2Q9QD

The crystal structure of full length human gins complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
192
structure length
186
Chain Sequence
SEAYFRVESGALGPEENFLSLDDILMSHEKLPVRTETAMPRLGAFFAETDNAVPQGSKLELPLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFGSQLLHFDSPENADISQSLLQTFIGRFRRIMDSSQNAYNEDTSALVARLDEMERGLFQTGQKGLNDFQCWEKGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords DNA replication complex GINS protein PSF2
publication title Crystal structure of the GINS complex and functional insights into its role in DNA replication.
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 186
sequence length 192
chains with identical sequence H
ec nomenclature
pdb deposition date 2007-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF05916 Sld5 GINS complex protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2050 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2q9qD00
3JC6C 2Q9QD 2EHOD 2E9XC 3ANWB
chains in the Genus database with same CATH superfamily
4UELA 3TLSA 4UF0B 2ZM8A 1S35A 3K3QC 1ZHCA 2N1GA 1HX8A 3FZLB 1NWMX 1OWAA 2IMLA 3EAMA 2N9DA 2LSYA 4LMKA 4ZI3D 3MXZA 5C8YE 2W0GA 2GK9A 2JRKA 1YKHB 2EHOD 1NAFA 1HFAA 4DIDB 4DUZT 4B3TT 2BG9C 3W15B 1HG5A 4GK0E 2OLTA 2CHNA 2W63A 3NZPA 3UULA 2Z6EA 4HWFA 3NWIA 3RYIE 3CQGB 3TLTA 4B3MT 4P0AA 2XM1A 3OTOT 1WCRA 2NOXA 2C5IT 2VQET 3SFDA 1HNZT 4ZZCA 1FEWA 1IZNB 5AQKB 3RRWA 4MHCA 2BKPA 2FJDA 2MYSA 1D1CA 2HH7A 3EDUA 2BG9B 3AE6A 2QYWA 3C4ZA 3QNUA 3H3AA 4MFRA 1XDOA 2E5VA 5JTGA 3LDQB 1MIVA 4Q25A 2VKJA 3L09A 2PBIA 4C91A 4YTNA 2Q9QD 3T1YT 5FY7A 3FXDB 5F5WA 5L3BB 3PU3A 3AAEB 3FXEB 4JI5T 3RF1A 2E9XA 5ABHA 4H9PC 1VOMA 4CN4A 1KNZA 2BVLA 5L4EA 3OYXA 4EZHA 2UUBT 3KVBA 3HI2A 1QSDA 3D0TA 1UURA 3PUXF 2D5UA 3KV9A 3RYHE 3KVAA 5F8PA 3MKDA 4EV6A 3I9WA 1SHZC 3P4PA 4DBQA 1D0ZA 2ZLYA 3UFGA 3AE9A 3P4SA 5JDMA 2XAQB 2HN2A 5HEGA 5LHIB 2QGSA 2XZEA 4U74A 2XAHB 2XAJB 4OYKA 5IYZE 1FMWA 2NTYA 1G8XA 2JQ9A 4NUVA 2I6HA 5AQTB 1LKXA 2YDRA 1MMAA 3K3OA 4H9NC 4YSZA 2WAUA 5FXXA 3OYZA 1KNRA 3JAFA 2VK9A 3AA7B 3UUNA 3HKDE 2H7VC 4ADZA 2V26A 4YSXA 4CN6A 3UQ7A 3ZC0A 5LNKA 2L8KA 2CE7A 3ZMSB 2FJBA 3GN5A 3O4XE 2LLYA 4KX6A 2IUBA 2XJ7A 2R6GF 5EK3A 4TNVA 3N9NA 3A8YC 1YQ3A 3RIAA 1YKEB 5M4YA 3PUGA 5LGTB 3J7Yq 2J62A 5IHYA 3R6NA 5FXWA 1BR1A 3PJAJ 2A2FX 3SFEA 4UEMA 2CCQA 2L9QA 2XQ9A 3CX7B 4HGAA 2IW5B 1R8IA 2Y6XA 4A98A 2G0UA 3AEFA 2LEHA 3RRCA 3JCFA 1MIYA 5FKYA 5ABEA 1MNDA 3CX6B 2C5KT 4U33A 3PUYF 2XQ4A 3B57A 4LF5T 2B76A 4HFEA 5KDMC 4QH5A 4UVCB 4QXHB 1HS7A 2YDQA 1W0AA 3JAEA 2LSKA 3VR9A 2ACXA 3UQ4A 2EHOA 1D1BA 1IAPA 5A1LA 5FP3A 4MBQA 3ZEFB 4B3ST 5LG4A 3WAJA 3AVRA 4ZS3A 5BMVE 4ZI2D 5HAXA 3CIRA 3FZFB 4FI5A 2NP9A 2LHNA 5JR9A 5JDNA 2W67A 3C98B 5AQPB 1JNZA 3FZKB 5JQGE 2YU1A 4O2BE 2YINA 2DL1A 4YJ3E 3IF8B 4X1IE 4EGWA 4DV0T 2BS4A 2Y48B 4X1YE 1WR0A 3ZPOA 3TLWA 2E8IA 4EXTA 1MIWA 1HTJF 2C0SA 4LMLA 5LHGB 3DP7A 2NR4A 5FXZA 4BJMA 2Q9QA 4EYUA 2E9XD 4U7IA 2OA5A 3GMIA 2KT9A 3QB5K 3PUVF 2LT3A 2ZM0A 3FZHB 3AA0B 2VB6A 4X66T 5AQJB 3LSVA 2K48A 4JUYA 2XQYA 2LOPA 3PE0A 3F31A 3N9OA 4DNDA 2V6XA 2W66A 3RIUA 3F57A 4DV3T 4TWDA 4AXPA 4IDZA 4WNKA 1YQ4A 4A56A 2KWHA 3ANWB 4NPPA 4H9RC 2BBJA 3Q5DA 4ISSA 2CWOA 2XQ3A 4EEBA 3HR0A 3NRYA 2A3DA 4ZZBA 4DV5T 4DBRA 4ASKA 4TNWA 3UUBA 5FY0A 3RIFA 3AE8A 2W2UA 3RYFE 4EYYR 2WDRA 2V5DA 4UVAB 5IUXA 3IA3A 1S94A 2LSGA 2DWKA 2KWIB 3LK42 2XQ7A 3UU4A 4JEUB 4O4HE 3RYCE 4PJJA 4JEHB 4LF8T 1WR6A 3ZT7A 1XNQT 2HPLA 2XUEA 4ZOLE 4WZXA 4X65T 4AQFA 3DJBA 2D2SA 2JQHA 2WS3A 1UX5A 5AQRB 4H9QC 4CI2B 1VCTA 1Y64B 3MJXA 4MALA 5FVLA 2VVNA 5AQHB 4IE7A 2WCAA 2JJ9A 3M65A 1KK7A 4YJ2E 2I0MA 3FZMB 2CXDA 1NEKA 4QH4A 4X62T 3CVRA 2KMFA 2CLYB 4IDQA 5LYJE 3O1IA 2JQKA 3PURA 3P4QA 4H63V 2VKDA 5LXTE 5LBQB 1OEDC 3C64A 4TUYE 2BKOA 2BBHA 3UU5A 4U7YA 3OKQA 4MLKA 2W61A 4O2AE 3RI5A 4AKIA 5H6RB 3SRZA 3ETUA 2XY8B 3FBLA 4XZCA 2ODUA 1UK5A 2NWBA 1IJ6A 2ZM2A 3VR8A 3Q5WA 5ETWA 1I94T 4H9SE 4UV8B 3JC6C 1ZV4X 3A7MA 1WFDA 3LBXB 3LJCA 1MNEA 4QHOA 4DV2T 2IDOB 4KP3C 2WDQA 4TWHA 1OEDB 4AKHA 1X9BA 2VL8A 2X51A 2XM2A 2VURA 2B1EA 5HEOA 2FBWA 1L0VA 4YHJA 1WLXA 3L39A 2CXFA 1QUUA 3QK6A 2CEAA 5LJNA 3FBZA 2V8SV 2BVMA 3VRBA 2RA1A 5CFBA 4CI1B 1M7KA 2RPAA 4QX8B 1D0XA 2WM9A 3PUQA 4AKLA 4V1Av 3NVOA 4P0BA 3EUHA 2I59A 3E08A 2MPKA 3KDSE 2WZHA 2VWAA 5J2TE 1HF8A 4JI3T 5AQVB 4X5TA 2LSIA 4JI0T 2WDVA 4YY3T 2LOSA 4CXWA 5AFUL 4ZI3C 2X68A 4DR1T 4HFBA 3KFWX 2X66A 4HWDA 2XQ6A 2CPTA 2V6YB 1UGOA 2DWGA 3KINB 2XPKA 4DR6T 4YTMA 2K5BB 5ABFB 4HFVA 3MA9A 1CHUA 2CBJA 2C5JA 1E2AA 3TLVA 4UF0A 2V7IA 3AE4A 5AQFB 4JI8T 1J5WA 3R84B 4ERRA 2M6BA 3N2KE 2CRBA 1H7CA 1X79A 5LBMA 5AQGB 2FUPA 3IEEA 4DR4T 3PUAA 5L3FB 4ISTA 3PUZF 1T98A 2V7JA 2WSSV 4TWFA 4B6XA 3VKGA 4KHPT 2VKOA 2ZMAA 1YXRA 3LBXA 5C3JA 4LF7T 4QXCB 5J1GA 3VRAA 4DO0A 4BAYB 1T72A 3M3ZB 1OXZA 3A5XA 1HNWT 3U3IA 5L3CB 4Z90A 2NTXA 2WU5A 1MMDA 4HN9A 4NXNT 4OYJA 1KFYA 5KX5E 4TZ4C 3AE3A 2CHOA 3SWHA 3PV0F 4IGUA 4PFPA 2ACZA 3BQKA 3UUMA 4L5GA 3V5SA 2BG9A 4JI2T 3EHZA 4I0UA 2IIUA 5KXJA 4U72A 1B7TA 4IE5A 1KNPA 5ADXL 1V9DA 4U31A 3CX8B 3ZYMA 1LRZA 3AE1A 4IE6A 4F6RC 3O9XA 5LOVE 2D9DA 3Q2MA 1VRBA 2BDEA 2X0YA 4F8HA 2DLRA 3WAKA 3ONLC 5LCYA 1HX1B 1J5ET 2LE8A 5FL0A 4PK4A 4GIWA 3RQWA 4AI6A 1T8BA 5HWYA 4LFAT 4LFBT 4HKAA 2LM9A 2JMHA 4N78D 2MOZA 3RPUA 5H6QB 2V6YA 2E2AA 3KV4A 3LK2B 1G73A 2YKSA 2JPFA 3N9LA 2H7OA 4CZZB 5JDQA 5JREA 1UX4A 2DNXA 3T8OA 2KINB 4CI3B 3AB3B 3P4WA 3ZT5A 3C4WA 4DV4T 3NKZA 3CKDA 3PU8A 3ZCJA 4PAGA 4IDPA 4UXNB 2NW7A 3QOFA 5HXSA 3BQLA 2KSRA 4DR7T 2YU2A 4O4JE 1KEYA 4YT0A 4DR3T 4PJNA 4QX7B 3S4UA 3ZSSA 2QRXA 5BR8T 1UUSA 1EZ3A 4COFA 1Z0PA 4IE4A 4DV7T 3LG7A 3Q5XA 3B13A 4LFCT 1LVFA 4JI6T 5LB7B 3SS1A 3KV6A 5FMNA 4IDNA 3ZN0B 4AKRB 3P7IA 2IHR1 5AQQB 3RKGA 2WU2A 2MTQA 3G06A 3C4XA 1Y01A 4TX5A 5HXRA 3T1HT 2WMOA 1NENA 1N36T 3ZMUB 3UT5E 4KUMB 2H3RA 3AA6B 2HHHT 2CWYA 2VKHA 1WRDA 3VU7H 5L3GB 2X9XA 3ZN1B 5E0OA 4CN1A 3Q9DA 3MACA 1US7B 4Z91A 2WY2A 5HCMA 4YLHA 4EB6E 5EK2A 4OHFA 2A72A 4JYAT 5LGNB 4ZXLA 4ZI2C 3CQXC 1SUMB 2LM2A 2YEVC 1YD8G 4EOZB 4LF4T 4JV5T 2X0HA 3HL6A 4QXBB 1BR0A 3SOLA 3N5LA 1I6ZA 3V5UA 3RQUA 2LKGA 3OPCA 4NXMT 3AEDA 3ZSTA 3U78A 2UXBT 4KI0F 4FJOA 3H37A 5LMNT 1D1AA 2KLQA 2W62A 4HWIB 2E5LT 3PUWF 2V7KA 1D0YA 4IL9A 2XAFB 5CJ5A 3CQCB 2V5CA 2JQQA 1HNXT 4JBWF 3UTKA 2E9XC 5DQWA 2FJEA 3X1DA 5AQLB 5HEUA 2LHRA 3N2GE 4U2YA 1AJ3A 1QLBA 3ZCIA 3JC6D 4ILAA 3PUSA 2K3WA 2XASB 2DCFA 1UCUA 5DQVA 3IHRA 2MAWA 3HKEE 4OX9T 2X67A 2FJAA 4EAHA 1E7PA 4YFSA 5LGUB 5AQSB 3ZJ1A 4OFZA 3AEEA 4E7ZA 1SE7A 3DTOA 5HEHA 4K0UA 3UU8A 4DUYT 1XWMA 2J1DG 4HE8A 3CK6A 4UV9B 4O4IE 5L4HA 3QUJA 4M1PA 4X1KE 5DJQC 1J1JA 5C2TA 2XQAA 3OJAA 3BK9A 1M62A 3FHNA 4O8SA 2WWVA 1O3XA 4U2ZA 4H9OC 4YTPA 1CUNA 3PJAA 4IHJE 4L9IA 4HEAA 1XMOT 3KBUA 4ILBA 4H63H 3ZYKA 2XQ5A 4PFOA 2BG9E 5FY1A 4P09A 2KNDA 4EEDA 3ANWA 3ZYLA 2HN1A 3EDVA 4Z8XA 3KV5A 3QB5A 3AAIA 4ILCA 4IE0A 5HWXA 2JMKA 4HWHA 4B3RT 2CMRA 2J47A 4CQIA 2UXXB 5LMUT 3H3MA 4A5XA 1VCSA 4CXYA 1FJGT 3UUXB 4IT4A 3J9X1 5HCJA 3GWHA 2UXNB 4GOUA 2LJLA 3N2OA 5JVDE 3GN5B 2SPCA 2WQYA 2V7LA 4HFIA 3K8PC 4ZS2A 2WP9A 5CGMA 3E22E 4OK0A 2XQ8A 2BKNA 4IL4A 2H89A 5GONE 2IAKA 3I1AA 5LHHB 3ABVA 2BS3A 3ZMVB 4EIWA 2UU9T 3AE5A 3N9MA 2EHOC 4AIUA 4YXDA 2IC6A 2VQFT 4I43B 5TAOA 5HXHA 1Z8UA 3VHLA 3AXJB 2IC9A 2QVAA 2LKHA 4E7SA 4C90A 5JR9C 5F3JA 1JNRA 4ZI7E 4DMVA 5AQMB 2JIWA 5FXVA 3P8CD 5AQIB 5FVKA 3AAAB 4IREA 2VVSA 2D0TA 4WW0A 3Q5EA 4AQYT 3VKHA 1GQEA 4EZ4A 4BA9A 1ZEEA 1FIOA 4PJLA 3UU3A 5AQUB 3L3PA 2UUAT 2BS2A 4TN7B 1XZYA 5ABGA 1N33T 2EHOB 4O4LE 2CA5A 3GA8A 3AE2A 1T7SA 4JI7T 4DV1T 3NZQA 5FYMA 3EI0A 4JI4T 1OEDA 1BR4A 3MK7C 2UXDT 5JR9B 2Q9QC 1DU2A 3ONJA 3N9QA 2XAGB 3ZLIA 4ZEYA 3ONXA 5KMGP 3QC9A 4GYRA 3UU6A 1MMNA 5JRCB 3O1JA 3RGLA 3RX6A 3TKLB 5JH7E 3NRXA 2W4XA 1W09A 4KHZF 5CB4E 2QA7A 1HG2A 3NBXX 4IDOA 3P4RA 4AQGA 3RIUC 1XDPA 4HFCA 1WYBA 2Q9QB 1SA0E 2KXPB 4LF6T 1HR0T 1U5PA 4XAXB 2WMNA 5FL1A 4GYSA 4JLEA 3CPZA 1WYCA 4X64T 4L0RA 1E1HB 2UUCT 5L47A 4QKNA 4U3CA 4QWNB 2F4VT 2M67A 3RH3A 3AEGA 4TV9E 2WBLA 4DV6T 3AE7A 4ILUA 5HYAA 5CA0E 4NUUA 5DABA 5ABFA 3FB2A 3AXJA 3I0QA 5HXCA 3I0OA 2LSJA 4YHHT 3L8RA 2DHRA 3I9YA 3JADA 2D0UA 2RP4A 3PTRB 4AQFC 4GKKT 3IBPA 4AISA 3OVUA 4KBMB 3TLUA 1BR2A 5EZYE 3EVYA 3RC3A 2XSBA 2CXLA 4WYVA 3ZT6A 5JDGA 5CA1E 3ZKRA 2AE9A 2WZIA 4J2CA 4NIQA 4TV8E 4DR2T 2YOEA 2WWUA 2NW9A 3AEAA 5LJMA 1YW0A 3RKOA 5LG3A 3F2EA 2HPJA 2LRLA 3LK3B 4ZHQE 3WI3A 3B5MA 1N32T 4XBFB 4ANJA 5L3EB 2OV9A 3EABA 2ZM6T 4WBNE 4AKGA 3CMLA 1MMGA 1W9RA 2V7MA 3C50A 3C51A 4PK5A 2ODVA 4K0KT 5J0ZA 2V1DB 2L3LA 2YN6A 5JRCA 1ZOYA 2PTFA 4DR5T 1W0BA 3ZC1A 3N9PA 4IIJE 4HFDA 5JDFA 1U4QA 5L3DB 3E0ZA 2CBIA 2LRKA 4UR9A 4DVDA 2PFVA 4YSYA 2XSAA 3AVSA 1XNRT 2MBGA 3PDYA 4I55E 4BJNA 5LP6E 1IBLT 5JDLA 3HKCE 3OBVE 4LMJA 4PW8A 4P1NA 4PK6A 2UXCT 2VL0A 4HTEA 4GK5E 3K3NA 4G63A 4HFHA 1N34T 5JDHA 2N2NA 1IBMT 4I50E 5FNVE 3CWZB 1LVKA 4HWCA 3ZJ2A 4UIGA 5L2LA 2Y8DA 1IJ5A 4DMWA 1XMQT 4UVBB 5AQNB 2J4GA 5HXEA 2K24A 4CXXA 2PG8A 4A97A 2AXDS 1HCIA 2H88A 2KZ7B 4WBOA 4KMCA 3RLFF 2WB5A 1FMVA 2P9BA 3RHWA 3ZMTB 2X9WA 4PNIA 3ETVA 1ZKEA 2DI4A 3RC8A 3AECA 4X20E 5LA6E 3HA4A 2CLYC 5HEJA 2NW8A 4JI1T 3P50A 4LF9T 3ESLA 2X9YA 2VASA 5J2UE 4G2AA 2M6IA 2A9UA 1ZP0A 1IBKT 3BQIA 3MZKB 5IWAT 2BZBA 2ES0A 2PJQA 3KBTA 4GKJT 2W00A 3K1SA 3AEBA 2X0LB 3UFEA 2YK0A 3AA1B 3LFMA 2YDSA 2E9XB 2CM0A 3O1HA 5EK4A 5AQOB 3ZMZB 2X9HA 1KF6A 4I4TE 2XHEB 3HKBE 4QH1A 2K9AA 1OEDE 2XTLA 4PJMA
chains in the Genus database with same CATH topology
5HWYA 2IC9A 4HKAA 4UELA 2LM9A 2JMHA 4E7SA 4UF0B 2ZM8A 2K48A 1S35A 4C90A 4N78D 5JR9C 4JUYA 2MOZA 3RPUA 2XQYA 3K3QC 2LOPA 5H6QB 5F3JA 4ZI7E 4DMVA 3PE0A 1ZHCA 3F31A 2N1GA 3KV4A 3LK2B 5FXVA 3P8CD 1HX8A 1G73A 3AAAB 1NWMX 1OWAA 3N9OA 4DNDA 2JPFA 2D0TA 4WW0A 3N9LA 3VKHA 4EZ4A 3F57A 2H7OA 4BA9A 2N9DA 1ZEEA 1FIOA 2LSYA 4PJLA 4CZZB 5JDQA 4ZI3D 5JREA 1UX4A 3L3PA 2DNXA 3MXZA 4AXPA 3T8OA 2KINB 4IDZA 5C8YE 2W0GA 4CI3B 3AB3B 4TN7B 4WNKA 2GK9A 2EHOB 4A56A 4O4LE 2JRKA 2KWHA 3ANWB 1YKHB 2CA5A 2EHOD 3GA8A 3C4WA 1NAFA 1HFAA 3CKDA 3PU8A 4H9RC 3ZCJA 4PAGA 4UXNB 3W15B 2NW7A 4ISSA 1HG5A 2CWOA 3NZQA 5HXSA 3BQLA 5FYMA 3HR0A 3NRYA 2A3DA 4GK0E 2YU2A 4O4JE 2W63A 1BR4A 3MK7C 3NZPA 3UULA 4DBRA 2Z6EA 5JR9B 4ASKA 2Q9QC 5FY0A 3RYIE 3RYFE 4EYYR 4PJNA 4QX7B 3CQGB 3N9QA 3S4UA 2XAGB 4UVAB 3ZLIA 4P0AA 1S94A 2LSGA 2DWKA 2KWIB 3ONXA 3LK42 5KMGP 1EZ3A 2NOXA 3QC9A 4GYRA 2C5IT 4JEUB 4O4HE 1Z0PA 1MMNA 5JRCB 4IE4A 3RYCE 1FEWA 1IZNB 3LG7A 3Q5XA 3B13A 3O1JA 4PJJA 3RX6A 1LVFA 3RRWA 3TKLB 5JH7E 4JEHB 4MHCA 3SS1A 3KV6A 5FMNA 1WR6A 3NRXA 2HPLA 2XUEA 4ZOLE 2MYSA 1D1CA 2HH7A 3EDUA 4AQFA 3DJBA 3ZN0B 4AKRB 2D2SA 1UX5A 3C4ZA 3P7IA 5CB4E 4H9QC 2QA7A 4CI2B 3H3AA 1Y64B 1HG2A 3NBXX 4MFRA 3MJXA 4MALA 4AQGA 2MTQA 1MIVA 1WYBA 2Q9QB 3C4XA 1SA0E 2VKJA 2KXPB 3L09A 2PBIA 4IE7A 4TX5A 4C91A 2JJ9A 2Q9QD 1U5PA 3M65A 4XAXB 5HXRA 1KK7A 4YJ2E 2CXDA 2WMNA 4GYSA 5FY7A 4JLEA 3CVRA 3FXDB 2WMOA 2KMFA 3CPZA 2CLYB 1WYCA 3O1IA 3ZMUB 5LYJE 3UT5E 3PURA 5L3BB 4L0RA 1E1HB 3PU3A 4H63V 3AAEB 3FXEB 4KUMB 2VKDA 2E9XA 5LXTE 4QKNA 2H3RA 4H9PC 1VOMA 4QWNB 5LBQB 3AA6B 2M67A 3RH3A 2CWYA 2VKHA 1WRDA 4TV9E 3VU7H 1KNZA 2BVLA 3C64A 4TUYE 2WBLA 5L3GB 3OYXA 2X9XA 3OKQA 3ZN1B 4EZHA 4MLKA 2W61A 3KVBA 3Q9DA 5E0OA 3HI2A 3MACA 1QSDA 1US7B 3D0TA 4O2AE 2D5UA 4ILUA 3KV9A 5HYAA 3RYHE 5CA0E 4AKIA 5H6RB 3KVAA 4NUUA 4YLHA 4EB6E 5EK2A 3SRZA 3ETUA 4OHFA 5DABA 2A72A 5LGNB 3FB2A 5F8PA 4ZI2C 3CQXC 3FBLA 3MKDA 4XZCA 3I0QA 2ODUA 3I9WA 5HXCA 1SHZC 2NWBA 3I0OA 1IJ6A 4DBQA 2ZM2A 3Q5WA 2LSJA 1D0ZA 5ETWA 2YEVC 1YD8G 2ZLYA 4H9SE 2DHRA 3I9YA 1ZV4X 3JC6C 4UV8B 4EOZB 2D0UA 2RP4A 3PTRB 5JDMA 3LBXB 2XAQB 4AQFC 3HL6A 4QXBB 3LJCA 1BR0A 1MNEA 5LHIB 3SOLA 3N5LA 4QHOA 2QGSA 3V5UA 3IBPA 4KP3C 4U74A 4KBMB 2XAHB 4AKHA 2VL8A 2XAJB 1BR2A 5EZYE 3EVYA 4OYKA 3RC3A 2X51A 5IYZE 3U78A 1FMWA 2NTYA 1G8XA 2CXLA 4NUVA 2B1EA 1LKXA 4FJOA 3H37A 1D1AA 2KLQA 5JDGA 2W62A 5CA1E 4J2CA 1MMAA 2V7KA 1D0YA 3K3OA 4H9NC 4TV8E 4YHJA 2XAFB 1WLXA 3CQCB 2WWUA 2CXFA 1QUUA 2WAUA 3QK6A 2CEAA 2NW9A 5LJNA 3FBZA 2JQQA 5LJMA 1YW0A 5FXXA 3RKOA 2BVMA 3UTKA 3OYZA 2E9XC 5DQWA 3F2EA 2VK9A 2RA1A 2HPJA 3AA7B 3LK3B 4CI1B 3UUNA 4ZHQE 2LHRA 3WI3A 4QX8B 4XBFB 3N2GE 4ANJA 5L3EB 1AJ3A 4WBNE 1D0XA 3ZCIA 3JC6D 2WM9A 4AKGA 3PUQA 4AKLA 3HKDE 3PUSA 3CMLA 4V1Av 1MMGA 2H7VC 2XASB 2DCFA 4ADZA 2V7MA 2V26A 3C50A 3ZC0A 3C51A 4PK5A 2ODVA 1UCUA 5LNKA 2L8KA 2CE7A 4P0BA 5DQVA 3ZMSB 3EUHA 2V1DB 2I59A 3E08A 2L3LA 5JRCA 3IHRA 3GN5A 3KDSE 3O4XE 3HKEE 2VWAA 2X67A 5J2TE 1HF8A 4EAHA 3ZC1A 5EK3A 4YFSA 3N9NA 5LGUB 3N9PA 4IIJE 3ZJ1A 4OFZA 5JDFA 2LSIA 1U4QA 4E7ZA 5L3DB 3E0ZA 3DTOA 1YKEB 4K0UA 5M4YA 3PUGA 2PFVA 4DVDA 2LOSA 5LGTB 3J7Yq 3AVSA 4CXWA 5AFUL 4ZI3C 2X68A 2MBGA 3PDYA 4I55E 5IHYA 3R6NA 5FXWA 1BR1A 2J1DG 4HE8A 2A2FX 3KFWX 2X66A 4UV9B 4BJNA 5LP6E 4O4IE 4UEMA 2CCQA 5JDLA 2L9QA 3HKCE 3OBVE 2DWGA 3QUJA 3CX7B 3KINB 4HGAA 2IW5B 4PW8A 2Y6XA 4M1PA 2G0UA 4X1KE 2LEHA 5DJQC 4PK6A 3RRCA 2K5BB 1MIYA 4HTEA 4GK5E 3OJAA 3BK9A 4HFVA 3K3NA 3MA9A 2C5JA 1MNDA 3FHNA 4O8SA 3CX6B 4G63A 4UF0A 2C5KT 2V7IA 1O3XA 4H9OC 3R84B 1CUNA 4ERRA 3B57A 5JDHA 3N2KE 4IHJE 2N2NA 4L9IA 5KDMC 4HEAA 4UVCB 4I50E 5FNVE 3CWZB 1H7CA 1LVKA 3ZJ2A 1X79A 4QXHB 3KBUA 1HS7A 5LBMA 4UIGA 4H63H 3ZYKA 3IEEA 5L2LA 3PUAA 5L3FB 4PFOA 2LSKA 2Y8DA 4ISTA 1T98A 1IJ5A 2ACXA 2EHOA 2V7JA 2WSSV 1D1BA 1IAPA 2KNDA 4P09A 5FY1A 4B6XA 4DMWA 3VKGA 3ANWA 5A1LA 4UVBB 3ZYLA 2VKOA 2ZMAA 5FP3A 3LBXA 3EDVA 4MBQA 3ZEFB 5HXEA 4QXCB 4Z8XA 3KV5A 2K24A 5J1GA 5LG4A 4CXXA 2PG8A 3AAIA 4DO0A 4IE0A 3WAJA 3AVRA 5HWXA 2JMKA 4BAYB 1HCIA 4ZS3A 2CMRA 2KZ7B 1OXZA 5BMVE 3A5XA 4WBOA 4ZI2D 5HAXA 4KMCA 4CQIA 2UXXB 4FI5A 2NP9A 2LHNA 3U3IA 5L3CB 2NTXA 5JR9A 1FMVA 2P9BA 3ZMTB 5JDNA 2X9WA 4PNIA 3ETVA 4CXYA 1ZKEA 2DI4A 1MMDA 3C98B 3RC8A 4HN9A 4OYJA 3UUXB 4X20E 5LA6E 5KX5E 3HA4A 2CLYC 3J9X1 4TZ4C 2NW8A 5JQGE 3GWHA 2UXNB 4GOUA 2LJLA 2YU1A 3N2OA 3GN5B 2SPCA 5JVDE 4O2BE 2YINA 2V7LA 3ESLA 3K8PC 4ZS2A 2X9YA 4YJ3E 3IF8B 3SWHA 2VASA 5J2UE 4G2AA 3E22E 4IGUA 4PFPA 3BQKA 4X1IE 3UUMA 4OK0A 4L5GA 3BQIA 3MZKB 2Y48B 4X1YE 2BZBA 3ZPOA 3V5SA 2ES0A 2PJQA 3KBTA 2W00A 2E8IA 4EXTA 1MIWA 1HTJF 2X0LB 1B7TA 4IE5A 4U72A 2C0SA 1V9DA 2YK0A 3AA1B 3LFMA 3UFEA 3CX8B 5ADXL 5LHGB 3DP7A 3ZYMA 1LRZA 5GONE 4IE6A 4F6RC 3O9XA 2E9XB 2IAKA 5LOVE 5FXZA 2CM0A 3I1AA 4BJMA 5LHHB 3O1HA 3Q2MA 2Q9QA 4EYUA 1VRBA 2BDEA 2E9XD 3VHLA 5EK4A 2OA5A 3GMIA 2DLRA 3WAKA 5LCYA 3ZMVB 3ZMZB 2X9HA 4EIWA 2KT9A 3N9MA 2EHOC 2LT3A 4I4TE 2LE8A 2ZM0A 2XHEB 3HKBE 2IC6A 2K9AA 4PK4A 3AA0B 4GIWA 4AI6A 2XTLA 4I43B 5TAOA 5HXHA 4PJMA 2VB6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JC6 C;  2Q9Q D;  2EHO D;  2E9X C;  3ANW B; 
#chains in the Genus database with same CATH topology
 4UEL A;  3TLS A;  4UF0 B;  2ZM8 A;  1S35 A;  3K3Q C;  1ZHC A;  2N1G A;  1HX8 A;  3FZL B;  1NWM X;  1OWA A;  2IML A;  3EAM A;  2N9D A;  2LSY A;  4LMK A;  4ZI3 D;  3MXZ A;  5C8Y E;  2W0G A;  2GK9 A;  2JRK A;  1YKH B;  2EHO D;  1NAF A;  1HFA A;  4DID B;  4DUZ T;  4B3T T;  2BG9 C;  3W15 B;  1HG5 A;  4GK0 E;  2OLT A;  2CHN A;  2W63 A;  3NZP A;  3UUL A;  2Z6E A;  4HWF A;  3NWI A;  3RYI E;  3CQG B;  3TLT A;  4B3M T;  4P0A A;  2XM1 A;  3OTO T;  1WCR A;  2NOX A;  2C5I T;  2VQE T;  3SFD A;  1HNZ T;  4ZZC A;  1FEW A;  1IZN B;  5AQK B;  3RRW A;  4MHC A;  2BKP A;  2FJD A;  2MYS A;  1D1C A;  2HH7 A;  3EDU A;  2BG9 B;  3AE6 A;  2QYW A;  3C4Z A;  3QNU A;  3H3A A;  4MFR A;  1XDO A;  2E5V A;  5JTG A;  3LDQ B;  1MIV A;  4Q25 A;  2VKJ A;  3L09 A;  2PBI A;  4C91 A;  4YTN A;  2Q9Q D;  3T1Y T;  5FY7 A;  3FXD B;  5F5W A;  5L3B B;  3PU3 A;  3AAE B;  3FXE B;  4JI5 T;  3RF1 A;  2E9X A;  5ABH A;  4H9P C;  1VOM A;  4CN4 A;  1KNZ A;  2BVL A;  5L4E A;  3OYX A;  4EZH A;  2UUB T;  3KVB A;  3HI2 A;  1QSD A;  3D0T A;  1UUR A;  3PUX F;  2D5U A;  3KV9 A;  3RYH E;  3KVA A;  5F8P A;  3MKD A;  4EV6 A;  3I9W A;  1SHZ C;  3P4P A;  4DBQ A;  1D0Z A;  2ZLY A;  3UFG A;  3AE9 A;  3P4S A;  5JDM A;  2XAQ B;  2HN2 A;  5HEG A;  5LHI B;  2QGS A;  2XZE A;  4U74 A;  2XAH B;  2XAJ B;  4OYK A;  5IYZ E;  1FMW A;  2NTY A;  1G8X A;  2JQ9 A;  4NUV A;  2I6H A;  5AQT B;  1LKX A;  2YDR A;  1MMA A;  3K3O A;  4H9N C;  4YSZ A;  2WAU A;  5FXX A;  3OYZ A;  1KNR A;  3JAF A;  2VK9 A;  3AA7 B;  3UUN A;  3HKD E;  2H7V C;  4ADZ A;  2V26 A;  4YSX A;  4CN6 A;  3UQ7 A;  3ZC0 A;  5LNK A;  2L8K A;  2CE7 A;  3ZMS B;  2FJB A;  3GN5 A;  3O4X E;  2LLY A;  4KX6 A;  2IUB A;  2XJ7 A;  2R6G F;  5EK3 A;  4TNV A;  3N9N A;  3A8Y C;  1YQ3 A;  3RIA A;  1YKE B;  5M4Y A;  3PUG A;  5LGT B;  3J7Y q;  2J62 A;  5IHY A;  3R6N A;  5FXW A;  1BR1 A;  3PJA J;  2A2F X;  3SFE A;  4UEM A;  2CCQ A;  2L9Q A;  2XQ9 A;  3CX7 B;  4HGA A;  2IW5 B;  1R8I A;  2Y6X A;  4A98 A;  2G0U A;  3AEF A;  2LEH A;  3RRC A;  3JCF A;  1MIY A;  5FKY A;  5ABE A;  1MND A;  3CX6 B;  2C5K T;  4U33 A;  3PUY F;  2XQ4 A;  3B57 A;  4LF5 T;  2B76 A;  4HFE A;  5KDM C;  4QH5 A;  4UVC B;  4QXH B;  1HS7 A;  2YDQ A;  1W0A A;  3JAE A;  2LSK A;  3VR9 A;  2ACX A;  3UQ4 A;  2EHO A;  1D1B A;  1IAP A;  5A1L A;  5FP3 A;  4MBQ A;  3ZEF B;  4B3S T;  5LG4 A;  3WAJ A;  3AVR A;  4ZS3 A;  5BMV E;  4ZI2 D;  5HAX A;  3CIR A;  3FZF B;  4FI5 A;  2NP9 A;  2LHN A;  5JR9 A;  5JDN A;  2W67 A;  3C98 B;  5AQP B;  1JNZ A;  3FZK B;  5JQG E;  2YU1 A;  4O2B E;  2YIN A;  2DL1 A;  4YJ3 E;  3IF8 B;  4X1I E;  4EGW A;  4DV0 T;  2BS4 A;  2Y48 B;  4X1Y E;  1WR0 A;  3ZPO A;  3TLW A;  2E8I A;  4EXT A;  1MIW A;  1HTJ F;  2C0S A;  4LML A;  5LHG B;  3DP7 A;  2NR4 A;  5FXZ A;  4BJM A;  2Q9Q A;  4EYU A;  2E9X D;  4U7I A;  2OA5 A;  3GMI A;  2KT9 A;  3QB5 K;  3PUV F;  2LT3 A;  2ZM0 A;  3FZH B;  3AA0 B;  2VB6 A;  4X66 T;  5AQJ B;  3LSV A;  2K48 A;  4JUY A;  2XQY A;  2LOP A;  3PE0 A;  3F31 A;  3N9O A;  4DND A;  2V6X A;  2W66 A;  3RIU A;  3F57 A;  4DV3 T;  4TWD A;  4AXP A;  4IDZ A;  4WNK A;  1YQ4 A;  4A56 A;  2KWH A;  3ANW B;  4NPP A;  4H9R C;  2BBJ A;  3Q5D A;  4ISS A;  2CWO A;  2XQ3 A;  4EEB A;  3HR0 A;  3NRY A;  2A3D A;  4ZZB A;  4DV5 T;  4DBR A;  4ASK A;  4TNW A;  3UUB A;  5FY0 A;  3RIF A;  3AE8 A;  2W2U A;  3RYF E;  4EYY R;  2WDR A;  2V5D A;  4UVA B;  5IUX A;  3IA3 A;  1S94 A;  2LSG A;  2DWK A;  2KWI B;  3LK4 2;  2XQ7 A;  3UU4 A;  4JEU B;  4O4H E;  3RYC E;  4PJJ A;  4JEH B;  4LF8 T;  1WR6 A;  3ZT7 A;  1XNQ T;  2HPL A;  2XUE A;  4ZOL E;  4WZX A;  4X65 T;  4AQF A;  3DJB A;  2D2S A;  2JQH A;  2WS3 A;  1UX5 A;  5AQR B;  4H9Q C;  4CI2 B;  1VCT A;  1Y64 B;  3MJX A;  4MAL A;  5FVL A;  2VVN A;  5AQH B;  4IE7 A;  2WCA A;  2JJ9 A;  3M65 A;  1KK7 A;  4YJ2 E;  2I0M A;  3FZM B;  2CXD A;  1NEK A;  4QH4 A;  4X62 T;  3CVR A;  2KMF A;  2CLY B;  4IDQ A;  5LYJ E;  3O1I A;  2JQK A;  3PUR A;  3P4Q A;  4H63 V;  2VKD A;  5LXT E;  5LBQ B;  1OED C;  3C64 A;  4TUY E;  2BKO A;  2BBH A;  3UU5 A;  4U7Y A;  3OKQ A;  4MLK A;  2W61 A;  4O2A E;  3RI5 A;  4AKI A;  5H6R B;  3SRZ A;  3ETU A;  2XY8 B;  3FBL A;  4XZC A;  2ODU A;  1UK5 A;  2NWB A;  1IJ6 A;  2ZM2 A;  3VR8 A;  3Q5W A;  5ETW A;  1I94 T;  4H9S E;  4UV8 B;  3JC6 C;  1ZV4 X;  3A7M A;  1WFD A;  3LBX B;  3LJC A;  1MNE A;  4QHO A;  4DV2 T;  2IDO B;  4KP3 C;  2WDQ A;  4TWH A;  1OED B;  4AKH A;  1X9B A;  2VL8 A;  2X51 A;  2XM2 A;  2VUR A;  2B1E A;  5HEO A;  2FBW A;  1L0V A;  4YHJ A;  1WLX A;  3L39 A;  2CXF A;  1QUU A;  3QK6 A;  2CEA A;  5LJN A;  3FBZ A;  2V8S V;  2BVM A;  3VRB A;  2RA1 A;  5CFB A;  4CI1 B;  1M7K A;  2RPA A;  4QX8 B;  1D0X A;  2WM9 A;  3PUQ A;  4AKL A;  4V1A v;  3NVO A;  4P0B A;  3EUH A;  2I59 A;  3E08 A;  2MPK A;  3KDS E;  2WZH A;  2VWA A;  5J2T E;  1HF8 A;  4JI3 T;  5AQV B;  4X5T A;  2LSI A;  4JI0 T;  2WDV A;  4YY3 T;  2LOS A;  4CXW A;  5AFU L;  4ZI3 C;  2X68 A;  4DR1 T;  4HFB A;  3KFW X;  2X66 A;  4HWD A;  2XQ6 A;  2CPT A;  2V6Y B;  1UGO A;  2DWG A;  3KIN B;  2XPK A;  4DR6 T;  4YTM A;  2K5B B;  5ABF B;  4HFV A;  3MA9 A;  1CHU A;  2CBJ A;  2C5J A;  1E2A A;  3TLV A;  4UF0 A;  2V7I A;  3AE4 A;  5AQF B;  4JI8 T;  1J5W A;  3R84 B;  4ERR A;  2M6B A;  3N2K E;  2CRB A;  1H7C A;  1X79 A;  5LBM A;  5AQG B;  2FUP A;  3IEE A;  4DR4 T;  3PUA A;  5L3F B;  4IST A;  3PUZ F;  1T98 A;  2V7J A;  2WSS V;  4TWF A;  4B6X A;  3VKG A;  4KHP T;  2VKO A;  2ZMA A;  1YXR A;  3LBX A;  5C3J A;  4LF7 T;  4QXC B;  5J1G A;  3VRA A;  4DO0 A;  4BAY B;  1T72 A;  3M3Z B;  1OXZ A;  3A5X A;  1HNW T;  3U3I A;  5L3C B;  4Z90 A;  2NTX A;  2WU5 A;  1MMD A;  4HN9 A;  4NXN T;  4OYJ A;  1KFY A;  5KX5 E;  4TZ4 C;  3AE3 A;  2CHO A;  3SWH A;  3PV0 F;  4IGU A;  4PFP A;  2ACZ A;  3BQK A;  3UUM A;  4L5G A;  3V5S A;  2BG9 A;  4JI2 T;  3EHZ A;  4I0U A;  2IIU A;  5KXJ A;  4U72 A;  1B7T A;  4IE5 A;  1KNP A;  5ADX L;  1V9D A;  4U31 A;  3CX8 B;  3ZYM A;  1LRZ A;  3AE1 A;  4IE6 A;  4F6R C;  3O9X A;  5LOV E;  2D9D A;  3Q2M A;  1VRB A;  2BDE A;  2X0Y A;  4F8H A;  2DLR A;  3WAK A;  3ONL C;  5LCY A;  1HX1 B;  1J5E T;  2LE8 A;  5FL0 A;  4PK4 A;  4GIW A;  3RQW A;  4AI6 A;  1T8B A;  5HWY A;  4LFA T;  4LFB T;  4HKA A;  2LM9 A;  2JMH A;  4N78 D;  2MOZ A;  3RPU A;  5H6Q B;  2V6Y A;  2E2A A;  3KV4 A;  3LK2 B;  1G73 A;  2YKS A;  2JPF A;  3N9L A;  2H7O A;  4CZZ B;  5JDQ A;  5JRE A;  1UX4 A;  2DNX A;  3T8O A;  2KIN B;  4CI3 B;  3AB3 B;  3P4W A;  3ZT5 A;  3C4W A;  4DV4 T;  3NKZ A;  3CKD A;  3PU8 A;  3ZCJ A;  4PAG A;  4IDP A;  4UXN B;  2NW7 A;  3QOF A;  5HXS A;  3BQL A;  2KSR A;  4DR7 T;  2YU2 A;  4O4J E;  1KEY A;  4YT0 A;  4DR3 T;  4PJN A;  4QX7 B;  3S4U A;  3ZSS A;  2QRX A;  5BR8 T;  1UUS A;  1EZ3 A;  4COF A;  1Z0P A;  4IE4 A;  4DV7 T;  3LG7 A;  3Q5X A;  3B13 A;  4LFC T;  1LVF A;  4JI6 T;  5LB7 B;  3SS1 A;  3KV6 A;  5FMN A;  4IDN A;  3ZN0 B;  4AKR B;  3P7I A;  2IHR 1;  5AQQ B;  3RKG A;  2WU2 A;  2MTQ A;  3G06 A;  3C4X A;  1Y01 A;  4TX5 A;  5HXR A;  3T1H T;  2WMO A;  1NEN A;  1N36 T;  3ZMU B;  3UT5 E;  4KUM B;  2H3R A;  3AA6 B;  2HHH T;  2CWY A;  2VKH A;  1WRD A;  3VU7 H;  5L3G B;  2X9X A;  3ZN1 B;  5E0O A;  4CN1 A;  3Q9D A;  3MAC A;  1US7 B;  4Z91 A;  2WY2 A;  5HCM A;  4YLH A;  4EB6 E;  5EK2 A;  4OHF A;  2A72 A;  4JYA T;  5LGN B;  4ZXL A;  4ZI2 C;  3CQX C;  1SUM B;  2LM2 A;  2YEV C;  1YD8 G;  4EOZ B;  4LF4 T;  4JV5 T;  2X0H A;  3HL6 A;  4QXB B;  1BR0 A;  3SOL A;  3N5L A;  1I6Z A;  3V5U A;  3RQU A;  2LKG A;  3OPC A;  4NXM T;  3AED A;  3ZST A;  3U78 A;  2UXB T;  4KI0 F;  4FJO A;  3H37 A;  5LMN T;  1D1A A;  2KLQ A;  2W62 A;  4HWI B;  2E5L T;  3PUW F;  2V7K A;  1D0Y A;  4IL9 A;  2XAF B;  5CJ5 A;  3CQC B;  2V5C A;  2JQQ A;  1HNX T;  4JBW F;  3UTK A;  2E9X C;  5DQW A;  2FJE A;  3X1D A;  5AQL B;  5HEU A;  2LHR A;  3N2G E;  4U2Y A;  1AJ3 A;  1QLB A;  3ZCI A;  3JC6 D;  4ILA A;  3PUS A;  2K3W A;  2XAS B;  2DCF A;  1UCU A;  5DQV A;  3IHR A;  2MAW A;  3HKE E;  4OX9 T;  2X67 A;  2FJA A;  4EAH A;  1E7P A;  4YFS A;  5LGU B;  5AQS B;  3ZJ1 A;  4OFZ A;  3AEE A;  4E7Z A;  1SE7 A;  3DTO A;  5HEH A;  4K0U A;  3UU8 A;  4DUY T;  1XWM A;  2J1D G;  4HE8 A;  3CK6 A;  4UV9 B;  4O4I E;  5L4H A;  3QUJ A;  4M1P A;  4X1K E;  5DJQ C;  1J1J A;  5C2T A;  2XQA A;  3OJA A;  3BK9 A;  1M62 A;  3FHN A;  4O8S A;  2WWV A;  1O3X A;  4U2Z A;  4H9O C;  4YTP A;  1CUN A;  3PJA A;  4IHJ E;  4L9I A;  4HEA A;  1XMO T;  3KBU A;  4ILB A;  4H63 H;  3ZYK A;  2XQ5 A;  4PFO A;  2BG9 E;  5FY1 A;  4P09 A;  2KND A;  4EED A;  3ANW A;  3ZYL A;  2HN1 A;  3EDV A;  4Z8X A;  3KV5 A;  3QB5 A;  3AAI A;  4ILC A;  4IE0 A;  5HWX A;  2JMK A;  4HWH A;  4B3R T;  2CMR A;  2J47 A;  4CQI A;  2UXX B;  5LMU T;  3H3M A;  4A5X A;  1VCS A;  4CXY A;  1FJG T;  3UUX B;  4IT4 A;  3J9X 1;  5HCJ A;  3GWH A;  2UXN B;  4GOU A;  2LJL A;  3N2O A;  5JVD E;  3GN5 B;  2SPC A;  2WQY A;  2V7L A;  4HFI A;  3K8P C;  4ZS2 A;  2WP9 A;  5CGM A;  3E22 E;  4OK0 A;  2XQ8 A;  2BKN A;  4IL4 A;  2H89 A;  5GON E;  2IAK A;  3I1A A;  5LHH B;  3ABV A;  2BS3 A;  3ZMV B;  4EIW A;  2UU9 T;  3AE5 A;  3N9M A;  2EHO C;  4AIU A;  4YXD A;  2IC6 A;  2VQF T;  4I43 B;  5TAO A;  5HXH A;  1Z8U A;  3VHL A;  3AXJ B;  2IC9 A;  2QVA A;  2LKH A;  4E7S A;  4C90 A;  5JR9 C;  5F3J A;  1JNR A;  4ZI7 E;  4DMV A;  5AQM B;  2JIW A;  5FXV A;  3P8C D;  5AQI B;  5FVK A;  3AAA B;  4IRE A;  2VVS A;  2D0T A;  4WW0 A;  3Q5E A;  4AQY T;  3VKH A;  1GQE A;  4EZ4 A;  4BA9 A;  1ZEE A;  1FIO A;  4PJL A;  3UU3 A;  5AQU B;  3L3P A;  2UUA T;  2BS2 A;  4TN7 B;  1XZY A;  5ABG A;  1N33 T;  2EHO B;  4O4L E;  2CA5 A;  3GA8 A;  3AE2 A;  1T7S A;  4JI7 T;  4DV1 T;  3NZQ A;  5FYM A;  3EI0 A;  4JI4 T;  1OED A;  1BR4 A;  3MK7 C;  2UXD T;  5JR9 B;  2Q9Q C;  1DU2 A;  3ONJ A;  3N9Q A;  2XAG B;  3ZLI A;  4ZEY A;  3ONX A;  5KMG P;  3QC9 A;  4GYR A;  3UU6 A;  1MMN A;  5JRC B;  3O1J A;  3RGL A;  3RX6 A;  3TKL B;  5JH7 E;  3NRX A;  2W4X A;  1W09 A;  4KHZ F;  5CB4 E;  2QA7 A;  1HG2 A;  3NBX X;  4IDO A;  3P4R A;  4AQG A;  3RIU C;  1XDP A;  4HFC A;  1WYB A;  2Q9Q B;  1SA0 E;  2KXP B;  4LF6 T;  1HR0 T;  1U5P A;  4XAX B;  2WMN A;  5FL1 A;  4GYS A;  4JLE A;  3CPZ A;  1WYC A;  4X64 T;  4L0R A;  1E1H B;  2UUC T;  5L47 A;  4QKN A;  4U3C A;  4QWN B;  2F4V T;  2M67 A;  3RH3 A;  3AEG A;  4TV9 E;  2WBL A;  4DV6 T;  3AE7 A;  4ILU A;  5HYA A;  5CA0 E;  4NUU A;  5DAB A;  5ABF A;  3FB2 A;  3AXJ A;  3I0Q A;  5HXC A;  3I0O A;  2LSJ A;  4YHH T;  3L8R A;  2DHR A;  3I9Y A;  3JAD A;  2D0U A;  2RP4 A;  3PTR B;  4AQF C;  4GKK T;  3IBP A;  4AIS A;  3OVU A;  4KBM B;  3TLU A;  1BR2 A;  5EZY E;  3EVY A;  3RC3 A;  2XSB A;  2CXL A;  4WYV A;  3ZT6 A;  5JDG A;  5CA1 E;  3ZKR A;  2AE9 A;  2WZI A;  4J2C A;  4NIQ A;  4TV8 E;  4DR2 T;  2YOE A;  2WWU A;  2NW9 A;  3AEA A;  5LJM A;  1YW0 A;  3RKO A;  5LG3 A;  3F2E A;  2HPJ A;  2LRL A;  3LK3 B;  4ZHQ E;  3WI3 A;  3B5M A;  1N32 T;  4XBF B;  4ANJ A;  5L3E B;  2OV9 A;  3EAB A;  2ZM6 T;  4WBN E;  4AKG A;  3CML A;  1MMG A;  1W9R A;  2V7M A;  3C50 A;  3C51 A;  4PK5 A;  2ODV A;  4K0K T;  5J0Z A;  2V1D B;  2L3L A;  2YN6 A;  5JRC A;  1ZOY A;  2PTF A;  4DR5 T;  1W0B A;  3ZC1 A;  3N9P A;  4IIJ E;  4HFD A;  5JDF A;  1U4Q A;  5L3D B;  3E0Z A;  2CBI A;  2LRK A;  4UR9 A;  4DVD A;  2PFV A;  4YSY A;  2XSA A;  3AVS A;  1XNR T;  2MBG A;  3PDY A;  4I55 E;  4BJN A;  5LP6 E;  1IBL T;  5JDL A;  3HKC E;  3OBV E;  4LMJ A;  4PW8 A;  4P1N A;  4PK6 A;  2UXC T;  2VL0 A;  4HTE A;  4GK5 E;  3K3N A;  4G63 A;  4HFH A;  1N34 T;  5JDH A;  2N2N A;  1IBM T;  4I50 E;  5FNV E;  3CWZ B;  1LVK A;  4HWC A;  3ZJ2 A;  4UIG A;  5L2L A;  2Y8D A;  1IJ5 A;  4DMW A;  1XMQ T;  4UVB B;  5AQN B;  2J4G A;  5HXE A;  2K24 A;  4CXX A;  2PG8 A;  4A97 A;  2AXD S;  1HCI A;  2H88 A;  2KZ7 B;  4WBO A;  4KMC A;  3RLF F;  2WB5 A;  1FMV A;  2P9B A;  3RHW A;  3ZMT B;  2X9W A;  4PNI A;  3ETV A;  1ZKE A;  2DI4 A;  3RC8 A;  3AEC A;  4X20 E;  5LA6 E;  3HA4 A;  2CLY C;  5HEJ A;  2NW8 A;  4JI1 T;  3P50 A;  4LF9 T;  3ESL A;  2X9Y A;  2VAS A;  5J2U E;  4G2A A;  2M6I A;  2A9U A;  1ZP0 A;  1IBK T;  3BQI A;  3MZK B;  5IWA T;  2BZB A;  2ES0 A;  2PJQ A;  3KBT A;  4GKJ T;  2W00 A;  3K1S A;  3AEB A;  2X0L B;  3UFE A;  2YK0 A;  3AA1 B;  3LFM A;  2YDS A;  2E9X B;  2CM0 A;  3O1H A;  5EK4 A;  5AQO B;  3ZMZ B;  2X9H A;  1KF6 A;  4I4T E;  2XHE B;  3HKB E;  4QH1 A;  2K9A A;  1OED E;  2XTL A;  4PJM A; 
#chains in the Genus database with same CATH homology
 5HWY A;  2IC9 A;  4HKA A;  4UEL A;  2LM9 A;  2JMH A;  4E7S A;  4UF0 B;  2ZM8 A;  2K48 A;  1S35 A;  4C90 A;  4N78 D;  5JR9 C;  4JUY A;  2MOZ A;  3RPU A;  2XQY A;  3K3Q C;  2LOP A;  5H6Q B;  5F3J A;  4ZI7 E;  4DMV A;  3PE0 A;  1ZHC A;  3F31 A;  2N1G A;  3KV4 A;  3LK2 B;  5FXV A;  3P8C D;  1HX8 A;  1G73 A;  3AAA B;  1NWM X;  1OWA A;  3N9O A;  4DND A;  2JPF A;  2D0T A;  4WW0 A;  3N9L A;  3VKH A;  4EZ4 A;  3F57 A;  2H7O A;  4BA9 A;  2N9D A;  1ZEE A;  1FIO A;  2LSY A;  4PJL A;  4CZZ B;  5JDQ A;  4ZI3 D;  5JRE A;  1UX4 A;  3L3P A;  2DNX A;  3MXZ A;  4AXP A;  3T8O A;  2KIN B;  4IDZ A;  5C8Y E;  2W0G A;  4CI3 B;  3AB3 B;  4TN7 B;  4WNK A;  2GK9 A;  2EHO B;  4A56 A;  4O4L E;  2JRK A;  2KWH A;  3ANW B;  1YKH B;  2CA5 A;  2EHO D;  3GA8 A;  3C4W A;  1NAF A;  1HFA A;  3CKD A;  3PU8 A;  4H9R C;  3ZCJ A;  4PAG A;  4UXN B;  3W15 B;  2NW7 A;  4ISS A;  1HG5 A;  2CWO A;  3NZQ A;  5HXS A;  3BQL A;  5FYM A;  3HR0 A;  3NRY A;  2A3D A;  4GK0 E;  2YU2 A;  4O4J E;  2W63 A;  1BR4 A;  3MK7 C;  3NZP A;  3UUL A;  4DBR A;  2Z6E A;  5JR9 B;  4ASK A;  2Q9Q C;  5FY0 A;  3RYI E;  3RYF E;  4EYY R;  4PJN A;  4QX7 B;  3CQG B;  3N9Q A;  3S4U A;  2XAG B;  4UVA B;  3ZLI A;  4P0A A;  1S94 A;  2LSG A;  2DWK A;  2KWI B;  3ONX A;  3LK4 2;  5KMG P;  1EZ3 A;  2NOX A;  3QC9 A;  4GYR A;  2C5I T;  4JEU B;  4O4H E;  1Z0P A;  1MMN A;  5JRC B;  4IE4 A;  3RYC E;  1FEW A;  1IZN B;  3LG7 A;  3Q5X A;  3B13 A;  3O1J A;  4PJJ A;  3RX6 A;  1LVF A;  3RRW A;  3TKL B;  5JH7 E;  4JEH B;  4MHC A;  3SS1 A;  3KV6 A;  5FMN A;  1WR6 A;  3NRX A;  2HPL A;  2XUE A;  4ZOL E;  2MYS A;  1D1C A;  2HH7 A;  3EDU A;  4AQF A;  3DJB A;  3ZN0 B;  4AKR B;  2D2S A;  1UX5 A;  3C4Z A;  3P7I A;  5CB4 E;  4H9Q C;  2QA7 A;  4CI2 B;  3H3A A;  1Y64 B;  1HG2 A;  3NBX X;  4MFR A;  3MJX A;  4MAL A;  4AQG A;  2MTQ A;  1MIV A;  1WYB A;  2Q9Q B;  3C4X A;  1SA0 E;  2VKJ A;  2KXP B;  3L09 A;  2PBI A;  4IE7 A;  4TX5 A;  4C91 A;  2JJ9 A;  2Q9Q D;  1U5P A;  3M65 A;  4XAX B;  5HXR A;  1KK7 A;  4YJ2 E;  2CXD A;  2WMN A;  4GYS A;  5FY7 A;  4JLE A;  3CVR A;  3FXD B;  2WMO A;  2KMF A;  3CPZ A;  2CLY B;  1WYC A;  3O1I A;  3ZMU B;  5LYJ E;  3UT5 E;  3PUR A;  5L3B B;  4L0R A;  1E1H B;  3PU3 A;  4H63 V;  3AAE B;  3FXE B;  4KUM B;  2VKD A;  2E9X A;  5LXT E;  4QKN A;  2H3R A;  4H9P C;  1VOM A;  4QWN B;  5LBQ B;  3AA6 B;  2M67 A;  3RH3 A;  2CWY A;  2VKH A;  1WRD A;  4TV9 E;  3VU7 H;  1KNZ A;  2BVL A;  3C64 A;  4TUY E;  2WBL A;  5L3G B;  3OYX A;  2X9X A;  3OKQ A;  3ZN1 B;  4EZH A;  4MLK A;  2W61 A;  3KVB A;  3Q9D A;  5E0O A;  3HI2 A;  3MAC A;  1QSD A;  1US7 B;  3D0T A;  4O2A E;  2D5U A;  4ILU A;  3KV9 A;  5HYA A;  3RYH E;  5CA0 E;  4AKI A;  5H6R B;  3KVA A;  4NUU A;  4YLH A;  4EB6 E;  5EK2 A;  3SRZ A;  3ETU A;  4OHF A;  5DAB A;  2A72 A;  5LGN B;  3FB2 A;  5F8P A;  4ZI2 C;  3CQX C;  3FBL A;  3MKD A;  4XZC A;  3I0Q A;  2ODU A;  3I9W A;  5HXC A;  1SHZ C;  2NWB A;  3I0O A;  1IJ6 A;  4DBQ A;  2ZM2 A;  3Q5W A;  2LSJ A;  1D0Z A;  5ETW A;  2YEV C;  1YD8 G;  2ZLY A;  4H9S E;  2DHR A;  3I9Y A;  1ZV4 X;  3JC6 C;  4UV8 B;  4EOZ B;  2D0U A;  2RP4 A;  3PTR B;  5JDM A;  3LBX B;  2XAQ B;  4AQF C;  3HL6 A;  4QXB B;  3LJC A;  1BR0 A;  1MNE A;  5LHI B;  3SOL A;  3N5L A;  4QHO A;  2QGS A;  3V5U A;  3IBP A;  4KP3 C;  4U74 A;  4KBM B;  2XAH B;  4AKH A;  2VL8 A;  2XAJ B;  1BR2 A;  5EZY E;  3EVY A;  4OYK A;  3RC3 A;  2X51 A;  5IYZ E;  3U78 A;  1FMW A;  2NTY A;  1G8X A;  2CXL A;  4NUV A;  2B1E A;  1LKX A;  4FJO A;  3H37 A;  1D1A A;  2KLQ A;  5JDG A;  2W62 A;  5CA1 E;  4J2C A;  1MMA A;  2V7K A;  1D0Y A;  3K3O A;  4H9N C;  4TV8 E;  4YHJ A;  2XAF B;  1WLX A;  3CQC B;  2WWU A;  2CXF A;  1QUU A;  2WAU A;  3QK6 A;  2CEA A;  2NW9 A;  5LJN A;  3FBZ A;  2JQQ A;  5LJM A;  1YW0 A;  5FXX A;  3RKO A;  2BVM A;  3UTK A;  3OYZ A;  2E9X C;  5DQW A;  3F2E A;  2VK9 A;  2RA1 A;  2HPJ A;  3AA7 B;  3LK3 B;  4CI1 B;  3UUN A;  4ZHQ E;  2LHR A;  3WI3 A;  4QX8 B;  4XBF B;  3N2G E;  4ANJ A;  5L3E B;  1AJ3 A;  4WBN E;  1D0X A;  3ZCI A;  3JC6 D;  2WM9 A;  4AKG A;  3PUQ A;  4AKL A;  3HKD E;  3PUS A;  3CML A;  4V1A v;  1MMG A;  2H7V C;  2XAS B;  2DCF A;  4ADZ A;  2V7M A;  2V26 A;  3C50 A;  3ZC0 A;  3C51 A;  4PK5 A;  2ODV A;  1UCU A;  5LNK A;  2L8K A;  2CE7 A;  4P0B A;  5DQV A;  3ZMS B;  3EUH A;  2V1D B;  2I59 A;  3E08 A;  2L3L A;  5JRC A;  3IHR A;  3GN5 A;  3KDS E;  3O4X E;  3HKE E;  2VWA A;  2X67 A;  5J2T E;  1HF8 A;  4EAH A;  3ZC1 A;  5EK3 A;  4YFS A;  3N9N A;  5LGU B;  3N9P A;  4IIJ E;  3ZJ1 A;  4OFZ A;  5JDF A;  2LSI A;  1U4Q A;  4E7Z A;  5L3D B;  3E0Z A;  3DTO A;  1YKE B;  4K0U A;  5M4Y A;  3PUG A;  2PFV A;  4DVD A;  2LOS A;  5LGT B;  3J7Y q;  3AVS A;  4CXW A;  5AFU L;  4ZI3 C;  2X68 A;  2MBG A;  3PDY A;  4I55 E;  5IHY A;  3R6N A;  5FXW A;  1BR1 A;  2J1D G;  4HE8 A;  2A2F X;  3KFW X;  2X66 A;  4UV9 B;  4BJN A;  5LP6 E;  4O4I E;  4UEM A;  2CCQ A;  5JDL A;  2L9Q A;  3HKC E;  3OBV E;  2DWG A;  3QUJ A;  3CX7 B;  3KIN B;  4HGA A;  2IW5 B;  4PW8 A;  2Y6X A;  4M1P A;  2G0U A;  4X1K E;  2LEH A;  5DJQ C;  4PK6 A;  3RRC A;  2K5B B;  1MIY A;  4HTE A;  4GK5 E;  3OJA A;  3BK9 A;  4HFV A;  3K3N A;  3MA9 A;  2C5J A;  1MND A;  3FHN A;  4O8S A;  3CX6 B;  4G63 A;  4UF0 A;  2C5K T;  2V7I A;  1O3X A;  4H9O C;  3R84 B;  1CUN A;  4ERR A;  3B57 A;  5JDH A;  3N2K E;  4IHJ E;  2N2N A;  4L9I A;  5KDM C;  4HEA A;  4UVC B;  4I50 E;  5FNV E;  3CWZ B;  1H7C A;  1LVK A;  3ZJ2 A;  1X79 A;  4QXH B;  3KBU A;  1HS7 A;  5LBM A;  4UIG A;  4H63 H;  3ZYK A;  3IEE A;  5L2L A;  3PUA A;  5L3F B;  4PFO A;  2LSK A;  2Y8D A;  4IST A;  1T98 A;  1IJ5 A;  2ACX A;  2EHO A;  2V7J A;  2WSS V;  1D1B A;  1IAP A;  2KND A;  4P09 A;  5FY1 A;  4B6X A;  4DMW A;  3VKG A;  3ANW A;  5A1L A;  4UVB B;  3ZYL A;  2VKO A;  2ZMA A;  5FP3 A;  3LBX A;  3EDV A;  4MBQ A;  3ZEF B;  5HXE A;  4QXC B;  4Z8X A;  3KV5 A;  2K24 A;  5J1G A;  5LG4 A;  4CXX A;  2PG8 A;  3AAI A;  4DO0 A;  4IE0 A;  3WAJ A;  3AVR A;  5HWX A;  2JMK A;  4BAY B;  1HCI A;  4ZS3 A;  2CMR A;  2KZ7 B;  1OXZ A;  5BMV E;  3A5X A;  4WBO A;  4ZI2 D;  5HAX A;  4KMC A;  4CQI A;  2UXX B;  4FI5 A;  2NP9 A;  2LHN A;  3U3I A;  5L3C B;  2NTX A;  5JR9 A;  1FMV A;  2P9B A;  3ZMT B;  5JDN A;  2X9W A;  4PNI A;  3ETV A;  4CXY A;  1ZKE A;  2DI4 A;  1MMD A;  3C98 B;  3RC8 A;  4HN9 A;  4OYJ A;  3UUX B;  4X20 E;  5LA6 E;  5KX5 E;  3HA4 A;  2CLY C;  3J9X 1;  4TZ4 C;  2NW8 A;  5JQG E;  3GWH A;  2UXN B;  4GOU A;  2LJL A;  2YU1 A;  3N2O A;  3GN5 B;  2SPC A;  5JVD E;  4O2B E;  2YIN A;  2V7L A;  3ESL A;  3K8P C;  4ZS2 A;  2X9Y A;  4YJ3 E;  3IF8 B;  3SWH A;  2VAS A;  5J2U E;  4G2A A;  3E22 E;  4IGU A;  4PFP A;  3BQK A;  4X1I E;  3UUM A;  4OK0 A;  4L5G A;  3BQI A;  3MZK B;  2Y48 B;  4X1Y E;  2BZB A;  3ZPO A;  3V5S A;  2ES0 A;  2PJQ A;  3KBT A;  2W00 A;  2E8I A;  4EXT A;  1MIW A;  1HTJ F;  2X0L B;  1B7T A;  4IE5 A;  4U72 A;  2C0S A;  1V9D A;  2YK0 A;  3AA1 B;  3LFM A;  3UFE A;  3CX8 B;  5ADX L;  5LHG B;  3DP7 A;  3ZYM A;  1LRZ A;  5GON E;  4IE6 A;  4F6R C;  3O9X A;  2E9X B;  2IAK A;  5LOV E;  5FXZ A;  2CM0 A;  3I1A A;  4BJM A;  5LHH B;  3O1H A;  3Q2M A;  2Q9Q A;  4EYU A;  1VRB A;  2BDE A;  2E9X D;  3VHL A;  5EK4 A;  2OA5 A;  3GMI A;  2DLR A;  3WAK A;  5LCY A;  3ZMV B;  3ZMZ B;  2X9H A;  4EIW A;  2KT9 A;  3N9M A;  2EHO C;  2LT3 A;  4I4T E;  2LE8 A;  2ZM0 A;  2XHE B;  3HKB E;  2IC6 A;  2K9A A;  4PK4 A;  3AA0 B;  4GIW A;  4AI6 A;  2XTL A;  4I43 B;  5TAO A;  5HXH A;  4PJM A;  2VB6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...