2LJLA

Nmr structure of hsp12 in the presence of dpc
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
109
structure length
109
Chain Sequence
MSDAGRKGFGEKASEALKPDSQKSYAEQGKEYITDKADKVAGKVQPEDNKGVFQGVHDSAEKGKDNAEGQGESLADQARDYMGAAKSKLNDAVEYVSGRVHGEEDPTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 12 kDa heat shock protein
publication title Structural characterization of Hsp12, the heat shock protein from Saccharomyces cerevisiae, in aqueous solution where it is intrinsically disordered and in detergent micelles where it is locally alpha-helical.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 12
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2011-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04119 HSP9_HSP12 Heat shock protein 9/12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1260 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2ljlA01
2L9QA 4AXPA 2LJLA
chains in the Genus database with same CATH superfamily
2Y48B 3N9QA 2XY8B 2V8SV 3RYCE 5L3EB 3SFDA 3V5UA 4A98A 5AQPB 5JDHA 4UV9B 3L8RA 5FY1A 2ODVA 3TKLB 1N32T 5FXXA 2E8IA 5FL0A 2DCFA 2W61A 4NUUA 3Q5EA 2IC9A 4YJ2E 5HYAA 4O4IE 4EIWA 1SA0E 4A5XA 4QX7B 5GONE 5AQTB 3NVOA 4B3ST 2K48A 1E1HB 1G8XA 4YLHA 1J5WA 5LGUB 1VRBA 2LJLA 3P4PA 4PFOA 3FBZA 1D1CA 2LSGA 3HKDE 3CKDA 3J9X1 2WZHA 4O8SA 4ZI2D 2OA5A 1KFYA 1UGOA 2FBWA 2Q9QC 3OYZA 4HKAA 2UU9T 3M3ZB 4ISSA 2XHEB 2ZLYA 2V7MA 1UUSA 2XAHB 4UVCB 3RX6A 4IREA 2CCQA 4TV8E 2VQFT 4GYRA 1YD8G 3Q2MA 3AA7B 3DJBA 2ACZA 2MAWA 4ZZBA 5AFUL 1HX8A 4DR3T 2LSYA 3NRXA 3PDYA 3QB5K 1FIOA 1FMVA 2VVSA 3I9WA 3BQLA 4TNVA 1E2AA 4HFHA 3GWHA 4H9NC 1J1JA 1S35A 4IE7A 2UUCT 4U31A 4MFRA 5JRCA 3RKGA 4PJLA 4DR1T 1IAPA 3ZYMA 3AAEB 4X66T 4UXNB 3RIFA 3SRZA 3IA3A 1OEDB 4BJNA 1JNRA 1OWAA 3CK6A 4ZHQE 4ERRA 3RPUA 2X51A 2IC6A 2X9WA 1IBKT 1FJGT 4HWFA 2NTXA 4P0BA 5KMGP 3VKHA 1I94T 4X64T 4HFVA 4QXBB 2WWUA 3OKQA 5BMVE 3ZCIA 2BKPA 3A8YC 3C51A 4MHCA 3LJCA 3RYHE 3Q9DA 1LVKA 3RQUA 1BR2A 3NZPA 3VU7H 1UK5A 4NIQA 2WWVA 4HWDA 3HL6A 2W0GA 2YDSA 2IIUA 2LEHA 4P0AA 3CQXC 4DO0A 4KBMB 3WAJA 3K3QC 3D0TA 2BG9A 4WZXA 1HFAA 3KVAA 2LLYA 4YTPA 4DR4T 1XWMA 3JAFA 1WFDA 4NXNT 4DV5T 3TLWA 4EV6A 4COFA 4EEDA 2WDRA 3SFEA 1XDPA 4X5TA 2V7IA 2N1GA 2M6IA 1FMWA 4KMCA 3MACA 3FB2A 4HN9A 4B3MT 2H7OA 2JIWA 5L3GB 3NKZA 2VK9A 2NW7A 2XAGB 5J0ZA 2KT9A 5JDGA 4JUYA 5IHYA 1HTJF 2BG9E 1D1AA 4U2ZA 4A56A 2XQYA 2CHOA 3C4ZA 4YHHT 1BR4A 1MMGA 2UXDT 5AQNB 4ILUA 5FXVA 2J62A 3ANWA 3KBTA 5JDFA 3B5MA 3RH3A 4DV6T 3S4UA 2RP4A 2ZM0A 2VVNA 4DV2T 1N36T 2CXFA 2UXCT 3JAEA 2MTQA 1MMDA 1NAFA 1EZ3A 3E08A 3H3AA 3VR9A 4Z91A 3KV5A 2I6HA 1NWMX 2XASB 3FZLB 4TN7B 2OV9A 1HNWT 3RHWA 3PUXF 1N34T 3RIAA 4DUZT 4JI4T 4IE6A 3OPCA 3KINB 2E9XA 3N2OA 3RC3A 1UCUA 3ONJA 5EK4A 4KUMB 4OYKA 1YW0A 1MMAA 3R84B 3V5SA 2BG9C 2NOXA 5FL1A 4GK5E 3G06A 3O1JA 4DIDB 3C4XA 4B6XA 2WB5A 4IDZA 1WRDA 5E0OA 4K0KT 1WR0A 4KP3C 2VB6A 2V6YB 2XQ6A 5C8YE 4XAXB 3VRAA 4JI6T 4E7SA 1W0BA 1XMOT 3ZMUB 5AQLB 3PUSA 2W00A 2QVAA 2XAJB 5FKYA 1BR1A 1MNEA 3PUYF 5CA1E 4UIGA 3HKEE 3LFMA 3EI0A 2E2AA 5LMUT 3SS1A 2EHOA 1YKHB 1WYBA 1U5PA 2LSKA 2D0TA 1X9BA 5HEHA 2BBJA 1N33T 2Y6XA 3BK9A 2VASA 3KFWX 3VHLA 2QYWA 2C5JA 1MIWA 3L39A 4QKNA 2XQ7A 3OYXA 3AE1A 4X20E 2CM0A 3TLVA 3CQCB 4ZS2A 1ZKEA 1LRZA 3ONLC 5FMNA 5HEOA 1T7SA 3EVYA 4UF0B 1Y01A 3GN5B 2C5KT 2RA1A 2WMOA 2YDQA 5HWYA 3R6NA 1IBLT 2JQKA 2UXXB 2LSJA 2IAKA 1D0ZA 2HH7A 2AE9A 5JDMA 4CI3B 4DR2T 4ZS3A 2K5BB 2WCAA 2W62A 3VR8A 4EYUA 3AEFA 3Q5DA 3UFGA 4DVDA 1DU2A 4EGWA 5AQJB 3W15B 4TWDA 3MKDA 1HF8A 3K8PC 2E9XC 2YEVC 1KNPA 2WS3A 3E22E 3WI3A 4YY3T 3ZJ1A 1IBMT 2V26A 2HPLA 3C64A 2OLTA 3ZT5A 2ZM8A 5LB7B 3AE3A 4IL9A 3EABA 4HTEA 3ZPOA 4AIUA 3LK3B 3C4WA 4DV1T 4H9PC 2CE7A 3N2KE 2JQ9A 2A2FX 4V1Av 2ACXA 1OEDA 3RIUA 4EOZB 3AXJB 5C2TA 5L3DB 2X0YA 3UFEA 5ABEA 2IUBA 1ZP0A 2ES0A 2MYSA 4UVAB 4HFIA 5HEGA 2LHNA 5LHIB 4YTNA 2H88A 3TLTA 5LOVE 3P8CD 2LKHA 3N9PA 4UEMA 3UT5E 1QSDA 2XZEA 2EHOC 3JADA 3MJXA 3I1AA 1UURA 3UU8A 5AQMB 5A1LA 5HXHA 3PE0A 3HKCE 5LYJE 4JI5T 2BVMA 4I50E 4Z90A 3KV9A 5JH7E 1XDOA 5HXCA 3X1DA 5LGTB 3LK2B 4WBNE 3HKBE 3N9OA 4NPPA 1OEDE 3N2GE 5CFBA 4EZ4A 1XNQT 3OBVE 4DBRA 4WBOA 2NTYA 3N9NA 3PUAA 2XSAA 4YSZA 5JVDE 4DV0T 3IEEA 2XJ7A 2DL1A 3EDUA 4LFAT 2P9BA 2JRKA 3B57A 2Q9QB 3ZMTB 1KK7A 5ABHA 4UELA 1ZEEA 4ZOLE 3IF8B 1HCIA 5DQVA 2WQYA 5F8PA 2IW5B 5JTGA 4JI1T 4G63A 3ABVA 3ZC1A 2VWAA 2BS3A 2PFVA 4OK0A 3ZYKA 3UULA 4ZEYA 3ZCJA 5LGNB 2N2NA 4KI0F 4M1PA 5FXWA 2NW9A 2UXNB 5ABFA 1S94A 3O4XE 3ONXA 3P4RA 3VKGA 3H37A 5EK2A 4O2AE 3GA8A 2CBJA 1OEDC 3KDSE 3RIUC 2XSBA 3UUXB 1J5ET 5LCYA 4PFPA 3KBUA 2W63A 3I9YA 3ZN0B 3ZKRA 5LG3A 2ODUA 3QUJA 1US7B 2VKDA 3CPZA 4IDQA 2D2SA 2B1EA 4B3TT 2C5IT 4HGAA 3FXEB 4C90A 2Q9QD 3QNUA 4QH5A 3LSVA 5FXZA 2ZM2A 4U2YA 3SOLA 4FJOA 1XZYA 3UUBA 3FZMB 2CPTA 4F6RC 2QGSA 3P7IA 3JC6D 2XM1A 3RYIE 3RI5A 5AQKB 2XUEA 2DNXA 4PJNA 2ZMAA 2X9YA 4PAGA 3AEAA 2CWYA 5JREA 3HA4A 4KX6A 2BDEA 2V1DB 2A9UA 1M7KA 3PUGA 4IDPA 1IJ5A 2VL0A 4ZXLA 5DQWA 4NUVA 1Z0PA 4U72A 2QRXA 2VQET 4LF5T 4QHOA 2VURA 4GIWA 2CBIA 2D0UA 2D9DA 4LF4T 4O4LE 4CN6A 4JI8T 1WYCA 4X65T 4QX8B 2W4XA 5HXSA 3CIRA 2BS2A 2VKOA 5IYZE 5HXRA 5H6RB 2FJEA 4CN1A 2YINA 2JJ9A 1T98A 4HFCA 3RRCA 2X0LB 2RPAA 1HNXT 1HG5A 3AEGA 5L47A 1ZV4X 5LBQB 5F5WA 1Z8UA 2R6GF 3A5XA 4GOUA 4OHFA 1KNZA 2B76A 5JR9A 1NEKA 5IUXA 5LJMA 2LSIA 2H7VC 3LBXB 2H89A 3BQIA 2LRKA 2XM2A 5JRCB 3ETUA 4EZHA 5LP6E 3DTOA 1HNZT 3ZLIA 2X0HA 3O9XA 4EEBA 2WBLA 3GN5A 4L9IA 3EHZA 2V7KA 2M67A 1SE7A 4AKRB 1X79A 5L4HA 1QUUA 3HI2A 2WDVA 3CVRA 4YFSA 4UVBB 4CI2B 3F57A 3UU5A 2VKHA 5L3CB 3K3OA 3CX8B 2WP9A 4CXXA 4Z8XA 3AE4A 4HWCA 4HFEA 4WW0A 5HEUA 4ZI3C 1KNRA 2V7LA 2JQHA 4IHJE 2X9XA 1SUMB 5IWAT 5J2TE 1YKEB 4U7IA 3IBPA 4CXYA 3KV4A 5HEJA 5JDLA 4IE5A 4ZI7E 3MK7C 4CI1B 5KXJA 3P4QA 2I0MA 5TAOA 3FZFB 2W67A 2XQ9A 4WYVA 3EUHA 3RLFF 1V9DA 4B3RT 2PTFA 2W2UA 4H9RC 3C98B 4EYYR 4JYAT 4BA9A 2MPKA 4LF9T 2FJBA 3AXJA 4IT4A 2UXBT 4YJ3E 4TWHA 3C50A 3GMIA 2PG8A 2BG9B 3O1IA 1IZNB 2A3DA 4LF6T 4QH1A 3NZQA 3J7Yq 5ABGA 2LE8A 3UUNA 3T1HT 5AQGB 5EK3A 2UUBT 1BR0A 5HXEA 5JR9C 4TNWA 4TZ4C 3FBLA 1LVFA 3SWHA 3UU6A 3N5LA 2LM2A 3KVBA 2HN2A 2AXDS 2UUAT 2LM9A 2DWGA 4JV5T 4ISTA 2E5LT 5LJNA 3AAAB 4K0UA 2V5CA 3QOFA 4PK5A 4DNDA 1MMNA 1R8IA 4DMVA 2LOPA 4IE0A 4MBQA 3AE8A 4H9SE 2E5VA 5DABA 5L3BB 3MZKB 5H6QB 3BQKA 4CN4A 4AKIA 2WSSV 1T72A 3L3PA 1D0YA 3P4SA 4A97A 4TV9E 3MXZA 3F2EA 1D0XA 5AQOB 4LMLA 1YXRA 4HEAA 2F4VT 3PUWF 5AQHB 4ZI2C 5JDNA 4GYSA 2V6XA 3TLUA 3AE5A 2YU2A 4ILBA 4JBWF 2YKSA 2CXDA 4QWNB 4JI0T 3RRWA 2JMKA 4OYJA 5HAXA 4DR7T 4PNIA 1VOMA 3ZMZB 1VCTA 2WMNA 2E9XB 3AA6B 2NR4A 2CLYB 3ZT7A 4IGUA 3UQ7A 3OVUA 2KSRA 4LFCT 4MALA 2N9DA 2DI4A 1D1BA 5LBMA 2DLRA 1SHZC 5ADXL 3ZMVB 2BBHA 4BAYB 2L3LA 3ETVA 2D5UA 3PJAA 2Z6EA 3FZKB 2NW8A 1CUNA 5HWXA 2MBGA 4L0RA 2KINB 4ANJA 1WR6A 3M65A 4DV7T 3AE2A 3T8OA 2NP9A 5L2LA 4E7ZA 3PU8A 4QH4A 4AQFA 4O4JE 4ADZA 2EHOB 4QXCB 4ZZCA 1MIYA 1T8BA 2V7JA 4EB6E 5C3JA 4GKJT 5L4EA 5AQIB 3LG7A 5JQGE 3CMLA 2HN1A 2E9XD 5CGMA 4BJMA 2XTLA 4PJMA 4I0UA 1KF6A 3T1YT 4LF8T 3FXDB 4QXHB 3JC6C 2DWKA 3RF1A 1IJ6A 2KMFA 3EDVA 4H63V 4YSYA 2HPJA 4I43B 5JDQA 2BKOA 2SPCA 1GQEA 1QLBA 1NENA 4YT0A 4L5GA 4YSXA 1YQ3A 3DP7A 1ZHCA 5LHGB 2LKGA 3PV0F 1JNZA 4EXTA 3NRYA 4G2AA 2L8KA 3ZC0A 2GK9A 4AQGA 2WY2A 4IE4A 1WLXA 2QA7A 2LT3A 3AE7A 4UV8B 3AVRA 2KXPB 3PUQA 4OX9T 3LK42 2WM9A 3LBXA 2EHOD 3PUZF 4JEUB 4IL4A 3B13A 1UX4A 2WU2A 1U4QA 1FEWA 1MIVA 1OXZA 4TWFA 4F8HA 3ZT6A 1YQ4A 2PJQA 3E0ZA 2XQ8A 5LMNT 4PJJA 4U7YA 2IMLA 5EZYE 2DHRA 3ZJ2A 1HG2A 3O1HA 4HE8A 2FJAA 5L3FB 3UU3A 2WDQA 3A7MA 2X67A 1W9RA 2NWBA 3L09A 2M6BA 4AQFC 4PK4A 4CXWA 4LFBT 2JPFA 1W09A 4PK6A 1I6ZA 4TX5A 4DR5T 4HFBA 4KHPT 3P50A 5LHHB 3ZEFB 3U3IA 4H9QC 5FNVE 2LHRA 5AQFB 3HR0A 2CHNA 2JQQA 2BVLA 4AI6A 3ZYLA 5BR8T 2WAUA 2XPKA 2YOEA 1ZOYA 4IDNA 3AAIA 5AQQB 3WAKA 4X1IE 3OTOT 2KNDA 2X68A 2FJDA 1LKXA 3AEBA 3MA9A 2V6YA 3UQ4A 2K9AA 2CMRA 3AVSA 5J1GA 3NWIA 3Q5XA 4AQYT 3PU3A 4J2CA 4U74A 3RQWA 1XMQT 4AKGA 5FY7A 3RGLA 4IIJE 2XAQB 1UX5A 1Y64B 2IDOB 5LG4A 2CA5A 2K24A 5LNKA 5CB4E 4XZCA 3CX7B 4HWIB 3VRBA 2I59A 3QK6A 2A72A 4P1NA 2KWHA 1CHUA 5ABFB 3P4WA 4YTMA 5FP3A 3OJAA 1E7PA 2JMHA 5F3JA 4TUYE 3H3MA 2XQAA 4JEHB 4CZZB 2YDRA 3QB5A 4NXMT 5HCJA 3ZSSA 4UF0A 4IDOA 4X1YE 1B7TA 2WZIA 3AE9A 2J1DG 5KDMC 2KLQA 4JI3T 4I4TE 4WNKA 4HWHA 1AJ3A 1MNDA 3K3NA 3N9MA 1HX1B 5FYMA 2BS4A 5AQUB 5LA6E 1KEYA 4LMKA 2VL8A 4KHZF 2X9HA 3FHNA 2W66A 3I0OA 4AKHA 2J47A 1W0AA 4DV4T 4HFDA 4LF7T 4JI7T 4ILAA 4Q25A 2XAFB 4X1KE 5CJ5A 1VCSA 2BZBA 2CRBA 3RC8A 1O3XA 1WCRA 4I55E 3NBXX 2MOZA 2XQ4A 4ILCA 2CXLA 3UU4A 3U78A 3LDQB 4UR9A 2YU1A 4X62T 3PUVF 4N78D 5FVKA 4YHJA 5AQVB 5AQRB 3ZN1B 2K3WA 2HHHT 3ZSTA 1L0VA 4GKKT 2C0SA 1HS7A 3ESLA 4AXPA 2V5DA 2LOSA 2L9QA 1G73A 3FZHB 4MLKA 2J4GA 3IHRA 4DBQA 5LXTE 3ZMSB 5JR9B 4U33A 4JI2T 2ZM6T 3AECA 2VKJA 2XQ5A 4P09A 3RYFE 2PBIA 3AB3B 3PTRB 3F31A 2H3RA 2LRLA 3AA0B 4AISA 3AA1B 3AEDA 4C91A 2Q9QA 5AQSB 4ZI3D 4ASKA 3JCFA 5CA0E 2KWIB 4DV3T 3ANWB 5FVLA 4H9OC 3I0QA 1M62A 4U3CA 2CEAA 4JLEA 2X66A 2KZ7B 5KX5E 5ETWA 2CWOA 3KV6A 3UUMA 3CX6B 5M4YA 5HCMA 3RKOA 5J2UE 2G0UA 4XBFB 4O2BE 2XQ3A 4H63H 3UTKA 1XNRT 2FUPA 3AEEA 3TLSA 4LMJA 2YK0A 3AE6A 3N9LA 5DJQC 1HR0T 4DUYT 2CLYC 4OFZA 3PJAJ 4DR6T 3CWZB 3Q5WA 4O4HE 2IHR1 2Y8DA 4PW8A 4AKLA 3QC9A 2YN6A 4EAHA 1H7CA 3EAMA 3CQGB 4YXDA 2WU5A 3PURA 3K1SA 4CQIA 4FI5A 4DMWA 2BKNA 4GK0E 5FY0A
chains in the Genus database with same CATH topology
2VB6A 3AVRA 4UV8B 2Y48B 3N9QA 2KXPB 3PUQA 5C8YE 4XAXB 3RYCE 5L3EB 3V5UA 3LK42 5LBQB 2WM9A 3LBXA 2EHOD 4JEUB 4E7SA 3B13A 3A5XA 3ZMUB 5JDHA 4GOUA 4OHFA 1KNZA 4UV9B 3PUSA 5FY1A 2W00A 5JR9A 2ODVA 1UX4A 1U4QA 2XAJB 5LJMA 1BR1A 1FEWA 2LSIA 1MNEA 1MIVA 3TKLB 1OXZA 5FXXA 5CA1E 4UIGA 2E8IA 2H7VC 2PJQA 3E0ZA 3LBXB 3HKEE 2DCFA 3BQIA 3LFMA 2W61A 4NUUA 2IC9A 4YJ2E 5JRCB 3SS1A 3ETUA 4PJJA 5HYAA 4O4IE 2EHOA 4EIWA 1SA0E 1YKHB 5EZYE 2DHRA 1WYBA 4QX7B 5GONE 1HG2A 3ZJ2A 4EZHA 5LP6E 3O1HA 4HE8A 1U5PA 3DTOA 2LSKA 2K48A 2D0TA 1E1HB 5L3FB 1G8XA 4YLHA 3ZLIA 5LGUB 1VRBA 2Y6XA 2X67A 2LJLA 4PFOA 3BK9A 2VASA 3FBZA 1D1CA 3KFWX 2LSGA 3VHLA 3HKDE 3CKDA 2C5JA 2NWBA 3L09A 2WBLA 4O8SA 1MIWA 3J9X1 4AQFC 3O9XA 3GN5A 4QKNA 4PK4A 4CXWA 3OYXA 4L9IA 4ZI2D 2OA5A 2V7KA 2JPFA 2M67A 4PK6A 4X20E 4AKRB 2CM0A 1X79A 4TX5A 3CQCB 1QUUA 2Q9QC 3OYZA 3HI2A 1ZKEA 3CVRA 1LRZA 4HKAA 4ZS2A 5FMNA 5LHHB 4YFSA 4UVBB 4ISSA 2XHEB 3ZEFB 4UF0B 3EVYA 4CI2B 3F57A 3U3IA 2ZLYA 3GN5B 2V7MA 2C5KT 2RA1A 2WMOA 4H9QC 2VKHA 5L3CB 5FNVE 5HWYA 2LHRA 3R6NA 3K3OA 2UXXB 3CX8B 3HR0A 4CXXA 2LSJA 2XAHB 2JQQA 2BVLA 4AI6A 4Z8XA 2IAKA 4UVCB 1D0ZA 2HH7A 3ZYLA 5JDMA 4CI3B 4WW0A 3RX6A 2CCQA 4ZS3A 2K5BB 2WAUA 2W62A 4TV8E 4ZI3C 4EYUA 2V7LA 4DVDA 4GYRA 4IHJE 2X9XA 1YD8G 3Q2MA 3W15B 3AA7B 3DJBA 5J2TE 1YKEB 3MKDA 1HF8A 5AFUL 3IBPA 3K8PC 4CXYA 1HX8A 2E9XC 3KV4A 3AAIA 5JDLA 3WAKA 4IE5A 4X1IE 2KNDA 2LSYA 2X68A 2YEVC 4ZI7E 3MK7C 3E22E 3NRXA 4CI1B 1LKXA 3WI3A 3MA9A 5TAOA 3PDYA 2K9AA 3ZJ1A 3EUHA 1FIOA 2V26A 1V9DA 2CMRA 3AVSA 5J1GA 4H9RC 1FMVA 2HPLA 3C98B 4EYYR 3I9WA 3C64A 3Q5XA 3PU3A 4J2CA 4BA9A 3BQLA 4U74A 2ZM8A 4AKGA 5FY7A 3GWHA 4YJ3E 4IIJE 4H9NC 3C50A 2XAQB 1S35A 3GMIA 4HTEA 3ZPOA 1UX5A 3LK3B 3C4WA 2PG8A 3O1IA 1IZNB 1Y64B 2A3DA 4H9PC 4IE7A 5LG4A 3NZQA 2CA5A 2CE7A 3N2KE 3J7Yq 2K24A 5LNKA 2LE8A 2A2FX 4V1Av 3UUNA 2ACXA 5CB4E 4MFRA 5JRCA 4XZCA 4EOZB 3CX7B 5EK3A 2I59A 4PJLA 1BR0A 5HXEA 5L3DB 3UFEA 3QK6A 5JR9C 1IAPA 2A72A 3ZYMA 3AAEB 5FY0A 4UXNB 2ES0A 2KWHA 3SRZA 2MYSA 4UVAB 4TZ4C 2LHNA 5LHIB 3FBLA 1LVFA 5LOVE 5FP3A 3OJAA 3SWHA 4BJNA 3P8CD 3N9PA 2JMHA 3N5LA 5F3JA 4TUYE 1OWAA 4UEMA 3KVBA 3UT5E 4JEHB 4ZHQE 1QSDA 2EHOC 3MJXA 4CZZB 4ERRA 3I1AA 5A1LA 5HXHA 3PE0A 3RPUA 2LM9A 3HKCE 2X51A 2IC6A 2X9WA 5LYJE 2DWGA 4ISTA 2BVMA 4I50E 4UF0A 5LJNA 3AAAB 3KV9A 5JH7E 4K0UA 5HXCA 2NTXA 4X1YE 4PK5A 4P0BA 5LGTB 5KMGP 1B7TA 3VKHA 3LK2B 4DNDA 1MMNA 4WBNE 2J1DG 3HKBE 5KDMC 4DMVA 2KLQA 3N9OA 4HFVA 2LOPA 3N2GE 4IE0A 4MBQA 4I4TE 4QXBB 2WWUA 3OKQA 4H9SE 4WNKA 4EZ4A 5BMVE 3OBVE 3ZCIA 5DABA 4DBRA 5L3BB 1AJ3A 4WBOA 3MZKB 5H6QB 2NTYA 3BQKA 3C51A 1MNDA 3K3NA 4MHCA 4AKIA 2WSSV 3N9MA 3N9NA 3PUAA 3LJCA 3L3PA 5FYMA 5JVDE 3RYHE 1D0YA 3Q9DA 4TV9E 1LVKA 3IEEA 3MXZA 5LA6E 3F2EA 1D0XA 1BR2A 3EDUA 2P9BA 3NZPA 4HEAA 3VU7H 2JRKA 3B57A 2VL8A 4ZI2C 2Q9QB 5JDNA 3HL6A 2X9HA 3FHNA 2W0GA 4GYSA 3ZMTB 3I0OA 4AKHA 1KK7A 2LEHA 4P0AA 3CQXC 4UELA 2YU2A 1ZEEA 4DO0A 4KBMB 4ZOLE 3WAJA 3IF8B 2CXDA 1HCIA 5DQVA 3K3QC 5F8PA 4QWNB 2IW5B 3D0TA 3RRWA 4G63A 1HFAA 2XAFB 3KVAA 3ZC1A 2JMKA 4OYJA 4X1KE 5HAXA 4PNIA 2VWAA 1VOMA 2BZBA 2PFVA 3ZMZB 3RC8A 4OK0A 1O3XA 4I55E 3ZYKA 2WMNA 3NBXX 2E9XB 2MOZA 3AA6B 3UULA 3ZCJA 5LGNB 2CLYB 2N2NA 4M1PA 5FXWA 4IGUA 2NW9A 2UXNB 1S94A 2CXLA 3O4XE 3U78A 2V7IA 3ONXA 4MALA 2N1GA 3VKGA 3H37A 5EK2A 2YU1A 4O2AE 2N9DA 2DI4A 3GA8A 1D1BA 3KDSE 4N78D 3UUXB 5LBMA 5LCYA 4YHJA 4PFPA 2DLRA 1FMWA 1SHZC 4KMCA 3KBUA 2W63A 3MACA 3I9YA 3FB2A 4HN9A 3ZMVB 3ZN1B 3ZN0B 5ADXL 2H7OA 5L3GB 4BAYB 2VK9A 2NW7A 2XAGB 2ODUA 2C0SA 2KT9A 5JDGA 1HS7A 2L3LA 4JUYA 5IHYA 3QUJA 1US7B 3ESLA 1HTJF 3ETVA 2VKDA 2D5UA 4AXPA 3CPZA 2D2SA 2B1EA 2LOSA 1D1AA 2L9QA 2Z6EA 2C5IT 4HGAA 4A56A 2XQYA 1G73A 2NW8A 1CUNA 5HWXA 4MLKA 2MBGA 3IHRA 4DBQA 5LXTE 3FXEB 3ZMSB 4C90A 4L0RA 2KINB 2Q9QD 5JR9B 4ANJA 1WR6A 2VKJA 5FXZA 2ZM2A 3C4ZA 3M65A 4P09A 3RYFE 3SOLA 4FJOA 2PBIA 1BR4A 1MMGA 3T8OA 3AB3B 2NP9A 3PTRB 5L2LA 4E7ZA 3F31A 4ILUA 3PU8A 5FXVA 4AQFA 2H3RA 4F6RC 2QGSA 3P7IA 3ANWA 4O4JE 3AA0B 3JC6D 4ADZA 2EHOB 3KBTA 5JDFA 3RYIE 4QXCB 3RH3A 3AA1B 3S4UA 1MIYA 2XUEA 4C91A 2Q9QA 2V7JA 4ZI3D 2DNXA 4EB6E 2RP4A 4ASKA 4PJNA 2ZM0A 5CA0E 2ZMAA 2X9YA 2KWIB 3LG7A 5JQGE 2CXFA 3CMLA 3ANWB 4PAGA 2MTQA 1MMDA 1NAFA 2CWYA 2E9XD 4H9OC 5JREA 3I0QA 4BJMA 1EZ3A 3E08A 3H3AA 3HA4A 2CEAA 2XTLA 2BDEA 2V1DB 3KV5A 4JLEA 1NWMX 2XASB 4PJMA 2X66A 2KZ7B 5KX5E 5ETWA 4TN7B 2CWOA 3PUGA 3KV6A 1IJ5A 3UUMA 3CX6B 5M4YA 3FXDB 4QXHB 3RKOA 3JC6C 5J2UE 2DWKA 5DQWA 1IJ6A 4NUVA 2KMFA 2G0UA 1Z0PA 4IE6A 4U72A 4XBFB 3KINB 4O2BE 3EDVA 4H63H 3UTKA 4H63V 2E9XA 3N2OA 3RC3A 1UCUA 2HPJA 4QHOA 2YK0A 4GIWA 3N9LA 4I43B 5JDQA 2D0UA 2SPCA 4KUMB 5DJQC 4OYKA 5EK4A 4O4LE 1YW0A 1MMAA 3R84B 1WYCA 1ZV4X 3V5SA 2CLYC 4L5GA 2NOXA 4OFZA 4GK5E 4QX8B 3CWZB 3O1JA 3Q5WA 3DP7A 4O4HE 2Y8DA 3C4XA 4B6XA 5HXSA 4PW8A 4AKLA 1ZHCA 4IDZA 3QC9A 4EAHA 5LHGB 1WRDA 2VKOA 5E0OA 5H6RB 5HXRA 5IYZE 1H7CA 3CQGB 2YINA 4EXTA 2JJ9A 3NRYA 4G2AA 2L8KA 3ZC0A 1T98A 2GK9A 4AQGA 4KP3C 3PURA 3RRCA 2X0LB 4CQIA 4FI5A 4DMWA 4GK0E 4IE4A 1HG5A 1WLXA 2QA7A 2LT3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L9Q A;  4AXP A;  2LJL A; 
#chains in the Genus database with same CATH topology
 2Y48 B;  3N9Q A;  2XY8 B;  2V8S V;  3RYC E;  5L3E B;  3SFD A;  3V5U A;  4A98 A;  5AQP B;  5JDH A;  4UV9 B;  3L8R A;  5FY1 A;  2ODV A;  3TKL B;  1N32 T;  5FXX A;  2E8I A;  5FL0 A;  2DCF A;  2W61 A;  4NUU A;  3Q5E A;  2IC9 A;  4YJ2 E;  5HYA A;  4O4I E;  4EIW A;  1SA0 E;  4A5X A;  4QX7 B;  5GON E;  5AQT B;  3NVO A;  4B3S T;  2K48 A;  1E1H B;  1G8X A;  4YLH A;  1J5W A;  5LGU B;  1VRB A;  2LJL A;  3P4P A;  4PFO A;  3FBZ A;  1D1C A;  2LSG A;  3HKD E;  3CKD A;  3J9X 1;  2WZH A;  4O8S A;  4ZI2 D;  2OA5 A;  1KFY A;  1UGO A;  2FBW A;  2Q9Q C;  3OYZ A;  4HKA A;  2UU9 T;  3M3Z B;  4ISS A;  2XHE B;  2ZLY A;  2V7M A;  1UUS A;  2XAH B;  4UVC B;  3RX6 A;  4IRE A;  2CCQ A;  4TV8 E;  2VQF T;  4GYR A;  1YD8 G;  3Q2M A;  3AA7 B;  3DJB A;  2ACZ A;  2MAW A;  4ZZB A;  5AFU L;  1HX8 A;  4DR3 T;  2LSY A;  3NRX A;  3PDY A;  3QB5 K;  1FIO A;  1FMV A;  2VVS A;  3I9W A;  3BQL A;  4TNV A;  1E2A A;  4HFH A;  3GWH A;  4H9N C;  1J1J A;  1S35 A;  4IE7 A;  2UUC T;  4U31 A;  4MFR A;  5JRC A;  3RKG A;  4PJL A;  4DR1 T;  1IAP A;  3ZYM A;  3AAE B;  4X66 T;  4UXN B;  3RIF A;  3SRZ A;  3IA3 A;  1OED B;  4BJN A;  1JNR A;  1OWA A;  3CK6 A;  4ZHQ E;  4ERR A;  3RPU A;  2X51 A;  2IC6 A;  2X9W A;  1IBK T;  1FJG T;  4HWF A;  2NTX A;  4P0B A;  5KMG P;  3VKH A;  1I94 T;  4X64 T;  4HFV A;  4QXB B;  2WWU A;  3OKQ A;  5BMV E;  3ZCI A;  2BKP A;  3A8Y C;  3C51 A;  4MHC A;  3LJC A;  3RYH E;  3Q9D A;  1LVK A;  3RQU A;  1BR2 A;  3NZP A;  3VU7 H;  1UK5 A;  4NIQ A;  2WWV A;  4HWD A;  3HL6 A;  2W0G A;  2YDS A;  2IIU A;  2LEH A;  4P0A A;  3CQX C;  4DO0 A;  4KBM B;  3WAJ A;  3K3Q C;  3D0T A;  2BG9 A;  4WZX A;  1HFA A;  3KVA A;  2LLY A;  4YTP A;  4DR4 T;  1XWM A;  3JAF A;  1WFD A;  4NXN T;  4DV5 T;  3TLW A;  4EV6 A;  4COF A;  4EED A;  2WDR A;  3SFE A;  1XDP A;  4X5T A;  2V7I A;  2N1G A;  2M6I A;  1FMW A;  4KMC A;  3MAC A;  3FB2 A;  4HN9 A;  4B3M T;  2H7O A;  2JIW A;  5L3G B;  3NKZ A;  2VK9 A;  2NW7 A;  2XAG B;  5J0Z A;  2KT9 A;  5JDG A;  4JUY A;  5IHY A;  1HTJ F;  2BG9 E;  1D1A A;  4U2Z A;  4A56 A;  2XQY A;  2CHO A;  3C4Z A;  4YHH T;  1BR4 A;  1MMG A;  2UXD T;  5AQN B;  4ILU A;  5FXV A;  2J62 A;  3ANW A;  3KBT A;  5JDF A;  3B5M A;  3RH3 A;  4DV6 T;  3S4U A;  2RP4 A;  2ZM0 A;  2VVN A;  4DV2 T;  1N36 T;  2CXF A;  2UXC T;  3JAE A;  2MTQ A;  1MMD A;  1NAF A;  1EZ3 A;  3E08 A;  3H3A A;  3VR9 A;  4Z91 A;  3KV5 A;  2I6H A;  1NWM X;  2XAS B;  3FZL B;  4TN7 B;  2OV9 A;  1HNW T;  3RHW A;  3PUX F;  1N34 T;  3RIA A;  4DUZ T;  4JI4 T;  4IE6 A;  3OPC A;  3KIN B;  2E9X A;  3N2O A;  3RC3 A;  1UCU A;  3ONJ A;  5EK4 A;  4KUM B;  4OYK A;  1YW0 A;  1MMA A;  3R84 B;  3V5S A;  2BG9 C;  2NOX A;  5FL1 A;  4GK5 E;  3G06 A;  3O1J A;  4DID B;  3C4X A;  4B6X A;  2WB5 A;  4IDZ A;  1WRD A;  5E0O A;  4K0K T;  1WR0 A;  4KP3 C;  2VB6 A;  2V6Y B;  2XQ6 A;  5C8Y E;  4XAX B;  3VRA A;  4JI6 T;  4E7S A;  1W0B A;  1XMO T;  3ZMU B;  5AQL B;  3PUS A;  2W00 A;  2QVA A;  2XAJ B;  5FKY A;  1BR1 A;  1MNE A;  3PUY F;  5CA1 E;  4UIG A;  3HKE E;  3LFM A;  3EI0 A;  2E2A A;  5LMU T;  3SS1 A;  2EHO A;  1YKH B;  1WYB A;  1U5P A;  2LSK A;  2D0T A;  1X9B A;  5HEH A;  2BBJ A;  1N33 T;  2Y6X A;  3BK9 A;  2VAS A;  3KFW X;  3VHL A;  2QYW A;  2C5J A;  1MIW A;  3L39 A;  4QKN A;  2XQ7 A;  3OYX A;  3AE1 A;  4X20 E;  2CM0 A;  3TLV A;  3CQC B;  4ZS2 A;  1ZKE A;  1LRZ A;  3ONL C;  5FMN A;  5HEO A;  1T7S A;  3EVY A;  4UF0 B;  1Y01 A;  3GN5 B;  2C5K T;  2RA1 A;  2WMO A;  2YDQ A;  5HWY A;  3R6N A;  1IBL T;  2JQK A;  2UXX B;  2LSJ A;  2IAK A;  1D0Z A;  2HH7 A;  2AE9 A;  5JDM A;  4CI3 B;  4DR2 T;  4ZS3 A;  2K5B B;  2WCA A;  2W62 A;  3VR8 A;  4EYU A;  3AEF A;  3Q5D A;  3UFG A;  4DVD A;  1DU2 A;  4EGW A;  5AQJ B;  3W15 B;  4TWD A;  3MKD A;  1HF8 A;  3K8P C;  2E9X C;  2YEV C;  1KNP A;  2WS3 A;  3E22 E;  3WI3 A;  4YY3 T;  3ZJ1 A;  1IBM T;  2V26 A;  2HPL A;  3C64 A;  2OLT A;  3ZT5 A;  2ZM8 A;  5LB7 B;  3AE3 A;  4IL9 A;  3EAB A;  4HTE A;  3ZPO A;  4AIU A;  3LK3 B;  3C4W A;  4DV1 T;  4H9P C;  2CE7 A;  3N2K E;  2JQ9 A;  2A2F X;  4V1A v;  2ACX A;  1OED A;  3RIU A;  4EOZ B;  3AXJ B;  5C2T A;  5L3D B;  2X0Y A;  3UFE A;  5ABE A;  2IUB A;  1ZP0 A;  2ES0 A;  2MYS A;  4UVA B;  4HFI A;  5HEG A;  2LHN A;  5LHI B;  4YTN A;  2H88 A;  3TLT A;  5LOV E;  3P8C D;  2LKH A;  3N9P A;  4UEM A;  3UT5 E;  1QSD A;  2XZE A;  2EHO C;  3JAD A;  3MJX A;  3I1A A;  1UUR A;  3UU8 A;  5AQM B;  5A1L A;  5HXH A;  3PE0 A;  3HKC E;  5LYJ E;  4JI5 T;  2BVM A;  4I50 E;  4Z90 A;  3KV9 A;  5JH7 E;  1XDO A;  5HXC A;  3X1D A;  5LGT B;  3LK2 B;  4WBN E;  3HKB E;  3N9O A;  4NPP A;  1OED E;  3N2G E;  5CFB A;  4EZ4 A;  1XNQ T;  3OBV E;  4DBR A;  4WBO A;  2NTY A;  3N9N A;  3PUA A;  2XSA A;  4YSZ A;  5JVD E;  4DV0 T;  3IEE A;  2XJ7 A;  2DL1 A;  3EDU A;  4LFA T;  2P9B A;  2JRK A;  3B57 A;  2Q9Q B;  3ZMT B;  1KK7 A;  5ABH A;  4UEL A;  1ZEE A;  4ZOL E;  3IF8 B;  1HCI A;  5DQV A;  2WQY A;  5F8P A;  2IW5 B;  5JTG A;  4JI1 T;  4G63 A;  3ABV A;  3ZC1 A;  2VWA A;  2BS3 A;  2PFV A;  4OK0 A;  3ZYK A;  3UUL A;  4ZEY A;  3ZCJ A;  5LGN B;  2N2N A;  4KI0 F;  4M1P A;  5FXW A;  2NW9 A;  2UXN B;  5ABF A;  1S94 A;  3O4X E;  3ONX A;  3P4R A;  3VKG A;  3H37 A;  5EK2 A;  4O2A E;  3GA8 A;  2CBJ A;  1OED C;  3KDS E;  3RIU C;  2XSB A;  3UUX B;  1J5E T;  5LCY A;  4PFP A;  3KBU A;  2W63 A;  3I9Y A;  3ZN0 B;  3ZKR A;  5LG3 A;  2ODU A;  3QUJ A;  1US7 B;  2VKD A;  3CPZ A;  4IDQ A;  2D2S A;  2B1E A;  4B3T T;  2C5I T;  4HGA A;  3FXE B;  4C90 A;  2Q9Q D;  3QNU A;  4QH5 A;  3LSV A;  5FXZ A;  2ZM2 A;  4U2Y A;  3SOL A;  4FJO A;  1XZY A;  3UUB A;  3FZM B;  2CPT A;  4F6R C;  2QGS A;  3P7I A;  3JC6 D;  2XM1 A;  3RYI E;  3RI5 A;  5AQK B;  2XUE A;  2DNX A;  4PJN A;  2ZMA A;  2X9Y A;  4PAG A;  3AEA A;  2CWY A;  5JRE A;  3HA4 A;  4KX6 A;  2BDE A;  2V1D B;  2A9U A;  1M7K A;  3PUG A;  4IDP A;  1IJ5 A;  2VL0 A;  4ZXL A;  5DQW A;  4NUV A;  1Z0P A;  4U72 A;  2QRX A;  2VQE T;  4LF5 T;  4QHO A;  2VUR A;  4GIW A;  2CBI A;  2D0U A;  2D9D A;  4LF4 T;  4O4L E;  4CN6 A;  4JI8 T;  1WYC A;  4X65 T;  4QX8 B;  2W4X A;  5HXS A;  3CIR A;  2BS2 A;  2VKO A;  5IYZ E;  5HXR A;  5H6R B;  2FJE A;  4CN1 A;  2YIN A;  2JJ9 A;  1T98 A;  4HFC A;  3RRC A;  2X0L B;  2RPA A;  1HNX T;  1HG5 A;  3AEG A;  5L47 A;  1ZV4 X;  5LBQ B;  5F5W A;  1Z8U A;  2R6G F;  3A5X A;  4GOU A;  4OHF A;  1KNZ A;  2B76 A;  5JR9 A;  1NEK A;  5IUX A;  5LJM A;  2LSI A;  2H7V C;  3LBX B;  2H89 A;  3BQI A;  2LRK A;  2XM2 A;  5JRC B;  3ETU A;  4EZH A;  5LP6 E;  3DTO A;  1HNZ T;  3ZLI A;  2X0H A;  3O9X A;  4EEB A;  2WBL A;  3GN5 A;  4L9I A;  3EHZ A;  2V7K A;  2M67 A;  1SE7 A;  4AKR B;  1X79 A;  5L4H A;  1QUU A;  3HI2 A;  2WDV A;  3CVR A;  4YFS A;  4UVB B;  4CI2 B;  3F57 A;  3UU5 A;  2VKH A;  5L3C B;  3K3O A;  3CX8 B;  2WP9 A;  4CXX A;  4Z8X A;  3AE4 A;  4HWC A;  4HFE A;  4WW0 A;  5HEU A;  4ZI3 C;  1KNR A;  2V7L A;  2JQH A;  4IHJ E;  2X9X A;  1SUM B;  5IWA T;  5J2T E;  1YKE B;  4U7I A;  3IBP A;  4CXY A;  3KV4 A;  5HEJ A;  5JDL A;  4IE5 A;  4ZI7 E;  3MK7 C;  4CI1 B;  5KXJ A;  3P4Q A;  2I0M A;  5TAO A;  3FZF B;  2W67 A;  2XQ9 A;  4WYV A;  3EUH A;  3RLF F;  1V9D A;  4B3R T;  2PTF A;  2W2U A;  4H9R C;  3C98 B;  4EYY R;  4JYA T;  4BA9 A;  2MPK A;  4LF9 T;  2FJB A;  3AXJ A;  4IT4 A;  2UXB T;  4YJ3 E;  4TWH A;  3C50 A;  3GMI A;  2PG8 A;  2BG9 B;  3O1I A;  1IZN B;  2A3D A;  4LF6 T;  4QH1 A;  3NZQ A;  3J7Y q;  5ABG A;  2LE8 A;  3UUN A;  3T1H T;  5AQG B;  5EK3 A;  2UUB T;  1BR0 A;  5HXE A;  5JR9 C;  4TNW A;  4TZ4 C;  3FBL A;  1LVF A;  3SWH A;  3UU6 A;  3N5L A;  2LM2 A;  3KVB A;  2HN2 A;  2AXD S;  2UUA T;  2LM9 A;  2DWG A;  4JV5 T;  4IST A;  2E5L T;  5LJN A;  3AAA B;  4K0U A;  2V5C A;  3QOF A;  4PK5 A;  4DND A;  1MMN A;  1R8I A;  4DMV A;  2LOP A;  4IE0 A;  4MBQ A;  3AE8 A;  4H9S E;  2E5V A;  5DAB A;  5L3B B;  3MZK B;  5H6Q B;  3BQK A;  4CN4 A;  4AKI A;  2WSS V;  1T72 A;  3L3P A;  1D0Y A;  3P4S A;  4A97 A;  4TV9 E;  3MXZ A;  3F2E A;  1D0X A;  5AQO B;  4LML A;  1YXR A;  4HEA A;  2F4V T;  3PUW F;  5AQH B;  4ZI2 C;  5JDN A;  4GYS A;  2V6X A;  3TLU A;  3AE5 A;  2YU2 A;  4ILB A;  4JBW F;  2YKS A;  2CXD A;  4QWN B;  4JI0 T;  3RRW A;  2JMK A;  4OYJ A;  5HAX A;  4DR7 T;  4PNI A;  1VOM A;  3ZMZ B;  1VCT A;  2WMN A;  2E9X B;  3AA6 B;  2NR4 A;  2CLY B;  3ZT7 A;  4IGU A;  3UQ7 A;  3OVU A;  2KSR A;  4LFC T;  4MAL A;  2N9D A;  2DI4 A;  1D1B A;  5LBM A;  2DLR A;  1SHZ C;  5ADX L;  3ZMV B;  2BBH A;  4BAY B;  2L3L A;  3ETV A;  2D5U A;  3PJA A;  2Z6E A;  3FZK B;  2NW8 A;  1CUN A;  5HWX A;  2MBG A;  4L0R A;  2KIN B;  4ANJ A;  1WR6 A;  3M65 A;  4DV7 T;  3AE2 A;  3T8O A;  2NP9 A;  5L2L A;  4E7Z A;  3PU8 A;  4QH4 A;  4AQF A;  4O4J E;  4ADZ A;  2EHO B;  4QXC B;  4ZZC A;  1MIY A;  1T8B A;  2V7J A;  4EB6 E;  5C3J A;  4GKJ T;  5L4E A;  5AQI B;  3LG7 A;  5JQG E;  3CML A;  2HN1 A;  2E9X D;  5CGM A;  4BJM A;  2XTL A;  4PJM A;  4I0U A;  1KF6 A;  3T1Y T;  4LF8 T;  3FXD B;  4QXH B;  3JC6 C;  2DWK A;  3RF1 A;  1IJ6 A;  2KMF A;  3EDV A;  4H63 V;  4YSY A;  2HPJ A;  4I43 B;  5JDQ A;  2BKO A;  2SPC A;  1GQE A;  1QLB A;  1NEN A;  4YT0 A;  4L5G A;  4YSX A;  1YQ3 A;  3DP7 A;  1ZHC A;  5LHG B;  2LKG A;  3PV0 F;  1JNZ A;  4EXT A;  3NRY A;  4G2A A;  2L8K A;  3ZC0 A;  2GK9 A;  4AQG A;  2WY2 A;  4IE4 A;  1WLX A;  2QA7 A;  2LT3 A;  3AE7 A;  4UV8 B;  3AVR A;  2KXP B;  3PUQ A;  4OX9 T;  3LK4 2;  2WM9 A;  3LBX A;  2EHO D;  3PUZ F;  4JEU B;  4IL4 A;  3B13 A;  1UX4 A;  2WU2 A;  1U4Q A;  1FEW A;  1MIV A;  1OXZ A;  4TWF A;  4F8H A;  3ZT6 A;  1YQ4 A;  2PJQ A;  3E0Z A;  2XQ8 A;  5LMN T;  4PJJ A;  4U7Y A;  2IML A;  5EZY E;  2DHR A;  3ZJ2 A;  1HG2 A;  3O1H A;  4HE8 A;  2FJA A;  5L3F B;  3UU3 A;  2WDQ A;  3A7M A;  2X67 A;  1W9R A;  2NWB A;  3L09 A;  2M6B A;  4AQF C;  4PK4 A;  4CXW A;  4LFB T;  2JPF A;  1W09 A;  4PK6 A;  1I6Z A;  4TX5 A;  4DR5 T;  4HFB A;  4KHP T;  3P50 A;  5LHH B;  3ZEF B;  3U3I A;  4H9Q C;  5FNV E;  2LHR A;  5AQF B;  3HR0 A;  2CHN A;  2JQQ A;  2BVL A;  4AI6 A;  3ZYL A;  5BR8 T;  2WAU A;  2XPK A;  2YOE A;  1ZOY A;  4IDN A;  3AAI A;  5AQQ B;  3WAK A;  4X1I E;  3OTO T;  2KND A;  2X68 A;  2FJD A;  1LKX A;  3AEB A;  3MA9 A;  2V6Y A;  3UQ4 A;  2K9A A;  2CMR A;  3AVS A;  5J1G A;  3NWI A;  3Q5X A;  4AQY T;  3PU3 A;  4J2C A;  4U74 A;  3RQW A;  1XMQ T;  4AKG A;  5FY7 A;  3RGL A;  4IIJ E;  2XAQ B;  1UX5 A;  1Y64 B;  2IDO B;  5LG4 A;  2CA5 A;  2K24 A;  5LNK A;  5CB4 E;  4XZC A;  3CX7 B;  4HWI B;  3VRB A;  2I59 A;  3QK6 A;  2A72 A;  4P1N A;  2KWH A;  1CHU A;  5ABF B;  3P4W A;  4YTM A;  5FP3 A;  3OJA A;  1E7P A;  2JMH A;  5F3J A;  4TUY E;  3H3M A;  2XQA A;  4JEH B;  4CZZ B;  2YDR A;  3QB5 A;  4NXM T;  5HCJ A;  3ZSS A;  4UF0 A;  4IDO A;  4X1Y E;  1B7T A;  2WZI A;  3AE9 A;  2J1D G;  5KDM C;  2KLQ A;  4JI3 T;  4I4T E;  4WNK A;  4HWH A;  1AJ3 A;  1MND A;  3K3N A;  3N9M A;  1HX1 B;  5FYM A;  2BS4 A;  5AQU B;  5LA6 E;  1KEY A;  4LMK A;  2VL8 A;  4KHZ F;  2X9H A;  3FHN A;  2W66 A;  3I0O A;  4AKH A;  2J47 A;  1W0A A;  4DV4 T;  4HFD A;  4LF7 T;  4JI7 T;  4ILA A;  4Q25 A;  2XAF B;  4X1K E;  5CJ5 A;  1VCS A;  2BZB A;  2CRB A;  3RC8 A;  1O3X A;  1WCR A;  4I55 E;  3NBX X;  2MOZ A;  2XQ4 A;  4ILC A;  2CXL A;  3UU4 A;  3U78 A;  3LDQ B;  4UR9 A;  2YU1 A;  4X62 T;  3PUV F;  4N78 D;  5FVK A;  4YHJ A;  5AQV B;  5AQR B;  3ZN1 B;  2K3W A;  2HHH T;  3ZST A;  1L0V A;  4GKK T;  2C0S A;  1HS7 A;  3ESL A;  4AXP A;  2V5D A;  2LOS A;  2L9Q A;  1G73 A;  3FZH B;  4MLK A;  2J4G A;  3IHR A;  4DBQ A;  5LXT E;  3ZMS B;  5JR9 B;  4U33 A;  4JI2 T;  2ZM6 T;  3AEC A;  2VKJ A;  2XQ5 A;  4P09 A;  3RYF E;  2PBI A;  3AB3 B;  3PTR B;  3F31 A;  2H3R A;  2LRL A;  3AA0 B;  4AIS A;  3AA1 B;  3AED A;  4C91 A;  2Q9Q A;  5AQS B;  4ZI3 D;  4ASK A;  3JCF A;  5CA0 E;  2KWI B;  4DV3 T;  3ANW B;  5FVL A;  4H9O C;  3I0Q A;  1M62 A;  4U3C A;  2CEA A;  4JLE A;  2X66 A;  2KZ7 B;  5KX5 E;  5ETW A;  2CWO A;  3KV6 A;  3UUM A;  3CX6 B;  5M4Y A;  5HCM A;  3RKO A;  5J2U E;  2G0U A;  4XBF B;  4O2B E;  2XQ3 A;  4H63 H;  3UTK A;  1XNR T;  2FUP A;  3AEE A;  3TLS A;  4LMJ A;  2YK0 A;  3AE6 A;  3N9L A;  5DJQ C;  1HR0 T;  4DUY T;  2CLY C;  4OFZ A;  3PJA J;  4DR6 T;  3CWZ B;  3Q5W A;  4O4H E;  2IHR 1;  2Y8D A;  4PW8 A;  4AKL A;  3QC9 A;  2YN6 A;  4EAH A;  1H7C A;  3EAM A;  3CQG B;  4YXD A;  2WU5 A;  3PUR A;  3K1S A;  4CQI A;  4FI5 A;  4DMW A;  2BKN A;  4GK0 E;  5FY0 A; 
#chains in the Genus database with same CATH homology
 2VB6 A;  3AVR A;  4UV8 B;  2Y48 B;  3N9Q A;  2KXP B;  3PUQ A;  5C8Y E;  4XAX B;  3RYC E;  5L3E B;  3V5U A;  3LK4 2;  5LBQ B;  2WM9 A;  3LBX A;  2EHO D;  4JEU B;  4E7S A;  3B13 A;  3A5X A;  3ZMU B;  5JDH A;  4GOU A;  4OHF A;  1KNZ A;  4UV9 B;  3PUS A;  5FY1 A;  2W00 A;  5JR9 A;  2ODV A;  1UX4 A;  1U4Q A;  2XAJ B;  5LJM A;  1BR1 A;  1FEW A;  2LSI A;  1MNE A;  1MIV A;  3TKL B;  1OXZ A;  5FXX A;  5CA1 E;  4UIG A;  2E8I A;  2H7V C;  2PJQ A;  3E0Z A;  3LBX B;  3HKE E;  2DCF A;  3BQI A;  3LFM A;  2W61 A;  4NUU A;  2IC9 A;  4YJ2 E;  5JRC B;  3SS1 A;  3ETU A;  4PJJ A;  5HYA A;  4O4I E;  2EHO A;  4EIW A;  1SA0 E;  1YKH B;  5EZY E;  2DHR A;  1WYB A;  4QX7 B;  5GON E;  1HG2 A;  3ZJ2 A;  4EZH A;  5LP6 E;  3O1H A;  4HE8 A;  1U5P A;  3DTO A;  2LSK A;  2K48 A;  2D0T A;  1E1H B;  5L3F B;  1G8X A;  4YLH A;  3ZLI A;  5LGU B;  1VRB A;  2Y6X A;  2X67 A;  2LJL A;  4PFO A;  3BK9 A;  2VAS A;  3FBZ A;  1D1C A;  3KFW X;  2LSG A;  3VHL A;  3HKD E;  3CKD A;  2C5J A;  2NWB A;  3L09 A;  2WBL A;  4O8S A;  1MIW A;  3J9X 1;  4AQF C;  3O9X A;  3GN5 A;  4QKN A;  4PK4 A;  4CXW A;  3OYX A;  4L9I A;  4ZI2 D;  2OA5 A;  2V7K A;  2JPF A;  2M67 A;  4PK6 A;  4X20 E;  4AKR B;  2CM0 A;  1X79 A;  4TX5 A;  3CQC B;  1QUU A;  2Q9Q C;  3OYZ A;  3HI2 A;  1ZKE A;  3CVR A;  1LRZ A;  4HKA A;  4ZS2 A;  5FMN A;  5LHH B;  4YFS A;  4UVB B;  4ISS A;  2XHE B;  3ZEF B;  4UF0 B;  3EVY A;  4CI2 B;  3F57 A;  3U3I A;  2ZLY A;  3GN5 B;  2V7M A;  2C5K T;  2RA1 A;  2WMO A;  4H9Q C;  2VKH A;  5L3C B;  5FNV E;  5HWY A;  2LHR A;  3R6N A;  3K3O A;  2UXX B;  3CX8 B;  3HR0 A;  4CXX A;  2LSJ A;  2XAH B;  2JQQ A;  2BVL A;  4AI6 A;  4Z8X A;  2IAK A;  4UVC B;  1D0Z A;  2HH7 A;  3ZYL A;  5JDM A;  4CI3 B;  4WW0 A;  3RX6 A;  2CCQ A;  4ZS3 A;  2K5B B;  2WAU A;  2W62 A;  4TV8 E;  4ZI3 C;  4EYU A;  2V7L A;  4DVD A;  4GYR A;  4IHJ E;  2X9X A;  1YD8 G;  3Q2M A;  3W15 B;  3AA7 B;  3DJB A;  5J2T E;  1YKE B;  3MKD A;  1HF8 A;  5AFU L;  3IBP A;  3K8P C;  4CXY A;  1HX8 A;  2E9X C;  3KV4 A;  3AAI A;  5JDL A;  3WAK A;  4IE5 A;  4X1I E;  2KND A;  2LSY A;  2X68 A;  2YEV C;  4ZI7 E;  3MK7 C;  3E22 E;  3NRX A;  4CI1 B;  1LKX A;  3WI3 A;  3MA9 A;  5TAO A;  3PDY A;  2K9A A;  3ZJ1 A;  3EUH A;  1FIO A;  2V26 A;  1V9D A;  2CMR A;  3AVS A;  5J1G A;  4H9R C;  1FMV A;  2HPL A;  3C98 B;  4EYY R;  3I9W A;  3C64 A;  3Q5X A;  3PU3 A;  4J2C A;  4BA9 A;  3BQL A;  4U74 A;  2ZM8 A;  4AKG A;  5FY7 A;  3GWH A;  4YJ3 E;  4IIJ E;  4H9N C;  3C50 A;  2XAQ B;  1S35 A;  3GMI A;  4HTE A;  3ZPO A;  1UX5 A;  3LK3 B;  3C4W A;  2PG8 A;  3O1I A;  1IZN B;  1Y64 B;  2A3D A;  4H9P C;  4IE7 A;  5LG4 A;  3NZQ A;  2CA5 A;  2CE7 A;  3N2K E;  3J7Y q;  2K24 A;  5LNK A;  2LE8 A;  2A2F X;  4V1A v;  3UUN A;  2ACX A;  5CB4 E;  4MFR A;  5JRC A;  4XZC A;  4EOZ B;  3CX7 B;  5EK3 A;  2I59 A;  4PJL A;  1BR0 A;  5HXE A;  5L3D B;  3UFE A;  3QK6 A;  5JR9 C;  1IAP A;  2A72 A;  3ZYM A;  3AAE B;  5FY0 A;  4UXN B;  2ES0 A;  2KWH A;  3SRZ A;  2MYS A;  4UVA B;  4TZ4 C;  2LHN A;  5LHI B;  3FBL A;  1LVF A;  5LOV E;  5FP3 A;  3OJA A;  3SWH A;  4BJN A;  3P8C D;  3N9P A;  2JMH A;  3N5L A;  5F3J A;  4TUY E;  1OWA A;  4UEM A;  3KVB A;  3UT5 E;  4JEH B;  4ZHQ E;  1QSD A;  2EHO C;  3MJX A;  4CZZ B;  4ERR A;  3I1A A;  5A1L A;  5HXH A;  3PE0 A;  3RPU A;  2LM9 A;  3HKC E;  2X51 A;  2IC6 A;  2X9W A;  5LYJ E;  2DWG A;  4IST A;  2BVM A;  4I50 E;  4UF0 A;  5LJN A;  3AAA B;  3KV9 A;  5JH7 E;  4K0U A;  5HXC A;  2NTX A;  4X1Y E;  4PK5 A;  4P0B A;  5LGT B;  5KMG P;  1B7T A;  3VKH A;  3LK2 B;  4DND A;  1MMN A;  4WBN E;  2J1D G;  3HKB E;  5KDM C;  4DMV A;  2KLQ A;  3N9O A;  4HFV A;  2LOP A;  3N2G E;  4IE0 A;  4MBQ A;  4I4T E;  4QXB B;  2WWU A;  3OKQ A;  4H9S E;  4WNK A;  4EZ4 A;  5BMV E;  3OBV E;  3ZCI A;  5DAB A;  4DBR A;  5L3B B;  1AJ3 A;  4WBO A;  3MZK B;  5H6Q B;  2NTY A;  3BQK A;  3C51 A;  1MND A;  3K3N A;  4MHC A;  4AKI A;  2WSS V;  3N9M A;  3N9N A;  3PUA A;  3LJC A;  3L3P A;  5FYM A;  5JVD E;  3RYH E;  1D0Y A;  3Q9D A;  4TV9 E;  1LVK A;  3IEE A;  3MXZ A;  5LA6 E;  3F2E A;  1D0X A;  1BR2 A;  3EDU A;  2P9B A;  3NZP A;  4HEA A;  3VU7 H;  2JRK A;  3B57 A;  2VL8 A;  4ZI2 C;  2Q9Q B;  5JDN A;  3HL6 A;  2X9H A;  3FHN A;  2W0G A;  4GYS A;  3ZMT B;  3I0O A;  4AKH A;  1KK7 A;  2LEH A;  4P0A A;  3CQX C;  4UEL A;  2YU2 A;  1ZEE A;  4DO0 A;  4KBM B;  4ZOL E;  3WAJ A;  3IF8 B;  2CXD A;  1HCI A;  5DQV A;  3K3Q C;  5F8P A;  4QWN B;  2IW5 B;  3D0T A;  3RRW A;  4G63 A;  1HFA A;  2XAF B;  3KVA A;  3ZC1 A;  2JMK A;  4OYJ A;  4X1K E;  5HAX A;  4PNI A;  2VWA A;  1VOM A;  2BZB A;  2PFV A;  3ZMZ B;  3RC8 A;  4OK0 A;  1O3X A;  4I55 E;  3ZYK A;  2WMN A;  3NBX X;  2E9X B;  2MOZ A;  3AA6 B;  3UUL A;  3ZCJ A;  5LGN B;  2CLY B;  2N2N A;  4M1P A;  5FXW A;  4IGU A;  2NW9 A;  2UXN B;  1S94 A;  2CXL A;  3O4X E;  3U78 A;  2V7I A;  3ONX A;  4MAL A;  2N1G A;  3VKG A;  3H37 A;  5EK2 A;  2YU1 A;  4O2A E;  2N9D A;  2DI4 A;  3GA8 A;  1D1B A;  3KDS E;  4N78 D;  3UUX B;  5LBM A;  5LCY A;  4YHJ A;  4PFP A;  2DLR A;  1FMW A;  1SHZ C;  4KMC A;  3KBU A;  2W63 A;  3MAC A;  3I9Y A;  3FB2 A;  4HN9 A;  3ZMV B;  3ZN1 B;  3ZN0 B;  5ADX L;  2H7O A;  5L3G B;  4BAY B;  2VK9 A;  2NW7 A;  2XAG B;  2ODU A;  2C0S A;  2KT9 A;  5JDG A;  1HS7 A;  2L3L A;  4JUY A;  5IHY A;  3QUJ A;  1US7 B;  3ESL A;  1HTJ F;  3ETV A;  2VKD A;  2D5U A;  4AXP A;  3CPZ A;  2D2S A;  2B1E A;  2LOS A;  1D1A A;  2L9Q A;  2Z6E A;  2C5I T;  4HGA A;  4A56 A;  2XQY A;  1G73 A;  2NW8 A;  1CUN A;  5HWX A;  4MLK A;  2MBG A;  3IHR A;  4DBQ A;  5LXT E;  3FXE B;  3ZMS B;  4C90 A;  4L0R A;  2KIN B;  2Q9Q D;  5JR9 B;  4ANJ A;  1WR6 A;  2VKJ A;  5FXZ A;  2ZM2 A;  3C4Z A;  3M65 A;  4P09 A;  3RYF E;  3SOL A;  4FJO A;  2PBI A;  1BR4 A;  1MMG A;  3T8O A;  3AB3 B;  2NP9 A;  3PTR B;  5L2L A;  4E7Z A;  3F31 A;  4ILU A;  3PU8 A;  5FXV A;  4AQF A;  2H3R A;  4F6R C;  2QGS A;  3P7I A;  3ANW A;  4O4J E;  3AA0 B;  3JC6 D;  4ADZ A;  2EHO B;  3KBT A;  5JDF A;  3RYI E;  4QXC B;  3RH3 A;  3AA1 B;  3S4U A;  1MIY A;  2XUE A;  4C91 A;  2Q9Q A;  2V7J A;  4ZI3 D;  2DNX A;  4EB6 E;  2RP4 A;  4ASK A;  4PJN A;  2ZM0 A;  5CA0 E;  2ZMA A;  2X9Y A;  2KWI B;  3LG7 A;  5JQG E;  2CXF A;  3CML A;  3ANW B;  4PAG A;  2MTQ A;  1MMD A;  1NAF A;  2CWY A;  2E9X D;  4H9O C;  5JRE A;  3I0Q A;  4BJM A;  1EZ3 A;  3E08 A;  3H3A A;  3HA4 A;  2CEA A;  2XTL A;  2BDE A;  2V1D B;  3KV5 A;  4JLE A;  1NWM X;  2XAS B;  4PJM A;  2X66 A;  2KZ7 B;  5KX5 E;  5ETW A;  4TN7 B;  2CWO A;  3PUG A;  3KV6 A;  1IJ5 A;  3UUM A;  3CX6 B;  5M4Y A;  3FXD B;  4QXH B;  3RKO A;  3JC6 C;  5J2U E;  2DWK A;  5DQW A;  1IJ6 A;  4NUV A;  2KMF A;  2G0U A;  1Z0P A;  4IE6 A;  4U72 A;  4XBF B;  3KIN B;  4O2B E;  3EDV A;  4H63 H;  3UTK A;  4H63 V;  2E9X A;  3N2O A;  3RC3 A;  1UCU A;  2HPJ A;  4QHO A;  2YK0 A;  4GIW A;  3N9L A;  4I43 B;  5JDQ A;  2D0U A;  2SPC A;  4KUM B;  5DJQ C;  4OYK A;  5EK4 A;  4O4L E;  1YW0 A;  1MMA A;  3R84 B;  1WYC A;  1ZV4 X;  3V5S A;  2CLY C;  4L5G A;  2NOX A;  4OFZ A;  4GK5 E;  4QX8 B;  3CWZ B;  3O1J A;  3Q5W A;  3DP7 A;  4O4H E;  2Y8D A;  3C4X A;  4B6X A;  5HXS A;  4PW8 A;  4AKL A;  1ZHC A;  4IDZ A;  3QC9 A;  4EAH A;  5LHG B;  1WRD A;  2VKO A;  5E0O A;  5H6R B;  5HXR A;  5IYZ E;  1H7C A;  3CQG B;  2YIN A;  4EXT A;  2JJ9 A;  3NRY A;  4G2A A;  2L8K A;  3ZC0 A;  1T98 A;  2GK9 A;  4AQG A;  4KP3 C;  3PUR A;  3RRC A;  2X0L B;  4CQI A;  4FI5 A;  4DMW A;  4GK0 E;  4IE4 A;  1HG5 A;  1WLX A;  2QA7 A;  2LT3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...