;  2IW5 B;  2CE7 A;  4UVA B;  2I59 A;  4HN9 A;  2K5B B;  5TAO A;  2X68 A;  3LBX B;  1SA0 E;  4O8S A;  5IHY A;  3AA7 B;  5FY0 A;  2KIN B;  3BQL A;  3AA1 B;  3R84 B;  2ES0 A;  5LHI B;  3SS1 A;  3RH3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...