4GKJT

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aug-codon in the a-site and paromomycin.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4gkjT00
4DR7T 4X62T 5LMNT 4DR3T 1XMQT 1FJGT 4LF4T 1XNRT 3T1HT 1J5ET 4GKJT 1N36T 4JV5T 4JI2T 2UU9T 4LFCT 4DR5T 4LF5T 2E5LT 1I94T 1XMOT 4GKKT 4LF7T 2HHHT 2ZM6T 4JI4T 4OX9T 4LFAT 4JI5T 2VQET 4DR6T 2UXDT 4LF9T 4LF8T 1IBLT 1HNWT 4JI8T 1HR0T 4KHPT 2UXCT 5IWAT 4DV2T 1IBKT 5BR8T 4B3TT 2UXBT 4YHHT 4DR4T 4DV3T 2UUBT 4DV6T 3T1YT 4AQYT 5LMUT 4B3MT 2UUCT 4LF6T 4DV7T 4DV4T 2F4VT 1N32T 1XNQT 2UUAT 4DUZT 1N33T 4B3RT 4DV0T 4DR2T 4JI0T 1HNXT 1HNZT 4JI3T 4JYAT 4X64T 4NXNT 4K0KT 4YY3T 4DR1T 1N34T 4X66T 4DV5T 3OTOT 4NXMT 4LFBT 2VQFT 4B3ST 4DV1T 4JI6T 4JI1T 1IBMT 4JI7T 4DUYT 4X65T
chains in the Genus database with same CATH superfamily
1T98A 3AB3B 2VVNA 4WZXA 5AFUL 3FZLB 1FJGT 5JR9C 5L4EA 2B1EA 4LF4T 5L2LA 4I50E 5AQSB 3R6NA 2VVSA 4QH1A 5FXWA 2K24A 3O1IA 2CPTA 3AA6B 3PUGA 1M62A 2WWVA 4LFAT 3ABVA 3KINB 2WS3A 4LF8T 5F5WA 4MALA 3LK3B 3GN5A 2Q9QC 3O1HA 2VKHA 2V5CA 5DQVA 2UXBT 1UURA 2A9UA 2KMFA 4DVDA 4H9QC 5LBQB 2LRLA 2VKDA 3X1DA 4PFPA 3EVYA 5FXZA 2BBHA 2QGSA 3CX8B 4YHJA 2WAUA 3Q9DA 3AE3A 2Y8DA 1UK5A 2DCFA 3MKDA 4X66T 3TLUA 2K3WA 4ZI3C 1FIOA 5C8YE 3A5XA 3PTRB 2LSYA 3ZN0B 4HFIA 3Q2MA 1OWAA 4GOUA 2BKOA 2JMKA 3OBVE 5JR9A 3V5SA 1YQ4A 4E7SA 3UFGA 4ILAA 3O1JA 3PUAA 1D0ZA 3I9YA 4H9RC 1MMNA 3JCFA 5JQGE 4LF5T 3PURA 5ABHA 2MYSA 2VQET 3RLFF 3CQCB 2H7VC 1Y01A 5JDFA 4CXXA 4YSYA 2V5DA 1HR0T 4TWFA 4CN6A 3N5LA 2IC6A 3WI3A 2R6GF 3Q5EA 2LSGA 5DJQC 2HN2A 1DU2A 3T8OA 4AQYT 4IE5A 4DIDB 1T8BA 1N33T 2LLYA 5FYMA 2W66A 4X64T 3ZT5A 1QSDA 5AQNB 2WDVA 3D0TA 4AKLA 2ODUA 4NUVA 3RIUA 3MXZA 2FJAA 1IBMT 4AKHA 4MBQA 3P4QA 2DWGA 2CLYB 3EUHA 3OKQA 3E08A 5E0OA 3IBPA 3NRYA 3TLSA 1U5PA 3SS1A 2HPLA 2VWAA 3TLVA 3T1HT 4TNWA 3HI2A 4UVAB 5IYZE 5J1GA 2E8IA 4PNIA 3GN5B 5F3JA 1LKXA 1UX4A 1NEKA 2HHHT 4JI4T 4OX9T 2UXDT 4EIWA 3C4WA 4IDOA 2X0YA 3RRCA 3OVUA 4HGAA 2QA7A 3N9QA 2LKGA 1FEWA 2W4XA 5DABA 3LSVA 2YOEA 2X67A 2BKNA 3RC3A 4GIWA 4DV3T 3UUBA 2UUBT 2WWUA 3B5MA 3PJAA 4YXDA 2VURA 5HCMA 2F4VT 5HEUA 3RX6A 2XZEA 4DV0T 5AQPB 3VRAA 4HFBA 4HN9A 3P4SA 4U72A 3LBXA 1WLXA 2ACZA 3C4XA 2KXPB 1NENA 3QC9A 2L9QA 3ZSSA 4JI6T 2XSBA 5JR9B 3L09A 2L3LA 5FVLA 1KEYA 3PV0F 2G0UA 3JC6D 5LXTE 2JQHA 3ZCIA 2YN6A 3AE5A 4JV5T 3MJXA 2CA5A 5HXHA 2DWKA 2W00A 3TKLB 4ZI7E 5C2TA 4TUYE 2Q9QB 4ZEYA 4DNDA 4Z90A 1HG5A 5FKYA 4TX5A 1IBLT 1ZHCA 4O4JE 1CUNA 3P8CD 4HFEA 3P4WA 2DL1A 3PUVF 4PK5A 4ERRA 2XPKA 5M4YA 5H6RB 3K8PC 3PDYA 4HE8A 3UUXB 4YHHT 2V7IA 4U33A 3IEEA 2BS2A 3AE9A 4YTPA 3AA1B 4DV4T 3RKOA 2V7MA 5FXXA 1X9BA 4PAGA 1XNQT 2OA5A 1MIVA 4DMWA 4ZI2C 2CBIA 2PJQA 1D0XA 3L8RA 2WZIA 4K0KT 3N2GE 4UV8B 4ASKA 4O4LE 3UT5E 2BDEA 3ZC1A 4QX7B 3KV4A 1HX1B 2DNXA 2XY8B 2YINA 4CI3B 4DO0A 4QH5A 2A2FX 2N2NA 3O4XE 3V5UA 3UTKA 1M7KA 3F31A 5L3EB 2WSSV 5ETWA 5CFBA 3CX6B 5IUXA 4LMJA 2BG9C 2IDOB 2CEAA 4KP3C 1HTJF 2XM1A 4X20E 4JI8T 4U3CA 1W0AA 4EXTA 3PUQA 2FJEA 3CVRA 5GONE 5F8PA 2XAGB 2ZMAA 2UUCT 5HWYA 3ZEFB 3M3ZB 4AXPA 2IC9A 2I6HA 4DR2T 4JI0T 2JQKA 1HNZT 2WMOA 2OV9A 1WYBA 3RH3A 2LHRA 2FJBA 3RF1A 2WB5A 2V7JA 2XQAA 4O2AE 4IL9A 2C0SA 4WBOA 3PU3A 2V6XA 4B6XA 2CXFA 1FMVA 2V8SV 1XWMA 4CI1B 4O2BE 1H7CA 2JPFA 2D0TA 4ZS3A 3QB5K 1MNDA 3GA8A 3E0ZA 4DMVA 2NP9A 4XBFB 5IHYA 2H89A 4YTNA 4H63H 4J2CA 3Q5DA 2FJDA 5LGNB 2CHOA 3CK6A 2J47A 4FI5A 3CWZB 2E5LT 3PUSA 3AEDA 2CBJA 2Q9QD 5L4HA 4AIUA 3OJAA 5KXJA 4O4IE 4V1Av 3AE1A 2BG9A 3NVOA 1MIWA 2KINB 2Y48B 4I4TE 3UU6A 1XDPA 1QUUA 3AE6A 1FMWA 3RRWA 1MNEA 3FBZA 3CKDA 3ONLC 3N9OA 4ILCA 4DV6T 4QXCB 3Q5XA 2EHOC 4X1IE 4DV7T 2CWOA 4Z8XA 5LCYA 2JRKA 3LFMA 2X9YA 1Z0PA 4U74A 3EI0A 3I9WA 2BS4A 1SA0E 4ZI3D 5LA6E 3JAEA 2WU5A 4N78D 4DV5T 4HWHA 4EB6E 5AQGB 2FBWA 3AEEA 3GWHA 3FXEB 2M6IA 5JDHA 4A5XA 4IDQA 1U4QA 2NOXA 4JEUB 5ABFA 2VK9A 1WCRA 2WZHA 2JQQA 2FUPA 1BR4A 3OYXA 3KBTA 2PFVA 1BR0A 4OK0A 3CIRA 1OEDA 2LSKA 1JNZA 5JREA 3AXJA 2D2SA 4GKKT 4JEHB 1MMGA 1YKHB 4NIQA 5AQQB 2UXXB 3FZMB 3FZKB 3RHWA 3OYZA 1ZOYA 1R8IA 4IDZA 2NW7A 3UULA 3UUNA 5AQMB 3QNUA 4KHPT 2LOSA 5JTGA 5L3BB 3ZMTB 2LEHA 5JDNA 4WW0A 4B3TT 3VHLA 1XDOA 2XAQB 3J7Yq 5LBMA 4Q25A 4DR4T 2KWHA 2SPCA 2ZM0A 3PE0A 2MAWA 4A98A 3ZMSB 4TV8E 1G73A 1SE7A 2Q9QA 4YLHA 4HWDA 5TAOA 5A1LA 4KBMB 4JYAT 4EEBA 5CGMA 4QHOA 4YY3T 4PJLA 2CWYA 2XJ7A 2ZM8A 4ZHQE 4O4HE 4WNKA 2WBLA 3N9PA 4GK5E 3FZFB 3ZMZB 5AQTB 3UQ7A 2E2AA 3B13A 1J1JA 1T72A 3AEBA 3H37A 3O9XA 3PUWF 2LKHA 4AQGA 4QKNA 4QH4A 3IF8B 4IHJE 3PUZF 1IJ5A 3UFEA 4HFHA 2N9DA 5AQLB 4EOZB 1WYCA 2LHNA 3Q5WA 3OPCA 4PFOA 3N9LA 3C64A 4IE7A 3RYIE 2BG9B 2I59A 3FZHB 1I94T 2K9AA 2WCAA 3HKEE 3TLTA 2E9XC 2PBIA 2XM2A 3LK2B 4HFCA 3BQIA 3RYHE 2LJLA 5JRCA 3GMIA 3RPUA 1XZYA 2W61A 2C5IT 4IE0A 4AQFC 4U7IA 5AQJB 3T1YT 2XAJB 4U2YA 5ABEA 1QLBA 2ZM2A 2L8KA 2UUAT 2YDQA 1US7B 3RGLA 4U31A 3RIFA 1MMAA 1YXRA 5LG4A 1N34T 3DTOA 5ABFB 4MHCA 3SWHA 2M67A 4DV1T 3AE7A 5L3FB 5C3JA 2WP9A 5CB4E 4PK4A 3NBXX 4X65T 3A7MA 5FL0A 1OEDB 4DR7T 5BMVE 3SOLA 2A3DA 5LMNT 4O8SA 3VU7H 3QUJA 4L9IA 3NZPA 1VRBA 3AXJB 3FXDB 5LB7B 2CXLA 2PTFA 4UV9B 2XQ8A 1YD8G 3ZCJA 5HXRA 4DBQA 4QX8B 3U78A 2BVLA 5AQVB 2A72A 5L47A 4IDNA 3AE4A 3QK6A 3A8YC 2KZ7B 2ZM6T 4X5TA 3VKGA 2RA1A 3L39A 4H9SE 2MBGA 1OXZA 2NW9A 2NR4A 4ILBA 2XASB 2JMHA 3JADA 2UXNB 2X66A 3K3NA 1IBKT 2IMLA 3ZKRA 1MIYA 2IHR1 5FY0A 2XQ6A 3C4ZA 4MLKA 3MACA 3ZPOA 1HS7A 4HFVA 4WBNE 1KNZA 4ZI2D 3CPZA 5HWXA 4ISSA 5FMNA 3P4RA 1HNXT 2C5JA 3S4UA 4NXNT 4CI2B 2VL0A 4P1NA 2J1DG 4LFBT 4JI1T 3K3OA 3HKDE 4U2ZA 3RC8A 5FY7A 5LJMA 5AQIB 1D0YA 4I43B 2YU2A 5AQOB 1XMQT 3ETUA 1BR1A 3G06A 5HCJA 4IE6A 5JDGA 4GKJT 3CMLA 1G8XA 2BS3A 2XHEB 4IGUA 4ANJA 5JRCB 5LJNA 3LDQB 1D1BA 3KV9A 2WMNA 4C90A 1I6ZA 2XQ7A 4GYRA 4EV6A 4DBRA 1S94A 2J62A 3HA4A 1X79A 2D9DA 3FBLA 3WAJA 5J2TE 3IHRA 2XQ4A 2CMRA 5LYJE 2XQ3A 4PJJA 4PK6A 3WAKA 3ZJ2A 3MA9A 5LMUT 3N9MA 5LHHB 5EK2A 3DP7A 3ZLIA 5J2UE 1KF6A 2W0GA 1NWMX 2QVAA 1KNPA 3NKZA 3OTOT 2VQFT 4Z91A 3H3MA 1Z8UA 1ZP0A 2CLYC 4LMLA 1LVKA 5HYAA 3JAFA 4TN7B 3KV5A 3ZT7A 4CXWA 4EEDA 2V6YA 1NAFA 3AAEB 2BZBA 2Z6EA 2YKSA 2ODVA 3AECA 3LJCA 3NZQA 1N36T 3ZJ1A 2E9XB 3L3PA 2X51A 1E7PA 5JH7E 5HEJA 3RQUA 4G2AA 2VKJA 4AKIA 2VASA 2XUEA 4IIJE 4I0UA 4M1PA 4P0BA 2X9XA 3PU8A 2UXCT 3M65A 4BA9A 2CHNA 3EHZA 4CZZB 3RKGA 4GYSA 2WQYA 2EHOD 2RPAA 2ACXA 3KVBA 3ZN1B 2XTLA 3I0OA 3FB2A 4HEAA 4DUZT 4UVCB 3UU8A 4A56A 4UEMA 5FY1A 1SHZC 2XAFB 5FP3A 1J5WA 4A97A 5KDMC 1UX5A 3NWIA 4EYUA 2KWIB 5HEGA 2LSJA 4JI7T 2KT9A 4KUMB 5LG3A 3B57A 3VKHA 2YU1A 2QYWA 4DR3T 2X0LB 2W62A 2LSIA 4CN1A 4AISA 5KX5E 1HF8A 1S35A 1MMDA 2XQ9A 4PJMA 3SFEA 4HFDA 4YTMA 2V26A 1O3XA 2JIWA 3AVRA 2UU9T 5HXSA 3MK7C 5ABGA 1XMOT 4H9NC 3VR9A 4JI5T 2W2UA 4C91A 2ZLYA 3AE2A 4LF9T 5FL1A 3KDSE 2MPKA 5HXCA 2CXDA 3AE8A 3EDVA 4TNVA 2K5BB 5LHGB 3C51A 3H3AA 3N2KE 4QXBB 4BJMA 3F57A 5AQFB 2CRBA 3AA0B 3RIUC 1WR0A 2X68A 2YEVC 4NPPA 3U3IA 5FXVA 4I55E 1N32T 3C98B 2LE8A 1HX8A 3ZYMA 2B76A 2W67A 1KK7A 3ZMUB 2V1DB 3BQLA 4EYYR 2E5VA 2V6YB 1HFAA 1L0VA 4JUYA 2IAKA 2EHOA 3ZSTA 2LT3A 2NTXA 2M6BA 2RP4A 1WR6A 1VCTA 4IDPA 1XNRT 2W63A 4EAHA 5LNKA 2X9WA 4JI2T 5DQWA 5CJ5A 4ADZA 2XQYA 3LG7A 2E9XD 3KVAA 1VOMA 2GK9A 4IE4A 2CE7A 3EDUA 4KI0F 4LF7T 3RYFE 1UGOA 1WRDA 1V9DA 2DHRA 2VB6A 3CX7B 2BG9E 2LRKA 4IREA 3AEAA 3QB5A 4YJ2E 3AA7B 4H63V 2CCQA 3SRZA 4EZ4A 2KNDA 4DV2T 4UF0A 2PG8A 2XQ5A 1ZEEA 5LP6E 4MFRA 4ZXLA 4H9OC 4P09A 2D5UA 1D1AA 3HKCE 4ZS2A 2QRXA 4IL4A 4COFA 4DR1T 4TWDA 3FHNA 3KBUA 1YW0A 2NW8A 2H88A 2CM0A 3RI5A 3UUMA 4LMKA 2ES0A 2MOZA 4AKRB 5H6QB 2OLTA 2H3RA 3IA3A 3ANWA 4E7ZA 4TV9E 2WU2A 5EK3A 4JLEA 4L0RA 2HN1A 1OEDE 3QOFA 1GQEA 5EK4A 1IJ6A 3UQ4A 2JQ9A 1KNRA 2KSRA 3AAIA 3KV6A 1W0BA 4HWFA 4OFZA 1UUSA 2WM9A 3PJAJ 2VL8A 5EZYE 4K0UA 1VCSA 4HKAA 2WDQA 4X1YE 2JJ9A 1LRZA 4CN4A 3ETVA 4ISTA 3AEFA 2BBJA 3VR8A 3ESLA 4F8HA 5L3GB 4AI6A 4TWHA 2X9HA 3ZT6A 2DLRA 2MTQA 2VKOA 4XAXB 5LHIB 3RQWA 2E9XA 4YSXA 2LM9A 2NWBA 3CQGB 4B3MT 5JVDE 5JDLA 2LM2A 3I1AA 1IZNB 2BVMA 4UXNB 3LK42 1Y64B 3UU4A 4ZZCA 1CHUA 1YKEB 4JI3T 5L3CB 2EHOB 3AVSA 4L5GA 2NTYA 4NXMT 4UELA 2J4GA 1KFYA 4AQFA 2DI4A 1AJ3A 3J9X1 2H7OA 4ZOLE 4X62T 4HTEA 4AKGA 2YK0A 3HKBE 3EABA 5LOVE 4HWIB 1D1CA 4CXYA 3W15B 2AXDS 1J5ET 3JC6C 4YFSA 3PUYF 4PJNA 2XSAA 4UIGA 2N1GA 4DR5T 3I0QA 3UU3A 2HH7A 4H9PC 2IW5B 4KHZF 3DJBA 4DR6T 4TZ4C 4UF0B 3E22E 5FNVE 3RIAA 2LOPA 1HNWT 1ZKEA 3ZYLA 3CQXC 3AEGA 1T7SA 5JDMA 3MZKB 2C5KT 3PUXF 5IWAT 4XZCA 4HWCA 5AQHB 5FVKA 3NRXA 5BR8T 4QXHB 5JDQA 5L3DB 4BJNA 3ONXA 4U7YA 4WYVA 4IT4A 1W09A 4YSZA 1EZ3A 2IIUA 4QWNB 4B3RT 3ZMVB 5HEHA 3BK9A 2IUBA 1YQ3A 4OHFA 5HEOA 2AE9A 5LGTB 5AQKB 4YT0A 3ANWB 4B3ST 1WFDA 5KMGP 5AQRB 3R84B 4KX6A 3ONJA 3K1SA 3C50A 5HXEA 2Y6XA 3N9NA 5LGUB 5CA1E 3ZYKA 4ZZBA 4G63A 4LFCT 3F2EA 4YJ3E 2I0MA 3N2OA 1B7TA 4OYJA 3P50A 2WDRA 3P4PA 3P7IA 4P0AA 5ADXL 4OYKA 3RYCE 4CQIA 2BKPA 4F6RC 3VRBA 4FJOA 2D0UA 3LBXB 2KLQA 3KFWX 4GK0E 1E2AA 2YDRA 2XAHB 5HAXA 2WY2A 3UU5A 5J0ZA 1UCUA 1JNRA 2HPJA 3TLWA 4UR9A 2YDSA 3HR0A 4ILUA 5AQUB 4KMCA 4UVBB 1E1HB 4LF6T 3BQKA 4EZHA 1IAPA 1LVFA 4BAYB 3K3QC 2X0HA 3EAMA 4JBWF 4PW8A 3HL6A 1ZV4X 2K48A 2V7KA 3ZC0A 3AAAB 1W9RA 1OEDC 3SFDA 4NUUA 2V7LA 1HG2A 4X1KE 2P9BA 5CA0E 1HCIA 1SUMB 4DUYT 4EGWA 1BR2A
chains in the Genus database with same CATH topology
4DR7T 4X62T 5LMNT 4DR3T 1XMQT 1FJGT 4LF4T 1XNRT 3T1HT 1J5ET 4GKJT 1N36T 4JV5T 4JI2T 2UU9T 4LFCT 4DR5T 4LF5T 2E5LT 1I94T 1XMOT 4GKKT 4LF7T 2HHHT 2ZM6T 4JI4T 4OX9T 4LFAT 4JI5T 2VQET 4DR6T 2UXDT 4LF9T 4LF8T 1IBLT 1HNWT 4JI8T 1HR0T 4KHPT 2UXCT 5IWAT 4DV2T 1IBKT 5BR8T 4B3TT 2UXBT 4YHHT 4DR4T 4DV3T 2UUBT 4DV6T 3T1YT 4AQYT 5LMUT 4B3MT 2UUCT 4LF6T 4DV7T 4DV4T 2F4VT 1N32T 1XNQT 2UUAT 4DUZT 1N33T 4B3RT 4DV0T 4DR2T 4JI0T 1HNXT 1HNZT 4JI3T 4JYAT 4X64T 4NXNT 4K0KT 4YY3T 4DR1T 1N34T 4X66T 4DV5T 3OTOT 4NXMT 4LFBT 2VQFT 4B3ST 4DV1T 4JI6T 4JI1T 1IBMT 4JI7T 4DUYT 4X65T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR7 T;  4X62 T;  5LMN T;  4DR3 T;  1XMQ T;  1FJG T;  4LF4 T;  1XNR T;  3T1H T;  1J5E T;  4GKJ T;  1N36 T;  4JV5 T;  4JI2 T;  2UU9 T;  4LFC T;  4DR5 T;  4LF5 T;  2E5L T;  1I94 T;  1XMO T;  4GKK T;  4LF7 T;  2HHH T;  2ZM6 T;  4JI4 T;  4OX9 T;  4LFA T;  4JI5 T;  2VQE T;  4DR6 T;  2UXD T;  4LF9 T;  4LF8 T;  1IBL T;  1HNW T;  4JI8 T;  1HR0 T;  4KHP T;  2UXC T;  5IWA T;  4DV2 T;  1IBK T;  5BR8 T;  4B3T T;  2UXB T;  4YHH T;  4DR4 T;  4DV3 T;  2UUB T;  4DV6 T;  3T1Y T;  4AQY T;  5LMU T;  4B3M T;  2UUC T;  4LF6 T;  4DV7 T;  4DV4 T;  2F4V T;  1N32 T;  1XNQ T;  2UUA T;  4DUZ T;  1N33 T;  4B3R T;  4DV0 T;  4DR2 T;  4JI0 T;  1HNX T;  1HNZ T;  4JI3 T;  4JYA T;  4X64 T;  4NXN T;  4K0K T;  4YY3 T;  4DR1 T;  1N34 T;  4X66 T;  4DV5 T;  3OTO T;  4NXM T;  4LFB T;  2VQF T;  4B3S T;  4DV1 T;  4JI6 T;  4JI1 T;  1IBM T;  4JI7 T;  4DUY T;  4X65 T; 
#chains in the Genus database with same CATH topology
 1T98 A;  3AB3 B;  2VVN A;  4WZX A;  5AFU L;  3FZL B;  1FJG T;  5JR9 C;  5L4E A;  2B1E A;  4LF4 T;  5L2L A;  4I50 E;  5AQS B;  3R6N A;  2VVS A;  4QH1 A;  5FXW A;  2K24 A;  3O1I A;  2CPT A;  3AA6 B;  3PUG A;  1M62 A;  2WWV A;  4LFA T;  3ABV A;  3KIN B;  2WS3 A;  4LF8 T;  5F5W A;  4MAL A;  3LK3 B;  3GN5 A;  2Q9Q C;  3O1H A;  2VKH A;  2V5C A;  5DQV A;  2UXB T;  1UUR A;  2A9U A;  2KMF A;  4DVD A;  4H9Q C;  5LBQ B;  2LRL A;  2VKD A;  3X1D A;  4PFP A;  3EVY A;  5FXZ A;  2BBH A;  2QGS A;  3CX8 B;  4YHJ A;  2WAU A;  3Q9D A;  3AE3 A;  2Y8D A;  1UK5 A;  2DCF A;  3MKD A;  4X66 T;  3TLU A;  2K3W A;  4ZI3 C;  1FIO A;  5C8Y E;  3A5X A;  3PTR B;  2LSY A;  3ZN0 B;  4HFI A;  3Q2M A;  1OWA A;  4GOU A;  2BKO A;  2JMK A;  3OBV E;  5JR9 A;  3V5S A;  1YQ4 A;  4E7S A;  3UFG A;  4ILA A;  3O1J A;  3PUA A;  1D0Z A;  3I9Y A;  4H9R C;  1MMN A;  3JCF A;  5JQG E;  4LF5 T;  3PUR A;  5ABH A;  2MYS A;  2VQE T;  3RLF F;  3CQC B;  2H7V C;  1Y01 A;  5JDF A;  4CXX A;  4YSY A;  2V5D A;  1HR0 T;  4TWF A;  4CN6 A;  3N5L A;  2IC6 A;  3WI3 A;  2R6G F;  3Q5E A;  2LSG A;  5DJQ C;  2HN2 A;  1DU2 A;  3T8O A;  4AQY T;  4IE5 A;  4DID B;  1T8B A;  1N33 T;  2LLY A;  5FYM A;  2W66 A;  4X64 T;  3ZT5 A;  1QSD A;  5AQN B;  2WDV A;  3D0T A;  4AKL A;  2ODU A;  4NUV A;  3RIU A;  3MXZ A;  2FJA A;  1IBM T;  4AKH A;  4MBQ A;  3P4Q A;  2DWG A;  2CLY B;  3EUH A;  3OKQ A;  3E08 A;  5E0O A;  3IBP A;  3NRY A;  3TLS A;  1U5P A;  3SS1 A;  2HPL A;  2VWA A;  3TLV A;  3T1H T;  4TNW A;  3HI2 A;  4UVA B;  5IYZ E;  5J1G A;  2E8I A;  4PNI A;  3GN5 B;  5F3J A;  1LKX A;  1UX4 A;  1NEK A;  2HHH T;  4JI4 T;  4OX9 T;  2UXD T;  4EIW A;  3C4W A;  4IDO A;  2X0Y A;  3RRC A;  3OVU A;  4HGA A;  2QA7 A;  3N9Q A;  2LKG A;  1FEW A;  2W4X A;  5DAB A;  3LSV A;  2YOE A;  2X67 A;  2BKN A;  3RC3 A;  4GIW A;  4DV3 T;  3UUB A;  2UUB T;  2WWU A;  3B5M A;  3PJA A;  4YXD A;  2VUR A;  5HCM A;  2F4V T;  5HEU A;  3RX6 A;  2XZE A;  4DV0 T;  5AQP B;  3VRA A;  4HFB A;  4HN9 A;  3P4S A;  4U72 A;  3LBX A;  1WLX A;  2ACZ A;  3C4X A;  2KXP B;  1NEN A;  3QC9 A;  2L9Q A;  3ZSS A;  4JI6 T;  2XSB A;  5JR9 B;  3L09 A;  2L3L A;  5FVL A;  1KEY A;  3PV0 F;  2G0U A;  3JC6 D;  5LXT E;  2JQH A;  3ZCI A;  2YN6 A;  3AE5 A;  4JV5 T;  3MJX A;  2CA5 A;  5HXH A;  2DWK A;  2W00 A;  3TKL B;  4ZI7 E;  5C2T A;  4TUY E;  2Q9Q B;  4ZEY A;  4DND A;  4Z90 A;  1HG5 A;  5FKY A;  4TX5 A;  1IBL T;  1ZHC A;  4O4J E;  1CUN A;  3P8C D;  4HFE A;  3P4W A;  2DL1 A;  3PUV F;  4PK5 A;  4ERR A;  2XPK A;  5M4Y A;  5H6R B;  3K8P C;  3PDY A;  4HE8 A;  3UUX B;  4YHH T;  2V7I A;  4U33 A;  3IEE A;  2BS2 A;  3AE9 A;  4YTP A;  3AA1 B;  4DV4 T;  3RKO A;  2V7M A;  5FXX A;  1X9B A;  4PAG A;  1XNQ T;  2OA5 A;  1MIV A;  4DMW A;  4ZI2 C;  2CBI A;  2PJQ A;  1D0X A;  3L8R A;  2WZI A;  4K0K T;  3N2G E;  4UV8 B;  4ASK A;  4O4L E;  3UT5 E;  2BDE A;  3ZC1 A;  4QX7 B;  3KV4 A;  1HX1 B;  2DNX A;  2XY8 B;  2YIN A;  4CI3 B;  4DO0 A;  4QH5 A;  2A2F X;  2N2N A;  3O4X E;  3V5U A;  3UTK A;  1M7K A;  3F31 A;  5L3E B;  2WSS V;  5ETW A;  5CFB A;  3CX6 B;  5IUX A;  4LMJ A;  2BG9 C;  2IDO B;  2CEA A;  4KP3 C;  1HTJ F;  2XM1 A;  4X20 E;  4JI8 T;  4U3C A;  1W0A A;  4EXT A;  3PUQ A;  2FJE A;  3CVR A;  5GON E;  5F8P A;  2XAG B;  2ZMA A;  2UUC T;  5HWY A;  3ZEF B;  3M3Z B;  4AXP A;  2IC9 A;  2I6H A;  4DR2 T;  4JI0 T;  2JQK A;  1HNZ T;  2WMO A;  2OV9 A;  1WYB A;  3RH3 A;  2LHR A;  2FJB A;  3RF1 A;  2WB5 A;  2V7J A;  2XQA A;  4O2A E;  4IL9 A;  2C0S A;  4WBO A;  3PU3 A;  2V6X A;  4B6X A;  2CXF A;  1FMV A;  2V8S V;  1XWM A;  4CI1 B;  4O2B E;  1H7C A;  2JPF A;  2D0T A;  4ZS3 A;  3QB5 K;  1MND A;  3GA8 A;  3E0Z A;  4DMV A;  2NP9 A;  4XBF B;  5IHY A;  2H89 A;  4YTN A;  4H63 H;  4J2C A;  3Q5D A;  2FJD A;  5LGN B;  2CHO A;  3CK6 A;  2J47 A;  4FI5 A;  3CWZ B;  2E5L T;  3PUS A;  3AED A;  2CBJ A;  2Q9Q D;  5L4H A;  4AIU A;  3OJA A;  5KXJ A;  4O4I E;  4V1A v;  3AE1 A;  2BG9 A;  3NVO A;  1MIW A;  2KIN B;  2Y48 B;  4I4T E;  3UU6 A;  1XDP A;  1QUU A;  3AE6 A;  1FMW A;  3RRW A;  1MNE A;  3FBZ A;  3CKD A;  3ONL C;  3N9O A;  4ILC A;  4DV6 T;  4QXC B;  3Q5X A;  2EHO C;  4X1I E;  4DV7 T;  2CWO A;  4Z8X A;  5LCY A;  2JRK A;  3LFM A;  2X9Y A;  1Z0P A;  4U74 A;  3EI0 A;  3I9W A;  2BS4 A;  1SA0 E;  4ZI3 D;  5LA6 E;  3JAE A;  2WU5 A;  4N78 D;  4DV5 T;  4HWH A;  4EB6 E;  5AQG B;  2FBW A;  3AEE A;  3GWH A;  3FXE B;  2M6I A;  5JDH A;  4A5X A;  4IDQ A;  1U4Q A;  2NOX A;  4JEU B;  5ABF A;  2VK9 A;  1WCR A;  2WZH A;  2JQQ A;  2FUP A;  1BR4 A;  3OYX A;  3KBT A;  2PFV A;  1BR0 A;  4OK0 A;  3CIR A;  1OED A;  2LSK A;  1JNZ A;  5JRE A;  3AXJ A;  2D2S A;  4GKK T;  4JEH B;  1MMG A;  1YKH B;  4NIQ A;  5AQQ B;  2UXX B;  3FZM B;  3FZK B;  3RHW A;  3OYZ A;  1ZOY A;  1R8I A;  4IDZ A;  2NW7 A;  3UUL A;  3UUN A;  5AQM B;  3QNU A;  4KHP T;  2LOS A;  5JTG A;  5L3B B;  3ZMT B;  2LEH A;  5JDN A;  4WW0 A;  4B3T T;  3VHL A;  1XDO A;  2XAQ B;  3J7Y q;  5LBM A;  4Q25 A;  4DR4 T;  2KWH A;  2SPC A;  2ZM0 A;  3PE0 A;  2MAW A;  4A98 A;  3ZMS B;  4TV8 E;  1G73 A;  1SE7 A;  2Q9Q A;  4YLH A;  4HWD A;  5TAO A;  5A1L A;  4KBM B;  4JYA T;  4EEB A;  5CGM A;  4QHO A;  4YY3 T;  4PJL A;  2CWY A;  2XJ7 A;  2ZM8 A;  4ZHQ E;  4O4H E;  4WNK A;  2WBL A;  3N9P A;  4GK5 E;  3FZF B;  3ZMZ B;  5AQT B;  3UQ7 A;  2E2A A;  3B13 A;  1J1J A;  1T72 A;  3AEB A;  3H37 A;  3O9X A;  3PUW F;  2LKH A;  4AQG A;  4QKN A;  4QH4 A;  3IF8 B;  4IHJ E;  3PUZ F;  1IJ5 A;  3UFE A;  4HFH A;  2N9D A;  5AQL B;  4EOZ B;  1WYC A;  2LHN A;  3Q5W A;  3OPC A;  4PFO A;  3N9L A;  3C64 A;  4IE7 A;  3RYI E;  2BG9 B;  2I59 A;  3FZH B;  1I94 T;  2K9A A;  2WCA A;  3HKE E;  3TLT A;  2E9X C;  2PBI A;  2XM2 A;  3LK2 B;  4HFC A;  3BQI A;  3RYH E;  2LJL A;  5JRC A;  3GMI A;  3RPU A;  1XZY A;  2W61 A;  2C5I T;  4IE0 A;  4AQF C;  4U7I A;  5AQJ B;  3T1Y T;  2XAJ B;  4U2Y A;  5ABE A;  1QLB A;  2ZM2 A;  2L8K A;  2UUA T;  2YDQ A;  1US7 B;  3RGL A;  4U31 A;  3RIF A;  1MMA A;  1YXR A;  5LG4 A;  1N34 T;  3DTO A;  5ABF B;  4MHC A;  3SWH A;  2M67 A;  4DV1 T;  3AE7 A;  5L3F B;  5C3J A;  2WP9 A;  5CB4 E;  4PK4 A;  3NBX X;  4X65 T;  3A7M A;  5FL0 A;  1OED B;  4DR7 T;  5BMV E;  3SOL A;  2A3D A;  5LMN T;  4O8S A;  3VU7 H;  3QUJ A;  4L9I A;  3NZP A;  1VRB A;  3AXJ B;  3FXD B;  5LB7 B;  2CXL A;  2PTF A;  4UV9 B;  2XQ8 A;  1YD8 G;  3ZCJ A;  5HXR A;  4DBQ A;  4QX8 B;  3U78 A;  2BVL A;  5AQV B;  2A72 A;  5L47 A;  4IDN A;  3AE4 A;  3QK6 A;  3A8Y C;  2KZ7 B;  2ZM6 T;  4X5T A;  3VKG A;  2RA1 A;  3L39 A;  4H9S E;  2MBG A;  1OXZ A;  2NW9 A;  2NR4 A;  4ILB A;  2XAS B;  2JMH A;  3JAD A;  2UXN B;  2X66 A;  3K3N A;  1IBK T;  2IML A;  3ZKR A;  1MIY A;  2IHR 1;  5FY0 A;  2XQ6 A;  3C4Z A;  4MLK A;  3MAC A;  3ZPO A;  1HS7 A;  4HFV A;  4WBN E;  1KNZ A;  4ZI2 D;  3CPZ A;  5HWX A;  4ISS A;  5FMN A;  3P4R A;  1HNX T;  2C5J A;  3S4U A;  4NXN T;  4CI2 B;  2VL0 A;  4P1N A;  2J1D G;  4LFB T;  4JI1 T;  3K3O A;  3HKD E;  4U2Z A;  3RC8 A;  5FY7 A;  5LJM A;  5AQI B;  1D0Y A;  4I43 B;  2YU2 A;  5AQO B;  1XMQ T;  3ETU A;  1BR1 A;  3G06 A;  5HCJ A;  4IE6 A;  5JDG A;  4GKJ T;  3CML A;  1G8X A;  2BS3 A;  2XHE B;  4IGU A;  4ANJ A;  5JRC B;  5LJN A;  3LDQ B;  1D1B A;  3KV9 A;  2WMN A;  4C90 A;  1I6Z A;  2XQ7 A;  4GYR A;  4EV6 A;  4DBR A;  1S94 A;  2J62 A;  3HA4 A;  1X79 A;  2D9D A;  3FBL A;  3WAJ A;  5J2T E;  3IHR A;  2XQ4 A;  2CMR A;  5LYJ E;  2XQ3 A;  4PJJ A;  4PK6 A;  3WAK A;  3ZJ2 A;  3MA9 A;  5LMU T;  3N9M A;  5LHH B;  5EK2 A;  3DP7 A;  3ZLI A;  5J2U E;  1KF6 A;  2W0G A;  1NWM X;  2QVA A;  1KNP A;  3NKZ A;  3OTO T;  2VQF T;  4Z91 A;  3H3M A;  1Z8U A;  1ZP0 A;  2CLY C;  4LML A;  1LVK A;  5HYA A;  3JAF A;  4TN7 B;  3KV5 A;  3ZT7 A;  4CXW A;  4EED A;  2V6Y A;  1NAF A;  3AAE B;  2BZB A;  2Z6E A;  2YKS A;  2ODV A;  3AEC A;  3LJC A;  3NZQ A;  1N36 T;  3ZJ1 A;  2E9X B;  3L3P A;  2X51 A;  1E7P A;  5JH7 E;  5HEJ A;  3RQU A;  4G2A A;  2VKJ A;  4AKI A;  2VAS A;  2XUE A;  4IIJ E;  4I0U A;  4M1P A;  4P0B A;  2X9X A;  3PU8 A;  2UXC T;  3M65 A;  4BA9 A;  2CHN A;  3EHZ A;  4CZZ B;  3RKG A;  4GYS A;  2WQY A;  2EHO D;  2RPA A;  2ACX A;  3KVB A;  3ZN1 B;  2XTL A;  3I0O A;  3FB2 A;  4HEA A;  4DUZ T;  4UVC B;  3UU8 A;  4A56 A;  4UEM A;  5FY1 A;  1SHZ C;  2XAF B;  5FP3 A;  1J5W A;  4A97 A;  5KDM C;  1UX5 A;  3NWI A;  4EYU A;  2KWI B;  5HEG A;  2LSJ A;  4JI7 T;  2KT9 A;  4KUM B;  5LG3 A;  3B57 A;  3VKH A;  2YU1 A;  2QYW A;  4DR3 T;  2X0L B;  2W62 A;  2LSI A;  4CN1 A;  4AIS A;  5KX5 E;  1HF8 A;  1S35 A;  1MMD A;  2XQ9 A;  4PJM A;  3SFE A;  4HFD A;  4YTM A;  2V26 A;  1O3X A;  2JIW A;  3AVR A;  2UU9 T;  5HXS A;  3MK7 C;  5ABG A;  1XMO T;  4H9N C;  3VR9 A;  4JI5 T;  2W2U A;  4C91 A;  2ZLY A;  3AE2 A;  4LF9 T;  5FL1 A;  3KDS E;  2MPK A;  5HXC A;  2CXD A;  3AE8 A;  3EDV A;  4TNV A;  2K5B B;  5LHG B;  3C51 A;  3H3A A;  3N2K E;  4QXB B;  4BJM A;  3F57 A;  5AQF B;  2CRB A;  3AA0 B;  3RIU C;  1WR0 A;  2X68 A;  2YEV C;  4NPP A;  3U3I A;  5FXV A;  4I55 E;  1N32 T;  3C98 B;  2LE8 A;  1HX8 A;  3ZYM A;  2B76 A;  2W67 A;  1KK7 A;  3ZMU B;  2V1D B;  3BQL A;  4EYY R;  2E5V A;  2V6Y B;  1HFA A;  1L0V A;  4JUY A;  2IAK A;  2EHO A;  3ZST A;  2LT3 A;  2NTX A;  2M6B A;  2RP4 A;  1WR6 A;  1VCT A;  4IDP A;  1XNR T;  2W63 A;  4EAH A;  5LNK A;  2X9W A;  4JI2 T;  5DQW A;  5CJ5 A;  4ADZ A;  2XQY A;  3LG7 A;  2E9X D;  3KVA A;  1VOM A;  2GK9 A;  4IE4 A;  2CE7 A;  3EDU A;  4KI0 F;  4LF7 T;  3RYF E;  1UGO A;  1WRD A;  1V9D A;  2DHR A;  2VB6 A;  3CX7 B;  2BG9 E;  2LRK A;  4IRE A;  3AEA A;  3QB5 A;  4YJ2 E;  3AA7 B;  4H63 V;  2CCQ A;  3SRZ A;  4EZ4 A;  2KND A;  4DV2 T;  4UF0 A;  2PG8 A;  2XQ5 A;  1ZEE A;  5LP6 E;  4MFR A;  4ZXL A;  4H9O C;  4P09 A;  2D5U A;  1D1A A;  3HKC E;  4ZS2 A;  2QRX A;  4IL4 A;  4COF A;  4DR1 T;  4TWD A;  3FHN A;  3KBU A;  1YW0 A;  2NW8 A;  2H88 A;  2CM0 A;  3RI5 A;  3UUM A;  4LMK A;  2ES0 A;  2MOZ A;  4AKR B;  5H6Q B;  2OLT A;  2H3R A;  3IA3 A;  3ANW A;  4E7Z A;  4TV9 E;  2WU2 A;  5EK3 A;  4JLE A;  4L0R A;  2HN1 A;  1OED E;  3QOF A;  1GQE A;  5EK4 A;  1IJ6 A;  3UQ4 A;  2JQ9 A;  1KNR A;  2KSR A;  3AAI A;  3KV6 A;  1W0B A;  4HWF A;  4OFZ A;  1UUS A;  2WM9 A;  3PJA J;  2VL8 A;  5EZY E;  4K0U A;  1VCS A;  4HKA A;  2WDQ A;  4X1Y E;  2JJ9 A;  1LRZ A;  4CN4 A;  3ETV A;  4IST A;  3AEF A;  2BBJ A;  3VR8 A;  3ESL A;  4F8H A;  5L3G B;  4AI6 A;  4TWH A;  2X9H A;  3ZT6 A;  2DLR A;  2MTQ A;  2VKO A;  4XAX B;  5LHI B;  3RQW A;  2E9X A;  4YSX A;  2LM9 A;  2NWB A;  3CQG B;  4B3M T;  5JVD E;  5JDL A;  2LM2 A;  3I1A A;  1IZN B;  2BVM A;  4UXN B;  3LK4 2;  1Y64 B;  3UU4 A;  4ZZC A;  1CHU A;  1YKE B;  4JI3 T;  5L3C B;  2EHO B;  3AVS A;  4L5G A;  2NTY A;  4NXM T;  4UEL A;  2J4G A;  1KFY A;  4AQF A;  2DI4 A;  1AJ3 A;  3J9X 1;  2H7O A;  4ZOL E;  4X62 T;  4HTE A;  4AKG A;  2YK0 A;  3HKB E;  3EAB A;  5LOV E;  4HWI B;  1D1C A;  4CXY A;  3W15 B;  2AXD S;  1J5E T;  3JC6 C;  4YFS A;  3PUY F;  4PJN A;  2XSA A;  4UIG A;  2N1G A;  4DR5 T;  3I0Q A;  3UU3 A;  2HH7 A;  4H9P C;  2IW5 B;  4KHZ F;  3DJB A;  4DR6 T;  4TZ4 C;  4UF0 B;  3E22 E;  5FNV E;  3RIA A;  2LOP A;  1HNW T;  1ZKE A;  3ZYL A;  3CQX C;  3AEG A;  1T7S A;  5JDM A;  3MZK B;  2C5K T;  3PUX F;  5IWA T;  4XZC A;  4HWC A;  5AQH B;  5FVK A;  3NRX A;  5BR8 T;  4QXH B;  5JDQ A;  5L3D B;  4BJN A;  3ONX A;  4U7Y A;  4WYV A;  4IT4 A;  1W09 A;  4YSZ A;  1EZ3 A;  2IIU A;  4QWN B;  4B3R T;  3ZMV B;  5HEH A;  3BK9 A;  2IUB A;  1YQ3 A;  4OHF A;  5HEO A;  2AE9 A;  5LGT B;  5AQK B;  4YT0 A;  3ANW B;  4B3S T;  1WFD A;  5KMG P;  5AQR B;  3R84 B;  4KX6 A;  3ONJ A;  3K1S A;  3C50 A;  5HXE A;  2Y6X A;  3N9N A;  5LGU B;  5CA1 E;  3ZYK A;  4ZZB A;  4G63 A;  4LFC T;  3F2E A;  4YJ3 E;  2I0M A;  3N2O A;  1B7T A;  4OYJ A;  3P50 A;  2WDR A;  3P4P A;  3P7I A;  4P0A A;  5ADX L;  4OYK A;  3RYC E;  4CQI A;  2BKP A;  4F6R C;  3VRB A;  4FJO A;  2D0U A;  3LBX B;  2KLQ A;  3KFW X;  4GK0 E;  1E2A A;  2YDR A;  2XAH B;  5HAX A;  2WY2 A;  3UU5 A;  5J0Z A;  1UCU A;  1JNR A;  2HPJ A;  3TLW A;  4UR9 A;  2YDS A;  3HR0 A;  4ILU A;  5AQU B;  4KMC A;  4UVB B;  1E1H B;  4LF6 T;  3BQK A;  4EZH A;  1IAP A;  1LVF A;  4BAY B;  3K3Q C;  2X0H A;  3EAM A;  4JBW F;  4PW8 A;  3HL6 A;  1ZV4 X;  2K48 A;  2V7K A;  3ZC0 A;  3AAA B;  1W9R A;  1OED C;  3SFD A;  4NUU A;  2V7L A;  1HG2 A;  4X1K E;  2P9B A;  5CA0 E;  1HCI A;  1SUM B;  4DUY T;  4EGW A;  1BR2 A; 
#chains in the Genus database with same CATH homology
 4DR7 T;  4X62 T;  5LMN T;  4DR3 T;  1XMQ T;  1FJG T;  4LF4 T;  1XNR T;  3T1H T;  1J5E T;  4GKJ T;  1N36 T;  4JV5 T;  4JI2 T;  2UU9 T;  4LFC T;  4DR5 T;  4LF5 T;  2E5L T;  1I94 T;  1XMO T;  4GKK T;  4LF7 T;  2HHH T;  2ZM6 T;  4JI4 T;  4OX9 T;  4LFA T;  4JI5 T;  2VQE T;  4DR6 T;  2UXD T;  4LF9 T;  4LF8 T;  1IBL T;  1HNW T;  4JI8 T;  1HR0 T;  4KHP T;  2UXC T;  5IWA T;  4DV2 T;  1IBK T;  5BR8 T;  4B3T T;  2UXB T;  4YHH T;  4DR4 T;  4DV3 T;  2UUB T;  4DV6 T;  3T1Y T;  4AQY T;  5LMU T;  4B3M T;  2UUC T;  4LF6 T;  4DV7 T;  4DV4 T;  2F4V T;  1N32 T;  1XNQ T;  2UUA T;  4DUZ T;  1N33 T;  4B3R T;  4DV0 T;  4DR2 T;  4JI0 T;  1HNX T;  1HNZ T;  4JI3 T;  4JYA T;  4X64 T;  4NXN T;  4K0K T;  4YY3 T;  4DR1 T;  1N34 T;  4X66 T;  4DV5 T;  3OTO T;  4NXM T;  4LFB T;  2VQF T;  4B3S T;  4DV1 T;  4JI6 T;  4JI1 T;  1IBM T;  4JI7 T;  4DUY T;  4X65 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...