2Q9QD

The crystal structure of full length human gins complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
192
structure length
186
Chain Sequence
SEAYFRVESGALGPEENFLSLDDILMSHEKLPVRTETAMPRLGAFFAETDNAVPQGSKLELPLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFGSQLLHFDSPENADISQSLLQTFIGRFRRIMDSSQNAYNEDTSALVARLDEMERGLFQTGQKGLNDFQCWEKGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA replication complex GINS protein PSF2
publication title Crystal structure of the GINS complex and functional insights into its role in DNA replication.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
total genus 55
structure length 186
sequence length 192
chains with identical sequence H
ec nomenclature
pdb deposition date 2007-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF05916 Sld5 GINS complex protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2050 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2q9qD00
2Q9QD 3ANWB 2EHOD 2E9XC 3JC6C
chains in the Genus database with same CATH superfamily
3PUZF 3C98B 4TZ4C 4NUVA 2HHHT 3AEGA 4LFCT 3RX6A 4HN9A 4KBMB 2J47A 2KWIB 1OXZA 3K8PC 1D1BA 2W00A 4UF0A 4AISA 1JNRA 2C0SA 4IDPA 3F57A 3CX7B 2BS3A 2ES0A 4LF8T 4O4HE 5CB4E 2W63A 4EZHA 1NEKA 1N36T 5LHGB 1M62A 3CQCB 4L0RA 4U7IA 5EK4A 5JDFA 3PUVF 2MPKA 4UV9B 4PNIA 4TWHA 4I0UA 4L9IA 1T7SA 3FXDB 2QYWA 4X62T 4LF9T 3AVRA 5LJMA 4UIGA 4QX8B 2GK9A 4H9RC 5L47A 2XM2A 1FMVA 4HGAA 1UX5A 3M65A 3C64A 3VU7H 3K3NA 2BBJA 3Q5XA 4DV0T 4IIJE 1FMWA 1YW0A 4PFPA 2LSGA 5HYAA 3CQGB 2VASA 4KUMB 4HFDA 2LJLA 2XAQB 3AAIA 3FHNA 3O4XE 3P8CD 4B3TT 2JMKA 3A5XA 3SRZA 1VRBA 5JDQA 5LYJE 1H7CA 3R84B 2LEHA 3M3ZB 4ZI2D 1SA0E 5FNVE 3VRAA 2WP9A 4CXYA 4JUYA 3L8RA 2ZLYA 2YINA 4JYAT 5LG3A 2UXNB 5JDLA 2JIWA 3UQ7A 1MIVA 1HS7A 1YQ3A 5FVKA 3IHRA 2PTFA 2W4XA 2V7JA 3RPUA 2W0GA 2XQAA 4IGUA 5HEOA 1D1AA 4DR7T 5JR9B 4IT4A 1T98A 5JR9C 3BQIA 3Q5EA 4O2BE 3ANWA 2E5LT 1Z8UA 1YKHB 5ABEA 3H3AA 2LM2A 2WCAA 1XNRT 3DTOA 4YT0A 2N1GA 1YKEB 1WR6A 4IE5A 4LMLA 4TX5A 5LGNB 3KV4A 3NWIA 2XQ9A 3Q5WA 3R6NA 3UU8A 3JC6C 3OYZA 5FKYA 2A2FX 3RC8A 2NW9A 1BR1A 4YTNA 2HN2A 2VQFT 2V8SV 4AQGA 3N5LA 4HFEA 2IAKA 3GN5B 2XQ7A 4QH5A 3SWHA 3FZHB 1U4QA 4IE6A 4DO0A 3ZMUB 3N9LA 3PTRB 1HTJF 4QKNA 3EUHA 2Z6EA 5FXXA 3WAJA 1AJ3A 3FZFB 3PV0F 4UR9A 2OLTA 2HPJA 4HFCA 4DBRA 2IDOB 5FL0A 2X9WA 1SUMB 3HKCE 4M1PA 4B6XA 2F4VT 2WMOA 4B3MT 5LG4A 4UVBB 4QXBB 2JQHA 3RQWA 5LOVE 4BJMA 3MXZA 4TNWA 3VR8A 3PJAJ 3RGLA 3P7IA 4FJOA 4HE8A 2DWKA 3RQUA 3ETVA 3ZLIA 4IL9A 4JI2T 4ISSA 3SFDA 4DR3T 4HFHA 2A9UA 2XZEA 4EYYR 3PUAA 2CHNA 1SHZC 1HNXT 2XQ8A 2WWVA 2W2UA 5LA6E 1US7B 4LF4T 1N33T 3HKDE 2Q9QD 4NXMT 3AEFA 4QH1A 4JEHB 2FJBA 1KEYA 5AQOB 2WS3A 4I55E 2MOZA 3N9MA 4EYUA 4YJ2E 3NBXX 3AE4A 4IREA 2W62A 2WQYA 3FB2A 3CX6B 2LSIA 2LLYA 2DL1A 2VK9A 4CXXA 5JRCB 5FY7A 4ZI7E 4ISTA 1HCIA 5AQIB 1UCUA 5AQSB 4ZZBA 2E2AA 4LFAT 4G2AA 1BR4A 1YQ4A 4GIWA 4HFBA 5L3CB 1ZOYA 4WYVA 2V6XA 4HWDA 3KVAA 1ZP0A 3TKLB 2XQYA 3FBZA 4DMWA 1J1JA 2EHOD 3PUYF 3QB5A 4TN7B 3TLSA 2VKJA 4ZS2A 3PDYA 2KZ7B 2Y8DA 3UU6A 4IL4A 4ZI2C 4YFSA 3RIUC 4ASKA 1ZHCA 2IC9A 2XY8B 5HWXA 4IHJE 2B76A 2KXPB 1FJGT 5HCMA 2J62A 5AQTB 4YTMA 5AQPB 2LHNA 4ANJA 3ZKRA 3N9OA 1G73A 2UUAT 1WYBA 1ZV4X 3C4XA 4ZZCA 4HKAA 2WAUA 3P4PA 2MTQA 3RI5A 3UQ4A 3JAEA 2XSAA 5L3GB 5F8PA 3EVYA 4EAHA 3LBXA 1D0ZA 3LJCA 4P0AA 2V6YA 2V5DA 3KBTA 4CXWA 1B7TA 2I0MA 2ZM2A 3HKEE 4JI8T 2LHRA 5E0OA 4JI3T 5J2UE 4AIUA 1YD8G 1WFDA 2LOPA 3HL6A 2NW7A 2CCQA 4X20E 5A1LA 1OEDB 2PFVA 1OEDC 3ZMZB 2HPLA 2X0YA 5IWAT 4U3CA 1W0BA 5DQWA 4K0KT 3K3QC 3V5UA 5IYZE 2WDRA 3IEEA 2YU1A 3SS1A 3OTOT 2YOEA 3F31A 2OV9A 1IBMT 2WM9A 4NUUA 4X1KE 3RRCA 3OVUA 3ZT7A 2VL8A 5ETWA 1UURA 3UFGA 2CXDA 3UUMA 4IE4A 4X66T 2VVNA 3ETUA 4DMVA 3AE1A 2PJQA 3I1AA 2QA7A 3UUXB 4C91A 2DLRA 4COFA 2UUBT 3ZMVB 2ODVA 1ZEEA 4X1IE 5EK2A 4CI3B 3H3MA 3CPZA 5CA1E 1E7PA 5BMVE 5LGTB 3KV9A 1ZKEA 4A56A 1S35A 4KHPT 2K3WA 3TLVA 4DR6T 1L0VA 2JMHA 2JJ9A 3N9NA 3J7Yq 4H9SE 5AQJB 4F8HA 1XWMA 2YN6A 5C2TA 2KINB 2IW5B 3AE5A 2NR4A 2Q9QB 3AE9A 2Q9QC 5AQUB 1I6ZA 1U5PA 3G06A 2XQ5A 2HN1A 1J5WA 3MACA 4JLEA 3PJAA 3O1IA 4V1Av 5LHIB 2D2SA 2X9HA 3N9QA 4IDQA 2D0UA 2VL0A 5ABHA 5LHHB 2BG9B 4PK6A 2YDSA 2BG9C 4MLKA 4ADZA 3RKGA 1KFYA 1MMAA 2ZM0A 4UELA 4DVDA 2WB5A 1MNEA 3EABA 1UK5A 4UEMA 3UULA 3AXJB 5LMNT 2UXCT 3NRXA 2L9QA 4ILUA 1KNRA 4JEUB 2M6IA 4O4JE 3ZMTB 4P09A 4AKRB 1CHUA 5J0ZA 3WI3A 4JI1T 1LRZA 5DQVA 1KNPA 3JADA 3SOLA 3X1DA 2EHOB 2PBIA 3RC3A 2EHOC 1M7KA 2MAWA 2BKNA 4IDNA 4CI1B 4H9NC 4U72A 2WDVA 3LK3B 2CWYA 2YK0A 5KXJA 2BVMA 1XMQT 2RPAA 3UUNA 5KDMC 3B13A 5AQQB 2IIUA 5IUXA 3GA8A 3CQXC 5LP6E 3UT5E 2LT3A 3HKBE 4H9OC 4QWNB 1HG5A 1E1HB 4G63A 4DR5T 4P1NA 4TNVA 1QSDA 1NENA 4XZCA 5AQVB 2FJEA 5JR9A 5M4YA 3UTKA 3Q5DA 2YKSA 3NVOA 5FY1A 3AE3A 4WW0A 1OEDE 3ESLA 4HWCA 1WLXA 2PG8A 4JI6T 2BKOA 3UUBA 2NTXA 3ZJ1A 2OA5A 4ILAA 5L3FB 3RHWA 5FVLA 1HF8A 2E9XB 2X0LB 2UU9T 4DV6T 2E9XC 1YXRA 3AB3B 4O2AE 4TV8E 4ILBA 4ZI3C 4DR2T 2WSSV 4PJJA 2CBIA 3C4WA 2XASB 5LBQB 5LXTE 2VVSA 4F6RC 3CWZB 3GN5A 4IDOA 5HEJA 1LVKA 1MIWA 4B3ST 4J2CA 4EIWA 3VKGA 2WMNA 1VCTA 3P50A 4GK5E 3S4UA 4CI2B 4MHCA 2WU5A 3BQKA 5HEGA 2NP9A 1WYCA 3W15B 3ZMSB 5FL1A 2KSRA 4A98A 5KX5E 4B3RT 3AAAB 1GQEA 1WCRA 5ADXL 4EGWA 1LVFA 5JQGE 2VB6A 1XZYA 4U7YA 2H88A 2CHOA 2CWOA 3CKDA 2I6HA 1BR2A 3ZCIA 3O1HA 3UFEA 4U2ZA 2UUCT 2J1DG 5HEUA 4DV1T 1UGOA 3EDVA 5CGMA 2UXDT 1IAPA 2XQ4A 3RKOA 4GKJT 1W0AA 4QHOA 4YHJA 2DNXA 2FJAA 4PFOA 1OWAA 2SPCA 3O9XA 5LGUB 4NIQA 4EEBA 3AEEA 2BZBA 4HFVA 4DBQA 4OYJA 2ODUA 2YEVC 3LDQB 2CPTA 2XPKA 2CBJA 2RP4A 5ABFB 4KI0F 3P4RA 3NZPA 4JV5T 5F5WA 2W61A 2CEAA 4OK0A 3TLUA 3VKHA 4WNKA 4DV2T 5JDNA 4AI6A 3H37A 5JRCA 5AQKB 2N2NA 4O8SA 4YSZA 3QUJA 1HG2A 2IHR1 3AVSA 1QLBA 4HFIA 3C4ZA 1KK7A 3EDUA 3HA4A 2XQ3A 1G8XA 2A72A 2CA5A 3KV6A 2YDQA 3ZC1A 2LM9A 4I43B 5HXEA 4AKHA 2LKHA 1Z0PA 2WZIA 2JQ9A 2RA1A 4U74A 3MKDA 2L3LA 1IBKT 2L8KA 2BBHA 2LRKA 2K5BB 3ONXA 3JC6D 4PAGA 3ZC0A 5LCYA 4AQFC 1QUUA 2BVLA 2UXXB 2CRBA 5F3JA 2BDEA 3RIUA 5AQRB 1T72A 5HXHA 3ZSSA 4L5GA 2VKHA 4JI4T 2NWBA 4TWDA 2I59A 5LNKA 2KT9A 1HFAA 3KFWX 3V5SA 1I94T 3PU3A 1D1CA 1R8IA 2R6GF 5JREA 4UF0B 2V26A 4KMCA 3B57A 3BQLA 4X64T 3PU8A 4H63V 4YXDA 1O3XA 5HXSA 3EAMA 2FJDA 1XDPA 2K24A 1Y01A 2NOXA 3KDSE 3PUXF 2QRXA 4HTEA 2WWUA 3N2KE 1VOMA 4IDZA 2IMLA 3FXEB 1N32T 3ZT6A 5EK3A 4DR4T 3LG7A 4GYSA 3E22E 2XAJB 5IHYA 2UXBT 4QXCB 1XMOT 1EZ3A 1OEDA 2VKDA 4EXTA 2JQQA 4YSXA 1JNZA 4I4TE 2XQ6A 2VWAA 4N78D 5L4HA 4WBNE 2H7VC 3MA9A 2E8IA 5C3JA 3AEBA 2LRLA 5ABGA 3ZN0B 4PJMA 1HR0T 4U31A 3I0QA 3AECA 3E0ZA 3Q9DA 1UUSA 4BA9A 3OPCA 2K48A 2C5JA 3ZPOA 5JVDE 2XAGB 2NW8A 3AA7B 3MK7C 3FZLB 2XM1A 1KNZA 2X68A 5J1GA 5FMNA 4X1YE 3AEAA 1W9RA 1IZNB 3C50A 4CQIA 4BJNA 4GK0E 1VCSA 3FBLA 4XBFB 4MFRA 4ZOLE 4QH4A 1LKXA 3RF1A 3TLTA 2WU2A 2C5KT 3AE2A 1WR0A 3ZEFB 4PK4A 1FEWA 3K3OA 2BKPA 2LE8A 2W67A 5L4EA 3D0TA 2XUEA 4ZXLA 4IE0A 3OYXA 3EI0A 1UX4A 4OYKA 4O4LE 3I9WA 4LMJA 4OX9T 2X9XA 5C8YE 2H3RA 2B1EA 4QXHB 3VHLA 3P4WA 2V7MA 1S94A 3ANWB 4UVAB 2Q9QA 4DR1T 4GKKT 4ILCA 4KP3C 3N9PA 3N2GE 4DUYT 3UU3A 2XAFB 3AE8A 3L39A 5FYMA 5AQMB 3RIFA 4DV4T 5AFUL 3N2OA 4MBQA 2KMFA 3LK42 1XNQT 5HCJA 4H63H 1X9BA 5HWYA 4OFZA 3CIRA 5HXRA 2WBLA 4KHZF 5CJ5A 4JI7T 5L3BB 2DWGA 2BG9A 1DU2A 2WZHA 4YJ3E 5HXCA 4PW8A 3RYIE 5JH7E 1D0XA 2QVAA 4QX7B 5HEHA 2MYSA 1D0YA 3IA3A 5JDHA 2ACZA 3PUSA 2XHEB 3AXJA 5LBMA 4U33A 4EZ4A 2XJ7A 1CUNA 2XAHB 1X79A 4DV5T 4PJNA 3I0OA 3NRYA 3ZYKA 1MMNA 2M67A 5LJNA 3DJBA 4K0UA 4LF6T 3ZT5A 2BS4A 3LSVA 3HR0A 3VR9A 1WRDA 2D0TA 2H89A 5KMGP 5HAXA 2EHOA 3CMLA 4TUYE 4DIDB 3T1HT 4HWHA 1BR0A 2WDQA 4U2YA 2CMRA 3NKZA 4Q25A 1W09A 3AEDA 2LSKA 4HEAA 2CE7A 4YLHA 4LF5T 2X66A 5CA0E 2LSYA 3K1SA 1IBLT 2X67A 3DP7A 4NPPA 2ZM6T 4AKGA 5J2TE 3SFEA 4JBWF 3ONJA 4C90A 4LFBT 2V1DB 4E7ZA 2G0UA 1IJ5A 3AE7A 4MALA 1HX1B 5EZYE 4ZEYA 4YY3T 1MMDA 2Y6XA 4UV8B 4OHFA 4EV6A 4UVCB 3EHZA 5CFBA 3A8YC 1IJ6A 1NAFA 1HNWT 3IF8B 2JQKA 4O4IE 2LKGA 3ZCJA 4ZHQE 2LSJA 3CK6A 2VURA 2JRKA 3P4QA 3JAFA 5AQLB 3RIAA 4TV9E 3MZKB 1FIOA 4GOUA 4HWIB 1V9DA 4A5XA 3L09A 4KX6A 2KWHA 2E9XA 3KBUA 3LK2B 3IBPA 2BS2A 4GYRA 2QGSA 4XAXB 4LMKA 3RLFF 4WBOA 2DCFA 2AE9A 2FBWA 4PJLA 1XDOA 2W66A 2HH7A 1NWMX 4EB6E 2XTLA 4H9QC 3UU4A 3I9YA 2DI4A 3FZKB 4I50E 3PUQA 4CN1A 3HI2A 4Z90A 4ERRA 2ZM8A 4CN4A 4X5TA 4ZS3A 3ZYLA 3CVRA 3PUWF 2X51A 2V7LA 4AXPA 4IE7A 4DV3T 3AA1B 4P0BA 5L3DB 3GMIA 2KLQA 4CZZB 5FXZA 5JDMA 2A3DA 1MMGA 2BG9E 5BR8T 3AAEB 4FI5A 3TLWA 2YDRA 3ZN1B 4EEDA 2C5IT 2CLYB 5L2LA 3AA6B 3QC9A 2CLYC 3F2EA 2WY2A 2CM0A 2DHRA 3CX8B 3LFMA 3RYHE 3U3IA 4AKIA 5H6QB 3KINB 3E08A 5DABA 1Y64B 3MJXA 3C51A 1HX8A 4TWFA 3JCFA 3OKQA 3OBVE 4JI0T 5FP3A 2MBGA 3A7MA 5AQFB 3QOFA 3OJAA 4YHHT 2XSBA 5LMUT 4NXNT 3J9X1 4DUZT 3LBXB 5LB7B 2X0HA 1MIYA 2VKOA 2V6YB 3ABVA 4Z8XA 3AE6A 2Y48B 2J4GA 3QK6A 2ACXA 3U78A 5FXWA 2D5UA 5ABFA 4DNDA 3T1YT 1SE7A 4AKLA 2AXDS 3PUGA 2X9YA 2P9BA 2V7KA 4E7SA 3O1JA 2NTYA 1HNZT 3PE0A 5DJQC 3Q2MA 5TAOA 2LOSA 4YSYA 1KF6A 5AQNB 2CXFA 2VQET 4BAYB 2CXLA 3KV5A 3NZQA 2KNDA 4WZXA 3UU5A 2IC6A 1J5ET 1N34T 3T8OA 3B5MA 5JDGA 4JI5T 3PURA 5FY0A 3RH3A 2ZMAA 3BK9A 3ZJ2A 5L3EB 2D9DA 3RRWA 5AQHB 2FUPA 1E2AA 3P4SA 3QB5K 4CN6A 3KVBA 5H6RB 2K9AA 2YU2A 2M6BA 4YTPA 3RYCE 2H7OA 2V7IA 4Z91A 2IUBA 1MNDA 4H9PC 5AQGB 2JPFA 2N9DA 2E9XD 4PK5A 2V5CA 4AQYT 4X65T 5FXVA 4A97A 4HWFA 3ZYMA 4AQFA 4DV7T 3QNUA 4ZI3D 3VRBA 3WAKA 3GWHA 4UXNB 3ONLC 5GONE 1T8BA 2E5VA 3ZSTA 5JTGA 3L3PA 3AA0B 4LF7T 3FZMB 3RYFE 4EOZB
chains in the Genus database with same CATH topology
3N2OA 3C98B 4TZ4C 4NUVA 2EHOD 3C4WA 2XASB 4TN7B 2VKJA 3RX6A 4HN9A 4KBMB 2KWIB 4MBQA 5LBQB 5LXTE 2KMFA 3LK42 4ZS2A 3PDYA 2KZ7B 4H63H 4F6RC 1OXZA 3CWZB 3GN5A 2Y8DA 3K8PC 5HWYA 4OFZA 1LVKA 1D1BA 5HXRA 4ZI2C 2WBLA 4YFSA 1MIWA 4ASKA 2W00A 4J2CA 1ZHCA 4UF0A 4EIWA 3VKGA 2IC9A 5L3BB 2DWGA 4IHJE 5HWXA 2WMNA 4YJ3E 5HXCA 2KXPB 4PW8A 4GK5E 3S4UA 4CI2B 4MHCA 3RYIE 1D0XA 5JH7E 2C0SA 3BQKA 3F57A 3CX7B 4QX7B 2MYSA 2NP9A 1D0YA 2ES0A 1WYCA 5JDHA 3PUSA 2XHEB 4O4HE 3W15B 5LBMA 3ZMSB 5AFUL 4EZ4A 2LHNA 5CB4E 2W63A 4EZHA 5KX5E 4ANJA 3N9OA 1CUNA 2XAHB 3AAAB 1G73A 5ADXL 1X79A 1LVFA 4PJNA 3I0OA 5JQGE 2VB6A 5LHGB 1WYBA 1ZV4X 3NRYA 3ZYKA 3C4XA 4HKAA 3CQCB 1MMNA 2WAUA 4L0RA 2CWOA 3CKDA 5EK4A 2M67A 5LJNA 3DJBA 2MTQA 5JDFA 1BR2A 4K0UA 3ZCIA 3O1HA 4UV9B 5L3GB 5F8PA 3EVYA 3UFEA 4PNIA 4EAHA 3LBXA 1D0ZA 2J1DG 4L9IA 3LJCA 4P0AA 3FXDB 3KBTA 3HR0A 4CXWA 3EDVA 1WRDA 2D0TA 1B7TA 5KMGP 5HAXA 2EHOA 3CMLA 1IAPA 4TUYE 2ZM2A 3HKEE 3RKOA 2LHRA 4YHJA 4QHOA 5E0OA 2DNXA 5J2UE 1BR0A 2CMRA 4PFOA 1YD8G 3AVRA 5LJMA 4UIGA 4QX8B 2LOPA 3HL6A 2GK9A 2NW7A 1OWAA 4H9RC 2SPCA 1FMVA 2LSKA 2CCQA 2CE7A 4HEAA 4HGAA 4X20E 1UX5A 5A1LA 3O9XA 3M65A 3C64A 5LGUB 2PFVA 4YLHA 3VU7H 3ZMZB 2HPLA 2X66A 3K3NA 3Q5XA 5CA0E 2LSYA 2BZBA 4IIJE 2X67A 1FMWA 3DP7A 5DQWA 3K3QC 4HFVA 3V5UA 4DBQA 1YW0A 4OYJA 2ODUA 2YEVC 5IYZE 4PFPA 4AKGA 2LSGA 5HYAA 3IEEA 5J2TE 2RP4A 3CQGB 2YU1A 2VASA 4KUMB 4C90A 2V1DB 3SS1A 2LJLA 2XAQB 3AAIA 3FHNA 3O4XE 3P8CD 4E7ZA 3F31A 2G0UA 1IJ5A 3NZPA 4MALA 2JMKA 3A5XA 2WM9A 4NUUA 4X1KE 3RRCA 3SRZA 1VRBA 5EZYE 5JDQA 5LYJE 2W61A 1H7CA 2CEAA 2VL8A 4OK0A 1MMDA 5ETWA 3R84B 3VKHA 2LEHA 2Y6XA 4UV8B 4OHFA 4ZI2D 4UVCB 4WNKA 1SA0E 2CXDA 5FNVE 5JDNA 3UUMA 4IE4A 4AI6A 1IJ6A 3H37A 4CXYA 4JUYA 5JRCA 2N2NA 2ZLYA 3ETUA 1NAFA 4O8SA 4DMVA 3IF8B 2YINA 3QUJA 4O4IE 1HG2A 3ZCJA 2UXNB 2PJQA 3AVSA 5JDLA 4ZHQE 3C4ZA 1KK7A 2LSJA 3I1AA 3EDUA 2QA7A 3HA4A 3UUXB 4C91A 1MIVA 1HS7A 2DLRA 3IHRA 1G8XA 2JRKA 2V7JA 3RPUA 3ZMVB 2A72A 3MZKB 4TV9E 2W0GA 2CA5A 3KV6A 2ODVA 1FIOA 4GOUA 4IGUA 1ZEEA 1D1AA 4X1IE 1V9DA 5EK2A 3ZC1A 4CI3B 5JR9B 1T98A 3L09A 2LM9A 3CPZA 5JR9C 4I43B 3BQIA 5CA1E 5HXEA 2KWHA 4AKHA 2E9XA 4O2BE 3KBUA 3LK2B 3IBPA 3ANWA 5BMVE 4GYRA 5LGTB 3KV9A 1Z0PA 1ZKEA 1YKHB 4A56A 2QGSA 4U74A 2RA1A 4XAXB 3MKDA 1S35A 3H3AA 2L3LA 4WBOA 2L8KA 2JMHA 2JJ9A 3N9NA 3J7Yq 4H9SE 2DCFA 3DTOA 4PJLA 2K5BB 2HH7A 1NWMX 4EB6E 2XTLA 4H9QC 3ONXA 3I9YA 2DI4A 2N1GA 3JC6D 1YKEB 2KINB 2IW5B 1WR6A 4IE5A 4PAGA 3ZC0A 4I50E 5LCYA 3PUQA 2Q9QB 4TX5A 4AQFC 5LGNB 1QUUA 3KV4A 2Q9QC 2BVLA 2UXXB 3Q5WA 3R6NA 1U5PA 3HI2A 4ERRA 5F3JA 2ZM8A 2BDEA 3JC6C 4ZS3A 3ZYLA 3CVRA 3OYZA 3MACA 5HXHA 4JLEA 2A2FX 3RC8A 3O1IA 2X51A 2V7LA 4L5GA 2VKHA 2NWBA 4AXPA 4V1Av 4IE7A 2I59A 3AA1B 2NW9A 5LHIB 5LNKA 4P0BA 1BR1A 5L3DB 3GMIA 2D2SA 2KLQA 2X9HA 2KT9A 3N9QA 3N5LA 1HFAA 4AQGA 4CZZB 3KFWX 2D0UA 2IAKA 5FXZA 5JDMA 3GN5B 3V5SA 2A3DA 1MMGA 3PU3A 3SWHA 1D1CA 4IE6A 1U4QA 4DO0A 3ZMUB 5LHHB 3N9LA 3PTRB 5JREA 4UF0B 1HTJF 4QKNA 2V26A 3AAEB 3EUHA 4FI5A 2Z6EA 4PK6A 3ZN1B 4KMCA 4MLKA 4ADZA 2C5IT 3B57A 3BQLA 3PU8A 1MMAA 2ZM0A 5FXXA 2CLYB 4H63V 3AA6B 3WAJA 5L2LA 4UELA 1AJ3A 4DVDA 3QC9A 2CLYC 3F2EA 1MNEA 1O3XA 5HXSA 2CM0A 2HPJA 4UEMA 2DHRA 3CX8B 3UULA 4DBRA 3LFMA 3RYHE 2K24A 3NRXA 2L9QA 2NOXA 3KDSE 3U3IA 4AKIA 2X9WA 4ILUA 5H6QB 3HKCE 3KINB 2WWUA 3N2KE 4HTEA 4M1PA 3E08A 5DABA 4JEUB 4B6XA 1Y64B 1VOMA 4O4JE 4IDZA 3MJXA 3ZMTB 3C51A 1HX8A 3OKQA 3FXEB 3OBVE 4P09A 4AKRB 5EK3A 2WMOA 3WI3A 5FP3A 2MBGA 3LG7A 4GYSA 5LG4A 3E22E 2XAJB 3OJAA 4UVBB 5IHYA 4QXBB 1LRZA 3J9X1 3LBXB 5DQVA 4QXCB 5LOVE 1EZ3A 1MIYA 4BJMA 3MXZA 2VKOA 2VKDA 4EXTA 3SOLA 4Z8XA 2JQQA 2Y48B 2EHOB 3QK6A 2PBIA 2ACXA 3P7IA 4FJOA 4HE8A 3RC3A 2EHOC 4I4TE 3U78A 2VWAA 4N78D 4WBNE 2DWKA 5FXWA 2D5UA 2H7VC 3ETVA 3MA9A 4CI1B 2E8IA 3ZLIA 4H9NC 4ISSA 4U72A 4EOZB 3ZN0B 4DNDA 4EYYR 4PJMA 3LK3B 3PUAA 1SHZC 4AKLA 2CWYA 3I0QA 5LA6E 1US7B 3PUGA 2YK0A 3E0ZA 3Q9DA 2X9YA 2P9BA 3HKDE 2V7KA 2BVMA 4BA9A 4E7SA 2Q9QD 2K48A 3O1JA 2C5JA 2NTYA 3ZPOA 3UUNA 5JVDE 2XAGB 3PE0A 2NW8A 5DJQC 5KDMC 4JEHB 3Q2MA 3AA7B 3B13A 3MK7C 5TAOA 2LOSA 3GA8A 3CQXC 1KNZA 2X68A 5J1GA 5FMNA 4X1YE 5LP6E 3UT5E 2CXFA 4BAYB 2CXLA 2LT3A 3KV5A 3HKBE 3NZQA 4I55E 2KNDA 1IZNB 2MOZA 3N9MA 3C50A 4H9OC 4QWNB 4CQIA 4EYUA 2IC6A 1HG5A 1E1HB 4G63A 3T8OA 4YJ2E 3NBXX 4BJNA 4GK0E 2W62A 5JDGA 3FBLA 4XBFB 3PURA 1QSDA 4MFRA 4ZOLE 1LKXA 5FY0A 3RH3A 2ZMAA 3BK9A 3ZJ2A 5L3EB 4XZCA 3FB2A 3CX6B 2LSIA 2C5KT 2VK9A 3ZEFB 4PK4A 5JR9A 5M4YA 3UTKA 4CXXA 5JRCB 5FY7A 3RRWA 1FEWA 3K3OA 5FY1A 4WW0A 4ZI7E 4ISTA 3ESLA 1HCIA 2LE8A 3KVBA 5H6RB 2K9AA 2YU2A 1WLXA 2PG8A 3D0TA 2XUEA 3RYCE 1UCUA 2H7OA 2V7IA 4IE0A 3OYXA 1MNDA 4H9PC 2NTXA 3ZJ1A 1UX4A 4OYKA 2JPFA 4O4LE 2N9DA 2OA5A 3I9WA 5L3FB 2X9XA 5C8YE 2E9XD 4G2AA 1BR4A 4PK5A 2H3RA 2B1EA 4GIWA 4QXHB 5L3CB 1HF8A 3VHLA 5FXVA 2V7MA 3ZYMA 4AQFA 1S94A 2E9XB 2X0LB 3ANWB 3KVAA 4UVAB 2Q9QA 4ZI3D 2E9XC 3WAKA 3GWHA 4UXNB 4KP3C 3N9PA 3N2GE 5GONE 3AB3B 4O2AE 4TV8E 3L3PA 3TKLB 2XAFB 4ZI3C 5FYMA 2XQYA 3AA0B 3FBZA 3RYFE 2WSSV 4DMWA 4PJJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q9Q D;  3ANW B;  2EHO D;  2E9X C;  3JC6 C; 
#chains in the Genus database with same CATH topology
 3PUZ F;  3C98 B;  4TZ4 C;  4NUV A;  2HHH T;  3AEG A;  4LFC T;  3RX6 A;  4HN9 A;  4KBM B;  2J47 A;  2KWI B;  1OXZ A;  3K8P C;  1D1B A;  2W00 A;  4UF0 A;  4AIS A;  1JNR A;  2C0S A;  4IDP A;  3F57 A;  3CX7 B;  2BS3 A;  2ES0 A;  4LF8 T;  4O4H E;  5CB4 E;  2W63 A;  4EZH A;  1NEK A;  1N36 T;  5LHG B;  1M62 A;  3CQC B;  4L0R A;  4U7I A;  5EK4 A;  5JDF A;  3PUV F;  2MPK A;  4UV9 B;  4PNI A;  4TWH A;  4I0U A;  4L9I A;  1T7S A;  3FXD B;  2QYW A;  4X62 T;  4LF9 T;  3AVR A;  5LJM A;  4UIG A;  4QX8 B;  2GK9 A;  4H9R C;  5L47 A;  2XM2 A;  1FMV A;  4HGA A;  1UX5 A;  3M65 A;  3C64 A;  3VU7 H;  3K3N A;  2BBJ A;  3Q5X A;  4DV0 T;  4IIJ E;  1FMW A;  1YW0 A;  4PFP A;  2LSG A;  5HYA A;  3CQG B;  2VAS A;  4KUM B;  4HFD A;  2LJL A;  2XAQ B;  3AAI A;  3FHN A;  3O4X E;  3P8C D;  4B3T T;  2JMK A;  3A5X A;  3SRZ A;  1VRB A;  5JDQ A;  5LYJ E;  1H7C A;  3R84 B;  2LEH A;  3M3Z B;  4ZI2 D;  1SA0 E;  5FNV E;  3VRA A;  2WP9 A;  4CXY A;  4JUY A;  3L8R A;  2ZLY A;  2YIN A;  4JYA T;  5LG3 A;  2UXN B;  5JDL A;  2JIW A;  3UQ7 A;  1MIV A;  1HS7 A;  1YQ3 A;  5FVK A;  3IHR A;  2PTF A;  2W4X A;  2V7J A;  3RPU A;  2W0G A;  2XQA A;  4IGU A;  5HEO A;  1D1A A;  4DR7 T;  5JR9 B;  4IT4 A;  1T98 A;  5JR9 C;  3BQI A;  3Q5E A;  4O2B E;  3ANW A;  2E5L T;  1Z8U A;  1YKH B;  5ABE A;  3H3A A;  2LM2 A;  2WCA A;  1XNR T;  3DTO A;  4YT0 A;  2N1G A;  1YKE B;  1WR6 A;  4IE5 A;  4LML A;  4TX5 A;  5LGN B;  3KV4 A;  3NWI A;  2XQ9 A;  3Q5W A;  3R6N A;  3UU8 A;  3JC6 C;  3OYZ A;  5FKY A;  2A2F X;  3RC8 A;  2NW9 A;  1BR1 A;  4YTN A;  2HN2 A;  2VQF T;  2V8S V;  4AQG A;  3N5L A;  4HFE A;  2IAK A;  3GN5 B;  2XQ7 A;  4QH5 A;  3SWH A;  3FZH B;  1U4Q A;  4IE6 A;  4DO0 A;  3ZMU B;  3N9L A;  3PTR B;  1HTJ F;  4QKN A;  3EUH A;  2Z6E A;  5FXX A;  3WAJ A;  1AJ3 A;  3FZF B;  3PV0 F;  4UR9 A;  2OLT A;  2HPJ A;  4HFC A;  4DBR A;  2IDO B;  5FL0 A;  2X9W A;  1SUM B;  3HKC E;  4M1P A;  4B6X A;  2F4V T;  2WMO A;  4B3M T;  5LG4 A;  4UVB B;  4QXB B;  2JQH A;  3RQW A;  5LOV E;  4BJM A;  3MXZ A;  4TNW A;  3VR8 A;  3PJA J;  3RGL A;  3P7I A;  4FJO A;  4HE8 A;  2DWK A;  3RQU A;  3ETV A;  3ZLI A;  4IL9 A;  4JI2 T;  4ISS A;  3SFD A;  4DR3 T;  4HFH A;  2A9U A;  2XZE A;  4EYY R;  3PUA A;  2CHN A;  1SHZ C;  1HNX T;  2XQ8 A;  2WWV A;  2W2U A;  5LA6 E;  1US7 B;  4LF4 T;  1N33 T;  3HKD E;  2Q9Q D;  4NXM T;  3AEF A;  4QH1 A;  4JEH B;  2FJB A;  1KEY A;  5AQO B;  2WS3 A;  4I55 E;  2MOZ A;  3N9M A;  4EYU A;  4YJ2 E;  3NBX X;  3AE4 A;  4IRE A;  2W62 A;  2WQY A;  3FB2 A;  3CX6 B;  2LSI A;  2LLY A;  2DL1 A;  2VK9 A;  4CXX A;  5JRC B;  5FY7 A;  4ZI7 E;  4IST A;  1HCI A;  5AQI B;  1UCU A;  5AQS B;  4ZZB A;  2E2A A;  4LFA T;  4G2A A;  1BR4 A;  1YQ4 A;  4GIW A;  4HFB A;  5L3C B;  1ZOY A;  4WYV A;  2V6X A;  4HWD A;  3KVA A;  1ZP0 A;  3TKL B;  2XQY A;  3FBZ A;  4DMW A;  1J1J A;  2EHO D;  3PUY F;  3QB5 A;  4TN7 B;  3TLS A;  2VKJ A;  4ZS2 A;  3PDY A;  2KZ7 B;  2Y8D A;  3UU6 A;  4IL4 A;  4ZI2 C;  4YFS A;  3RIU C;  4ASK A;  1ZHC A;  2IC9 A;  2XY8 B;  5HWX A;  4IHJ E;  2B76 A;  2KXP B;  1FJG T;  5HCM A;  2J62 A;  5AQT B;  4YTM A;  5AQP B;  2LHN A;  4ANJ A;  3ZKR A;  3N9O A;  1G73 A;  2UUA T;  1WYB A;  1ZV4 X;  3C4X A;  4ZZC A;  4HKA A;  2WAU A;  3P4P A;  2MTQ A;  3RI5 A;  3UQ4 A;  3JAE A;  2XSA A;  5L3G B;  5F8P A;  3EVY A;  4EAH A;  3LBX A;  1D0Z A;  3LJC A;  4P0A A;  2V6Y A;  2V5D A;  3KBT A;  4CXW A;  1B7T A;  2I0M A;  2ZM2 A;  3HKE E;  4JI8 T;  2LHR A;  5E0O A;  4JI3 T;  5J2U E;  4AIU A;  1YD8 G;  1WFD A;  2LOP A;  3HL6 A;  2NW7 A;  2CCQ A;  4X20 E;  5A1L A;  1OED B;  2PFV A;  1OED C;  3ZMZ B;  2HPL A;  2X0Y A;  5IWA T;  4U3C A;  1W0B A;  5DQW A;  4K0K T;  3K3Q C;  3V5U A;  5IYZ E;  2WDR A;  3IEE A;  2YU1 A;  3SS1 A;  3OTO T;  2YOE A;  3F31 A;  2OV9 A;  1IBM T;  2WM9 A;  4NUU A;  4X1K E;  3RRC A;  3OVU A;  3ZT7 A;  2VL8 A;  5ETW A;  1UUR A;  3UFG A;  2CXD A;  3UUM A;  4IE4 A;  4X66 T;  2VVN A;  3ETU A;  4DMV A;  3AE1 A;  2PJQ A;  3I1A A;  2QA7 A;  3UUX B;  4C91 A;  2DLR A;  4COF A;  2UUB T;  3ZMV B;  2ODV A;  1ZEE A;  4X1I E;  5EK2 A;  4CI3 B;  3H3M A;  3CPZ A;  5CA1 E;  1E7P A;  5BMV E;  5LGT B;  3KV9 A;  1ZKE A;  4A56 A;  1S35 A;  4KHP T;  2K3W A;  3TLV A;  4DR6 T;  1L0V A;  2JMH A;  2JJ9 A;  3N9N A;  3J7Y q;  4H9S E;  5AQJ B;  4F8H A;  1XWM A;  2YN6 A;  5C2T A;  2KIN B;  2IW5 B;  3AE5 A;  2NR4 A;  2Q9Q B;  3AE9 A;  2Q9Q C;  5AQU B;  1I6Z A;  1U5P A;  3G06 A;  2XQ5 A;  2HN1 A;  1J5W A;  3MAC A;  4JLE A;  3PJA A;  3O1I A;  4V1A v;  5LHI B;  2D2S A;  2X9H A;  3N9Q A;  4IDQ A;  2D0U A;  2VL0 A;  5ABH A;  5LHH B;  2BG9 B;  4PK6 A;  2YDS A;  2BG9 C;  4MLK A;  4ADZ A;  3RKG A;  1KFY A;  1MMA A;  2ZM0 A;  4UEL A;  4DVD A;  2WB5 A;  1MNE A;  3EAB A;  1UK5 A;  4UEM A;  3UUL A;  3AXJ B;  5LMN T;  2UXC T;  3NRX A;  2L9Q A;  4ILU A;  1KNR A;  4JEU B;  2M6I A;  4O4J E;  3ZMT B;  4P09 A;  4AKR B;  1CHU A;  5J0Z A;  3WI3 A;  4JI1 T;  1LRZ A;  5DQV A;  1KNP A;  3JAD A;  3SOL A;  3X1D A;  2EHO B;  2PBI A;  3RC3 A;  2EHO C;  1M7K A;  2MAW A;  2BKN A;  4IDN A;  4CI1 B;  4H9N C;  4U72 A;  2WDV A;  3LK3 B;  2CWY A;  2YK0 A;  5KXJ A;  2BVM A;  1XMQ T;  2RPA A;  3UUN A;  5KDM C;  3B13 A;  5AQQ B;  2IIU A;  5IUX A;  3GA8 A;  3CQX C;  5LP6 E;  3UT5 E;  2LT3 A;  3HKB E;  4H9O C;  4QWN B;  1HG5 A;  1E1H B;  4G63 A;  4DR5 T;  4P1N A;  4TNV A;  1QSD A;  1NEN A;  4XZC A;  5AQV B;  2FJE A;  5JR9 A;  5M4Y A;  3UTK A;  3Q5D A;  2YKS A;  3NVO A;  5FY1 A;  3AE3 A;  4WW0 A;  1OED E;  3ESL A;  4HWC A;  1WLX A;  2PG8 A;  4JI6 T;  2BKO A;  3UUB A;  2NTX A;  3ZJ1 A;  2OA5 A;  4ILA A;  5L3F B;  3RHW A;  5FVL A;  1HF8 A;  2E9X B;  2X0L B;  2UU9 T;  4DV6 T;  2E9X C;  1YXR A;  3AB3 B;  4O2A E;  4TV8 E;  4ILB A;  4ZI3 C;  4DR2 T;  2WSS V;  4PJJ A;  2CBI A;  3C4W A;  2XAS B;  5LBQ B;  5LXT E;  2VVS A;  4F6R C;  3CWZ B;  3GN5 A;  4IDO A;  5HEJ A;  1LVK A;  1MIW A;  4B3S T;  4J2C A;  4EIW A;  3VKG A;  2WMN A;  1VCT A;  3P50 A;  4GK5 E;  3S4U A;  4CI2 B;  4MHC A;  2WU5 A;  3BQK A;  5HEG A;  2NP9 A;  1WYC A;  3W15 B;  3ZMS B;  5FL1 A;  2KSR A;  4A98 A;  5KX5 E;  4B3R T;  3AAA B;  1GQE A;  1WCR A;  5ADX L;  4EGW A;  1LVF A;  5JQG E;  2VB6 A;  1XZY A;  4U7Y A;  2H88 A;  2CHO A;  2CWO A;  3CKD A;  2I6H A;  1BR2 A;  3ZCI A;  3O1H A;  3UFE A;  4U2Z A;  2UUC T;  2J1D G;  5HEU A;  4DV1 T;  1UGO A;  3EDV A;  5CGM A;  2UXD T;  1IAP A;  2XQ4 A;  3RKO A;  4GKJ T;  1W0A A;  4QHO A;  4YHJ A;  2DNX A;  2FJA A;  4PFO A;  1OWA A;  2SPC A;  3O9X A;  5LGU B;  4NIQ A;  4EEB A;  3AEE A;  2BZB A;  4HFV A;  4DBQ A;  4OYJ A;  2ODU A;  2YEV C;  3LDQ B;  2CPT A;  2XPK A;  2CBJ A;  2RP4 A;  5ABF B;  4KI0 F;  3P4R A;  3NZP A;  4JV5 T;  5F5W A;  2W61 A;  2CEA A;  4OK0 A;  3TLU A;  3VKH A;  4WNK A;  4DV2 T;  5JDN A;  4AI6 A;  3H37 A;  5JRC A;  5AQK B;  2N2N A;  4O8S A;  4YSZ A;  3QUJ A;  1HG2 A;  2IHR 1;  3AVS A;  1QLB A;  4HFI A;  3C4Z A;  1KK7 A;  3EDU A;  3HA4 A;  2XQ3 A;  1G8X A;  2A72 A;  2CA5 A;  3KV6 A;  2YDQ A;  3ZC1 A;  2LM9 A;  4I43 B;  5HXE A;  4AKH A;  2LKH A;  1Z0P A;  2WZI A;  2JQ9 A;  2RA1 A;  4U74 A;  3MKD A;  2L3L A;  1IBK T;  2L8K A;  2BBH A;  2LRK A;  2K5B B;  3ONX A;  3JC6 D;  4PAG A;  3ZC0 A;  5LCY A;  4AQF C;  1QUU A;  2BVL A;  2UXX B;  2CRB A;  5F3J A;  2BDE A;  3RIU A;  5AQR B;  1T72 A;  5HXH A;  3ZSS A;  4L5G A;  2VKH A;  4JI4 T;  2NWB A;  4TWD A;  2I59 A;  5LNK A;  2KT9 A;  1HFA A;  3KFW X;  3V5S A;  1I94 T;  3PU3 A;  1D1C A;  1R8I A;  2R6G F;  5JRE A;  4UF0 B;  2V26 A;  4KMC A;  3B57 A;  3BQL A;  4X64 T;  3PU8 A;  4H63 V;  4YXD A;  1O3X A;  5HXS A;  3EAM A;  2FJD A;  1XDP A;  2K24 A;  1Y01 A;  2NOX A;  3KDS E;  3PUX F;  2QRX A;  4HTE A;  2WWU A;  3N2K E;  1VOM A;  4IDZ A;  2IML A;  3FXE B;  1N32 T;  3ZT6 A;  5EK3 A;  4DR4 T;  3LG7 A;  4GYS A;  3E22 E;  2XAJ B;  5IHY A;  2UXB T;  4QXC B;  1XMO T;  1EZ3 A;  1OED A;  2VKD A;  4EXT A;  2JQQ A;  4YSX A;  1JNZ A;  4I4T E;  2XQ6 A;  2VWA A;  4N78 D;  5L4H A;  4WBN E;  2H7V C;  3MA9 A;  2E8I A;  5C3J A;  3AEB A;  2LRL A;  5ABG A;  3ZN0 B;  4PJM A;  1HR0 T;  4U31 A;  3I0Q A;  3AEC A;  3E0Z A;  3Q9D A;  1UUS A;  4BA9 A;  3OPC A;  2K48 A;  2C5J A;  3ZPO A;  5JVD E;  2XAG B;  2NW8 A;  3AA7 B;  3MK7 C;  3FZL B;  2XM1 A;  1KNZ A;  2X68 A;  5J1G A;  5FMN A;  4X1Y E;  3AEA A;  1W9R A;  1IZN B;  3C50 A;  4CQI A;  4BJN A;  4GK0 E;  1VCS A;  3FBL A;  4XBF B;  4MFR A;  4ZOL E;  4QH4 A;  1LKX A;  3RF1 A;  3TLT A;  2WU2 A;  2C5K T;  3AE2 A;  1WR0 A;  3ZEF B;  4PK4 A;  1FEW A;  3K3O A;  2BKP A;  2LE8 A;  2W67 A;  5L4E A;  3D0T A;  2XUE A;  4ZXL A;  4IE0 A;  3OYX A;  3EI0 A;  1UX4 A;  4OYK A;  4O4L E;  3I9W A;  4LMJ A;  4OX9 T;  2X9X A;  5C8Y E;  2H3R A;  2B1E A;  4QXH B;  3VHL A;  3P4W A;  2V7M A;  1S94 A;  3ANW B;  4UVA B;  2Q9Q A;  4DR1 T;  4GKK T;  4ILC A;  4KP3 C;  3N9P A;  3N2G E;  4DUY T;  3UU3 A;  2XAF B;  3AE8 A;  3L39 A;  5FYM A;  5AQM B;  3RIF A;  4DV4 T;  5AFU L;  3N2O A;  4MBQ A;  2KMF A;  3LK4 2;  1XNQ T;  5HCJ A;  4H63 H;  1X9B A;  5HWY A;  4OFZ A;  3CIR A;  5HXR A;  2WBL A;  4KHZ F;  5CJ5 A;  4JI7 T;  5L3B B;  2DWG A;  2BG9 A;  1DU2 A;  2WZH A;  4YJ3 E;  5HXC A;  4PW8 A;  3RYI E;  5JH7 E;  1D0X A;  2QVA A;  4QX7 B;  5HEH A;  2MYS A;  1D0Y A;  3IA3 A;  5JDH A;  2ACZ A;  3PUS A;  2XHE B;  3AXJ A;  5LBM A;  4U33 A;  4EZ4 A;  2XJ7 A;  1CUN A;  2XAH B;  1X79 A;  4DV5 T;  4PJN A;  3I0O A;  3NRY A;  3ZYK A;  1MMN A;  2M67 A;  5LJN A;  3DJB A;  4K0U A;  4LF6 T;  3ZT5 A;  2BS4 A;  3LSV A;  3HR0 A;  3VR9 A;  1WRD A;  2D0T A;  2H89 A;  5KMG P;  5HAX A;  2EHO A;  3CML A;  4TUY E;  4DID B;  3T1H T;  4HWH A;  1BR0 A;  2WDQ A;  4U2Y A;  2CMR A;  3NKZ A;  4Q25 A;  1W09 A;  3AED A;  2LSK A;  4HEA A;  2CE7 A;  4YLH A;  4LF5 T;  2X66 A;  5CA0 E;  2LSY A;  3K1S A;  1IBL T;  2X67 A;  3DP7 A;  4NPP A;  2ZM6 T;  4AKG A;  5J2T E;  3SFE A;  4JBW F;  3ONJ A;  4C90 A;  4LFB T;  2V1D B;  4E7Z A;  2G0U A;  1IJ5 A;  3AE7 A;  4MAL A;  1HX1 B;  5EZY E;  4ZEY A;  4YY3 T;  1MMD A;  2Y6X A;  4UV8 B;  4OHF A;  4EV6 A;  4UVC B;  3EHZ A;  5CFB A;  3A8Y C;  1IJ6 A;  1NAF A;  1HNW T;  3IF8 B;  2JQK A;  4O4I E;  2LKG A;  3ZCJ A;  4ZHQ E;  2LSJ A;  3CK6 A;  2VUR A;  2JRK A;  3P4Q A;  3JAF A;  5AQL B;  3RIA A;  4TV9 E;  3MZK B;  1FIO A;  4GOU A;  4HWI B;  1V9D A;  4A5X A;  3L09 A;  4KX6 A;  2KWH A;  2E9X A;  3KBU A;  3LK2 B;  3IBP A;  2BS2 A;  4GYR A;  2QGS A;  4XAX B;  4LMK A;  3RLF F;  4WBO A;  2DCF A;  2AE9 A;  2FBW A;  4PJL A;  1XDO A;  2W66 A;  2HH7 A;  1NWM X;  4EB6 E;  2XTL A;  4H9Q C;  3UU4 A;  3I9Y A;  2DI4 A;  3FZK B;  4I50 E;  3PUQ A;  4CN1 A;  3HI2 A;  4Z90 A;  4ERR A;  2ZM8 A;  4CN4 A;  4X5T A;  4ZS3 A;  3ZYL A;  3CVR A;  3PUW F;  2X51 A;  2V7L A;  4AXP A;  4IE7 A;  4DV3 T;  3AA1 B;  4P0B A;  5L3D B;  3GMI A;  2KLQ A;  4CZZ B;  5FXZ A;  5JDM A;  2A3D A;  1MMG A;  2BG9 E;  5BR8 T;  3AAE B;  4FI5 A;  3TLW A;  2YDR A;  3ZN1 B;  4EED A;  2C5I T;  2CLY B;  5L2L A;  3AA6 B;  3QC9 A;  2CLY C;  3F2E A;  2WY2 A;  2CM0 A;  2DHR A;  3CX8 B;  3LFM A;  3RYH E;  3U3I A;  4AKI A;  5H6Q B;  3KIN B;  3E08 A;  5DAB A;  1Y64 B;  3MJX A;  3C51 A;  1HX8 A;  4TWF A;  3JCF A;  3OKQ A;  3OBV E;  4JI0 T;  5FP3 A;  2MBG A;  3A7M A;  5AQF B;  3QOF A;  3OJA A;  4YHH T;  2XSB A;  5LMU T;  4NXN T;  3J9X 1;  4DUZ T;  3LBX B;  5LB7 B;  2X0H A;  1MIY A;  2VKO A;  2V6Y B;  3ABV A;  4Z8X A;  3AE6 A;  2Y48 B;  2J4G A;  3QK6 A;  2ACX A;  3U78 A;  5FXW A;  2D5U A;  5ABF A;  4DND A;  3T1Y T;  1SE7 A;  4AKL A;  2AXD S;  3PUG A;  2X9Y A;  2P9B A;  2V7K A;  4E7S A;  3O1J A;  2NTY A;  1HNZ T;  3PE0 A;  5DJQ C;  3Q2M A;  5TAO A;  2LOS A;  4YSY A;  1KF6 A;  5AQN B;  2CXF A;  2VQE T;  4BAY B;  2CXL A;  3KV5 A;  3NZQ A;  2KND A;  4WZX A;  3UU5 A;  2IC6 A;  1J5E T;  1N34 T;  3T8O A;  3B5M A;  5JDG A;  4JI5 T;  3PUR A;  5FY0 A;  3RH3 A;  2ZMA A;  3BK9 A;  3ZJ2 A;  5L3E B;  2D9D A;  3RRW A;  5AQH B;  2FUP A;  1E2A A;  3P4S A;  3QB5 K;  4CN6 A;  3KVB A;  5H6R B;  2K9A A;  2YU2 A;  2M6B A;  4YTP A;  3RYC E;  2H7O A;  2V7I A;  4Z91 A;  2IUB A;  1MND A;  4H9P C;  5AQG B;  2JPF A;  2N9D A;  2E9X D;  4PK5 A;  2V5C A;  4AQY T;  4X65 T;  5FXV A;  4A97 A;  4HWF A;  3ZYM A;  4AQF A;  4DV7 T;  3QNU A;  4ZI3 D;  3VRB A;  3WAK A;  3GWH A;  4UXN B;  3ONL C;  5GON E;  1T8B A;  2E5V A;  3ZST A;  5JTG A;  3L3P A;  3AA0 B;  4LF7 T;  3FZM B;  3RYF E;  4EOZ B; 
#chains in the Genus database with same CATH homology
 3N2O A;  3C98 B;  4TZ4 C;  4NUV A;  2EHO D;  3C4W A;  2XAS B;  4TN7 B;  2VKJ A;  3RX6 A;  4HN9 A;  4KBM B;  2KWI B;  4MBQ A;  5LBQ B;  5LXT E;  2KMF A;  3LK4 2;  4ZS2 A;  3PDY A;  2KZ7 B;  4H63 H;  4F6R C;  1OXZ A;  3CWZ B;  3GN5 A;  2Y8D A;  3K8P C;  5HWY A;  4OFZ A;  1LVK A;  1D1B A;  5HXR A;  4ZI2 C;  2WBL A;  4YFS A;  1MIW A;  4ASK A;  2W00 A;  4J2C A;  1ZHC A;  4UF0 A;  4EIW A;  3VKG A;  2IC9 A;  5L3B B;  2DWG A;  4IHJ E;  5HWX A;  2WMN A;  4YJ3 E;  5HXC A;  2KXP B;  4PW8 A;  4GK5 E;  3S4U A;  4CI2 B;  4MHC A;  3RYI E;  1D0X A;  5JH7 E;  2C0S A;  3BQK A;  3F57 A;  3CX7 B;  4QX7 B;  2MYS A;  2NP9 A;  1D0Y A;  2ES0 A;  1WYC A;  5JDH A;  3PUS A;  2XHE B;  4O4H E;  3W15 B;  5LBM A;  3ZMS B;  5AFU L;  4EZ4 A;  2LHN A;  5CB4 E;  2W63 A;  4EZH A;  5KX5 E;  4ANJ A;  3N9O A;  1CUN A;  2XAH B;  3AAA B;  1G73 A;  5ADX L;  1X79 A;  1LVF A;  4PJN A;  3I0O A;  5JQG E;  2VB6 A;  5LHG B;  1WYB A;  1ZV4 X;  3NRY A;  3ZYK A;  3C4X A;  4HKA A;  3CQC B;  1MMN A;  2WAU A;  4L0R A;  2CWO A;  3CKD A;  5EK4 A;  2M67 A;  5LJN A;  3DJB A;  2MTQ A;  5JDF A;  1BR2 A;  4K0U A;  3ZCI A;  3O1H A;  4UV9 B;  5L3G B;  5F8P A;  3EVY A;  3UFE A;  4PNI A;  4EAH A;  3LBX A;  1D0Z A;  2J1D G;  4L9I A;  3LJC A;  4P0A A;  3FXD B;  3KBT A;  3HR0 A;  4CXW A;  3EDV A;  1WRD A;  2D0T A;  1B7T A;  5KMG P;  5HAX A;  2EHO A;  3CML A;  1IAP A;  4TUY E;  2ZM2 A;  3HKE E;  3RKO A;  2LHR A;  4YHJ A;  4QHO A;  5E0O A;  2DNX A;  5J2U E;  1BR0 A;  2CMR A;  4PFO A;  1YD8 G;  3AVR A;  5LJM A;  4UIG A;  4QX8 B;  2LOP A;  3HL6 A;  2GK9 A;  2NW7 A;  1OWA A;  4H9R C;  2SPC A;  1FMV A;  2LSK A;  2CCQ A;  2CE7 A;  4HEA A;  4HGA A;  4X20 E;  1UX5 A;  5A1L A;  3O9X A;  3M65 A;  3C64 A;  5LGU B;  2PFV A;  4YLH A;  3VU7 H;  3ZMZ B;  2HPL A;  2X66 A;  3K3N A;  3Q5X A;  5CA0 E;  2LSY A;  2BZB A;  4IIJ E;  2X67 A;  1FMW A;  3DP7 A;  5DQW A;  3K3Q C;  4HFV A;  3V5U A;  4DBQ A;  1YW0 A;  4OYJ A;  2ODU A;  2YEV C;  5IYZ E;  4PFP A;  4AKG A;  2LSG A;  5HYA A;  3IEE A;  5J2T E;  2RP4 A;  3CQG B;  2YU1 A;  2VAS A;  4KUM B;  4C90 A;  2V1D B;  3SS1 A;  2LJL A;  2XAQ B;  3AAI A;  3FHN A;  3O4X E;  3P8C D;  4E7Z A;  3F31 A;  2G0U A;  1IJ5 A;  3NZP A;  4MAL A;  2JMK A;  3A5X A;  2WM9 A;  4NUU A;  4X1K E;  3RRC A;  3SRZ A;  1VRB A;  5EZY E;  5JDQ A;  5LYJ E;  2W61 A;  1H7C A;  2CEA A;  2VL8 A;  4OK0 A;  1MMD A;  5ETW A;  3R84 B;  3VKH A;  2LEH A;  2Y6X A;  4UV8 B;  4OHF A;  4ZI2 D;  4UVC B;  4WNK A;  1SA0 E;  2CXD A;  5FNV E;  5JDN A;  3UUM A;  4IE4 A;  4AI6 A;  1IJ6 A;  3H37 A;  4CXY A;  4JUY A;  5JRC A;  2N2N A;  2ZLY A;  3ETU A;  1NAF A;  4O8S A;  4DMV A;  3IF8 B;  2YIN A;  3QUJ A;  4O4I E;  1HG2 A;  3ZCJ A;  2UXN B;  2PJQ A;  3AVS A;  5JDL A;  4ZHQ E;  3C4Z A;  1KK7 A;  2LSJ A;  3I1A A;  3EDU A;  2QA7 A;  3HA4 A;  3UUX B;  4C91 A;  1MIV A;  1HS7 A;  2DLR A;  3IHR A;  1G8X A;  2JRK A;  2V7J A;  3RPU A;  3ZMV B;  2A72 A;  3MZK B;  4TV9 E;  2W0G A;  2CA5 A;  3KV6 A;  2ODV A;  1FIO A;  4GOU A;  4IGU A;  1ZEE A;  1D1A A;  4X1I E;  1V9D A;  5EK2 A;  3ZC1 A;  4CI3 B;  5JR9 B;  1T98 A;  3L09 A;  2LM9 A;  3CPZ A;  5JR9 C;  4I43 B;  3BQI A;  5CA1 E;  5HXE A;  2KWH A;  4AKH A;  2E9X A;  4O2B E;  3KBU A;  3LK2 B;  3IBP A;  3ANW A;  5BMV E;  4GYR A;  5LGT B;  3KV9 A;  1Z0P A;  1ZKE A;  1YKH B;  4A56 A;  2QGS A;  4U74 A;  2RA1 A;  4XAX B;  3MKD A;  1S35 A;  3H3A A;  2L3L A;  4WBO A;  2L8K A;  2JMH A;  2JJ9 A;  3N9N A;  3J7Y q;  4H9S E;  2DCF A;  3DTO A;  4PJL A;  2K5B B;  2HH7 A;  1NWM X;  4EB6 E;  2XTL A;  4H9Q C;  3ONX A;  3I9Y A;  2DI4 A;  2N1G A;  3JC6 D;  1YKE B;  2KIN B;  2IW5 B;  1WR6 A;  4IE5 A;  4PAG A;  3ZC0 A;  4I50 E;  5LCY A;  3PUQ A;  2Q9Q B;  4TX5 A;  4AQF C;  5LGN B;  1QUU A;  3KV4 A;  2Q9Q C;  2BVL A;  2UXX B;  3Q5W A;  3R6N A;  1U5P A;  3HI2 A;  4ERR A;  5F3J A;  2ZM8 A;  2BDE A;  3JC6 C;  4ZS3 A;  3ZYL A;  3CVR A;  3OYZ A;  3MAC A;  5HXH A;  4JLE A;  2A2F X;  3RC8 A;  3O1I A;  2X51 A;  2V7L A;  4L5G A;  2VKH A;  2NWB A;  4AXP A;  4V1A v;  4IE7 A;  2I59 A;  3AA1 B;  2NW9 A;  5LHI B;  5LNK A;  4P0B A;  1BR1 A;  5L3D B;  3GMI A;  2D2S A;  2KLQ A;  2X9H A;  2KT9 A;  3N9Q A;  3N5L A;  1HFA A;  4AQG A;  4CZZ B;  3KFW X;  2D0U A;  2IAK A;  5FXZ A;  5JDM A;  3GN5 B;  3V5S A;  2A3D A;  1MMG A;  3PU3 A;  3SWH A;  1D1C A;  4IE6 A;  1U4Q A;  4DO0 A;  3ZMU B;  5LHH B;  3N9L A;  3PTR B;  5JRE A;  4UF0 B;  1HTJ F;  4QKN A;  2V26 A;  3AAE B;  3EUH A;  4FI5 A;  2Z6E A;  4PK6 A;  3ZN1 B;  4KMC A;  4MLK A;  4ADZ A;  2C5I T;  3B57 A;  3BQL A;  3PU8 A;  1MMA A;  2ZM0 A;  5FXX A;  2CLY B;  4H63 V;  3AA6 B;  3WAJ A;  5L2L A;  4UEL A;  1AJ3 A;  4DVD A;  3QC9 A;  2CLY C;  3F2E A;  1MNE A;  1O3X A;  5HXS A;  2CM0 A;  2HPJ A;  4UEM A;  2DHR A;  3CX8 B;  3UUL A;  4DBR A;  3LFM A;  3RYH E;  2K24 A;  3NRX A;  2L9Q A;  2NOX A;  3KDS E;  3U3I A;  4AKI A;  2X9W A;  4ILU A;  5H6Q B;  3HKC E;  3KIN B;  2WWU A;  3N2K E;  4HTE A;  4M1P A;  3E08 A;  5DAB A;  4JEU B;  4B6X A;  1Y64 B;  1VOM A;  4O4J E;  4IDZ A;  3MJX A;  3ZMT B;  3C51 A;  1HX8 A;  3OKQ A;  3FXE B;  3OBV E;  4P09 A;  4AKR B;  5EK3 A;  2WMO A;  3WI3 A;  5FP3 A;  2MBG A;  3LG7 A;  4GYS A;  5LG4 A;  3E22 E;  2XAJ B;  3OJA A;  4UVB B;  5IHY A;  4QXB B;  1LRZ A;  3J9X 1;  3LBX B;  5DQV A;  4QXC B;  5LOV E;  1EZ3 A;  1MIY A;  4BJM A;  3MXZ A;  2VKO A;  2VKD A;  4EXT A;  3SOL A;  4Z8X A;  2JQQ A;  2Y48 B;  2EHO B;  3QK6 A;  2PBI A;  2ACX A;  3P7I A;  4FJO A;  4HE8 A;  3RC3 A;  2EHO C;  4I4T E;  3U78 A;  2VWA A;  4N78 D;  4WBN E;  2DWK A;  5FXW A;  2D5U A;  2H7V C;  3ETV A;  3MA9 A;  4CI1 B;  2E8I A;  3ZLI A;  4H9N C;  4ISS A;  4U72 A;  4EOZ B;  3ZN0 B;  4DND A;  4EYY R;  4PJM A;  3LK3 B;  3PUA A;  1SHZ C;  4AKL A;  2CWY A;  3I0Q A;  5LA6 E;  1US7 B;  3PUG A;  2YK0 A;  3E0Z A;  3Q9D A;  2X9Y A;  2P9B A;  3HKD E;  2V7K A;  2BVM A;  4BA9 A;  4E7S A;  2Q9Q D;  2K48 A;  3O1J A;  2C5J A;  2NTY A;  3ZPO A;  3UUN A;  5JVD E;  2XAG B;  3PE0 A;  2NW8 A;  5DJQ C;  5KDM C;  4JEH B;  3Q2M A;  3AA7 B;  3B13 A;  3MK7 C;  5TAO A;  2LOS A;  3GA8 A;  3CQX C;  1KNZ A;  2X68 A;  5J1G A;  5FMN A;  4X1Y E;  5LP6 E;  3UT5 E;  2CXF A;  4BAY B;  2CXL A;  2LT3 A;  3KV5 A;  3HKB E;  3NZQ A;  4I55 E;  2KND A;  1IZN B;  2MOZ A;  3N9M A;  3C50 A;  4H9O C;  4QWN B;  4CQI A;  4EYU A;  2IC6 A;  1HG5 A;  1E1H B;  4G63 A;  3T8O A;  4YJ2 E;  3NBX X;  4BJN A;  4GK0 E;  2W62 A;  5JDG A;  3FBL A;  4XBF B;  3PUR A;  1QSD A;  4MFR A;  4ZOL E;  1LKX A;  5FY0 A;  3RH3 A;  2ZMA A;  3BK9 A;  3ZJ2 A;  5L3E B;  4XZC A;  3FB2 A;  3CX6 B;  2LSI A;  2C5K T;  2VK9 A;  3ZEF B;  4PK4 A;  5JR9 A;  5M4Y A;  3UTK A;  4CXX A;  5JRC B;  5FY7 A;  3RRW A;  1FEW A;  3K3O A;  5FY1 A;  4WW0 A;  4ZI7 E;  4IST A;  3ESL A;  1HCI A;  2LE8 A;  3KVB A;  5H6R B;  2K9A A;  2YU2 A;  1WLX A;  2PG8 A;  3D0T A;  2XUE A;  3RYC E;  1UCU A;  2H7O A;  2V7I A;  4IE0 A;  3OYX A;  1MND A;  4H9P C;  2NTX A;  3ZJ1 A;  1UX4 A;  4OYK A;  2JPF A;  4O4L E;  2N9D A;  2OA5 A;  3I9W A;  5L3F B;  2X9X A;  5C8Y E;  2E9X D;  4G2A A;  1BR4 A;  4PK5 A;  2H3R A;  2B1E A;  4GIW A;  4QXH B;  5L3C B;  1HF8 A;  3VHL A;  5FXV A;  2V7M A;  3ZYM A;  4AQF A;  1S94 A;  2E9X B;  2X0L B;  3ANW B;  3KVA A;  4UVA B;  2Q9Q A;  4ZI3 D;  2E9X C;  3WAK A;  3GWH A;  4UXN B;  4KP3 C;  3N9P A;  3N2G E;  5GON E;  3AB3 B;  4O2A E;  4TV8 E;  3L3P A;  3TKL B;  2XAF B;  4ZI3 C;  5FYM A;  2XQY A;  3AA0 B;  3FBZ A;  3RYF E;  2WSS V;  4DMW A;  4PJJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...