5AQQB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
111
structure length
106
Chain Sequence
SNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 106
sequence length 111
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqqB00
4HWDA 4HWIB 1UK5A 2D9DA 5AQIB 1HX1B 5AQRB 5AQNB 1T7SA 5AQSB 5AQFB 5AQQB 4HWCA 4HWHA 3M3ZB 5AQOB 1M62A 3LDQB 3FZLB 5AQHB 5AQTB 3FZHB 5AQLB 5AQJB 1UGOA 3FZKB 5AQGB 5AQMB 4HWFA 5AQVB 3A8YC 1I6ZA 5AQUB 5AQKB 5AQPB 1M7KA 3FZMB 3FZFB
chains in the Genus database with same CATH superfamily
4P1NA 4AKIA 3Q5DA 3MXZA 5HCMA 2M6IA 4LF8T 4HE8A 3RIFA 2A2FX 4WBNE 2M6BA 2KWHA 3UUBA 4YSYA 3C64A 2FUPA 4U2YA 4E7ZA 4H9QC 2WDVA 5L3DB 2L3LA 1XMQT 4EV6A 3SFEA 2H88A 2E9XB 1KNPA 3I0OA 1IZNB 3TLUA 5F3JA 1YQ4A 2WZIA 4GYSA 4IDQA 1FJGT 2PBIA 2LSYA 2CXLA 3LBXB 4JI1T 3SWHA 5ABEA 2NP9A 2X0HA 3NZQA 1V9DA 5LNKA 2ACXA 4DV7T 1AJ3A 4IT4A 4X1YE 1ZHCA 3UUNA 2CHNA 1ZEEA 3PDYA 3AA1B 2N9DA 3PUGA 3SFDA 5HYAA 2B1EA 2D0UA 4LMLA 5LCYA 5BMVE 3AXJA 5JDMA 4FJOA 2XQ6A 4MLKA 2ZM6T 4X1IE 5FKYA 2WSSV 3L8RA 3ZC1A 3UFGA 1N34T 2IMLA 1NEKA 3RYCE 5JR9A 4MBQA 2NW9A 4PJLA 5AQSB 1B7TA 4JI0T 2LRKA 1LKXA 2C5KT 1W9RA 3LJCA 4CN1A 4ANJA 3UU6A 5LGNB 1KFYA 4TN7B 2DWGA 2XQ3A 3PUQA 2K48A 1SUMB 1UCUA 4AKRB 1KNZA 2JQ9A 2LHRA 5HWXA 1IAPA 4YT0A 5JDFA 4DR7T 3O4XE 2BS3A 4YSXA 4CXXA 3ZMTB 2A9UA 5IYZE 2V1DB 1IBMT 4XAXB 1BR4A 3T8OA 3ZMVB 5AQFB 1MMDA 1OXZA 3CIRA 2DL1A 2CE7A 4ZS2A 1LVKA 1UX5A 5AQUB 4Q25A 2H7VC 2HPLA 2KMFA 3ZT7A 4LF9T 1BR2A 5AQIB 3HKEE 2VB6A 1WFDA 1D0XA 3PUWF 1NENA 3Q2MA 4HEAA 4DV0T 2UXBT 5IHYA 4CZZB 1SE7A 2BG9B 3MK7C 3MKDA 3T1YT 4DR6T 2D9DA 2X68A 1J5WA 3NBXX 2JJ9A 2NOXA 3N9QA 3QOFA 5JDQA 2EHOA 3H3AA 2MOZA 3EI0A 4DMVA 5FL1A 3OYZA 2NTYA 3NVOA 4QH4A 5H6RB 2V7IA 5GONE 1N33T 5M4YA 5HXEA 4OFZA 3K3NA 3ETVA 3L39A 4UVCB 3P4RA 4O4IE 2LSIA 2XQ4A 2PFVA 4UV9B 4MFRA 5HXCA 1XDPA 5FVKA 1FMVA 2KZ7B 5CFBA 4K0UA 5JDLA 1UURA 5C2TA 4EEDA 4G63A 3UU3A 2BS2A 2VURA 5FY1A 4P0AA 4X66T 3CX7B 3UU4A 4YHHT 2YU1A 2VQFT 3M3ZB 4HWHA 4B3RT 1G8XA 2LSGA 4C91A 2FBWA 4CQIA 5LHGB 2W66A 3OJAA 2XSBA 3Q5XA 2XY8B 4U74A 2LM9A 2XQAA 1YW0A 4KX6A 1UK5A 3VRAA 3VHLA 3ZN1B 3UQ4A 4ILUA 5LG3A 4O4HE 4ADZA 2Q9QA 3NRXA 4YTNA 4JI6T 4AQFA 4I55E 3KV6A 4I50E 2WWVA 1SHZC 4IE7A 5H6QB 4DIDB 3PTRB 2DLRA 4LF5T 3O1IA 2BZBA 3ZSSA 5IWAT 1E7PA 3E22E 1T8BA 1N32T 3RIUA 1MMNA 4HFCA 3P4SA 3TLVA 5C8YE 3VKHA 2JQKA 2LM2A 3P4PA 4I0UA 4M1PA 2QGSA 1MNEA 3PV0F 4IE0A 4PK4A 3RIAA 4AXPA 4ILBA 1MMAA 5HAXA 2XUEA 5JVDE 4X64T 2V7KA 5JRCB 3CQCB 3FZHB 2LJLA 4Z90A 2BS4A 3PUXF 2BKNA 5CB4E 2WM9A 3H3MA 3OVUA 3Q9DA 3C98B 4A5XA 1OEDA 2PJQA 4OK0A 3AEFA 3ZMZB 4PJMA 2KLQA 3LK3B 1J1JA 1IBKT 2J1DG 1HX1B 2WQYA 4DBQA 4DNDA 2ACZA 3B57A 3MJXA 2IAKA 5DJQC 2KXPB 4JI5T 5IUXA 5FNVE 4O2AE 2XHEB 3AXJB 3KINB 4CXWA 1W0BA 5KX5E 3EDUA 5FYMA 4EXTA 2E5LT 2XTLA 3PURA 5JREA 2WWUA 4CI2B 3P7IA 3PUSA 5JR9B 1Z8UA 2RP4A 3ZC0A 4H9OC 2XAHB 5L4HA 5HCJA 1OEDE 3JAEA 3F2EA 1D1AA 2WBLA 3AAEB 2P9BA 3N2KE 4OYJA 5DQWA 5TAOA 4DUYT 4LF6T 3GWHA 1HCIA 3AEEA 2UUAT 2LEHA 3FZFB 4HWIB 1NAFA 3F31A 5LBMA 4PNIA 1Y01A 3EABA 5LA6E 4ZXLA 2IDOB 3K8PC 2NW7A 3GN5A 4KI0F 3P4QA 2K24A 2BKOA 4DV6T 3W15B 3RRCA 2KT9A 4B3MT 3MA9A 4AKGA 4AISA 3ONLC 2XQ5A 4CN4A 2LSJA 2N1GA 4JI4T 3GMIA 4EZHA 4WZXA 3SOLA 2W4XA 3FBZA 3MZKB 3KV9A 3J9X1 5AQMB 1HNWT 4U72A 5A1LA 2C5JA 2G0UA 2UXCT 4NUVA 4TX5A 4GOUA 3J7Yq 3CQXC 3AECA 5LGTB 1S94A 4QKNA 4IDNA 2CWYA 4TWFA 3LK2B 5CJ5A 4GKKT 4YXDA 5L2LA 2RA1A 2YDQA 5JRCA 4NXMT 3ZCJA 4PK5A 2X0YA 4X65T 2DCFA 1HR0T 4TWHA 2X9XA 2HN1A 4IGUA 1ZP0A 2BBJA 2EHOB 4HFDA 2BVMA 1IJ5A 3WAJA 4U2ZA 5CGMA 1WYBA 3CMLA 1MMGA 2YOEA 3K3OA 3TLWA 1D1BA 3N9OA 3UU5A 1WRDA 3AE3A 3ZYMA 3FB2A 1OWAA 4DV5T 3N2OA 5LG4A 3U78A 2J62A 4TV9E 2X9YA 1CUNA 2LOSA 3RHWA 1XWMA 4GIWA 3VU7H 2IC9A 2KWIB 1M62A 2VKDA 3AE5A 2X0LB 3HA4A 3DJBA 2KSRA 4PAGA 3PJAJ 4ISSA 2D2SA 3N9LA 3ZSTA 2JMKA 4B3TT 2OLTA 5AQOB 3O1HA 3LSVA 2W2UA 4HFEA 5F8PA 1WR0A 1US7B 3RKOA 4EOZB 3A8YC 2CHOA 4DR4T 5EK3A 4YTPA 2OA5A 5LGUB 1X79A 3AA7B 2Q9QB 1Z0PA 1JNZA 2NWBA 3LG7A 4DVDA 5AQHB 5HEOA 4O2BE 5LHHB 2K5BB 5DABA 4AIUA 2W0GA 5AQPB 5AFUL 4UVBB 2X51A 3SS1A 5KDMC 4DV2T 4J2CA 5HXRA 4A56A 4O4JE 3N9PA 4YLHA 3VKGA 5ABFA 1U5PA 2XM1A 2UXXB 4PJNA 2ES0A 3CPZA 3EHZA 5HEGA 2E9XD 1YD8G 2CM0A 4YJ3E 3RKGA 3AEDA 5ABHA 5J2UE 4QXBB 3I9WA 4OYKA 3RGLA 2AE9A 4QWNB 1VOMA 3CX6B 4H63H 2LLYA 3C50A 4UXNB 5L47A 1J5ET 3RC8A 2W67A 1OEDB 2IHR1 2HH7A 3P4WA 1VRBA 2HN2A 1HNZT 5JDNA 3K1SA 3HL6A 2X9HA 3KBUA 4DR5T 3FZLB 3N9NA 4HFIA 5F5WA 4DV4T 3QC9A 4JI2T 2XJ7A 3JAFA 1EZ3A 2I6HA 3GA8A 4LFAT 2V7LA 5EZYE 2W61A 2L8KA 4QX8B 4JLEA 4COFA 2XQ8A 1KNRA 2HPJA 5CA0E 5AQLB 4N78D 4H9SE 5HXHA 3FBLA 4P0BA 4HKAA 2X67A 4I43B 2WDRA 2ZM0A 5FVLA 3KV5A 4EIWA 2N2NA 2XSAA 2JIWA 5FXWA 5EK2A 1L0VA 2WCAA 4AKHA 2KNDA 4V1Av 3IBPA 1VCTA 5E0OA 3H37A 2OV9A 2H7OA 3C4WA 3A7MA 1FIOA 1UUSA 1YKHB 3GN5B 3EAMA 2VASA 3I9YA 4IE4A 4UV8B 2YKSA 2ODVA 3HR0A 2ZMAA 2LRLA 1E2AA 5JH7E 4TNVA 4WNKA 3CX8B 4A97A 5FXXA 2CEAA 1KF6A 1D0ZA 2XASB 3WI3A 3ZKRA 2AXDS 2WZHA 4KBMB 4WBOA 3RH3A 3UFEA 2XAQB 3KV4A 2BVLA 2Y48B 5ADXL 2YDSA 1BR0A 3Q5EA 3RF1A 2YU2A 3TLTA 1XNRT 2Y8DA 2DNXA 5J0ZA 3CKDA 4EEBA 3CK6A 4ZI2C 2LHNA 2C5IT 3IEEA 2B76A 2JRKA 2PG8A 5LJNA 2J4GA 2XAFB 4H9PC 1S35A 5AQKB 3PJAA 2XQ7A 1IBLT 3JADA 4OX9T 5L3BB 4DUZT 3FXDB 4F6RC 3OTOT 3N2GE 4JV5T 4UF0A 4IDOA 4JI8T 2J47A 1E1HB 4HFHA 2NR4A 4JEUB 2CMRA 4AI6A 4NIQA 3AE2A 2WS3A 2L9QA 3HKDE 1YQ3A 3E08A 1XMOT 1HFAA 4C90A 4HFBA 5FL0A 4UELA 5JDGA 2E9XC 3UUXB 3PU8A 4PK6A 4ZHQE 3B5MA 4H9NC 3QB5K 1UX4A 4KHZF 3PUYF 4QH1A 3FZKB 3ONXA 3AEBA 4PFPA 1XDOA 4KP3C 5HEHA 4QH5A 2VVNA 2XZEA 2VL0A 4U7IA 2V6YA 3VR8A 2CA5A 2V26A 3AA6B 4L0RA 3RQUA 4E7SA 1FEWA 3U3IA 4XZCA 3QUJA 4ZEYA 3R6NA 2NW8A 5FXZA 2UU9T 1HG5A 2ZLYA 3KVAA 1U4QA 4KUMB 2IIUA 3QNUA 1JNRA 5ETWA 4L5GA 3QB5A 4YSZA 4DO0A 3SRZA 2WB5A 4H9RC 4CI1B 1X9BA 3ZCIA 5LB7B 3ETUA 4CXYA 4GKJT 5JDHA 2VWAA 5LP6E 4DR2T 2WU2A 3RYHE 3Q5WA 1Y64B 2Z6EA 5HWYA 4LMJA 3RPUA 2W62A 3PUZF 4Z8XA 1LRZA 2QA7A 5ABFB 4HFVA 4L9IA 2FJBA 5FP3A 4AQFC 3RC3A 5KXJA 3JC6C 2MYSA 4MALA 4TZ4C 2V6XA 4ILAA 2V8SV 2CCQA 2Y6XA 3A5XA 4LFBT 2CWOA 1D1CA 4LMKA 2BBHA 2XAGB 1WCRA 3BK9A 2CBJA 4B6XA 4EGWA 4YTMA 1HX8A 4TUYE 2LKHA 2XQ9A 4X62T 2CBIA 1ZV4X 4TV8E 3AEGA 2WU5A 3LFMA 4XBFB 4ZI7E 3ZMUB 5J1GA 1CHUA 5FMNA 1OEDC 4IDPA 2BG9C 2LE8A 4YFSA 4EYYR 2JMHA 2UUBT 2VKJA 3EUHA 2E8IA 1IJ6A 2SPCA 2UXNB 3UULA 2E5VA 4O8SA 3L09A 3NRYA 2I59A 4IREA 4UVAB 2A3DA 5L3CB 3E0ZA 4PFOA 1MIVA 4HGAA 2VVSA 3AVRA 3L3PA 3ZT5A 4IIJE 3UT5E 2VQET 3UTKA 2H3RA 3RRWA 2K9AA 3DP7A 4DV3T 3N5LA 2DI4A 2GK9A 2CXDA 4ZI3C 2CPTA 3AEAA 5AQNB 1HNXT 3AA0B 2JQHA 4TWDA 2MTQA 2FJEA 4JI3T 1HG2A 2X66A 4NUUA 4P09A 1WYCA 3ABVA 2D5UA 5LXTE 1MIYA 3NKZA 4JEHB 3AE9A 3ANWA 3C4XA 4X5TA 3ZMSB 4ZI2D 2CLYB 5AQQB 4K0KT 5C3JA 3IA3A 3X1DA 2D0TA 3KFWX 5LMNT 4NXNT 2WDQA 4IE5A 2K3WA 3S4UA 4TNWA 4BJNA 4X20E 5LJMA 3WAKA 5AQRB 4BJMA 4CI3B 5FXVA 1T98A 1HF8A 4JYAT 3RYFE 2H89A 2PTFA 1XNQT 1YKEB 5L3GB 3CVRA 5CA1E 2VL8A 4LF4T 2LT3A 5LMUT 2EHOD 3AE7A 5LOVE 5ABGA 1O3XA 3F57A 2I0MA 3PUVF 1MNDA 4QXCB 1G73A 4ILCA 4BA9A 3AE1A 4GK0E 3KDSE 3KBTA 4BAYB 2NTXA 3PUAA 2VKHA 2VK9A 3ONJA 3RQWA 4UF0B 3BQKA 1LVFA 3P8CD 2YINA 1W0AA 2W00A 2WP9A 3FXEB 1VCSA 3ESLA 2FJDA 4ZZBA 3AE6A 4YY3T 4IDZA 1ZKEA 3ZJ1A 1KEYA 3OKQA 1GQEA 3KVBA 1H7CA 4ZZCA 4HWCA 3RYIE 2E9XA 2DHRA 3R84B 2WMNA 2XM2A 5LHIB 5HEUA 3LBXA 2V6YB 5DQVA 4U7YA 1T72A 1WR6A 1W09A 3CQGB 4H63V 4FI5A 4EZ4A 3K3QC 4UIGA 3AAAB 3RI5A 3UQ7A 2DWKA 3M65A 5AQVB 4HTEA 4PW8A 1M7KA 2Q9QD 4QXHB 1N36T 3TLSA 3ZPOA 2MPKA 2V7JA 1QUUA 3JC6D 3O1JA 5L4EA 5LYJE 2JQQA 3T1HT 2YK0A 5FY7A 3AE4A 2QVAA 2CXFA 3TKLB 1FMWA 1SA0E 5JR9C 3OPCA 4DMWA 4CN6A 2WMOA 4LF7T 2BKPA 4Z91A 4IHJE 3P50A 4IL4A 3O9XA 1ZOYA 4ZS3A 1HS7A 1D0YA 2ZM8A 4O4LE 4KHPT 4AQYT 4WYVA 3VR9A 3C51A 3VRBA 2XPKA 3N9MA 3D0TA 3RLFF 3AE8A 3LK42 2RPAA 3CWZB 4NPPA 5AQJB 2IC6A 2ODUA 3HKBE 5EK4A 5FY0A 2IW5B 3AAIA 2E2AA 2V5CA 4U31A 4B3ST 2R6GF 3QK6A 5J2TE 4A98A 3NZPA 1I94T 2LKGA 3BQLA 4JBWF 2LSKA 2F4VT 4DBRA 4OHFA 2A72A 3I1AA 4EB6E 2HHHT 4X1KE 2CRBA 2QYWA 4UEMA 4ERRA 4ZI3D 2V7MA 5JTGA 3FZMB 4LFCT 3EVYA 4HWDA 2XQYA 3IF8B 2BG9A 2YN6A 3ZEFB 2FJAA 2QRXA 4JUYA 2IUBA 4GYRA 4YJ2E 2KINB 2EHOC 4HN9A 3ZN0B 3BQIA 4HWFA 4IE6A 3IHRA 4MHCA 1NWMX 1MIWA 3G06A 5HXSA 1T7SA 2X9WA 3ZLIA 2LOPA 2MBGA 2V5DA 2ZM2A 4JI7T 4AKLA 5AQGB 4U3CA 3PU3A 1I6ZA 3AVSA 1QLBA 2XAJB 4GK5E 4WW0A 1HTJF 1DU2A 3HKCE 4G2AA 2MAWA 3ZYKA 3C4ZA 1BR1A 3EDVA 5LBQB 4F8HA 3ANWB 4I4TE 3FHNA 5JQGE 3JCFA 4U33A 1QSDA 3MACA 4IL9A 2BG9E 5L3FB 3LDQB 3OYXA 2UUCT 3V5SA 3HI2A 4ZOLE 4DV1T 2UXDT 4QX7B 2VKOA 2BDEA 3I0QA 2JPFA 2WY2A 2CLYC 4ISTA 2Q9QC 4QHOA 4ASKA 2M67A 5KMGP 3PE0A 5AQTB 4EAHA 3OBVE 4YHJA 3ZJ2A 4UR9A 5L3EB 3DTOA 3UUMA 1R8IA 2C0SA 5HEJA 4KMCA 1XZYA 3RIUC 4AQGA 2YEVC 3ZT6A 3V5UA 4DR1T 5BR8T 3AB3B 3NWIA 3ZYLA 3UU8A 3RX6A 2WAUA 4EYUA 1WLXA 1YXRA 4DR3T 1UGOA 3B13A 4PJJA 2W63A 2YDRA 1KK7A
chains in the Genus database with same CATH topology
4HWDA 4HWIB 1UK5A 2D9DA 5AQIB 1HX1B 5AQRB 5AQNB 1T7SA 5AQSB 5AQFB 5AQQB 4HWCA 4HWHA 3M3ZB 5AQOB 1M62A 3LDQB 3FZLB 5AQHB 5AQTB 3FZHB 5AQLB 5AQJB 1UGOA 3FZKB 5AQGB 5AQMB 4HWFA 5AQVB 3A8YC 1I6ZA 5AQUB 5AQKB 5AQPB 1M7KA 3FZMB 3FZFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HWD A;  4HWI B;  1UK5 A;  2D9D A;  5AQI B;  1HX1 B;  5AQR B;  5AQN B;  1T7S A;  5AQS B;  5AQF B;  5AQQ B;  4HWC A;  4HWH A;  3M3Z B;  5AQO B;  1M62 A;  3LDQ B;  3FZL B;  5AQH B;  5AQT B;  3FZH B;  5AQL B;  5AQJ B;  1UGO A;  3FZK B;  5AQG B;  5AQM B;  4HWF A;  5AQV B;  3A8Y C;  1I6Z A;  5AQU B;  5AQK B;  5AQP B;  1M7K A;  3FZM B;  3FZF B; 
#chains in the Genus database with same CATH topology
 4P1N A;  4AKI A;  3Q5D A;  3MXZ A;  5HCM A;  2M6I A;  4LF8 T;  4HE8 A;  3RIF A;  2A2F X;  4WBN E;  2M6B A;  2KWH A;  3UUB A;  4YSY A;  3C64 A;  2FUP A;  4U2Y A;  4E7Z A;  4H9Q C;  2WDV A;  5L3D B;  2L3L A;  1XMQ T;  4EV6 A;  3SFE A;  2H88 A;  2E9X B;  1KNP A;  3I0O A;  1IZN B;  3TLU A;  5F3J A;  1YQ4 A;  2WZI A;  4GYS A;  4IDQ A;  1FJG T;  2PBI A;  2LSY A;  2CXL A;  3LBX B;  4JI1 T;  3SWH A;  5ABE A;  2NP9 A;  2X0H A;  3NZQ A;  1V9D A;  5LNK A;  2ACX A;  4DV7 T;  1AJ3 A;  4IT4 A;  4X1Y E;  1ZHC A;  3UUN A;  2CHN A;  1ZEE A;  3PDY A;  3AA1 B;  2N9D A;  3PUG A;  3SFD A;  5HYA A;  2B1E A;  2D0U A;  4LML A;  5LCY A;  5BMV E;  3AXJ A;  5JDM A;  4FJO A;  2XQ6 A;  4MLK A;  2ZM6 T;  4X1I E;  5FKY A;  2WSS V;  3L8R A;  3ZC1 A;  3UFG A;  1N34 T;  2IML A;  1NEK A;  3RYC E;  5JR9 A;  4MBQ A;  2NW9 A;  4PJL A;  5AQS B;  1B7T A;  4JI0 T;  2LRK A;  1LKX A;  2C5K T;  1W9R A;  3LJC A;  4CN1 A;  4ANJ A;  3UU6 A;  5LGN B;  1KFY A;  4TN7 B;  2DWG A;  2XQ3 A;  3PUQ A;  2K48 A;  1SUM B;  1UCU A;  4AKR B;  1KNZ A;  2JQ9 A;  2LHR A;  5HWX A;  1IAP A;  4YT0 A;  5JDF A;  4DR7 T;  3O4X E;  2BS3 A;  4YSX A;  4CXX A;  3ZMT B;  2A9U A;  5IYZ E;  2V1D B;  1IBM T;  4XAX B;  1BR4 A;  3T8O A;  3ZMV B;  5AQF B;  1MMD A;  1OXZ A;  3CIR A;  2DL1 A;  2CE7 A;  4ZS2 A;  1LVK A;  1UX5 A;  5AQU B;  4Q25 A;  2H7V C;  2HPL A;  2KMF A;  3ZT7 A;  4LF9 T;  1BR2 A;  5AQI B;  3HKE E;  2VB6 A;  1WFD A;  1D0X A;  3PUW F;  1NEN A;  3Q2M A;  4HEA A;  4DV0 T;  2UXB T;  5IHY A;  4CZZ B;  1SE7 A;  2BG9 B;  3MK7 C;  3MKD A;  3T1Y T;  4DR6 T;  2D9D A;  2X68 A;  1J5W A;  3NBX X;  2JJ9 A;  2NOX A;  3N9Q A;  3QOF A;  5JDQ A;  2EHO A;  3H3A A;  2MOZ A;  3EI0 A;  4DMV A;  5FL1 A;  3OYZ A;  2NTY A;  3NVO A;  4QH4 A;  5H6R B;  2V7I A;  5GON E;  1N33 T;  5M4Y A;  5HXE A;  4OFZ A;  3K3N A;  3ETV A;  3L39 A;  4UVC B;  3P4R A;  4O4I E;  2LSI A;  2XQ4 A;  2PFV A;  4UV9 B;  4MFR A;  5HXC A;  1XDP A;  5FVK A;  1FMV A;  2KZ7 B;  5CFB A;  4K0U A;  5JDL A;  1UUR A;  5C2T A;  4EED A;  4G63 A;  3UU3 A;  2BS2 A;  2VUR A;  5FY1 A;  4P0A A;  4X66 T;  3CX7 B;  3UU4 A;  4YHH T;  2YU1 A;  2VQF T;  3M3Z B;  4HWH A;  4B3R T;  1G8X A;  2LSG A;  4C91 A;  2FBW A;  4CQI A;  5LHG B;  2W66 A;  3OJA A;  2XSB A;  3Q5X A;  2XY8 B;  4U74 A;  2LM9 A;  2XQA A;  1YW0 A;  4KX6 A;  1UK5 A;  3VRA A;  3VHL A;  3ZN1 B;  3UQ4 A;  4ILU A;  5LG3 A;  4O4H E;  4ADZ A;  2Q9Q A;  3NRX A;  4YTN A;  4JI6 T;  4AQF A;  4I55 E;  3KV6 A;  4I50 E;  2WWV A;  1SHZ C;  4IE7 A;  5H6Q B;  4DID B;  3PTR B;  2DLR A;  4LF5 T;  3O1I A;  2BZB A;  3ZSS A;  5IWA T;  1E7P A;  3E22 E;  1T8B A;  1N32 T;  3RIU A;  1MMN A;  4HFC A;  3P4S A;  3TLV A;  5C8Y E;  3VKH A;  2JQK A;  2LM2 A;  3P4P A;  4I0U A;  4M1P A;  2QGS A;  1MNE A;  3PV0 F;  4IE0 A;  4PK4 A;  3RIA A;  4AXP A;  4ILB A;  1MMA A;  5HAX A;  2XUE A;  5JVD E;  4X64 T;  2V7K A;  5JRC B;  3CQC B;  3FZH B;  2LJL A;  4Z90 A;  2BS4 A;  3PUX F;  2BKN A;  5CB4 E;  2WM9 A;  3H3M A;  3OVU A;  3Q9D A;  3C98 B;  4A5X A;  1OED A;  2PJQ A;  4OK0 A;  3AEF A;  3ZMZ B;  4PJM A;  2KLQ A;  3LK3 B;  1J1J A;  1IBK T;  2J1D G;  1HX1 B;  2WQY A;  4DBQ A;  4DND A;  2ACZ A;  3B57 A;  3MJX A;  2IAK A;  5DJQ C;  2KXP B;  4JI5 T;  5IUX A;  5FNV E;  4O2A E;  2XHE B;  3AXJ B;  3KIN B;  4CXW A;  1W0B A;  5KX5 E;  3EDU A;  5FYM A;  4EXT A;  2E5L T;  2XTL A;  3PUR A;  5JRE A;  2WWU A;  4CI2 B;  3P7I A;  3PUS A;  5JR9 B;  1Z8U A;  2RP4 A;  3ZC0 A;  4H9O C;  2XAH B;  5L4H A;  5HCJ A;  1OED E;  3JAE A;  3F2E A;  1D1A A;  2WBL A;  3AAE B;  2P9B A;  3N2K E;  4OYJ A;  5DQW A;  5TAO A;  4DUY T;  4LF6 T;  3GWH A;  1HCI A;  3AEE A;  2UUA T;  2LEH A;  3FZF B;  4HWI B;  1NAF A;  3F31 A;  5LBM A;  4PNI A;  1Y01 A;  3EAB A;  5LA6 E;  4ZXL A;  2IDO B;  3K8P C;  2NW7 A;  3GN5 A;  4KI0 F;  3P4Q A;  2K24 A;  2BKO A;  4DV6 T;  3W15 B;  3RRC A;  2KT9 A;  4B3M T;  3MA9 A;  4AKG A;  4AIS A;  3ONL C;  2XQ5 A;  4CN4 A;  2LSJ A;  2N1G A;  4JI4 T;  3GMI A;  4EZH A;  4WZX A;  3SOL A;  2W4X A;  3FBZ A;  3MZK B;  3KV9 A;  3J9X 1;  5AQM B;  1HNW T;  4U72 A;  5A1L A;  2C5J A;  2G0U A;  2UXC T;  4NUV A;  4TX5 A;  4GOU A;  3J7Y q;  3CQX C;  3AEC A;  5LGT B;  1S94 A;  4QKN A;  4IDN A;  2CWY A;  4TWF A;  3LK2 B;  5CJ5 A;  4GKK T;  4YXD A;  5L2L A;  2RA1 A;  2YDQ A;  5JRC A;  4NXM T;  3ZCJ A;  4PK5 A;  2X0Y A;  4X65 T;  2DCF A;  1HR0 T;  4TWH A;  2X9X A;  2HN1 A;  4IGU A;  1ZP0 A;  2BBJ A;  2EHO B;  4HFD A;  2BVM A;  1IJ5 A;  3WAJ A;  4U2Z A;  5CGM A;  1WYB A;  3CML A;  1MMG A;  2YOE A;  3K3O A;  3TLW A;  1D1B A;  3N9O A;  3UU5 A;  1WRD A;  3AE3 A;  3ZYM A;  3FB2 A;  1OWA A;  4DV5 T;  3N2O A;  5LG4 A;  3U78 A;  2J62 A;  4TV9 E;  2X9Y A;  1CUN A;  2LOS A;  3RHW A;  1XWM A;  4GIW A;  3VU7 H;  2IC9 A;  2KWI B;  1M62 A;  2VKD A;  3AE5 A;  2X0L B;  3HA4 A;  3DJB A;  2KSR A;  4PAG A;  3PJA J;  4ISS A;  2D2S A;  3N9L A;  3ZST A;  2JMK A;  4B3T T;  2OLT A;  5AQO B;  3O1H A;  3LSV A;  2W2U A;  4HFE A;  5F8P A;  1WR0 A;  1US7 B;  3RKO A;  4EOZ B;  3A8Y C;  2CHO A;  4DR4 T;  5EK3 A;  4YTP A;  2OA5 A;  5LGU B;  1X79 A;  3AA7 B;  2Q9Q B;  1Z0P A;  1JNZ A;  2NWB A;  3LG7 A;  4DVD A;  5AQH B;  5HEO A;  4O2B E;  5LHH B;  2K5B B;  5DAB A;  4AIU A;  2W0G A;  5AQP B;  5AFU L;  4UVB B;  2X51 A;  3SS1 A;  5KDM C;  4DV2 T;  4J2C A;  5HXR A;  4A56 A;  4O4J E;  3N9P A;  4YLH A;  3VKG A;  5ABF A;  1U5P A;  2XM1 A;  2UXX B;  4PJN A;  2ES0 A;  3CPZ A;  3EHZ A;  5HEG A;  2E9X D;  1YD8 G;  2CM0 A;  4YJ3 E;  3RKG A;  3AED A;  5ABH A;  5J2U E;  4QXB B;  3I9W A;  4OYK A;  3RGL A;  2AE9 A;  4QWN B;  1VOM A;  3CX6 B;  4H63 H;  2LLY A;  3C50 A;  4UXN B;  5L47 A;  1J5E T;  3RC8 A;  2W67 A;  1OED B;  2IHR 1;  2HH7 A;  3P4W A;  1VRB A;  2HN2 A;  1HNZ T;  5JDN A;  3K1S A;  3HL6 A;  2X9H A;  3KBU A;  4DR5 T;  3FZL B;  3N9N A;  4HFI A;  5F5W A;  4DV4 T;  3QC9 A;  4JI2 T;  2XJ7 A;  3JAF A;  1EZ3 A;  2I6H A;  3GA8 A;  4LFA T;  2V7L A;  5EZY E;  2W61 A;  2L8K A;  4QX8 B;  4JLE A;  4COF A;  2XQ8 A;  1KNR A;  2HPJ A;  5CA0 E;  5AQL B;  4N78 D;  4H9S E;  5HXH A;  3FBL A;  4P0B A;  4HKA A;  2X67 A;  4I43 B;  2WDR A;  2ZM0 A;  5FVL A;  3KV5 A;  4EIW A;  2N2N A;  2XSA A;  2JIW A;  5FXW A;  5EK2 A;  1L0V A;  2WCA A;  4AKH A;  2KND A;  4V1A v;  3IBP A;  1VCT A;  5E0O A;  3H37 A;  2OV9 A;  2H7O A;  3C4W A;  3A7M A;  1FIO A;  1UUS A;  1YKH B;  3GN5 B;  3EAM A;  2VAS A;  3I9Y A;  4IE4 A;  4UV8 B;  2YKS A;  2ODV A;  3HR0 A;  2ZMA A;  2LRL A;  1E2A A;  5JH7 E;  4TNV A;  4WNK A;  3CX8 B;  4A97 A;  5FXX A;  2CEA A;  1KF6 A;  1D0Z A;  2XAS B;  3WI3 A;  3ZKR A;  2AXD S;  2WZH A;  4KBM B;  4WBO A;  3RH3 A;  3UFE A;  2XAQ B;  3KV4 A;  2BVL A;  2Y48 B;  5ADX L;  2YDS A;  1BR0 A;  3Q5E A;  3RF1 A;  2YU2 A;  3TLT A;  1XNR T;  2Y8D A;  2DNX A;  5J0Z A;  3CKD A;  4EEB A;  3CK6 A;  4ZI2 C;  2LHN A;  2C5I T;  3IEE A;  2B76 A;  2JRK A;  2PG8 A;  5LJN A;  2J4G A;  2XAF B;  4H9P C;  1S35 A;  5AQK B;  3PJA A;  2XQ7 A;  1IBL T;  3JAD A;  4OX9 T;  5L3B B;  4DUZ T;  3FXD B;  4F6R C;  3OTO T;  3N2G E;  4JV5 T;  4UF0 A;  4IDO A;  4JI8 T;  2J47 A;  1E1H B;  4HFH A;  2NR4 A;  4JEU B;  2CMR A;  4AI6 A;  4NIQ A;  3AE2 A;  2WS3 A;  2L9Q A;  3HKD E;  1YQ3 A;  3E08 A;  1XMO T;  1HFA A;  4C90 A;  4HFB A;  5FL0 A;  4UEL A;  5JDG A;  2E9X C;  3UUX B;  3PU8 A;  4PK6 A;  4ZHQ E;  3B5M A;  4H9N C;  3QB5 K;  1UX4 A;  4KHZ F;  3PUY F;  4QH1 A;  3FZK B;  3ONX A;  3AEB A;  4PFP A;  1XDO A;  4KP3 C;  5HEH A;  4QH5 A;  2VVN A;  2XZE A;  2VL0 A;  4U7I A;  2V6Y A;  3VR8 A;  2CA5 A;  2V26 A;  3AA6 B;  4L0R A;  3RQU A;  4E7S A;  1FEW A;  3U3I A;  4XZC A;  3QUJ A;  4ZEY A;  3R6N A;  2NW8 A;  5FXZ A;  2UU9 T;  1HG5 A;  2ZLY A;  3KVA A;  1U4Q A;  4KUM B;  2IIU A;  3QNU A;  1JNR A;  5ETW A;  4L5G A;  3QB5 A;  4YSZ A;  4DO0 A;  3SRZ A;  2WB5 A;  4H9R C;  4CI1 B;  1X9B A;  3ZCI A;  5LB7 B;  3ETU A;  4CXY A;  4GKJ T;  5JDH A;  2VWA A;  5LP6 E;  4DR2 T;  2WU2 A;  3RYH E;  3Q5W A;  1Y64 B;  2Z6E A;  5HWY A;  4LMJ A;  3RPU A;  2W62 A;  3PUZ F;  4Z8X A;  1LRZ A;  2QA7 A;  5ABF B;  4HFV A;  4L9I A;  2FJB A;  5FP3 A;  4AQF C;  3RC3 A;  5KXJ A;  3JC6 C;  2MYS A;  4MAL A;  4TZ4 C;  2V6X A;  4ILA A;  2V8S V;  2CCQ A;  2Y6X A;  3A5X A;  4LFB T;  2CWO A;  1D1C A;  4LMK A;  2BBH A;  2XAG B;  1WCR A;  3BK9 A;  2CBJ A;  4B6X A;  4EGW A;  4YTM A;  1HX8 A;  4TUY E;  2LKH A;  2XQ9 A;  4X62 T;  2CBI A;  1ZV4 X;  4TV8 E;  3AEG A;  2WU5 A;  3LFM A;  4XBF B;  4ZI7 E;  3ZMU B;  5J1G A;  1CHU A;  5FMN A;  1OED C;  4IDP A;  2BG9 C;  2LE8 A;  4YFS A;  4EYY R;  2JMH A;  2UUB T;  2VKJ A;  3EUH A;  2E8I A;  1IJ6 A;  2SPC A;  2UXN B;  3UUL A;  2E5V A;  4O8S A;  3L09 A;  3NRY A;  2I59 A;  4IRE A;  4UVA B;  2A3D A;  5L3C B;  3E0Z A;  4PFO A;  1MIV A;  4HGA A;  2VVS A;  3AVR A;  3L3P A;  3ZT5 A;  4IIJ E;  3UT5 E;  2VQE T;  3UTK A;  2H3R A;  3RRW A;  2K9A A;  3DP7 A;  4DV3 T;  3N5L A;  2DI4 A;  2GK9 A;  2CXD A;  4ZI3 C;  2CPT A;  3AEA A;  5AQN B;  1HNX T;  3AA0 B;  2JQH A;  4TWD A;  2MTQ A;  2FJE A;  4JI3 T;  1HG2 A;  2X66 A;  4NUU A;  4P09 A;  1WYC A;  3ABV A;  2D5U A;  5LXT E;  1MIY A;  3NKZ A;  4JEH B;  3AE9 A;  3ANW A;  3C4X A;  4X5T A;  3ZMS B;  4ZI2 D;  2CLY B;  5AQQ B;  4K0K T;  5C3J A;  3IA3 A;  3X1D A;  2D0T A;  3KFW X;  5LMN T;  4NXN T;  2WDQ A;  4IE5 A;  2K3W A;  3S4U A;  4TNW A;  4BJN A;  4X20 E;  5LJM A;  3WAK A;  5AQR B;  4BJM A;  4CI3 B;  5FXV A;  1T98 A;  1HF8 A;  4JYA T;  3RYF E;  2H89 A;  2PTF A;  1XNQ T;  1YKE B;  5L3G B;  3CVR A;  5CA1 E;  2VL8 A;  4LF4 T;  2LT3 A;  5LMU T;  2EHO D;  3AE7 A;  5LOV E;  5ABG A;  1O3X A;  3F57 A;  2I0M A;  3PUV F;  1MND A;  4QXC B;  1G73 A;  4ILC A;  4BA9 A;  3AE1 A;  4GK0 E;  3KDS E;  3KBT A;  4BAY B;  2NTX A;  3PUA A;  2VKH A;  2VK9 A;  3ONJ A;  3RQW A;  4UF0 B;  3BQK A;  1LVF A;  3P8C D;  2YIN A;  1W0A A;  2W00 A;  2WP9 A;  3FXE B;  1VCS A;  3ESL A;  2FJD A;  4ZZB A;  3AE6 A;  4YY3 T;  4IDZ A;  1ZKE A;  3ZJ1 A;  1KEY A;  3OKQ A;  1GQE A;  3KVB A;  1H7C A;  4ZZC A;  4HWC A;  3RYI E;  2E9X A;  2DHR A;  3R84 B;  2WMN A;  2XM2 A;  5LHI B;  5HEU A;  3LBX A;  2V6Y B;  5DQV A;  4U7Y A;  1T72 A;  1WR6 A;  1W09 A;  3CQG B;  4H63 V;  4FI5 A;  4EZ4 A;  3K3Q C;  4UIG A;  3AAA B;  3RI5 A;  3UQ7 A;  2DWK A;  3M65 A;  5AQV B;  4HTE A;  4PW8 A;  1M7K A;  2Q9Q D;  4QXH B;  1N36 T;  3TLS A;  3ZPO A;  2MPK A;  2V7J A;  1QUU A;  3JC6 D;  3O1J A;  5L4E A;  5LYJ E;  2JQQ A;  3T1H T;  2YK0 A;  5FY7 A;  3AE4 A;  2QVA A;  2CXF A;  3TKL B;  1FMW A;  1SA0 E;  5JR9 C;  3OPC A;  4DMW A;  4CN6 A;  2WMO A;  4LF7 T;  2BKP A;  4Z91 A;  4IHJ E;  3P50 A;  4IL4 A;  3O9X A;  1ZOY A;  4ZS3 A;  1HS7 A;  1D0Y A;  2ZM8 A;  4O4L E;  4KHP T;  4AQY T;  4WYV A;  3VR9 A;  3C51 A;  3VRB A;  2XPK A;  3N9M A;  3D0T A;  3RLF F;  3AE8 A;  3LK4 2;  2RPA A;  3CWZ B;  4NPP A;  5AQJ B;  2IC6 A;  2ODU A;  3HKB E;  5EK4 A;  5FY0 A;  2IW5 B;  3AAI A;  2E2A A;  2V5C A;  4U31 A;  4B3S T;  2R6G F;  3QK6 A;  5J2T E;  4A98 A;  3NZP A;  1I94 T;  2LKG A;  3BQL A;  4JBW F;  2LSK A;  2F4V T;  4DBR A;  4OHF A;  2A72 A;  3I1A A;  4EB6 E;  2HHH T;  4X1K E;  2CRB A;  2QYW A;  4UEM A;  4ERR A;  4ZI3 D;  2V7M A;  5JTG A;  3FZM B;  4LFC T;  3EVY A;  4HWD A;  2XQY A;  3IF8 B;  2BG9 A;  2YN6 A;  3ZEF B;  2FJA A;  2QRX A;  4JUY A;  2IUB A;  4GYR A;  4YJ2 E;  2KIN B;  2EHO C;  4HN9 A;  3ZN0 B;  3BQI A;  4HWF A;  4IE6 A;  3IHR A;  4MHC A;  1NWM X;  1MIW A;  3G06 A;  5HXS A;  1T7S A;  2X9W A;  3ZLI A;  2LOP A;  2MBG A;  2V5D A;  2ZM2 A;  4JI7 T;  4AKL A;  5AQG B;  4U3C A;  3PU3 A;  1I6Z A;  3AVS A;  1QLB A;  2XAJ B;  4GK5 E;  4WW0 A;  1HTJ F;  1DU2 A;  3HKC E;  4G2A A;  2MAW A;  3ZYK A;  3C4Z A;  1BR1 A;  3EDV A;  5LBQ B;  4F8H A;  3ANW B;  4I4T E;  3FHN A;  5JQG E;  3JCF A;  4U33 A;  1QSD A;  3MAC A;  4IL9 A;  2BG9 E;  5L3F B;  3LDQ B;  3OYX A;  2UUC T;  3V5S A;  3HI2 A;  4ZOL E;  4DV1 T;  2UXD T;  4QX7 B;  2VKO A;  2BDE A;  3I0Q A;  2JPF A;  2WY2 A;  2CLY C;  4IST A;  2Q9Q C;  4QHO A;  4ASK A;  2M67 A;  5KMG P;  3PE0 A;  5AQT B;  4EAH A;  3OBV E;  4YHJ A;  3ZJ2 A;  4UR9 A;  5L3E B;  3DTO A;  3UUM A;  1R8I A;  2C0S A;  5HEJ A;  4KMC A;  1XZY A;  3RIU C;  4AQG A;  2YEV C;  3ZT6 A;  3V5U A;  4DR1 T;  5BR8 T;  3AB3 B;  3NWI A;  3ZYL A;  3UU8 A;  3RX6 A;  2WAU A;  4EYU A;  1WLX A;  1YXR A;  4DR3 T;  1UGO A;  3B13 A;  4PJJ A;  2W63 A;  2YDR A;  1KK7 A; 
#chains in the Genus database with same CATH homology
 4HWD A;  4HWI B;  1UK5 A;  2D9D A;  5AQI B;  1HX1 B;  5AQR B;  5AQN B;  1T7S A;  5AQS B;  5AQF B;  5AQQ B;  4HWC A;  4HWH A;  3M3Z B;  5AQO B;  1M62 A;  3LDQ B;  3FZL B;  5AQH B;  5AQT B;  3FZH B;  5AQL B;  5AQJ B;  1UGO A;  3FZK B;  5AQG B;  5AQM B;  4HWF A;  5AQV B;  3A8Y C;  1I6Z A;  5AQU B;  5AQK B;  5AQP B;  1M7K A;  3FZM B;  3FZF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...