4GKJT

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aug-codon in the a-site and paromomycin.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4gkjT00
4DV7T 2UU9T 5LMUT 4GKJT 2ZM6T 4KHPT 5BR8T 4NXNT 4DUYT 4JI7T 4B3RT 4LFCT 4JV5T 4DR3T 4DR4T 4DR5T 1N32T 4JI2T 2HHHT 4DR7T 4AQYT 1HNWT 1XNQT 4JI5T 4LF4T 4DR2T 4LFAT 4YY3T 1IBKT 2F4VT 1HR0T 4JI8T 4JI6T 4GKKT 5IWAT 4DR6T 4DV3T 1HNZT 4LF9T 1XMQT 1N33T 2UUCT 1XMOT 4LF7T 2UXCT 2VQFT 4DV2T 2UUAT 4JI1T 4X64T 1HNXT 4X65T 4LF6T 4DUZT 4B3MT 3T1YT 2UXDT 4X62T 4DR1T 1N36T 2UXBT 2UUBT 4DV5T 4LFBT 2VQET 4JI0T 4YHHT 1IBLT 4JI3T 1N34T 1I94T 4X66T 4B3ST 4B3TT 1XNRT 5LMNT 4LF5T 3OTOT 4OX9T 2E5LT 4JI4T 4DV0T 1FJGT 1J5ET 4JYAT 4DV1T 4DV4T 4DV6T 1IBMT 3T1HT 4NXMT 4K0KT 4LF8T
chains in the Genus database with same CATH superfamily
2XY8B 2WDVA 2V8SV 4P1NA 3QC9A 2NTYA 3C98B 3P4WA 3PUVF 2CWOA 2V7IA 4JV5T 4TN7B 3ZC0A 2BKOA 1WR0A 1XZYA 2V1DB 4I4TE 5LBMA 1LRZA 3C51A 1VCTA 1YXRA 3TKLB 2WWUA 3KVAA 4PW8A 5AQRB 2WDQA 2M6IA 5FMNA 2AE9A 3N2OA 5F8PA 2V6XA 2DHRA 2FJBA 3KDSE 4JBWF 4P0BA 4F8HA 2UUBT 4AQGA 2CEAA 3ZMVB 3KFWX 3O1HA 1BR2A 2H3RA 3M3ZB 5J1GA 2LM9A 3PUGA 2HN1A 4B3TT 2VL8A 3A8YC 1XNRT 3P4RA 2BBJA 4PJMA 3LBXA 4EZ4A 2FJAA 2ZLYA 1J5ET 4I0UA 3Q5XA 2W62A 5C2TA 5J0ZA 4DV4T 2RPAA 3P7IA 4I55E 4IDZA 2NR4A 3KV9A 4LMKA 1AJ3A 3LDQB 1G73A 4HFHA 1S35A 4JEUB 3ONJA 5LXTE 4ZI3C 4YLHA 3HKBE 4DR7T 2BVMA 3AA0B 5HXSA 5L2LA 1HNWT 2VVNA 5FXVA 4JI5T 1NEKA 3EVYA 2QYWA 3L09A 1O3XA 4IREA 2XAJB 5FNVE 3AEFA 3IHRA 3UU3A 4U72A 3IA3A 2D5UA 2LLYA 4TUYE 4YSYA 4LF6T 3CIRA 2LSKA 4B3MT 5HXHA 3LSVA 4HFEA 2MPKA 4BJMA 2VVSA 3ONXA 3ZT6A 3AECA 3AE4A 1YKHB 2Y6XA 3KINB 2X67A 3VRBA 1MIVA 4HFIA 5AQJB 5ABHA 3BQLA 2CM0A 3UQ7A 3GN5A 3OTOT 2DL1A 3N9QA 1WLXA 4HN9A 2IW5B 4X20E 5L3EB 3KBUA 2LSYA 4WBOA 2VURA 4LMJA 5BR8T 4ZXLA 2YN6A 1W0BA 3ANWB 3AAEB 4TV9E 3I0QA 1D1AA 3QB5A 3RGLA 2LHRA 3FBZA 2CXLA 1ZP0A 3RLFF 4DR4T 3K1SA 4Q25A 2ZMAA 1Y64B 5HXEA 3RH3A 3VRAA 3B57A 4U33A 1VRBA 3UT5E 4DR2T 4UELA 1WYBA 3N9NA 3CX8B 2OV9A 4UF0B 4GOUA 3UUMA 1XMQT 3P4PA 3RI5A 5HCJA 3ZN1B 4IIJE 2JMHA 3RQUA 5DJQC 3AEGA 2UXBT 4C91A 4BAYB 2K3WA 2XQ8A 3F31A 3NVOA 1KNRA 2A9UA 1KK7A 1J1JA 5JTGA 3N9PA 4OK0A 4YTNA 2E5VA 2IDOB 4Z91A 3I9YA 4L0RA 3OYZA 4GK0E 5EK3A 4XBFB 4DVDA 4IE4A 2N1GA 3UU5A 4K0KT 2NWBA 3RYHE 3Q2MA 4AQFA 4KHPT 3EUHA 1Y01A 4AXPA 2CWYA 3MA9A 4O4JE 4CXYA 4UR9A 3AVRA 1ZOYA 4IGUA 1B7TA 2H7OA 3L3PA 3L39A 2YU2A 3NRXA 1N32T 4O4LE 3TLSA 4L9IA 2YK0A 4AKRB 3O9XA 2K48A 5J2TE 1MNEA 4IDNA 4HE8A 2LRLA 3NZPA 4GKKT 3N9OA 5JVDE 5AQUB 5LOVE 1ZEEA 5HEHA 4QH4A 4X1KE 2KNDA 4YTPA 2AXDS 3MJXA 3HL6A 4ZS2A 4ILUA 4EEDA 4HEAA 3L8RA 3IF8B 4DIDB 2MBGA 5FVLA 3FHNA 3P8CD 1UURA 3EHZA 3WAKA 3LJCA 4QHOA 5AQVB 4HGAA 1HX8A 5AQOB 4QX7B 2DCFA 4DMVA 3PUZF 4XAXB 5CFBA 5H6RB 3J7Yq 2N2NA 3UUBA 5AQIB 4DV1T 2W0GA 5KMGP 2NP9A 4LF8T 2KINB 3AE9A 4GKJT 2JQ9A 2WMNA 2YINA 2WZIA 3O4XE 4JLEA 3CQXC 4NXNT 2GK9A 5FVKA 5HCMA 2Y48B 3RC3A 4PK5A 3AA1B 4KBMB 3ZYKA 3ZCJA 2HHHT 3JAFA 2LKGA 4HFCA 5AQFB 4A5XA 3OBVE 3UU4A 1NAFA 3NKZA 2Q9QA 4Z90A 2B1EA 2V6YB 3C64A 4YT0A 2D0UA 2JMKA 3ZYMA 2DLRA 3DTOA 2H89A 4OYKA 2Z6EA 3ZT7A 4LF9T 1D1CA 1T7SA 4LF7T 1MMAA 2OA5A 2W63A 4X64T 3UULA 5LA6E 3TLUA 5JRCA 3FXDB 5L3CB 3VKGA 5L3GB 3V5SA 4LFBT 2J47A 4PJLA 2JQHA 2E9XC 3Q5EA 4YHJA 2D0TA 3RYFE 5LNKA 3UTKA 2XQ9A 4QXCB 4JI4T 3A5XA 1LVFA 3TLTA 2XM2A 1WYCA 2W66A 2BBHA 3AEAA 4NXMT 2FBWA 5CA0E 1W9RA 3GMIA 4TX5A 4HWIB 1IAPA 4YJ3E 4U74A 2V7KA 3E0ZA 5EK2A 2YU1A 3K8PC 4IE7A 1LKXA 4TNWA 1VOMA 1IJ5A 5H6QB 3R6NA 4U7YA 2WB5A 2VL0A 5AQSB 4E7SA 5L3DB 4DMWA 3MK7C 3PV0F 5KXJA 4LFAT 4A97A 4CXXA 4JUYA 3TLVA 2X51A 4ZI3D 3C4WA 2KMFA 3QUJA 3E08A 2H7VC 4O2BE 3RIAA 4G2AA 1US7B 2WU2A 1Z8UA 3ZJ1A 4EB6E 2LSJA 1ZKEA 2CLYC 1T72A 2ES0A 3E22E 5LCYA 1N36T 5ABFA 4PFOA 2OLTA 4X1IE 3ZYLA 5F5WA 5AQMB 1N34T 2IC9A 4ZZCA 4HWFA 5AQHB 4N78D 3KV6A 1E7PA 5LMNT 1UX5A 5FKYA 2LT3A 4I43B 2Q9QC 4C90A 1OEDE 4MLKA 5C8YE 4DO0A 3ESLA 4EXTA 1HX1B 1J5WA 2XAGB 1LVKA 5FY1A 3AE6A 2P9BA 3AA6B 2XAHB 2LHNA 1V9DA 2CMRA 2ODVA 4EZHA 2CCQA 2BKNA 4DR5T 1HG2A 3RIUC 1FMVA 3PUAA 3ZEFB 4QH1A 1OEDB 3LK42 2CHOA 1IBKT 1IZNB 3GWHA 3D0TA 4ADZA 2B76A 2C0SA 4I50E 1X9BA 4DV2T 4U3CA 2L8KA 3W15B 2QRXA 3RKOA 5LYJE 3LBXB 3LFMA 3NRYA 3RX6A 2V7MA 5LB7B 2LSGA 5AQNB 2R6GF 3PURA 2PTFA 2W00A 5JQGE 3BQIA 4MHCA 3AE8A 4TZ4C 3CKDA 3I9WA 5EK4A 1IBMT 1QSDA 4LMLA 5LBQB 5LMUT 2ZM0A 5HWYA 4WBNE 4NIQA 3ANWA 5LGNB 5HEUA 4ISTA 4B3RT 4LFCT 4ZEYA 4KMCA 1E2AA 4F6RC 3MZKB 2YDRA 4IL4A 1IJ6A 4DR3T 2LE8A 4KUMB 3H37A 4G63A 1SE7A 5F3JA 3ZSSA 3K3OA 2LJLA 4EOZB 2VK9A 5ABGA 3NWIA 4EEBA 1YQ3A 2VASA 4KI0F 4QXHB 2YDSA 2L3LA 2X0LB 5AQGB 2XM1A 2D2SA 2HPLA 5IWAT 3PUYF 3KVBA 2J4GA 2BG9E 1UCUA 3PUXF 2BVLA 4X65T 5FP3A 2WU5A 4GK5E 5M4YA 1T8BA 3KBTA 4U2ZA 2X9XA 1D1BA 3ETVA 5LHGB 5A1LA 2XJ7A 1WRDA 3RQWA 3FZLB 4X66T 2H88A 3P4QA 3ABVA 4KP3C 5L3BB 4OX9T 2NW9A 5AQQB 1SUMB 5AQKB 1D0ZA 2VKJA 2XPKA 4QXBB 4JYAT 1EZ3A 4U31A 2BG9B 3PE0A 1KNPA 1D0YA 3FXEB 1YD8G 4ZS3A 5JREA 4AIUA 4CZZB 5EZYE 5HAXA 4HKAA 2MAWA 5JDMA 5FL1A 4QWNB 4AI6A 5HWXA 2ZM2A 1XNQT 3CX7B 3U78A 4HTEA 3MACA 5JR9A 3UU8A 3OYXA 3PJAJ 4MBQA 3NBXX 4CI2B 2CHNA 3BK9A 1N33T 4MALA 1DU2A 2YDQA 3CVRA 2PBIA 1JNZA 2IAKA 2J1DG 5LGUB 2HH7A 3O1IA 1W09A 1WFDA 4AKIA 4UIGA 4UEMA 4ASKA 4DBRA 1IBLT 3VR8A 3SWHA 1I94T 2CA5A 2LM2A 4P0AA 3ZPOA 4EIWA 2JPFA 4COFA 3HA4A 4GYSA 3EDUA 1BR0A 5CJ5A 3QK6A 3RYCE 3AAIA 1FJGT 3UQ4A 2E9XD 3VU7H 4IE5A 1YW0A 4MFRA 2E9XB 1GQEA 2RA1A 3SFDA 2NW7A 4EYYR 3O1JA 4TWDA 1XDOA 4DNDA 4IE6A 2QVAA 3FZFB 3OKQA 3FB2A 4B6XA 4H63V 5JH7E 4BJNA 3ZLIA 4O2AE 5AQTB 3AXJA 1SHZC 2I6HA 4GIWA 1JNRA 3H3AA 4AKHA 3LK3B 4AQYT 2FUPA 1NWMX 5LJNA 2YOEA 2DNXA 3HKEE 4DBQA 4JI8T 3B13A 1VCSA 2VKDA 1KNZA 2NOXA 5TAOA 3U3IA 5LP6E 2UXCT 3FZKB 4TV8E 2BS4A 3IBPA 3CMLA 3HR0A 2K5BB 4U7IA 2UXDT 4ILAA 1G8XA 2X66A 5HXRA 3ZMSB 1WR6A 1I6ZA 5GONE 4ZOLE 3UFEA 5AQLB 3N2KE 4H9NC 2LOSA 2CLYB 4AQFC 4JEHB 5JR9C 3PDYA 2VKHA 1HTJF 3PU8A 5FYMA 2J62A 4EAHA 2JQKA 4EGWA 1MIWA 2W2UA 3ZC1A 2V7LA 2EHOA 3AE5A 1XWMA 4NPPA 3MKDA 2ZM6T 2Q9QD 5IUXA 2Q9QB 4PNIA 3SOLA 4E7ZA 2UXNB 2C5JA 1QLBA 5HEGA 5DQWA 2HN2A 2WY2A 5HYAA 2NTXA 2MTQA 5JRCB 3A7MA 3EI0A 5LHHB 3RPUA 1ZHCA 2VWAA 1HG5A 3ZMZB 3OJAA 4UVCB 4YTMA 2V7JA 4HFVA 3KV4A 1MMDA 2XTLA 3GA8A 2CXFA 3UFGA 3ZCIA 4IDOA 3IEEA 2IIUA 5FY0A 5ADXL 2ODUA 2CBJA 3RHWA 1CUNA 3TLWA 2DWKA 3EAMA 5FY7A 3M65A 2BS2A 2XQAA 4PJJA 2XQ5A 3AE3A 4DV0T 3N2GE 3WAJA 5FXXA 3S4UA 4ZZBA 2UU9T 2DI4A 4ZI2C 3PTRB 4AKGA 3Q5WA 4KX6A 3HI2A 4FI5A 3WI3A 4X1YE 3P50A 4FJOA 3Q5DA 3J9X1 2IHR1 4QKNA 4ZHQE 4HFDA 2JQQA 5JDQA 2CBIA 5CB4E 2XQ7A 1OEDA 4CI1B 2G0UA 4X5TA 5ABFB 3C50A 3V5UA 4DR6T 1HNZT 2EHOC 3QOFA 4WYVA 3JC6C 4JI1T 2C5KT 4ZI7E 3VR9A 3PUQA 2LEHA 4IT4A 2MOZA 3AE1A 5HEJA 4UV8B 2XASB 1HCIA 3AA7B 4JI0T 5AFUL 2PFVA 5CGMA 2WSSV 2V5DA 5LG4A 3AE2A 3JADA 4U2YA 3JCFA 2XQYA 3AEBA 3F2EA 5L4HA 3AEEA 3BQKA 5J2UE 1CHUA 1KF6A 1UX4A 2X9YA 3RKGA 5JDNA 5DABA 1S94A 4IL9A 4DUYT 2IUBA 4OYJA 4JI7T 3NZQA 1KFYA 2KWHA 3P4SA 5L3FB 2VB6A 5FXZA 3SRZA 1M7KA 3N9MA 4JI2T 5HEOA 4CI3B 2WAUA 3K3NA 4M1PA 3QNUA 1KEYA 2WZHA 3OVUA 2BDEA 1XDPA 4A98A 5BMVE 1ZV4X 3Q9DA 2PG8A 4DV3T 3I0OA 2XZEA 4CXWA 1XMOT 3PUWF 4A56A 2NW8A 2X0YA 3CK6A 5FXWA 4KHZF 4DUZT 3T1YT 2I59A 2I0MA 2D9DA 3X1DA 3FBLA 3OPCA 5ABEA 5JDLA 4BA9A 3H3MA 1MIYA 3SS1A 3T8OA 2ZM8A 1T98A 4UF0A 5KDMC 4OHFA 2WS3A 2A3DA 3DJBA 4HWHA 3PUSA 4B3ST 4PK4A 3FZMB 2LRKA 2XSAA 2XQ4A 3ZT5A 3VKHA 2WMOA 3N5LA 4OFZA 3GN5B 4TWHA 2E5LT 1OEDC 2K24A 2KZ7B 3RC8A 4YSXA 5L47A 4ANJA 2X0HA 2BG9A 3T1HT 3ZSTA 1U5PA 3RYIE 4DV7T 4QX8B 4AISA 4H63H 5IHYA 2WP9A 3AAAB 3ETUA 4O4HE 3K3QC 4YXDA 4ILBA 4CQIA 4CN1A 3FZHB 2JJ9A 2Y8DA 1MMNA 3LG7A 5LGTB 5LJMA 2X68A 2ACZA 2IMLA 3AVSA 2F4VT 1U4QA 2M6BA 2KSRA 2WCAA 4H9OC 1MNDA 3UUNA 4YFSA 2VQFT 2UUAT 4IDPA 3EABA 3AB3B 1FMWA 4DV5T 1UK5A 2CXDA 2QA7A 4JI3T 5KX5E 4HWDA 4WZXA 3ONLC 2QGSA 5L4EA 2CPTA 2L9QA 4YSZA 1X79A 3CX6B 2WWVA 4PJNA 2VKOA 3RRCA 4H9RC 4ILCA 4NUUA 2E9XA 3RIFA 5JDHA 2YEVC 1M62A 4UV9B 3RF1A 4J2CA 3PU3A 2BS3A 2XUEA 2W4XA 1H7CA 4XZCA 5JR9B 4O8SA 4WW0A 5LHIB 2XQ3A 5CA1E 1D0XA 5E0OA 2W61A 2X9HA 4O4IE 4L5GA 3CQGB 4LF4T 1L0VA 4YY3T 3B5MA 3N9LA 4PK6A 3RRWA 1R8IA 1Z0PA 2N9DA 4CN6A 4H9PC 2BG9C 3I1AA 2KLQA 2IC6A 2E8IA 5IYZE 2K9AA 4P09A 4Z8XA 4EYUA 4X62T 5FL0A 2YKSA 2JIWA 4QH5A 3KV5A 3PJAA 4WNKA 2V6YA 2VQET 3UUXB 4EV6A 3HKDE 2XAQB 3ZN0B 2KXPB 2KWIB 4IHJE 2CRBA 2V26A 4H9QC 4LF5T 3C4ZA 5ETWA 2XSBA 1NENA 3F57A 1MMGA 1E1HB 2LOPA 3AXJB 1BR4A 3ZMTB 3QB5K 2XQ6A 4DV6T 2XAFB 4YJ2E 1HFAA 5LG3A 2M67A 4K0UA 3UU6A 4TWFA 3CWZB 3R84B 5C3JA 5AQPB 4CN4A 2C5IT 1YKEB 2FJDA 2FJEA 2JRKA 2CE7A 2BZBA 3CQCB 2ACXA 3DP7A 1FEWA 4UVBB 5DQVA 2LSIA 2MYSA 4ZI2D 2UXXB 5JDGA 1HS7A 2DWGA 1UUSA 1HR0T 4JI6T 4HWCA 4NUVA 1OXZA 2E2AA 2UUCT 2V5CA 3RIUA 2RP4A 3HKCE 2X9WA 3AEDA 3JAEA 1HNXT 2WDRA 3MXZA 1W0AA 3VHLA 4TNVA 4GYRA 1HF8A 1YQ4A 2XHEB 5JDFA 4HFBA 1UGOA 2BKPA 3SFEA 4DR1T 2PJQA 4AKLA 2A2FX 2W67A 1WCRA 4IDQA 2EHOD 4YHHT 4UXNB 4ERRA 3JC6D 2EHOB 5HXCA 2WBLA 1BR1A 4V1Av 3ZMUB 3ZJ2A 2HPJA 3EDVA 3ZKRA 4PFPA 2SPCA 4UVAB 2A72A 4IE0A 3G06A 3C4XA 1OWAA 4PAGA 2WM9A 1QUUA 4H9SE 2KT9A 3AE7A 3CPZA 2WQYA 4ISSA 3LK2B 1FIOA 1SA0E 2LKHA
chains in the Genus database with same CATH topology
4DV7T 2UU9T 5LMUT 4GKJT 2ZM6T 4KHPT 5BR8T 4NXNT 4DUYT 4JI7T 4B3RT 4LFCT 4JV5T 4DR3T 4DR4T 4DR5T 1N32T 4JI2T 2HHHT 4DR7T 4AQYT 1HNWT 1XNQT 4JI5T 4LF4T 4DR2T 4LFAT 4YY3T 1IBKT 2F4VT 1HR0T 4JI8T 4JI6T 4GKKT 5IWAT 4DR6T 4DV3T 1HNZT 4LF9T 1XMQT 1N33T 2UUCT 1XMOT 4LF7T 2UXCT 2VQFT 4DV2T 2UUAT 4JI1T 4X64T 1HNXT 4X65T 4LF6T 4DUZT 4B3MT 3T1YT 2UXDT 4X62T 4DR1T 1N36T 2UXBT 2UUBT 4DV5T 4LFBT 2VQET 4JI0T 4YHHT 1IBLT 4JI3T 1N34T 1I94T 4X66T 4B3ST 4B3TT 1XNRT 5LMNT 4LF5T 3OTOT 4OX9T 2E5LT 4JI4T 4DV0T 1FJGT 1J5ET 4JYAT 4DV1T 4DV4T 4DV6T 1IBMT 3T1HT 4NXMT 4K0KT 4LF8T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV7 T;  2UU9 T;  5LMU T;  4GKJ T;  2ZM6 T;  4KHP T;  5BR8 T;  4NXN T;  4DUY T;  4JI7 T;  4B3R T;  4LFC T;  4JV5 T;  4DR3 T;  4DR4 T;  4DR5 T;  1N32 T;  4JI2 T;  2HHH T;  4DR7 T;  4AQY T;  1HNW T;  1XNQ T;  4JI5 T;  4LF4 T;  4DR2 T;  4LFA T;  4YY3 T;  1IBK T;  2F4V T;  1HR0 T;  4JI8 T;  4JI6 T;  4GKK T;  5IWA T;  4DR6 T;  4DV3 T;  1HNZ T;  4LF9 T;  1XMQ T;  1N33 T;  2UUC T;  1XMO T;  4LF7 T;  2UXC T;  2VQF T;  4DV2 T;  2UUA T;  4JI1 T;  4X64 T;  1HNX T;  4X65 T;  4LF6 T;  4DUZ T;  4B3M T;  3T1Y T;  2UXD T;  4X62 T;  4DR1 T;  1N36 T;  2UXB T;  2UUB T;  4DV5 T;  4LFB T;  2VQE T;  4JI0 T;  4YHH T;  1IBL T;  4JI3 T;  1N34 T;  1I94 T;  4X66 T;  4B3S T;  4B3T T;  1XNR T;  5LMN T;  4LF5 T;  3OTO T;  4OX9 T;  2E5L T;  4JI4 T;  4DV0 T;  1FJG T;  1J5E T;  4JYA T;  4DV1 T;  4DV4 T;  4DV6 T;  1IBM T;  3T1H T;  4NXM T;  4K0K T;  4LF8 T; 
#chains in the Genus database with same CATH topology
 2XY8 B;  2WDV A;  2V8S V;  4P1N A;  3QC9 A;  2NTY A;  3C98 B;  3P4W A;  3PUV F;  2CWO A;  2V7I A;  4JV5 T;  4TN7 B;  3ZC0 A;  2BKO A;  1WR0 A;  1XZY A;  2V1D B;  4I4T E;  5LBM A;  1LRZ A;  3C51 A;  1VCT A;  1YXR A;  3TKL B;  2WWU A;  3KVA A;  4PW8 A;  5AQR B;  2WDQ A;  2M6I A;  5FMN A;  2AE9 A;  3N2O A;  5F8P A;  2V6X A;  2DHR A;  2FJB A;  3KDS E;  4JBW F;  4P0B A;  4F8H A;  2UUB T;  4AQG A;  2CEA A;  3ZMV B;  3KFW X;  3O1H A;  1BR2 A;  2H3R A;  3M3Z B;  5J1G A;  2LM9 A;  3PUG A;  2HN1 A;  4B3T T;  2VL8 A;  3A8Y C;  1XNR T;  3P4R A;  2BBJ A;  4PJM A;  3LBX A;  4EZ4 A;  2FJA A;  2ZLY A;  1J5E T;  4I0U A;  3Q5X A;  2W62 A;  5C2T A;  5J0Z A;  4DV4 T;  2RPA A;  3P7I A;  4I55 E;  4IDZ A;  2NR4 A;  3KV9 A;  4LMK A;  1AJ3 A;  3LDQ B;  1G73 A;  4HFH A;  1S35 A;  4JEU B;  3ONJ A;  5LXT E;  4ZI3 C;  4YLH A;  3HKB E;  4DR7 T;  2BVM A;  3AA0 B;  5HXS A;  5L2L A;  1HNW T;  2VVN A;  5FXV A;  4JI5 T;  1NEK A;  3EVY A;  2QYW A;  3L09 A;  1O3X A;  4IRE A;  2XAJ B;  5FNV E;  3AEF A;  3IHR A;  3UU3 A;  4U72 A;  3IA3 A;  2D5U A;  2LLY A;  4TUY E;  4YSY A;  4LF6 T;  3CIR A;  2LSK A;  4B3M T;  5HXH A;  3LSV A;  4HFE A;  2MPK A;  4BJM A;  2VVS A;  3ONX A;  3ZT6 A;  3AEC A;  3AE4 A;  1YKH B;  2Y6X A;  3KIN B;  2X67 A;  3VRB A;  1MIV A;  4HFI A;  5AQJ B;  5ABH A;  3BQL A;  2CM0 A;  3UQ7 A;  3GN5 A;  3OTO T;  2DL1 A;  3N9Q A;  1WLX A;  4HN9 A;  2IW5 B;  4X20 E;  5L3E B;  3KBU A;  2LSY A;  4WBO A;  2VUR A;  4LMJ A;  5BR8 T;  4ZXL A;  2YN6 A;  1W0B A;  3ANW B;  3AAE B;  4TV9 E;  3I0Q A;  1D1A A;  3QB5 A;  3RGL A;  2LHR A;  3FBZ A;  2CXL A;  1ZP0 A;  3RLF F;  4DR4 T;  3K1S A;  4Q25 A;  2ZMA A;  1Y64 B;  5HXE A;  3RH3 A;  3VRA A;  3B57 A;  4U33 A;  1VRB A;  3UT5 E;  4DR2 T;  4UEL A;  1WYB A;  3N9N A;  3CX8 B;  2OV9 A;  4UF0 B;  4GOU A;  3UUM A;  1XMQ T;  3P4P A;  3RI5 A;  5HCJ A;  3ZN1 B;  4IIJ E;  2JMH A;  3RQU A;  5DJQ C;  3AEG A;  2UXB T;  4C91 A;  4BAY B;  2K3W A;  2XQ8 A;  3F31 A;  3NVO A;  1KNR A;  2A9U A;  1KK7 A;  1J1J A;  5JTG A;  3N9P A;  4OK0 A;  4YTN A;  2E5V A;  2IDO B;  4Z91 A;  3I9Y A;  4L0R A;  3OYZ A;  4GK0 E;  5EK3 A;  4XBF B;  4DVD A;  4IE4 A;  2N1G A;  3UU5 A;  4K0K T;  2NWB A;  3RYH E;  3Q2M A;  4AQF A;  4KHP T;  3EUH A;  1Y01 A;  4AXP A;  2CWY A;  3MA9 A;  4O4J E;  4CXY A;  4UR9 A;  3AVR A;  1ZOY A;  4IGU A;  1B7T A;  2H7O A;  3L3P A;  3L39 A;  2YU2 A;  3NRX A;  1N32 T;  4O4L E;  3TLS A;  4L9I A;  2YK0 A;  4AKR B;  3O9X A;  2K48 A;  5J2T E;  1MNE A;  4IDN A;  4HE8 A;  2LRL A;  3NZP A;  4GKK T;  3N9O A;  5JVD E;  5AQU B;  5LOV E;  1ZEE A;  5HEH A;  4QH4 A;  4X1K E;  2KND A;  4YTP A;  2AXD S;  3MJX A;  3HL6 A;  4ZS2 A;  4ILU A;  4EED A;  4HEA A;  3L8R A;  3IF8 B;  4DID B;  2MBG A;  5FVL A;  3FHN A;  3P8C D;  1UUR A;  3EHZ A;  3WAK A;  3LJC A;  4QHO A;  5AQV B;  4HGA A;  1HX8 A;  5AQO B;  4QX7 B;  2DCF A;  4DMV A;  3PUZ F;  4XAX B;  5CFB A;  5H6R B;  3J7Y q;  2N2N A;  3UUB A;  5AQI B;  4DV1 T;  2W0G A;  5KMG P;  2NP9 A;  4LF8 T;  2KIN B;  3AE9 A;  4GKJ T;  2JQ9 A;  2WMN A;  2YIN A;  2WZI A;  3O4X E;  4JLE A;  3CQX C;  4NXN T;  2GK9 A;  5FVK A;  5HCM A;  2Y48 B;  3RC3 A;  4PK5 A;  3AA1 B;  4KBM B;  3ZYK A;  3ZCJ A;  2HHH T;  3JAF A;  2LKG A;  4HFC A;  5AQF B;  4A5X A;  3OBV E;  3UU4 A;  1NAF A;  3NKZ A;  2Q9Q A;  4Z90 A;  2B1E A;  2V6Y B;  3C64 A;  4YT0 A;  2D0U A;  2JMK A;  3ZYM A;  2DLR A;  3DTO A;  2H89 A;  4OYK A;  2Z6E A;  3ZT7 A;  4LF9 T;  1D1C A;  1T7S A;  4LF7 T;  1MMA A;  2OA5 A;  2W63 A;  4X64 T;  3UUL A;  5LA6 E;  3TLU A;  5JRC A;  3FXD B;  5L3C B;  3VKG A;  5L3G B;  3V5S A;  4LFB T;  2J47 A;  4PJL A;  2JQH A;  2E9X C;  3Q5E A;  4YHJ A;  2D0T A;  3RYF E;  5LNK A;  3UTK A;  2XQ9 A;  4QXC B;  4JI4 T;  3A5X A;  1LVF A;  3TLT A;  2XM2 A;  1WYC A;  2W66 A;  2BBH A;  3AEA A;  4NXM T;  2FBW A;  5CA0 E;  1W9R A;  3GMI A;  4TX5 A;  4HWI B;  1IAP A;  4YJ3 E;  4U74 A;  2V7K A;  3E0Z A;  5EK2 A;  2YU1 A;  3K8P C;  4IE7 A;  1LKX A;  4TNW A;  1VOM A;  1IJ5 A;  5H6Q B;  3R6N A;  4U7Y A;  2WB5 A;  2VL0 A;  5AQS B;  4E7S A;  5L3D B;  4DMW A;  3MK7 C;  3PV0 F;  5KXJ A;  4LFA T;  4A97 A;  4CXX A;  4JUY A;  3TLV A;  2X51 A;  4ZI3 D;  3C4W A;  2KMF A;  3QUJ A;  3E08 A;  2H7V C;  4O2B E;  3RIA A;  4G2A A;  1US7 B;  2WU2 A;  1Z8U A;  3ZJ1 A;  4EB6 E;  2LSJ A;  1ZKE A;  2CLY C;  1T72 A;  2ES0 A;  3E22 E;  5LCY A;  1N36 T;  5ABF A;  4PFO A;  2OLT A;  4X1I E;  3ZYL A;  5F5W A;  5AQM B;  1N34 T;  2IC9 A;  4ZZC A;  4HWF A;  5AQH B;  4N78 D;  3KV6 A;  1E7P A;  5LMN T;  1UX5 A;  5FKY A;  2LT3 A;  4I43 B;  2Q9Q C;  4C90 A;  1OED E;  4MLK A;  5C8Y E;  4DO0 A;  3ESL A;  4EXT A;  1HX1 B;  1J5W A;  2XAG B;  1LVK A;  5FY1 A;  3AE6 A;  2P9B A;  3AA6 B;  2XAH B;  2LHN A;  1V9D A;  2CMR A;  2ODV A;  4EZH A;  2CCQ A;  2BKN A;  4DR5 T;  1HG2 A;  3RIU C;  1FMV A;  3PUA A;  3ZEF B;  4QH1 A;  1OED B;  3LK4 2;  2CHO A;  1IBK T;  1IZN B;  3GWH A;  3D0T A;  4ADZ A;  2B76 A;  2C0S A;  4I50 E;  1X9B A;  4DV2 T;  4U3C A;  2L8K A;  3W15 B;  2QRX A;  3RKO A;  5LYJ E;  3LBX B;  3LFM A;  3NRY A;  3RX6 A;  2V7M A;  5LB7 B;  2LSG A;  5AQN B;  2R6G F;  3PUR A;  2PTF A;  2W00 A;  5JQG E;  3BQI A;  4MHC A;  3AE8 A;  4TZ4 C;  3CKD A;  3I9W A;  5EK4 A;  1IBM T;  1QSD A;  4LML A;  5LBQ B;  5LMU T;  2ZM0 A;  5HWY A;  4WBN E;  4NIQ A;  3ANW A;  5LGN B;  5HEU A;  4IST A;  4B3R T;  4LFC T;  4ZEY A;  4KMC A;  1E2A A;  4F6R C;  3MZK B;  2YDR A;  4IL4 A;  1IJ6 A;  4DR3 T;  2LE8 A;  4KUM B;  3H37 A;  4G63 A;  1SE7 A;  5F3J A;  3ZSS A;  3K3O A;  2LJL A;  4EOZ B;  2VK9 A;  5ABG A;  3NWI A;  4EEB A;  1YQ3 A;  2VAS A;  4KI0 F;  4QXH B;  2YDS A;  2L3L A;  2X0L B;  5AQG B;  2XM1 A;  2D2S A;  2HPL A;  5IWA T;  3PUY F;  3KVB A;  2J4G A;  2BG9 E;  1UCU A;  3PUX F;  2BVL A;  4X65 T;  5FP3 A;  2WU5 A;  4GK5 E;  5M4Y A;  1T8B A;  3KBT A;  4U2Z A;  2X9X A;  1D1B A;  3ETV A;  5LHG B;  5A1L A;  2XJ7 A;  1WRD A;  3RQW A;  3FZL B;  4X66 T;  2H88 A;  3P4Q A;  3ABV A;  4KP3 C;  5L3B B;  4OX9 T;  2NW9 A;  5AQQ B;  1SUM B;  5AQK B;  1D0Z A;  2VKJ A;  2XPK A;  4QXB B;  4JYA T;  1EZ3 A;  4U31 A;  2BG9 B;  3PE0 A;  1KNP A;  1D0Y A;  3FXE B;  1YD8 G;  4ZS3 A;  5JRE A;  4AIU A;  4CZZ B;  5EZY E;  5HAX A;  4HKA A;  2MAW A;  5JDM A;  5FL1 A;  4QWN B;  4AI6 A;  5HWX A;  2ZM2 A;  1XNQ T;  3CX7 B;  3U78 A;  4HTE A;  3MAC A;  5JR9 A;  3UU8 A;  3OYX A;  3PJA J;  4MBQ A;  3NBX X;  4CI2 B;  2CHN A;  3BK9 A;  1N33 T;  4MAL A;  1DU2 A;  2YDQ A;  3CVR A;  2PBI A;  1JNZ A;  2IAK A;  2J1D G;  5LGU B;  2HH7 A;  3O1I A;  1W09 A;  1WFD A;  4AKI A;  4UIG A;  4UEM A;  4ASK A;  4DBR A;  1IBL T;  3VR8 A;  3SWH A;  1I94 T;  2CA5 A;  2LM2 A;  4P0A A;  3ZPO A;  4EIW A;  2JPF A;  4COF A;  3HA4 A;  4GYS A;  3EDU A;  1BR0 A;  5CJ5 A;  3QK6 A;  3RYC E;  3AAI A;  1FJG T;  3UQ4 A;  2E9X D;  3VU7 H;  4IE5 A;  1YW0 A;  4MFR A;  2E9X B;  1GQE A;  2RA1 A;  3SFD A;  2NW7 A;  4EYY R;  3O1J A;  4TWD A;  1XDO A;  4DND A;  4IE6 A;  2QVA A;  3FZF B;  3OKQ A;  3FB2 A;  4B6X A;  4H63 V;  5JH7 E;  4BJN A;  3ZLI A;  4O2A E;  5AQT B;  3AXJ A;  1SHZ C;  2I6H A;  4GIW A;  1JNR A;  3H3A A;  4AKH A;  3LK3 B;  4AQY T;  2FUP A;  1NWM X;  5LJN A;  2YOE A;  2DNX A;  3HKE E;  4DBQ A;  4JI8 T;  3B13 A;  1VCS A;  2VKD A;  1KNZ A;  2NOX A;  5TAO A;  3U3I A;  5LP6 E;  2UXC T;  3FZK B;  4TV8 E;  2BS4 A;  3IBP A;  3CML A;  3HR0 A;  2K5B B;  4U7I A;  2UXD T;  4ILA A;  1G8X A;  2X66 A;  5HXR A;  3ZMS B;  1WR6 A;  1I6Z A;  5GON E;  4ZOL E;  3UFE A;  5AQL B;  3N2K E;  4H9N C;  2LOS A;  2CLY B;  4AQF C;  4JEH B;  5JR9 C;  3PDY A;  2VKH A;  1HTJ F;  3PU8 A;  5FYM A;  2J62 A;  4EAH A;  2JQK A;  4EGW A;  1MIW A;  2W2U A;  3ZC1 A;  2V7L A;  2EHO A;  3AE5 A;  1XWM A;  4NPP A;  3MKD A;  2ZM6 T;  2Q9Q D;  5IUX A;  2Q9Q B;  4PNI A;  3SOL A;  4E7Z A;  2UXN B;  2C5J A;  1QLB A;  5HEG A;  5DQW A;  2HN2 A;  2WY2 A;  5HYA A;  2NTX A;  2MTQ A;  5JRC B;  3A7M A;  3EI0 A;  5LHH B;  3RPU A;  1ZHC A;  2VWA A;  1HG5 A;  3ZMZ B;  3OJA A;  4UVC B;  4YTM A;  2V7J A;  4HFV A;  3KV4 A;  1MMD A;  2XTL A;  3GA8 A;  2CXF A;  3UFG A;  3ZCI A;  4IDO A;  3IEE A;  2IIU A;  5FY0 A;  5ADX L;  2ODU A;  2CBJ A;  3RHW A;  1CUN A;  3TLW A;  2DWK A;  3EAM A;  5FY7 A;  3M65 A;  2BS2 A;  2XQA A;  4PJJ A;  2XQ5 A;  3AE3 A;  4DV0 T;  3N2G E;  3WAJ A;  5FXX A;  3S4U A;  4ZZB A;  2UU9 T;  2DI4 A;  4ZI2 C;  3PTR B;  4AKG A;  3Q5W A;  4KX6 A;  3HI2 A;  4FI5 A;  3WI3 A;  4X1Y E;  3P50 A;  4FJO A;  3Q5D A;  3J9X 1;  2IHR 1;  4QKN A;  4ZHQ E;  4HFD A;  2JQQ A;  5JDQ A;  2CBI A;  5CB4 E;  2XQ7 A;  1OED A;  4CI1 B;  2G0U A;  4X5T A;  5ABF B;  3C50 A;  3V5U A;  4DR6 T;  1HNZ T;  2EHO C;  3QOF A;  4WYV A;  3JC6 C;  4JI1 T;  2C5K T;  4ZI7 E;  3VR9 A;  3PUQ A;  2LEH A;  4IT4 A;  2MOZ A;  3AE1 A;  5HEJ A;  4UV8 B;  2XAS B;  1HCI A;  3AA7 B;  4JI0 T;  5AFU L;  2PFV A;  5CGM A;  2WSS V;  2V5D A;  5LG4 A;  3AE2 A;  3JAD A;  4U2Y A;  3JCF A;  2XQY A;  3AEB A;  3F2E A;  5L4H A;  3AEE A;  3BQK A;  5J2U E;  1CHU A;  1KF6 A;  1UX4 A;  2X9Y A;  3RKG A;  5JDN A;  5DAB A;  1S94 A;  4IL9 A;  4DUY T;  2IUB A;  4OYJ A;  4JI7 T;  3NZQ A;  1KFY A;  2KWH A;  3P4S A;  5L3F B;  2VB6 A;  5FXZ A;  3SRZ A;  1M7K A;  3N9M A;  4JI2 T;  5HEO A;  4CI3 B;  2WAU A;  3K3N A;  4M1P A;  3QNU A;  1KEY A;  2WZH A;  3OVU A;  2BDE A;  1XDP A;  4A98 A;  5BMV E;  1ZV4 X;  3Q9D A;  2PG8 A;  4DV3 T;  3I0O A;  2XZE A;  4CXW A;  1XMO T;  3PUW F;  4A56 A;  2NW8 A;  2X0Y A;  3CK6 A;  5FXW A;  4KHZ F;  4DUZ T;  3T1Y T;  2I59 A;  2I0M A;  2D9D A;  3X1D A;  3FBL A;  3OPC A;  5ABE A;  5JDL A;  4BA9 A;  3H3M A;  1MIY A;  3SS1 A;  3T8O A;  2ZM8 A;  1T98 A;  4UF0 A;  5KDM C;  4OHF A;  2WS3 A;  2A3D A;  3DJB A;  4HWH A;  3PUS A;  4B3S T;  4PK4 A;  3FZM B;  2LRK A;  2XSA A;  2XQ4 A;  3ZT5 A;  3VKH A;  2WMO A;  3N5L A;  4OFZ A;  3GN5 B;  4TWH A;  2E5L T;  1OED C;  2K24 A;  2KZ7 B;  3RC8 A;  4YSX A;  5L47 A;  4ANJ A;  2X0H A;  2BG9 A;  3T1H T;  3ZST A;  1U5P A;  3RYI E;  4DV7 T;  4QX8 B;  4AIS A;  4H63 H;  5IHY A;  2WP9 A;  3AAA B;  3ETU A;  4O4H E;  3K3Q C;  4YXD A;  4ILB A;  4CQI A;  4CN1 A;  3FZH B;  2JJ9 A;  2Y8D A;  1MMN A;  3LG7 A;  5LGT B;  5LJM A;  2X68 A;  2ACZ A;  2IML A;  3AVS A;  2F4V T;  1U4Q A;  2M6B A;  2KSR A;  2WCA A;  4H9O C;  1MND A;  3UUN A;  4YFS A;  2VQF T;  2UUA T;  4IDP A;  3EAB A;  3AB3 B;  1FMW A;  4DV5 T;  1UK5 A;  2CXD A;  2QA7 A;  4JI3 T;  5KX5 E;  4HWD A;  4WZX A;  3ONL C;  2QGS A;  5L4E A;  2CPT A;  2L9Q A;  4YSZ A;  1X79 A;  3CX6 B;  2WWV A;  4PJN A;  2VKO A;  3RRC A;  4H9R C;  4ILC A;  4NUU A;  2E9X A;  3RIF A;  5JDH A;  2YEV C;  1M62 A;  4UV9 B;  3RF1 A;  4J2C A;  3PU3 A;  2BS3 A;  2XUE A;  2W4X A;  1H7C A;  4XZC A;  5JR9 B;  4O8S A;  4WW0 A;  5LHI B;  2XQ3 A;  5CA1 E;  1D0X A;  5E0O A;  2W61 A;  2X9H A;  4O4I E;  4L5G A;  3CQG B;  4LF4 T;  1L0V A;  4YY3 T;  3B5M A;  3N9L A;  4PK6 A;  3RRW A;  1R8I A;  1Z0P A;  2N9D A;  4CN6 A;  4H9P C;  2BG9 C;  3I1A A;  2KLQ A;  2IC6 A;  2E8I A;  5IYZ E;  2K9A A;  4P09 A;  4Z8X A;  4EYU A;  4X62 T;  5FL0 A;  2YKS A;  2JIW A;  4QH5 A;  3KV5 A;  3PJA A;  4WNK A;  2V6Y A;  2VQE T;  3UUX B;  4EV6 A;  3HKD E;  2XAQ B;  3ZN0 B;  2KXP B;  2KWI B;  4IHJ E;  2CRB A;  2V26 A;  4H9Q C;  4LF5 T;  3C4Z A;  5ETW A;  2XSB A;  1NEN A;  3F57 A;  1MMG A;  1E1H B;  2LOP A;  3AXJ B;  1BR4 A;  3ZMT B;  3QB5 K;  2XQ6 A;  4DV6 T;  2XAF B;  4YJ2 E;  1HFA A;  5LG3 A;  2M67 A;  4K0U A;  3UU6 A;  4TWF A;  3CWZ B;  3R84 B;  5C3J A;  5AQP B;  4CN4 A;  2C5I T;  1YKE B;  2FJD A;  2FJE A;  2JRK A;  2CE7 A;  2BZB A;  3CQC B;  2ACX A;  3DP7 A;  1FEW A;  4UVB B;  5DQV A;  2LSI A;  2MYS A;  4ZI2 D;  2UXX B;  5JDG A;  1HS7 A;  2DWG A;  1UUS A;  1HR0 T;  4JI6 T;  4HWC A;  4NUV A;  1OXZ A;  2E2A A;  2UUC T;  2V5C A;  3RIU A;  2RP4 A;  3HKC E;  2X9W A;  3AED A;  3JAE A;  1HNX T;  2WDR A;  3MXZ A;  1W0A A;  3VHL A;  4TNV A;  4GYR A;  1HF8 A;  1YQ4 A;  2XHE B;  5JDF A;  4HFB A;  1UGO A;  2BKP A;  3SFE A;  4DR1 T;  2PJQ A;  4AKL A;  2A2F X;  2W67 A;  1WCR A;  4IDQ A;  2EHO D;  4YHH T;  4UXN B;  4ERR A;  3JC6 D;  2EHO B;  5HXC A;  2WBL A;  1BR1 A;  4V1A v;  3ZMU B;  3ZJ2 A;  2HPJ A;  3EDV A;  3ZKR A;  4PFP A;  2SPC A;  4UVA B;  2A72 A;  4IE0 A;  3G06 A;  3C4X A;  1OWA A;  4PAG A;  2WM9 A;  1QUU A;  4H9S E;  2KT9 A;  3AE7 A;  3CPZ A;  2WQY A;  4ISS A;  3LK2 B;  1FIO A;  1SA0 E;  2LKH A; 
#chains in the Genus database with same CATH homology
 4DV7 T;  2UU9 T;  5LMU T;  4GKJ T;  2ZM6 T;  4KHP T;  5BR8 T;  4NXN T;  4DUY T;  4JI7 T;  4B3R T;  4LFC T;  4JV5 T;  4DR3 T;  4DR4 T;  4DR5 T;  1N32 T;  4JI2 T;  2HHH T;  4DR7 T;  4AQY T;  1HNW T;  1XNQ T;  4JI5 T;  4LF4 T;  4DR2 T;  4LFA T;  4YY3 T;  1IBK T;  2F4V T;  1HR0 T;  4JI8 T;  4JI6 T;  4GKK T;  5IWA T;  4DR6 T;  4DV3 T;  1HNZ T;  4LF9 T;  1XMQ T;  1N33 T;  2UUC T;  1XMO T;  4LF7 T;  2UXC T;  2VQF T;  4DV2 T;  2UUA T;  4JI1 T;  4X64 T;  1HNX T;  4X65 T;  4LF6 T;  4DUZ T;  4B3M T;  3T1Y T;  2UXD T;  4X62 T;  4DR1 T;  1N36 T;  2UXB T;  2UUB T;  4DV5 T;  4LFB T;  2VQE T;  4JI0 T;  4YHH T;  1IBL T;  4JI3 T;  1N34 T;  1I94 T;  4X66 T;  4B3S T;  4B3T T;  1XNR T;  5LMN T;  4LF5 T;  3OTO T;  4OX9 T;  2E5L T;  4JI4 T;  4DV0 T;  1FJG T;  1J5E T;  4JYA T;  4DV1 T;  4DV4 T;  4DV6 T;  1IBM T;  3T1H T;  4NXM T;  4K0K T;  4LF8 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...