4GKJT

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aug-codon in the a-site and paromomycin.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4gkjT00
1IBMT 4JI6T 2E5LT 4JI5T 5BR8T 4DV5T 1N34T 4JI2T 4DR4T 4LF6T 4B3TT 1IBLT 5LMUT 4DV1T 1HNXT 4LF9T 4B3ST 4LFCT 2UUCT 4GKJT 4NXNT 4OX9T 4JI1T 1FJGT 1I94T 4NXMT 4KHPT 4DUZT 4DV6T 3T1HT 4B3MT 4LF5T 5IWAT 4LFAT 1N36T 4JV5T 4JI7T 4GKKT 2UUBT 4JI3T 4DV4T 2VQFT 2UUAT 2VQET 1XNQT 4DR7T 2F4VT 4JI0T 1HNZT 1HR0T 3T1YT 4DV3T 1N32T 2UXDT 1IBKT 3OTOT 5LMNT 4DR6T 4LF8T 2UXCT 4B3RT 4DUYT 4LF4T 2UU9T 1N33T 4DR3T 1J5ET 4DR2T 2HHHT 4DR1T 4JI4T 4DV7T 4JI8T 4X62T 1HNWT 1XNRT 4DR5T 1XMOT 4X64T 4LF7T 2ZM6T 4AQYT 4DV0T 4DV2T 4JYAT 4LFBT 1XMQT 4K0KT 2UXBT 4X66T 4X65T 4YY3T 4YHHT
chains in the Genus database with same CATH superfamily
3F57A 3FXDB 3Q5DA 2IC9A 2LHNA 1KK7A 5AQJB 2N1GA 3V5SA 4TZ4C 4LF9T 1EZ3A 5H6QB 3OJAA 2SPCA 5FL0A 5E0OA 4O4JE 4ADZA 2CEAA 1MNDA 2MOZA 3AAIA 4ZHQE 3M65A 3JAEA 3QOFA 1FIOA 2CCQA 3K3QC 2HPJA 4HFHA 2XQ4A 3WI3A 1VOMA 1YKHB 4BA9A 5AQFB 4YSXA 2Q9QB 1N32T 4HWCA 2X9XA 4AKHA 2LEHA 1X9BA 5ETWA 4DIDB 3ANWA 2C0SA 3C98B 3KVAA 4G2AA 5LBMA 3AE7A 2JPFA 3AEFA 5EK3A 3KV4A 4MHCA 1ZHCA 2EHOB 4PJJA 1D0ZA 2B1EA 2V6XA 3QB5A 4ZI7E 4HEAA 1T7SA 1YXRA 2PTFA 2NWBA 3C50A 4QH1A 3ZN1B 4DBQA 2K9AA 3H3MA 5AQNB 3AE8A 4UVCB 2X66A 2VK9A 1T98A 3NWIA 1D1BA 1HNXT 5ABFA 1HG2A 4I0UA 1NENA 3RI5A 1MNEA 3EAMA 3HKCE 2ACXA 4Z8XA 4YTPA 4QX8B 3PUYF 4Z90A 2CLYC 4DV6T 3HI2A 4TV9E 1YW0A 4U74A 2V7MA 1MMDA 4ZZBA 3CQCB 4MLKA 4CI3B 3RPUA 3BQLA 3K3NA 5FNVE 1QUUA 4JI0T 2Q9QD 1HF8A 2WCAA 3P4SA 4I43B 4NPPA 5L4HA 3P8CD 1IBKT 3C4XA 3GMIA 4IDNA 5L3FB 1J1JA 3A5XA 2YKSA 2YU2A 2UU9T 1N33T 4DO0A 4DVDA 4DR3T 5AQTB 1YD8G 2X9YA 4GYRA 1YQ4A 2EHOD 2KMFA 3PURA 4PK4A 4WNKA 3TLTA 3RC8A 2ZM6T 4DNDA 4C90A 2JJ9A 2LE8A 2W4XA 4UR9A 3KFWX 1W9RA 3UU3A 2NTYA 5L3BB 5FMNA 3AAAB 2LM9A 2XAHB 5LGNB 3AE6A 4HGAA 1XWMA 1XDOA 2XHEB 3IF8B 5LMUT 5HWYA 1D0XA 4LFCT 3AAEB 3CVRA 3LJCA 2HH7A 3ZMTB 4QH4A 1OEDC 5IWAT 2D0UA 5ADXL 2LOPA 4OHFA 2X0LB 5KXJA 3F2EA 2KT9A 2WP9A 3IA3A 2XM1A 2QYWA 4HWDA 1X79A 3KVBA 4QXCB 1LVKA 1HS7A 2L9QA 2WU5A 4YLHA 5J2UE 2W61A 3QC9A 2OLTA 4DR2T 4EEDA 4DR1T 2AE9A 2WDQA 2V1DB 3NKZA 3KV5A 4IE6A 2V5CA 5IUXA 3RRWA 3P50A 4PFOA 2BS2A 1KNRA 5L3DB 3CWZB 5HXHA 2QGSA 2FJAA 1WR0A 2IDOB 2VKDA 2CWOA 4QHOA 3ZYMA 2PG8A 2W2UA 2XZEA 3KDSE 2BZBA 4PW8A 4C91A 2X0YA 5FXVA 5AQIB 4B6XA 3Q5XA 2D2SA 3G06A 3MXZA 2LHRA 2YEVC 4H9QC 4ZI3D 4ILAA 2LSYA 2V7LA 2CMRA 5HEJA 3KBUA 4JI3T 3L3PA 3AE3A 2XAQB 3FZFB 4WZXA 3FBLA 5FP3A 4U33A 3PU8A 4HFVA 1CUNA 2VVNA 5AQVB 4X5TA 2QRXA 2NTXA 2LKHA 2JRKA 3HA4A 3CX6B 3GN5A 3CX7B 1L0VA 4ANJA 3RYIE 3AEBA 3B57A 2WQYA 5C2TA 3I9WA 3MJXA 1XMQT 1O3XA 2VVSA 1KEYA 1WYBA 4O4HE 1FEWA 4A97A 3AB3B 5ABFB 3OBVE 3K8PC 3JC6C 5JDMA 5LNKA 4AI6A 1CHUA 3RIAA 4B3TT 5AQOB 4B3ST 3QNUA 4UVAB 2JQQA 2PJQA 2XQ7A 3SFEA 3HKDE 2D5UA 3MKDA 3PE0A 4U7YA 5J1GA 1XDPA 4HFBA 4U72A 2L3LA 5LHHB 2CLYB 1NEKA 5CA0E 2V7JA 5TAOA 3L39A 2RA1A 5LOVE 3P4RA 4UV9B 1SA0E 2IIUA 5JDNA 4CI2B 1MMAA 4EYUA 3UUBA 2VB6A 3DJBA 4DR6T 1U4QA 3HR0A 3ZKRA 5M4YA 4GK5E 4HWHA 3J7Yq 3EUHA 2ODUA 2H7VC 5DQVA 2LT3A 3VR8A 2LSJA 4PJMA 5AQPB 2LRKA 2DI4A 1OXZA 5CFBA 2LSIA 2E8IA 2XQ5A 1I6ZA 4EOZB 4NUUA 4JEHB 3KV6A 1Z8UA 2V5DA 3ESLA 3SWHA 3RKGA 2B76A 3RYCE 3RQWA 2I59A 2YOEA 4DR4T 4LF6T 4DV1T 4CXXA 2JQKA 3RLFF 3ZLIA 4U2YA 5AQSB 2LSKA 3HL6A 4YFSA 5DJQC 4COFA 4PK5A 3EHZA 3LK2B 1B7TA 4B3MT 3A8YC 4G63A 5JR9C 3WAJA 4KMCA 3I0OA 4U3CA 3TLWA 2UUAT 3ZMZB 4F8HA 4GK0E 4WBOA 5JR9A 2BVMA 2UXXB 2KWIB 5HEUA 2J4GA 3AEAA 3LDQB 4TWHA 3BQKA 2WB5A 3FZHB 3DP7A 2E9XB 2X67A 1SUMB 3UUMA 3I0QA 3RQUA 3H37A 1IAPA 3RC3A 3ZCJA 3UTKA 5CGMA 3RYFE 3PU3A 5FY1A 1WLXA 4FJOA 3ZJ1A 4F6RC 5JQGE 2NW9A 5CB4E 3NZPA 4Z91A 4JYAT 3E22E 2V8SV 4X66T 2A2FX 5AQUB 4AISA 3SS1A 3N2KE 4ZZCA 2E2AA 3M3ZB 2XSAA 3P4PA 2E5LT 4KP3C 3O4XE 5L47A 2DLRA 4JI2T 2BDEA 4PK6A 2NR4A 1V9DA 3X1DA 3O1HA 5FKYA 1I94T 2J62A 3ZYLA 4HN9A 3RX6A 4DUZT 3ZPOA 2VKOA 4GKKT 4U2ZA 2R6GF 4ZS2A 3O1JA 4HWIB 3Q5EA 1HTJF 4HE8A 5FL1A 2LSGA 5AQMB 1XNQT 1M7KA 4DMVA 3RGLA 4UEMA 3T1YT 2YDQA 5HEOA 3WAKA 4KX6A 2WWVA 3VRBA 3VRAA 1G73A 2WM9A 2E9XD 4LF8T 3FZLB 2UXCT 3SOLA 2VKHA 4L0RA 2NOXA 4AKRB 4K0UA 3UULA 2W00A 2VKJA 5ABHA 4X62T 4CI1B 4IT4A 2FJEA 1XNRT 3GWHA 4HWFA 2WZIA 4DR5T 5KDMC 4DV0T 3SFDA 3QUJA 4X65T 3CMLA 4IHJE 3ONLC 5JDGA 3ZT5A 4QH5A 4XBFB 3KINB 3P4QA 4BJNA 4YY3T 4YHHT 5FXXA 3EI0A 5JDHA 4JI6T 5ABGA 5DABA 2KINB 4MBQA 3E0ZA 3U3IA 3N9NA 3I1AA 3FZKB 4CQIA 1IBLT 5AQKB 3PV0F 4JUYA 3LFMA 2C5JA 4LMJA 5JRCA 2WMNA 3BK9A 4JI1T 2CXLA 2N9DA 4UELA 3AE5A 5FY0A 4LF5T 2W67A 3ETVA 4UVBB 2K48A 2FUPA 3UFEA 2VL8A 2FJDA 2V7IA 2IC6A 3EDUA 1OWAA 4DR7T 3N5LA 4A98A 3MACA 3RRCA 4TWDA 3TLVA 5L3CB 4ASKA 5LMNT 2IUBA 2PBIA 3N9QA 2K3WA 2HN2A 2QA7A 3PUAA 1XZYA 1OEDA 4GOUA 3ZMVB 3FB2A 3PUQA 2KLQA 5ABEA 4AXPA 2H88A 4EEBA 4OFZA 3MK7C 1MIWA 3R6NA 5AFUL 5FVKA 3B5MA 2IAKA 2KZ7B 2DHRA 2M6IA 3FXEB 3ZMUB 5JTGA 3AXJA 4TX5A 2WS3A 2W66A 1KNZA 1OEDE 4E7ZA 4NIQA 4EZ4A 2YDRA 3CK6A 2ZLYA 4OX9T 3T8OA 2WDRA 1Y01A 1UURA 2KSRA 3PTRB 2BKOA 5EK2A 4LFAT 3NRXA 2CBJA 4DBRA 3JADA 2UUBT 2BVLA 1BR0A 5JR9B 1LVFA 2XM2A 3RIUC 1UK5A 2L8KA 4AKLA 3VR9A 3EVYA 2A72A 2BBJA 3AA1B 1J5WA 1G8XA 3QB5K 3AEEA 2QVAA 4CN6A 4GYSA 4H9SE 4PFPA 1KNPA 2CPTA 3RIUA 2IW5B 4XAXB 3N2OA 5HCMA 3AA6B 3ZT7A 1E1HB 4EYYR 2LJLA 3VKGA 2ZM0A 4QKNA 4ZI2D 1UX4A 3HKBE 2KNDA 3ONXA 4JI4T 2JMHA 4JI8T 5FXZA 5F3JA 2N2NA 3VKHA 3CQXC 4H9NC 2WY2A 3ANWB 1NWMX 1XMOT 4QWNB 3PUVF 1S94A 3GA8A 4Q25A 3ZCIA 2A3DA 5J2TE 2UXBT 4L5GA 5JREA 2WAUA 4MFRA 3A7MA 5BR8T 1FMVA 2ACZA 3DTOA 4PJNA 2Y6XA 4ZXLA 4ILBA 1BR1A 2IMLA 4FI5A 3NBXX 4GKJT 1ZOYA 3LK42 4NXNT 4P1NA 5L4EA 2CRBA 2BG9C 4NXMT 3SRZA 3CX8B 2WWUA 5HXRA 4ZS3A 1QSDA 1HG5A 2CHOA 3AVSA 4X20E 5KX5E 1D1CA 1T8BA 3KV9A 2BG9A 4DV4T 1IJ5A 3O1IA 1ZEEA 3IBPA 2HN1A 2W62A 4CN1A 1HNZT 3TLSA 5LXTE 3UQ4A 1BR2A 2YU1A 1SE7A 2JQ9A 2CBIA 2XUEA 3PDYA 3IEEA 4OYKA 4UIGA 2Y48B 4ISTA 4BAYB 4O4IE 5C8YE 1Z0PA 3C51A 1VRBA 5AQHB 4AQYT 3OYXA 3L09A 3S4UA 5EZYE 2W63A 4ISSA 4X1KE 4H9RC 3UUNA 3V5UA 4I50E 4ZI3C 3ZSSA 1N34T 4EV6A 3W15B 5HXSA 3ZN0B 2LRLA 3UFGA 4HFEA 2W0GA 2KWHA 5L2LA 3AVRA 1ZP0A 4A56A 3RH3A 2J1DG 3L8RA 2V7KA 4BJMA 1T72A 2ZM2A 2XQYA 2JIWA 3D0TA 2BKPA 1E2AA 5A1LA 4YXDA 3BQIA 4U7IA 3RF1A 4EIWA 4HFIA 1KF6A 5HYAA 5HAXA 3AA7B 3C4WA 5HXCA 2F4VT 4H63V 2MTQA 3N2GE 3PJAA 3CPZA 2D9DA 2UXDT 3PUXF 1OEDB 4O2BE 1DU2A 2JQHA 3JAFA 4TNVA 4IREA 5LJMA 2OV9A 2XAFB 5JVDE 2UXNB 3AE9A 3MA9A 1MMGA 2IHR1 2VL0A 4ILCA 3N9MA 4DV2T 4ILUA 3VHLA 2WDVA 3AXJB 5LYJE 2X68A 4CN4A 3LSVA 4YJ2E 1S35A 1JNRA 1SHZC 5IHYA 3NRYA 2C5KT 1LKXA 5HCJA 3TLUA 1UGOA 5H6RB 2FJBA 4P0AA 5JDQA 3NVOA 2UUCT 2MPKA 4XZCA 4ZOLE 5CA1E 1WCRA 5FY7A 4QXHB 3AE2A 1ZKEA 4KHPT 3ZMSB 4KUMB 5LHGB 2CXFA 4JI7T 3PUZF 3O9XA 5LA6E 3AEDA 4O4LE 2XASB 4ERRA 5LBQB 5LHIB 1VCTA 2VQET 1E7PA 1HFAA 2H89A 3UU8A 5LCYA 4HFDA 1QLBA 4IL9A 2V6YA 2NW7A 4YT0A 3CKDA 1FMWA 5FVLA 4DUYT 4YTNA 3UU6A 2HHHT 2RP4A 2XQ3A 2NP9A 2M6BA 4IE4A 4EAHA 4X64T 2WMOA 1U5PA 2CWYA 3GN5B 1US7B 4LFBT 4WYVA 2RPAA 4CXYA 4ZEYA 2PFVA 2XQ8A 2CE7A 3VU7H 2VASA 2V26A 5HEHA 4AQGA 4IDQA 4IE0A 3PUGA 2XAJB 5LJNA 5LG3A 4P09A 4EB6E 4H9OC 5DQWA 2NW8A 4MALA 5LG4A 2WU2A 3PUWF 2H3RA 1AJ3A 3Q5WA 4CXWA 2DWKA 1YKEB 4IGUA 1MIYA 3U78A 3JCFA 2BG9B 5IYZE 2C5IT 2OA5A 1IJ6A 5EK4A 4EXTA 4IDZA 4O2AE 5L3EB 2BKNA 2E5VA 2Z6EA 3B13A 5LGTB 4UF0A 1WYCA 5F5WA 3RIFA 4L9IA 2LLYA 1HR0T 2LKGA 4YHJA 2X9HA 2XJ7A 4LMLA 5C3JA 3ZSTA 3EABA 2WBLA 1D0YA 4B3RT 4UV8B 4HTEA 3UT5E 2H7OA 5AQRB 4IL4A 4TV8E 3OPCA 4TWFA 1HNWT 3N9LA 2X51A 1JNZA 2GK9A 2MBGA 4IDOA 2XTLA 2G0UA 4K0KT 3ETUA 4TUYE 2K24A 2XQAA 3OYZA 1HX1B 3ZEFB 3ZYKA 4DV5T 3LBXA 2I0MA 3HKEE 2XQ6A 2XY8B 4UXNB 3OKQA 2HPLA 2WZHA 2J47A 4YJ3E 5J0ZA 1FJGT 5AQQB 2VWAA 1GQEA 3T1HT 3H3AA 3JC6D 1WR6A 1Y64B 2E9XC 3FZMB 2JMKA 3AA0B 4H9PC 2CM0A 2P9BA 4HFCA 2Q9QC 2E9XA 4N78D 2K5BB 4OYJA 4O8SA 3FBZA 3RKOA 3RHWA 3RYHE 5JH7E 1IZNB 1MIVA 1UUSA 4OK0A 4LF4T 3TKLB 1D1AA 2Q9QA 2XAGB 1J5ET 4KHZF 2ZM8A 1LRZA 1KFYA 3AECA 2EHOC 4EZHA 2X9WA 2XSBA 3P4WA 4YTMA 2D0TA 2X0HA 2DWGA 3EDVA 4IE7A 3IHRA 2I6HA 2DNXA 2EHOA 4KBMB 4U31A 3ZC1A 3KBTA 4HKAA 3LK3B 4WBNE 1IBMT 2LM2A 4JI5T 2M67A 2DL1A 3Q2MA 3UU4A 5FXWA 4H63H 5HXEA 5F8PA 4PJLA 3PJAJ 4QXBB 2A9UA 3N9OA 2BBHA 5GONE 1ZV4X 4JBWF 4YSZA 2Y8DA 5KMGP 1H7CA 2YK0A 1N36T 2WSSV 3P7IA 2BS4A 2ZMAA 2CA5A 3UU5A 1UX5A 4I4TE 2VQFT 2V6YB 1NAFA 4IIJE 1W0BA 4AKGA 4E7SA 3CQGB 4YSYA 3K1SA 4DV3T 3LG7A 3UUXB 2KXPB 3K3OA 3Q9DA 3ZT6A 4WW0A 4JLEA 3J9X1 4GIWA 4DV7T 3FHNA 3N9PA 1UCUA 2FBWA 3ONJA 2MYSA 3C4ZA 2YN6A 3ZC0A 4LMKA 5LB7B 3ZJ2A 4I55E 4KI0F 4CZZB 3C64A 2YDSA 2AXDS 2BG9E 4AKIA 3E08A 3AE4A 1MMNA 2ODVA 1WRDA 1BR4A 3MZKB 1W0AA 4TNWA 2CXDA 4X1IE 3ABVA 5L3GB 3AEGA 2CHNA 1HX8A 4JEUB 2XPKA 1WFDA 2XQ9A 4JV5T 1R8IA 4UF0B 5JRCB 3AE1A 2YINA 4M1PA 1VCSA 4ZI2C 3R84B 4X1YE 2MAWA 4IE5A 5CJ5A 3F31A 4P0BA 2VURA 1HCIA 4AIUA 3OTOT 5AQLB 4J2CA 4AQFC 4A5XA 4DMWA 1M62A 4PAGA 5JDLA 1W09A 2DCFA 4EGWA 5LGUB 5LP6E 4V1Av 4IDPA 4AQFA 5HWXA 5BMVE 3UQ7A 3NZQA 4LF7T 3PUSA 4TN7B 2BS3A 5FYMA 5HEGA 3QK6A 5JDFA 3I9YA 3LBXB 2ES0A 5AQGB 4PNIA 4NUVA 3OVUA 3CIRA 4QX7B 1YQ3A 2LOSA
chains in the Genus database with same CATH topology
1IBMT 4JI6T 2E5LT 4JI5T 5BR8T 4DV5T 1N34T 4JI2T 4DR4T 4LF6T 4B3TT 1IBLT 5LMUT 4DV1T 1HNXT 4LF9T 4B3ST 4LFCT 2UUCT 4GKJT 4NXNT 4OX9T 4JI1T 1FJGT 1I94T 4NXMT 4KHPT 4DUZT 4DV6T 3T1HT 4B3MT 4LF5T 5IWAT 4LFAT 1N36T 4JV5T 4JI7T 4GKKT 2UUBT 4JI3T 4DV4T 2VQFT 2UUAT 2VQET 1XNQT 4DR7T 2F4VT 4JI0T 1HNZT 1HR0T 3T1YT 4DV3T 1N32T 2UXDT 1IBKT 3OTOT 5LMNT 4DR6T 4LF8T 2UXCT 4B3RT 4DUYT 4LF4T 2UU9T 1N33T 4DR3T 1J5ET 4DR2T 2HHHT 4DR1T 4JI4T 4DV7T 4JI8T 4X62T 1HNWT 1XNRT 4DR5T 1XMOT 4X64T 4LF7T 2ZM6T 4AQYT 4DV0T 4DV2T 4JYAT 4LFBT 1XMQT 4K0KT 2UXBT 4X66T 4X65T 4YY3T 4YHHT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBM T;  4JI6 T;  2E5L T;  4JI5 T;  5BR8 T;  4DV5 T;  1N34 T;  4JI2 T;  4DR4 T;  4LF6 T;  4B3T T;  1IBL T;  5LMU T;  4DV1 T;  1HNX T;  4LF9 T;  4B3S T;  4LFC T;  2UUC T;  4GKJ T;  4NXN T;  4OX9 T;  4JI1 T;  1FJG T;  1I94 T;  4NXM T;  4KHP T;  4DUZ T;  4DV6 T;  3T1H T;  4B3M T;  4LF5 T;  5IWA T;  4LFA T;  1N36 T;  4JV5 T;  4JI7 T;  4GKK T;  2UUB T;  4JI3 T;  4DV4 T;  2VQF T;  2UUA T;  2VQE T;  1XNQ T;  4DR7 T;  2F4V T;  4JI0 T;  1HNZ T;  1HR0 T;  3T1Y T;  4DV3 T;  1N32 T;  2UXD T;  1IBK T;  3OTO T;  5LMN T;  4DR6 T;  4LF8 T;  2UXC T;  4B3R T;  4DUY T;  4LF4 T;  2UU9 T;  1N33 T;  4DR3 T;  1J5E T;  4DR2 T;  2HHH T;  4DR1 T;  4JI4 T;  4DV7 T;  4JI8 T;  4X62 T;  1HNW T;  1XNR T;  4DR5 T;  1XMO T;  4X64 T;  4LF7 T;  2ZM6 T;  4AQY T;  4DV0 T;  4DV2 T;  4JYA T;  4LFB T;  1XMQ T;  4K0K T;  2UXB T;  4X66 T;  4X65 T;  4YY3 T;  4YHH T; 
#chains in the Genus database with same CATH topology
 3F57 A;  3FXD B;  3Q5D A;  2IC9 A;  2LHN A;  1KK7 A;  5AQJ B;  2N1G A;  3V5S A;  4TZ4 C;  4LF9 T;  1EZ3 A;  5H6Q B;  3OJA A;  2SPC A;  5FL0 A;  5E0O A;  4O4J E;  4ADZ A;  2CEA A;  1MND A;  2MOZ A;  3AAI A;  4ZHQ E;  3M65 A;  3JAE A;  3QOF A;  1FIO A;  2CCQ A;  3K3Q C;  2HPJ A;  4HFH A;  2XQ4 A;  3WI3 A;  1VOM A;  1YKH B;  4BA9 A;  5AQF B;  4YSX A;  2Q9Q B;  1N32 T;  4HWC A;  2X9X A;  4AKH A;  2LEH A;  1X9B A;  5ETW A;  4DID B;  3ANW A;  2C0S A;  3C98 B;  3KVA A;  4G2A A;  5LBM A;  3AE7 A;  2JPF A;  3AEF A;  5EK3 A;  3KV4 A;  4MHC A;  1ZHC A;  2EHO B;  4PJJ A;  1D0Z A;  2B1E A;  2V6X A;  3QB5 A;  4ZI7 E;  4HEA A;  1T7S A;  1YXR A;  2PTF A;  2NWB A;  3C50 A;  4QH1 A;  3ZN1 B;  4DBQ A;  2K9A A;  3H3M A;  5AQN B;  3AE8 A;  4UVC B;  2X66 A;  2VK9 A;  1T98 A;  3NWI A;  1D1B A;  1HNX T;  5ABF A;  1HG2 A;  4I0U A;  1NEN A;  3RI5 A;  1MNE A;  3EAM A;  3HKC E;  2ACX A;  4Z8X A;  4YTP A;  4QX8 B;  3PUY F;  4Z90 A;  2CLY C;  4DV6 T;  3HI2 A;  4TV9 E;  1YW0 A;  4U74 A;  2V7M A;  1MMD A;  4ZZB A;  3CQC B;  4MLK A;  4CI3 B;  3RPU A;  3BQL A;  3K3N A;  5FNV E;  1QUU A;  4JI0 T;  2Q9Q D;  1HF8 A;  2WCA A;  3P4S A;  4I43 B;  4NPP A;  5L4H A;  3P8C D;  1IBK T;  3C4X A;  3GMI A;  4IDN A;  5L3F B;  1J1J A;  3A5X A;  2YKS A;  2YU2 A;  2UU9 T;  1N33 T;  4DO0 A;  4DVD A;  4DR3 T;  5AQT B;  1YD8 G;  2X9Y A;  4GYR A;  1YQ4 A;  2EHO D;  2KMF A;  3PUR A;  4PK4 A;  4WNK A;  3TLT A;  3RC8 A;  2ZM6 T;  4DND A;  4C90 A;  2JJ9 A;  2LE8 A;  2W4X A;  4UR9 A;  3KFW X;  1W9R A;  3UU3 A;  2NTY A;  5L3B B;  5FMN A;  3AAA B;  2LM9 A;  2XAH B;  5LGN B;  3AE6 A;  4HGA A;  1XWM A;  1XDO A;  2XHE B;  3IF8 B;  5LMU T;  5HWY A;  1D0X A;  4LFC T;  3AAE B;  3CVR A;  3LJC A;  2HH7 A;  3ZMT B;  4QH4 A;  1OED C;  5IWA T;  2D0U A;  5ADX L;  2LOP A;  4OHF A;  2X0L B;  5KXJ A;  3F2E A;  2KT9 A;  2WP9 A;  3IA3 A;  2XM1 A;  2QYW A;  4HWD A;  1X79 A;  3KVB A;  4QXC B;  1LVK A;  1HS7 A;  2L9Q A;  2WU5 A;  4YLH A;  5J2U E;  2W61 A;  3QC9 A;  2OLT A;  4DR2 T;  4EED A;  4DR1 T;  2AE9 A;  2WDQ A;  2V1D B;  3NKZ A;  3KV5 A;  4IE6 A;  2V5C A;  5IUX A;  3RRW A;  3P50 A;  4PFO A;  2BS2 A;  1KNR A;  5L3D B;  3CWZ B;  5HXH A;  2QGS A;  2FJA A;  1WR0 A;  2IDO B;  2VKD A;  2CWO A;  4QHO A;  3ZYM A;  2PG8 A;  2W2U A;  2XZE A;  3KDS E;  2BZB A;  4PW8 A;  4C91 A;  2X0Y A;  5FXV A;  5AQI B;  4B6X A;  3Q5X A;  2D2S A;  3G06 A;  3MXZ A;  2LHR A;  2YEV C;  4H9Q C;  4ZI3 D;  4ILA A;  2LSY A;  2V7L A;  2CMR A;  5HEJ A;  3KBU A;  4JI3 T;  3L3P A;  3AE3 A;  2XAQ B;  3FZF B;  4WZX A;  3FBL A;  5FP3 A;  4U33 A;  3PU8 A;  4HFV A;  1CUN A;  2VVN A;  5AQV B;  4X5T A;  2QRX A;  2NTX A;  2LKH A;  2JRK A;  3HA4 A;  3CX6 B;  3GN5 A;  3CX7 B;  1L0V A;  4ANJ A;  3RYI E;  3AEB A;  3B57 A;  2WQY A;  5C2T A;  3I9W A;  3MJX A;  1XMQ T;  1O3X A;  2VVS A;  1KEY A;  1WYB A;  4O4H E;  1FEW A;  4A97 A;  3AB3 B;  5ABF B;  3OBV E;  3K8P C;  3JC6 C;  5JDM A;  5LNK A;  4AI6 A;  1CHU A;  3RIA A;  4B3T T;  5AQO B;  4B3S T;  3QNU A;  4UVA B;  2JQQ A;  2PJQ A;  2XQ7 A;  3SFE A;  3HKD E;  2D5U A;  3MKD A;  3PE0 A;  4U7Y A;  5J1G A;  1XDP A;  4HFB A;  4U72 A;  2L3L A;  5LHH B;  2CLY B;  1NEK A;  5CA0 E;  2V7J A;  5TAO A;  3L39 A;  2RA1 A;  5LOV E;  3P4R A;  4UV9 B;  1SA0 E;  2IIU A;  5JDN A;  4CI2 B;  1MMA A;  4EYU A;  3UUB A;  2VB6 A;  3DJB A;  4DR6 T;  1U4Q A;  3HR0 A;  3ZKR A;  5M4Y A;  4GK5 E;  4HWH A;  3J7Y q;  3EUH A;  2ODU A;  2H7V C;  5DQV A;  2LT3 A;  3VR8 A;  2LSJ A;  4PJM A;  5AQP B;  2LRK A;  2DI4 A;  1OXZ A;  5CFB A;  2LSI A;  2E8I A;  2XQ5 A;  1I6Z A;  4EOZ B;  4NUU A;  4JEH B;  3KV6 A;  1Z8U A;  2V5D A;  3ESL A;  3SWH A;  3RKG A;  2B76 A;  3RYC E;  3RQW A;  2I59 A;  2YOE A;  4DR4 T;  4LF6 T;  4DV1 T;  4CXX A;  2JQK A;  3RLF F;  3ZLI A;  4U2Y A;  5AQS B;  2LSK A;  3HL6 A;  4YFS A;  5DJQ C;  4COF A;  4PK5 A;  3EHZ A;  3LK2 B;  1B7T A;  4B3M T;  3A8Y C;  4G63 A;  5JR9 C;  3WAJ A;  4KMC A;  3I0O A;  4U3C A;  3TLW A;  2UUA T;  3ZMZ B;  4F8H A;  4GK0 E;  4WBO A;  5JR9 A;  2BVM A;  2UXX B;  2KWI B;  5HEU A;  2J4G A;  3AEA A;  3LDQ B;  4TWH A;  3BQK A;  2WB5 A;  3FZH B;  3DP7 A;  2E9X B;  2X67 A;  1SUM B;  3UUM A;  3I0Q A;  3RQU A;  3H37 A;  1IAP A;  3RC3 A;  3ZCJ A;  3UTK A;  5CGM A;  3RYF E;  3PU3 A;  5FY1 A;  1WLX A;  4FJO A;  3ZJ1 A;  4F6R C;  5JQG E;  2NW9 A;  5CB4 E;  3NZP A;  4Z91 A;  4JYA T;  3E22 E;  2V8S V;  4X66 T;  2A2F X;  5AQU B;  4AIS A;  3SS1 A;  3N2K E;  4ZZC A;  2E2A A;  3M3Z B;  2XSA A;  3P4P A;  2E5L T;  4KP3 C;  3O4X E;  5L47 A;  2DLR A;  4JI2 T;  2BDE A;  4PK6 A;  2NR4 A;  1V9D A;  3X1D A;  3O1H A;  5FKY A;  1I94 T;  2J62 A;  3ZYL A;  4HN9 A;  3RX6 A;  4DUZ T;  3ZPO A;  2VKO A;  4GKK T;  4U2Z A;  2R6G F;  4ZS2 A;  3O1J A;  4HWI B;  3Q5E A;  1HTJ F;  4HE8 A;  5FL1 A;  2LSG A;  5AQM B;  1XNQ T;  1M7K A;  4DMV A;  3RGL A;  4UEM A;  3T1Y T;  2YDQ A;  5HEO A;  3WAK A;  4KX6 A;  2WWV A;  3VRB A;  3VRA A;  1G73 A;  2WM9 A;  2E9X D;  4LF8 T;  3FZL B;  2UXC T;  3SOL A;  2VKH A;  4L0R A;  2NOX A;  4AKR B;  4K0U A;  3UUL A;  2W00 A;  2VKJ A;  5ABH A;  4X62 T;  4CI1 B;  4IT4 A;  2FJE A;  1XNR T;  3GWH A;  4HWF A;  2WZI A;  4DR5 T;  5KDM C;  4DV0 T;  3SFD A;  3QUJ A;  4X65 T;  3CML A;  4IHJ E;  3ONL C;  5JDG A;  3ZT5 A;  4QH5 A;  4XBF B;  3KIN B;  3P4Q A;  4BJN A;  4YY3 T;  4YHH T;  5FXX A;  3EI0 A;  5JDH A;  4JI6 T;  5ABG A;  5DAB A;  2KIN B;  4MBQ A;  3E0Z A;  3U3I A;  3N9N A;  3I1A A;  3FZK B;  4CQI A;  1IBL T;  5AQK B;  3PV0 F;  4JUY A;  3LFM A;  2C5J A;  4LMJ A;  5JRC A;  2WMN A;  3BK9 A;  4JI1 T;  2CXL A;  2N9D A;  4UEL A;  3AE5 A;  5FY0 A;  4LF5 T;  2W67 A;  3ETV A;  4UVB B;  2K48 A;  2FUP A;  3UFE A;  2VL8 A;  2FJD A;  2V7I A;  2IC6 A;  3EDU A;  1OWA A;  4DR7 T;  3N5L A;  4A98 A;  3MAC A;  3RRC A;  4TWD A;  3TLV A;  5L3C B;  4ASK A;  5LMN T;  2IUB A;  2PBI A;  3N9Q A;  2K3W A;  2HN2 A;  2QA7 A;  3PUA A;  1XZY A;  1OED A;  4GOU A;  3ZMV B;  3FB2 A;  3PUQ A;  2KLQ A;  5ABE A;  4AXP A;  2H88 A;  4EEB A;  4OFZ A;  3MK7 C;  1MIW A;  3R6N A;  5AFU L;  5FVK A;  3B5M A;  2IAK A;  2KZ7 B;  2DHR A;  2M6I A;  3FXE B;  3ZMU B;  5JTG A;  3AXJ A;  4TX5 A;  2WS3 A;  2W66 A;  1KNZ A;  1OED E;  4E7Z A;  4NIQ A;  4EZ4 A;  2YDR A;  3CK6 A;  2ZLY A;  4OX9 T;  3T8O A;  2WDR A;  1Y01 A;  1UUR A;  2KSR A;  3PTR B;  2BKO A;  5EK2 A;  4LFA T;  3NRX A;  2CBJ A;  4DBR A;  3JAD A;  2UUB T;  2BVL A;  1BR0 A;  5JR9 B;  1LVF A;  2XM2 A;  3RIU C;  1UK5 A;  2L8K A;  4AKL A;  3VR9 A;  3EVY A;  2A72 A;  2BBJ A;  3AA1 B;  1J5W A;  1G8X A;  3QB5 K;  3AEE A;  2QVA A;  4CN6 A;  4GYS A;  4H9S E;  4PFP A;  1KNP A;  2CPT A;  3RIU A;  2IW5 B;  4XAX B;  3N2O A;  5HCM A;  3AA6 B;  3ZT7 A;  1E1H B;  4EYY R;  2LJL A;  3VKG A;  2ZM0 A;  4QKN A;  4ZI2 D;  1UX4 A;  3HKB E;  2KND A;  3ONX A;  4JI4 T;  2JMH A;  4JI8 T;  5FXZ A;  5F3J A;  2N2N A;  3VKH A;  3CQX C;  4H9N C;  2WY2 A;  3ANW B;  1NWM X;  1XMO T;  4QWN B;  3PUV F;  1S94 A;  3GA8 A;  4Q25 A;  3ZCI A;  2A3D A;  5J2T E;  2UXB T;  4L5G A;  5JRE A;  2WAU A;  4MFR A;  3A7M A;  5BR8 T;  1FMV A;  2ACZ A;  3DTO A;  4PJN A;  2Y6X A;  4ZXL A;  4ILB A;  1BR1 A;  2IML A;  4FI5 A;  3NBX X;  4GKJ T;  1ZOY A;  3LK4 2;  4NXN T;  4P1N A;  5L4E A;  2CRB A;  2BG9 C;  4NXM T;  3SRZ A;  3CX8 B;  2WWU A;  5HXR A;  4ZS3 A;  1QSD A;  1HG5 A;  2CHO A;  3AVS A;  4X20 E;  5KX5 E;  1D1C A;  1T8B A;  3KV9 A;  2BG9 A;  4DV4 T;  1IJ5 A;  3O1I A;  1ZEE A;  3IBP A;  2HN1 A;  2W62 A;  4CN1 A;  1HNZ T;  3TLS A;  5LXT E;  3UQ4 A;  1BR2 A;  2YU1 A;  1SE7 A;  2JQ9 A;  2CBI A;  2XUE A;  3PDY A;  3IEE A;  4OYK A;  4UIG A;  2Y48 B;  4IST A;  4BAY B;  4O4I E;  5C8Y E;  1Z0P A;  3C51 A;  1VRB A;  5AQH B;  4AQY T;  3OYX A;  3L09 A;  3S4U A;  5EZY E;  2W63 A;  4ISS A;  4X1K E;  4H9R C;  3UUN A;  3V5U A;  4I50 E;  4ZI3 C;  3ZSS A;  1N34 T;  4EV6 A;  3W15 B;  5HXS A;  3ZN0 B;  2LRL A;  3UFG A;  4HFE A;  2W0G A;  2KWH A;  5L2L A;  3AVR A;  1ZP0 A;  4A56 A;  3RH3 A;  2J1D G;  3L8R A;  2V7K A;  4BJM A;  1T72 A;  2ZM2 A;  2XQY A;  2JIW A;  3D0T A;  2BKP A;  1E2A A;  5A1L A;  4YXD A;  3BQI A;  4U7I A;  3RF1 A;  4EIW A;  4HFI A;  1KF6 A;  5HYA A;  5HAX A;  3AA7 B;  3C4W A;  5HXC A;  2F4V T;  4H63 V;  2MTQ A;  3N2G E;  3PJA A;  3CPZ A;  2D9D A;  2UXD T;  3PUX F;  1OED B;  4O2B E;  1DU2 A;  2JQH A;  3JAF A;  4TNV A;  4IRE A;  5LJM A;  2OV9 A;  2XAF B;  5JVD E;  2UXN B;  3AE9 A;  3MA9 A;  1MMG A;  2IHR 1;  2VL0 A;  4ILC A;  3N9M A;  4DV2 T;  4ILU A;  3VHL A;  2WDV A;  3AXJ B;  5LYJ E;  2X68 A;  4CN4 A;  3LSV A;  4YJ2 E;  1S35 A;  1JNR A;  1SHZ C;  5IHY A;  3NRY A;  2C5K T;  1LKX A;  5HCJ A;  3TLU A;  1UGO A;  5H6R B;  2FJB A;  4P0A A;  5JDQ A;  3NVO A;  2UUC T;  2MPK A;  4XZC A;  4ZOL E;  5CA1 E;  1WCR A;  5FY7 A;  4QXH B;  3AE2 A;  1ZKE A;  4KHP T;  3ZMS B;  4KUM B;  5LHG B;  2CXF A;  4JI7 T;  3PUZ F;  3O9X A;  5LA6 E;  3AED A;  4O4L E;  2XAS B;  4ERR A;  5LBQ B;  5LHI B;  1VCT A;  2VQE T;  1E7P A;  1HFA A;  2H89 A;  3UU8 A;  5LCY A;  4HFD A;  1QLB A;  4IL9 A;  2V6Y A;  2NW7 A;  4YT0 A;  3CKD A;  1FMW A;  5FVL A;  4DUY T;  4YTN A;  3UU6 A;  2HHH T;  2RP4 A;  2XQ3 A;  2NP9 A;  2M6B A;  4IE4 A;  4EAH A;  4X64 T;  2WMO A;  1U5P A;  2CWY A;  3GN5 B;  1US7 B;  4LFB T;  4WYV A;  2RPA A;  4CXY A;  4ZEY A;  2PFV A;  2XQ8 A;  2CE7 A;  3VU7 H;  2VAS A;  2V26 A;  5HEH A;  4AQG A;  4IDQ A;  4IE0 A;  3PUG A;  2XAJ B;  5LJN A;  5LG3 A;  4P09 A;  4EB6 E;  4H9O C;  5DQW A;  2NW8 A;  4MAL A;  5LG4 A;  2WU2 A;  3PUW F;  2H3R A;  1AJ3 A;  3Q5W A;  4CXW A;  2DWK A;  1YKE B;  4IGU A;  1MIY A;  3U78 A;  3JCF A;  2BG9 B;  5IYZ E;  2C5I T;  2OA5 A;  1IJ6 A;  5EK4 A;  4EXT A;  4IDZ A;  4O2A E;  5L3E B;  2BKN A;  2E5V A;  2Z6E A;  3B13 A;  5LGT B;  4UF0 A;  1WYC A;  5F5W A;  3RIF A;  4L9I A;  2LLY A;  1HR0 T;  2LKG A;  4YHJ A;  2X9H A;  2XJ7 A;  4LML A;  5C3J A;  3ZST A;  3EAB A;  2WBL A;  1D0Y A;  4B3R T;  4UV8 B;  4HTE A;  3UT5 E;  2H7O A;  5AQR B;  4IL4 A;  4TV8 E;  3OPC A;  4TWF A;  1HNW T;  3N9L A;  2X51 A;  1JNZ A;  2GK9 A;  2MBG A;  4IDO A;  2XTL A;  2G0U A;  4K0K T;  3ETU A;  4TUY E;  2K24 A;  2XQA A;  3OYZ A;  1HX1 B;  3ZEF B;  3ZYK A;  4DV5 T;  3LBX A;  2I0M A;  3HKE E;  2XQ6 A;  2XY8 B;  4UXN B;  3OKQ A;  2HPL A;  2WZH A;  2J47 A;  4YJ3 E;  5J0Z A;  1FJG T;  5AQQ B;  2VWA A;  1GQE A;  3T1H T;  3H3A A;  3JC6 D;  1WR6 A;  1Y64 B;  2E9X C;  3FZM B;  2JMK A;  3AA0 B;  4H9P C;  2CM0 A;  2P9B A;  4HFC A;  2Q9Q C;  2E9X A;  4N78 D;  2K5B B;  4OYJ A;  4O8S A;  3FBZ A;  3RKO A;  3RHW A;  3RYH E;  5JH7 E;  1IZN B;  1MIV A;  1UUS A;  4OK0 A;  4LF4 T;  3TKL B;  1D1A A;  2Q9Q A;  2XAG B;  1J5E T;  4KHZ F;  2ZM8 A;  1LRZ A;  1KFY A;  3AEC A;  2EHO C;  4EZH A;  2X9W A;  2XSB A;  3P4W A;  4YTM A;  2D0T A;  2X0H A;  2DWG A;  3EDV A;  4IE7 A;  3IHR A;  2I6H A;  2DNX A;  2EHO A;  4KBM B;  4U31 A;  3ZC1 A;  3KBT A;  4HKA A;  3LK3 B;  4WBN E;  1IBM T;  2LM2 A;  4JI5 T;  2M67 A;  2DL1 A;  3Q2M A;  3UU4 A;  5FXW A;  4H63 H;  5HXE A;  5F8P A;  4PJL A;  3PJA J;  4QXB B;  2A9U A;  3N9O A;  2BBH A;  5GON E;  1ZV4 X;  4JBW F;  4YSZ A;  2Y8D A;  5KMG P;  1H7C A;  2YK0 A;  1N36 T;  2WSS V;  3P7I A;  2BS4 A;  2ZMA A;  2CA5 A;  3UU5 A;  1UX5 A;  4I4T E;  2VQF T;  2V6Y B;  1NAF A;  4IIJ E;  1W0B A;  4AKG A;  4E7S A;  3CQG B;  4YSY A;  3K1S A;  4DV3 T;  3LG7 A;  3UUX B;  2KXP B;  3K3O A;  3Q9D A;  3ZT6 A;  4WW0 A;  4JLE A;  3J9X 1;  4GIW A;  4DV7 T;  3FHN A;  3N9P A;  1UCU A;  2FBW A;  3ONJ A;  2MYS A;  3C4Z A;  2YN6 A;  3ZC0 A;  4LMK A;  5LB7 B;  3ZJ2 A;  4I55 E;  4KI0 F;  4CZZ B;  3C64 A;  2YDS A;  2AXD S;  2BG9 E;  4AKI A;  3E08 A;  3AE4 A;  1MMN A;  2ODV A;  1WRD A;  1BR4 A;  3MZK B;  1W0A A;  4TNW A;  2CXD A;  4X1I E;  3ABV A;  5L3G B;  3AEG A;  2CHN A;  1HX8 A;  4JEU B;  2XPK A;  1WFD A;  2XQ9 A;  4JV5 T;  1R8I A;  4UF0 B;  5JRC B;  3AE1 A;  2YIN A;  4M1P A;  1VCS A;  4ZI2 C;  3R84 B;  4X1Y E;  2MAW A;  4IE5 A;  5CJ5 A;  3F31 A;  4P0B A;  2VUR A;  1HCI A;  4AIU A;  3OTO T;  5AQL B;  4J2C A;  4AQF C;  4A5X A;  4DMW A;  1M62 A;  4PAG A;  5JDL A;  1W09 A;  2DCF A;  4EGW A;  5LGU B;  5LP6 E;  4V1A v;  4IDP A;  4AQF A;  5HWX A;  5BMV E;  3UQ7 A;  3NZQ A;  4LF7 T;  3PUS A;  4TN7 B;  2BS3 A;  5FYM A;  5HEG A;  3QK6 A;  5JDF A;  3I9Y A;  3LBX B;  2ES0 A;  5AQG B;  4PNI A;  4NUV A;  3OVU A;  3CIR A;  4QX7 B;  1YQ3 A;  2LOS A; 
#chains in the Genus database with same CATH homology
 1IBM T;  4JI6 T;  2E5L T;  4JI5 T;  5BR8 T;  4DV5 T;  1N34 T;  4JI2 T;  4DR4 T;  4LF6 T;  4B3T T;  1IBL T;  5LMU T;  4DV1 T;  1HNX T;  4LF9 T;  4B3S T;  4LFC T;  2UUC T;  4GKJ T;  4NXN T;  4OX9 T;  4JI1 T;  1FJG T;  1I94 T;  4NXM T;  4KHP T;  4DUZ T;  4DV6 T;  3T1H T;  4B3M T;  4LF5 T;  5IWA T;  4LFA T;  1N36 T;  4JV5 T;  4JI7 T;  4GKK T;  2UUB T;  4JI3 T;  4DV4 T;  2VQF T;  2UUA T;  2VQE T;  1XNQ T;  4DR7 T;  2F4V T;  4JI0 T;  1HNZ T;  1HR0 T;  3T1Y T;  4DV3 T;  1N32 T;  2UXD T;  1IBK T;  3OTO T;  5LMN T;  4DR6 T;  4LF8 T;  2UXC T;  4B3R T;  4DUY T;  4LF4 T;  2UU9 T;  1N33 T;  4DR3 T;  1J5E T;  4DR2 T;  2HHH T;  4DR1 T;  4JI4 T;  4DV7 T;  4JI8 T;  4X62 T;  1HNW T;  1XNR T;  4DR5 T;  1XMO T;  4X64 T;  4LF7 T;  2ZM6 T;  4AQY T;  4DV0 T;  4DV2 T;  4JYA T;  4LFB T;  1XMQ T;  4K0K T;  2UXB T;  4X66 T;  4X65 T;  4YY3 T;  4YHH T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...