2LJLA

Nmr structure of hsp12 in the presence of dpc
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
109
structure length
109
Chain Sequence
MSDAGRKGFGEKASEALKPDSQKSYAEQGKEYITDKADKVAGKVQPEDNKGVFQGVHDSAEKGKDNAEGQGESLADQARDYMGAAKSKLNDAVEYVSGRVHGEEDPTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of Hsp12, the heat shock protein from Saccharomyces cerevisiae, in aqueous solution where it is intrinsically disordered and in detergent micelles where it is locally alpha-helical.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
molecule keywords 12 kDa heat shock protein
total genus 12
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2011-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04119 HSP9_HSP12 Heat shock protein 9/12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1260 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2ljlA01
2LJLA 2L9QA 4AXPA
chains in the Genus database with same CATH superfamily
2V26A 5FL0A 2E5VA 5HEHA 3EHZA 3QB5A 2CHNA 4YLHA 4JLEA 5HAXA 3U3IA 5AFUL 4G2AA 4DR2T 4GYRA 3UQ7A 4UF0A 4XBFB 2CLYB 1HS7A 4CI3B 4DV2T 5EK4A 3NKZA 3MXZA 2Q9QD 1JNRA 4DV5T 3QB5K 4GKJT 3RH3A 3UQ4A 4U31A 3F31A 3FXDB 2NTXA 3ESLA 2EHOD 2M6IA 3JCFA 3I9YA 3MKDA 2B76A 3WAKA 5L3DB 1XMOT 2LOPA 1T98A 2WDVA 1WFDA 3BK9A 5JQGE 1FJGT 1UX4A 2CEAA 3PUGA 3RIAA 1HNWT 2UXXB 4ILCA 2CWYA 2LSYA 1E2AA 3HL6A 2YOEA 3AEAA 4TNWA 3DJBA 2K9AA 3PU3A 4YXDA 4C91A 4IL4A 2KWIB 3SFDA 5FY7A 5JTGA 1WCRA 3CWZB 3OVUA 4ZEYA 4YJ3E 4HWDA 2VKHA 2YK0A 2WDQA 3EDUA 1GQEA 2XM2A 4HKAA 2DHRA 4KX6A 2LHRA 1W0AA 3VRAA 4CXYA 2E9XA 4IREA 4OYKA 2PJQA 4HFCA 2A3DA 2BZBA 2WAUA 5AQGB 4DV6T 1N34T 3FXEB 2ZLYA 3L39A 4TN7B 4DVDA 2NOXA 3RLFF 5ABFA 3E22E 3GMIA 2F4VT 4KBMB 4H9SE 2PTFA 1R8IA 4U7YA 4MALA 4MBQA 3EAMA 2BKOA 4WNKA 3RQWA 4UXNB 2X68A 3RKGA 3PE0A 3PUQA 5ETWA 5LCYA 2UXCT 2IC6A 1Z0PA 4PFOA 1D1AA 4IDZA 2YDQA 2V7IA 3PV0F 3RHWA 1U5PA 2C5KT 3AE6A 4LMLA 5CJ5A 2KXPB 5L4HA 3TLTA 2QVAA 4O4LE 5HWYA 3SFEA 4DMWA 1IBMT 3F2EA 3W15B 3ZLIA 4U3CA 4DIDB 5ABHA 4X66T 2H89A 5GONE 1T8BA 4DR1T 2V7MA 3V5SA 2LLYA 2JRKA 4PJLA 5HXRA 4I43B 2MOZA 4HWFA 5LHIB 4X5TA 1YD8G 3KBTA 2XQ3A 3BQIA 4ZI2D 1IZNB 2D0TA 3LSVA 4JI5T 3ZEFB 1QUUA 4CN6A 3CPZA 3J9X1 4TV9E 3AE2A 3IEEA 2ACXA 1UUSA 5IWAT 3ZMZB 5EZYE 1T72A 4DMVA 3LK3B 4IT4A 4BAYB 5L3EB 4AKGA 1SE7A 3AXJB 5J2UE 4ZI7E 1U4QA 2LKGA 4KI0F 3C4WA 5DQVA 1FIOA 1KNPA 3UUBA 1XNRT 1W9RA 2XQYA 1FEWA 1Y64B 4DUYT 1E1HB 5FKYA 2Y48B 2BBHA 4L9IA 2ES0A 5AQHB 3RIUA 3K1SA 4QH1A 4BJNA 4EEDA 1KNZA 3NZQA 1WRDA 3AVRA 1ZHCA 2VKDA 3ZMSB 2KT9A 3WAJA 2XY8B 2VKOA 4Z8XA 2CBIA 2VASA 4E7ZA 4JI1T 4IDOA 4EGWA 4EV6A 4DV4T 2ZM0A 2IMLA 2FJDA 3EI0A 4U2ZA 2D0UA 2A9UA 2V8SV 3L09A 2MBGA 1V9DA 4L5GA 3ZYKA 2CXLA 2DWKA 2UUAT 3HKDE 2VKJA 1MNDA 3T8OA 4JI7T 1KK7A 2HH7A 4U72A 3AEBA 3M65A 1XDOA 1LRZA 2BVLA 3NRXA 2UU9T 2UUBT 2CMRA 4GYSA 2BS3A 4HWHA 4I55E 2WZHA 1CHUA 3LBXB 3BQLA 4XAXB 3RRCA 4EOZB 3AE1A 1HR0T 3PUZF 2WMNA 5AQVB 1HNZT 3FB2A 4JI3T 5HYAA 4MLKA 1OEDA 5L4EA 2D9DA 2NW8A 3UUMA 4K0KT 2XJ7A 3ZN1B 1DU2A 1ZOYA 3N9QA 4DV0T 3TLSA 4QXBB 3MJXA 2H88A 1D0XA 3PUXF 1BR4A 2IUBA 3RIFA 1BR0A 1OXZA 2B1EA 3NRYA 3PUSA 2X9YA 4JEUB 4ZZCA 2XHEB 5JREA 2BS4A 4AISA 4LFAT 2V5DA 4F6RC 1ZKEA 2WWUA 2D2SA 2L8KA 4DV3T 2VQFT 3F57A 3UU4A 4GIWA 4KHPT 1E7PA 3FBZA 2IIUA 2LSJA 5TAOA 3TKLB 3C4ZA 4B3TT 2BG9C 2XAFB 4NUVA 5DQWA 1MMNA 3UTKA 1OWAA 1VCSA 4IHJE 3JAEA 3QK6A 2LSKA 2HPJA 5HCMA 4X64T 2Y6XA 3ANWA 4LF6T 4DBQA 2LKHA 3ETVA 5IYZE 5L47A 1BR1A 4HFIA 4CXWA 3Q5DA 5AQKB 4CN4A 4EZ4A 5LG4A 2FJBA 2YEVC 3ONXA 1HFAA 4UVCB 5F5WA 2WBLA 2K3WA 1I6ZA 2AE9A 2C0SA 2JQ9A 2KWHA 2QYWA 3I0QA 3ONLC 2BKNA 4TWHA 5FY0A 3TLUA 2MYSA 1OEDE 2DWGA 4O2AE 2YINA 3EVYA 3LDQB 4PNIA 1EZ3A 3T1YT 1UX5A 2WSSV 4PW8A 4QH5A 2DI4A 3AEGA 4UF0B 4YY3T 5LHHB 5L2LA 3N9MA 2W4XA 3N2GE 2N9DA 3M3ZB 3N9LA 3OPCA 3PTRB 4LMKA 5FYMA 5FXZA 5JR9A 1HNXT 4JYAT 4LF8T 3VKHA 3H37A 4YHHT 1N36T 2NW7A 4XZCA 2HN2A 1VRBA 2CM0A 3CIRA 5JH7E 1NAFA 4UIGA 5L3GB 3OTOT 4L0RA 3V5UA 5LMNT 2EHOC 2NTYA 4QX7B 2XQ9A 2IHR1 2HPLA 3CX6B 3PUAA 4TNVA 3GA8A 4TV8E 5AQTB 4YJ2E 2E5LT 3KVBA 3UULA 3N2OA 4A56A 3B5MA 2YU2A 4HTEA 3FZKB 5AQUB 2W2UA 5CFBA 1JNZA 4HEAA 2Q9QC 4GKKT 2JQHA 3N9NA 1D0ZA 3UT5E 3ZSTA 1IJ6A 1YKEB 2W61A 5E0OA 2Z6EA 2E9XB 5LNKA 1WLXA 5DABA 5LB7B 3RPUA 4EYUA 4DR4T 4YTPA 4H9PC 5LGNB 2CXDA 4JUYA 2M67A 4KMCA 3H3MA 2XQ8A 3KINB 2V7LA 3LK2B 3N9PA 4O8SA 3ZYLA 4DV7T 3RYIE 2UUCT 5FXWA 5M4YA 2XAGB 3MA9A 4GK0E 4AQGA 2CCQA 5EK2A 2W00A 4IE7A 3T1HT 5JVDE 2FJEA 2FJAA 1WR6A 5FXXA 4UELA 2E9XD 3C51A 3AAEB 3ETUA 5A1LA 1MIYA 3P4PA 4H9QC 2WB5A 3AAIA 3I0OA 2LJLA 3OBVE 4AQFA 2YU1A 4E7SA 4TZ4C 2CLYC 2XASB 3GN5A 2LSGA 3I9WA 3PURA 3D0TA 2W67A 4PK5A 3ZJ2A 3K8PC 4PJJA 4DR3T 4I50E 2K24A 1M62A 2NP9A 4TWFA 5H6QB 2BVMA 3IF8B 2UXDT 1VOMA 3E0ZA 4PK6A 4YSXA 5HEJA 3OKQA 2Y8DA 3N2KE 2JMHA 4FJOA 4O4HE 3J7Yq 3O9XA 2KMFA 2WU2A 1D1CA 2A2FX 2ODUA 4JEHB 4AXPA 3ANWB 2UXNB 3K3NA 4TUYE 2CXFA 4B6XA 5LP6E 2K48A 2M6BA 5AQLB 2XTLA 2V6YA 4PAGA 4OFZA 4ILUA 4X65T 3ZYMA 3S4UA 5LHGB 5HXEA 4JI2T 2I0MA 5EK3A 2J4GA 4H9NC 3NZPA 1WR0A 2KNDA 3AA1B 1MMAA 3CX7B 4P0BA 3RYFE 5H6RB 1IBKT 4AKHA 4CI2B 3P4QA 2RPAA 4ISSA 3AB3B 1YKHB 2XAHB 2ZM8A 4PFPA 2QGSA 4X1YE 2X9WA 4LFBT 1MNEA 3PUYF 3OYZA 2ODVA 4YFSA 5LJMA 4ERRA 2A72A 3WI3A 4AKLA 4JI4T 2UXBT 4DR5T 4DBRA 2Q9QB 5HXCA 3ZPOA 4JBWF 2WU5A 2PBIA 3ZT6A 3QOFA 3AE9A 4DO0A 1IAPA 3RGLA 4LF9T 4UV8B 2LRKA 2X0YA 4LF5T 3ZCIA 2KLQA 3HR0A 2OV9A 2VL0A 2XUEA 3KFWX 2J47A 2YN6A 1YQ3A 3X1DA 5LMUT 1UURA 3O1HA 4IDNA 3NWIA 5CA0E 1YQ4A 3AA6B 3PDYA 2XQ5A 3P7IA 1UCUA 1MIWA 2ACZA 5FP3A 4ZI3C 4BJMA 4OX9T 1LVFA 4JI0T 5JDMA 2GK9A 2H3RA 3JC6C 4YTMA 3Q5EA 4N78D 3LG7A 3QNUA 2NW9A 1N32T 1X9BA 3RQUA 3O1JA 4H63V 4QX8B 2CE7A 5AQFB 5CB4E 2D5UA 3UU5A 4KUMB 4X1KE 2BBJA 2V1DB 3P8CD 5AQRB 5F3JA 2LM9A 2WS3A 3EABA 4HWCA 4A5XA 5BR8T 2X67A 5L3BB 1UGOA 4IL9A 3HKBE 3NVOA 3HA4A 4GOUA 2CHOA 3ZMVB 2OA5A 4IE6A 5CGMA 4U33A 4QHOA 1IJ5A 4UR9A 3BQKA 2EHOB 3VRBA 5IUXA 2E9XC 2VURA 5HCJA 3UUNA 4QXHB 3OJAA 1L0VA 4AKRB 3N9OA 2BG9B 3JAFA 5AQMB 5AQPB 3R6NA 4ADZA 4QH4A 1J5WA 3UU6A 3P4WA 5JDGA 2W0GA 1MMDA 2CRBA 1O3XA 2X0LB 5AQJB 3RF1A 1SA0E 3LBXA 2R6GF 4PK4A 3EDVA 3AA0B 5KX5E 5LGUB 1IBLT 3FBLA 3AE8A 1QLBA 4LF7T 4ASKA 4QKNA 1HX1B 3FHNA 3OYXA 5JR9B 4EAHA 4B3RT 4Q25A 3AEFA 3A5XA 2LE8A 1YW0A 2G0UA 1QSDA 2LT3A 3O4XE 2QRXA 2LHNA 5ABGA 2XZEA 3TLVA 4EZHA 2W63A 2FBWA 4ANJA 1CUNA 5HEGA 4NUUA 5KMGP 1S94A 3ZT7A 4I4TE 2C5JA 2DLRA 2HHHT 4HN9A 1MIVA 4P0AA 3UU8A 5JDQA 1NWMX 1US7B 3MZKB 4P1NA 3G06A 5F8PA 2MAWA 3P4SA 2JIWA 4IE5A 4WYVA 4CQIA 1UK5A 2JQKA 4IGUA 2BKPA 2C5IT 2ZM2A 3C98B 3LJCA 4YSYA 5C3JA 3RC8A 4DR6T 2H7OA 1D1BA 1HCIA 5ABFB 3AE5A 5HWXA 5LGTB 3TLWA 5LBQB 2W66A 4EEBA 1HTJF 3Q5WA 1S35A 4HFEA 4U74A 1KNRA 4ZOLE 4ISTA 4WBOA 5HEOA 5LBMA 4OHFA 3CK6A 3A7MA 3B13A 4IE0A 5CA1E 3FZFB 4EXTA 1FMWA 2RA1A 4OYJA 4ZS2A 1J1JA 2OLTA 3Q5XA 5IHYA 1M7KA 2X51A 2WP9A 3AXJA 2WCAA 3CQGB 4ILAA 1N33T 1G8XA 1HF8A 1HX8A 3E08A 3L3PA 4MFRA 4YTNA 2CWOA 3HKCE 3Q9DA 3U78A 4GK5E 1KFYA 3KV5A 4WZXA 2VB6A 4C90A 2I6HA 4X1IE 4EIWA 1OEDB 2WWVA 3VR8A 2J1DG 3VU7H 5J2TE 4UVBB 1G73A 2JPFA 1HG2A 4OK0A 3ZN0B 3H3AA 3PU8A 3PJAA 2K5BB 5L3FB 3CKDA 3AAAB 5LA6E 5LJNA 2WM9A 4YSZA 3P4RA 3C50A 3LFMA 4LF4T 3HKEE 2CA5A 3FZMB 4IIJE 2WZIA 4EYYR 2N1GA 4WW0A 2X66A 3FZHB 4HFHA 5HEUA 3P50A 5AQQB 1KF6A 1XDPA 2P9BA 4YHJA 3RYHE 1AJ3A 3VKGA 2BS2A 3AECA 3ONJA 2SPCA 5ADXL 1SHZC 3I1AA 1WYBA 1Z8UA 3MACA 4P09A 1XNQT 3AEDA 3DP7A 1MMGA 3CQCB 3CX8B 3VR9A 2EHOA 2V7JA 1J5ET 4NXMT 3ZMUB 5J0ZA 2IDOB 3ZJ1A 2CBJA 2H7VC 3SOLA 3RI5A 3SRZA 4K0UA 4DV1T 4ZI3D 4X62T 3CVRA 4ZXLA 2YDRA 2LEHA 1I94T 1D0YA 4AIUA 1LKXA 5JR9C 4A97A 3AVSA 4ZI2C 5FL1A 4TX5A 4JI8T 3K3QC 3ZC1A 4I0UA 3L8RA 2LSIA 3AEEA 4V1Av 2VWAA 3HI2A 4QXCB 5AQSB 3UFGA 2VL8A 1X79A 3R84B 3RIUC 2VQET 3MK7C 4PJMA 4UV9B 4Z90A 5HXSA 3AA7B 3IHRA 4M1PA 4H63H 5LXTE 2RP4A 2VK9A 4MHCA 3IA3A 3GN5B 1NEKA 5J1GA 4AKIA 2PFVA 1XMQT 2IW5B 2DNXA 3FZLB 4JV5T 2CPTA 3UFEA 4H9OC 3Q2MA 3UUXB 2PG8A 4TWDA 3RYCE 3C64A 3LK42 2V5CA 4QWNB 4IDPA 4ILBA 2X9XA 3ZKRA 4COFA 2XM1A 3JC6D 5LG3A 2QA7A 4UEMA 4AQYT 4X20E 1W09A 2XQAA 2FUPA 1BR2A 2YKSA 4HWIB 5C8YE 3C4XA 1VCTA 2J62A 2JJ9A 1XWMA 4WBNE 1YXRA 2MTQA 4U2YA 3ZSSA 4NXNT 2X0HA 3QUJA 5LYJE 2V7KA 5FMNA 2VVNA 1H7CA 2XPKA 2L3LA 4DNDA 4G63A 2VVSA 2KZ7B 4HFVA 5ABEA 2I59A 2V6XA 4ZS3A 2BG9A 2XQ4A 2DL1A 4LMJA 2MPKA 4CN1A 5DJQC 4ZZBA 3KBUA 5JRCB 4BA9A 2BDEA 1SUMB 3CQXC 3AE4A 2IAKA 3PJAJ 3KV6A 3VHLA 4AI6A 3NBXX 4IDQA 1XZYA 1KEYA 2XQ6A 4DUZT 4B3MT 4CI1B 2X9HA 2DCFA 2XAQB 3KDSE 3SS1A 5L3CB 4LFCT 2LOSA 1ZP0A 2WDRA 2V6YB 2WMOA 2HN1A 3KV4A 4U7IA 4A98A 4ZHQE 5KDMC 2ZM6T 3RX6A 5KXJA 4O4JE 2WY2A 3GWHA 3AE7A 4CXXA 3PUVF 2NR4A 3QC9A 5FNVE 3B57A 1OEDC 2YDSA 2XSAA 3DTOA 1Y01A 3O1IA 2JMKA 4HFBA 5AQIB 5JDFA 2E8IA 4O4IE 1LVKA 3JADA 1B7TA 4HFDA 3UU3A 2LM2A 3K3OA 4B3ST 4HE8A 2AXDS 4O2BE 5C2TA 4DR7T 3AE3A 4PJNA 3KVAA 2E2AA 5JDNA 2KINB 4H9RC 2XSBA 4IE4A 1ZV4X 3ABVA 3RRWA 3ZT5A 4NIQA 2NWBA 2XQ7A 3RKOA 5BMVE 1FMVA 3EUHA 2BG9E 1WYCA 4F8HA 1ZEEA 2W62A 3IBPA 4J2CA 3RC3A 4FI5A 4AQFC 4Z91A 1NENA 5FY1A 4YT0A 2ZMAA 5HXHA 4NPPA 2WQYA 2Q9QA 1T7SA 4KP3C 5AQOB 3ZCJA 5JDHA 2JQQA 5LOVE 3A8YC 4JI6T 5JRCA 3CMLA 3PUWF 4UVAB 4CZZB 1HG5A 3N5LA 2LRLA 3KV9A 4HGAA 2IC9A 3ZMTB 2XAJB 2L9QA 5FVKA 2N2NA 5JDLA 5FXVA 3SWHA 3ZC0A 2KSRA 4EB6E 1W0BA 5FVLA 5AQNB 4KHZF
chains in the Genus database with same CATH topology
2V26A 4YLHA 4JLEA 5HAXA 3U3IA 5AFUL 4G2AA 4GYRA 4UF0A 4XBFB 2CLYB 1HS7A 4CI3B 5EK4A 3MXZA 2Q9QD 3RH3A 3F31A 3FXDB 2NTXA 3ESLA 2EHOD 3I9YA 3MKDA 3WAKA 5L3DB 2LOPA 1T98A 3BK9A 5JQGE 1UX4A 2CEAA 3PUGA 2UXXB 2CWYA 2LSYA 3HL6A 3DJBA 2K9AA 3PU3A 4C91A 2KWIB 5FY7A 3CWZB 2VKHA 2YK0A 3EDUA 4HKAA 2DHRA 2LHRA 4CXYA 2E9XA 4OYKA 2PJQA 2A3DA 2BZBA 2WAUA 3FXEB 2ZLYA 4TN7B 4DVDA 2NOXA 3E22E 3GMIA 4KBMB 4H9SE 4MALA 4MBQA 4WNKA 4UXNB 2X68A 3PE0A 3PUQA 5ETWA 5LCYA 2IC6A 1Z0PA 4PFOA 1D1AA 4IDZA 2V7IA 1U5PA 2C5KT 2KXPB 4DMWA 5HWYA 4O4LE 3F2EA 3W15B 3ZLIA 5GONE 2V7MA 3V5SA 2JRKA 4PJLA 5HXRA 4I43B 2MOZA 5LHIB 1YD8G 3KBTA 3BQIA 4ZI2D 1IZNB 2D0TA 3ZEFB 1QUUA 3CPZA 3J9X1 4TV9E 3IEEA 2ACXA 3ZMZB 5EZYE 4DMVA 5L3EB 3LK3B 4BAYB 4AKGA 5J2UE 4ZI7E 1U4QA 3C4WA 5DQVA 1FIOA 2XQYA 1FEWA 1Y64B 1E1HB 2Y48B 4L9IA 2ES0A 4BJNA 1KNZA 3NZQA 1WRDA 3AVRA 1ZHCA 2VKDA 3ZMSB 2KT9A 3WAJA 2VKOA 4Z8XA 2VASA 4E7ZA 2ZM0A 2D0UA 3L09A 2MBGA 1V9DA 4L5GA 3ZYKA 2CXLA 2DWKA 3HKDE 2VKJA 1MNDA 3T8OA 1KK7A 2HH7A 4U72A 3NRXA 3M65A 1LRZA 2BVLA 2CMRA 4GYSA 4I55E 3RRCA 3LBXB 3BQLA 4XAXB 4EOZB 2WMNA 3FB2A 5HYAA 4MLKA 2NW8A 3UUMA 3ZN1B 3N9QA 4QXBB 3MJXA 1D0XA 1BR4A 1BR0A 1OXZA 2B1EA 3NRYA 3PUSA 2X9YA 4JEUB 2XHEB 5JREA 4F6RC 1ZKEA 2WWUA 2D2SA 2L8KA 3F57A 4GIWA 3FBZA 5TAOA 2LSJA 3TKLB 3C4ZA 2XAFB 5DQWA 4NUVA 3UTKA 1MMNA 1OWAA 4IHJE 3QK6A 2LSKA 2HPJA 2Y6XA 3ANWA 4DBQA 5IYZE 3ETVA 1BR1A 4EZ4A 4CXWA 5LG4A 2YEVC 3ONXA 1HFAA 4UVCB 2WBLA 3I0QA 2C0SA 2KWHA 5FY0A 2MYSA 2DWGA 4O2AE 2YINA 3EVYA 4PNIA 1EZ3A 1UX5A 2WSSV 4PW8A 2DI4A 4UF0B 5LHHB 5L2LA 3N9MA 3N2GE 2N9DA 3N9LA 3PTRB 5FXZA 5FYMA 5JR9A 3VKHA 3H37A 2NW7A 4XZCA 1VRBA 2CM0A 5JH7E 1NAFA 4UIGA 5L3GB 4L0RA 3V5UA 2EHOC 2NTYA 4QX7B 4TV8E 3CX6B 2HPLA 3PUAA 4YJ2E 3GA8A 3KVBA 3UULA 3N2OA 4A56A 4HTEA 2YU2A 4HEAA 2Q9QC 3N9NA 3UT5E 1D0ZA 1IJ6A 1YKEB 2W61A 5E0OA 2Z6EA 2E9XB 5LNKA 1WLXA 5DABA 3RPUA 4EYUA 4H9PC 5LGNB 2CXDA 4JUYA 2M67A 4KMCA 3KINB 2V7LA 3LK2B 3N9PA 4O8SA 3ZYLA 3RYIE 5FXWA 5M4YA 2XAGB 3MA9A 4GK0E 4AQGA 2CCQA 5EK2A 2W00A 4IE7A 5JVDE 1WR6A 5FXXA 4UELA 2E9XD 3C51A 3AAEB 3ETUA 5A1LA 1MIYA 4H9QC 3AAIA 3I0OA 2LJLA 3OBVE 4AQFA 2YU1A 4E7SA 4TZ4C 2CLYC 2XASB 3GN5A 2LSGA 3I9WA 3PURA 3D0TA 4PK5A 4YJ3E 3ZJ2A 3K8PC 4PJJA 4I50E 2K24A 2NP9A 5H6QB 2BVMA 3IF8B 1VOMA 3E0ZA 4PK6A 3OKQA 2Y8DA 3N2KE 2JMHA 4FJOA 4O4HE 3J7Yq 3O9XA 2KMFA 4JEHB 1D1CA 2A2FX 2ODUA 4AXPA 3ANWB 2UXNB 3K3NA 4TUYE 2CXFA 4B6XA 5LP6E 2K48A 2XTLA 4PAGA 4OFZA 4ILUA 3ZYMA 3S4UA 5LHGB 5HXEA 5EK3A 4H9NC 3NZPA 3RYFE 2KNDA 3AA1B 1MMAA 3CX7B 4P0BA 5H6RB 4AKHA 4CI2B 4ISSA 3AB3B 1YKHB 2XAHB 2ZM8A 4PFPA 2QGSA 4X1YE 2X9WA 1MNEA 5LJMA 3OYZA 2ODVA 4YFSA 2A72A 3WI3A 4AKLA 4DBRA 2Q9QB 5HXCA 3ZPOA 2PBIA 4DO0A 1IAPA 4UV8B 3ZCIA 2KLQA 3HR0A 2XUEA 3KFWX 3O1HA 5CA0E 3PDYA 3AA6B 4ZI3C 3P7IA 1UCUA 1MIWA 5FP3A 4BJMA 1LVFA 5JDMA 2GK9A 2H3RA 3JC6C 4N78D 3LG7A 2NW9A 3O1JA 4H63V 4QX8B 2CE7A 5CB4E 2D5UA 4KUMB 4X1KE 2V1DB 3P8CD 5F3JA 2LM9A 2X67A 5L3BB 3HKBE 3HA4A 4GOUA 3ZMVB 2OA5A 4IE6A 4QHOA 1IJ5A 3BQKA 2EHOB 2E9XC 3UUNA 4QXHB 3OJAA 4AKRB 3N9OA 4ADZA 3R6NA 5JDGA 2W0GA 1MMDA 4CXXA 1O3XA 2X0LB 1SA0E 3LBXA 4PK4A 3EDVA 3AA0B 5KX5E 5LGUB 3FBLA 4ASKA 4QKNA 3FHNA 3OYXA 5JR9B 4EAHA 3A5XA 2LE8A 1YW0A 2G0UA 1QSDA 2LT3A 3O4XE 2LHNA 4EZHA 2W63A 4ANJA 1CUNA 4NUUA 5KMGP 1S94A 4I4TE 2C5JA 2DLRA 4HN9A 1MIVA 4P0AA 5JDQA 1NWMX 1US7B 3MZKB 5F8PA 4IE5A 4CQIA 4ERRA 4IGUA 5JRCB 2C5IT 2ZM2A 3C98B 3LJCA 3RC8A 2H7OA 1HCIA 1D1BA 5HWXA 5LGTB 5LBQB 1HTJF 3Q5WA 1S35A 4U74A 4ZOLE 4ISTA 4WBOA 5LBMA 4OHFA 3B13A 4IE0A 5CA1E 4EXTA 1FMWA 2RA1A 4OYJA 4ZS2A 3Q5XA 5IHYA 2X51A 3CQGB 1G8XA 1HF8A 1HX8A 3E08A 3L3PA 4MFRA 2CWOA 3HKCE 3Q9DA 3U78A 4GK5E 3KV5A 4C90A 2VB6A 4X1IE 4EIWA 2J1DG 3VU7H 5J2TE 4UVBB 1G73A 2JPFA 1HG2A 4OK0A 3ZN0B 3H3AA 3PU8A 2K5BB 5L3FB 3CKDA 3AAAB 5LA6E 5LJNA 2WM9A 3C50A 3LFMA 3HKEE 2CA5A 4IIJE 4EYYR 2N1GA 4WW0A 2X66A 2P9BA 4YHJA 3RYHE 1AJ3A 3VKGA 2SPCA 5ADXL 1SHZC 3I1AA 1WYBA 3MACA 4P09A 3DP7A 1MMGA 3CQCB 3CX8B 2EHOA 2V7JA 3ZMUB 3ZJ1A 2H7VC 3SOLA 3SRZA 4K0UA 4ZI3D 3CVRA 2LEHA 1D0YA 5JR9C 1LKXA 3AVSA 4ZI2C 4TX5A 3K3QC 3ZC1A 2LSIA 4V1Av 2VWAA 3HI2A 4QXCB 2VL8A 1X79A 3R84B 3MK7C 4PJMA 4UV9B 5HXSA 3AA7B 3IHRA 4M1PA 4H63H 5LXTE 2RP4A 2VK9A 4MHCA 3GN5B 5J1GA 4AKIA 2PFVA 2IW5B 2DNXA 3UFEA 4H9OC 3Q2MA 3UUXB 2PG8A 3RYCE 3C64A 3LK42 4QWNB 2X9XA 3JC6D 2QA7A 4UEMA 4X20E 5C8YE 1BR2A 3C4XA 2JJ9A 4WBNE 2MTQA 3QUJA 5LYJE 2V7KA 5FMNA 1H7CA 2L3LA 4DNDA 4G63A 2KZ7B 4HFVA 2I59A 4ZS3A 5DJQC 3KBUA 4BA9A 2BDEA 3CQXC 2IAKA 3KV6A 3VHLA 4AI6A 3NBXX 4CI1B 2X9HA 2DCFA 2XAQB 3KDSE 3SS1A 5L3CB 2LOSA 4ZHQE 2WMOA 3KV4A 5KDMC 3RX6A 4O4JE 3GWHA 5FNVE 3QC9A 3B57A 3DTOA 3O1IA 5JDFA 2JMKA 2E8IA 4O4IE 1LVKA 1B7TA 3K3OA 4HE8A 4O2BE 4PJNA 3KVAA 5JDNA 2KINB 4H9RC 4IE4A 1ZV4X 3RRWA 2NWBA 3RKOA 5BMVE 1FMVA 3EUHA 1WYCA 1ZEEA 2W62A 3IBPA 4J2CA 3RC3A 4FI5A 4AQFC 5FY1A 2ZMAA 5HXHA 2Q9QA 4KP3C 3ZCJA 5JDHA 2JQQA 5LOVE 5JRCA 3CMLA 4UVAB 4CZZB 1HG5A 3N5LA 3KV9A 4HGAA 2IC9A 3ZMTB 2XAJB 2L9QA 2N2NA 5JDLA 5FXVA 3SWHA 3ZC0A 4EB6E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LJL A;  2L9Q A;  4AXP A; 
#chains in the Genus database with same CATH topology
 2V26 A;  5FL0 A;  2E5V A;  5HEH A;  3EHZ A;  3QB5 A;  2CHN A;  4YLH A;  4JLE A;  5HAX A;  3U3I A;  5AFU L;  4G2A A;  4DR2 T;  4GYR A;  3UQ7 A;  4UF0 A;  4XBF B;  2CLY B;  1HS7 A;  4CI3 B;  4DV2 T;  5EK4 A;  3NKZ A;  3MXZ A;  2Q9Q D;  1JNR A;  4DV5 T;  3QB5 K;  4GKJ T;  3RH3 A;  3UQ4 A;  4U31 A;  3F31 A;  3FXD B;  2NTX A;  3ESL A;  2EHO D;  2M6I A;  3JCF A;  3I9Y A;  3MKD A;  2B76 A;  3WAK A;  5L3D B;  1XMO T;  2LOP A;  1T98 A;  2WDV A;  1WFD A;  3BK9 A;  5JQG E;  1FJG T;  1UX4 A;  2CEA A;  3PUG A;  3RIA A;  1HNW T;  2UXX B;  4ILC A;  2CWY A;  2LSY A;  1E2A A;  3HL6 A;  2YOE A;  3AEA A;  4TNW A;  3DJB A;  2K9A A;  3PU3 A;  4YXD A;  4C91 A;  4IL4 A;  2KWI B;  3SFD A;  5FY7 A;  5JTG A;  1WCR A;  3CWZ B;  3OVU A;  4ZEY A;  4YJ3 E;  4HWD A;  2VKH A;  2YK0 A;  2WDQ A;  3EDU A;  1GQE A;  2XM2 A;  4HKA A;  2DHR A;  4KX6 A;  2LHR A;  1W0A A;  3VRA A;  4CXY A;  2E9X A;  4IRE A;  4OYK A;  2PJQ A;  4HFC A;  2A3D A;  2BZB A;  2WAU A;  5AQG B;  4DV6 T;  1N34 T;  3FXE B;  2ZLY A;  3L39 A;  4TN7 B;  4DVD A;  2NOX A;  3RLF F;  5ABF A;  3E22 E;  3GMI A;  2F4V T;  4KBM B;  4H9S E;  2PTF A;  1R8I A;  4U7Y A;  4MAL A;  4MBQ A;  3EAM A;  2BKO A;  4WNK A;  3RQW A;  4UXN B;  2X68 A;  3RKG A;  3PE0 A;  3PUQ A;  5ETW A;  5LCY A;  2UXC T;  2IC6 A;  1Z0P A;  4PFO A;  1D1A A;  4IDZ A;  2YDQ A;  2V7I A;  3PV0 F;  3RHW A;  1U5P A;  2C5K T;  3AE6 A;  4LML A;  5CJ5 A;  2KXP B;  5L4H A;  3TLT A;  2QVA A;  4O4L E;  5HWY A;  3SFE A;  4DMW A;  1IBM T;  3F2E A;  3W15 B;  3ZLI A;  4U3C A;  4DID B;  5ABH A;  4X66 T;  2H89 A;  5GON E;  1T8B A;  4DR1 T;  2V7M A;  3V5S A;  2LLY A;  2JRK A;  4PJL A;  5HXR A;  4I43 B;  2MOZ A;  4HWF A;  5LHI B;  4X5T A;  1YD8 G;  3KBT A;  2XQ3 A;  3BQI A;  4ZI2 D;  1IZN B;  2D0T A;  3LSV A;  4JI5 T;  3ZEF B;  1QUU A;  4CN6 A;  3CPZ A;  3J9X 1;  4TV9 E;  3AE2 A;  3IEE A;  2ACX A;  1UUS A;  5IWA T;  3ZMZ B;  5EZY E;  1T72 A;  4DMV A;  3LK3 B;  4IT4 A;  4BAY B;  5L3E B;  4AKG A;  1SE7 A;  3AXJ B;  5J2U E;  4ZI7 E;  1U4Q A;  2LKG A;  4KI0 F;  3C4W A;  5DQV A;  1FIO A;  1KNP A;  3UUB A;  1XNR T;  1W9R A;  2XQY A;  1FEW A;  1Y64 B;  4DUY T;  1E1H B;  5FKY A;  2Y48 B;  2BBH A;  4L9I A;  2ES0 A;  5AQH B;  3RIU A;  3K1S A;  4QH1 A;  4BJN A;  4EED A;  1KNZ A;  3NZQ A;  1WRD A;  3AVR A;  1ZHC A;  2VKD A;  3ZMS B;  2KT9 A;  3WAJ A;  2XY8 B;  2VKO A;  4Z8X A;  2CBI A;  2VAS A;  4E7Z A;  4JI1 T;  4IDO A;  4EGW A;  4EV6 A;  4DV4 T;  2ZM0 A;  2IML A;  2FJD A;  3EI0 A;  4U2Z A;  2D0U A;  2A9U A;  2V8S V;  3L09 A;  2MBG A;  1V9D A;  4L5G A;  3ZYK A;  2CXL A;  2DWK A;  2UUA T;  3HKD E;  2VKJ A;  1MND A;  3T8O A;  4JI7 T;  1KK7 A;  2HH7 A;  4U72 A;  3AEB A;  3M65 A;  1XDO A;  1LRZ A;  2BVL A;  3NRX A;  2UU9 T;  2UUB T;  2CMR A;  4GYS A;  2BS3 A;  4HWH A;  4I55 E;  2WZH A;  1CHU A;  3LBX B;  3BQL A;  4XAX B;  3RRC A;  4EOZ B;  3AE1 A;  1HR0 T;  3PUZ F;  2WMN A;  5AQV B;  1HNZ T;  3FB2 A;  4JI3 T;  5HYA A;  4MLK A;  1OED A;  5L4E A;  2D9D A;  2NW8 A;  3UUM A;  4K0K T;  2XJ7 A;  3ZN1 B;  1DU2 A;  1ZOY A;  3N9Q A;  4DV0 T;  3TLS A;  4QXB B;  3MJX A;  2H88 A;  1D0X A;  3PUX F;  1BR4 A;  2IUB A;  3RIF A;  1BR0 A;  1OXZ A;  2B1E A;  3NRY A;  3PUS A;  2X9Y A;  4JEU B;  4ZZC A;  2XHE B;  5JRE A;  2BS4 A;  4AIS A;  4LFA T;  2V5D A;  4F6R C;  1ZKE A;  2WWU A;  2D2S A;  2L8K A;  4DV3 T;  2VQF T;  3F57 A;  3UU4 A;  4GIW A;  4KHP T;  1E7P A;  3FBZ A;  2IIU A;  2LSJ A;  5TAO A;  3TKL B;  3C4Z A;  4B3T T;  2BG9 C;  2XAF B;  4NUV A;  5DQW A;  1MMN A;  3UTK A;  1OWA A;  1VCS A;  4IHJ E;  3JAE A;  3QK6 A;  2LSK A;  2HPJ A;  5HCM A;  4X64 T;  2Y6X A;  3ANW A;  4LF6 T;  4DBQ A;  2LKH A;  3ETV A;  5IYZ E;  5L47 A;  1BR1 A;  4HFI A;  4CXW A;  3Q5D A;  5AQK B;  4CN4 A;  4EZ4 A;  5LG4 A;  2FJB A;  2YEV C;  3ONX A;  1HFA A;  4UVC B;  5F5W A;  2WBL A;  2K3W A;  1I6Z A;  2AE9 A;  2C0S A;  2JQ9 A;  2KWH A;  2QYW A;  3I0Q A;  3ONL C;  2BKN A;  4TWH A;  5FY0 A;  3TLU A;  2MYS A;  1OED E;  2DWG A;  4O2A E;  2YIN A;  3EVY A;  3LDQ B;  4PNI A;  1EZ3 A;  3T1Y T;  1UX5 A;  2WSS V;  4PW8 A;  4QH5 A;  2DI4 A;  3AEG A;  4UF0 B;  4YY3 T;  5LHH B;  5L2L A;  3N9M A;  2W4X A;  3N2G E;  2N9D A;  3M3Z B;  3N9L A;  3OPC A;  3PTR B;  4LMK A;  5FYM A;  5FXZ A;  5JR9 A;  1HNX T;  4JYA T;  4LF8 T;  3VKH A;  3H37 A;  4YHH T;  1N36 T;  2NW7 A;  4XZC A;  2HN2 A;  1VRB A;  2CM0 A;  3CIR A;  5JH7 E;  1NAF A;  4UIG A;  5L3G B;  3OTO T;  4L0R A;  3V5U A;  5LMN T;  2EHO C;  2NTY A;  4QX7 B;  2XQ9 A;  2IHR 1;  2HPL A;  3CX6 B;  3PUA A;  4TNV A;  3GA8 A;  4TV8 E;  5AQT B;  4YJ2 E;  2E5L T;  3KVB A;  3UUL A;  3N2O A;  4A56 A;  3B5M A;  2YU2 A;  4HTE A;  3FZK B;  5AQU B;  2W2U A;  5CFB A;  1JNZ A;  4HEA A;  2Q9Q C;  4GKK T;  2JQH A;  3N9N A;  1D0Z A;  3UT5 E;  3ZST A;  1IJ6 A;  1YKE B;  2W61 A;  5E0O A;  2Z6E A;  2E9X B;  5LNK A;  1WLX A;  5DAB A;  5LB7 B;  3RPU A;  4EYU A;  4DR4 T;  4YTP A;  4H9P C;  5LGN B;  2CXD A;  4JUY A;  2M67 A;  4KMC A;  3H3M A;  2XQ8 A;  3KIN B;  2V7L A;  3LK2 B;  3N9P A;  4O8S A;  3ZYL A;  4DV7 T;  3RYI E;  2UUC T;  5FXW A;  5M4Y A;  2XAG B;  3MA9 A;  4GK0 E;  4AQG A;  2CCQ A;  5EK2 A;  2W00 A;  4IE7 A;  3T1H T;  5JVD E;  2FJE A;  2FJA A;  1WR6 A;  5FXX A;  4UEL A;  2E9X D;  3C51 A;  3AAE B;  3ETU A;  5A1L A;  1MIY A;  3P4P A;  4H9Q C;  2WB5 A;  3AAI A;  3I0O A;  2LJL A;  3OBV E;  4AQF A;  2YU1 A;  4E7S A;  4TZ4 C;  2CLY C;  2XAS B;  3GN5 A;  2LSG A;  3I9W A;  3PUR A;  3D0T A;  2W67 A;  4PK5 A;  3ZJ2 A;  3K8P C;  4PJJ A;  4DR3 T;  4I50 E;  2K24 A;  1M62 A;  2NP9 A;  4TWF A;  5H6Q B;  2BVM A;  3IF8 B;  2UXD T;  1VOM A;  3E0Z A;  4PK6 A;  4YSX A;  5HEJ A;  3OKQ A;  2Y8D A;  3N2K E;  2JMH A;  4FJO A;  4O4H E;  3J7Y q;  3O9X A;  2KMF A;  2WU2 A;  1D1C A;  2A2F X;  2ODU A;  4JEH B;  4AXP A;  3ANW B;  2UXN B;  3K3N A;  4TUY E;  2CXF A;  4B6X A;  5LP6 E;  2K48 A;  2M6B A;  5AQL B;  2XTL A;  2V6Y A;  4PAG A;  4OFZ A;  4ILU A;  4X65 T;  3ZYM A;  3S4U A;  5LHG B;  5HXE A;  4JI2 T;  2I0M A;  5EK3 A;  2J4G A;  4H9N C;  3NZP A;  1WR0 A;  2KND A;  3AA1 B;  1MMA A;  3CX7 B;  4P0B A;  3RYF E;  5H6R B;  1IBK T;  4AKH A;  4CI2 B;  3P4Q A;  2RPA A;  4ISS A;  3AB3 B;  1YKH B;  2XAH B;  2ZM8 A;  4PFP A;  2QGS A;  4X1Y E;  2X9W A;  4LFB T;  1MNE A;  3PUY F;  3OYZ A;  2ODV A;  4YFS A;  5LJM A;  4ERR A;  2A72 A;  3WI3 A;  4AKL A;  4JI4 T;  2UXB T;  4DR5 T;  4DBR A;  2Q9Q B;  5HXC A;  3ZPO A;  4JBW F;  2WU5 A;  2PBI A;  3ZT6 A;  3QOF A;  3AE9 A;  4DO0 A;  1IAP A;  3RGL A;  4LF9 T;  4UV8 B;  2LRK A;  2X0Y A;  4LF5 T;  3ZCI A;  2KLQ A;  3HR0 A;  2OV9 A;  2VL0 A;  2XUE A;  3KFW X;  2J47 A;  2YN6 A;  1YQ3 A;  3X1D A;  5LMU T;  1UUR A;  3O1H A;  4IDN A;  3NWI A;  5CA0 E;  1YQ4 A;  3AA6 B;  3PDY A;  2XQ5 A;  3P7I A;  1UCU A;  1MIW A;  2ACZ A;  5FP3 A;  4ZI3 C;  4BJM A;  4OX9 T;  1LVF A;  4JI0 T;  5JDM A;  2GK9 A;  2H3R A;  3JC6 C;  4YTM A;  3Q5E A;  4N78 D;  3LG7 A;  3QNU A;  2NW9 A;  1N32 T;  1X9B A;  3RQU A;  3O1J A;  4H63 V;  4QX8 B;  2CE7 A;  5AQF B;  5CB4 E;  2D5U A;  3UU5 A;  4KUM B;  4X1K E;  2BBJ A;  2V1D B;  3P8C D;  5AQR B;  5F3J A;  2LM9 A;  2WS3 A;  3EAB A;  4HWC A;  4A5X A;  5BR8 T;  2X67 A;  5L3B B;  1UGO A;  4IL9 A;  3HKB E;  3NVO A;  3HA4 A;  4GOU A;  2CHO A;  3ZMV B;  2OA5 A;  4IE6 A;  5CGM A;  4U33 A;  4QHO A;  1IJ5 A;  4UR9 A;  3BQK A;  2EHO B;  3VRB A;  5IUX A;  2E9X C;  2VUR A;  5HCJ A;  3UUN A;  4QXH B;  3OJA A;  1L0V A;  4AKR B;  3N9O A;  2BG9 B;  3JAF A;  5AQM B;  5AQP B;  3R6N A;  4ADZ A;  4QH4 A;  1J5W A;  3UU6 A;  3P4W A;  5JDG A;  2W0G A;  1MMD A;  2CRB A;  1O3X A;  2X0L B;  5AQJ B;  3RF1 A;  1SA0 E;  3LBX A;  2R6G F;  4PK4 A;  3EDV A;  3AA0 B;  5KX5 E;  5LGU B;  1IBL T;  3FBL A;  3AE8 A;  1QLB A;  4LF7 T;  4ASK A;  4QKN A;  1HX1 B;  3FHN A;  3OYX A;  5JR9 B;  4EAH A;  4B3R T;  4Q25 A;  3AEF A;  3A5X A;  2LE8 A;  1YW0 A;  2G0U A;  1QSD A;  2LT3 A;  3O4X E;  2QRX A;  2LHN A;  5ABG A;  2XZE A;  3TLV A;  4EZH A;  2W63 A;  2FBW A;  4ANJ A;  1CUN A;  5HEG A;  4NUU A;  5KMG P;  1S94 A;  3ZT7 A;  4I4T E;  2C5J A;  2DLR A;  2HHH T;  4HN9 A;  1MIV A;  4P0A A;  3UU8 A;  5JDQ A;  1NWM X;  1US7 B;  3MZK B;  4P1N A;  3G06 A;  5F8P A;  2MAW A;  3P4S A;  2JIW A;  4IE5 A;  4WYV A;  4CQI A;  1UK5 A;  2JQK A;  4IGU A;  2BKP A;  2C5I T;  2ZM2 A;  3C98 B;  3LJC A;  4YSY A;  5C3J A;  3RC8 A;  4DR6 T;  2H7O A;  1D1B A;  1HCI A;  5ABF B;  3AE5 A;  5HWX A;  5LGT B;  3TLW A;  5LBQ B;  2W66 A;  4EEB A;  1HTJ F;  3Q5W A;  1S35 A;  4HFE A;  4U74 A;  1KNR A;  4ZOL E;  4IST A;  4WBO A;  5HEO A;  5LBM A;  4OHF A;  3CK6 A;  3A7M A;  3B13 A;  4IE0 A;  5CA1 E;  3FZF B;  4EXT A;  1FMW A;  2RA1 A;  4OYJ A;  4ZS2 A;  1J1J A;  2OLT A;  3Q5X A;  5IHY A;  1M7K A;  2X51 A;  2WP9 A;  3AXJ A;  2WCA A;  3CQG B;  4ILA A;  1N33 T;  1G8X A;  1HF8 A;  1HX8 A;  3E08 A;  3L3P A;  4MFR A;  4YTN A;  2CWO A;  3HKC E;  3Q9D A;  3U78 A;  4GK5 E;  1KFY A;  3KV5 A;  4WZX A;  2VB6 A;  4C90 A;  2I6H A;  4X1I E;  4EIW A;  1OED B;  2WWV A;  3VR8 A;  2J1D G;  3VU7 H;  5J2T E;  4UVB B;  1G73 A;  2JPF A;  1HG2 A;  4OK0 A;  3ZN0 B;  3H3A A;  3PU8 A;  3PJA A;  2K5B B;  5L3F B;  3CKD A;  3AAA B;  5LA6 E;  5LJN A;  2WM9 A;  4YSZ A;  3P4R A;  3C50 A;  3LFM A;  4LF4 T;  3HKE E;  2CA5 A;  3FZM B;  4IIJ E;  2WZI A;  4EYY R;  2N1G A;  4WW0 A;  2X66 A;  3FZH B;  4HFH A;  5HEU A;  3P50 A;  5AQQ B;  1KF6 A;  1XDP A;  2P9B A;  4YHJ A;  3RYH E;  1AJ3 A;  3VKG A;  2BS2 A;  3AEC A;  3ONJ A;  2SPC A;  5ADX L;  1SHZ C;  3I1A A;  1WYB A;  1Z8U A;  3MAC A;  4P09 A;  1XNQ T;  3AED A;  3DP7 A;  1MMG A;  3CQC B;  3CX8 B;  3VR9 A;  2EHO A;  2V7J A;  1J5E T;  4NXM T;  3ZMU B;  5J0Z A;  2IDO B;  3ZJ1 A;  2CBJ A;  2H7V C;  3SOL A;  3RI5 A;  3SRZ A;  4K0U A;  4DV1 T;  4ZI3 D;  4X62 T;  3CVR A;  4ZXL A;  2YDR A;  2LEH A;  1I94 T;  1D0Y A;  4AIU A;  1LKX A;  5JR9 C;  4A97 A;  3AVS A;  4ZI2 C;  5FL1 A;  4TX5 A;  4JI8 T;  3K3Q C;  3ZC1 A;  4I0U A;  3L8R A;  2LSI A;  3AEE A;  4V1A v;  2VWA A;  3HI2 A;  4QXC B;  5AQS B;  3UFG A;  2VL8 A;  1X79 A;  3R84 B;  3RIU C;  2VQE T;  3MK7 C;  4PJM A;  4UV9 B;  4Z90 A;  5HXS A;  3AA7 B;  3IHR A;  4M1P A;  4H63 H;  5LXT E;  2RP4 A;  2VK9 A;  4MHC A;  3IA3 A;  3GN5 B;  1NEK A;  5J1G A;  4AKI A;  2PFV A;  1XMQ T;  2IW5 B;  2DNX A;  3FZL B;  4JV5 T;  2CPT A;  3UFE A;  4H9O C;  3Q2M A;  3UUX B;  2PG8 A;  4TWD A;  3RYC E;  3C64 A;  3LK4 2;  2V5C A;  4QWN B;  4IDP A;  4ILB A;  2X9X A;  3ZKR A;  4COF A;  2XM1 A;  3JC6 D;  5LG3 A;  2QA7 A;  4UEM A;  4AQY T;  4X20 E;  1W09 A;  2XQA A;  2FUP A;  1BR2 A;  2YKS A;  4HWI B;  5C8Y E;  3C4X A;  1VCT A;  2J62 A;  2JJ9 A;  1XWM A;  4WBN E;  1YXR A;  2MTQ A;  4U2Y A;  3ZSS A;  4NXN T;  2X0H A;  3QUJ A;  5LYJ E;  2V7K A;  5FMN A;  2VVN A;  1H7C A;  2XPK A;  2L3L A;  4DND A;  4G63 A;  2VVS A;  2KZ7 B;  4HFV A;  5ABE A;  2I59 A;  2V6X A;  4ZS3 A;  2BG9 A;  2XQ4 A;  2DL1 A;  4LMJ A;  2MPK A;  4CN1 A;  5DJQ C;  4ZZB A;  3KBU A;  5JRC B;  4BA9 A;  2BDE A;  1SUM B;  3CQX C;  3AE4 A;  2IAK A;  3PJA J;  3KV6 A;  3VHL A;  4AI6 A;  3NBX X;  4IDQ A;  1XZY A;  1KEY A;  2XQ6 A;  4DUZ T;  4B3M T;  4CI1 B;  2X9H A;  2DCF A;  2XAQ B;  3KDS E;  3SS1 A;  5L3C B;  4LFC T;  2LOS A;  1ZP0 A;  2WDR A;  2V6Y B;  2WMO A;  2HN1 A;  3KV4 A;  4U7I A;  4A98 A;  4ZHQ E;  5KDM C;  2ZM6 T;  3RX6 A;  5KXJ A;  4O4J E;  2WY2 A;  3GWH A;  3AE7 A;  4CXX A;  3PUV F;  2NR4 A;  3QC9 A;  5FNV E;  3B57 A;  1OED C;  2YDS A;  2XSA A;  3DTO A;  1Y01 A;  3O1I A;  2JMK A;  4HFB A;  5AQI B;  5JDF A;  2E8I A;  4O4I E;  1LVK A;  3JAD A;  1B7T A;  4HFD A;  3UU3 A;  2LM2 A;  3K3O A;  4B3S T;  4HE8 A;  2AXD S;  4O2B E;  5C2T A;  4DR7 T;  3AE3 A;  4PJN A;  3KVA A;  2E2A A;  5JDN A;  2KIN B;  4H9R C;  2XSB A;  4IE4 A;  1ZV4 X;  3ABV A;  3RRW A;  3ZT5 A;  4NIQ A;  2NWB A;  2XQ7 A;  3RKO A;  5BMV E;  1FMV A;  3EUH A;  2BG9 E;  1WYC A;  4F8H A;  1ZEE A;  2W62 A;  3IBP A;  4J2C A;  3RC3 A;  4FI5 A;  4AQF C;  4Z91 A;  1NEN A;  5FY1 A;  4YT0 A;  2ZMA A;  5HXH A;  4NPP A;  2WQY A;  2Q9Q A;  1T7S A;  4KP3 C;  5AQO B;  3ZCJ A;  5JDH A;  2JQQ A;  5LOV E;  3A8Y C;  4JI6 T;  5JRC A;  3CML A;  3PUW F;  4UVA B;  4CZZ B;  1HG5 A;  3N5L A;  2LRL A;  3KV9 A;  4HGA A;  2IC9 A;  3ZMT B;  2XAJ B;  2L9Q A;  5FVK A;  2N2N A;  5JDL A;  5FXV A;  3SWH A;  3ZC0 A;  2KSR A;  4EB6 E;  1W0B A;  5FVL A;  5AQN B;  4KHZ F; 
#chains in the Genus database with same CATH homology
 2V26 A;  4YLH A;  4JLE A;  5HAX A;  3U3I A;  5AFU L;  4G2A A;  4GYR A;  4UF0 A;  4XBF B;  2CLY B;  1HS7 A;  4CI3 B;  5EK4 A;  3MXZ A;  2Q9Q D;  3RH3 A;  3F31 A;  3FXD B;  2NTX A;  3ESL A;  2EHO D;  3I9Y A;  3MKD A;  3WAK A;  5L3D B;  2LOP A;  1T98 A;  3BK9 A;  5JQG E;  1UX4 A;  2CEA A;  3PUG A;  2UXX B;  2CWY A;  2LSY A;  3HL6 A;  3DJB A;  2K9A A;  3PU3 A;  4C91 A;  2KWI B;  5FY7 A;  3CWZ B;  2VKH A;  2YK0 A;  3EDU A;  4HKA A;  2DHR A;  2LHR A;  4CXY A;  2E9X A;  4OYK A;  2PJQ A;  2A3D A;  2BZB A;  2WAU A;  3FXE B;  2ZLY A;  4TN7 B;  4DVD A;  2NOX A;  3E22 E;  3GMI A;  4KBM B;  4H9S E;  4MAL A;  4MBQ A;  4WNK A;  4UXN B;  2X68 A;  3PE0 A;  3PUQ A;  5ETW A;  5LCY A;  2IC6 A;  1Z0P A;  4PFO A;  1D1A A;  4IDZ A;  2V7I A;  1U5P A;  2C5K T;  2KXP B;  4DMW A;  5HWY A;  4O4L E;  3F2E A;  3W15 B;  3ZLI A;  5GON E;  2V7M A;  3V5S A;  2JRK A;  4PJL A;  5HXR A;  4I43 B;  2MOZ A;  5LHI B;  1YD8 G;  3KBT A;  3BQI A;  4ZI2 D;  1IZN B;  2D0T A;  3ZEF B;  1QUU A;  3CPZ A;  3J9X 1;  4TV9 E;  3IEE A;  2ACX A;  3ZMZ B;  5EZY E;  4DMV A;  5L3E B;  3LK3 B;  4BAY B;  4AKG A;  5J2U E;  4ZI7 E;  1U4Q A;  3C4W A;  5DQV A;  1FIO A;  2XQY A;  1FEW A;  1Y64 B;  1E1H B;  2Y48 B;  4L9I A;  2ES0 A;  4BJN A;  1KNZ A;  3NZQ A;  1WRD A;  3AVR A;  1ZHC A;  2VKD A;  3ZMS B;  2KT9 A;  3WAJ A;  2VKO A;  4Z8X A;  2VAS A;  4E7Z A;  2ZM0 A;  2D0U A;  3L09 A;  2MBG A;  1V9D A;  4L5G A;  3ZYK A;  2CXL A;  2DWK A;  3HKD E;  2VKJ A;  1MND A;  3T8O A;  1KK7 A;  2HH7 A;  4U72 A;  3NRX A;  3M65 A;  1LRZ A;  2BVL A;  2CMR A;  4GYS A;  4I55 E;  3RRC A;  3LBX B;  3BQL A;  4XAX B;  4EOZ B;  2WMN A;  3FB2 A;  5HYA A;  4MLK A;  2NW8 A;  3UUM A;  3ZN1 B;  3N9Q A;  4QXB B;  3MJX A;  1D0X A;  1BR4 A;  1BR0 A;  1OXZ A;  2B1E A;  3NRY A;  3PUS A;  2X9Y A;  4JEU B;  2XHE B;  5JRE A;  4F6R C;  1ZKE A;  2WWU A;  2D2S A;  2L8K A;  3F57 A;  4GIW A;  3FBZ A;  5TAO A;  2LSJ A;  3TKL B;  3C4Z A;  2XAF B;  5DQW A;  4NUV A;  3UTK A;  1MMN A;  1OWA A;  4IHJ E;  3QK6 A;  2LSK A;  2HPJ A;  2Y6X A;  3ANW A;  4DBQ A;  5IYZ E;  3ETV A;  1BR1 A;  4EZ4 A;  4CXW A;  5LG4 A;  2YEV C;  3ONX A;  1HFA A;  4UVC B;  2WBL A;  3I0Q A;  2C0S A;  2KWH A;  5FY0 A;  2MYS A;  2DWG A;  4O2A E;  2YIN A;  3EVY A;  4PNI A;  1EZ3 A;  1UX5 A;  2WSS V;  4PW8 A;  2DI4 A;  4UF0 B;  5LHH B;  5L2L A;  3N9M A;  3N2G E;  2N9D A;  3N9L A;  3PTR B;  5FXZ A;  5FYM A;  5JR9 A;  3VKH A;  3H37 A;  2NW7 A;  4XZC A;  1VRB A;  2CM0 A;  5JH7 E;  1NAF A;  4UIG A;  5L3G B;  4L0R A;  3V5U A;  2EHO C;  2NTY A;  4QX7 B;  4TV8 E;  3CX6 B;  2HPL A;  3PUA A;  4YJ2 E;  3GA8 A;  3KVB A;  3UUL A;  3N2O A;  4A56 A;  4HTE A;  2YU2 A;  4HEA A;  2Q9Q C;  3N9N A;  3UT5 E;  1D0Z A;  1IJ6 A;  1YKE B;  2W61 A;  5E0O A;  2Z6E A;  2E9X B;  5LNK A;  1WLX A;  5DAB A;  3RPU A;  4EYU A;  4H9P C;  5LGN B;  2CXD A;  4JUY A;  2M67 A;  4KMC A;  3KIN B;  2V7L A;  3LK2 B;  3N9P A;  4O8S A;  3ZYL A;  3RYI E;  5FXW A;  5M4Y A;  2XAG B;  3MA9 A;  4GK0 E;  4AQG A;  2CCQ A;  5EK2 A;  2W00 A;  4IE7 A;  5JVD E;  1WR6 A;  5FXX A;  4UEL A;  2E9X D;  3C51 A;  3AAE B;  3ETU A;  5A1L A;  1MIY A;  4H9Q C;  3AAI A;  3I0O A;  2LJL A;  3OBV E;  4AQF A;  2YU1 A;  4E7S A;  4TZ4 C;  2CLY C;  2XAS B;  3GN5 A;  2LSG A;  3I9W A;  3PUR A;  3D0T A;  4PK5 A;  4YJ3 E;  3ZJ2 A;  3K8P C;  4PJJ A;  4I50 E;  2K24 A;  2NP9 A;  5H6Q B;  2BVM A;  3IF8 B;  1VOM A;  3E0Z A;  4PK6 A;  3OKQ A;  2Y8D A;  3N2K E;  2JMH A;  4FJO A;  4O4H E;  3J7Y q;  3O9X A;  2KMF A;  4JEH B;  1D1C A;  2A2F X;  2ODU A;  4AXP A;  3ANW B;  2UXN B;  3K3N A;  4TUY E;  2CXF A;  4B6X A;  5LP6 E;  2K48 A;  2XTL A;  4PAG A;  4OFZ A;  4ILU A;  3ZYM A;  3S4U A;  5LHG B;  5HXE A;  5EK3 A;  4H9N C;  3NZP A;  3RYF E;  2KND A;  3AA1 B;  1MMA A;  3CX7 B;  4P0B A;  5H6R B;  4AKH A;  4CI2 B;  4ISS A;  3AB3 B;  1YKH B;  2XAH B;  2ZM8 A;  4PFP A;  2QGS A;  4X1Y E;  2X9W A;  1MNE A;  5LJM A;  3OYZ A;  2ODV A;  4YFS A;  2A72 A;  3WI3 A;  4AKL A;  4DBR A;  2Q9Q B;  5HXC A;  3ZPO A;  2PBI A;  4DO0 A;  1IAP A;  4UV8 B;  3ZCI A;  2KLQ A;  3HR0 A;  2XUE A;  3KFW X;  3O1H A;  5CA0 E;  3PDY A;  3AA6 B;  4ZI3 C;  3P7I A;  1UCU A;  1MIW A;  5FP3 A;  4BJM A;  1LVF A;  5JDM A;  2GK9 A;  2H3R A;  3JC6 C;  4N78 D;  3LG7 A;  2NW9 A;  3O1J A;  4H63 V;  4QX8 B;  2CE7 A;  5CB4 E;  2D5U A;  4KUM B;  4X1K E;  2V1D B;  3P8C D;  5F3J A;  2LM9 A;  2X67 A;  5L3B B;  3HKB E;  3HA4 A;  4GOU A;  3ZMV B;  2OA5 A;  4IE6 A;  4QHO A;  1IJ5 A;  3BQK A;  2EHO B;  2E9X C;  3UUN A;  4QXH B;  3OJA A;  4AKR B;  3N9O A;  4ADZ A;  3R6N A;  5JDG A;  2W0G A;  1MMD A;  4CXX A;  1O3X A;  2X0L B;  1SA0 E;  3LBX A;  4PK4 A;  3EDV A;  3AA0 B;  5KX5 E;  5LGU B;  3FBL A;  4ASK A;  4QKN A;  3FHN A;  3OYX A;  5JR9 B;  4EAH A;  3A5X A;  2LE8 A;  1YW0 A;  2G0U A;  1QSD A;  2LT3 A;  3O4X E;  2LHN A;  4EZH A;  2W63 A;  4ANJ A;  1CUN A;  4NUU A;  5KMG P;  1S94 A;  4I4T E;  2C5J A;  2DLR A;  4HN9 A;  1MIV A;  4P0A A;  5JDQ A;  1NWM X;  1US7 B;  3MZK B;  5F8P A;  4IE5 A;  4CQI A;  4ERR A;  4IGU A;  5JRC B;  2C5I T;  2ZM2 A;  3C98 B;  3LJC A;  3RC8 A;  2H7O A;  1HCI A;  1D1B A;  5HWX A;  5LGT B;  5LBQ B;  1HTJ F;  3Q5W A;  1S35 A;  4U74 A;  4ZOL E;  4IST A;  4WBO A;  5LBM A;  4OHF A;  3B13 A;  4IE0 A;  5CA1 E;  4EXT A;  1FMW A;  2RA1 A;  4OYJ A;  4ZS2 A;  3Q5X A;  5IHY A;  2X51 A;  3CQG B;  1G8X A;  1HF8 A;  1HX8 A;  3E08 A;  3L3P A;  4MFR A;  2CWO A;  3HKC E;  3Q9D A;  3U78 A;  4GK5 E;  3KV5 A;  4C90 A;  2VB6 A;  4X1I E;  4EIW A;  2J1D G;  3VU7 H;  5J2T E;  4UVB B;  1G73 A;  2JPF A;  1HG2 A;  4OK0 A;  3ZN0 B;  3H3A A;  3PU8 A;  2K5B B;  5L3F B;  3CKD A;  3AAA B;  5LA6 E;  5LJN A;  2WM9 A;  3C50 A;  3LFM A;  3HKE E;  2CA5 A;  4IIJ E;  4EYY R;  2N1G A;  4WW0 A;  2X66 A;  2P9B A;  4YHJ A;  3RYH E;  1AJ3 A;  3VKG A;  2SPC A;  5ADX L;  1SHZ C;  3I1A A;  1WYB A;  3MAC A;  4P09 A;  3DP7 A;  1MMG A;  3CQC B;  3CX8 B;  2EHO A;  2V7J A;  3ZMU B;  3ZJ1 A;  2H7V C;  3SOL A;  3SRZ A;  4K0U A;  4ZI3 D;  3CVR A;  2LEH A;  1D0Y A;  5JR9 C;  1LKX A;  3AVS A;  4ZI2 C;  4TX5 A;  3K3Q C;  3ZC1 A;  2LSI A;  4V1A v;  2VWA A;  3HI2 A;  4QXC B;  2VL8 A;  1X79 A;  3R84 B;  3MK7 C;  4PJM A;  4UV9 B;  5HXS A;  3AA7 B;  3IHR A;  4M1P A;  4H63 H;  5LXT E;  2RP4 A;  2VK9 A;  4MHC A;  3GN5 B;  5J1G A;  4AKI A;  2PFV A;  2IW5 B;  2DNX A;  3UFE A;  4H9O C;  3Q2M A;  3UUX B;  2PG8 A;  3RYC E;  3C64 A;  3LK4 2;  4QWN B;  2X9X A;  3JC6 D;  2QA7 A;  4UEM A;  4X20 E;  5C8Y E;  1BR2 A;  3C4X A;  2JJ9 A;  4WBN E;  2MTQ A;  3QUJ A;  5LYJ E;  2V7K A;  5FMN A;  1H7C A;  2L3L A;  4DND A;  4G63 A;  2KZ7 B;  4HFV A;  2I59 A;  4ZS3 A;  5DJQ C;  3KBU A;  4BA9 A;  2BDE A;  3CQX C;  2IAK A;  3KV6 A;  3VHL A;  4AI6 A;  3NBX X;  4CI1 B;  2X9H A;  2DCF A;  2XAQ B;  3KDS E;  3SS1 A;  5L3C B;  2LOS A;  4ZHQ E;  2WMO A;  3KV4 A;  5KDM C;  3RX6 A;  4O4J E;  3GWH A;  5FNV E;  3QC9 A;  3B57 A;  3DTO A;  3O1I A;  5JDF A;  2JMK A;  2E8I A;  4O4I E;  1LVK A;  1B7T A;  3K3O A;  4HE8 A;  4O2B E;  4PJN A;  3KVA A;  5JDN A;  2KIN B;  4H9R C;  4IE4 A;  1ZV4 X;  3RRW A;  2NWB A;  3RKO A;  5BMV E;  1FMV A;  3EUH A;  1WYC A;  1ZEE A;  2W62 A;  3IBP A;  4J2C A;  3RC3 A;  4FI5 A;  4AQF C;  5FY1 A;  2ZMA A;  5HXH A;  2Q9Q A;  4KP3 C;  3ZCJ A;  5JDH A;  2JQQ A;  5LOV E;  5JRC A;  3CML A;  4UVA B;  4CZZ B;  1HG5 A;  3N5L A;  3KV9 A;  4HGA A;  2IC9 A;  3ZMT B;  2XAJ B;  2L9Q A;  2N2N A;  5JDL A;  5FXV A;  3SWH A;  3ZC0 A;  4EB6 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...