2Q9QD

The crystal structure of full length human gins complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
192
structure length
186
Chain Sequence
b'SEAYFRVESGALGPEENFLSLDDILMSHEKLPVRTETAMPRLGAFFAETDNAVPQGSKLELPLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFGSQLLHFDSPENADISQSLLQTFIGRFRRIMDSSQNAYNEDTSALVARLDEMERGLFQTGQKGLNDFQCWEKGQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA replication complex GINS protein PSF2
publication title Crystal structure of the GINS complex and functional insights into its role in DNA replication.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
total genus 55
structure length 186
sequence length 192
chains with identical sequence H
ec nomenclature
pdb deposition date 2007-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF05916 Sld5 GINS complex protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2050 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2q9qD00
3ANWB 2EHOD 2E9XC 3JC6C 2Q9QD
chains in the Genus database with same CATH superfamily
4DV1T 5HWXA 2BDEA 2CBJA 4AKHA 2YDRA 5HWYA 3JAEA 4PJLA 3UFGA 2VKOA 4M1PA 5L3DB 2QGSA 3D0TA 5A1LA 1LKXA 5JR9B 3NVOA 3O9XA 2CBIA 3SWHA 4IL9A 3B57A 4AISA 3AB3B 2UU9T 4CI1B 2VB6A 3AEAA 3I9YA 2C5IT 1X9BA 2K5BB 3P4QA 4TN7B 5AQOB 5L3GB 3ONJA 1WR6A 4U2YA 2LRLA 2XPKA 1XDOA 4P1NA 3K3QC 2OV9A 3A8YC 3KV5A 2NR4A 3VR8A 5LNKA 3OYXA 4DR7T 1OEDE 2VVNA 4UR9A 2NW9A 5H6QB 5LOVE 1HNZT 4UIGA 4DV3T 3N5LA 4YSYA 2IC6A 4JEUB 3DP7A 4DVDA 2PG8A 2CXLA 5GONE 3OYZA 1E7PA 5LBMA 3L8RA 4L5GA 1WRDA 1MMGA 1US7B 2H89A 2BG9B 5J0ZA 3QUJA 1SUMB 5ADXL 5L3BB 4ZEYA 1D1AA 4YY3T 3DTOA 5C2TA 4HEAA 2V7LA 4H9QC 4F8HA 2X9XA 3RYHE 4QX8B 3HKDE 2VWAA 5AQJB 1W09A 3I0QA 4YLHA 3FHNA 4YTMA 4YT0A 3B13A 2PFVA 4Z8XA 3Q5EA 1WYBA 1OWAA 1JNRA 3GMIA 1WFDA 3BK9A 5F3JA 3ZMTB 4P0AA 3A7MA 1Z0PA 4AQFC 3EUHA 4BJMA 4XZCA 2JQHA 5FXZA 3AE8A 1J5WA 1D1CA 4QX7B 5JREA 5BMVE 5JDGA 2XQAA 3O1HA 2VKHA 5L2LA 4ILUA 1HS7A 2ZLYA 3P4PA 2IMLA 3AVRA 5EZYE 3TKLB 3ETUA 2UUCT 4TZ4C 2Q9QB 3NRXA 2A9UA 2K3WA 3K8PC 5EK4A 1XZYA 4OFZA 3IHRA 5L3CB 2C5KT 1FEWA 4PFPA 4DUZT 1XNQT 5HAXA 1WR0A 3PJAJ 2E9XA 5FYMA 2L9QA 3NZPA 2WP9A 3MJXA 1IBKT 4U7IA 2CLYB 2D2SA 3VHLA 5AQTB 5AQUB 3ZEFB 2NTXA 4LF8T 2KMFA 5LBQB 1E2AA 4C90A 2CWYA 2XJ7A 5J2TE 1G8XA 4QXBB 3FXDB 4U33A 1YD8G 5DABA 4OYKA 1YXRA 1V9DA 2YKSA 4HWFA 2LEHA 3ZC1A 3I9WA 3ZSSA 3ZYLA 3RQUA 2OLTA 2VQFT 1T72A 5AQMB 3VR9A 4A98A 4AXPA 3I0OA 4ISTA 2E9XD 2W4XA 3C98B 2KWHA 3ZN0B 1N32T 4EAHA 1IBLT 1I94T 4V1Av 4CQIA 4HFEA 3RRCA 1Y64B 3ETVA 1R8IA 2B76A 2XQ8A 4CXWA 2JMKA 2LKHA 1WLXA 1MNDA 2KZ7B 1ZKEA 1YKHB 2XQ6A 2CA5A 3AVSA 1KK7A 2CWOA 4C91A 3H37A 2IIUA 2YK0A 2XQ9A 4UELA 1S94A 4ASKA 2ZM8A 3UU4A 2KNDA 3KINB 4JBWF 5LG4A 2V8SV 2V7JA 1SE7A 3AE3A 5DQVA 3X1DA 3ZMSB 3AE9A 3LBXA 4H63V 5IYZE 4MALA 5JDHA 4TNVA 2W0GA 4Q25A 4IREA 2F4VT 2LSJA 3IEEA 3CKDA 3FZMB 2DHRA 2CMRA 3E0ZA 4AQFA 1D0ZA 2LHNA 4NXNT 2Y6XA 4AQGA 3RC8A 2E8IA 3UULA 2LOSA 2UXCT 2VL0A 4H9RC 3OPCA 5ABFA 1LRZA 2X51A 2V5DA 3PUWF 3M65A 1HCIA 2W63A 2XM2A 4PJJA 3OKQA 3ZCIA 2XAHB 3MACA 1OEDA 2FJBA 5HYAA 4IE7A 4UVBB 1N34T 2I0MA 1QUUA 3AXJA 4HFIA 2IDOB 5LJNA 2ZM6T 4DV4T 3P7IA 2ODUA 4Z91A 4I0UA 3OTOT 2Y48B 3AEDA 3U78A 4DBRA 4JUYA 2V6YB 4JI2T 4YHJA 3T1YT 5ABGA 5IWAT 2VVSA 3PTRB 2JQKA 4HKAA 2BZBA 3RYFE 1WYCA 4A97A 4OYJA 5LHHB 4QH4A 4HGAA 4IE5A 1MIVA 3FZLB 5CA1E 2VQET 3AE5A 1M7KA 3EDVA 4J2CA 4X66T 1FIOA 4A5XA 3AAEB 2L8KA 1YQ4A 5CJ5A 5JDMA 4AI6A 4TWHA 3EVYA 3KV6A 4GKJT 1LVKA 4ILAA 4EIWA 1UK5A 2CHOA 2FJAA 3PUQA 2PJQA 2BS3A 2JQ9A 3VRBA 3ZLIA 3W15B 4X64T 4UV9B 5AQRB 1QLBA 4IDQA 2WS3A 1W0AA 1KF6A 1XNRT 3C64A 2BKOA 2BKNA 4NUVA 4X1IE 3RIAA 1JNZA 3SOLA 2P9BA 4NXMT 4EYUA 2UUAT 2WCAA 3RHWA 5C8YE 3LFMA 3Q2MA 3RYIE 3OBVE 2WSSV 3CK6A 4CZZB 2EHOC 2YU1A 4DR1T 5LYJE 2QVAA 1IZNB 1MIYA 2D9DA 4WYVA 4HTEA 2JRKA 5LJMA 1J1JA 3RX6A 1L0VA 3LK3B 2WDVA 3TLUA 2YEVC 4IGUA 2QRXA 2V6XA 4YJ2E 2ODVA 2M67A 2YU2A 4LMLA 4DBQA 2JIWA 3UQ7A 4HFHA 3CMLA 3KVBA 3Q5DA 2E9XC 3UQ4A 5J2UE 3WAKA 4EEBA 5HXSA 4CN4A 2YDQA 4EB6E 3LK42 2LT3A 3L3PA 1O3XA 5M4YA 3KV4A 5LG3A 4AKRB 1YW0A 3RIUA 2GK9A 3G06A 1MMDA 5HXCA 4WZXA 1BR4A 3VU7H 2XTLA 4LFAT 3PJAA 3GWHA 5ABEA 2QYWA 2B1EA 2X68A 3KDSE 4DMWA 3HKBE 5FY7A 4QKNA 3ONLC 5JDFA 2BVLA 2KT9A 2J4GA 3CX7B 5AQVB 4UF0A 4IDZA 5KXJA 4EYYR 1UGOA 1KNPA 1N33T 4X1YE 4QH5A 2E2AA 2KWIB 2NOXA 5FXWA 3AA0B 3R6NA 4B3MT 3R84B 5FMNA 3C4WA 2XAFB 2XASB 2HPJA 2NP9A 3PV0F 4EGWA 2KSRA 1XMQT 2OA5A 4KBMB 2LJLA 1OXZA 1MMNA 3AEEA 5LHGB 3CIRA 2BVMA 1SHZC 2NW7A 3AE1A 1BR2A 5JDLA 2WY2A 5DJQC 3NRYA 3HL6A 3ZJ2A 4OHFA 4YHHT 3UUBA 2BS2A 4L9IA 3PUGA 4LMKA 2X9WA 1D0XA 5C3JA 5AQPB 3ZKRA 2X0HA 2WAUA 5JTGA 5HCJA 1UX5A 3GA8A 4CXXA 3ZMUB 3ZT5A 4HE8A 4ZZCA 2FUPA 3PUZF 3VKHA 4UF0B 2JPFA 4GK5E 5AQGB 1ZEEA 2QA7A 2V7KA 2ACXA 2EHOA 5H6RB 3Q9DA 2CM0A 4XAXB 3ESLA 3UUXB 4JI5T 2NWBA 3AE2A 2W2UA 4ZS2A 4MLKA 5LCYA 1Z8UA 4CN1A 4TWDA 1OEDC 2LM2A 4LMJA 4DNDA 4JI8T 3FZFB 2UXBT 2XQ7A 4DR5T 1ZP0A 4KHZF 3QNUA 2MTQA 3P4WA 4IHJE 2EHOD 2N9DA 4IL4A 2FJEA 2N1GA 3MXZA 3VKGA 3MA9A 5L4HA 2I59A 1FMVA 2KINB 3UTKA 4E7ZA 4G63A 4DR3T 2VK9A 4ERRA 4K0KT 4QWNB 3C4XA 4AKLA 3FBLA 1CUNA 4ISSA 3N9NA 4HFBA 1I6ZA 4KHPT 4MFRA 2PTFA 4MBQA 3VRAA 3RC3A 4H9NC 4DV0T 2Y8DA 2V26A 4MHCA 2BG9E 2MYSA 2G0UA 4HFVA 1UCUA 2WDQA 2I6HA 4HWIB 3PUVF 4WBOA 5JDNA 4AQYT 4JYAT 4BJNA 3TLSA 3PUSA 1MNEA 3KBTA 1IBMT 3UU5A 2E9XB 2H7VC 4O8SA 4B3RT 4TX5A 4EOZB 2JMHA 4HWCA 2HH7A 3H3AA 4HFCA 1XMOT 4IDPA 5JRCA 4O4IE 2FBWA 1B7TA 3HR0A 2KLQA 4JI1T 4KX6A 2A72A 4LF7T 3TLVA 1KEYA 3TLWA 3RRWA 4PK4A 1T98A 1NAFA 1KNZA 1E1HB 2H88A 3RIFA 3TLTA 4PW8A 2X0YA 3F57A 2LOPA 2HHHT 2DLRA 3ZPOA 3EABA 2W66A 3P4RA 4P09A 4PJMA 2WWUA 3N9LA 3FBZA 2LRKA 2CHNA 3ZMVB 2CCQA 4HFDA 2W67A 3EI0A 2MAWA 1NWMX 3IA3A 1UUSA 2C5JA 3PUYF 1MIWA 5LB7B 4YTNA 4F6RC 2W61A 2LLYA 4DIDB 3L39A 4U3CA 4IT4A 3LSVA 3F2EA 3RIUC 4BAYB 5ABHA 1BR0A 3N9OA 2BBJA 1T7SA 5AFUL 2CPTA 3QC9A 1VCSA 1WCRA 5AQSB 3LBXB 4TWFA 2DL1A 4ZOLE 5E0OA 2ZM2A 4OX9T 1ZOYA 1VCTA 3E08A 5HXHA 3O4XE 5FXVA 2ACZA 4UV8B 3L09A 2XQ3A 2RPAA 2UXDT 5AQFB 4JEHB 3P4SA 4WBNE 3JAFA 2YINA 4AKIA 5ABFB 2LSGA 3NBXX 2MPKA 4LF9T 2IAKA 2WMNA 4O2BE 1HFAA 3K3OA 2V7IA 2NW8A 3V5SA 1HX8A 3CX6B 5HEHA 3B5MA 3NZQA 1OEDB 1KFYA 3AXJB 1ZHCA 4X65T 2DNXA 3GN5A 3UT5E 2UXXB 5AQLB 1T8BA 3CQCB 2J62A 2XY8B 5DQWA 2VURA 4YTPA 4DV6T 2XHEB 1D0YA 3BQIA 3QB5K 4NUUA 2DI4A 3AEGA 3RKOA 1X79A 4EV6A 3DJBA 4IIJE 4U74A 2D0UA 3NWIA 3JCFA 4ANJA 5JH7E 1CHUA 2WMOA 3SS1A 2VKJA 4WNKA 2CE7A 2WU5A 4K0UA 5AQNB 5CFBA 2CRBA 5LA6E 1U5PA 1YKEB 2M6IA 2VKDA 4ADZA 3KV9A 4Z90A 5ETWA 4IE4A 3JC6D 4BA9A 3ZJ1A 4PAGA 4COFA 1HF8A 3J9X1 4YJ3E 4B6XA 2V1DB 4JI0T 4X1KE 3SFEA 4O2AE 2L3LA 4PFOA 3N9MA 1IJ5A 2KXPB 4YFSA 4PJNA 3GN5B 2JJ9A 4L0RA 5FVLA 4AIUA 5JDQA 3EDUA 2UUBT 4A56A 3HKCE 3LK2B 4B3ST 4ZI7E 2IHR1 3C51A 3UU8A 5LP6E 2R6GF 2C0SA 2V5CA 4I43B 1U4QA 4H9OC 5JQGE 3M3ZB 5F5WA 5CA0E 3LJCA 2BG9A 4N78D 2BKPA 1HG5A 3ANWA 4ZI3D 2K48A 4U31A 1NENA 1NEKA 2A3DA 4ILBA 4I55E 2WWVA 2BBHA 1KNRA 3RYCE 3AE7A 3AECA 4GKKT 2DCFA 1HNXT 2X0LB 2NTYA 4O4LE 3RI5A 5FL0A 3ABVA 3IBPA 4JI7T 2JQQA 3T8OA 4DV2T 2X9YA 3PE0A 4IDOA 5CB4E 3MKDA 4E7SA 4LF5T 3CVRA 2W00A 2IC9A 4ZI2C 2A2FX 2XZEA 3BQKA 2K24A 3J7Yq 5FNVE 3CPZA 3ZYMA 4CI3B 4EXTA 1VRBA 2DWKA 3HA4A 3A5XA 3KBUA 4H63H 5FKYA 4UVAB 3H3MA 2W62A 4B3TT 4DV5T 1QSDA 4JLEA 2H3RA 4PK5A 5JVDE 2CXDA 5AQHB 2X9HA 4JI6T 3IF8B 4LFBT 4ZS3A 3FB2A 3ANWB 3HKEE 3AA6B 3QB5A 2Q9QA 3CQXC 4DR2T 1FJGT 2Z6EA 4EZ4A 1DU2A 5L3FB 4FJOA 2WDRA 3ZC0A 1W0BA 1J5ET 4HN9A 2YDSA 2WQYA 5L4EA 3U3IA 1VOMA 4UXNB 3PU8A 5BR8T 2UXNB 1IAPA 3CWZB 4DO0A 2CEAA 2X66A 2X67A 1UX4A 2AXDS 4YXDA 4TUYE 5AQQB 1D1BA 2IUBA 1HR0T 3NKZA 4TV8E 2Q9QD 5LGNB 3N2OA 3ZCJA 3WI3A 3PUXF 3ONXA 4DV7T 1HX1B 4ZHQE 4AKGA 1M62A 4EEDA 3FZHB 3RLFF 3ZT7A 1S35A 4CXYA 2LSKA 3ZSTA 4TNWA 3FXEB 3OJAA 5LMUT 4DMVA 3RPUA 3QOFA 5LMNT 3UFEA 3ZMZB 3UUMA 5AQIB 5LXTE 2FJDA 5HXRA 4GOUA 4X5TA 3CQGB 5HEGA 2V7MA 4H9SE 4JI4T 2EHOB 2N2NA 3OVUA 4U72A 5CGMA 4NPPA 2XSAA 4PK6A 3EHZA 3P8CD 2E5LT 3P50A 3PURA 4XBFB 3AA1B 4CN6A 3UU6A 1GQEA 4QH1A 4UVCB 3AEBA 4H9PC 3MK7C 2K9AA 4U7YA 4X20E 2J47A 4NIQA 5FY1A 2VASA 4GK0E 3T1HT 5KX5E 5IUXA 4O4HE 4KMCA 2IW5B 2XSBA 5KMGP 4GYRA 3F31A 4P0BA 3JC6C 3RQWA 2WZIA 1EZ3A 4PNIA 4LFCT 1H7CA 3RF1A 3FZKB 4OK0A 5IHYA 4DR6T 5JR9C 3AE6A 2HN1A 2XM1A 4X62T 5HXEA 3AAAB 2ZMAA 5F8PA 1Y01A 2YOEA 4ZI2D 3LG7A 4KI0F 2XQYA 4I50E 4QXHB 1HNWT 5FXXA 5FVKA 2D0TA 3CX8B 2V6YA 4EZHA 2XAJB 2LHRA 4HWHA 4ZI3C 4QHOA 5FP3A 2RA1A 2LKGA 4GYSA 5LHIB 5HEOA 4WW0A 2ZM0A 2HPLA 2WBLA 2XAGB 2WZHA 3E22E 4KUMB 3QK6A 4LF4T 3MZKB 5JRCB 4IE0A 1HG2A 2H7OA 4GIWA 4ZXLA 2BG9C 3UU3A 1AJ3A 1HTJF 4TV9E 1LVFA 3ZT6A 3AA7B 1IJ6A 4JI3T 3HI2A 3S4UA 2RP4A 1FMWA 4CI2B 2LSIA 4DR4T 3V5UA 3O1IA 3N9PA 1N36T 1ZV4X 3Q5WA 2SPCA 5HEUA 5HEJA 3SRZA 2AE9A 1W9RA 1XDPA 1XWMA 3KVAA 2CXFA 3O1JA 3RGLA 2XQ5A 2XAQB 3N2GE 3C4ZA 4YSXA 3C50A 5FL1A 3RKGA 4U2ZA 4DUYT 2VL8A 5TAOA 2BS4A 3N9QA 5L3EB 2XUEA 4O4JE 3EAMA 5LGTB 3PU3A 4IDNA 3UUNA 1MMAA 2WM9A 3ZN1B 1UURA 2Q9QC 2WU2A 5L47A 3K3NA 2HN2A 4JV5T 2PBIA 3K1SA 1G73A 5FY0A 3BQLA 3PDYA 5JR9A 4UEMA 5EK3A 3WAJA 3Q5XA 3ZYKA 4G2AA 5AQKB 2CLYC 2M6BA 5KDMC 1YQ3A 2MBGA 3SFDA 2MOZA 2LSYA 2E5VA 4LF6T 2XQ4A 3N2KE 4FI5A 3I1AA 3KFWX 3RH3A 2DWGA 4IE6A 2LM9A 5HCMA 4ILCA 2ES0A 3PUAA 1BR1A 1SA0E 5J1GA 5LGUB 2J1DG 4YSZA 5EK2A 2LE8A 3AE4A 4KP3C 4ZZBA 2WB5A 2D5UA 3JADA 3AEFA 4I4TE 3AAIA 4QXCB 4HWDA 3LDQB 2YN6A
chains in the Genus database with same CATH topology
4IE5A 3PUSA 5HWXA 4DO0A 2BDEA 2CEAA 1MIVA 1MNEA 3KBTA 4AKHA 2X66A 2E9XB 5LHHB 5HWYA 2H7VC 4O8SA 4PJLA 4TX5A 2X67A 4EOZB 1UX4A 2VKOA 2JMHA 4M1PA 5L3DB 2QGSA 3D0TA 2HH7A 5A1LA 4TUYE 3H3AA 1LKXA 1D1BA 5JR9B 5CA1E 3O9XA 4TV8E 3SWHA 2Q9QD 5LGNB 5JRCA 3N2OA 4O4IE 3B57A 3ZCJA 1B7TA 3WI3A 3EDVA 4J2CA 3HR0A 3AB3B 4CI1B 1FIOA 3ONXA 2KLQA 2VB6A 3AAEB 3I9YA 2C5IT 2L8KA 2A72A 4ZHQE 4AKGA 5JDMA 4AI6A 2K5BB 3RRWA 4PK4A 1T98A 3EVYA 3KV6A 4TN7B 5L3GB 1NAFA 1KNZA 1E1HB 1LVKA 1WR6A 1S35A 4PW8A 4EIWA 4CXYA 3K3QC 2LSKA 3F57A 3KV5A 2LOPA 3PUQA 2PJQA 2DLRA 3ZPOA 3FXEB 5LNKA 4PJMA 4P09A 3OJAA 3OYXA 2WWUA 3N9LA 3ZLIA 3FBZA 2NW9A 4DMVA 3W15B 4UV9B 5H6QB 3RPUA 5LOVE 3ZMVB 2CCQA 3UFEA 1NWMX 4UIGA 3ZMZB 3UUMA 3N5LA 3C64A 2IC6A 4JEUB 3DP7A 5LXTE 2C5JA 4DVDA 2PG8A 2CXLA 4NUVA 4GOUA 4X1IE 5HXRA 1MIWA 3SOLA 2P9BA 5GONE 3OYZA 5LBMA 4EYUA 3CQGB 4L5GA 2V7MA 4H9SE 2EHOB 2N2NA 5C8YE 1WRDA 3LFMA 4F6RC 1MMGA 3Q2MA 2W61A 3RYIE 1US7B 3OBVE 4U72A 3QUJA 2WSSV 5ADXL 4CZZB 2EHOC 4PK6A 2YU1A 5L3BB 3F2EA 5LYJE 4BAYB 1D1AA 3P8CD 3DTOA 1BR0A 3N9OA 4HEAA 2V7LA 3PURA 4XBFB 3AA1B 4UVCB 5AFUL 1IZNB 4H9QC 1MIYA 3QC9A 4H9PC 2X9XA 4HTEA 3LBXB 2JRKA 3MK7C 5LJMA 3RYHE 4QX8B 4ZOLE 3HKDE 2K9AA 4X20E 2VWAA 5E0OA 5FY1A 3I0QA 2VASA 4GK0E 2ZM2A 3RX6A 5KX5E 4YLHA 4O4HE 3LK3B 3FHNA 4KMCA 2IW5B 5KMGP 3B13A 4GYRA 2PFVA 3F31A 2YEVC 4P0BA 3E08A 4IGUA 4Z8XA 3JC6C 5HXHA 3O4XE 4YJ2E 2ODVA 1WYBA 2M67A 2YU2A 4DBQA 5FXVA 1OWAA 1EZ3A 3GMIA 4PNIA 3CMLA 3BK9A 1H7CA 3KVBA 5F3JA 3ZMTB 4UV8B 2E9XC 4P0AA 1Z0PA 4AQFC 3L09A 3EUHA 4BJMA 4OK0A 5J2UE 4XZCA 5IHYA 3WAKA 5HXSA 5FXZA 4JEHB 4WBNE 4EB6E 5JR9C 3LK42 2LT3A 2YINA 4AKIA 1D1CA 4QX7B 5JREA 2LSGA 3L3PA 3NBXX 5BMVE 1O3XA 5M4YA 3KV4A 5JDGA 4AKRB 5HXEA 2IAKA 3AAAB 2WMNA 2VKHA 1HFAA 2ZMAA 1YW0A 3O1HA 4O2BE 5F8PA 3K3OA 4ZI2D 3LG7A 2V7IA 2GK9A 2NW8A 2XQYA 3V5SA 5L2LA 1HX8A 3CX6B 1MMDA 4I50E 5HXCA 3NZQA 4ILUA 4QXHB 1HS7A 5FXXA 1BR4A 2ZLYA 2D0TA 3AVRA 1ZHCA 5EZYE 3VU7H 2DNXA 2XTLA 3ETUA 3TKLB 3GN5A 3UT5E 3GWHA 2UXXB 3CX8B 2B1EA 4TZ4C 2Q9QB 2X68A 3NRXA 4EZHA 3KDSE 3CQCB 3K8PC 4DMWA 3HKBE 2XAJB 5DQWA 5FY7A 5EK4A 2LHRA 4QKNA 2XHEB 5JDFA 2BVLA 1D0YA 4QHOA 4ZI3C 2KT9A 4OFZA 3IHRA 5L3CB 3BQIA 2C5KT 5FP3A 1FEWA 4NUUA 4PFPA 5HAXA 2DI4A 3RKOA 1X79A 3CX7B 4UF0A 2RA1A 4IDZA 2E9XA 5FYMA 3DJBA 4GYSA 2L9QA 3NZPA 4EYYR 5LHIB 4IIJE 4U74A 2D0UA 4WW0A 3MJXA 4X1YE 2ZM0A 2CLYB 2HPLA 2KWIB 4ANJA 5JH7E 2D2SA 2NOXA 5FXWA 3VHLA 2WBLA 2XAGB 3AA0B 3R6NA 2WMOA 3R84B 5FMNA 3C4WA 3SS1A 2XAFB 2XASB 3E22E 3ZEFB 2NTXA 4KUMB 2VKJA 2KMFA 4WNKA 5LBQB 2CE7A 4C90A 2CWYA 2HPJA 3QK6A 5J2TE 4K0UA 1G8XA 2NP9A 3MZKB 4QXBB 3FXDB 5JRCB 5LA6E 1U5PA 1YKEB 4IE0A 1HG2A 1YD8G 2VKDA 5DABA 3KV9A 2OA5A 4ADZA 2H7OA 4OYKA 5ETWA 4GIWA 4KBMB 1V9DA 4IE4A 2LJLA 1OXZA 2LEHA 1AJ3A 1MMNA 3JC6D 1HTJF 3ZC1A 3ZJ1A 4BA9A 5LHGB 4TV9E 1LVFA 4PAGA 3I9WA 1HF8A 2BVMA 3ZYLA 3AA7B 1IJ6A 1SHZC 2NW7A 3J9X1 4YJ3E 4B6XA 4AXPA 1BR2A 5JDLA 3HI2A 3I0OA 4ISTA 3S4UA 2RP4A 1FMWA 2V1DB 2E9XD 4CI2B 5DJQC 2LSIA 3C98B 4X1KE 4O2AE 2L3LA 2KWHA 3O1IA 3V5UA 3ZN0B 4PFOA 4EAHA 3N9MA 3NRYA 3HL6A 3ZJ2A 4OHFA 1IJ5A 2KXPB 4L9IA 4V1Av 3PUGA 4YFSA 4PJNA 3N9PA 4CQIA 2X9WA 3GN5B 1ZV4X 1D0XA 2JJ9A 4L0RA 3RRCA 1Y64B 3ETVA 5JDQA 3EDUA 4A56A 2WAUA 3HKCE 3Q5WA 4CXWA 2SPCA 3LK2B 1UX5A 4ZI7E 2JMKA 3SRZA 1WLXA 3GA8A 1MNDA 2KZ7B 1ZKEA 3C51A 4CXXA 3ZMUB 4HE8A 1YKHB 3KVAA 5LP6E 2CA5A 2CXFA 2C0SA 3AVSA 1KK7A 3VKHA 3O1JA 4UF0B 4I43B 2JPFA 1U4QA 4GK5E 2CWOA 4H9OC 2XAQB 4C91A 1ZEEA 3H37A 2QA7A 3N2GE 2V7KA 5JQGE 3C4ZA 2ACXA 3C50A 5CA0E 2EHOA 2YK0A 4UELA 3LJCA 3Q9DA 1S94A 5H6RB 4ASKA 2CM0A 4XAXB 3ESLA 2ZM8A 2VL8A 4N78D 1HG5A 3UUXB 2KNDA 3ANWA 4ZI3D 2K48A 5TAOA 2A3DA 2NWBA 4I55E 3KINB 3N9QA 5L3EB 5LG4A 4ZS2A 4MLKA 5LCYA 2XUEA 4O4JE 3RYCE 5LGTB 2V7JA 2DCFA 3PU3A 5DQVA 3UUNA 1MMAA 4DNDA 3ZMSB 2WM9A 3ZN1B 3LBXA 4H63V 2X0LB 5IYZE 4MALA 5JDHA 2NTYA 2W0GA 4O4LE 2Q9QC 2MTQA 2LSJA 3K3NA 3IBPA 3IEEA 3CKDA 2PBIA 4IHJE 2JQQA 3T8OA 2DHRA 2CMRA 3E0ZA 2X9YA 3PE0A 1G73A 2EHOD 5CB4E 3MKDA 2N9DA 5FY0A 4AQFA 4E7SA 3CVRA 2W00A 2IC9A 1D0ZA 2LHNA 2N1GA 4ZI2C 2A2FX 3MXZA 3BQLA 3VKGA 3BQKA 3PDYA 5JR9A 3MA9A 2I59A 2Y6XA 1FMVA 2KINB 4UEMA 2K24A 5EK3A 4AQGA 3WAJA 3J7Yq 3RC8A 2E8IA 5FNVE 3UTKA 3CPZA 3Q5XA 3ZYKA 4E7ZA 4G2AA 4G63A 3UULA 3ZYMA 4CI3B 2CLYC 2LOSA 4EXTA 1VRBA 2DWKA 3HA4A 4H9RC 3A5XA 5KDMC 1LRZA 3KBUA 4H63H 2X51A 2VK9A 4ERRA 2MBGA 4QWNB 4UVAB 3C4XA 3M65A 2MOZA 1HCIA 4AKLA 2LSYA 3FBLA 2W62A 3N2KE 2W63A 4PJJA 3OKQA 4FI5A 3I1AA 2XAHB 3MACA 3ZCIA 3KFWX 1CUNA 1QSDA 4ISSA 4JLEA 2H3RA 4PK5A 5JVDE 2CXDA 5HYAA 2X9HA 4IE7A 3RH3A 3IF8B 4UVBB 2DWGA 3N9NA 1QUUA 4IE6A 4ZS3A 3FB2A 2LM9A 5LJNA 3ANWB 3HKEE 3AA6B 4MFRA 2ES0A 3PUAA 1BR1A 2Q9QA 3CQXC 3P7IA 4MBQA 2Z6EA 2ODUA 3RC3A 4EZ4A 1SA0E 5L3FB 4H9NC 5J1GA 4FJOA 2Y8DA 2Y48B 5LGUB 3U78A 2V26A 2J1DG 4DBRA 5EK2A 3ZC0A 2LE8A 4MHCA 4KP3C 4JUYA 2MYSA 2G0UA 4HFVA 4HN9A 4YHJA 1UCUA 2D5UA 4WBOA 5JDNA 4I4TE 3AAIA 4QXCB 3U3IA 3PTRB 1VOMA 4HKAA 4UXNB 2BZBA 3PU8A 3RYFE 4BJNA 1WYCA 2UXNB 4OYJA 4HGAA 1IAPA 3CWZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ANW B;  2EHO D;  2E9X C;  3JC6 C;  2Q9Q D; 
#chains in the Genus database with same CATH topology
 4DV1 T;  5HWX A;  2BDE A;  2CBJ A;  4AKH A;  2YDR A;  5HWY A;  3JAE A;  4PJL A;  3UFG A;  2VKO A;  4M1P A;  5L3D B;  2QGS A;  3D0T A;  5A1L A;  1LKX A;  5JR9 B;  3NVO A;  3O9X A;  2CBI A;  3SWH A;  4IL9 A;  3B57 A;  4AIS A;  3AB3 B;  2UU9 T;  4CI1 B;  2VB6 A;  3AEA A;  3I9Y A;  2C5I T;  1X9B A;  2K5B B;  3P4Q A;  4TN7 B;  5AQO B;  5L3G B;  3ONJ A;  1WR6 A;  4U2Y A;  2LRL A;  2XPK A;  1XDO A;  4P1N A;  3K3Q C;  2OV9 A;  3A8Y C;  3KV5 A;  2NR4 A;  3VR8 A;  5LNK A;  3OYX A;  4DR7 T;  1OED E;  2VVN A;  4UR9 A;  2NW9 A;  5H6Q B;  5LOV E;  1HNZ T;  4UIG A;  4DV3 T;  3N5L A;  4YSY A;  2IC6 A;  4JEU B;  3DP7 A;  4DVD A;  2PG8 A;  2CXL A;  5GON E;  3OYZ A;  1E7P A;  5LBM A;  3L8R A;  4L5G A;  1WRD A;  1MMG A;  1US7 B;  2H89 A;  2BG9 B;  5J0Z A;  3QUJ A;  1SUM B;  5ADX L;  5L3B B;  4ZEY A;  1D1A A;  4YY3 T;  3DTO A;  5C2T A;  4HEA A;  2V7L A;  4H9Q C;  4F8H A;  2X9X A;  3RYH E;  4QX8 B;  3HKD E;  2VWA A;  5AQJ B;  1W09 A;  3I0Q A;  4YLH A;  3FHN A;  4YTM A;  4YT0 A;  3B13 A;  2PFV A;  4Z8X A;  3Q5E A;  1WYB A;  1OWA A;  1JNR A;  3GMI A;  1WFD A;  3BK9 A;  5F3J A;  3ZMT B;  4P0A A;  3A7M A;  1Z0P A;  4AQF C;  3EUH A;  4BJM A;  4XZC A;  2JQH A;  5FXZ A;  3AE8 A;  1J5W A;  1D1C A;  4QX7 B;  5JRE A;  5BMV E;  5JDG A;  2XQA A;  3O1H A;  2VKH A;  5L2L A;  4ILU A;  1HS7 A;  2ZLY A;  3P4P A;  2IML A;  3AVR A;  5EZY E;  3TKL B;  3ETU A;  2UUC T;  4TZ4 C;  2Q9Q B;  3NRX A;  2A9U A;  2K3W A;  3K8P C;  5EK4 A;  1XZY A;  4OFZ A;  3IHR A;  5L3C B;  2C5K T;  1FEW A;  4PFP A;  4DUZ T;  1XNQ T;  5HAX A;  1WR0 A;  3PJA J;  2E9X A;  5FYM A;  2L9Q A;  3NZP A;  2WP9 A;  3MJX A;  1IBK T;  4U7I A;  2CLY B;  2D2S A;  3VHL A;  5AQT B;  5AQU B;  3ZEF B;  2NTX A;  4LF8 T;  2KMF A;  5LBQ B;  1E2A A;  4C90 A;  2CWY A;  2XJ7 A;  5J2T E;  1G8X A;  4QXB B;  3FXD B;  4U33 A;  1YD8 G;  5DAB A;  4OYK A;  1YXR A;  1V9D A;  2YKS A;  4HWF A;  2LEH A;  3ZC1 A;  3I9W A;  3ZSS A;  3ZYL A;  3RQU A;  2OLT A;  2VQF T;  1T72 A;  5AQM B;  3VR9 A;  4A98 A;  4AXP A;  3I0O A;  4IST A;  2E9X D;  2W4X A;  3C98 B;  2KWH A;  3ZN0 B;  1N32 T;  4EAH A;  1IBL T;  1I94 T;  4V1A v;  4CQI A;  4HFE A;  3RRC A;  1Y64 B;  3ETV A;  1R8I A;  2B76 A;  2XQ8 A;  4CXW A;  2JMK A;  2LKH A;  1WLX A;  1MND A;  2KZ7 B;  1ZKE A;  1YKH B;  2XQ6 A;  2CA5 A;  3AVS A;  1KK7 A;  2CWO A;  4C91 A;  3H37 A;  2IIU A;  2YK0 A;  2XQ9 A;  4UEL A;  1S94 A;  4ASK A;  2ZM8 A;  3UU4 A;  2KND A;  3KIN B;  4JBW F;  5LG4 A;  2V8S V;  2V7J A;  1SE7 A;  3AE3 A;  5DQV A;  3X1D A;  3ZMS B;  3AE9 A;  3LBX A;  4H63 V;  5IYZ E;  4MAL A;  5JDH A;  4TNV A;  2W0G A;  4Q25 A;  4IRE A;  2F4V T;  2LSJ A;  3IEE A;  3CKD A;  3FZM B;  2DHR A;  2CMR A;  3E0Z A;  4AQF A;  1D0Z A;  2LHN A;  4NXN T;  2Y6X A;  4AQG A;  3RC8 A;  2E8I A;  3UUL A;  2LOS A;  2UXC T;  2VL0 A;  4H9R C;  3OPC A;  5ABF A;  1LRZ A;  2X51 A;  2V5D A;  3PUW F;  3M65 A;  1HCI A;  2W63 A;  2XM2 A;  4PJJ A;  3OKQ A;  3ZCI A;  2XAH B;  3MAC A;  1OED A;  2FJB A;  5HYA A;  4IE7 A;  4UVB B;  1N34 T;  2I0M A;  1QUU A;  3AXJ A;  4HFI A;  2IDO B;  5LJN A;  2ZM6 T;  4DV4 T;  3P7I A;  2ODU A;  4Z91 A;  4I0U A;  3OTO T;  2Y48 B;  3AED A;  3U78 A;  4DBR A;  4JUY A;  2V6Y B;  4JI2 T;  4YHJ A;  3T1Y T;  5ABG A;  5IWA T;  2VVS A;  3PTR B;  2JQK A;  4HKA A;  2BZB A;  3RYF E;  1WYC A;  4A97 A;  4OYJ A;  5LHH B;  4QH4 A;  4HGA A;  4IE5 A;  1MIV A;  3FZL B;  5CA1 E;  2VQE T;  3AE5 A;  1M7K A;  3EDV A;  4J2C A;  4X66 T;  1FIO A;  4A5X A;  3AAE B;  2L8K A;  1YQ4 A;  5CJ5 A;  5JDM A;  4AI6 A;  4TWH A;  3EVY A;  3KV6 A;  4GKJ T;  1LVK A;  4ILA A;  4EIW A;  1UK5 A;  2CHO A;  2FJA A;  3PUQ A;  2PJQ A;  2BS3 A;  2JQ9 A;  3VRB A;  3ZLI A;  3W15 B;  4X64 T;  4UV9 B;  5AQR B;  1QLB A;  4IDQ A;  2WS3 A;  1W0A A;  1KF6 A;  1XNR T;  3C64 A;  2BKO A;  2BKN A;  4NUV A;  4X1I E;  3RIA A;  1JNZ A;  3SOL A;  2P9B A;  4NXM T;  4EYU A;  2UUA T;  2WCA A;  3RHW A;  5C8Y E;  3LFM A;  3Q2M A;  3RYI E;  3OBV E;  2WSS V;  3CK6 A;  4CZZ B;  2EHO C;  2YU1 A;  4DR1 T;  5LYJ E;  2QVA A;  1IZN B;  1MIY A;  2D9D A;  4WYV A;  4HTE A;  2JRK A;  5LJM A;  1J1J A;  3RX6 A;  1L0V A;  3LK3 B;  2WDV A;  3TLU A;  2YEV C;  4IGU A;  2QRX A;  2V6X A;  4YJ2 E;  2ODV A;  2M67 A;  2YU2 A;  4LML A;  4DBQ A;  2JIW A;  3UQ7 A;  4HFH A;  3CML A;  3KVB A;  3Q5D A;  2E9X C;  3UQ4 A;  5J2U E;  3WAK A;  4EEB A;  5HXS A;  4CN4 A;  2YDQ A;  4EB6 E;  3LK4 2;  2LT3 A;  3L3P A;  1O3X A;  5M4Y A;  3KV4 A;  5LG3 A;  4AKR B;  1YW0 A;  3RIU A;  2GK9 A;  3G06 A;  1MMD A;  5HXC A;  4WZX A;  1BR4 A;  3VU7 H;  2XTL A;  4LFA T;  3PJA A;  3GWH A;  5ABE A;  2QYW A;  2B1E A;  2X68 A;  3KDS E;  4DMW A;  3HKB E;  5FY7 A;  4QKN A;  3ONL C;  5JDF A;  2BVL A;  2KT9 A;  2J4G A;  3CX7 B;  5AQV B;  4UF0 A;  4IDZ A;  5KXJ A;  4EYY R;  1UGO A;  1KNP A;  1N33 T;  4X1Y E;  4QH5 A;  2E2A A;  2KWI B;  2NOX A;  5FXW A;  3AA0 B;  3R6N A;  4B3M T;  3R84 B;  5FMN A;  3C4W A;  2XAF B;  2XAS B;  2HPJ A;  2NP9 A;  3PV0 F;  4EGW A;  2KSR A;  1XMQ T;  2OA5 A;  4KBM B;  2LJL A;  1OXZ A;  1MMN A;  3AEE A;  5LHG B;  3CIR A;  2BVM A;  1SHZ C;  2NW7 A;  3AE1 A;  1BR2 A;  5JDL A;  2WY2 A;  5DJQ C;  3NRY A;  3HL6 A;  3ZJ2 A;  4OHF A;  4YHH T;  3UUB A;  2BS2 A;  4L9I A;  3PUG A;  4LMK A;  2X9W A;  1D0X A;  5C3J A;  5AQP B;  3ZKR A;  2X0H A;  2WAU A;  5JTG A;  5HCJ A;  1UX5 A;  3GA8 A;  4CXX A;  3ZMU B;  3ZT5 A;  4HE8 A;  4ZZC A;  2FUP A;  3PUZ F;  3VKH A;  4UF0 B;  2JPF A;  4GK5 E;  5AQG B;  1ZEE A;  2QA7 A;  2V7K A;  2ACX A;  2EHO A;  5H6R B;  3Q9D A;  2CM0 A;  4XAX B;  3ESL A;  3UUX B;  4JI5 T;  2NWB A;  3AE2 A;  2W2U A;  4ZS2 A;  4MLK A;  5LCY A;  1Z8U A;  4CN1 A;  4TWD A;  1OED C;  2LM2 A;  4LMJ A;  4DND A;  4JI8 T;  3FZF B;  2UXB T;  2XQ7 A;  4DR5 T;  1ZP0 A;  4KHZ F;  3QNU A;  2MTQ A;  3P4W A;  4IHJ E;  2EHO D;  2N9D A;  4IL4 A;  2FJE A;  2N1G A;  3MXZ A;  3VKG A;  3MA9 A;  5L4H A;  2I59 A;  1FMV A;  2KIN B;  3UTK A;  4E7Z A;  4G63 A;  4DR3 T;  2VK9 A;  4ERR A;  4K0K T;  4QWN B;  3C4X A;  4AKL A;  3FBL A;  1CUN A;  4ISS A;  3N9N A;  4HFB A;  1I6Z A;  4KHP T;  4MFR A;  2PTF A;  4MBQ A;  3VRA A;  3RC3 A;  4H9N C;  4DV0 T;  2Y8D A;  2V26 A;  4MHC A;  2BG9 E;  2MYS A;  2G0U A;  4HFV A;  1UCU A;  2WDQ A;  2I6H A;  4HWI B;  3PUV F;  4WBO A;  5JDN A;  4AQY T;  4JYA T;  4BJN A;  3TLS A;  3PUS A;  1MNE A;  3KBT A;  1IBM T;  3UU5 A;  2E9X B;  2H7V C;  4O8S A;  4B3R T;  4TX5 A;  4EOZ B;  2JMH A;  4HWC A;  2HH7 A;  3H3A A;  4HFC A;  1XMO T;  4IDP A;  5JRC A;  4O4I E;  2FBW A;  1B7T A;  3HR0 A;  2KLQ A;  4JI1 T;  4KX6 A;  2A72 A;  4LF7 T;  3TLV A;  1KEY A;  3TLW A;  3RRW A;  4PK4 A;  1T98 A;  1NAF A;  1KNZ A;  1E1H B;  2H88 A;  3RIF A;  3TLT A;  4PW8 A;  2X0Y A;  3F57 A;  2LOP A;  2HHH T;  2DLR A;  3ZPO A;  3EAB A;  2W66 A;  3P4R A;  4P09 A;  4PJM A;  2WWU A;  3N9L A;  3FBZ A;  2LRK A;  2CHN A;  3ZMV B;  2CCQ A;  4HFD A;  2W67 A;  3EI0 A;  2MAW A;  1NWM X;  3IA3 A;  1UUS A;  2C5J A;  3PUY F;  1MIW A;  5LB7 B;  4YTN A;  4F6R C;  2W61 A;  2LLY A;  4DID B;  3L39 A;  4U3C A;  4IT4 A;  3LSV A;  3F2E A;  3RIU C;  4BAY B;  5ABH A;  1BR0 A;  3N9O A;  2BBJ A;  1T7S A;  5AFU L;  2CPT A;  3QC9 A;  1VCS A;  1WCR A;  5AQS B;  3LBX B;  4TWF A;  2DL1 A;  4ZOL E;  5E0O A;  2ZM2 A;  4OX9 T;  1ZOY A;  1VCT A;  3E08 A;  5HXH A;  3O4X E;  5FXV A;  2ACZ A;  4UV8 B;  3L09 A;  2XQ3 A;  2RPA A;  2UXD T;  5AQF B;  4JEH B;  3P4S A;  4WBN E;  3JAF A;  2YIN A;  4AKI A;  5ABF B;  2LSG A;  3NBX X;  2MPK A;  4LF9 T;  2IAK A;  2WMN A;  4O2B E;  1HFA A;  3K3O A;  2V7I A;  2NW8 A;  3V5S A;  1HX8 A;  3CX6 B;  5HEH A;  3B5M A;  3NZQ A;  1OED B;  1KFY A;  3AXJ B;  1ZHC A;  4X65 T;  2DNX A;  3GN5 A;  3UT5 E;  2UXX B;  5AQL B;  1T8B A;  3CQC B;  2J62 A;  2XY8 B;  5DQW A;  2VUR A;  4YTP A;  4DV6 T;  2XHE B;  1D0Y A;  3BQI A;  3QB5 K;  4NUU A;  2DI4 A;  3AEG A;  3RKO A;  1X79 A;  4EV6 A;  3DJB A;  4IIJ E;  4U74 A;  2D0U A;  3NWI A;  3JCF A;  4ANJ A;  5JH7 E;  1CHU A;  2WMO A;  3SS1 A;  2VKJ A;  4WNK A;  2CE7 A;  2WU5 A;  4K0U A;  5AQN B;  5CFB A;  2CRB A;  5LA6 E;  1U5P A;  1YKE B;  2M6I A;  2VKD A;  4ADZ A;  3KV9 A;  4Z90 A;  5ETW A;  4IE4 A;  3JC6 D;  4BA9 A;  3ZJ1 A;  4PAG A;  4COF A;  1HF8 A;  3J9X 1;  4YJ3 E;  4B6X A;  2V1D B;  4JI0 T;  4X1K E;  3SFE A;  4O2A E;  2L3L A;  4PFO A;  3N9M A;  1IJ5 A;  2KXP B;  4YFS A;  4PJN A;  3GN5 B;  2JJ9 A;  4L0R A;  5FVL A;  4AIU A;  5JDQ A;  3EDU A;  2UUB T;  4A56 A;  3HKC E;  3LK2 B;  4B3S T;  4ZI7 E;  2IHR 1;  3C51 A;  3UU8 A;  5LP6 E;  2R6G F;  2C0S A;  2V5C A;  4I43 B;  1U4Q A;  4H9O C;  5JQG E;  3M3Z B;  5F5W A;  5CA0 E;  3LJC A;  2BG9 A;  4N78 D;  2BKP A;  1HG5 A;  3ANW A;  4ZI3 D;  2K48 A;  4U31 A;  1NEN A;  1NEK A;  2A3D A;  4ILB A;  4I55 E;  2WWV A;  2BBH A;  1KNR A;  3RYC E;  3AE7 A;  3AEC A;  4GKK T;  2DCF A;  1HNX T;  2X0L B;  2NTY A;  4O4L E;  3RI5 A;  5FL0 A;  3ABV A;  3IBP A;  4JI7 T;  2JQQ A;  3T8O A;  4DV2 T;  2X9Y A;  3PE0 A;  4IDO A;  5CB4 E;  3MKD A;  4E7S A;  4LF5 T;  3CVR A;  2W00 A;  2IC9 A;  4ZI2 C;  2A2F X;  2XZE A;  3BQK A;  2K24 A;  3J7Y q;  5FNV E;  3CPZ A;  3ZYM A;  4CI3 B;  4EXT A;  1VRB A;  2DWK A;  3HA4 A;  3A5X A;  3KBU A;  4H63 H;  5FKY A;  4UVA B;  3H3M A;  2W62 A;  4B3T T;  4DV5 T;  1QSD A;  4JLE A;  2H3R A;  4PK5 A;  5JVD E;  2CXD A;  5AQH B;  2X9H A;  4JI6 T;  3IF8 B;  4LFB T;  4ZS3 A;  3FB2 A;  3ANW B;  3HKE E;  3AA6 B;  3QB5 A;  2Q9Q A;  3CQX C;  4DR2 T;  1FJG T;  2Z6E A;  4EZ4 A;  1DU2 A;  5L3F B;  4FJO A;  2WDR A;  3ZC0 A;  1W0B A;  1J5E T;  4HN9 A;  2YDS A;  2WQY A;  5L4E A;  3U3I A;  1VOM A;  4UXN B;  3PU8 A;  5BR8 T;  2UXN B;  1IAP A;  3CWZ B;  4DO0 A;  2CEA A;  2X66 A;  2X67 A;  1UX4 A;  2AXD S;  4YXD A;  4TUY E;  5AQQ B;  1D1B A;  2IUB A;  1HR0 T;  3NKZ A;  4TV8 E;  2Q9Q D;  5LGN B;  3N2O A;  3ZCJ A;  3WI3 A;  3PUX F;  3ONX A;  4DV7 T;  1HX1 B;  4ZHQ E;  4AKG A;  1M62 A;  4EED A;  3FZH B;  3RLF F;  3ZT7 A;  1S35 A;  4CXY A;  2LSK A;  3ZST A;  4TNW A;  3FXE B;  3OJA A;  5LMU T;  4DMV A;  3RPU A;  3QOF A;  5LMN T;  3UFE A;  3ZMZ B;  3UUM A;  5AQI B;  5LXT E;  2FJD A;  5HXR A;  4GOU A;  4X5T A;  3CQG B;  5HEG A;  2V7M A;  4H9S E;  4JI4 T;  2EHO B;  2N2N A;  3OVU A;  4U72 A;  5CGM A;  4NPP A;  2XSA A;  4PK6 A;  3EHZ A;  3P8C D;  2E5L T;  3P50 A;  3PUR A;  4XBF B;  3AA1 B;  4CN6 A;  3UU6 A;  1GQE A;  4QH1 A;  4UVC B;  3AEB A;  4H9P C;  3MK7 C;  2K9A A;  4U7Y A;  4X20 E;  2J47 A;  4NIQ A;  5FY1 A;  2VAS A;  4GK0 E;  3T1H T;  5KX5 E;  5IUX A;  4O4H E;  4KMC A;  2IW5 B;  2XSB A;  5KMG P;  4GYR A;  3F31 A;  4P0B A;  3JC6 C;  3RQW A;  2WZI A;  1EZ3 A;  4PNI A;  4LFC T;  1H7C A;  3RF1 A;  3FZK B;  4OK0 A;  5IHY A;  4DR6 T;  5JR9 C;  3AE6 A;  2HN1 A;  2XM1 A;  4X62 T;  5HXE A;  3AAA B;  2ZMA A;  5F8P A;  1Y01 A;  2YOE A;  4ZI2 D;  3LG7 A;  4KI0 F;  2XQY A;  4I50 E;  4QXH B;  1HNW T;  5FXX A;  5FVK A;  2D0T A;  3CX8 B;  2V6Y A;  4EZH A;  2XAJ B;  2LHR A;  4HWH A;  4ZI3 C;  4QHO A;  5FP3 A;  2RA1 A;  2LKG A;  4GYS A;  5LHI B;  5HEO A;  4WW0 A;  2ZM0 A;  2HPL A;  2WBL A;  2XAG B;  2WZH A;  3E22 E;  4KUM B;  3QK6 A;  4LF4 T;  3MZK B;  5JRC B;  4IE0 A;  1HG2 A;  2H7O A;  4GIW A;  4ZXL A;  2BG9 C;  3UU3 A;  1AJ3 A;  1HTJ F;  4TV9 E;  1LVF A;  3ZT6 A;  3AA7 B;  1IJ6 A;  4JI3 T;  3HI2 A;  3S4U A;  2RP4 A;  1FMW A;  4CI2 B;  2LSI A;  4DR4 T;  3V5U A;  3O1I A;  3N9P A;  1N36 T;  1ZV4 X;  3Q5W A;  2SPC A;  5HEU A;  5HEJ A;  3SRZ A;  2AE9 A;  1W9R A;  1XDP A;  1XWM A;  3KVA A;  2CXF A;  3O1J A;  3RGL A;  2XQ5 A;  2XAQ B;  3N2G E;  3C4Z A;  4YSX A;  3C50 A;  5FL1 A;  3RKG A;  4U2Z A;  4DUY T;  2VL8 A;  5TAO A;  2BS4 A;  3N9Q A;  5L3E B;  2XUE A;  4O4J E;  3EAM A;  5LGT B;  3PU3 A;  4IDN A;  3UUN A;  1MMA A;  2WM9 A;  3ZN1 B;  1UUR A;  2Q9Q C;  2WU2 A;  5L47 A;  3K3N A;  2HN2 A;  4JV5 T;  2PBI A;  3K1S A;  1G73 A;  5FY0 A;  3BQL A;  3PDY A;  5JR9 A;  4UEM A;  5EK3 A;  3WAJ A;  3Q5X A;  3ZYK A;  4G2A A;  5AQK B;  2CLY C;  2M6B A;  5KDM C;  1YQ3 A;  2MBG A;  3SFD A;  2MOZ A;  2LSY A;  2E5V A;  4LF6 T;  2XQ4 A;  3N2K E;  4FI5 A;  3I1A A;  3KFW X;  3RH3 A;  2DWG A;  4IE6 A;  2LM9 A;  5HCM A;  4ILC A;  2ES0 A;  3PUA A;  1BR1 A;  1SA0 E;  5J1G A;  5LGU B;  2J1D G;  4YSZ A;  5EK2 A;  2LE8 A;  3AE4 A;  4KP3 C;  4ZZB A;  2WB5 A;  2D5U A;  3JAD A;  3AEF A;  4I4T E;  3AAI A;  4QXC B;  4HWD A;  3LDQ B;  2YN6 A; 
#chains in the Genus database with same CATH homology
 4IE5 A;  3PUS A;  5HWX A;  4DO0 A;  2BDE A;  2CEA A;  1MIV A;  1MNE A;  3KBT A;  4AKH A;  2X66 A;  2E9X B;  5LHH B;  5HWY A;  2H7V C;  4O8S A;  4PJL A;  4TX5 A;  2X67 A;  4EOZ B;  1UX4 A;  2VKO A;  2JMH A;  4M1P A;  5L3D B;  2QGS A;  3D0T A;  2HH7 A;  5A1L A;  4TUY E;  3H3A A;  1LKX A;  1D1B A;  5JR9 B;  5CA1 E;  3O9X A;  4TV8 E;  3SWH A;  2Q9Q D;  5LGN B;  5JRC A;  3N2O A;  4O4I E;  3B57 A;  3ZCJ A;  1B7T A;  3WI3 A;  3EDV A;  4J2C A;  3HR0 A;  3AB3 B;  4CI1 B;  1FIO A;  3ONX A;  2KLQ A;  2VB6 A;  3AAE B;  3I9Y A;  2C5I T;  2L8K A;  2A72 A;  4ZHQ E;  4AKG A;  5JDM A;  4AI6 A;  2K5B B;  3RRW A;  4PK4 A;  1T98 A;  3EVY A;  3KV6 A;  4TN7 B;  5L3G B;  1NAF A;  1KNZ A;  1E1H B;  1LVK A;  1WR6 A;  1S35 A;  4PW8 A;  4EIW A;  4CXY A;  3K3Q C;  2LSK A;  3F57 A;  3KV5 A;  2LOP A;  3PUQ A;  2PJQ A;  2DLR A;  3ZPO A;  3FXE B;  5LNK A;  4PJM A;  4P09 A;  3OJA A;  3OYX A;  2WWU A;  3N9L A;  3ZLI A;  3FBZ A;  2NW9 A;  4DMV A;  3W15 B;  4UV9 B;  5H6Q B;  3RPU A;  5LOV E;  3ZMV B;  2CCQ A;  3UFE A;  1NWM X;  4UIG A;  3ZMZ B;  3UUM A;  3N5L A;  3C64 A;  2IC6 A;  4JEU B;  3DP7 A;  5LXT E;  2C5J A;  4DVD A;  2PG8 A;  2CXL A;  4NUV A;  4GOU A;  4X1I E;  5HXR A;  1MIW A;  3SOL A;  2P9B A;  5GON E;  3OYZ A;  5LBM A;  4EYU A;  3CQG B;  4L5G A;  2V7M A;  4H9S E;  2EHO B;  2N2N A;  5C8Y E;  1WRD A;  3LFM A;  4F6R C;  1MMG A;  3Q2M A;  2W61 A;  3RYI E;  1US7 B;  3OBV E;  4U72 A;  3QUJ A;  2WSS V;  5ADX L;  4CZZ B;  2EHO C;  4PK6 A;  2YU1 A;  5L3B B;  3F2E A;  5LYJ E;  4BAY B;  1D1A A;  3P8C D;  3DTO A;  1BR0 A;  3N9O A;  4HEA A;  2V7L A;  3PUR A;  4XBF B;  3AA1 B;  4UVC B;  5AFU L;  1IZN B;  4H9Q C;  1MIY A;  3QC9 A;  4H9P C;  2X9X A;  4HTE A;  3LBX B;  2JRK A;  3MK7 C;  5LJM A;  3RYH E;  4QX8 B;  4ZOL E;  3HKD E;  2K9A A;  4X20 E;  2VWA A;  5E0O A;  5FY1 A;  3I0Q A;  2VAS A;  4GK0 E;  2ZM2 A;  3RX6 A;  5KX5 E;  4YLH A;  4O4H E;  3LK3 B;  3FHN A;  4KMC A;  2IW5 B;  5KMG P;  3B13 A;  4GYR A;  2PFV A;  3F31 A;  2YEV C;  4P0B A;  3E08 A;  4IGU A;  4Z8X A;  3JC6 C;  5HXH A;  3O4X E;  4YJ2 E;  2ODV A;  1WYB A;  2M67 A;  2YU2 A;  4DBQ A;  5FXV A;  1OWA A;  1EZ3 A;  3GMI A;  4PNI A;  3CML A;  3BK9 A;  1H7C A;  3KVB A;  5F3J A;  3ZMT B;  4UV8 B;  2E9X C;  4P0A A;  1Z0P A;  4AQF C;  3L09 A;  3EUH A;  4BJM A;  4OK0 A;  5J2U E;  4XZC A;  5IHY A;  3WAK A;  5HXS A;  5FXZ A;  4JEH B;  4WBN E;  4EB6 E;  5JR9 C;  3LK4 2;  2LT3 A;  2YIN A;  4AKI A;  1D1C A;  4QX7 B;  5JRE A;  2LSG A;  3L3P A;  3NBX X;  5BMV E;  1O3X A;  5M4Y A;  3KV4 A;  5JDG A;  4AKR B;  5HXE A;  2IAK A;  3AAA B;  2WMN A;  2VKH A;  1HFA A;  2ZMA A;  1YW0 A;  3O1H A;  4O2B E;  5F8P A;  3K3O A;  4ZI2 D;  3LG7 A;  2V7I A;  2GK9 A;  2NW8 A;  2XQY A;  3V5S A;  5L2L A;  1HX8 A;  3CX6 B;  1MMD A;  4I50 E;  5HXC A;  3NZQ A;  4ILU A;  4QXH B;  1HS7 A;  5FXX A;  1BR4 A;  2ZLY A;  2D0T A;  3AVR A;  1ZHC A;  5EZY E;  3VU7 H;  2DNX A;  2XTL A;  3ETU A;  3TKL B;  3GN5 A;  3UT5 E;  3GWH A;  2UXX B;  3CX8 B;  2B1E A;  4TZ4 C;  2Q9Q B;  2X68 A;  3NRX A;  4EZH A;  3KDS E;  3CQC B;  3K8P C;  4DMW A;  3HKB E;  2XAJ B;  5DQW A;  5FY7 A;  5EK4 A;  2LHR A;  4QKN A;  2XHE B;  5JDF A;  2BVL A;  1D0Y A;  4QHO A;  4ZI3 C;  2KT9 A;  4OFZ A;  3IHR A;  5L3C B;  3BQI A;  2C5K T;  5FP3 A;  1FEW A;  4NUU A;  4PFP A;  5HAX A;  2DI4 A;  3RKO A;  1X79 A;  3CX7 B;  4UF0 A;  2RA1 A;  4IDZ A;  2E9X A;  5FYM A;  3DJB A;  4GYS A;  2L9Q A;  3NZP A;  4EYY R;  5LHI B;  4IIJ E;  4U74 A;  2D0U A;  4WW0 A;  3MJX A;  4X1Y E;  2ZM0 A;  2CLY B;  2HPL A;  2KWI B;  4ANJ A;  5JH7 E;  2D2S A;  2NOX A;  5FXW A;  3VHL A;  2WBL A;  2XAG B;  3AA0 B;  3R6N A;  2WMO A;  3R84 B;  5FMN A;  3C4W A;  3SS1 A;  2XAF B;  2XAS B;  3E22 E;  3ZEF B;  2NTX A;  4KUM B;  2VKJ A;  2KMF A;  4WNK A;  5LBQ B;  2CE7 A;  4C90 A;  2CWY A;  2HPJ A;  3QK6 A;  5J2T E;  4K0U A;  1G8X A;  2NP9 A;  3MZK B;  4QXB B;  3FXD B;  5JRC B;  5LA6 E;  1U5P A;  1YKE B;  4IE0 A;  1HG2 A;  1YD8 G;  2VKD A;  5DAB A;  3KV9 A;  2OA5 A;  4ADZ A;  2H7O A;  4OYK A;  5ETW A;  4GIW A;  4KBM B;  1V9D A;  4IE4 A;  2LJL A;  1OXZ A;  2LEH A;  1AJ3 A;  1MMN A;  3JC6 D;  1HTJ F;  3ZC1 A;  3ZJ1 A;  4BA9 A;  5LHG B;  4TV9 E;  1LVF A;  4PAG A;  3I9W A;  1HF8 A;  2BVM A;  3ZYL A;  3AA7 B;  1IJ6 A;  1SHZ C;  2NW7 A;  3J9X 1;  4YJ3 E;  4B6X A;  4AXP A;  1BR2 A;  5JDL A;  3HI2 A;  3I0O A;  4IST A;  3S4U A;  2RP4 A;  1FMW A;  2V1D B;  2E9X D;  4CI2 B;  5DJQ C;  2LSI A;  3C98 B;  4X1K E;  4O2A E;  2L3L A;  2KWH A;  3O1I A;  3V5U A;  3ZN0 B;  4PFO A;  4EAH A;  3N9M A;  3NRY A;  3HL6 A;  3ZJ2 A;  4OHF A;  1IJ5 A;  2KXP B;  4L9I A;  4V1A v;  3PUG A;  4YFS A;  4PJN A;  3N9P A;  4CQI A;  2X9W A;  3GN5 B;  1ZV4 X;  1D0X A;  2JJ9 A;  4L0R A;  3RRC A;  1Y64 B;  3ETV A;  5JDQ A;  3EDU A;  4A56 A;  2WAU A;  3HKC E;  3Q5W A;  4CXW A;  2SPC A;  3LK2 B;  1UX5 A;  4ZI7 E;  2JMK A;  3SRZ A;  1WLX A;  3GA8 A;  1MND A;  2KZ7 B;  1ZKE A;  3C51 A;  4CXX A;  3ZMU B;  4HE8 A;  1YKH B;  3KVA A;  5LP6 E;  2CA5 A;  2CXF A;  2C0S A;  3AVS A;  1KK7 A;  3VKH A;  3O1J A;  4UF0 B;  4I43 B;  2JPF A;  1U4Q A;  4GK5 E;  2CWO A;  4H9O C;  2XAQ B;  4C91 A;  1ZEE A;  3H37 A;  2QA7 A;  3N2G E;  2V7K A;  5JQG E;  3C4Z A;  2ACX A;  3C50 A;  5CA0 E;  2EHO A;  2YK0 A;  4UEL A;  3LJC A;  3Q9D A;  1S94 A;  5H6R B;  4ASK A;  2CM0 A;  4XAX B;  3ESL A;  2ZM8 A;  2VL8 A;  4N78 D;  1HG5 A;  3UUX B;  2KND A;  3ANW A;  4ZI3 D;  2K48 A;  5TAO A;  2A3D A;  2NWB A;  4I55 E;  3KIN B;  3N9Q A;  5L3E B;  5LG4 A;  4ZS2 A;  4MLK A;  5LCY A;  2XUE A;  4O4J E;  3RYC E;  5LGT B;  2V7J A;  2DCF A;  3PU3 A;  5DQV A;  3UUN A;  1MMA A;  4DND A;  3ZMS B;  2WM9 A;  3ZN1 B;  3LBX A;  4H63 V;  2X0L B;  5IYZ E;  4MAL A;  5JDH A;  2NTY A;  2W0G A;  4O4L E;  2Q9Q C;  2MTQ A;  2LSJ A;  3K3N A;  3IBP A;  3IEE A;  3CKD A;  2PBI A;  4IHJ E;  2JQQ A;  3T8O A;  2DHR A;  2CMR A;  3E0Z A;  2X9Y A;  3PE0 A;  1G73 A;  2EHO D;  5CB4 E;  3MKD A;  2N9D A;  5FY0 A;  4AQF A;  4E7S A;  3CVR A;  2W00 A;  2IC9 A;  1D0Z A;  2LHN A;  2N1G A;  4ZI2 C;  2A2F X;  3MXZ A;  3BQL A;  3VKG A;  3BQK A;  3PDY A;  5JR9 A;  3MA9 A;  2I59 A;  2Y6X A;  1FMV A;  2KIN B;  4UEM A;  2K24 A;  5EK3 A;  4AQG A;  3WAJ A;  3J7Y q;  3RC8 A;  2E8I A;  5FNV E;  3UTK A;  3CPZ A;  3Q5X A;  3ZYK A;  4E7Z A;  4G2A A;  4G63 A;  3UUL A;  3ZYM A;  4CI3 B;  2CLY C;  2LOS A;  4EXT A;  1VRB A;  2DWK A;  3HA4 A;  4H9R C;  3A5X A;  5KDM C;  1LRZ A;  3KBU A;  4H63 H;  2X51 A;  2VK9 A;  4ERR A;  2MBG A;  4QWN B;  4UVA B;  3C4X A;  3M65 A;  2MOZ A;  1HCI A;  4AKL A;  2LSY A;  3FBL A;  2W62 A;  3N2K E;  2W63 A;  4PJJ A;  3OKQ A;  4FI5 A;  3I1A A;  2XAH B;  3MAC A;  3ZCI A;  3KFW X;  1CUN A;  1QSD A;  4ISS A;  4JLE A;  2H3R A;  4PK5 A;  5JVD E;  2CXD A;  5HYA A;  2X9H A;  4IE7 A;  3RH3 A;  3IF8 B;  4UVB B;  2DWG A;  3N9N A;  1QUU A;  4IE6 A;  4ZS3 A;  3FB2 A;  2LM9 A;  5LJN A;  3ANW B;  3HKE E;  3AA6 B;  4MFR A;  2ES0 A;  3PUA A;  1BR1 A;  2Q9Q A;  3CQX C;  3P7I A;  4MBQ A;  2Z6E A;  2ODU A;  3RC3 A;  4EZ4 A;  1SA0 E;  5L3F B;  4H9N C;  5J1G A;  4FJO A;  2Y8D A;  2Y48 B;  5LGU B;  3U78 A;  2V26 A;  2J1D G;  4DBR A;  5EK2 A;  3ZC0 A;  2LE8 A;  4MHC A;  4KP3 C;  4JUY A;  2MYS A;  2G0U A;  4HFV A;  4HN9 A;  4YHJ A;  1UCU A;  2D5U A;  4WBO A;  5JDN A;  4I4T E;  3AAI A;  4QXC B;  3U3I A;  3PTR B;  1VOM A;  4HKA A;  4UXN B;  2BZB A;  3PU8 A;  3RYF E;  4BJN A;  1WYC A;  2UXN B;  4OYJ A;  4HGA A;  1IAP A;  3CWZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...