2LJLA

Nmr structure of hsp12 in the presence of dpc
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
109
structure length
109
Chain Sequence
b'MSDAGRKGFGEKASEALKPDSQKSYAEQGKEYITDKADKVAGKVQPEDNKGVFQGVHDSAEKGKDNAEGQGESLADQARDYMGAAKSKLNDAVEYVSGRVHGEEDPTKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 12 kDa heat shock protein
publication title Structural characterization of Hsp12, the heat shock protein from Saccharomyces cerevisiae, in aqueous solution where it is intrinsically disordered and in detergent micelles where it is locally alpha-helical.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 12
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2011-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04119 HSP9_HSP12 Heat shock protein 9/12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1260 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2ljlA01
2LJLA 2L9QA 4AXPA
chains in the Genus database with same CATH superfamily
2ODUA 1W0AA 3FZFB 5JR9A 4HFDA 3VKHA 2IC6A 4X65T 1LVFA 1NAFA 4MBQA 1LVKA 2OA5A 3AE1A 2FJBA 4C90A 2BS3A 3K3OA 3D0TA 3E08A 4X1YE 2V7LA 4GKKT 3CWZB 3AE4A 5AQKB 2QYWA 2JQ9A 5JDNA 5HWYA 4B3MT 2XAHB 3EABA 3JADA 2V1DB 4YSYA 1T7SA 4IE7A 3CK6A 3ZMZB 4JI7T 4QHOA 2V5CA 2XQ8A 3AE7A 1WCRA 2AE9A 2HN2A 3JCFA 2W67A 4YHHT 4HFBA 4UV8B 1YKEB 2CHNA 1YXRA 4OYJA 4DR4T 3EI0A 4B6XA 2CXFA 2Y8DA 4LF7T 4K0UA 4JI6T 2XM2A 3DP7A 5C3JA 2CXDA 4LF6T 4QX7B 5HAXA 2XUEA 2E2AA 2D0UA 4QKNA 4HFCA 3SFDA 2CWYA 3NKZA 2WMOA 2BVLA 1IJ6A 3NWIA 1LRZA 5JREA 3GN5B 4TV9E 4DBRA 3MXZA 4N78D 2N2NA 3C4WA 2B1EA 5HCMA 3RX6A 4IHJE 2UUAT 2XSAA 4NXNT 5AQIB 3BQLA 2WU5A 5AQHB 2K24A 3KDSE 4LFAT 1KNRA 5LMUT 3VHLA 3AEFA 5TAOA 3MACA 1J5ET 2WS3A 4ILUA 4YTPA 2DLRA 1EZ3A 3HI2A 5HEUA 2DWKA 3A5XA 3AXJB 1VCTA 5L4EA 3RC8A 2QGSA 3ZT5A 3PUXF 4XBFB 2BZBA 3HKBE 3L09A 1CUNA 3N2OA 2ACXA 3FZKB 3KBTA 3ZT7A 3LDQB 2LM9A 4HWHA 3AEBA 5KXJA 4IDPA 3J9X1 3OYXA 5CB4E 2JQKA 3PUQA 3H3MA 3QB5A 2W2UA 1T72A 3AE6A 3CX7B 3C50A 1FEWA 1M62A 1HX1B 3KV6A 1UGOA 1Y01A 3RGLA 4EGWA 4K0KT 3FB2A 3I9YA 3PUVF 2H89A 2XY8B 4PFPA 2K9AA 5HXHA 2XQ7A 2ZM8A 3RH3A 1FMWA 4GOUA 5HXRA 2I59A 2X9YA 3PUGA 4DMWA 1HFAA 4JI0T 2Q9QA 2J4GA 4XZCA 2WWUA 2MTQA 5HXCA 4X20E 1QUUA 3O4XE 3AA7B 2X66A 3GWHA 2FUPA 4ZZBA 2G0UA 1YQ4A 3JC6C 5LBMA 3NBXX 2BDEA 2WP9A 4DR6T 2XPKA 2KNDA 2A2FX 4ASKA 5JDGA 4U31A 3RIUC 5C2TA 3PUYF 3O1IA 4I55E 5L3EB 2WCAA 2UUBT 2YK0A 1HS7A 4EIWA 3ANWA 3V5SA 1AJ3A 3QC9A 3RYIE 5FXWA 3ZT6A 2ACZA 2YOEA 1D1BA 2PBIA 1MMGA 2CA5A 2CHOA 2I0MA 4ERRA 1N34T 4LF5T 5LMNT 5HXSA 2CLYC 3FHNA 3H37A 2EHOB 3FBZA 4X62T 3GA8A 2CXLA 2V5DA 3MA9A 5LHHB 5AQFB 3LBXA 4COFA 4QH4A 3JC6D 2LJLA 5FY1A 4DV7T 2DL1A 4QXCB 2VQET 1WR6A 2W63A 4KHZF 3Q5EA 2HHHT 1FIOA 3TLVA 3TLWA 3RF1A 1VRBA 1Y64B 2MYSA 5LGUB 1MNDA 4IREA 5LHIB 3ESLA 4HWDA 5JR9B 1MIWA 3UUBA 1IZNB 3P50A 1XZYA 4OX9T 2IAKA 3J7Yq 5L3FB 4F6RC 1LKXA 1D1CA 5LP6E 4UXNB 2XQAA 4YSXA 2CBIA 4H63V 3RQUA 5CFBA 4L5GA 3VRBA 3IHRA 5AQQB 2LM2A 1X9BA 5JDMA 5L3DB 4KUMB 5JDFA 3RC3A 3QNUA 4DMVA 1D0ZA 1W0BA 4X64T 4AQGA 3ZYLA 1MIVA 4QX8B 5FMNA 2XSBA 4HKAA 1N33T 5L2LA 3SOLA 2UXCT 3RIFA 2HH7A 2KWHA 2YU2A 2W61A 5AQTB 3M65A 3AA6B 3F2EA 5C8YE 1I6ZA 3WAJA 1MIYA 1D0XA 3L39A 4DIDB 4HTEA 3I1AA 3AE8A 3UU5A 4NXMT 2QA7A 4EAHA 4GK0E 3HKDE 4PK6A 3X1DA 3ETUA 5ETWA 2XAJB 4WW0A 2F4VT 4O2AE 1D1AA 1MMDA 4DV3T 4U7IA 5F5WA 3N9LA 4KBMB 2B76A 2GK9A 5IYZE 4I0UA 4ZI3C 2H7OA 3AEAA 2VWAA 4HFHA 2ODVA 3RYCE 1UX4A 2D0TA 3O1JA 4PNIA 2C0SA 5AQVB 4M1PA 1WYBA 2ES0A 4HWFA 2IIUA 3BQKA 2BG9E 5JH7E 1V9DA 5F8PA 4ILBA 2E9XD 3CQGB 4HWIB 5CJ5A 3PV0F 1G8XA 3CQCB 4ZI2C 1T8BA 3LK42 3VKGA 1U4QA 5AQGB 1OWAA 4YJ2E 1OXZA 2W66A 2NW8A 4ISTA 1NWMX 2CE7A 5E0OA 2V7KA 2YDRA 4AQYT 3AAIA 4YT0A 2EHOC 4ZHQE 3JAFA 5LOVE 2H3RA 4DR2T 1S94A 3EUHA 2H88A 5EZYE 1BR4A 5FXZA 2LEHA 3CX8B 3UUMA 2RA1A 4X1IE 5DABA 3ZJ1A 4PJNA 5HEHA 4LMJA 2JJ9A 4IL9A 4JI2T 3ONLC 1YKHB 4P0BA 5HWXA 2UXDT 2LHRA 3F57A 4A56A 4O2BE 3RRWA 2VKDA 1N36T 3U3IA 4HFIA 4Q25A 2KLQA 4WYVA 3UFGA 1WFDA 5JR9C 3ABVA 3ZLIA 1UUSA 4WNKA 2IUBA 4QXHB 5LBQB 2LSYA 2QVAA 2WY2A 2DI4A 4ZI2D 5J2TE 1MMAA 3UQ7A 3RPUA 3L3PA 4YTNA 2RPAA 3TLTA 3RIAA 4CN1A 5AQSB 4CQIA 4Z8XA 1L0VA 3SRZA 4DR1T 2ZM2A 2ZM6T 2VVNA 1KFYA 1HNWT 2M6IA 3LFMA 1YW0A 1XNRT 1FMVA 4EEBA 4PJMA 3N2KE 3UU3A 2Q9QB 3RRCA 3OTOT 2UU9T 3Q5WA 3AB3B 4IDOA 4HWCA 5HEOA 2VASA 4HFEA 4YXDA 2VQFT 3H3AA 1HNXT 2M6BA 4WBOA 2MBGA 3ONXA 5CA0E 4UVBB 5AFUL 2Y6XA 3RQWA 3Q5DA 2CBJA 4QWNB 4BAYB 3PU8A 3ANWB 4U2ZA 4PAGA 5FNVE 3ZYKA 3UFEA 2LOSA 3RYHE 2XQ4A 4B3RT 3OVUA 4AKLA 2V26A 2DNXA 2OV9A 4H9OC 2BS4A 1QLBA 5GONE 1BR0A 4IIJE 3IBPA 2BKPA 3S4UA 2VB6A 3N2GE 4GYRA 4KI0F 4UF0A 3CX6B 3N9PA 2JQHA 3LBXB 2XQ6A 2JRKA 2UXXB 2HPJA 2XAGB 4JUYA 4CI3B 4E7SA 2UUCT 3SWHA 4IE0A 5JVDE 5LYJE 3TKLB 5L3CB 2FJEA 1E7PA 2BS2A 1OEDC 5J2UE 2XTLA 5AQMB 5JDHA 4LMLA 4G63A 2JMKA 2X0HA 3DTOA 3KV4A 4A5XA 2JIWA 4TX5A 3VR8A 2YN6A 2Z6EA 2L3LA 3MKDA 1HG2A 2W0GA 3SS1A 3K3QC 3T1HT 3UQ4A 4TNVA 3UT5E 2A3DA 3WI3A 3Q9DA 2VURA 3ZYMA 2WU2A 2H7VC 3AEDA 4KX6A 4YFSA 2DWGA 5FXXA 3I0QA 4X66T 2JMHA 4OK0A 3O1HA 4B3TT 5FL0A 4CN4A 1VOMA 4Z90A 4JI3T 5BR8T 4I50E 2WB5A 5AQUB 3R84B 3K3NA 4NPPA 5FVKA 2D2SA 4X5TA 3EDUA 2LSGA 3W15B 2BG9A 2VKHA 4TWHA 4IDZA 2LE8A 3N9NA 4B3ST 3LJCA 2XZEA 3E0ZA 4U7YA 3QK6A 2V6YA 2YINA 1IBLT 3QOFA 2N1GA 5AQPB 4ZI7E 4WZXA 2PJQA 4U74A 4IE6A 5A1LA 2NWBA 2HPLA 4TV8E 2X0YA 3Q2MA 4DR5T 2KT9A 3IEEA 4U2YA 2BVMA 2QRXA 2NP9A 3P4WA 3A7MA 1ZHCA 2VK9A 4MFRA 5EK2A 4FI5A 5L47A 2NTYA 3AAEB 1KF6A 3AA1B 4DV6T 4NIQA 1ZP0A 3MJXA 4DV1T 2DHRA 4AKGA 4ILCA 2KINB 1HTJF 3P4QA 1HR0T 4PFOA 3BK9A 1U5PA 5EK4A 2LLYA 4U3CA 4Z91A 2KSRA 5ABEA 4O8SA 4H9RC 4O4HE 3ZC0A 4JI1T 3UU6A 3RKOA 3LK2B 3ZJ2A 1N32T 4HE8A 3PURA 3KV5A 5DQVA 4TWDA 4BA9A 3HL6A 3ZSSA 2XAFB 4JEUB 3ZPOA 3ZSTA 5AQLB 4AKIA 4XAXB 2X67A 3FZHB 3PDYA 5LG4A 2XQ3A 4IDQA 2W00A 2WBLA 4JYAT 2K48A 2OLTA 4KMCA 1YQ3A 5JQGE 5FVLA 2WWVA 1HG5A 2LT3A 3EAMA 4KHPT 4QXBB 2IW5B 4JI5T 3BQIA 3OPCA 2E9XA 3N5LA 3B5MA 3FXDB 1W09A 3FBLA 1CHUA 3KFWX 2KMFA 2KXPB 4LF8T 1BR1A 2WDRA 4AQFC 2XJ7A 2W62A 4EZ4A 2K3WA 2XAQB 2XASB 4P09A 3R6NA 3KVBA 4DV2T 3ZMSB 4GIWA 2BBJA 2LSJA 3V5UA 3P4SA 2YU1A 5ABFA 3MK7C 2V7JA 4MALA 5LG3A 5FKYA 5HYAA 3AE9A 1KNPA 3PJAJ 4DV4T 2PG8A 5BMVE 3MZKB 5LJMA 4HEAA 4ILAA 4LFBT 3K8PC 3RKGA 3N9OA 1MMNA 4AI6A 4YHJA 3AEGA 4GYSA 5JDLA 2LKGA 4MHCA 5FY7A 4PJJA 1O3XA 2YDQA 3ZKRA 4JBWF 5AQJB 3PUZF 2NTXA 2FJDA 1XDPA 4PW8A 3QB5K 4IDNA 3FZLB 2LRLA 2SPCA 1B7TA 3O9XA 2WDQA 2XQ9A 5LGNB 1E2AA 4UF0B 5LB7B 5LHGB 2HN1A 4LF4T 4GKJT 2R6GF 3C98B 5FXVA 2CWOA 1XNQT 1FJGT 4F8HA 4DR3T 2L9QA 4A98A 1WRDA 2FJAA 2E5VA 3VRAA 5M4YA 5EK3A 2ZMAA 4MLKA 4ZI3D 5FYMA 4TWFA 5H6QB 2Y48B 4H9NC 4UEMA 2X9HA 4L0RA 4TZ4C 4IL4A 2ZM0A 1UK5A 2C5IT 3VU7H 4HN9A 3WAKA 5IUXA 2VKOA 3HKEE 3ETVA 2V8SV 3HR0A 2WAUA 2RP4A 3ONJA 4LF9T 1R8IA 3PTRB 4TNWA 5J0ZA 2LSIA 2CMRA 2KWIB 3QUJA 2NOXA 2V7IA 3F31A 3AVRA 2EHOD 1HCIA 4H63H 4YLHA 2XQ5A 3DJBA 5F3JA 1KK7A 1J5WA 2BBHA 1GQEA 3CQXC 4BJMA 2LHNA 2BG9B 3KINB 5HXEA 4DBQA 2CCQA 2N9DA 2X0LB 3JAEA 3RLFF 3ZMVB 1UX5A 1Z0PA 3L8RA 2NW9A 2C5JA 4E7ZA 2V6YB 3KVAA 3TLSA 3IF8B 5LXTE 1M7KA 5JRCA 5J1GA 4G2AA 2E8IA 2IHR1 2E5LT 3PUSA 2JPFA 2XQYA 2W4XA 1KNZA 4JEHB 3N9MA 1XMQT 4AKHA 2CLYB 2X51A 4DO0A 4EYYR 3B57A 2XHEB 3OBVE 3N9QA 5LA6E 2X9WA 3Q5XA 4CI2B 2IC9A 4HGAA 1WYCA 4AKRB 1JNZA 4UV9B 3PUAA 4AIUA 4DV0T 4UIGA 4IE4A 2XM1A 5DJQC 4HFVA 1SE7A 4I43B 2J1DG 5IWAT 4AISA 5H6RB 1OEDA 2DCFA 4JI4T 4O4LE 2YEVC 4P0AA 3UTKA 3PJAA 4DUZT 2CM0A 5FP3A 3NRYA 1XWMA 3CVRA 2V7MA 3UULA 5ABGA 4V1Av 4DNDA 4EYUA 5LJNA 4CN6A 3P7IA 1NEKA 1WR0A 1VCSA 2LOPA 3AE2A 4UR9A 4UVAB 1IBKT 4EXTA 4PJLA 2VL8A 3I9WA 2LRKA 1SA0E 1SUMB 3AAAB 1ZV4X 3ZN0B 4ZS2A 2VKJA 3RHWA 4OFZA 5FL1A 3C51A 4O4IE 3ZEFB 3OJAA 2IDOB 3ZCIA 2E9XB 3HKCE 4GK5E 4DUYT 3K1SA 1I94T 5CGMA 5JTGA 2YDSA 1ZEEA 3ZN1B 1HF8A 4C91A 3FXEB 3G06A 1T98A 3CMLA 5ABHA 2VVSA 2WM9A 3E22E 4CI1B 4EOZB 5KMGP 1G73A 4H9PC 3LK3B 5HCJA 4U33A 2A72A 3RIUA 5AQNB 4L9IA 4I4TE 4DV5T 2WMNA 5AQOB 2WDVA 4EB6E 2X68A 3OYZA 5ABFB 2KZ7B 1HX8A 2LKHA 1WLXA 3A8YC 1YD8G 2MPKA 3M3ZB 2Q9QC 4ADZA 4DR7T 3B13A 3P4RA 4EEDA 3LSVA 2BG9C 4AXPA 2I6HA 4J2CA 3U78A 2L8KA 1ZOYA 1BR2A 3AVSA 5FY0A 4LFCT 3CKDA 5L4HA 3GN5A 1DU2A 2UXNB 4EZHA 2K5BB 3RYFE 1MNEA 3NZQA 4JLEA 1ZKEA 3P8CD 4H9SE 3SFEA 3KV9A 2AXDS 4JV5T 2JQQA 3OKQA 4PK4A 5HEJA 2X9XA 5LGTB 1XMOT 3I0OA 2WZIA 1W9RA 4U72A 2V6XA 1JNRA 5LNKA 4DVDA 2IMLA 3AXJA 4CXYA 4LMKA 3ZC1A 2Q9QD 2M67A 4P1NA 3NRXA 4OHFA 4BJNA 3PE0A 3PU3A 1E1HB 1IBMT 4UELA 5AQRB 4CXWA 1NENA 1IAPA 4CZZB 1QSDA 4YTMA 3EVYA 5L3GB 4ZXLA 4ZS3A 2ZLYA 3UUNA 3LG7A 4YY3T 1H7CA 5IHYA 3AE5A 4ZOLE 1OEDE 1Z8UA 3AA0B 2UXBT 3KBUA 5JDQA 3P4PA 4TN7B 1J1JA 1UCUA 4AQFA 5KX5E 1SHZC 2D9DA 4H9QC 2CRBA 3NVOA 3ZMUB 4O4JE 3GMIA 2MAWA 4YJ3E 5HEGA 4ISSA 2YKSA 2NR4A 3C4ZA 3AE3A 2WQYA 2VL0A 2E9XC 3IA3A 4JI8T 2FBWA 2CEAA 3UU4A 5DQWA 1XDOA 4ZZCA 4QH5A 2J47A 2J62A 3NZPA 4NUVA 3C4XA 4OYKA 3AEEA 3EDVA 1S35A 3TLUA 4KP3C 2CPTA 4IGUA 3HA4A 4A97A 3CIRA 4PK5A 4YSZA 5JRCB 5KDMC 3PUWF 3T8OA 5LCYA 2PFVA 4WBNE 3FZMB 3AECA 2MOZA 3C64A 1HNZT 3UUXB 4X1KE 1UURA 4EV6A 2BKOA 5ADXL 3VR9A 4CXXA 2PTFA 4IE5A 4ZEYA 4UVCB 2D5UA 2A9UA 4TUYE 2BKNA 4ANJA 5CA1E 1D0YA 2LSKA 3CPZA 4FJOA 2WZHA 2C5KT 2EHOA 3ZMTB 3T1YT 1US7B 4QH1A 1X79A 1OEDB 4IT4A 1KEYA 2P9BA 5L3BB 2WSSV 3UU8A 3ZCJA 2NW7A 1IJ5A 4NUUA 3RI5A 3EHZA
chains in the Genus database with same CATH topology
4IE4A 3ZYLA 1MIVA 2ODUA 3QK6A 5JR9A 2YINA 4QX8B 5DJQC 4HFVA 2N1GA 5FMNA 4HKAA 4I43B 3VKHA 2IC6A 2J1DG 5L2LA 1LVFA 1NAFA 4ZI7E 3SOLA 4MBQA 5H6RB 2PJQA 2HH7A 2KWHA 1LVKA 2YU2A 2W61A 4U74A 4IE6A 2OA5A 5A1LA 2DCFA 3M65A 2NWBA 2HPLA 4TV8E 3AA6B 3F2EA 4O4LE 2YEVC 3Q2MA 4P0AA 5C8YE 4C90A 3UTKA 3WAJA 2CM0A 3K3OA 1MIYA 5FP3A 3D0TA 1D0XA 2KT9A 3NRYA 3IEEA 3E08A 4X1YE 3CVRA 2BVMA 2V7LA 4HTEA 3I1AA 2V7MA 3CWZB 2NP9A 3UULA 2QA7A 4EAHA 4GK0E 1ZHCA 2VK9A 5JDNA 4V1Av 4MFRA 5HWYA 4DNDA 4EYUA 5EK2A 3HKDE 4PK6A 5LJNA 3P7IA 2XAHB 3ETUA 5ETWA 4FI5A 2LOPA 2NTYA 2XAJB 3AAEB 4UVAB 3AA1B 4WW0A 2V1DB 4EXTA 4PJLA 4IE7A 2VL8A 4O2AE 3I9WA 3MJXA 3ZMZB 1D1AA 2DHRA 4AKGA 1MMDA 1SA0E 4QHOA 2KINB 1HTJF 3N9LA 4KBMB 3AAAB 2GK9A 1ZV4X 5IYZE 4ZS2A 3ZN0B 4PFOA 2VKJA 4OFZA 4ZI3C 2H7OA 2VWAA 3BK9A 3C51A 4O4IE 2ODVA 3RYCE 1U5PA 5EK4A 1UX4A 3ZEFB 2D0TA 3O1JA 3OJAA 4PNIA 2C0SA 4M1PA 4O8SA 4UV8B 4H9RC 1WYBA 4O4HE 2ES0A 3ZC0A 3ZCIA 1YKEB 2E9XB 3BQKA 4OYJA 3RKOA 3LK2B 3ZJ2A 3HKCE 5JH7E 4HE8A 1V9DA 4GK5E 4B6XA 5F8PA 3PURA 2E9XD 3CQGB 3KV5A 2CXFA 5DQVA 2Y8DA 4BA9A 3HL6A 4K0UA 2XAFB 3DP7A 1ZEEA 3ZN1B 1HF8A 2CXDA 4JEUB 4C91A 1G8XA 3ZPOA 4QX7B 3FXEB 5HAXA 3CQCB 2XUEA 1T98A 2D0UA 4QKNA 4ZI2C 4AKIA 4XAXB 3CMLA 3LK42 2X67A 1U4QA 3VKGA 1OWAA 3PDYA 4YJ2E 2CWYA 1OXZA 5LG4A 2WM9A 2WMOA 2NW8A 3E22E 4CI1B 2BVLA 4EOZB 1IJ6A 2W00A 4ISTA 1NWMX 2WBLA 1G73A 4H9PC 5KMGP 1LRZA 3LK3B 2CE7A 2K48A 5JREA 5E0OA 3GN5B 2A72A 4KMCA 4TV9E 2V7KA 4DBRA 5JQGE 3MXZA 4L9IA 4N78D 2N2NA 3AAIA 2B1EA 3C4WA 4I4TE 1HG5A 2EHOC 2LT3A 5LOVE 4ZHQE 3RX6A 4IHJE 2H3RA 2WMNA 1S94A 3EUHA 4QXBB 2IW5B 4EB6E 3BQIA 5EZYE 2X68A 3OYZA 2E9XA 1BR4A 2KZ7B 1HX8A 3N5LA 5FXZA 1WLXA 2LEHA 3CX8B 3FXDB 3BQLA 2RA1A 4X1IE 3FBLA 3UUMA 1YD8G 5DABA 2Q9QC 3ZJ1A 4ADZA 4PJNA 2K24A 3B13A 3KDSE 2JJ9A 3KFWX 3VHLA 2KMFA 4AXPA 2KXPB 1YKHB 5TAOA 1BR1A 4P0BA 3MACA 5HWXA 4AQFC 4J2CA 4ILUA 3U78A 2LHRA 3F57A 4A56A 2W62A 2DLRA 4EZ4A 2L8KA 4O2BE 2XAQB 3RRWA 1EZ3A 2XASB 3HI2A 1BR2A 3AVSA 2VKDA 4P09A 3U3IA 2DWKA 2KLQA 3A5XA 5FY0A 3CKDA 3R6NA 3GN5A 5JR9C 2UXNB 3ZLIA 4EZHA 3KVBA 3RC8A 2K5BB 4WNKA 3ZMSB 4QXHB 4GIWA 2LSJA 3RYFE 1MNEA 3NZQA 3V5UA 4JLEA 5LBQB 1ZKEA 2LSYA 2DI4A 2QGSA 2YU1A 4ZI2D 5J2TE 1MMAA 3MK7C 2V7JA 3RPUA 3P8CD 4MALA 4XBFB 4H9SE 2BZBA 3HKBE 3L3PA 3L09A 5HYAA 1CUNA 3KV9A 3N2OA 2ACXA 3KBTA 4CQIA 2JQQA 3OKQA 4Z8XA 4PK4A 3SRZA 2X9XA 5LGTB 2PG8A 2ZM2A 2LM9A 3I0OA 5BMVE 3MZKB 5LJMA 3LFMA 1YW0A 3J9X1 3OYXA 1FMVA 4HEAA 4PJMA 4U72A 5CB4E 3K8PC 3N2KE 3PUQA 4DVDA 5LNKA 3N9OA 1MMNA 4AI6A 4YHJA 2Q9QB 4GYSA 3RRCA 5JDLA 4CXYA 4MHCA 3Q5WA 5FY7A 3ZC1A 2Q9QD 2M67A 3AB3B 3CX7B 4PJJA 3NRXA 1O3XA 4OHFA 2VASA 3C50A 4BJNA 3PE0A 3PU3A 1FEWA 1E1HB 2NTXA 3H3AA 4PW8A 4UELA 3KV6A 4CXWA 1IAPA 4CZZB 1QSDA 3EVYA 4WBOA 2MBGA 3FB2A 3I9YA 3ONXA 5CA0E 5L3GB 2SPCA 4UVBB 5AFUL 2Y6XA 4PFPA 1B7TA 4ZS3A 3O9XA 2ZLYA 3UUNA 2K9AA 3LG7A 2ZM8A 5HXHA 1H7CA 5LGNB 5IHYA 4QWNB 3RH3A 1FMWA 4UF0B 4BAYB 4GOUA 3PU8A 5LHGB 5HXRA 2I59A 4ZOLE 2X9YA 3C98B 3AA0B 3ANWB 5FXVA 2CWOA 3PUGA 4DMWA 1HFAA 2Q9QA 3KBUA 5JDQA 4PAGA 5FNVE 3ZYKA 3UFEA 2LOSA 3RYHE 4XZCA 2WWUA 4TN7B 2L9QA 2MTQA 1WRDA 4X20E 5HXCA 1QUUA 3O4XE 5EK3A 4AKLA 5M4YA 3AA7B 2X66A 2V26A 3GWHA 1UCUA 4AQFA 2DNXA 5KX5E 1SHZC 2ZMAA 4MLKA 4ZI3D 4H9QC 2G0UA 4H9OC 3JC6C 5FYMA 5LBMA 3NBXX 2BDEA 5GONE 1BR0A 5H6QB 2Y48B 4H9NC 3ZMUB 4IIJE 2KNDA 3IBPA 2A2FX 4O4JE 4UEMA 4ASKA 2X9HA 3GMIA 4L0RA 5JDGA 4TZ4C 4YJ3E 3S4UA 2VB6A 2ZM0A 4ISSA 3O1IA 4I55E 5L3EB 2C5IT 3N2GE 4GYRA 4UF0A 2YK0A 3C4ZA 3CX6B 1HS7A 3N9PA 4EIWA 3VU7H 4HN9A 2E9XC 3LBXB 3WAKA 2JRKA 2UXXB 2HPJA 2XAGB 2VKOA 4JUYA 3ANWA 3V5SA 3HKEE 3SWHA 2CEAA 4CI3B 4E7SA 1AJ3A 3ETVA 3QC9A 4IE0A 5DQWA 3RYIE 3HR0A 5JVDE 2WAUA 2RP4A 5FXWA 5LYJE 3TKLB 5L3CB 1D1BA 3NZPA 3PTRB 4NUVA 3C4XA 5J2UE 2XTLA 2PBIA 1MMGA 4OYKA 2LSIA 5JDHA 4G63A 2CA5A 3EDVA 4ERRA 2CMRA 1S35A 2KWIB 2JMKA 4KP3C 3QUJA 5HXSA 3DTOA 4IGUA 2CLYC 2NOXA 3FHNA 3H37A 3KV4A 2V7IA 2EHOB 3F31A 3HA4A 4PK5A 4TX5A 3AVRA 5JRCB 5KDMC 2EHOD 1HCIA 4H63H 3T8OA 3FBZA 4YLHA 3DJBA 5F3JA 2Z6EA 1KK7A 3GA8A 2L3LA 5LCYA 3MKDA 1HG2A 2PFVA 2CXLA 2W0GA 3MA9A 3SS1A 4WBNE 3K3QC 5LHHB 3LBXA 3CQXC 4BJMA 2MOZA 3C64A 2LHNA 3UUXB 3JC6D 4X1KE 3KINB 5HXEA 2LJLA 3UT5E 5FY1A 2A3DA 4DBQA 4QXCB 5ADXL 2CCQA 2N9DA 2X0LB 3WI3A 4CXXA 1WR6A 2W63A 4IE5A 3Q9DA 3ZYMA 4UVCB 1FIOA 2D5UA 3ZMVB 1UX5A 1Z0PA 1VRBA 1Y64B 2H7VC 2MYSA 4TUYE 5LGUB 4ANJA 1MNDA 2NW9A 5LHIB 3ESLA 4YFSA 5CA1E 2C5JA 2DWGA 4E7ZA 1D0YA 1MIWA 5FXXA 5JR9B 3I0QA 1IZNB 2LSKA 3CPZA 3KVAA 4FJOA 3IF8B 2JMHA 5LXTE 4OK0A 3O1HA 2C5KT 2EHOA 3ZMTB 5JRCA 1VOMA 2IAKA 5J1GA 3J7Yq 5L3FB 1US7B 4G2AA 4F6RC 1X79A 4I50E 2E8IA 3R84B 3K3NA 1LKXA 1D1CA 3PUSA 2JPFA 2XQYA 4UXNB 5LP6E 1KNZA 4H63V 4L5GA 3IHRA 3N9MA 2D2SA 4JEHB 3EDUA 2LSGA 4AKHA 2P9BA 3W15B 2CLYB 2X51A 4DO0A 5L3BB 2VKHA 2WSSV 4EYYR 3B57A 2XHEB 3OBVE 3N9QA 4IDZA 5LA6E 3ZCJA 2NW7A 2X9WA 3Q5XA 5JDMA 1IJ5A 2LE8A 4KUMB 5L3DB 5JDFA 4CI2B 2IC9A 4HGAA 3N9NA 3LJCA 1WYCA 3E0ZA 4AKRB 3RC3A 4NUUA 4UV9B 3PUAA 4DMVA 1D0ZA 4UIGA 4AQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LJL A;  2L9Q A;  4AXP A; 
#chains in the Genus database with same CATH topology
 2ODU A;  1W0A A;  3FZF B;  5JR9 A;  4HFD A;  3VKH A;  2IC6 A;  4X65 T;  1LVF A;  1NAF A;  4MBQ A;  1LVK A;  2OA5 A;  3AE1 A;  2FJB A;  4C90 A;  2BS3 A;  3K3O A;  3D0T A;  3E08 A;  4X1Y E;  2V7L A;  4GKK T;  3CWZ B;  3AE4 A;  5AQK B;  2QYW A;  2JQ9 A;  5JDN A;  5HWY A;  4B3M T;  2XAH B;  3EAB A;  3JAD A;  2V1D B;  4YSY A;  1T7S A;  4IE7 A;  3CK6 A;  3ZMZ B;  4JI7 T;  4QHO A;  2V5C A;  2XQ8 A;  3AE7 A;  1WCR A;  2AE9 A;  2HN2 A;  3JCF A;  2W67 A;  4YHH T;  4HFB A;  4UV8 B;  1YKE B;  2CHN A;  1YXR A;  4OYJ A;  4DR4 T;  3EI0 A;  4B6X A;  2CXF A;  2Y8D A;  4LF7 T;  4K0U A;  4JI6 T;  2XM2 A;  3DP7 A;  5C3J A;  2CXD A;  4LF6 T;  4QX7 B;  5HAX A;  2XUE A;  2E2A A;  2D0U A;  4QKN A;  4HFC A;  3SFD A;  2CWY A;  3NKZ A;  2WMO A;  2BVL A;  1IJ6 A;  3NWI A;  1LRZ A;  5JRE A;  3GN5 B;  4TV9 E;  4DBR A;  3MXZ A;  4N78 D;  2N2N A;  3C4W A;  2B1E A;  5HCM A;  3RX6 A;  4IHJ E;  2UUA T;  2XSA A;  4NXN T;  5AQI B;  3BQL A;  2WU5 A;  5AQH B;  2K24 A;  3KDS E;  4LFA T;  1KNR A;  5LMU T;  3VHL A;  3AEF A;  5TAO A;  3MAC A;  1J5E T;  2WS3 A;  4ILU A;  4YTP A;  2DLR A;  1EZ3 A;  3HI2 A;  5HEU A;  2DWK A;  3A5X A;  3AXJ B;  1VCT A;  5L4E A;  3RC8 A;  2QGS A;  3ZT5 A;  3PUX F;  4XBF B;  2BZB A;  3HKB E;  3L09 A;  1CUN A;  3N2O A;  2ACX A;  3FZK B;  3KBT A;  3ZT7 A;  3LDQ B;  2LM9 A;  4HWH A;  3AEB A;  5KXJ A;  4IDP A;  3J9X 1;  3OYX A;  5CB4 E;  2JQK A;  3PUQ A;  3H3M A;  3QB5 A;  2W2U A;  1T72 A;  3AE6 A;  3CX7 B;  3C50 A;  1FEW A;  1M62 A;  1HX1 B;  3KV6 A;  1UGO A;  1Y01 A;  3RGL A;  4EGW A;  4K0K T;  3FB2 A;  3I9Y A;  3PUV F;  2H89 A;  2XY8 B;  4PFP A;  2K9A A;  5HXH A;  2XQ7 A;  2ZM8 A;  3RH3 A;  1FMW A;  4GOU A;  5HXR A;  2I59 A;  2X9Y A;  3PUG A;  4DMW A;  1HFA A;  4JI0 T;  2Q9Q A;  2J4G A;  4XZC A;  2WWU A;  2MTQ A;  5HXC A;  4X20 E;  1QUU A;  3O4X E;  3AA7 B;  2X66 A;  3GWH A;  2FUP A;  4ZZB A;  2G0U A;  1YQ4 A;  3JC6 C;  5LBM A;  3NBX X;  2BDE A;  2WP9 A;  4DR6 T;  2XPK A;  2KND A;  2A2F X;  4ASK A;  5JDG A;  4U31 A;  3RIU C;  5C2T A;  3PUY F;  3O1I A;  4I55 E;  5L3E B;  2WCA A;  2UUB T;  2YK0 A;  1HS7 A;  4EIW A;  3ANW A;  3V5S A;  1AJ3 A;  3QC9 A;  3RYI E;  5FXW A;  3ZT6 A;  2ACZ A;  2YOE A;  1D1B A;  2PBI A;  1MMG A;  2CA5 A;  2CHO A;  2I0M A;  4ERR A;  1N34 T;  4LF5 T;  5LMN T;  5HXS A;  2CLY C;  3FHN A;  3H37 A;  2EHO B;  3FBZ A;  4X62 T;  3GA8 A;  2CXL A;  2V5D A;  3MA9 A;  5LHH B;  5AQF B;  3LBX A;  4COF A;  4QH4 A;  3JC6 D;  2LJL A;  5FY1 A;  4DV7 T;  2DL1 A;  4QXC B;  2VQE T;  1WR6 A;  2W63 A;  4KHZ F;  3Q5E A;  2HHH T;  1FIO A;  3TLV A;  3TLW A;  3RF1 A;  1VRB A;  1Y64 B;  2MYS A;  5LGU B;  1MND A;  4IRE A;  5LHI B;  3ESL A;  4HWD A;  5JR9 B;  1MIW A;  3UUB A;  1IZN B;  3P50 A;  1XZY A;  4OX9 T;  2IAK A;  3J7Y q;  5L3F B;  4F6R C;  1LKX A;  1D1C A;  5LP6 E;  4UXN B;  2XQA A;  4YSX A;  2CBI A;  4H63 V;  3RQU A;  5CFB A;  4L5G A;  3VRB A;  3IHR A;  5AQQ B;  2LM2 A;  1X9B A;  5JDM A;  5L3D B;  4KUM B;  5JDF A;  3RC3 A;  3QNU A;  4DMV A;  1D0Z A;  1W0B A;  4X64 T;  4AQG A;  3ZYL A;  1MIV A;  4QX8 B;  5FMN A;  2XSB A;  4HKA A;  1N33 T;  5L2L A;  3SOL A;  2UXC T;  3RIF A;  2HH7 A;  2KWH A;  2YU2 A;  2W61 A;  5AQT B;  3M65 A;  3AA6 B;  3F2E A;  5C8Y E;  1I6Z A;  3WAJ A;  1MIY A;  1D0X A;  3L39 A;  4DID B;  4HTE A;  3I1A A;  3AE8 A;  3UU5 A;  4NXM T;  2QA7 A;  4EAH A;  4GK0 E;  3HKD E;  4PK6 A;  3X1D A;  3ETU A;  5ETW A;  2XAJ B;  4WW0 A;  2F4V T;  4O2A E;  1D1A A;  1MMD A;  4DV3 T;  4U7I A;  5F5W A;  3N9L A;  4KBM B;  2B76 A;  2GK9 A;  5IYZ E;  4I0U A;  4ZI3 C;  2H7O A;  3AEA A;  2VWA A;  4HFH A;  2ODV A;  3RYC E;  1UX4 A;  2D0T A;  3O1J A;  4PNI A;  2C0S A;  5AQV B;  4M1P A;  1WYB A;  2ES0 A;  4HWF A;  2IIU A;  3BQK A;  2BG9 E;  5JH7 E;  1V9D A;  5F8P A;  4ILB A;  2E9X D;  3CQG B;  4HWI B;  5CJ5 A;  3PV0 F;  1G8X A;  3CQC B;  4ZI2 C;  1T8B A;  3LK4 2;  3VKG A;  1U4Q A;  5AQG B;  1OWA A;  4YJ2 E;  1OXZ A;  2W66 A;  2NW8 A;  4IST A;  1NWM X;  2CE7 A;  5E0O A;  2V7K A;  2YDR A;  4AQY T;  3AAI A;  4YT0 A;  2EHO C;  4ZHQ E;  3JAF A;  5LOV E;  2H3R A;  4DR2 T;  1S94 A;  3EUH A;  2H88 A;  5EZY E;  1BR4 A;  5FXZ A;  2LEH A;  3CX8 B;  3UUM A;  2RA1 A;  4X1I E;  5DAB A;  3ZJ1 A;  4PJN A;  5HEH A;  4LMJ A;  2JJ9 A;  4IL9 A;  4JI2 T;  3ONL C;  1YKH B;  4P0B A;  5HWX A;  2UXD T;  2LHR A;  3F57 A;  4A56 A;  4O2B E;  3RRW A;  2VKD A;  1N36 T;  3U3I A;  4HFI A;  4Q25 A;  2KLQ A;  4WYV A;  3UFG A;  1WFD A;  5JR9 C;  3ABV A;  3ZLI A;  1UUS A;  4WNK A;  2IUB A;  4QXH B;  5LBQ B;  2LSY A;  2QVA A;  2WY2 A;  2DI4 A;  4ZI2 D;  5J2T E;  1MMA A;  3UQ7 A;  3RPU A;  3L3P A;  4YTN A;  2RPA A;  3TLT A;  3RIA A;  4CN1 A;  5AQS B;  4CQI A;  4Z8X A;  1L0V A;  3SRZ A;  4DR1 T;  2ZM2 A;  2ZM6 T;  2VVN A;  1KFY A;  1HNW T;  2M6I A;  3LFM A;  1YW0 A;  1XNR T;  1FMV A;  4EEB A;  4PJM A;  3N2K E;  3UU3 A;  2Q9Q B;  3RRC A;  3OTO T;  2UU9 T;  3Q5W A;  3AB3 B;  4IDO A;  4HWC A;  5HEO A;  2VAS A;  4HFE A;  4YXD A;  2VQF T;  3H3A A;  1HNX T;  2M6B A;  4WBO A;  2MBG A;  3ONX A;  5CA0 E;  4UVB B;  5AFU L;  2Y6X A;  3RQW A;  3Q5D A;  2CBJ A;  4QWN B;  4BAY B;  3PU8 A;  3ANW B;  4U2Z A;  4PAG A;  5FNV E;  3ZYK A;  3UFE A;  2LOS A;  3RYH E;  2XQ4 A;  4B3R T;  3OVU A;  4AKL A;  2V26 A;  2DNX A;  2OV9 A;  4H9O C;  2BS4 A;  1QLB A;  5GON E;  1BR0 A;  4IIJ E;  3IBP A;  2BKP A;  3S4U A;  2VB6 A;  3N2G E;  4GYR A;  4KI0 F;  4UF0 A;  3CX6 B;  3N9P A;  2JQH A;  3LBX B;  2XQ6 A;  2JRK A;  2UXX B;  2HPJ A;  2XAG B;  4JUY A;  4CI3 B;  4E7S A;  2UUC T;  3SWH A;  4IE0 A;  5JVD E;  5LYJ E;  3TKL B;  5L3C B;  2FJE A;  1E7P A;  2BS2 A;  1OED C;  5J2U E;  2XTL A;  5AQM B;  5JDH A;  4LML A;  4G63 A;  2JMK A;  2X0H A;  3DTO A;  3KV4 A;  4A5X A;  2JIW A;  4TX5 A;  3VR8 A;  2YN6 A;  2Z6E A;  2L3L A;  3MKD A;  1HG2 A;  2W0G A;  3SS1 A;  3K3Q C;  3T1H T;  3UQ4 A;  4TNV A;  3UT5 E;  2A3D A;  3WI3 A;  3Q9D A;  2VUR A;  3ZYM A;  2WU2 A;  2H7V C;  3AED A;  4KX6 A;  4YFS A;  2DWG A;  5FXX A;  3I0Q A;  4X66 T;  2JMH A;  4OK0 A;  3O1H A;  4B3T T;  5FL0 A;  4CN4 A;  1VOM A;  4Z90 A;  4JI3 T;  5BR8 T;  4I50 E;  2WB5 A;  5AQU B;  3R84 B;  3K3N A;  4NPP A;  5FVK A;  2D2S A;  4X5T A;  3EDU A;  2LSG A;  3W15 B;  2BG9 A;  2VKH A;  4TWH A;  4IDZ A;  2LE8 A;  3N9N A;  4B3S T;  3LJC A;  2XZE A;  3E0Z A;  4U7Y A;  3QK6 A;  2V6Y A;  2YIN A;  1IBL T;  3QOF A;  2N1G A;  5AQP B;  4ZI7 E;  4WZX A;  2PJQ A;  4U74 A;  4IE6 A;  5A1L A;  2NWB A;  2HPL A;  4TV8 E;  2X0Y A;  3Q2M A;  4DR5 T;  2KT9 A;  3IEE A;  4U2Y A;  2BVM A;  2QRX A;  2NP9 A;  3P4W A;  3A7M A;  1ZHC A;  2VK9 A;  4MFR A;  5EK2 A;  4FI5 A;  5L47 A;  2NTY A;  3AAE B;  1KF6 A;  3AA1 B;  4DV6 T;  4NIQ A;  1ZP0 A;  3MJX A;  4DV1 T;  2DHR A;  4AKG A;  4ILC A;  2KIN B;  1HTJ F;  3P4Q A;  1HR0 T;  4PFO A;  3BK9 A;  1U5P A;  5EK4 A;  2LLY A;  4U3C A;  4Z91 A;  2KSR A;  5ABE A;  4O8S A;  4H9R C;  4O4H E;  3ZC0 A;  4JI1 T;  3UU6 A;  3RKO A;  3LK2 B;  3ZJ2 A;  1N32 T;  4HE8 A;  3PUR A;  3KV5 A;  5DQV A;  4TWD A;  4BA9 A;  3HL6 A;  3ZSS A;  2XAF B;  4JEU B;  3ZPO A;  3ZST A;  5AQL B;  4AKI A;  4XAX B;  2X67 A;  3FZH B;  3PDY A;  5LG4 A;  2XQ3 A;  4IDQ A;  2W00 A;  2WBL A;  4JYA T;  2K48 A;  2OLT A;  4KMC A;  1YQ3 A;  5JQG E;  5FVL A;  2WWV A;  1HG5 A;  2LT3 A;  3EAM A;  4KHP T;  4QXB B;  2IW5 B;  4JI5 T;  3BQI A;  3OPC A;  2E9X A;  3N5L A;  3B5M A;  3FXD B;  1W09 A;  3FBL A;  1CHU A;  3KFW X;  2KMF A;  2KXP B;  4LF8 T;  1BR1 A;  2WDR A;  4AQF C;  2XJ7 A;  2W62 A;  4EZ4 A;  2K3W A;  2XAQ B;  2XAS B;  4P09 A;  3R6N A;  3KVB A;  4DV2 T;  3ZMS B;  4GIW A;  2BBJ A;  2LSJ A;  3V5U A;  3P4S A;  2YU1 A;  5ABF A;  3MK7 C;  2V7J A;  4MAL A;  5LG3 A;  5FKY A;  5HYA A;  3AE9 A;  1KNP A;  3PJA J;  4DV4 T;  2PG8 A;  5BMV E;  3MZK B;  5LJM A;  4HEA A;  4ILA A;  4LFB T;  3K8P C;  3RKG A;  3N9O A;  1MMN A;  4AI6 A;  4YHJ A;  3AEG A;  4GYS A;  5JDL A;  2LKG A;  4MHC A;  5FY7 A;  4PJJ A;  1O3X A;  2YDQ A;  3ZKR A;  4JBW F;  5AQJ B;  3PUZ F;  2NTX A;  2FJD A;  1XDP A;  4PW8 A;  3QB5 K;  4IDN A;  3FZL B;  2LRL A;  2SPC A;  1B7T A;  3O9X A;  2WDQ A;  2XQ9 A;  5LGN B;  1E2A A;  4UF0 B;  5LB7 B;  5LHG B;  2HN1 A;  4LF4 T;  4GKJ T;  2R6G F;  3C98 B;  5FXV A;  2CWO A;  1XNQ T;  1FJG T;  4F8H A;  4DR3 T;  2L9Q A;  4A98 A;  1WRD A;  2FJA A;  2E5V A;  3VRA A;  5M4Y A;  5EK3 A;  2ZMA A;  4MLK A;  4ZI3 D;  5FYM A;  4TWF A;  5H6Q B;  2Y48 B;  4H9N C;  4UEM A;  2X9H A;  4L0R A;  4TZ4 C;  4IL4 A;  2ZM0 A;  1UK5 A;  2C5I T;  3VU7 H;  4HN9 A;  3WAK A;  5IUX A;  2VKO A;  3HKE E;  3ETV A;  2V8S V;  3HR0 A;  2WAU A;  2RP4 A;  3ONJ A;  4LF9 T;  1R8I A;  3PTR B;  4TNW A;  5J0Z A;  2LSI A;  2CMR A;  2KWI B;  3QUJ A;  2NOX A;  2V7I A;  3F31 A;  3AVR A;  2EHO D;  1HCI A;  4H63 H;  4YLH A;  2XQ5 A;  3DJB A;  5F3J A;  1KK7 A;  1J5W A;  2BBH A;  1GQE A;  3CQX C;  4BJM A;  2LHN A;  2BG9 B;  3KIN B;  5HXE A;  4DBQ A;  2CCQ A;  2N9D A;  2X0L B;  3JAE A;  3RLF F;  3ZMV B;  1UX5 A;  1Z0P A;  3L8R A;  2NW9 A;  2C5J A;  4E7Z A;  2V6Y B;  3KVA A;  3TLS A;  3IF8 B;  5LXT E;  1M7K A;  5JRC A;  5J1G A;  4G2A A;  2E8I A;  2IHR 1;  2E5L T;  3PUS A;  2JPF A;  2XQY A;  2W4X A;  1KNZ A;  4JEH B;  3N9M A;  1XMQ T;  4AKH A;  2CLY B;  2X51 A;  4DO0 A;  4EYY R;  3B57 A;  2XHE B;  3OBV E;  3N9Q A;  5LA6 E;  2X9W A;  3Q5X A;  4CI2 B;  2IC9 A;  4HGA A;  1WYC A;  4AKR B;  1JNZ A;  4UV9 B;  3PUA A;  4AIU A;  4DV0 T;  4UIG A;  4IE4 A;  2XM1 A;  5DJQ C;  4HFV A;  1SE7 A;  4I43 B;  2J1D G;  5IWA T;  4AIS A;  5H6R B;  1OED A;  2DCF A;  4JI4 T;  4O4L E;  2YEV C;  4P0A A;  3UTK A;  3PJA A;  4DUZ T;  2CM0 A;  5FP3 A;  3NRY A;  1XWM A;  3CVR A;  2V7M A;  3UUL A;  5ABG A;  4V1A v;  4DND A;  4EYU A;  5LJN A;  4CN6 A;  3P7I A;  1NEK A;  1WR0 A;  1VCS A;  2LOP A;  3AE2 A;  4UR9 A;  4UVA B;  1IBK T;  4EXT A;  4PJL A;  2VL8 A;  3I9W A;  2LRK A;  1SA0 E;  1SUM B;  3AAA B;  1ZV4 X;  3ZN0 B;  4ZS2 A;  2VKJ A;  3RHW A;  4OFZ A;  5FL1 A;  3C51 A;  4O4I E;  3ZEF B;  3OJA A;  2IDO B;  3ZCI A;  2E9X B;  3HKC E;  4GK5 E;  4DUY T;  3K1S A;  1I94 T;  5CGM A;  5JTG A;  2YDS A;  1ZEE A;  3ZN1 B;  1HF8 A;  4C91 A;  3FXE B;  3G06 A;  1T98 A;  3CML A;  5ABH A;  2VVS A;  2WM9 A;  3E22 E;  4CI1 B;  4EOZ B;  5KMG P;  1G73 A;  4H9P C;  3LK3 B;  5HCJ A;  4U33 A;  2A72 A;  3RIU A;  5AQN B;  4L9I A;  4I4T E;  4DV5 T;  2WMN A;  5AQO B;  2WDV A;  4EB6 E;  2X68 A;  3OYZ A;  5ABF B;  2KZ7 B;  1HX8 A;  2LKH A;  1WLX A;  3A8Y C;  1YD8 G;  2MPK A;  3M3Z B;  2Q9Q C;  4ADZ A;  4DR7 T;  3B13 A;  3P4R A;  4EED A;  3LSV A;  2BG9 C;  4AXP A;  2I6H A;  4J2C A;  3U78 A;  2L8K A;  1ZOY A;  1BR2 A;  3AVS A;  5FY0 A;  4LFC T;  3CKD A;  5L4H A;  3GN5 A;  1DU2 A;  2UXN B;  4EZH A;  2K5B B;  3RYF E;  1MNE A;  3NZQ A;  4JLE A;  1ZKE A;  3P8C D;  4H9S E;  3SFE A;  3KV9 A;  2AXD S;  4JV5 T;  2JQQ A;  3OKQ A;  4PK4 A;  5HEJ A;  2X9X A;  5LGT B;  1XMO T;  3I0O A;  2WZI A;  1W9R A;  4U72 A;  2V6X A;  1JNR A;  5LNK A;  4DVD A;  2IML A;  3AXJ A;  4CXY A;  4LMK A;  3ZC1 A;  2Q9Q D;  2M67 A;  4P1N A;  3NRX A;  4OHF A;  4BJN A;  3PE0 A;  3PU3 A;  1E1H B;  1IBM T;  4UEL A;  5AQR B;  4CXW A;  1NEN A;  1IAP A;  4CZZ B;  1QSD A;  4YTM A;  3EVY A;  5L3G B;  4ZXL A;  4ZS3 A;  2ZLY A;  3UUN A;  3LG7 A;  4YY3 T;  1H7C A;  5IHY A;  3AE5 A;  4ZOL E;  1OED E;  1Z8U A;  3AA0 B;  2UXB T;  3KBU A;  5JDQ A;  3P4P A;  4TN7 B;  1J1J A;  1UCU A;  4AQF A;  5KX5 E;  1SHZ C;  2D9D A;  4H9Q C;  2CRB A;  3NVO A;  3ZMU B;  4O4J E;  3GMI A;  2MAW A;  4YJ3 E;  5HEG A;  4ISS A;  2YKS A;  2NR4 A;  3C4Z A;  3AE3 A;  2WQY A;  2VL0 A;  2E9X C;  3IA3 A;  4JI8 T;  2FBW A;  2CEA A;  3UU4 A;  5DQW A;  1XDO A;  4ZZC A;  4QH5 A;  2J47 A;  2J62 A;  3NZP A;  4NUV A;  3C4X A;  4OYK A;  3AEE A;  3EDV A;  1S35 A;  3TLU A;  4KP3 C;  2CPT A;  4IGU A;  3HA4 A;  4A97 A;  3CIR A;  4PK5 A;  4YSZ A;  5JRC B;  5KDM C;  3PUW F;  3T8O A;  5LCY A;  2PFV A;  4WBN E;  3FZM B;  3AEC A;  2MOZ A;  3C64 A;  1HNZ T;  3UUX B;  4X1K E;  1UUR A;  4EV6 A;  2BKO A;  5ADX L;  3VR9 A;  4CXX A;  2PTF A;  4IE5 A;  4ZEY A;  4UVC B;  2D5U A;  2A9U A;  4TUY E;  2BKN A;  4ANJ A;  5CA1 E;  1D0Y A;  2LSK A;  3CPZ A;  4FJO A;  2WZH A;  2C5K T;  2EHO A;  3ZMT B;  3T1Y T;  1US7 B;  4QH1 A;  1X79 A;  1OED B;  4IT4 A;  1KEY A;  2P9B A;  5L3B B;  2WSS V;  3UU8 A;  3ZCJ A;  2NW7 A;  1IJ5 A;  4NUU A;  3RI5 A;  3EHZ A; 
#chains in the Genus database with same CATH homology
 4IE4 A;  3ZYL A;  1MIV A;  2ODU A;  3QK6 A;  5JR9 A;  2YIN A;  4QX8 B;  5DJQ C;  4HFV A;  2N1G A;  5FMN A;  4HKA A;  4I43 B;  3VKH A;  2IC6 A;  2J1D G;  5L2L A;  1LVF A;  1NAF A;  4ZI7 E;  3SOL A;  4MBQ A;  5H6R B;  2PJQ A;  2HH7 A;  2KWH A;  1LVK A;  2YU2 A;  2W61 A;  4U74 A;  4IE6 A;  2OA5 A;  5A1L A;  2DCF A;  3M65 A;  2NWB A;  2HPL A;  4TV8 E;  3AA6 B;  3F2E A;  4O4L E;  2YEV C;  3Q2M A;  4P0A A;  5C8Y E;  4C90 A;  3UTK A;  3WAJ A;  2CM0 A;  3K3O A;  1MIY A;  5FP3 A;  3D0T A;  1D0X A;  2KT9 A;  3NRY A;  3IEE A;  3E08 A;  4X1Y E;  3CVR A;  2BVM A;  2V7L A;  4HTE A;  3I1A A;  2V7M A;  3CWZ B;  2NP9 A;  3UUL A;  2QA7 A;  4EAH A;  4GK0 E;  1ZHC A;  2VK9 A;  5JDN A;  4V1A v;  4MFR A;  5HWY A;  4DND A;  4EYU A;  5EK2 A;  3HKD E;  4PK6 A;  5LJN A;  3P7I A;  2XAH B;  3ETU A;  5ETW A;  4FI5 A;  2LOP A;  2NTY A;  2XAJ B;  3AAE B;  4UVA B;  3AA1 B;  4WW0 A;  2V1D B;  4EXT A;  4PJL A;  4IE7 A;  2VL8 A;  4O2A E;  3I9W A;  3MJX A;  3ZMZ B;  1D1A A;  2DHR A;  4AKG A;  1MMD A;  1SA0 E;  4QHO A;  2KIN B;  1HTJ F;  3N9L A;  4KBM B;  3AAA B;  2GK9 A;  1ZV4 X;  5IYZ E;  4ZS2 A;  3ZN0 B;  4PFO A;  2VKJ A;  4OFZ A;  4ZI3 C;  2H7O A;  2VWA A;  3BK9 A;  3C51 A;  4O4I E;  2ODV A;  3RYC E;  1U5P A;  5EK4 A;  1UX4 A;  3ZEF B;  2D0T A;  3O1J A;  3OJA A;  4PNI A;  2C0S A;  4M1P A;  4O8S A;  4UV8 B;  4H9R C;  1WYB A;  4O4H E;  2ES0 A;  3ZC0 A;  3ZCI A;  1YKE B;  2E9X B;  3BQK A;  4OYJ A;  3RKO A;  3LK2 B;  3ZJ2 A;  3HKC E;  5JH7 E;  4HE8 A;  1V9D A;  4GK5 E;  4B6X A;  5F8P A;  3PUR A;  2E9X D;  3CQG B;  3KV5 A;  2CXF A;  5DQV A;  2Y8D A;  4BA9 A;  3HL6 A;  4K0U A;  2XAF B;  3DP7 A;  1ZEE A;  3ZN1 B;  1HF8 A;  2CXD A;  4JEU B;  4C91 A;  1G8X A;  3ZPO A;  4QX7 B;  3FXE B;  5HAX A;  3CQC B;  2XUE A;  1T98 A;  2D0U A;  4QKN A;  4ZI2 C;  4AKI A;  4XAX B;  3CML A;  3LK4 2;  2X67 A;  1U4Q A;  3VKG A;  1OWA A;  3PDY A;  4YJ2 E;  2CWY A;  1OXZ A;  5LG4 A;  2WM9 A;  2WMO A;  2NW8 A;  3E22 E;  4CI1 B;  2BVL A;  4EOZ B;  1IJ6 A;  2W00 A;  4IST A;  1NWM X;  2WBL A;  1G73 A;  4H9P C;  5KMG P;  1LRZ A;  3LK3 B;  2CE7 A;  2K48 A;  5JRE A;  5E0O A;  3GN5 B;  2A72 A;  4KMC A;  4TV9 E;  2V7K A;  4DBR A;  5JQG E;  3MXZ A;  4L9I A;  4N78 D;  2N2N A;  3AAI A;  2B1E A;  3C4W A;  4I4T E;  1HG5 A;  2EHO C;  2LT3 A;  5LOV E;  4ZHQ E;  3RX6 A;  4IHJ E;  2H3R A;  2WMN A;  1S94 A;  3EUH A;  4QXB B;  2IW5 B;  4EB6 E;  3BQI A;  5EZY E;  2X68 A;  3OYZ A;  2E9X A;  1BR4 A;  2KZ7 B;  1HX8 A;  3N5L A;  5FXZ A;  1WLX A;  2LEH A;  3CX8 B;  3FXD B;  3BQL A;  2RA1 A;  4X1I E;  3FBL A;  3UUM A;  1YD8 G;  5DAB A;  2Q9Q C;  3ZJ1 A;  4ADZ A;  4PJN A;  2K24 A;  3B13 A;  3KDS E;  2JJ9 A;  3KFW X;  3VHL A;  2KMF A;  4AXP A;  2KXP B;  1YKH B;  5TAO A;  1BR1 A;  4P0B A;  3MAC A;  5HWX A;  4AQF C;  4J2C A;  4ILU A;  3U78 A;  2LHR A;  3F57 A;  4A56 A;  2W62 A;  2DLR A;  4EZ4 A;  2L8K A;  4O2B E;  2XAQ B;  3RRW A;  1EZ3 A;  2XAS B;  3HI2 A;  1BR2 A;  3AVS A;  2VKD A;  4P09 A;  3U3I A;  2DWK A;  2KLQ A;  3A5X A;  5FY0 A;  3CKD A;  3R6N A;  3GN5 A;  5JR9 C;  2UXN B;  3ZLI A;  4EZH A;  3KVB A;  3RC8 A;  2K5B B;  4WNK A;  3ZMS B;  4QXH B;  4GIW A;  2LSJ A;  3RYF E;  1MNE A;  3NZQ A;  3V5U A;  4JLE A;  5LBQ B;  1ZKE A;  2LSY A;  2DI4 A;  2QGS A;  2YU1 A;  4ZI2 D;  5J2T E;  1MMA A;  3MK7 C;  2V7J A;  3RPU A;  3P8C D;  4MAL A;  4XBF B;  4H9S E;  2BZB A;  3HKB E;  3L3P A;  3L09 A;  5HYA A;  1CUN A;  3KV9 A;  3N2O A;  2ACX A;  3KBT A;  4CQI A;  2JQQ A;  3OKQ A;  4Z8X A;  4PK4 A;  3SRZ A;  2X9X A;  5LGT B;  2PG8 A;  2ZM2 A;  2LM9 A;  3I0O A;  5BMV E;  3MZK B;  5LJM A;  3LFM A;  1YW0 A;  3J9X 1;  3OYX A;  1FMV A;  4HEA A;  4PJM A;  4U72 A;  5CB4 E;  3K8P C;  3N2K E;  3PUQ A;  4DVD A;  5LNK A;  3N9O A;  1MMN A;  4AI6 A;  4YHJ A;  2Q9Q B;  4GYS A;  3RRC A;  5JDL A;  4CXY A;  4MHC A;  3Q5W A;  5FY7 A;  3ZC1 A;  2Q9Q D;  2M67 A;  3AB3 B;  3CX7 B;  4PJJ A;  3NRX A;  1O3X A;  4OHF A;  2VAS A;  3C50 A;  4BJN A;  3PE0 A;  3PU3 A;  1FEW A;  1E1H B;  2NTX A;  3H3A A;  4PW8 A;  4UEL A;  3KV6 A;  4CXW A;  1IAP A;  4CZZ B;  1QSD A;  3EVY A;  4WBO A;  2MBG A;  3FB2 A;  3I9Y A;  3ONX A;  5CA0 E;  5L3G B;  2SPC A;  4UVB B;  5AFU L;  2Y6X A;  4PFP A;  1B7T A;  4ZS3 A;  3O9X A;  2ZLY A;  3UUN A;  2K9A A;  3LG7 A;  2ZM8 A;  5HXH A;  1H7C A;  5LGN B;  5IHY A;  4QWN B;  3RH3 A;  1FMW A;  4UF0 B;  4BAY B;  4GOU A;  3PU8 A;  5LHG B;  5HXR A;  2I59 A;  4ZOL E;  2X9Y A;  3C98 B;  3AA0 B;  3ANW B;  5FXV A;  2CWO A;  3PUG A;  4DMW A;  1HFA A;  2Q9Q A;  3KBU A;  5JDQ A;  4PAG A;  5FNV E;  3ZYK A;  3UFE A;  2LOS A;  3RYH E;  4XZC A;  2WWU A;  4TN7 B;  2L9Q A;  2MTQ A;  1WRD A;  4X20 E;  5HXC A;  1QUU A;  3O4X E;  5EK3 A;  4AKL A;  5M4Y A;  3AA7 B;  2X66 A;  2V26 A;  3GWH A;  1UCU A;  4AQF A;  2DNX A;  5KX5 E;  1SHZ C;  2ZMA A;  4MLK A;  4ZI3 D;  4H9Q C;  2G0U A;  4H9O C;  3JC6 C;  5FYM A;  5LBM A;  3NBX X;  2BDE A;  5GON E;  1BR0 A;  5H6Q B;  2Y48 B;  4H9N C;  3ZMU B;  4IIJ E;  2KND A;  3IBP A;  2A2F X;  4O4J E;  4UEM A;  4ASK A;  2X9H A;  3GMI A;  4L0R A;  5JDG A;  4TZ4 C;  4YJ3 E;  3S4U A;  2VB6 A;  2ZM0 A;  4ISS A;  3O1I A;  4I55 E;  5L3E B;  2C5I T;  3N2G E;  4GYR A;  4UF0 A;  2YK0 A;  3C4Z A;  3CX6 B;  1HS7 A;  3N9P A;  4EIW A;  3VU7 H;  4HN9 A;  2E9X C;  3LBX B;  3WAK A;  2JRK A;  2UXX B;  2HPJ A;  2XAG B;  2VKO A;  4JUY A;  3ANW A;  3V5S A;  3HKE E;  3SWH A;  2CEA A;  4CI3 B;  4E7S A;  1AJ3 A;  3ETV A;  3QC9 A;  4IE0 A;  5DQW A;  3RYI E;  3HR0 A;  5JVD E;  2WAU A;  2RP4 A;  5FXW A;  5LYJ E;  3TKL B;  5L3C B;  1D1B A;  3NZP A;  3PTR B;  4NUV A;  3C4X A;  5J2U E;  2XTL A;  2PBI A;  1MMG A;  4OYK A;  2LSI A;  5JDH A;  4G63 A;  2CA5 A;  3EDV A;  4ERR A;  2CMR A;  1S35 A;  2KWI B;  2JMK A;  4KP3 C;  3QUJ A;  5HXS A;  3DTO A;  4IGU A;  2CLY C;  2NOX A;  3FHN A;  3H37 A;  3KV4 A;  2V7I A;  2EHO B;  3F31 A;  3HA4 A;  4PK5 A;  4TX5 A;  3AVR A;  5JRC B;  5KDM C;  2EHO D;  1HCI A;  4H63 H;  3T8O A;  3FBZ A;  4YLH A;  3DJB A;  5F3J A;  2Z6E A;  1KK7 A;  3GA8 A;  2L3L A;  5LCY A;  3MKD A;  1HG2 A;  2PFV A;  2CXL A;  2W0G A;  3MA9 A;  3SS1 A;  4WBN E;  3K3Q C;  5LHH B;  3LBX A;  3CQX C;  4BJM A;  2MOZ A;  3C64 A;  2LHN A;  3UUX B;  3JC6 D;  4X1K E;  3KIN B;  5HXE A;  2LJL A;  3UT5 E;  5FY1 A;  2A3D A;  4DBQ A;  4QXC B;  5ADX L;  2CCQ A;  2N9D A;  2X0L B;  3WI3 A;  4CXX A;  1WR6 A;  2W63 A;  4IE5 A;  3Q9D A;  3ZYM A;  4UVC B;  1FIO A;  2D5U A;  3ZMV B;  1UX5 A;  1Z0P A;  1VRB A;  1Y64 B;  2H7V C;  2MYS A;  4TUY E;  5LGU B;  4ANJ A;  1MND A;  2NW9 A;  5LHI B;  3ESL A;  4YFS A;  5CA1 E;  2C5J A;  2DWG A;  4E7Z A;  1D0Y A;  1MIW A;  5FXX A;  5JR9 B;  3I0Q A;  1IZN B;  2LSK A;  3CPZ A;  3KVA A;  4FJO A;  3IF8 B;  2JMH A;  5LXT E;  4OK0 A;  3O1H A;  2C5K T;  2EHO A;  3ZMT B;  5JRC A;  1VOM A;  2IAK A;  5J1G A;  3J7Y q;  5L3F B;  1US7 B;  4G2A A;  4F6R C;  1X79 A;  4I50 E;  2E8I A;  3R84 B;  3K3N A;  1LKX A;  1D1C A;  3PUS A;  2JPF A;  2XQY A;  4UXN B;  5LP6 E;  1KNZ A;  4H63 V;  4L5G A;  3IHR A;  3N9M A;  2D2S A;  4JEH B;  3EDU A;  2LSG A;  4AKH A;  2P9B A;  3W15 B;  2CLY B;  2X51 A;  4DO0 A;  5L3B B;  2VKH A;  2WSS V;  4EYY R;  3B57 A;  2XHE B;  3OBV E;  3N9Q A;  4IDZ A;  5LA6 E;  3ZCJ A;  2NW7 A;  2X9W A;  3Q5X A;  5JDM A;  1IJ5 A;  2LE8 A;  4KUM B;  5L3D B;  5JDF A;  4CI2 B;  2IC9 A;  4HGA A;  3N9N A;  3LJC A;  1WYC A;  3E0Z A;  4AKR B;  3RC3 A;  4NUU A;  4UV9 B;  3PUA A;  4DMV A;  1D0Z A;  4UIG A;  4AQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...