2LJLA

Nmr structure of hsp12 in the presence of dpc
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
109
structure length
109
Chain Sequence
MSDAGRKGFGEKASEALKPDSQKSYAEQGKEYITDKADKVAGKVQPEDNKGVFQGVHDSAEKGKDNAEGQGESLADQARDYMGAAKSKLNDAVEYVSGRVHGEEDPTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords 12 kDa heat shock protein
publication title Structural characterization of Hsp12, the heat shock protein from Saccharomyces cerevisiae, in aqueous solution where it is intrinsically disordered and in detergent micelles where it is locally alpha-helical.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 12
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2011-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04119 HSP9_HSP12 Heat shock protein 9/12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1260 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2ljlA01
2LJLA 2L9QA 4AXPA
chains in the Genus database with same CATH superfamily
2WS3A 2ACXA 5EK2A 2V5CA 5LG3A 2WZHA 4HGAA 5AQHB 2H88A 1MMNA 2BBJA 2VKOA 3GN5B 4GOUA 1Z8UA 2KINB 4EGWA 2VVSA 4U2YA 2XTLA 4Z90A 1D1AA 3GA8A 5FXVA 4CN6A 1T72A 2CA5A 3P7IA 2IDOB 2X9XA 2MOZA 2VASA 2QVAA 4KHPT 3H3AA 3T1HT 4TV8E 1JNRA 3N9NA 3KBUA 2WP9A 4C90A 3LBXB 4IIJE 2LM9A 4IE5A 1MNDA 1ZEEA 2JRKA 4TWFA 2KNDA 5HXCA 4V1Av 2V7JA 4DBRA 2NTXA 1HF8A 2VQFT 3KV5A 5CB4E 5LNKA 4WZXA 2WQYA 4U2ZA 3AE2A 2DI4A 3PUAA 2BVMA 5LJMA 1KFYA 2LSGA 5AQTB 5LBMA 4DR7T 4NPPA 1CUNA 3ONLC 2Q9QC 3FBLA 5L2LA 4HWCA 4QXCB 2E9XA 4H9SE 4DV1T 4H9OC 2BG9E 3ONXA 1N33T 2MTQA 1KNZA 1YD8G 4PW8A 3CPZA 4JUYA 1XZYA 4B3RT 3ETVA 3L39A 1WFDA 1QSDA 1UK5A 4YJ2E 3A8YC 1XWMA 3V5UA 2AE9A 2QA7A 2XPKA 2BG9B 5LHHB 4P0AA 2H89A 2XQYA 1NENA 2XSAA 2B1EA 5JRCB 2ES0A 4ZS3A 5LG4A 3RHWA 4EV6A 2K24A 4UR9A 2MBGA 4ZI3D 2K48A 3AEAA 2XQAA 2RPAA 3J7Yq 3N9PA 2YDQA 5L4HA 4AI6A 4IDNA 2ZM2A 5CGMA 3AEDA 2CLYC 4HFVA 3FZMB 1HX1B 2X68A 3P4QA 5DJQC 4WYVA 4ZXLA 2I6HA 3N2OA 1OEDC 2CM0A 5LP6E 5HEOA 3ZYMA 4AKIA 4MLKA 4AXPA 4YSYA 2AXDS 2C5IT 3Q5WA 2C5KT 3V5SA 3WAJA 4AKRB 3VR8A 4O4HE 2M6BA 3RQWA 1E2AA 5JDMA 3L8RA 5DABA 1CHUA 2I0MA 3PV0F 4DVDA 2CMRA 4ZHQE 4EIWA 2ZMAA 1IJ5A 4UEMA 2FJAA 3K3QC 2KMFA 2MPKA 2H7OA 4UIGA 4L9IA 4BJNA 4QKNA 2XQ6A 3FBZA 2CBJA 2FJBA 3RPUA 3N2GE 3ZSTA 4ANJA 3OPCA 1UGOA 2ZM0A 4KHZF 3UU4A 2UUAT 4YT0A 4PFPA 1GQEA 1HR0T 2XZEA 3B5MA 3PUYF 5FKYA 2XAQB 4EXTA 1BR2A 2V6YB 5EK4A 4NXMT 2YOEA 2MAWA 1HS7A 1B7TA 1MIVA 4IREA 2IC6A 3ZMSB 4TX5A 3JC6C 2X66A 3TLUA 2YKSA 2CBIA 1X79A 2VB6A 2IW5B 1DU2A 3ZT5A 2UXBT 3NVOA 3AE9A 2OV9A 4Z8XA 2XHEB 3K8PC 1LVFA 2HN2A 3RC3A 2X9HA 3GMIA 4IHJE 4G63A 3PE0A 4X66T 1BR4A 4E7ZA 2E2AA 4GKKT 2XQ4A 3O4XE 3KINB 3EABA 2XQ8A 2D2SA 5FNVE 4XBFB 4XAXB 2IC9A 1ZV4X 3TLTA 4LFAT 5HEUA 5A1LA 3SFDA 3ZC0A 3F31A 3I1AA 2CCQA 3Q5XA 4AIUA 1IBKT 4OK0A 5ABFB 2E5LT 5C2TA 4HTEA 3RKOA 3AE4A 5LMUT 3C4ZA 4IDPA 1ZHCA 3L09A 4IL9A 3JAEA 2CXDA 3PUZF 5M4YA 3C4WA 5BMVE 1T7SA 4UVCB 3DJBA 3AA6B 3KVAA 4DNDA 2UXXB 3EAMA 2L3LA 2VL0A 3N2KE 5FVLA 4X1KE 2CWYA 5AFUL 2VK9A 5FY0A 3QK6A 1WCRA 2WBLA 4O2BE 4ILBA 4U7IA 1IJ6A 2KWHA 4YSZA 1UUSA 1T98A 4DR2T 3X1DA 3MXZA 3F57A 1LKXA 2EHOD 2DL1A 4XZCA 5J2TE 1ZP0A 3O1JA 2YDSA 4HWFA 1X9BA 4AISA 3MKDA 3AEGA 1FIOA 4DO0A 4YTNA 2XM1A 5FL1A 4IE7A 3NRXA 5L47A 5L4EA 3AAAB 4M1PA 5LGUB 1XNRT 3SFEA 3ZSSA 2DWGA 4OYJA 2W61A 2LOSA 4KI0F 4ISTA 4YLHA 4H9NC 2FUPA 5GONE 3RH3A 5J0ZA 1U5PA 4A97A 5AQMB 2WB5A 5ABHA 5DQWA 3RI5A 4EAHA 1SE7A 2OA5A 4ERRA 3RKGA 2P9BA 3RYHE 3PUVF 4DR3T 4JI5T 4DV6T 4HFBA 3AEEA 4I55E 2CRBA 4F6RC 4MBQA 5AQKB 1HG2A 4IE4A 2X0YA 2E8IA 3JADA 2V1DB 4OYKA 4DR4T 5LBQB 3AA7B 1QUUA 3KV4A 3ZMUB 4ILAA 5KDMC 5CA0E 5ADXL 3FHNA 3QC9A 2V7IA 4OX9T 4CQIA 4PK4A 3PJAA 4HFIA 3NRYA 2ACZA 5C3JA 3UU8A 1FEWA 3WI3A 4CZZB 4HFCA 1ZKEA 2E9XB 2XM2A 4JI1T 4TUYE 2Q9QB 2W67A 2IUBA 1OWAA 3UT5E 5HAXA 4H63V 5LYJE 2NWBA 4AQFC 3EDUA 2MYSA 3RX6A 4I4TE 3AXJB 1HX8A 3OBVE 2DHRA 2C0SA 2W0GA 3SOLA 4EZ4A 4X20E 4QXHB 4P09A 3P4WA 3RGLA 2QRXA 4LFCT 3PU3A 5JVDE 3ZJ2A 3CQXC 4WW0A 2JQQA 5ABGA 5AQVB 4AKHA 2XQ7A 3UUBA 3RYIE 4H9RC 4JEHB 4JI6T 1NAFA 5L3FB 1IZNB 2LSYA 4DUYT 4IT4A 4FJOA 3HKBE 3LDQB 3L3PA 3FB2A 5J2UE 4LF6T 2WDQA 4HWIB 5LMNT 4HWDA 4ZZCA 4Z91A 3JAFA 3AVSA 2H3RA 2UUCT 4OHFA 2Q9QA 4ZZBA 3SRZA 4U7YA 3VR9A 3AE3A 3AE6A 1VCTA 3ZCIA 1N34T 2QYWA 2XAFB 4GKJT 4P1NA 3MJXA 4O4LE 3EUHA 4TNWA 1S35A 2XY8B 1OEDB 3ZMTB 4AQGA 5BR8T 3UUMA 4PJMA 3KV6A 3ZT7A 3AXJA 2UXDT 4ZI2D 4CI2B 2X9YA 1MMDA 4I50E 3CWZB 2IIUA 5LA6E 2V6XA 3P8CD 5HXHA 1BR1A 4YJ3E 3PU8A 5JDFA 3H3MA 4CXYA 4WBNE 4LF4T 1QLBA 3HKDE 5AQPB 2H7VC 2WWVA 4EEDA 4IL4A 3SS1A 5JR9C 4UELA 2B76A 2UXCT 2XAHB 4X5TA 5LOVE 1XNQT 3ZYLA 3UFEA 3IEEA 3C4XA 2ZLYA 3FXDB 1D0XA 3RF1A 4NXNT 4CI3B 5JH7E 3ZN0B 2K5BB 5FY1A 5L3GB 5FL0A 1I94T 3FZFB 2VKDA 3O1HA 2WMNA 3BQKA 5FXWA 3HKEE 4U33A 5EK3A 3FXEB 3CQGB 2GK9A 3PDYA 3AECA 2V7LA 3UTKA 4K0KT 4ZI3C 1L0VA 3NZQA 4NUUA 3LK42 5AQIB 4YSXA 1OEDA 5LGNB 3CX6B 3BQIA 3ANWB 5LCYA 4IE0A 4DR6T 2HH7A 3AVRA 3QOFA 3CMLA 5HCJA 3H37A 2BG9C 2M67A 2BDEA 4ILCA 2RA1A 3UU5A 4AKLA 3CVRA 3AB3B 4DMVA 3KVBA 2W63A 3J9X1 4QX7B 5AQNB 5LGTB 4GYRA 4HFDA 4JI4T 1W0AA 4CN4A 3EDVA 3AEFA 2A3DA 4CXWA 2PJQA 3W15B 4QWNB 4MALA 2PTFA 2QGSA 5HCMA 2BS3A 2LSIA 3ANWA 5FP3A 5HEHA 5AQFB 1O3XA 5CJ5A 5JDHA 1XDOA 2CE7A 5CFBA 2LKGA 2WSSV 2XQ9A 2R6GF 4A5XA 2PFVA 5LHIB 4LF9T 1XMOT 5H6QB 3LK3B 5LHGB 4G2AA 1H7CA 4IE6A 2KLQA 2N1GA 4X1YE 5FY7A 3UULA 1W0BA 3BQLA 3QUJA 3AA1B 3ETUA 2HHHT 3PUSA 2VVNA 1MMAA 2VKJA 1NEKA 5AQLB 2XQ3A 2LOPA 3O1IA 3IBPA 4A56A 3IA3A 3RYFE 1J5WA 2NW9A 4JI8T 4NUVA 2ZM6T 2VQET 4B6XA 2PG8A 4KP3C 5AQUB 1I6ZA 2XSBA 4TN7B 2BKOA 3HL6A 4B3ST 5E0OA 5FXZA 2WY2A 1UX5A 4MHCA 2JMHA 1YKEB 2A2FX 2CHNA 4H9QC 4AKGA 3ZLIA 2DCFA 5IUXA 4TZ4C 5LJNA 5IYZE 3ZN1B 2E5VA 2WAUA 2KZ7B 3T1YT 2LHRA 4YHJA 1HCIA 2X67A 2WWUA 3Q9DA 3NWIA 3FZLB 2OLTA 2NP9A 1WR0A 1HTJF 4ZS2A 2HN1A 4U72A 3ZCJA 4HFHA 3NKZA 3KDSE 1Z0PA 4QH5A 2BZBA 2YEVC 4LFBT 4QHOA 4ZOLE 1IAPA 4ILUA 3M65A 4TV9E 1SUMB 1WR6A 4YTPA 1IBMT 4O2AE 4EYYR 2V5DA 2CEAA 2Y6XA 4YTMA 4P0BA 2N9DA 1IBLT 2EHOC 5FVKA 3ZJ1A 4COFA 3RIUC 1EZ3A 3O9XA 3RRCA 4WNKA 4LMLA 2LSJA 4YXDA 3ZC1A 2D0TA 4E7SA 2G0UA 4HFEA 3LJCA 3ZPOA 4ISSA 5AQRB 1WYCA 4X1IE 4H63H 4IDQA 2CXLA 3RRWA 3HA4A 2W66A 2V26A 4U74A 3P4SA 2A72A 3AE8A 2VKHA 2ZM8A 2BKPA 2L8KA 4LMJA 2WM9A 4CI1B 2LSKA 5AQJB 3B13A 2KXPB 5IWAT 2HPJA 3CK6A 2JJ9A 3Q5DA 3CKDA 5IHYA 2NW7A 2YN6A 4DV4T 2JIWA 1KNRA 3UQ4A 4YY3T 5AQGB 3OYXA 5JDNA 2WDVA 3MK7C 4NIQA 4UV9B 5AQQB 3M3ZB 3FZHB 4EYUA 4WBOA 4AQYT 4IDZA 2XJ7A 3CX7B 3I9YA 2UUBT 2KT9A 4LF7T 2LT3A 4UVBB 2V7KA 3AE7A 4IDOA 3Q2MA 4GIWA 3ZEFB 3F2EA 2NR4A 4PJLA 2HPLA 2WMOA 5HEGA 4DIDB 2BBHA 4PJJA 4UXNB 3A7MA 1UCUA 5AQOB 2CXFA 1HNWT 2K9AA 4F8HA 1MMGA 2BS4A 4X65T 3KFWX 2J47A 2BKNA 2YU2A 1UX4A 3VKGA 4AQFA 1U4QA 2UU9T 1MIWA 3UFGA 4LF8T 2E9XD 1T8BA 4I0UA 4O4JE 1V9DA 2Q9QD 5H6RB 5HXSA 3N9OA 3RLFF 1J1JA 3ZMZB 5JDLA 3Q5EA 3G06A 1N32T 2IMLA 1YQ4A 3I0OA 5JR9B 2F4VT 1NWMX 4YHHT 3OJAA 5HEJA 1WRDA 2LHNA 5HYAA 4I43B 3RYCE 4JI2T 3D0TA 4QH4A 1OEDE 5J1GA 4U31A 2CLYB 2D0UA 2LE8A 2BVLA 2Z6EA 5F8PA 2YU1A 3TKLB 2E9XC 4PNIA 5C8YE 5F3JA 3NBXX 3GN5A 2FBWA 3LSVA 4TWDA 4KMCA 3TLSA 2ODVA 3OKQA 1R8IA 3PURA 2CWOA 1YW0A 4N78D 4JEUB 4PFOA 3MA9A 3EVYA 3QB5K 2M6IA 2X51A 4GYSA 2FJDA 3I9WA 1Y64B 4BAYB 3LBXA 4QXBB 1FMWA 3A5XA 3N9QA 4A98A 5JREA 4O4IE 2LRLA 1XMQT 5FYMA 4LMKA 4KUMB 5HXRA 4JBWF 3PUXF 5JQGE 5JR9A 2IAKA 3UQ7A 4ZI2C 2J4GA 2KWIB 5L3EB 2J1DG 4PAGA 3AE5A 1KK7A 4H9PC 5HWXA 1JNZA 5LXTE 1G8XA 4LF5T 2D9DA 4BA9A 4DR5T 4B3MT 4DV2T 5KX5E 4Q25A 3P50A 4CN1A 5HXEA 4JYAT 1HNZT 3E0ZA 2Y48B 3UUXB 2LM2A 1MIYA 1LVKA 3QNUA 1D0ZA 1YKHB 3CX8B 2LLYA 2YDRA 3HI2A 2BG9A 2DNXA 2BS2A 3R84B 3IHRA 5ABEA 3MZKB 3U78A 5JRCA 1WYBA 3VKHA 3N5LA 3DTOA 3RIFA 1HFAA 3C98B 4MFRA 3JC6D 4J2CA 5EZYE 3IF8B 3KBTA 3C50A 1YQ3A 3S4UA 4HEAA 3PUGA 4UV8B 4YFSA 3ZYKA 5JDQA 3P4RA 3NZPA 3N9LA 1VCSA 2NTYA 3B57A 2UXNB 4X62T 4JI7T 4JV5T 5KMGP 3K1SA 3AA0B 3AAIA 4HN9A 2XAJB 3R6NA 2CHOA 1M62A 2ODUA 4DV3T 3CIRA 1D0YA 4TWHA 3U3IA 4HWHA 2XUEA 2JQKA 2RP4A 4JI3T 4O8SA 4PK5A 2YINA 2NOXA 3I0QA 4PJNA 4X64T 2LKHA 2XASB 3JCFA 4KBMB 3HR0A 3OTOT 2CPTA 3PUWF 2IHR1 1VOMA 4BJMA 3TLVA 2WDRA 2W2UA 4ASKA 3MACA 3K3NA 5CA1E 3QB5A 2DWKA 3E22E 5HWYA 3UU3A 1US7B 3EI0A 2VL8A 2YK0A 3KV9A 3ABVA 2V6YA 2W62A 5F5WA 2SPCA 3LG7A 2WZIA 3T8OA 4K0UA 3RIAA 3PUQA 4HE8A 2JQ9A 4DBQA 4EOZB 4B3TT 1LRZA 5AQSB 2A9UA 3PTRB 4HKAA 2EHOB 5TAOA 1OXZA 4UF0B 1MNEA 4ADZA 4L0RA 5L3DB 3P4PA 1KF6A 1G73A 3C51A 1FJGT 3OYZA 4U3CA 5FMNA 1KEYA 3VRBA 3DP7A 4ZEYA 1S94A 4L5GA 1YXRA 3UU6A 3LFMA 5JTGA 1FMVA 4IGUA 1WLXA 3HKCE 1HNXT 1SA0E 5DQVA 3RC8A 4EB6E 4DV7T 2X9WA 3RQUA 4GK5E 2VURA 2WU2A 2JMKA 1E1HB 5L3BB 4ZI7E 5KXJA 2J62A 2X0LB 2V8SV 2WU5A 4QX8B 3N9MA 2LRKA 3VRAA 2W4XA 2DLRA 2L9QA 2KSRA 4CXXA 3ZKRA 2WCAA 1HG5A 1D1CA 2K3WA 2I59A 4JLEA 1AJ3A 4EEBA 3OVUA 3FZKB 5ABFA 3GWHA 3EHZA 1D1BA 2NW8A 4JI0T 4C91A 4QH1A 2EHOA 3ESLA 3CQCB 2JQHA 4UF0A 4UVAB 5ETWA 1M7KA 2FJEA 3RIUA 3PJAJ 3BK9A 2XQ5A 5LB7B 5FXXA 1UURA 1E7PA 4DR1T 3VHLA 1Y01A 4OFZA 2X0HA 2V7MA 1XDPA 3VU7H 3TLWA 3UUNA 2D5UA 4KX6A 4GK0E 1VRBA 2LEHA 1W09A 4DMWA 2Y8DA 3AEBA 1BR0A 3C64A 5JDGA 4DV0T 3E08A 3K3OA 3LK2B 1N36T 3WAKA 2LJLA 1W9RA 3AAEB 2JPFA 4DV5T 3SWHA 4DUZT 2XAGB 2W00A 4EZHA 1J5ET 4TNVA 1ZOYA 4PK6A 1SHZC 2C5JA 2N2NA 3ZT6A 5L3CB 4FI5A 1KNPA 3ZMVB 2VWAA 3AE1A 2PBIA 3ONJA
chains in the Genus database with same CATH topology
2WBLA 4O2BE 4QXBB 4CXWA 1FMWA 2ACXA 2PJQA 4QWNB 4MALA 3W15B 5EK2A 1IJ6A 3A5XA 3N9QA 2KWHA 2QGSA 4HGAA 5JREA 4O4IE 1T98A 1MMNA 2VKOA 5FYMA 3GN5B 3MXZA 4KUMB 5HXRA 3F57A 1LKXA 2EHOD 4XZCA 5J2TE 2LSIA 5JQGE 3O1JA 4GOUA 3ANWA 5JR9A 3MKDA 1FIOA 4DO0A 2IAKA 2KINB 5FP3A 2XTLA 4IE7A 1D1AA 3GA8A 3NRXA 5FXVA 4ZI2C 1O3XA 2KWIB 5JDHA 3P7IA 2CA5A 2J1DG 3AAAB 4M1PA 5L3EB 2X9XA 2CE7A 2MOZA 5LGUB 2VASA 2WSSV 2DWGA 3H3AA 4PAGA 4OYJA 4TV8E 2W61A 1KK7A 2PFVA 2LOSA 5LHIB 4H9PC 5HWXA 3N9NA 5H6QB 3KBUA 3LK3B 4C90A 4ISTA 3LBXB 5LXTE 4YLHA 4IIJE 1G8XA 5LHGB 4H9NC 2LM9A 4G2AA 1H7CA 4IE6A 4BA9A 4IE5A 1MNDA 1ZEEA 2KLQA 2JRKA 2N1GA 5GONE 4X1YE 5KX5E 2KNDA 3RH3A 5FY7A 4V1Av 1U5PA 5HXCA 2V7JA 3UULA 5HXEA 4DBRA 2NTXA 1HF8A 3BQLA 3E0ZA 3KV5A 5CB4E 5LNKA 3QUJA 3AA1B 2Y48B 3ETUA 3PUSA 5DQWA 1MMAA 2VKJA 4EAHA 2OA5A 3UUXB 4ERRA 2DI4A 1MIYA 2P9BA 3RYHE 1LVKA 1D0ZA 1YKHB 3PUAA 2BVMA 3CX8B 5LJMA 2LOPA 2LSGA 3O1IA 3IBPA 4I55E 4A56A 4F6RC 4MBQA 3HI2A 3RYFE 1HG2A 4IE4A 5LBMA 2NW9A 2DNXA 1CUNA 2Q9QC 4NUVA 2E8IA 3R84B 4B6XA 3IHRA 2V1DB 3MZKB 4OYKA 2PG8A 4KP3C 3U78A 3FBLA 5L2LA 5LBQB 5JRCA 1WYBA 3AA7B 4TN7B 3VKHA 4QXCB 2E9XA 3N5LA 3DTOA 4H9SE 5FY0A 1HFAA 3C98B 3HL6A 5E0OA 5FXZA 4H9OC 3ONXA 1QUUA 4MFRA 3KV4A 3JC6D 3ZMUB 4J2CA 2MTQA 1KNZA 1YD8G 5KDMC 5EZYE 4PW8A 1UX5A 3IF8B 3C50A 3CPZA 3KBTA 5CA0E 4JUYA 4MHCA 2JMHA 3ETVA 3S4UA 5ADXL 1YKEB 4HEAA 2A2FX 3FHNA 3QC9A 2V7IA 4H9QC 4AKGA 3ZLIA 4CQIA 3PUGA 2DCFA 4PK4A 1QSDA 4YJ2E 4TZ4C 4UV8B 3V5UA 4YFSA 3ZYKA 2QA7A 5LHHB 5LJNA 5JDQA 4P0AA 3NRYA 3NZPA 3N9LA 5IYZE 2NTYA 3ZN1B 3B57A 2WAUA 2KZ7B 2UXNB 1FEWA 2XQYA 2LHRA 4YHJA 1HCIA 3WI3A 2B1EA 4CZZB 5KMGP 5JRCB 2X67A 2ES0A 4ZS3A 3AA0B 1ZKEA 2WWUA 3AAIA 5LG4A 4HN9A 2XAJB 3R6NA 2E9XB 2K24A 2ODUA 1D0YA 4TUYE 2Q9QB 3Q9DA 3U3IA 2NP9A 2MBGA 4ZI3D 1HTJF 2K48A 4ZS2A 3J7Yq 4U72A 2XUEA 3N9PA 1OWAA 3UT5E 3ZCJA 5HAXA 4H63V 5LYJE 3KDSE 2NWBA 4AQFC 3EDUA 1Z0PA 2RP4A 4AI6A 2ZM2A 2MYSA 3RX6A 2BZBA 2YEVC 2CLYC 4O8SA 4QHOA 4ZOLE 4I4TE 2YINA 4PK5A 1IAPA 2NOXA 1HX8A 4HFVA 3OBVE 3M65A 4ILUA 4TV9E 2DHRA 3I0QA 2C0SA 2W0GA 4PJNA 1WR6A 2X68A 2XASB 3SOLA 4O2AE 5DJQC 4EYYR 4EZ4A 4X20E 4QXHB 4KBMB 3HR0A 4P09A 2CEAA 2Y6XA 3N2OA 4P0BA 2N9DA 2EHOC 3PU3A 5JVDE 3ZJ2A 3CQXC 3ZJ1A 1VOMA 2CM0A 5LP6E 4WW0A 2JQQA 1EZ3A 3O9XA 3RRCA 4BJMA 4AKHA 3ZYMA 4AKIA 4WNKA 4MLKA 4AXPA 2LSJA 3Q5WA 2C5IT 3ZC1A 2D0TA 3RYIE 4H9RC 4E7SA 2C5KT 4ASKA 2G0UA 3V5SA 3WAJA 4JEHB 3LJCA 1NAFA 4AKRB 1IZNB 5L3FB 3MACA 4O4HE 2LSYA 4ISSA 3ZPOA 3K3NA 1WYCA 4FJOA 3HKBE 4X1IE 3L3PA 4H63H 5JDMA 3FB2A 5CA1E 2CXLA 2DWKA 5DABA 3RRWA 5J2UE 3E22E 3HA4A 2V26A 5HWYA 4DVDA 2CMRA 4U74A 1US7B 4ZHQE 4EIWA 2A72A 2ZMAA 1IJ5A 2VKHA 2VL8A 2YK0A 2ZM8A 4UEMA 2L8KA 3KV9A 2WM9A 2W62A 3K3QC 4CI1B 2LSKA 3B13A 3AVSA 2KMFA 2KXPB 2H3RA 2HPJA 4OHFA 2SPCA 2H7OA 4UIGA 4L9IA 4BJNA 4QKNA 2Q9QA 3LG7A 3T8OA 2JJ9A 4K0UA 3SRZA 3PUQA 3CKDA 4HE8A 3FBZA 3ZCIA 4DBQA 2XAFB 5IHYA 2NW7A 4EOZB 1LRZA 3MJXA 4O4LE 3EUHA 1S35A 3PTRB 3ZMTB 4HKAA 2EHOB 4AQGA 5TAOA 1OXZA 4UF0B 3UUMA 4PJMA 3KV6A 3RPUA 1MNEA 3N2GE 4ADZA 4L0RA 5L3DB 4ANJA 2ZM0A 4ZI2D 3OYXA 1G73A 4CI2B 5JDNA 2X9YA 1MMDA 3C51A 4I50E 4PFPA 3CWZB 3MK7C 3OYZA 5LA6E 4UV9B 5FMNA 3P8CD 4WBOA 4EYUA 4IDZA 5HXHA 3CX7B 2XAQB 1BR1A 3I9YA 1BR2A 4EXTA 3DP7A 1S94A 3PU8A 4L5GA 4YJ3E 5JDFA 5EK4A 2KT9A 2LT3A 4UVBB 4CXYA 4WBNE 2V7KA 3HKDE 1HS7A 2H7VC 3SS1A 1B7TA 1MIVA 3LFMA 4UELA 1FMVA 3Q2MA 4GIWA 5JR9C 2XAHB 4IGUA 2IC6A 3ZEFB 3ZMSB 4TX5A 1WLXA 3F2EA 3HKCE 5LOVE 1SA0E 3JC6C 2HPLA 4PJLA 2WMOA 2X66A 5DQVA 4EB6E 3RC8A 2X9WA 4PJJA 4GK5E 4UXNB 3ZYLA 1UCUA 2JMKA 3UFEA 3IEEA 1X79A 3C4XA 2CXFA 2K9AA 1E1HB 5L3BB 2ZLYA 1MMGA 2VB6A 1D0XA 3FXDB 4ZI7E 4CI3B 2IW5B 5JH7E 3ZN0B 2K5BB 2X0LB 3KFWX 5FY1A 2YU2A 5L3GB 4QX8B 1UX4A 3N9MA 3VKGA 4AQFA 2VKDA 4Z8XA 1U4QA 2XHEB 3K8PC 1MIWA 1LVFA 3O1HA 2WMNA 2DLRA 2L9QA 3BQKA 4CXXA 5FXWA 3HKEE 1HG5A 2X9HA 5EK3A 3RC3A 1D1CA 3FXEB 2E9XD 4O4JE 1V9DA 2I59A 3CQGB 4JLEA 1AJ3A 2GK9A 2Q9QD 5H6RB 3GMIA 5HXSA 3PDYA 4IHJE 2V7LA 3N9OA 4G63A 3GWHA 3PE0A 3UTKA 3ZMZB 4ZI3C 1D1BA 2NW8A 5JDLA 3NZQA 4NUUA 4C91A 3LK42 2EHOA 5LGNB 3ESLA 1BR4A 3CQCB 3CX6B 4UF0A 4UVAB 5ETWA 4E7ZA 3I0OA 3BK9A 3BQIA 5FXXA 3ANWB 5JR9B 3O4XE 1NWMX 3KINB 3OJAA 5LCYA 4IE0A 2D2SA 5FNVE 1WRDA 3VHLA 2LHNA 5HYAA 2HH7A 3AVRA 4I43B 3CMLA 3RYCE 4OFZA 2V7MA 3H37A 4XBFB 4XAXB 3VU7H 3D0TA 3UUNA 5J1GA 2IC9A 1ZV4X 2M67A 2CLYB 2BDEA 2D0UA 2LE8A 2BVLA 2RA1A 2D5UA 5A1LA 3ZC0A 2Z6EA 3F31A 3I1AA 2CCQA 3Q5XA 2YU1A 4GK0E 1VRBA 5F8PA 3TKLB 2E9XC 2LEHA 4PNIA 4AKLA 3CVRA 4OK0A 5C8YE 5F3JA 3NBXX 4DMWA 3AB3B 2Y8DA 4HTEA 3RKOA 1BR0A 3GN5A 4DMVA 3KVBA 2W63A 3C4ZA 3J9X1 4QX7B 3C64A 1ZHCA 3L09A 4KMCA 5JDGA 2ODVA 3OKQA 3E08A 3K3OA 3LK2B 3PURA 5LGTB 3WAKA 2CWOA 1YW0A 2CXDA 4N78D 2LJLA 4JEUB 3AAEB 4PFOA 2JPFA 3SWHA 4GYRA 3MA9A 5M4YA 3EVYA 2XAGB 3C4WA 5BMVE 2W00A 2X51A 4GYSA 4EZHA 4UVCB 3DJBA 3AA6B 3KVAA 4PK6A 4DNDA 1SHZC 2C5JA 2N2NA 2UXXB 5L3CB 2L3LA 4FI5A 3I9WA 3N2KE 3ZMVB 3EDVA 1Y64B 4X1KE 2CWYA 2VK9A 2VWAA 4BAYB 2A3DA 2PBIA 5AFUL 3QK6A 3LBXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LJL A;  2L9Q A;  4AXP A; 
#chains in the Genus database with same CATH topology
 2WS3 A;  2ACX A;  5EK2 A;  2V5C A;  5LG3 A;  2WZH A;  4HGA A;  5AQH B;  2H88 A;  1MMN A;  2BBJ A;  2VKO A;  3GN5 B;  4GOU A;  1Z8U A;  2KIN B;  4EGW A;  2VVS A;  4U2Y A;  2XTL A;  4Z90 A;  1D1A A;  3GA8 A;  5FXV A;  4CN6 A;  1T72 A;  2CA5 A;  3P7I A;  2IDO B;  2X9X A;  2MOZ A;  2VAS A;  2QVA A;  4KHP T;  3H3A A;  3T1H T;  4TV8 E;  1JNR A;  3N9N A;  3KBU A;  2WP9 A;  4C90 A;  3LBX B;  4IIJ E;  2LM9 A;  4IE5 A;  1MND A;  1ZEE A;  2JRK A;  4TWF A;  2KND A;  5HXC A;  4V1A v;  2V7J A;  4DBR A;  2NTX A;  1HF8 A;  2VQF T;  3KV5 A;  5CB4 E;  5LNK A;  4WZX A;  2WQY A;  4U2Z A;  3AE2 A;  2DI4 A;  3PUA A;  2BVM A;  5LJM A;  1KFY A;  2LSG A;  5AQT B;  5LBM A;  4DR7 T;  4NPP A;  1CUN A;  3ONL C;  2Q9Q C;  3FBL A;  5L2L A;  4HWC A;  4QXC B;  2E9X A;  4H9S E;  4DV1 T;  4H9O C;  2BG9 E;  3ONX A;  1N33 T;  2MTQ A;  1KNZ A;  1YD8 G;  4PW8 A;  3CPZ A;  4JUY A;  1XZY A;  4B3R T;  3ETV A;  3L39 A;  1WFD A;  1QSD A;  1UK5 A;  4YJ2 E;  3A8Y C;  1XWM A;  3V5U A;  2AE9 A;  2QA7 A;  2XPK A;  2BG9 B;  5LHH B;  4P0A A;  2H89 A;  2XQY A;  1NEN A;  2XSA A;  2B1E A;  5JRC B;  2ES0 A;  4ZS3 A;  5LG4 A;  3RHW A;  4EV6 A;  2K24 A;  4UR9 A;  2MBG A;  4ZI3 D;  2K48 A;  3AEA A;  2XQA A;  2RPA A;  3J7Y q;  3N9P A;  2YDQ A;  5L4H A;  4AI6 A;  4IDN A;  2ZM2 A;  5CGM A;  3AED A;  2CLY C;  4HFV A;  3FZM B;  1HX1 B;  2X68 A;  3P4Q A;  5DJQ C;  4WYV A;  4ZXL A;  2I6H A;  3N2O A;  1OED C;  2CM0 A;  5LP6 E;  5HEO A;  3ZYM A;  4AKI A;  4MLK A;  4AXP A;  4YSY A;  2AXD S;  2C5I T;  3Q5W A;  2C5K T;  3V5S A;  3WAJ A;  4AKR B;  3VR8 A;  4O4H E;  2M6B A;  3RQW A;  1E2A A;  5JDM A;  3L8R A;  5DAB A;  1CHU A;  2I0M A;  3PV0 F;  4DVD A;  2CMR A;  4ZHQ E;  4EIW A;  2ZMA A;  1IJ5 A;  4UEM A;  2FJA A;  3K3Q C;  2KMF A;  2MPK A;  2H7O A;  4UIG A;  4L9I A;  4BJN A;  4QKN A;  2XQ6 A;  3FBZ A;  2CBJ A;  2FJB A;  3RPU A;  3N2G E;  3ZST A;  4ANJ A;  3OPC A;  1UGO A;  2ZM0 A;  4KHZ F;  3UU4 A;  2UUA T;  4YT0 A;  4PFP A;  1GQE A;  1HR0 T;  2XZE A;  3B5M A;  3PUY F;  5FKY A;  2XAQ B;  4EXT A;  1BR2 A;  2V6Y B;  5EK4 A;  4NXM T;  2YOE A;  2MAW A;  1HS7 A;  1B7T A;  1MIV A;  4IRE A;  2IC6 A;  3ZMS B;  4TX5 A;  3JC6 C;  2X66 A;  3TLU A;  2YKS A;  2CBI A;  1X79 A;  2VB6 A;  2IW5 B;  1DU2 A;  3ZT5 A;  2UXB T;  3NVO A;  3AE9 A;  2OV9 A;  4Z8X A;  2XHE B;  3K8P C;  1LVF A;  2HN2 A;  3RC3 A;  2X9H A;  3GMI A;  4IHJ E;  4G63 A;  3PE0 A;  4X66 T;  1BR4 A;  4E7Z A;  2E2A A;  4GKK T;  2XQ4 A;  3O4X E;  3KIN B;  3EAB A;  2XQ8 A;  2D2S A;  5FNV E;  4XBF B;  4XAX B;  2IC9 A;  1ZV4 X;  3TLT A;  4LFA T;  5HEU A;  5A1L A;  3SFD A;  3ZC0 A;  3F31 A;  3I1A A;  2CCQ A;  3Q5X A;  4AIU A;  1IBK T;  4OK0 A;  5ABF B;  2E5L T;  5C2T A;  4HTE A;  3RKO A;  3AE4 A;  5LMU T;  3C4Z A;  4IDP A;  1ZHC A;  3L09 A;  4IL9 A;  3JAE A;  2CXD A;  3PUZ F;  5M4Y A;  3C4W A;  5BMV E;  1T7S A;  4UVC B;  3DJB A;  3AA6 B;  3KVA A;  4DND A;  2UXX B;  3EAM A;  2L3L A;  2VL0 A;  3N2K E;  5FVL A;  4X1K E;  2CWY A;  5AFU L;  2VK9 A;  5FY0 A;  3QK6 A;  1WCR A;  2WBL A;  4O2B E;  4ILB A;  4U7I A;  1IJ6 A;  2KWH A;  4YSZ A;  1UUS A;  1T98 A;  4DR2 T;  3X1D A;  3MXZ A;  3F57 A;  1LKX A;  2EHO D;  2DL1 A;  4XZC A;  5J2T E;  1ZP0 A;  3O1J A;  2YDS A;  4HWF A;  1X9B A;  4AIS A;  3MKD A;  3AEG A;  1FIO A;  4DO0 A;  4YTN A;  2XM1 A;  5FL1 A;  4IE7 A;  3NRX A;  5L47 A;  5L4E A;  3AAA B;  4M1P A;  5LGU B;  1XNR T;  3SFE A;  3ZSS A;  2DWG A;  4OYJ A;  2W61 A;  2LOS A;  4KI0 F;  4IST A;  4YLH A;  4H9N C;  2FUP A;  5GON E;  3RH3 A;  5J0Z A;  1U5P A;  4A97 A;  5AQM B;  2WB5 A;  5ABH A;  5DQW A;  3RI5 A;  4EAH A;  1SE7 A;  2OA5 A;  4ERR A;  3RKG A;  2P9B A;  3RYH E;  3PUV F;  4DR3 T;  4JI5 T;  4DV6 T;  4HFB A;  3AEE A;  4I55 E;  2CRB A;  4F6R C;  4MBQ A;  5AQK B;  1HG2 A;  4IE4 A;  2X0Y A;  2E8I A;  3JAD A;  2V1D B;  4OYK A;  4DR4 T;  5LBQ B;  3AA7 B;  1QUU A;  3KV4 A;  3ZMU B;  4ILA A;  5KDM C;  5CA0 E;  5ADX L;  3FHN A;  3QC9 A;  2V7I A;  4OX9 T;  4CQI A;  4PK4 A;  3PJA A;  4HFI A;  3NRY A;  2ACZ A;  5C3J A;  3UU8 A;  1FEW A;  3WI3 A;  4CZZ B;  4HFC A;  1ZKE A;  2E9X B;  2XM2 A;  4JI1 T;  4TUY E;  2Q9Q B;  2W67 A;  2IUB A;  1OWA A;  3UT5 E;  5HAX A;  4H63 V;  5LYJ E;  2NWB A;  4AQF C;  3EDU A;  2MYS A;  3RX6 A;  4I4T E;  3AXJ B;  1HX8 A;  3OBV E;  2DHR A;  2C0S A;  2W0G A;  3SOL A;  4EZ4 A;  4X20 E;  4QXH B;  4P09 A;  3P4W A;  3RGL A;  2QRX A;  4LFC T;  3PU3 A;  5JVD E;  3ZJ2 A;  3CQX C;  4WW0 A;  2JQQ A;  5ABG A;  5AQV B;  4AKH A;  2XQ7 A;  3UUB A;  3RYI E;  4H9R C;  4JEH B;  4JI6 T;  1NAF A;  5L3F B;  1IZN B;  2LSY A;  4DUY T;  4IT4 A;  4FJO A;  3HKB E;  3LDQ B;  3L3P A;  3FB2 A;  5J2U E;  4LF6 T;  2WDQ A;  4HWI B;  5LMN T;  4HWD A;  4ZZC A;  4Z91 A;  3JAF A;  3AVS A;  2H3R A;  2UUC T;  4OHF A;  2Q9Q A;  4ZZB A;  3SRZ A;  4U7Y A;  3VR9 A;  3AE3 A;  3AE6 A;  1VCT A;  3ZCI A;  1N34 T;  2QYW A;  2XAF B;  4GKJ T;  4P1N A;  3MJX A;  4O4L E;  3EUH A;  4TNW A;  1S35 A;  2XY8 B;  1OED B;  3ZMT B;  4AQG A;  5BR8 T;  3UUM A;  4PJM A;  3KV6 A;  3ZT7 A;  3AXJ A;  2UXD T;  4ZI2 D;  4CI2 B;  2X9Y A;  1MMD A;  4I50 E;  3CWZ B;  2IIU A;  5LA6 E;  2V6X A;  3P8C D;  5HXH A;  1BR1 A;  4YJ3 E;  3PU8 A;  5JDF A;  3H3M A;  4CXY A;  4WBN E;  4LF4 T;  1QLB A;  3HKD E;  5AQP B;  2H7V C;  2WWV A;  4EED A;  4IL4 A;  3SS1 A;  5JR9 C;  4UEL A;  2B76 A;  2UXC T;  2XAH B;  4X5T A;  5LOV E;  1XNQ T;  3ZYL A;  3UFE A;  3IEE A;  3C4X A;  2ZLY A;  3FXD B;  1D0X A;  3RF1 A;  4NXN T;  4CI3 B;  5JH7 E;  3ZN0 B;  2K5B B;  5FY1 A;  5L3G B;  5FL0 A;  1I94 T;  3FZF B;  2VKD A;  3O1H A;  2WMN A;  3BQK A;  5FXW A;  3HKE E;  4U33 A;  5EK3 A;  3FXE B;  3CQG B;  2GK9 A;  3PDY A;  3AEC A;  2V7L A;  3UTK A;  4K0K T;  4ZI3 C;  1L0V A;  3NZQ A;  4NUU A;  3LK4 2;  5AQI B;  4YSX A;  1OED A;  5LGN B;  3CX6 B;  3BQI A;  3ANW B;  5LCY A;  4IE0 A;  4DR6 T;  2HH7 A;  3AVR A;  3QOF A;  3CML A;  5HCJ A;  3H37 A;  2BG9 C;  2M67 A;  2BDE A;  4ILC A;  2RA1 A;  3UU5 A;  4AKL A;  3CVR A;  3AB3 B;  4DMV A;  3KVB A;  2W63 A;  3J9X 1;  4QX7 B;  5AQN B;  5LGT B;  4GYR A;  4HFD A;  4JI4 T;  1W0A A;  4CN4 A;  3EDV A;  3AEF A;  2A3D A;  4CXW A;  2PJQ A;  3W15 B;  4QWN B;  4MAL A;  2PTF A;  2QGS A;  5HCM A;  2BS3 A;  2LSI A;  3ANW A;  5FP3 A;  5HEH A;  5AQF B;  1O3X A;  5CJ5 A;  5JDH A;  1XDO A;  2CE7 A;  5CFB A;  2LKG A;  2WSS V;  2XQ9 A;  2R6G F;  4A5X A;  2PFV A;  5LHI B;  4LF9 T;  1XMO T;  5H6Q B;  3LK3 B;  5LHG B;  4G2A A;  1H7C A;  4IE6 A;  2KLQ A;  2N1G A;  4X1Y E;  5FY7 A;  3UUL A;  1W0B A;  3BQL A;  3QUJ A;  3AA1 B;  3ETU A;  2HHH T;  3PUS A;  2VVN A;  1MMA A;  2VKJ A;  1NEK A;  5AQL B;  2XQ3 A;  2LOP A;  3O1I A;  3IBP A;  4A56 A;  3IA3 A;  3RYF E;  1J5W A;  2NW9 A;  4JI8 T;  4NUV A;  2ZM6 T;  2VQE T;  4B6X A;  2PG8 A;  4KP3 C;  5AQU B;  1I6Z A;  2XSB A;  4TN7 B;  2BKO A;  3HL6 A;  4B3S T;  5E0O A;  5FXZ A;  2WY2 A;  1UX5 A;  4MHC A;  2JMH A;  1YKE B;  2A2F X;  2CHN A;  4H9Q C;  4AKG A;  3ZLI A;  2DCF A;  5IUX A;  4TZ4 C;  5LJN A;  5IYZ E;  3ZN1 B;  2E5V A;  2WAU A;  2KZ7 B;  3T1Y T;  2LHR A;  4YHJ A;  1HCI A;  2X67 A;  2WWU A;  3Q9D A;  3NWI A;  3FZL B;  2OLT A;  2NP9 A;  1WR0 A;  1HTJ F;  4ZS2 A;  2HN1 A;  4U72 A;  3ZCJ A;  4HFH A;  3NKZ A;  3KDS E;  1Z0P A;  4QH5 A;  2BZB A;  2YEV C;  4LFB T;  4QHO A;  4ZOL E;  1IAP A;  4ILU A;  3M65 A;  4TV9 E;  1SUM B;  1WR6 A;  4YTP A;  1IBM T;  4O2A E;  4EYY R;  2V5D A;  2CEA A;  2Y6X A;  4YTM A;  4P0B A;  2N9D A;  1IBL T;  2EHO C;  5FVK A;  3ZJ1 A;  4COF A;  3RIU C;  1EZ3 A;  3O9X A;  3RRC A;  4WNK A;  4LML A;  2LSJ A;  4YXD A;  3ZC1 A;  2D0T A;  4E7S A;  2G0U A;  4HFE A;  3LJC A;  3ZPO A;  4ISS A;  5AQR B;  1WYC A;  4X1I E;  4H63 H;  4IDQ A;  2CXL A;  3RRW A;  3HA4 A;  2W66 A;  2V26 A;  4U74 A;  3P4S A;  2A72 A;  3AE8 A;  2VKH A;  2ZM8 A;  2BKP A;  2L8K A;  4LMJ A;  2WM9 A;  4CI1 B;  2LSK A;  5AQJ B;  3B13 A;  2KXP B;  5IWA T;  2HPJ A;  3CK6 A;  2JJ9 A;  3Q5D A;  3CKD A;  5IHY A;  2NW7 A;  2YN6 A;  4DV4 T;  2JIW A;  1KNR A;  3UQ4 A;  4YY3 T;  5AQG B;  3OYX A;  5JDN A;  2WDV A;  3MK7 C;  4NIQ A;  4UV9 B;  5AQQ B;  3M3Z B;  3FZH B;  4EYU A;  4WBO A;  4AQY T;  4IDZ A;  2XJ7 A;  3CX7 B;  3I9Y A;  2UUB T;  2KT9 A;  4LF7 T;  2LT3 A;  4UVB B;  2V7K A;  3AE7 A;  4IDO A;  3Q2M A;  4GIW A;  3ZEF B;  3F2E A;  2NR4 A;  4PJL A;  2HPL A;  2WMO A;  5HEG A;  4DID B;  2BBH A;  4PJJ A;  4UXN B;  3A7M A;  1UCU A;  5AQO B;  2CXF A;  1HNW T;  2K9A A;  4F8H A;  1MMG A;  2BS4 A;  4X65 T;  3KFW X;  2J47 A;  2BKN A;  2YU2 A;  1UX4 A;  3VKG A;  4AQF A;  1U4Q A;  2UU9 T;  1MIW A;  3UFG A;  4LF8 T;  2E9X D;  1T8B A;  4I0U A;  4O4J E;  1V9D A;  2Q9Q D;  5H6R B;  5HXS A;  3N9O A;  3RLF F;  1J1J A;  3ZMZ B;  5JDL A;  3Q5E A;  3G06 A;  1N32 T;  2IML A;  1YQ4 A;  3I0O A;  5JR9 B;  2F4V T;  1NWM X;  4YHH T;  3OJA A;  5HEJ A;  1WRD A;  2LHN A;  5HYA A;  4I43 B;  3RYC E;  4JI2 T;  3D0T A;  4QH4 A;  1OED E;  5J1G A;  4U31 A;  2CLY B;  2D0U A;  2LE8 A;  2BVL A;  2Z6E A;  5F8P A;  2YU1 A;  3TKL B;  2E9X C;  4PNI A;  5C8Y E;  5F3J A;  3NBX X;  3GN5 A;  2FBW A;  3LSV A;  4TWD A;  4KMC A;  3TLS A;  2ODV A;  3OKQ A;  1R8I A;  3PUR A;  2CWO A;  1YW0 A;  4N78 D;  4JEU B;  4PFO A;  3MA9 A;  3EVY A;  3QB5 K;  2M6I A;  2X51 A;  4GYS A;  2FJD A;  3I9W A;  1Y64 B;  4BAY B;  3LBX A;  4QXB B;  1FMW A;  3A5X A;  3N9Q A;  4A98 A;  5JRE A;  4O4I E;  2LRL A;  1XMQ T;  5FYM A;  4LMK A;  4KUM B;  5HXR A;  4JBW F;  3PUX F;  5JQG E;  5JR9 A;  2IAK A;  3UQ7 A;  4ZI2 C;  2J4G A;  2KWI B;  5L3E B;  2J1D G;  4PAG A;  3AE5 A;  1KK7 A;  4H9P C;  5HWX A;  1JNZ A;  5LXT E;  1G8X A;  4LF5 T;  2D9D A;  4BA9 A;  4DR5 T;  4B3M T;  4DV2 T;  5KX5 E;  4Q25 A;  3P50 A;  4CN1 A;  5HXE A;  4JYA T;  1HNZ T;  3E0Z A;  2Y48 B;  3UUX B;  2LM2 A;  1MIY A;  1LVK A;  3QNU A;  1D0Z A;  1YKH B;  3CX8 B;  2LLY A;  2YDR A;  3HI2 A;  2BG9 A;  2DNX A;  2BS2 A;  3R84 B;  3IHR A;  5ABE A;  3MZK B;  3U78 A;  5JRC A;  1WYB A;  3VKH A;  3N5L A;  3DTO A;  3RIF A;  1HFA A;  3C98 B;  4MFR A;  3JC6 D;  4J2C A;  5EZY E;  3IF8 B;  3KBT A;  3C50 A;  1YQ3 A;  3S4U A;  4HEA A;  3PUG A;  4UV8 B;  4YFS A;  3ZYK A;  5JDQ A;  3P4R A;  3NZP A;  3N9L A;  1VCS A;  2NTY A;  3B57 A;  2UXN B;  4X62 T;  4JI7 T;  4JV5 T;  5KMG P;  3K1S A;  3AA0 B;  3AAI A;  4HN9 A;  2XAJ B;  3R6N A;  2CHO A;  1M62 A;  2ODU A;  4DV3 T;  3CIR A;  1D0Y A;  4TWH A;  3U3I A;  4HWH A;  2XUE A;  2JQK A;  2RP4 A;  4JI3 T;  4O8S A;  4PK5 A;  2YIN A;  2NOX A;  3I0Q A;  4PJN A;  4X64 T;  2LKH A;  2XAS B;  3JCF A;  4KBM B;  3HR0 A;  3OTO T;  2CPT A;  3PUW F;  2IHR 1;  1VOM A;  4BJM A;  3TLV A;  2WDR A;  2W2U A;  4ASK A;  3MAC A;  3K3N A;  5CA1 E;  3QB5 A;  2DWK A;  3E22 E;  5HWY A;  3UU3 A;  1US7 B;  3EI0 A;  2VL8 A;  2YK0 A;  3KV9 A;  3ABV A;  2V6Y A;  2W62 A;  5F5W A;  2SPC A;  3LG7 A;  2WZI A;  3T8O A;  4K0U A;  3RIA A;  3PUQ A;  4HE8 A;  2JQ9 A;  4DBQ A;  4EOZ B;  4B3T T;  1LRZ A;  5AQS B;  2A9U A;  3PTR B;  4HKA A;  2EHO B;  5TAO A;  1OXZ A;  4UF0 B;  1MNE A;  4ADZ A;  4L0R A;  5L3D B;  3P4P A;  1KF6 A;  1G73 A;  3C51 A;  1FJG T;  3OYZ A;  4U3C A;  5FMN A;  1KEY A;  3VRB A;  3DP7 A;  4ZEY A;  1S94 A;  4L5G A;  1YXR A;  3UU6 A;  3LFM A;  5JTG A;  1FMV A;  4IGU A;  1WLX A;  3HKC E;  1HNX T;  1SA0 E;  5DQV A;  3RC8 A;  4EB6 E;  4DV7 T;  2X9W A;  3RQU A;  4GK5 E;  2VUR A;  2WU2 A;  2JMK A;  1E1H B;  5L3B B;  4ZI7 E;  5KXJ A;  2J62 A;  2X0L B;  2V8S V;  2WU5 A;  4QX8 B;  3N9M A;  2LRK A;  3VRA A;  2W4X A;  2DLR A;  2L9Q A;  2KSR A;  4CXX A;  3ZKR A;  2WCA A;  1HG5 A;  1D1C A;  2K3W A;  2I59 A;  4JLE A;  1AJ3 A;  4EEB A;  3OVU A;  3FZK B;  5ABF A;  3GWH A;  3EHZ A;  1D1B A;  2NW8 A;  4JI0 T;  4C91 A;  4QH1 A;  2EHO A;  3ESL A;  3CQC B;  2JQH A;  4UF0 A;  4UVA B;  5ETW A;  1M7K A;  2FJE A;  3RIU A;  3PJA J;  3BK9 A;  2XQ5 A;  5LB7 B;  5FXX A;  1UUR A;  1E7P A;  4DR1 T;  3VHL A;  1Y01 A;  4OFZ A;  2X0H A;  2V7M A;  1XDP A;  3VU7 H;  3TLW A;  3UUN A;  2D5U A;  4KX6 A;  4GK0 E;  1VRB A;  2LEH A;  1W09 A;  4DMW A;  2Y8D A;  3AEB A;  1BR0 A;  3C64 A;  5JDG A;  4DV0 T;  3E08 A;  3K3O A;  3LK2 B;  1N36 T;  3WAK A;  2LJL A;  1W9R A;  3AAE B;  2JPF A;  4DV5 T;  3SWH A;  4DUZ T;  2XAG B;  2W00 A;  4EZH A;  1J5E T;  4TNV A;  1ZOY A;  4PK6 A;  1SHZ C;  2C5J A;  2N2N A;  3ZT6 A;  5L3C B;  4FI5 A;  1KNP A;  3ZMV B;  2VWA A;  3AE1 A;  2PBI A;  3ONJ A; 
#chains in the Genus database with same CATH homology
 2WBL A;  4O2B E;  4QXB B;  4CXW A;  1FMW A;  2ACX A;  2PJQ A;  4QWN B;  4MAL A;  3W15 B;  5EK2 A;  1IJ6 A;  3A5X A;  3N9Q A;  2KWH A;  2QGS A;  4HGA A;  5JRE A;  4O4I E;  1T98 A;  1MMN A;  2VKO A;  5FYM A;  3GN5 B;  3MXZ A;  4KUM B;  5HXR A;  3F57 A;  1LKX A;  2EHO D;  4XZC A;  5J2T E;  2LSI A;  5JQG E;  3O1J A;  4GOU A;  3ANW A;  5JR9 A;  3MKD A;  1FIO A;  4DO0 A;  2IAK A;  2KIN B;  5FP3 A;  2XTL A;  4IE7 A;  1D1A A;  3GA8 A;  3NRX A;  5FXV A;  4ZI2 C;  1O3X A;  2KWI B;  5JDH A;  3P7I A;  2CA5 A;  2J1D G;  3AAA B;  4M1P A;  5L3E B;  2X9X A;  2CE7 A;  2MOZ A;  5LGU B;  2VAS A;  2WSS V;  2DWG A;  3H3A A;  4PAG A;  4OYJ A;  4TV8 E;  2W61 A;  1KK7 A;  2PFV A;  2LOS A;  5LHI B;  4H9P C;  5HWX A;  3N9N A;  5H6Q B;  3KBU A;  3LK3 B;  4C90 A;  4IST A;  3LBX B;  5LXT E;  4YLH A;  4IIJ E;  1G8X A;  5LHG B;  4H9N C;  2LM9 A;  4G2A A;  1H7C A;  4IE6 A;  4BA9 A;  4IE5 A;  1MND A;  1ZEE A;  2KLQ A;  2JRK A;  2N1G A;  5GON E;  4X1Y E;  5KX5 E;  2KND A;  3RH3 A;  5FY7 A;  4V1A v;  1U5P A;  5HXC A;  2V7J A;  3UUL A;  5HXE A;  4DBR A;  2NTX A;  1HF8 A;  3BQL A;  3E0Z A;  3KV5 A;  5CB4 E;  5LNK A;  3QUJ A;  3AA1 B;  2Y48 B;  3ETU A;  3PUS A;  5DQW A;  1MMA A;  2VKJ A;  4EAH A;  2OA5 A;  3UUX B;  4ERR A;  2DI4 A;  1MIY A;  2P9B A;  3RYH E;  1LVK A;  1D0Z A;  1YKH B;  3PUA A;  2BVM A;  3CX8 B;  5LJM A;  2LOP A;  2LSG A;  3O1I A;  3IBP A;  4I55 E;  4A56 A;  4F6R C;  4MBQ A;  3HI2 A;  3RYF E;  1HG2 A;  4IE4 A;  5LBM A;  2NW9 A;  2DNX A;  1CUN A;  2Q9Q C;  4NUV A;  2E8I A;  3R84 B;  4B6X A;  3IHR A;  2V1D B;  3MZK B;  4OYK A;  2PG8 A;  4KP3 C;  3U78 A;  3FBL A;  5L2L A;  5LBQ B;  5JRC A;  1WYB A;  3AA7 B;  4TN7 B;  3VKH A;  4QXC B;  2E9X A;  3N5L A;  3DTO A;  4H9S E;  5FY0 A;  1HFA A;  3C98 B;  3HL6 A;  5E0O A;  5FXZ A;  4H9O C;  3ONX A;  1QUU A;  4MFR A;  3KV4 A;  3JC6 D;  3ZMU B;  4J2C A;  2MTQ A;  1KNZ A;  1YD8 G;  5KDM C;  5EZY E;  4PW8 A;  1UX5 A;  3IF8 B;  3C50 A;  3CPZ A;  3KBT A;  5CA0 E;  4JUY A;  4MHC A;  2JMH A;  3ETV A;  3S4U A;  5ADX L;  1YKE B;  4HEA A;  2A2F X;  3FHN A;  3QC9 A;  2V7I A;  4H9Q C;  4AKG A;  3ZLI A;  4CQI A;  3PUG A;  2DCF A;  4PK4 A;  1QSD A;  4YJ2 E;  4TZ4 C;  4UV8 B;  3V5U A;  4YFS A;  3ZYK A;  2QA7 A;  5LHH B;  5LJN A;  5JDQ A;  4P0A A;  3NRY A;  3NZP A;  3N9L A;  5IYZ E;  2NTY A;  3ZN1 B;  3B57 A;  2WAU A;  2KZ7 B;  2UXN B;  1FEW A;  2XQY A;  2LHR A;  4YHJ A;  1HCI A;  3WI3 A;  2B1E A;  4CZZ B;  5KMG P;  5JRC B;  2X67 A;  2ES0 A;  4ZS3 A;  3AA0 B;  1ZKE A;  2WWU A;  3AAI A;  5LG4 A;  4HN9 A;  2XAJ B;  3R6N A;  2E9X B;  2K24 A;  2ODU A;  1D0Y A;  4TUY E;  2Q9Q B;  3Q9D A;  3U3I A;  2NP9 A;  2MBG A;  4ZI3 D;  1HTJ F;  2K48 A;  4ZS2 A;  3J7Y q;  4U72 A;  2XUE A;  3N9P A;  1OWA A;  3UT5 E;  3ZCJ A;  5HAX A;  4H63 V;  5LYJ E;  3KDS E;  2NWB A;  4AQF C;  3EDU A;  1Z0P A;  2RP4 A;  4AI6 A;  2ZM2 A;  2MYS A;  3RX6 A;  2BZB A;  2YEV C;  2CLY C;  4O8S A;  4QHO A;  4ZOL E;  4I4T E;  2YIN A;  4PK5 A;  1IAP A;  2NOX A;  1HX8 A;  4HFV A;  3OBV E;  3M65 A;  4ILU A;  4TV9 E;  2DHR A;  3I0Q A;  2C0S A;  2W0G A;  4PJN A;  1WR6 A;  2X68 A;  2XAS B;  3SOL A;  4O2A E;  5DJQ C;  4EYY R;  4EZ4 A;  4X20 E;  4QXH B;  4KBM B;  3HR0 A;  4P09 A;  2CEA A;  2Y6X A;  3N2O A;  4P0B A;  2N9D A;  2EHO C;  3PU3 A;  5JVD E;  3ZJ2 A;  3CQX C;  3ZJ1 A;  1VOM A;  2CM0 A;  5LP6 E;  4WW0 A;  2JQQ A;  1EZ3 A;  3O9X A;  3RRC A;  4BJM A;  4AKH A;  3ZYM A;  4AKI A;  4WNK A;  4MLK A;  4AXP A;  2LSJ A;  3Q5W A;  2C5I T;  3ZC1 A;  2D0T A;  3RYI E;  4H9R C;  4E7S A;  2C5K T;  4ASK A;  2G0U A;  3V5S A;  3WAJ A;  4JEH B;  3LJC A;  1NAF A;  4AKR B;  1IZN B;  5L3F B;  3MAC A;  4O4H E;  2LSY A;  4ISS A;  3ZPO A;  3K3N A;  1WYC A;  4FJO A;  3HKB E;  4X1I E;  3L3P A;  4H63 H;  5JDM A;  3FB2 A;  5CA1 E;  2CXL A;  2DWK A;  5DAB A;  3RRW A;  5J2U E;  3E22 E;  3HA4 A;  2V26 A;  5HWY A;  4DVD A;  2CMR A;  4U74 A;  1US7 B;  4ZHQ E;  4EIW A;  2A72 A;  2ZMA A;  1IJ5 A;  2VKH A;  2VL8 A;  2YK0 A;  2ZM8 A;  4UEM A;  2L8K A;  3KV9 A;  2WM9 A;  2W62 A;  3K3Q C;  4CI1 B;  2LSK A;  3B13 A;  3AVS A;  2KMF A;  2KXP B;  2H3R A;  2HPJ A;  4OHF A;  2SPC A;  2H7O A;  4UIG A;  4L9I A;  4BJN A;  4QKN A;  2Q9Q A;  3LG7 A;  3T8O A;  2JJ9 A;  4K0U A;  3SRZ A;  3PUQ A;  3CKD A;  4HE8 A;  3FBZ A;  3ZCI A;  4DBQ A;  2XAF B;  5IHY A;  2NW7 A;  4EOZ B;  1LRZ A;  3MJX A;  4O4L E;  3EUH A;  1S35 A;  3PTR B;  3ZMT B;  4HKA A;  2EHO B;  4AQG A;  5TAO A;  1OXZ A;  4UF0 B;  3UUM A;  4PJM A;  3KV6 A;  3RPU A;  1MNE A;  3N2G E;  4ADZ A;  4L0R A;  5L3D B;  4ANJ A;  2ZM0 A;  4ZI2 D;  3OYX A;  1G73 A;  4CI2 B;  5JDN A;  2X9Y A;  1MMD A;  3C51 A;  4I50 E;  4PFP A;  3CWZ B;  3MK7 C;  3OYZ A;  5LA6 E;  4UV9 B;  5FMN A;  3P8C D;  4WBO A;  4EYU A;  4IDZ A;  5HXH A;  3CX7 B;  2XAQ B;  1BR1 A;  3I9Y A;  1BR2 A;  4EXT A;  3DP7 A;  1S94 A;  3PU8 A;  4L5G A;  4YJ3 E;  5JDF A;  5EK4 A;  2KT9 A;  2LT3 A;  4UVB B;  4CXY A;  4WBN E;  2V7K A;  3HKD E;  1HS7 A;  2H7V C;  3SS1 A;  1B7T A;  1MIV A;  3LFM A;  4UEL A;  1FMV A;  3Q2M A;  4GIW A;  5JR9 C;  2XAH B;  4IGU A;  2IC6 A;  3ZEF B;  3ZMS B;  4TX5 A;  1WLX A;  3F2E A;  3HKC E;  5LOV E;  1SA0 E;  3JC6 C;  2HPL A;  4PJL A;  2WMO A;  2X66 A;  5DQV A;  4EB6 E;  3RC8 A;  2X9W A;  4PJJ A;  4GK5 E;  4UXN B;  3ZYL A;  1UCU A;  2JMK A;  3UFE A;  3IEE A;  1X79 A;  3C4X A;  2CXF A;  2K9A A;  1E1H B;  5L3B B;  2ZLY A;  1MMG A;  2VB6 A;  1D0X A;  3FXD B;  4ZI7 E;  4CI3 B;  2IW5 B;  5JH7 E;  3ZN0 B;  2K5B B;  2X0L B;  3KFW X;  5FY1 A;  2YU2 A;  5L3G B;  4QX8 B;  1UX4 A;  3N9M A;  3VKG A;  4AQF A;  2VKD A;  4Z8X A;  1U4Q A;  2XHE B;  3K8P C;  1MIW A;  1LVF A;  3O1H A;  2WMN A;  2DLR A;  2L9Q A;  3BQK A;  4CXX A;  5FXW A;  3HKE E;  1HG5 A;  2X9H A;  5EK3 A;  3RC3 A;  1D1C A;  3FXE B;  2E9X D;  4O4J E;  1V9D A;  2I59 A;  3CQG B;  4JLE A;  1AJ3 A;  2GK9 A;  2Q9Q D;  5H6R B;  3GMI A;  5HXS A;  3PDY A;  4IHJ E;  2V7L A;  3N9O A;  4G63 A;  3GWH A;  3PE0 A;  3UTK A;  3ZMZ B;  4ZI3 C;  1D1B A;  2NW8 A;  5JDL A;  3NZQ A;  4NUU A;  4C91 A;  3LK4 2;  2EHO A;  5LGN B;  3ESL A;  1BR4 A;  3CQC B;  3CX6 B;  4UF0 A;  4UVA B;  5ETW A;  4E7Z A;  3I0O A;  3BK9 A;  3BQI A;  5FXX A;  3ANW B;  5JR9 B;  3O4X E;  1NWM X;  3KIN B;  3OJA A;  5LCY A;  4IE0 A;  2D2S A;  5FNV E;  1WRD A;  3VHL A;  2LHN A;  5HYA A;  2HH7 A;  3AVR A;  4I43 B;  3CML A;  3RYC E;  4OFZ A;  2V7M A;  3H37 A;  4XBF B;  4XAX B;  3VU7 H;  3D0T A;  3UUN A;  5J1G A;  2IC9 A;  1ZV4 X;  2M67 A;  2CLY B;  2BDE A;  2D0U A;  2LE8 A;  2BVL A;  2RA1 A;  2D5U A;  5A1L A;  3ZC0 A;  2Z6E A;  3F31 A;  3I1A A;  2CCQ A;  3Q5X A;  2YU1 A;  4GK0 E;  1VRB A;  5F8P A;  3TKL B;  2E9X C;  2LEH A;  4PNI A;  4AKL A;  3CVR A;  4OK0 A;  5C8Y E;  5F3J A;  3NBX X;  4DMW A;  3AB3 B;  2Y8D A;  4HTE A;  3RKO A;  1BR0 A;  3GN5 A;  4DMV A;  3KVB A;  2W63 A;  3C4Z A;  3J9X 1;  4QX7 B;  3C64 A;  1ZHC A;  3L09 A;  4KMC A;  5JDG A;  2ODV A;  3OKQ A;  3E08 A;  3K3O A;  3LK2 B;  3PUR A;  5LGT B;  3WAK A;  2CWO A;  1YW0 A;  2CXD A;  4N78 D;  2LJL A;  4JEU B;  3AAE B;  4PFO A;  2JPF A;  3SWH A;  4GYR A;  3MA9 A;  5M4Y A;  3EVY A;  2XAG B;  3C4W A;  5BMV E;  2W00 A;  2X51 A;  4GYS A;  4EZH A;  4UVC B;  3DJB A;  3AA6 B;  3KVA A;  4PK6 A;  4DND A;  1SHZ C;  2C5J A;  2N2N A;  2UXX B;  5L3C B;  2L3L A;  4FI5 A;  3I9W A;  3N2K E;  3ZMV B;  3EDV A;  1Y64 B;  4X1K E;  2CWY A;  2VK9 A;  2VWA A;  4BAY B;  2A3D A;  2PBI A;  5AFU L;  3QK6 A;  3LBX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...