2LJLA

Nmr structure of hsp12 in the presence of dpc
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
109
structure length
109
Chain Sequence
MSDAGRKGFGEKASEALKPDSQKSYAEQGKEYITDKADKVAGKVQPEDNKGVFQGVHDSAEKGKDNAEGQGESLADQARDYMGAAKSKLNDAVEYVSGRVHGEEDPTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of Hsp12, the heat shock protein from Saccharomyces cerevisiae, in aqueous solution where it is intrinsically disordered and in detergent micelles where it is locally alpha-helical.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
molecule keywords 12 kDa heat shock protein
total genus 12
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2011-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04119 HSP9_HSP12 Heat shock protein 9/12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1260 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2ljlA01
2LJLA 4AXPA 2L9QA
chains in the Genus database with same CATH superfamily
5CA0E 5KX5E 3E22E 3IHRA 1DU2A 2IW5B 3C50A 4Z8XA 1UURA 1HTJF 3UU3A 5C8YE 4H63V 4HKAA 2UUCT 2BS4A 3KBUA 4DMVA 4QHOA 4JI5T 4AXPA 3SFEA 3AAAB 2XSBA 4MBQA 4CQIA 5LHGB 3WAJA 4TWFA 2W00A 4XAXB 5L4EA 2IAKA 3FHNA 3T8OA 3C4WA 3TLVA 1MMNA 2JMKA 2NR4A 2XQ4A 3CVRA 5LHIB 4G2AA 2E9XA 5HXHA 3AVSA 2CMRA 3WAKA 2WWUA 4U3CA 4ZI2D 4F8HA 3P50A 4J2CA 5JDFA 2VURA 3P4QA 3QK6A 4OK0A 5CB4E 5ABHA 1MNDA 4NUUA 1FMWA 1BR1A 2CA5A 2QYWA 4P1NA 2CBIA 2W62A 2N9DA 3Q5DA 2LLYA 5JDLA 2WMNA 4HWDA 2BKOA 4OYJA 5IHYA 3RIFA 2LM9A 3ETUA 4ISSA 1R8IA 3KVAA 4HTEA 4IGUA 4DV6T 3AAIA 3FZMB 3EHZA 4JI1T 1NWMX 2ACXA 3K3OA 3PUVF 1HS7A 1YKEB 1H7CA 2JQHA 2C0SA 4MFRA 3RI5A 5J0ZA 4IT4A 3EVYA 4DV7T 4U74A 2UXXB 3RH3A 4LF6T 4JBWF 4PFOA 3RIAA 4PJLA 3KDSE 3QC9A 5HEUA 5LP6E 4LF4T 3NRXA 3QUJA 4IIJE 3UUMA 4C91A 2JRKA 2DWGA 2Y48B 4ZXLA 3HKBE 1E1HB 2CWYA 4HFDA 4TNWA 5HEHA 1QUUA 2R6GF 3PUSA 1U5PA 3PU8A 4HGAA 3RC8A 4KHPT 3K3QC 3P4PA 4Q25A 2H88A 4PK6A 3R6NA 2RA1A 3PURA 3AE5A 2I0MA 4WBNE 1XWMA 1Z8UA 4O4IE 3QB5K 1WLXA 2XY8B 1I6ZA 2XAJB 3JC6D 2QVAA 1UK5A 3K8PC 2UU9T 2Q9QA 2XSAA 2YINA 3RRCA 2CHOA 5CJ5A 3C64A 4AQYT 1HF8A 2PTFA 4IE7A 3LJCA 2CE7A 2VWAA 2X66A 4IE6A 2K24A 3KBTA 3LG7A 2NW8A 4GKJT 3ABVA 3EABA 3TKLB 4B6XA 4ZI2C 3VR8A 2WU2A 3FXEB 5GONE 1G73A 4AQFC 3RRWA 5L47A 4GOUA 2CM0A 2PFVA 2WP9A 4MALA 2M6IA 2L8KA 3FBLA 4UF0B 2XUEA 3W15B 5DQVA 5HEOA 2DL1A 4HWFA 3O1JA 2W0GA 3EDUA 5L3EB 3JADA 1W0BA 2ZLYA 4PFPA 2VL0A 5A1LA 1HCIA 2FJBA 2XASB 3BQKA 2HN2A 2VK9A 3PUXF 1N36T 2CPTA 2BVLA 2V6YB 2C5IT 3H3AA 4CZZB 4DV2T 1KFYA 1T7SA 1IBMT 4JI0T 4AKHA 3D0TA 4MHCA 2VVSA 5LG4A 2LSYA 1ZP0A 2BG9C 3MKDA 3P8CD 4IHJE 2QRXA 1OEDE 4IE5A 4YLHA 5ABFB 1FEWA 5AQFB 4JYAT 3UQ4A 2N2NA 4G63A 4A98A 4GKKT 2KNDA 4PJJA 5IYZE 2JQQA 1E2AA 3PDYA 3O4XE 2IHR1 3PE0A 5AQGB 2ES0A 3AE4A 4WBOA 1WR6A 2ZMAA 5AQRB 2QA7A 4ZI7E 5IWAT 3P7IA 2OLTA 2AE9A 2YU1A 2ZM2A 3FZFB 3C4XA 3HI2A 4H9RC 2JMHA 3S4UA 5HXEA 2CBJA 3BQIA 5FXWA 4I43B 3UT5E 4CXXA 3F31A 3ZN1B 2YOEA 1IZNB 2ZM8A 5L3FB 4YHHT 1W0AA 3BK9A 4DV3T 1ZOYA 3ZYLA 2C5KT 2EHOD 5CFBA 5LJMA 2M67A 2I6HA 2FJEA 3I9YA 4X65T 2J62A 2KSRA 4KBMB 2WB5A 2JPFA 5LGUB 4IDNA 2WU5A 1VRBA 2CXLA 3V5SA 1J5ET 2QGSA 3GMIA 4X1YE 3E08A 3VRAA 4B3ST 2YDSA 2I59A 2XQ8A 3CK6A 4DR3T 2BZBA 4Z90A 4JLEA 4P0BA 3VHLA 3UUBA 2J1DG 2A3DA 3I1AA 3N9QA 4U7IA 3LSVA 4TNVA 4HFBA 3B13A 5AQSB 2CEAA 4NUVA 1VOMA 3MXZA 3N5LA 4ZZBA 2FJDA 2CXDA 3PUYF 4PNIA 5F3JA 2E5VA 3F57A 5EK4A 2XHEB 3RYFE 2HPJA 2FUPA 4KI0F 4DUYT 3ZMSB 3I0OA 5ABGA 3OTOT 1UCUA 4AKLA 3ANWA 3LBXB 4C90A 1SA0E 3KFWX 4DVDA 4LFAT 4ILBA 5C2TA 5ADXL 2LOSA 3TLUA 2XAQB 2V7IA 3CX6B 3U3IA 2ZM6T 4O8SA 1MIVA 4NPPA 1QLBA 3RKOA 2WMOA 3CQGB 3HKEE 4JI2T 4EXTA 3AEEA 4JV5T 3AE1A 3LK2B 3SWHA 3PJAJ 1J5WA 1NAFA 2E8IA 4ADZA 2NTYA 3AA7B 3RIUA 2ODUA 1N33T 2K48A 4ZS3A 5L2LA 1HR0T 1HG5A 3AE3A 1OXZA 4UF0A 3JAEA 4PK4A 2ODVA 3AXJA 2VKOA 3I0QA 3NWIA 2A72A 5CA1E 5F5WA 5IUXA 2Q9QD 4H63H 4UIGA 4H9SE 4BJNA 4CI3B 4QXHB 1Y64B 4X1IE 3NKZA 5TAOA 3N2OA 1AJ3A 2YDQA 4QWNB 3AE2A 2E9XD 2F4VT 4O4LE 5ETWA 5HYAA 3CMLA 4NIQA 5J2TE 1ZV4X 2OV9A 1UX4A 2LHRA 3DJBA 2CWOA 4HEAA 4O4JE 5ABFA 3ZCJA 4IDZA 3FZHB 3ZSTA 4QXCB 4DNDA 2CXFA 2JJ9A 4ZI3C 3A8YC 1B7TA 1V9DA 4U2YA 3UUXB 2DCFA 2XAHB 3DP7A 4ZI3D 2V8SV 5C3JA 1D0YA 2W4XA 2X51A 2CLYB 4UVBB 2V6YA 4L5GA 2DI4A 5L3GB 2LKHA 3HKCE 2NOXA 3FZKB 3OVUA 5JTGA 5M4YA 3CX7B 5FXVA 3VKGA 1OWAA 3AE6A 3RX6A 4YT0A 4HFCA 5LOVE 5LMNT 4UV8B 4DBQA 4A5XA 5LGNB 2MBGA 3A7MA 2XAFB 1XZYA 1HNWT 3JCFA 5JREA 4X64T 2L3LA 5AQQB 3Q5WA 4AKIA 3MZKB 3KVBA 4U7YA 2KINB 3P4SA 2GK9A 4H9PC 4X1KE 4CI1B 4L9IA 1IBLT 1KK7A 2BDEA 4AIUA 4QH1A 2IC6A 4KUMB 1JNZA 5L4HA 2Y6XA 1WFDA 3RKGA 3RYIE 2UUBT 2UXCT 4AI6A 2KMFA 2PBIA 1XMOT 5AQUB 2BBJA 2V7KA 3IBPA 3QB5A 1EZ3A 5HXCA 4LF7T 4Z91A 4B3RT 1XDPA 2XJ7A 1N34T 2K3WA 2XQAA 2W61A 5HAXA 3H37A 3ONXA 4EEBA 3C4ZA 3PJAA 3ZLIA 3ZT7A 4ZOLE 4LMLA 5KXJA 3EUHA 3N9LA 3VR9A 2W2UA 1US7B 2V5DA 4BJMA 4QH5A 5JDMA 4AQGA 5ABEA 2XM1A 2H3RA 3AECA 3P4WA 2X67A 2MPKA 2YN6A 2IMLA 3AEAA 3MACA 2G0UA 4YXDA 5JDHA 3UULA 2WSSV 1BR2A 3ETVA 3G06A 3ZYMA 5LMUT 4JI3T 2NTXA 3ZPOA 2D5UA 4YSZA 4X62T 2WBLA 4UEMA 4X5TA 5LGTB 1YXRA 2B1EA 3PUWF 4LF9T 3FZLB 5LBMA 2VQFT 4B3TT 1S94A 4MLKA 3ZT6A 4YHJA 1OEDA 5L3CB 3JC6C 4K0KT 3OPCA 3UU6A 4ZEYA 1LVKA 1VCSA 4JI7T 3ZCIA 1Y01A 5EK2A 1O3XA 2OA5A 3C98B 3AVRA 5HCJA 1IJ6A 4DV0T 1XNRT 2XZEA 1D1CA 3EI0A 2SPCA 3BQLA 4OYKA 2WDQA 4ZHQE 4IE0A 4P0AA 4DR4T 1X79A 4FJOA 4EB6E 1YW0A 4QX7B 3AE7A 2RPAA 5FY1A 5LYJE 3LDQB 2WY2A 4ILUA 4WYVA 5FVLA 2BVMA 1ZKEA 4IDQA 1WCRA 4O2BE 5AQNB 1GQEA 1WYBA 2DLRA 3AXJB 3KINB 4TN7B 1HX1B 4PW8A 2ACZA 2BS2A 1D0ZA 4HFHA 2JIWA 1HX8A 3B57A 3RGLA 4ERRA 4LMKA 3JAFA 2IIUA 1YQ3A 3DTOA 3GN5B 4YSYA 4NXNT 3QNUA 4TZ4C 4CN1A 4JEHB 5KMGP 3OBVE 4JEUB 4QH4A 5AQJB 1VCTA 4LFCT 3O1IA 1D0XA 2X9XA 3AA1B 4V1Av 1FIOA 2XTLA 5EZYE 5JDQA 2D0TA 2V26A 2VKHA 4TX5A 5AQPB 1XMQT 5DQWA 5AQLB 4DR1T 2Y8DA 4ILAA 4HE8A 2H7OA 2N1GA 5LCYA 3VU7H 4EV6A 1YKHB 5J1GA 4EEDA 1T8BA 2UXNB 3VRBA 4AQFA 4FI5A 4HWCA 4LF8T 4X66T 2V5CA 2VKJA 4IE4A 3ZJ2A 2DNXA 2MOZA 5KDMC 3PU3A 2X0LB 4LMJA 2A9UA 2KWHA 5JDGA 4YTNA 3TLWA 3IF8B 2VL8A 1MMGA 3V5UA 4COFA 2M6BA 1MIYA 3MA9A 2VVNA 2WWVA 3ZKRA 1IAPA 3ANWB 2VB6A 3CPZA 3LBXA 2Z6EA 3HL6A 2WZIA 3ZJ1A 2WZHA 4OHFA 3A5XA 1T72A 4IDOA 3AEGA 4YFSA 2J4GA 3AA0B 3ZMUB 5BMVE 2BS3A 3CQXC 1M7KA 2LM2A 3N9OA 4TWHA 3KV9A 4UVAB 3RC3A 4TV8E 2CCQA 2MTQA 3FXDB 1HNZT 2HHHT 3CX8B 4JI6T 2WQYA 2CLYC 1HFAA 2Q9QC 5HCMA 2XQYA 3KV5A 4PAGA 1MNEA 2DWKA 4H9QC 3M65A 2BG9E 5AQTB 3GWHA 4DUZT 4DR2T 3T1HT 3O9XA 4U33A 1NENA 2JQKA 2C5JA 3U78A 3ZT5A 4I0UA 3LK3B 5JR9B 4CN6A 1UUSA 1YQ4A 2V1DB 2XQ5A 1UGOA 2LSKA 4KHZF 4L0RA 2KZ7B 3M3ZB 3GA8A 2E2AA 3PUGA 4QKNA 5JR9C 2E5LT 1SE7A 2D0UA 1WYCA 2Q9QB 5HXRA 4EIWA 4YSXA 1U4QA 5FL0A 2HH7A 2KXPB 2V6XA 3PUZF 4GIWA 4ILCA 4TWDA 5CGMA 1D1AA 3AEDA 3RPUA 3VKHA 1YD8G 2CHNA 1T98A 2BKNA 2DHRA 5FVKA 5LHHB 2WAUA 2J47A 4XBFB 2JQ9A 4U31A 4E7ZA 2VASA 5LJNA 3J9X1 4HWHA 4ZZCA 3HA4A 5L3DB 2P9BA 2WCAA 2UXDT 2YU2A 3X1DA 1FMVA 3ZEFB 4DV4T 2VKDA 4WW0A 3SFDA 5HEJA 3ZC0A 4O4HE 2NW9A 3J7Yq 1KF6A 1WRDA 3T1YT 3FBZA 2EHOB 5LA6E 3ZMVB 1HNXT 1W09A 4U2ZA 3OKQA 1IJ5A 4ISTA 2LEHA 2WDVA 2V7JA 3F2EA 3RF1A 2XM2A 3RLFF 1BR4A 3UFEA 2E9XC 4QXBB 2X9WA 4OFZA 5HEGA 4JI4T 5AFUL 4E7SA 4EOZB 3NRYA 3AB3B 2KLQA 3LFMA 2K9AA 4I50E 4IL9A 4WNKA 3RYCE 1KNRA 2LJLA 4WZXA 4UELA 5AQOB 3N2GE 4DV5T 4X20E 2A2FX 4GK5E 4PK5A 3PV0F 4ZS2A 1JNRA 1MMDA 3ONLC 2L9QA 2FJAA 3KV6A 2BBHA 3OJAA 3QOFA 4O2AE 2B76A 5FYMA 1S35A 5AQHB 3GN5A 5H6RB 5BR8T 4LF5T 4NXMT 4TUYE 4F6RC 2BG9B 3PTRB 2FBWA 2EHOA 3KV4A 5HWYA 2H89A 5FMNA 2LOPA 2XQ6A 4OX9T 5DABA 3RQWA 4YJ2E 4K0UA 2RP4A 2V7LA 3L09A 5AQVB 3UFGA 4ASKA 2UXBT 4CXWA 5FL1A 3NZPA 4JI8T 5JVDE 3TLSA 2AXDS 5FP3A 4YY3T 4DIDB 2LSIA 3H3MA 4TV9E 3AEFA 3RQUA 1HG2A 3CKDA 1KNPA 2NP9A 3CWZB 5JRCA 2KT9A 3P4RA 1ZEEA 2UUAT 2LSGA 5HXSA 2YEVC 2MAWA 3L8RA 1UX5A 1KNZA 2ZM0A 1J1JA 3FB2A 4JUYA 4DMWA 2X9YA 1KEYA 3RHWA 2H7VC 4CXYA 3ZSSA 1ZHCA 2YDRA 3I9WA 4P09A 2NWBA 2MYSA 3OYXA 3NVOA 3Q9DA 4IDPA 5LNKA 1Z0PA 3PUQA 4YTPA 5HWXA 4IREA 1OEDB 2HPLA 5LB7B 1N32T 3NZQA 2X9HA 3EDVA 4EZHA 3UUNA 2LRKA 3ESLA 2E9XB 4I4TE 4B3MT 5DJQC 2XAGB 1LRZA 1MIWA 1WR0A 2CRBA 2K5BB 3MJXA 5E0OA 4UXNB 5FKYA 3ZYKA 5JRCB 4GYSA 3CQCB 1XDOA 3HKDE 5JDNA 2LT3A 3IA3A 2XPKA 2XQ7A 1E7PA 4HFEA 4PJMA 3ZMZB 3C51A 3SRZA 3ZMTB 2WM9A 2LRLA 3OYZA 4ANJA 4H9OC 3ZC1A 4DO0A 4EZ4A 1W9RA 4H9NC 5FXZA 3L3PA 3Q2MA 1NEKA 1SUMB 4BA9A 2LKGA 2WS3A 2IUBA 3NBXX 4PJNA 3UTKA 1OEDC 4DBRA 1IBKT 4AKGA 2YKSA 1CHUA 2LSJA 4YJ3E 5F8PA 3IEEA 2VQET 5FXXA 2W67A 3E0ZA 3UQ7A 2WDRA 3AAEB 3UU5A 4UVCB 2XQ3A 2X0HA 4I55E 2KWIB 5FNVE 4AISA 4LFBT 1D1BA 3L39A 3N9PA 3SS1A 4UV9B 2PJQA 4CN4A 1M62A 3N9MA 3O1HA 5JQGE 4HFVA 4DR5T 5LBQB 3ONJA 3SOLA 2X0YA 3K1SA 5H6QB 1SHZC 1LVFA 1QSDA 1XNQT 2W66A 4UR9A 4DR7T 4HFIA 4GK0E 1MMAA 4EGWA 1LKXA 5L3BB 4DR6T 4CI2B 2BKPA 5FY7A 2PG8A 3R84B 4GYRA 4BAYB 5LG3A 2W63A 2YK0A 4QX8B 4YTMA 5EK3A 2V7MA 2EHOC 3N9NA 3CIRA 3PUAA 4KP3C 3UU8A 4KX6A 2X68A 3TLTA 3ZN0B 2IC9A 3B5MA 4A56A 4XZCA 5AQIB 2HN1A 4IL4A 2BG9A 4DV1T 4KMCA 3RYHE 4HN9A 4EYUA 1L0VA 1X9BA 1G8XA 2D9DA 4N78D 5AQKB 1BR0A 3N2KE 4U72A 3AE9A 1FJGT 3WI3A 4A97A 4M1PA 5JR9A 1CUNA 2NW7A 5LXTE 3HR0A 2LHNA 3Q5EA 3MK7C 1I94T 2LE8A 3AE8A 3EAMA 3UU4A 2IDOB 4EYYR 2XQ9A 5AQMB 4EAHA 4HWIB 3Q5XA 4AKRB 3K3NA 5JH7E 3LK42 2D2SA 3AA6B 5FY0A 3AEBA 5J2UE 3RIUC
chains in the Genus database with same CATH topology
5CA0E 5KX5E 3E22E 3IHRA 2IW5B 3C50A 4Z8XA 1HTJF 5C8YE 4H63V 4HKAA 3KBUA 4DMVA 4QHOA 4AXPA 3AAAB 4MBQA 4CQIA 3WAJA 2W00A 4XAXB 2IAKA 3FHNA 3T8OA 3C4WA 5LHIB 1MMNA 2JMKA 3CVRA 4G2AA 2E9XA 5HXHA 3AVSA 2CMRA 3WAKA 2WWUA 4ZI2D 4J2CA 5JDFA 4OK0A 3QK6A 5CB4E 1MNDA 4NUUA 1FMWA 1BR1A 2CA5A 2W62A 2N9DA 5JDLA 2WMNA 4OYJA 5IHYA 2LM9A 3ETUA 4ISSA 3KVAA 4HTEA 4IGUA 3AAIA 1HS7A 1NWMX 2ACXA 3K3OA 1YKEB 1H7CA 4MFRA 2C0SA 3EVYA 4U74A 2UXXB 3RH3A 4PFOA 4PJLA 3KDSE 3QC9A 5LP6E 3NRXA 3QUJA 4IIJE 3UUMA 4C91A 2JRKA 2DWGA 2Y48B 3HKBE 1E1HB 2CWYA 1QUUA 3PUSA 4HGAA 1U5PA 3PU8A 3RC8A 3K3QC 4PK6A 3R6NA 2RA1A 3PURA 4WBNE 4O4IE 1WLXA 2XAJB 3JC6D 3K8PC 2Q9QA 2YINA 3RRCA 3C64A 1HF8A 4IE7A 3LJCA 2CE7A 2VWAA 2X66A 4IE6A 2K24A 3KBTA 3LG7A 2NW8A 3TKLB 4B6XA 4ZI2C 3FXEB 5GONE 1G73A 4AQFC 3RRWA 4GOUA 2CM0A 2PFVA 4MALA 2L8KA 3FBLA 4UF0B 2XUEA 3W15B 5DQVA 3O1JA 2W0GA 3EDUA 5L3EB 2ZLYA 4PFPA 5A1LA 1HCIA 2XASB 3BQKA 2VK9A 3H3AA 2BVLA 2C5IT 4CZZB 4AI6A 4AKHA 3D0TA 4MHCA 5LG4A 2LSYA 3MKDA 3P8CD 4IHJE 4IE5A 4YLHA 1FEWA 2N2NA 4G63A 2KNDA 4PJJA 5IYZE 2JQQA 3PDYA 3O4XE 3PE0A 2ES0A 4WBOA 1WR6A 2ZMAA 4ZI7E 2QA7A 3P7IA 2YU1A 2ZM2A 4H9RC 3S4UA 3C4XA 3HI2A 5HXEA 2JMHA 3BQIA 5FXWA 4I43B 3UT5E 4CXXA 3F31A 3ZN1B 1IZNB 2ZM8A 5L3FB 3BK9A 3ZYLA 2C5KT 2EHOD 5LJMA 2M67A 3I9YA 4KBMB 2JPFA 1VRBA 2CXLA 3V5SA 2QGSA 3GMIA 4X1YE 3E08A 2I59A 2BZBA 4JLEA 4P0BA 3VHLA 2J1DG 2A3DA 3I1AA 3N9QA 3B13A 2CEAA 4NUVA 1VOMA 3MXZA 3N5LA 5F3JA 2CXDA 4PNIA 3F57A 5EK4A 2XHEB 3RYFE 2HPJA 3ZMSB 3I0OA 1UCUA 4AKLA 3ANWA 3LBXB 4C90A 1SA0E 3KFWX 4DVDA 5ADXL 2LOSA 3U3IA 2XAQB 2V7IA 3CX6B 4O8SA 1MIVA 4EXTA 3RKOA 2WMOA 3CQGB 3HKEE 3LK2B 3SWHA 1NAFA 2E8IA 4ADZA 2NTYA 3AA7B 2ODUA 2K48A 4ZS3A 5L2LA 1HG5A 1OXZA 4UF0A 4PK4A 2ODVA 3I0QA 2VKOA 5CA1E 5LGUB 2A72A 2Q9QD 4H63H 4UIGA 4H9SE 4BJNA 4CI3B 4QXHB 1Y64B 4X1IE 1AJ3A 5TAOA 3N2OA 4QWNB 2E9XD 4O4LE 5ETWA 5HYAA 3CMLA 5J2TE 1ZV4X 1UX4A 2LHRA 3DJBA 2CWOA 4HEAA 4O4JE 3ZCJA 4IDZA 4QXCB 4DNDA 2CXFA 2JJ9A 4ZI3C 1B7TA 1V9DA 3UUXB 4ZI3D 2DCFA 2XAHB 3DP7A 1D0YA 2X51A 2CLYB 4UVBB 4L5GA 2DI4A 5L3GB 5M4YA 3HKCE 2NOXA 3CX7B 3VKGA 1OWAA 3RX6A 5LOVE 4UV8B 4DBQA 5LGNB 2MBGA 2XAFB 5JREA 2L3LA 4AKIA 3Q5WA 3MZKB 3KVBA 4X1KE 2KINB 4CI1B 2GK9A 4H9PC 4L9IA 1KK7A 2BDEA 2IC6A 4KUMB 2Y6XA 3RYIE 2KMFA 2PBIA 2V7KA 3IBPA 5HXCA 1EZ3A 2W61A 5HAXA 3H37A 3ONXA 3C4ZA 3ZLIA 4ZOLE 3EUHA 3N9LA 1US7B 4BJMA 5JDMA 4AQGA 2H3RA 2X67A 5JDHA 3MACA 2G0UA 3UULA 2WSSV 1BR2A 3ETVA 3ZYMA 2NTXA 3ZPOA 2D5UA 2WBLA 4UEMA 5LGTB 2B1EA 5LBMA 1S94A 4MLKA 4YHJA 5L3CB 3JC6C 1LVKA 3ZCIA 5EK2A 1O3XA 2OA5A 3C98B 3AVRA 1IJ6A 1D1CA 4ZHQE 2SPCA 3BQLA 4OYKA 4IE0A 4P0AA 1X79A 4FJOA 4EB6E 1YW0A 4QX7B 5LYJE 5FY1A 4ILUA 2BVMA 1ZKEA 4O2BE 1WYBA 2DLRA 3KINB 4TN7B 4PW8A 1D0ZA 1HX8A 3B57A 4ERRA 3DTOA 3GN5B 4TZ4C 4JEHB 5KMGP 3OBVE 4JEUB 3O1IA 1D0XA 2X9XA 3AA1B 4V1Av 1FIOA 2XTLA 5EZYE 5JDQA 2D0TA 2V26A 2VKHA 4TX5A 5DQWA 2Y8DA 5LHGB 4HE8A 2H7OA 2N1GA 5LCYA 3VU7H 1YKHB 5J1GA 2UXNB 4FI5A 2VKJA 4IE4A 3ZJ2A 2DNXA 2MOZA 5KDMC 3PU3A 2X0LB 2KWHA 5JDGA 3IF8B 2VL8A 1MMGA 3V5UA 3MA9A 1MIYA 1IAPA 3ANWB 2VB6A 3CPZA 3LBXA 2Z6EA 3HL6A 3ZJ1A 4OHFA 3A5XA 4YFSA 3ZMUB 5BMVE 3AA0B 3CQXC 3N9OA 4UVAB 3KV9A 3RC3A 4TV8E 2CCQA 2MTQA 3FXDB 3CX8B 2CLYC 1HFAA 2Q9QC 2XQYA 3KV5A 4PAGA 1MNEA 2DWKA 4H9QC 3M65A 3GWHA 3O9XA 2C5JA 3U78A 3LK3B 5JR9B 4L0RA 2V1DB 2LSKA 2KZ7B 3GA8A 3PUGA 4QKNA 5JR9C 2D0UA 5HXRA 1WYCA 2Q9QB 4EIWA 1U4QA 2HH7A 2KXPB 4GIWA 3VKHA 1D1AA 3RPUA 1YD8G 1T98A 2DHRA 5LHHB 4XBFB 2WAUA 4E7ZA 2VASA 5LJNA 3J9X1 3HA4A 5L3DB 2P9BA 2YU2A 1FMVA 3ZEFB 2VKDA 4WW0A 3ZC0A 4O4HE 2NW9A 3J7Yq 1WRDA 3FBZA 2EHOB 5LA6E 3ZMVB 3OKQA 1IJ5A 4ISTA 2LEHA 2V7JA 3F2EA 1BR4A 3UFEA 2E9XC 4QXBB 2X9WA 4OFZA 5AFUL 4E7SA 4EOZB 3NRYA 3AB3B 2KLQA 3LFMA 2K9AA 4I50E 4WNKA 3RYCE 2LJLA 4UELA 3N2GE 4X20E 2A2FX 4GK5E 4PK5A 4ZS2A 1MMDA 4O2AE 2L9QA 3KV6A 3OJAA 5FXVA 5FYMA 1S35A 5H6RB 3GN5A 4TUYE 4F6RC 3PTRB 2EHOA 3KV4A 5HWYA 5FMNA 2LOPA 5DABA 4YJ2E 4K0UA 2RP4A 2V7LA 3L09A 4ASKA 4CXWA 3NZPA 5JVDE 5FP3A 2LSIA 4TV9E 1HG2A 3CKDA 2NP9A 3CWZB 5JRCA 2KT9A 1ZEEA 2LSGA 5HXSA 2YEVC 1KNZA 1UX5A 2ZM0A 3FB2A 4DMWA 4JUYA 2X9YA 2H7VC 4CXYA 1ZHCA 3I9WA 4P09A 2NWBA 2MYSA 3OYXA 3Q9DA 5LNKA 1Z0PA 3PUQA 5HWXA 2HPLA 3NZQA 2X9HA 3EDVA 4EZHA 3UUNA 3ESLA 2E9XB 4I4TE 5DJQC 2XAGB 1LRZA 1MIWA 2K5BB 3MJXA 5E0OA 4UXNB 3ZYKA 5JRCB 4GYSA 3CQCB 3HKDE 5JDNA 2LT3A 4PJMA 4AQFA 3ZMZB 3C51A 3SRZA 3ZMTB 2WM9A 3OYZA 4ANJA 4H9OC 3ZC1A 4DO0A 4EZ4A 4H9NC 5FXZA 3L3PA 3Q2MA 4BA9A 3NBXX 4PJNA 3UTKA 4DBRA 4AKGA 2LSJA 4YJ3E 5F8PA 3IEEA 5FXXA 3E0ZA 3AAEB 4UVCB 4I55E 2KWIB 5FNVE 1D1BA 3N9PA 3SS1A 4UV9B 2PJQA 3O1HA 3N9MA 5JQGE 4HFVA 5LBQB 3SOLA 5H6QB 1SHZC 1LVFA 1QSDA 4GK0E 1MMAA 5L3BB 1LKXA 4CI2B 5FY7A 2PG8A 3R84B 4GYRA 4BAYB 2YK0A 2W63A 4QX8B 5EK3A 2V7MA 2EHOC 3N9NA 3PUAA 4KP3C 2X68A 3ZN0B 2IC9A 4A56A 4XZCA 4KMCA 3RYHE 4HN9A 4EYUA 1G8XA 4N78D 1BR0A 3N2KE 4U72A 3WI3A 4M1PA 5JR9A 1CUNA 2NW7A 5LXTE 3HR0A 2LHNA 3MK7C 2LE8A 4EYYR 4EAHA 3Q5XA 4AKRB 3K3NA 5JH7E 3LK42 2D2SA 3AA6B 5FY0A 5J2UE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LJL A;  4AXP A;  2L9Q A; 
#chains in the Genus database with same CATH topology
 5CA0 E;  5KX5 E;  3E22 E;  3IHR A;  1DU2 A;  2IW5 B;  3C50 A;  4Z8X A;  1UUR A;  1HTJ F;  3UU3 A;  5C8Y E;  4H63 V;  4HKA A;  2UUC T;  2BS4 A;  3KBU A;  4DMV A;  4QHO A;  4JI5 T;  4AXP A;  3SFE A;  3AAA B;  2XSB A;  4MBQ A;  4CQI A;  5LHG B;  3WAJ A;  4TWF A;  2W00 A;  4XAX B;  5L4E A;  2IAK A;  3FHN A;  3T8O A;  3C4W A;  3TLV A;  1MMN A;  2JMK A;  2NR4 A;  2XQ4 A;  3CVR A;  5LHI B;  4G2A A;  2E9X A;  5HXH A;  3AVS A;  2CMR A;  3WAK A;  2WWU A;  4U3C A;  4ZI2 D;  4F8H A;  3P50 A;  4J2C A;  5JDF A;  2VUR A;  3P4Q A;  3QK6 A;  4OK0 A;  5CB4 E;  5ABH A;  1MND A;  4NUU A;  1FMW A;  1BR1 A;  2CA5 A;  2QYW A;  4P1N A;  2CBI A;  2W62 A;  2N9D A;  3Q5D A;  2LLY A;  5JDL A;  2WMN A;  4HWD A;  2BKO A;  4OYJ A;  5IHY A;  3RIF A;  2LM9 A;  3ETU A;  4ISS A;  1R8I A;  3KVA A;  4HTE A;  4IGU A;  4DV6 T;  3AAI A;  3FZM B;  3EHZ A;  4JI1 T;  1NWM X;  2ACX A;  3K3O A;  3PUV F;  1HS7 A;  1YKE B;  1H7C A;  2JQH A;  2C0S A;  4MFR A;  3RI5 A;  5J0Z A;  4IT4 A;  3EVY A;  4DV7 T;  4U74 A;  2UXX B;  3RH3 A;  4LF6 T;  4JBW F;  4PFO A;  3RIA A;  4PJL A;  3KDS E;  3QC9 A;  5HEU A;  5LP6 E;  4LF4 T;  3NRX A;  3QUJ A;  4IIJ E;  3UUM A;  4C91 A;  2JRK A;  2DWG A;  2Y48 B;  4ZXL A;  3HKB E;  1E1H B;  2CWY A;  4HFD A;  4TNW A;  5HEH A;  1QUU A;  2R6G F;  3PUS A;  1U5P A;  3PU8 A;  4HGA A;  3RC8 A;  4KHP T;  3K3Q C;  3P4P A;  4Q25 A;  2H88 A;  4PK6 A;  3R6N A;  2RA1 A;  3PUR A;  3AE5 A;  2I0M A;  4WBN E;  1XWM A;  1Z8U A;  4O4I E;  3QB5 K;  1WLX A;  2XY8 B;  1I6Z A;  2XAJ B;  3JC6 D;  2QVA A;  1UK5 A;  3K8P C;  2UU9 T;  2Q9Q A;  2XSA A;  2YIN A;  3RRC A;  2CHO A;  5CJ5 A;  3C64 A;  4AQY T;  1HF8 A;  2PTF A;  4IE7 A;  3LJC A;  2CE7 A;  2VWA A;  2X66 A;  4IE6 A;  2K24 A;  3KBT A;  3LG7 A;  2NW8 A;  4GKJ T;  3ABV A;  3EAB A;  3TKL B;  4B6X A;  4ZI2 C;  3VR8 A;  2WU2 A;  3FXE B;  5GON E;  1G73 A;  4AQF C;  3RRW A;  5L47 A;  4GOU A;  2CM0 A;  2PFV A;  2WP9 A;  4MAL A;  2M6I A;  2L8K A;  3FBL A;  4UF0 B;  2XUE A;  3W15 B;  5DQV A;  5HEO A;  2DL1 A;  4HWF A;  3O1J A;  2W0G A;  3EDU A;  5L3E B;  3JAD A;  1W0B A;  2ZLY A;  4PFP A;  2VL0 A;  5A1L A;  1HCI A;  2FJB A;  2XAS B;  3BQK A;  2HN2 A;  2VK9 A;  3PUX F;  1N36 T;  2CPT A;  2BVL A;  2V6Y B;  2C5I T;  3H3A A;  4CZZ B;  4DV2 T;  1KFY A;  1T7S A;  1IBM T;  4JI0 T;  4AKH A;  3D0T A;  4MHC A;  2VVS A;  5LG4 A;  2LSY A;  1ZP0 A;  2BG9 C;  3MKD A;  3P8C D;  4IHJ E;  2QRX A;  1OED E;  4IE5 A;  4YLH A;  5ABF B;  1FEW A;  5AQF B;  4JYA T;  3UQ4 A;  2N2N A;  4G63 A;  4A98 A;  4GKK T;  2KND A;  4PJJ A;  5IYZ E;  2JQQ A;  1E2A A;  3PDY A;  3O4X E;  2IHR 1;  3PE0 A;  5AQG B;  2ES0 A;  3AE4 A;  4WBO A;  1WR6 A;  2ZMA A;  5AQR B;  2QA7 A;  4ZI7 E;  5IWA T;  3P7I A;  2OLT A;  2AE9 A;  2YU1 A;  2ZM2 A;  3FZF B;  3C4X A;  3HI2 A;  4H9R C;  2JMH A;  3S4U A;  5HXE A;  2CBJ A;  3BQI A;  5FXW A;  4I43 B;  3UT5 E;  4CXX A;  3F31 A;  3ZN1 B;  2YOE A;  1IZN B;  2ZM8 A;  5L3F B;  4YHH T;  1W0A A;  3BK9 A;  4DV3 T;  1ZOY A;  3ZYL A;  2C5K T;  2EHO D;  5CFB A;  5LJM A;  2M67 A;  2I6H A;  2FJE A;  3I9Y A;  4X65 T;  2J62 A;  2KSR A;  4KBM B;  2WB5 A;  2JPF A;  5LGU B;  4IDN A;  2WU5 A;  1VRB A;  2CXL A;  3V5S A;  1J5E T;  2QGS A;  3GMI A;  4X1Y E;  3E08 A;  3VRA A;  4B3S T;  2YDS A;  2I59 A;  2XQ8 A;  3CK6 A;  4DR3 T;  2BZB A;  4Z90 A;  4JLE A;  4P0B A;  3VHL A;  3UUB A;  2J1D G;  2A3D A;  3I1A A;  3N9Q A;  4U7I A;  3LSV A;  4TNV A;  4HFB A;  3B13 A;  5AQS B;  2CEA A;  4NUV A;  1VOM A;  3MXZ A;  3N5L A;  4ZZB A;  2FJD A;  2CXD A;  3PUY F;  4PNI A;  5F3J A;  2E5V A;  3F57 A;  5EK4 A;  2XHE B;  3RYF E;  2HPJ A;  2FUP A;  4KI0 F;  4DUY T;  3ZMS B;  3I0O A;  5ABG A;  3OTO T;  1UCU A;  4AKL A;  3ANW A;  3LBX B;  4C90 A;  1SA0 E;  3KFW X;  4DVD A;  4LFA T;  4ILB A;  5C2T A;  5ADX L;  2LOS A;  3TLU A;  2XAQ B;  2V7I A;  3CX6 B;  3U3I A;  2ZM6 T;  4O8S A;  1MIV A;  4NPP A;  1QLB A;  3RKO A;  2WMO A;  3CQG B;  3HKE E;  4JI2 T;  4EXT A;  3AEE A;  4JV5 T;  3AE1 A;  3LK2 B;  3SWH A;  3PJA J;  1J5W A;  1NAF A;  2E8I A;  4ADZ A;  2NTY A;  3AA7 B;  3RIU A;  2ODU A;  1N33 T;  2K48 A;  4ZS3 A;  5L2L A;  1HR0 T;  1HG5 A;  3AE3 A;  1OXZ A;  4UF0 A;  3JAE A;  4PK4 A;  2ODV A;  3AXJ A;  2VKO A;  3I0Q A;  3NWI A;  2A72 A;  5CA1 E;  5F5W A;  5IUX A;  2Q9Q D;  4H63 H;  4UIG A;  4H9S E;  4BJN A;  4CI3 B;  4QXH B;  1Y64 B;  4X1I E;  3NKZ A;  5TAO A;  3N2O A;  1AJ3 A;  2YDQ A;  4QWN B;  3AE2 A;  2E9X D;  2F4V T;  4O4L E;  5ETW A;  5HYA A;  3CML A;  4NIQ A;  5J2T E;  1ZV4 X;  2OV9 A;  1UX4 A;  2LHR A;  3DJB A;  2CWO A;  4HEA A;  4O4J E;  5ABF A;  3ZCJ A;  4IDZ A;  3FZH B;  3ZST A;  4QXC B;  4DND A;  2CXF A;  2JJ9 A;  4ZI3 C;  3A8Y C;  1B7T A;  1V9D A;  4U2Y A;  3UUX B;  2DCF A;  2XAH B;  3DP7 A;  4ZI3 D;  2V8S V;  5C3J A;  1D0Y A;  2W4X A;  2X51 A;  2CLY B;  4UVB B;  2V6Y A;  4L5G A;  2DI4 A;  5L3G B;  2LKH A;  3HKC E;  2NOX A;  3FZK B;  3OVU A;  5JTG A;  5M4Y A;  3CX7 B;  5FXV A;  3VKG A;  1OWA A;  3AE6 A;  3RX6 A;  4YT0 A;  4HFC A;  5LOV E;  5LMN T;  4UV8 B;  4DBQ A;  4A5X A;  5LGN B;  2MBG A;  3A7M A;  2XAF B;  1XZY A;  1HNW T;  3JCF A;  5JRE A;  4X64 T;  2L3L A;  5AQQ B;  3Q5W A;  4AKI A;  3MZK B;  3KVB A;  4U7Y A;  2KIN B;  3P4S A;  2GK9 A;  4H9P C;  4X1K E;  4CI1 B;  4L9I A;  1IBL T;  1KK7 A;  2BDE A;  4AIU A;  4QH1 A;  2IC6 A;  4KUM B;  1JNZ A;  5L4H A;  2Y6X A;  1WFD A;  3RKG A;  3RYI E;  2UUB T;  2UXC T;  4AI6 A;  2KMF A;  2PBI A;  1XMO T;  5AQU B;  2BBJ A;  2V7K A;  3IBP A;  3QB5 A;  1EZ3 A;  5HXC A;  4LF7 T;  4Z91 A;  4B3R T;  1XDP A;  2XJ7 A;  1N34 T;  2K3W A;  2XQA A;  2W61 A;  5HAX A;  3H37 A;  3ONX A;  4EEB A;  3C4Z A;  3PJA A;  3ZLI A;  3ZT7 A;  4ZOL E;  4LML A;  5KXJ A;  3EUH A;  3N9L A;  3VR9 A;  2W2U A;  1US7 B;  2V5D A;  4BJM A;  4QH5 A;  5JDM A;  4AQG A;  5ABE A;  2XM1 A;  2H3R A;  3AEC A;  3P4W A;  2X67 A;  2MPK A;  2YN6 A;  2IML A;  3AEA A;  3MAC A;  2G0U A;  4YXD A;  5JDH A;  3UUL A;  2WSS V;  1BR2 A;  3ETV A;  3G06 A;  3ZYM A;  5LMU T;  4JI3 T;  2NTX A;  3ZPO A;  2D5U A;  4YSZ A;  4X62 T;  2WBL A;  4UEM A;  4X5T A;  5LGT B;  1YXR A;  2B1E A;  3PUW F;  4LF9 T;  3FZL B;  5LBM A;  2VQF T;  4B3T T;  1S94 A;  4MLK A;  3ZT6 A;  4YHJ A;  1OED A;  5L3C B;  3JC6 C;  4K0K T;  3OPC A;  3UU6 A;  4ZEY A;  1LVK A;  1VCS A;  4JI7 T;  3ZCI A;  1Y01 A;  5EK2 A;  1O3X A;  2OA5 A;  3C98 B;  3AVR A;  5HCJ A;  1IJ6 A;  4DV0 T;  1XNR T;  2XZE A;  1D1C A;  3EI0 A;  2SPC A;  3BQL A;  4OYK A;  2WDQ A;  4ZHQ E;  4IE0 A;  4P0A A;  4DR4 T;  1X79 A;  4FJO A;  4EB6 E;  1YW0 A;  4QX7 B;  3AE7 A;  2RPA A;  5FY1 A;  5LYJ E;  3LDQ B;  2WY2 A;  4ILU A;  4WYV A;  5FVL A;  2BVM A;  1ZKE A;  4IDQ A;  1WCR A;  4O2B E;  5AQN B;  1GQE A;  1WYB A;  2DLR A;  3AXJ B;  3KIN B;  4TN7 B;  1HX1 B;  4PW8 A;  2ACZ A;  2BS2 A;  1D0Z A;  4HFH A;  2JIW A;  1HX8 A;  3B57 A;  3RGL A;  4ERR A;  4LMK A;  3JAF A;  2IIU A;  1YQ3 A;  3DTO A;  3GN5 B;  4YSY A;  4NXN T;  3QNU A;  4TZ4 C;  4CN1 A;  4JEH B;  5KMG P;  3OBV E;  4JEU B;  4QH4 A;  5AQJ B;  1VCT A;  4LFC T;  3O1I A;  1D0X A;  2X9X A;  3AA1 B;  4V1A v;  1FIO A;  2XTL A;  5EZY E;  5JDQ A;  2D0T A;  2V26 A;  2VKH A;  4TX5 A;  5AQP B;  1XMQ T;  5DQW A;  5AQL B;  4DR1 T;  2Y8D A;  4ILA A;  4HE8 A;  2H7O A;  2N1G A;  5LCY A;  3VU7 H;  4EV6 A;  1YKH B;  5J1G A;  4EED A;  1T8B A;  2UXN B;  3VRB A;  4AQF A;  4FI5 A;  4HWC A;  4LF8 T;  4X66 T;  2V5C A;  2VKJ A;  4IE4 A;  3ZJ2 A;  2DNX A;  2MOZ A;  5KDM C;  3PU3 A;  2X0L B;  4LMJ A;  2A9U A;  2KWH A;  5JDG A;  4YTN A;  3TLW A;  3IF8 B;  2VL8 A;  1MMG A;  3V5U A;  4COF A;  2M6B A;  1MIY A;  3MA9 A;  2VVN A;  2WWV A;  3ZKR A;  1IAP A;  3ANW B;  2VB6 A;  3CPZ A;  3LBX A;  2Z6E A;  3HL6 A;  2WZI A;  3ZJ1 A;  2WZH A;  4OHF A;  3A5X A;  1T72 A;  4IDO A;  3AEG A;  4YFS A;  2J4G A;  3AA0 B;  3ZMU B;  5BMV E;  2BS3 A;  3CQX C;  1M7K A;  2LM2 A;  3N9O A;  4TWH A;  3KV9 A;  4UVA B;  3RC3 A;  4TV8 E;  2CCQ A;  2MTQ A;  3FXD B;  1HNZ T;  2HHH T;  3CX8 B;  4JI6 T;  2WQY A;  2CLY C;  1HFA A;  2Q9Q C;  5HCM A;  2XQY A;  3KV5 A;  4PAG A;  1MNE A;  2DWK A;  4H9Q C;  3M65 A;  2BG9 E;  5AQT B;  3GWH A;  4DUZ T;  4DR2 T;  3T1H T;  3O9X A;  4U33 A;  1NEN A;  2JQK A;  2C5J A;  3U78 A;  3ZT5 A;  4I0U A;  3LK3 B;  5JR9 B;  4CN6 A;  1UUS A;  1YQ4 A;  2V1D B;  2XQ5 A;  1UGO A;  2LSK A;  4KHZ F;  4L0R A;  2KZ7 B;  3M3Z B;  3GA8 A;  2E2A A;  3PUG A;  4QKN A;  5JR9 C;  2E5L T;  1SE7 A;  2D0U A;  1WYC A;  2Q9Q B;  5HXR A;  4EIW A;  4YSX A;  1U4Q A;  5FL0 A;  2HH7 A;  2KXP B;  2V6X A;  3PUZ F;  4GIW A;  4ILC A;  4TWD A;  5CGM A;  1D1A A;  3AED A;  3RPU A;  3VKH A;  1YD8 G;  2CHN A;  1T98 A;  2BKN A;  2DHR A;  5FVK A;  5LHH B;  2WAU A;  2J47 A;  4XBF B;  2JQ9 A;  4U31 A;  4E7Z A;  2VAS A;  5LJN A;  3J9X 1;  4HWH A;  4ZZC A;  3HA4 A;  5L3D B;  2P9B A;  2WCA A;  2UXD T;  2YU2 A;  3X1D A;  1FMV A;  3ZEF B;  4DV4 T;  2VKD A;  4WW0 A;  3SFD A;  5HEJ A;  3ZC0 A;  4O4H E;  2NW9 A;  3J7Y q;  1KF6 A;  1WRD A;  3T1Y T;  3FBZ A;  2EHO B;  5LA6 E;  3ZMV B;  1HNX T;  1W09 A;  4U2Z A;  3OKQ A;  1IJ5 A;  4IST A;  2LEH A;  2WDV A;  2V7J A;  3F2E A;  3RF1 A;  2XM2 A;  3RLF F;  1BR4 A;  3UFE A;  2E9X C;  4QXB B;  2X9W A;  4OFZ A;  5HEG A;  4JI4 T;  5AFU L;  4E7S A;  4EOZ B;  3NRY A;  3AB3 B;  2KLQ A;  3LFM A;  2K9A A;  4I50 E;  4IL9 A;  4WNK A;  3RYC E;  1KNR A;  2LJL A;  4WZX A;  4UEL A;  5AQO B;  3N2G E;  4DV5 T;  4X20 E;  2A2F X;  4GK5 E;  4PK5 A;  3PV0 F;  4ZS2 A;  1JNR A;  1MMD A;  3ONL C;  2L9Q A;  2FJA A;  3KV6 A;  2BBH A;  3OJA A;  3QOF A;  4O2A E;  2B76 A;  5FYM A;  1S35 A;  5AQH B;  3GN5 A;  5H6R B;  5BR8 T;  4LF5 T;  4NXM T;  4TUY E;  4F6R C;  2BG9 B;  3PTR B;  2FBW A;  2EHO A;  3KV4 A;  5HWY A;  2H89 A;  5FMN A;  2LOP A;  2XQ6 A;  4OX9 T;  5DAB A;  3RQW A;  4YJ2 E;  4K0U A;  2RP4 A;  2V7L A;  3L09 A;  5AQV B;  3UFG A;  4ASK A;  2UXB T;  4CXW A;  5FL1 A;  3NZP A;  4JI8 T;  5JVD E;  3TLS A;  2AXD S;  5FP3 A;  4YY3 T;  4DID B;  2LSI A;  3H3M A;  4TV9 E;  3AEF A;  3RQU A;  1HG2 A;  3CKD A;  1KNP A;  2NP9 A;  3CWZ B;  5JRC A;  2KT9 A;  3P4R A;  1ZEE A;  2UUA T;  2LSG A;  5HXS A;  2YEV C;  2MAW A;  3L8R A;  1UX5 A;  1KNZ A;  2ZM0 A;  1J1J A;  3FB2 A;  4JUY A;  4DMW A;  2X9Y A;  1KEY A;  3RHW A;  2H7V C;  4CXY A;  3ZSS A;  1ZHC A;  2YDR A;  3I9W A;  4P09 A;  2NWB A;  2MYS A;  3OYX A;  3NVO A;  3Q9D A;  4IDP A;  5LNK A;  1Z0P A;  3PUQ A;  4YTP A;  5HWX A;  4IRE A;  1OED B;  2HPL A;  5LB7 B;  1N32 T;  3NZQ A;  2X9H A;  3EDV A;  4EZH A;  3UUN A;  2LRK A;  3ESL A;  2E9X B;  4I4T E;  4B3M T;  5DJQ C;  2XAG B;  1LRZ A;  1MIW A;  1WR0 A;  2CRB A;  2K5B B;  3MJX A;  5E0O A;  4UXN B;  5FKY A;  3ZYK A;  5JRC B;  4GYS A;  3CQC B;  1XDO A;  3HKD E;  5JDN A;  2LT3 A;  3IA3 A;  2XPK A;  2XQ7 A;  1E7P A;  4HFE A;  4PJM A;  3ZMZ B;  3C51 A;  3SRZ A;  3ZMT B;  2WM9 A;  2LRL A;  3OYZ A;  4ANJ A;  4H9O C;  3ZC1 A;  4DO0 A;  4EZ4 A;  1W9R A;  4H9N C;  5FXZ A;  3L3P A;  3Q2M A;  1NEK A;  1SUM B;  4BA9 A;  2LKG A;  2WS3 A;  2IUB A;  3NBX X;  4PJN A;  3UTK A;  1OED C;  4DBR A;  1IBK T;  4AKG A;  2YKS A;  1CHU A;  2LSJ A;  4YJ3 E;  5F8P A;  3IEE A;  2VQE T;  5FXX A;  2W67 A;  3E0Z A;  3UQ7 A;  2WDR A;  3AAE B;  3UU5 A;  4UVC B;  2XQ3 A;  2X0H A;  4I55 E;  2KWI B;  5FNV E;  4AIS A;  4LFB T;  1D1B A;  3L39 A;  3N9P A;  3SS1 A;  4UV9 B;  2PJQ A;  4CN4 A;  1M62 A;  3N9M A;  3O1H A;  5JQG E;  4HFV A;  4DR5 T;  5LBQ B;  3ONJ A;  3SOL A;  2X0Y A;  3K1S A;  5H6Q B;  1SHZ C;  1LVF A;  1QSD A;  1XNQ T;  2W66 A;  4UR9 A;  4DR7 T;  4HFI A;  4GK0 E;  1MMA A;  4EGW A;  1LKX A;  5L3B B;  4DR6 T;  4CI2 B;  2BKP A;  5FY7 A;  2PG8 A;  3R84 B;  4GYR A;  4BAY B;  5LG3 A;  2W63 A;  2YK0 A;  4QX8 B;  4YTM A;  5EK3 A;  2V7M A;  2EHO C;  3N9N A;  3CIR A;  3PUA A;  4KP3 C;  3UU8 A;  4KX6 A;  2X68 A;  3TLT A;  3ZN0 B;  2IC9 A;  3B5M A;  4A56 A;  4XZC A;  5AQI B;  2HN1 A;  4IL4 A;  2BG9 A;  4DV1 T;  4KMC A;  3RYH E;  4HN9 A;  4EYU A;  1L0V A;  1X9B A;  1G8X A;  2D9D A;  4N78 D;  5AQK B;  1BR0 A;  3N2K E;  4U72 A;  3AE9 A;  1FJG T;  3WI3 A;  4A97 A;  4M1P A;  5JR9 A;  1CUN A;  2NW7 A;  5LXT E;  3HR0 A;  2LHN A;  3Q5E A;  3MK7 C;  1I94 T;  2LE8 A;  3AE8 A;  3EAM A;  3UU4 A;  2IDO B;  4EYY R;  2XQ9 A;  5AQM B;  4EAH A;  4HWI B;  3Q5X A;  4AKR B;  3K3N A;  5JH7 E;  3LK4 2;  2D2S A;  3AA6 B;  5FY0 A;  3AEB A;  5J2U E;  3RIU C; 
#chains in the Genus database with same CATH homology
 5CA0 E;  5KX5 E;  3E22 E;  3IHR A;  2IW5 B;  3C50 A;  4Z8X A;  1HTJ F;  5C8Y E;  4H63 V;  4HKA A;  3KBU A;  4DMV A;  4QHO A;  4AXP A;  3AAA B;  4MBQ A;  4CQI A;  3WAJ A;  2W00 A;  4XAX B;  2IAK A;  3FHN A;  3T8O A;  3C4W A;  5LHI B;  1MMN A;  2JMK A;  3CVR A;  4G2A A;  2E9X A;  5HXH A;  3AVS A;  2CMR A;  3WAK A;  2WWU A;  4ZI2 D;  4J2C A;  5JDF A;  4OK0 A;  3QK6 A;  5CB4 E;  1MND A;  4NUU A;  1FMW A;  1BR1 A;  2CA5 A;  2W62 A;  2N9D A;  5JDL A;  2WMN A;  4OYJ A;  5IHY A;  2LM9 A;  3ETU A;  4ISS A;  3KVA A;  4HTE A;  4IGU A;  3AAI A;  1HS7 A;  1NWM X;  2ACX A;  3K3O A;  1YKE B;  1H7C A;  4MFR A;  2C0S A;  3EVY A;  4U74 A;  2UXX B;  3RH3 A;  4PFO A;  4PJL A;  3KDS E;  3QC9 A;  5LP6 E;  3NRX A;  3QUJ A;  4IIJ E;  3UUM A;  4C91 A;  2JRK A;  2DWG A;  2Y48 B;  3HKB E;  1E1H B;  2CWY A;  1QUU A;  3PUS A;  4HGA A;  1U5P A;  3PU8 A;  3RC8 A;  3K3Q C;  4PK6 A;  3R6N A;  2RA1 A;  3PUR A;  4WBN E;  4O4I E;  1WLX A;  2XAJ B;  3JC6 D;  3K8P C;  2Q9Q A;  2YIN A;  3RRC A;  3C64 A;  1HF8 A;  4IE7 A;  3LJC A;  2CE7 A;  2VWA A;  2X66 A;  4IE6 A;  2K24 A;  3KBT A;  3LG7 A;  2NW8 A;  3TKL B;  4B6X A;  4ZI2 C;  3FXE B;  5GON E;  1G73 A;  4AQF C;  3RRW A;  4GOU A;  2CM0 A;  2PFV A;  4MAL A;  2L8K A;  3FBL A;  4UF0 B;  2XUE A;  3W15 B;  5DQV A;  3O1J A;  2W0G A;  3EDU A;  5L3E B;  2ZLY A;  4PFP A;  5A1L A;  1HCI A;  2XAS B;  3BQK A;  2VK9 A;  3H3A A;  2BVL A;  2C5I T;  4CZZ B;  4AI6 A;  4AKH A;  3D0T A;  4MHC A;  5LG4 A;  2LSY A;  3MKD A;  3P8C D;  4IHJ E;  4IE5 A;  4YLH A;  1FEW A;  2N2N A;  4G63 A;  2KND A;  4PJJ A;  5IYZ E;  2JQQ A;  3PDY A;  3O4X E;  3PE0 A;  2ES0 A;  4WBO A;  1WR6 A;  2ZMA A;  4ZI7 E;  2QA7 A;  3P7I A;  2YU1 A;  2ZM2 A;  4H9R C;  3S4U A;  3C4X A;  3HI2 A;  5HXE A;  2JMH A;  3BQI A;  5FXW A;  4I43 B;  3UT5 E;  4CXX A;  3F31 A;  3ZN1 B;  1IZN B;  2ZM8 A;  5L3F B;  3BK9 A;  3ZYL A;  2C5K T;  2EHO D;  5LJM A;  2M67 A;  3I9Y A;  4KBM B;  2JPF A;  1VRB A;  2CXL A;  3V5S A;  2QGS A;  3GMI A;  4X1Y E;  3E08 A;  2I59 A;  2BZB A;  4JLE A;  4P0B A;  3VHL A;  2J1D G;  2A3D A;  3I1A A;  3N9Q A;  3B13 A;  2CEA A;  4NUV A;  1VOM A;  3MXZ A;  3N5L A;  5F3J A;  2CXD A;  4PNI A;  3F57 A;  5EK4 A;  2XHE B;  3RYF E;  2HPJ A;  3ZMS B;  3I0O A;  1UCU A;  4AKL A;  3ANW A;  3LBX B;  4C90 A;  1SA0 E;  3KFW X;  4DVD A;  5ADX L;  2LOS A;  3U3I A;  2XAQ B;  2V7I A;  3CX6 B;  4O8S A;  1MIV A;  4EXT A;  3RKO A;  2WMO A;  3CQG B;  3HKE E;  3LK2 B;  3SWH A;  1NAF A;  2E8I A;  4ADZ A;  2NTY A;  3AA7 B;  2ODU A;  2K48 A;  4ZS3 A;  5L2L A;  1HG5 A;  1OXZ A;  4UF0 A;  4PK4 A;  2ODV A;  3I0Q A;  2VKO A;  5CA1 E;  5LGU B;  2A72 A;  2Q9Q D;  4H63 H;  4UIG A;  4H9S E;  4BJN A;  4CI3 B;  4QXH B;  1Y64 B;  4X1I E;  1AJ3 A;  5TAO A;  3N2O A;  4QWN B;  2E9X D;  4O4L E;  5ETW A;  5HYA A;  3CML A;  5J2T E;  1ZV4 X;  1UX4 A;  2LHR A;  3DJB A;  2CWO A;  4HEA A;  4O4J E;  3ZCJ A;  4IDZ A;  4QXC B;  4DND A;  2CXF A;  2JJ9 A;  4ZI3 C;  1B7T A;  1V9D A;  3UUX B;  4ZI3 D;  2DCF A;  2XAH B;  3DP7 A;  1D0Y A;  2X51 A;  2CLY B;  4UVB B;  4L5G A;  2DI4 A;  5L3G B;  5M4Y A;  3HKC E;  2NOX A;  3CX7 B;  3VKG A;  1OWA A;  3RX6 A;  5LOV E;  4UV8 B;  4DBQ A;  5LGN B;  2MBG A;  2XAF B;  5JRE A;  2L3L A;  4AKI A;  3Q5W A;  3MZK B;  3KVB A;  4X1K E;  2KIN B;  4CI1 B;  2GK9 A;  4H9P C;  4L9I A;  1KK7 A;  2BDE A;  2IC6 A;  4KUM B;  2Y6X A;  3RYI E;  2KMF A;  2PBI A;  2V7K A;  3IBP A;  5HXC A;  1EZ3 A;  2W61 A;  5HAX A;  3H37 A;  3ONX A;  3C4Z A;  3ZLI A;  4ZOL E;  3EUH A;  3N9L A;  1US7 B;  4BJM A;  5JDM A;  4AQG A;  2H3R A;  2X67 A;  5JDH A;  3MAC A;  2G0U A;  3UUL A;  2WSS V;  1BR2 A;  3ETV A;  3ZYM A;  2NTX A;  3ZPO A;  2D5U A;  2WBL A;  4UEM A;  5LGT B;  2B1E A;  5LBM A;  1S94 A;  4MLK A;  4YHJ A;  5L3C B;  3JC6 C;  1LVK A;  3ZCI A;  5EK2 A;  1O3X A;  2OA5 A;  3C98 B;  3AVR A;  1IJ6 A;  1D1C A;  4ZHQ E;  2SPC A;  3BQL A;  4OYK A;  4IE0 A;  4P0A A;  1X79 A;  4FJO A;  4EB6 E;  1YW0 A;  4QX7 B;  5LYJ E;  5FY1 A;  4ILU A;  2BVM A;  1ZKE A;  4O2B E;  1WYB A;  2DLR A;  3KIN B;  4TN7 B;  4PW8 A;  1D0Z A;  1HX8 A;  3B57 A;  4ERR A;  3DTO A;  3GN5 B;  4TZ4 C;  4JEH B;  5KMG P;  3OBV E;  4JEU B;  3O1I A;  1D0X A;  2X9X A;  3AA1 B;  4V1A v;  1FIO A;  2XTL A;  5EZY E;  5JDQ A;  2D0T A;  2V26 A;  2VKH A;  4TX5 A;  5DQW A;  2Y8D A;  5LHG B;  4HE8 A;  2H7O A;  2N1G A;  5LCY A;  3VU7 H;  1YKH B;  5J1G A;  2UXN B;  4FI5 A;  2VKJ A;  4IE4 A;  3ZJ2 A;  2DNX A;  2MOZ A;  5KDM C;  3PU3 A;  2X0L B;  2KWH A;  5JDG A;  3IF8 B;  2VL8 A;  1MMG A;  3V5U A;  3MA9 A;  1MIY A;  1IAP A;  3ANW B;  2VB6 A;  3CPZ A;  3LBX A;  2Z6E A;  3HL6 A;  3ZJ1 A;  4OHF A;  3A5X A;  4YFS A;  3ZMU B;  5BMV E;  3AA0 B;  3CQX C;  3N9O A;  4UVA B;  3KV9 A;  3RC3 A;  4TV8 E;  2CCQ A;  2MTQ A;  3FXD B;  3CX8 B;  2CLY C;  1HFA A;  2Q9Q C;  2XQY A;  3KV5 A;  4PAG A;  1MNE A;  2DWK A;  4H9Q C;  3M65 A;  3GWH A;  3O9X A;  2C5J A;  3U78 A;  3LK3 B;  5JR9 B;  4L0R A;  2V1D B;  2LSK A;  2KZ7 B;  3GA8 A;  3PUG A;  4QKN A;  5JR9 C;  2D0U A;  5HXR A;  1WYC A;  2Q9Q B;  4EIW A;  1U4Q A;  2HH7 A;  2KXP B;  4GIW A;  3VKH A;  1D1A A;  3RPU A;  1YD8 G;  1T98 A;  2DHR A;  5LHH B;  4XBF B;  2WAU A;  4E7Z A;  2VAS A;  5LJN A;  3J9X 1;  3HA4 A;  5L3D B;  2P9B A;  2YU2 A;  1FMV A;  3ZEF B;  2VKD A;  4WW0 A;  3ZC0 A;  4O4H E;  2NW9 A;  3J7Y q;  1WRD A;  3FBZ A;  2EHO B;  5LA6 E;  3ZMV B;  3OKQ A;  1IJ5 A;  4IST A;  2LEH A;  2V7J A;  3F2E A;  1BR4 A;  3UFE A;  2E9X C;  4QXB B;  2X9W A;  4OFZ A;  5AFU L;  4E7S A;  4EOZ B;  3NRY A;  3AB3 B;  2KLQ A;  3LFM A;  2K9A A;  4I50 E;  4WNK A;  3RYC E;  2LJL A;  4UEL A;  3N2G E;  4X20 E;  2A2F X;  4GK5 E;  4PK5 A;  4ZS2 A;  1MMD A;  4O2A E;  2L9Q A;  3KV6 A;  3OJA A;  5FXV A;  5FYM A;  1S35 A;  5H6R B;  3GN5 A;  4TUY E;  4F6R C;  3PTR B;  2EHO A;  3KV4 A;  5HWY A;  5FMN A;  2LOP A;  5DAB A;  4YJ2 E;  4K0U A;  2RP4 A;  2V7L A;  3L09 A;  4ASK A;  4CXW A;  3NZP A;  5JVD E;  5FP3 A;  2LSI A;  4TV9 E;  1HG2 A;  3CKD A;  2NP9 A;  3CWZ B;  5JRC A;  2KT9 A;  1ZEE A;  2LSG A;  5HXS A;  2YEV C;  1KNZ A;  1UX5 A;  2ZM0 A;  3FB2 A;  4DMW A;  4JUY A;  2X9Y A;  2H7V C;  4CXY A;  1ZHC A;  3I9W A;  4P09 A;  2NWB A;  2MYS A;  3OYX A;  3Q9D A;  5LNK A;  1Z0P A;  3PUQ A;  5HWX A;  2HPL A;  3NZQ A;  2X9H A;  3EDV A;  4EZH A;  3UUN A;  3ESL A;  2E9X B;  4I4T E;  5DJQ C;  2XAG B;  1LRZ A;  1MIW A;  2K5B B;  3MJX A;  5E0O A;  4UXN B;  3ZYK A;  5JRC B;  4GYS A;  3CQC B;  3HKD E;  5JDN A;  2LT3 A;  4PJM A;  4AQF A;  3ZMZ B;  3C51 A;  3SRZ A;  3ZMT B;  2WM9 A;  3OYZ A;  4ANJ A;  4H9O C;  3ZC1 A;  4DO0 A;  4EZ4 A;  4H9N C;  5FXZ A;  3L3P A;  3Q2M A;  4BA9 A;  3NBX X;  4PJN A;  3UTK A;  4DBR A;  4AKG A;  2LSJ A;  4YJ3 E;  5F8P A;  3IEE A;  5FXX A;  3E0Z A;  3AAE B;  4UVC B;  4I55 E;  2KWI B;  5FNV E;  1D1B A;  3N9P A;  3SS1 A;  4UV9 B;  2PJQ A;  3O1H A;  3N9M A;  5JQG E;  4HFV A;  5LBQ B;  3SOL A;  5H6Q B;  1SHZ C;  1LVF A;  1QSD A;  4GK0 E;  1MMA A;  5L3B B;  1LKX A;  4CI2 B;  5FY7 A;  2PG8 A;  3R84 B;  4GYR A;  4BAY B;  2YK0 A;  2W63 A;  4QX8 B;  5EK3 A;  2V7M A;  2EHO C;  3N9N A;  3PUA A;  4KP3 C;  2X68 A;  3ZN0 B;  2IC9 A;  4A56 A;  4XZC A;  4KMC A;  3RYH E;  4HN9 A;  4EYU A;  1G8X A;  4N78 D;  1BR0 A;  3N2K E;  4U72 A;  3WI3 A;  4M1P A;  5JR9 A;  1CUN A;  2NW7 A;  5LXT E;  3HR0 A;  2LHN A;  3MK7 C;  2LE8 A;  4EYY R;  4EAH A;  3Q5X A;  4AKR B;  3K3N A;  5JH7 E;  3LK4 2;  2D2S A;  3AA6 B;  5FY0 A;  5J2U E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...