5AQQB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
111
structure length
106
Chain Sequence
b'SNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 44
structure length 106
sequence length 111
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqqB00
3A8YC 5AQTB 5AQPB 3FZKB 3FZMB 3LDQB 5AQSB 3FZFB 4HWDA 3FZLB 5AQQB 2D9DA 5AQGB 5AQFB 5AQKB 5AQLB 4HWFA 5AQMB 4HWIB 5AQRB 5AQUB 3M3ZB 5AQIB 3FZHB 1UGOA 5AQJB 1M7KA 1I6ZA 5AQVB 5AQOB 1M62A 5AQNB 1UK5A 4HWCA 5AQHB 1HX1B 1T7SA 4HWHA
chains in the Genus database with same CATH superfamily
3OKQA 2J62A 3CQGB 1I94T 2LJLA 2JPFA 3C4WA 4F6RC 1D1CA 4TWDA 3WAKA 3RGLA 2XAJB 4ZXLA 2ZM0A 3RKGA 3PU8A 4A97A 5LBQB 4LF8T 4YLHA 2H7VC 5JRCA 3LJCA 4F8HA 1KNPA 2NTXA 3J9X1 4ZZBA 1MIVA 1D1AA 3T8OA 1US7B 2VVNA 2KXPB 4TNVA 1J1JA 4COFA 5L3BB 4FI5A 3RYCE 3C50A 3K8PC 2UUBT 4NIQA 2NR4A 3M65A 2X67A 5HYAA 4H9QC 4DV5T 4J2CA 5ABGA 4I55E 2QVAA 2VASA 4O8SA 2JQ9A 2W62A 4ASKA 2OLTA 1R8IA 4ZS2A 5HXEA 2XM1A 3PV0F 4YY3T 2DLRA 3NKZA 3UU3A 1XMOT 4IE5A 4HKAA 4O4IE 5AQQB 1W0AA 3UUXB 5TAOA 4N78D 2ZM6T 2FBWA 2LKGA 3NRXA 4P09A 3NRYA 4MBQA 2XASB 4PW8A 1WYBA 4HFIA 2C5IT 3JC6C 4DNDA 2WP9A 3RYFE 1KF6A 2L3LA 1L0VA 2YKSA 4LF5T 4ZI2D 3AEFA 4QX7B 1VCTA 1GQEA 2IAKA 4KUMB 4QH4A 1SE7A 5C2TA 3V5SA 3ZCJA 5FVLA 5HXHA 4U74A 3Q5WA 1ZEEA 4GOUA 4YJ2E 3HKCE 4BAYB 5FNVE 4Z90A 2DWKA 1T72A 1ZHCA 4JLEA 4PJLA 3RRWA 2HPJA 4YSZA 4EYUA 4PK5A 4OFZA 2PBIA 3CVRA 1IBLT 2AE9A 4DV3T 3RC3A 4A98A 3P50A 2CBJA 1FJGT 5CFBA 1U5PA 2PFVA 4IL4A 5HXCA 3O1JA 3JC6D 3RQWA 3SWHA 5JDHA 1SUMB 3GN5A 4A5XA 1O3XA 4OYKA 3HKEE 4B3ST 2DWGA 5CJ5A 2YDSA 1HS7A 3IBPA 2J47A 3F57A 2YEVC 1T98A 3W15B 1UX4A 2ACXA 2V7JA 3ABVA 4WBOA 2BVMA 4YTPA 3T1YT 2V8SV 4IE7A 4L5GA 1KNZA 4DO0A 3FBLA 5L3EB 3PUZF 5F8PA 2KMFA 4TNWA 3N9OA 4QKNA 5JTGA 2H88A 3QC9A 4I50E 4X66T 3OPCA 2HPLA 2WU5A 1HG2A 2IDOB 2L8KA 1N36T 2UXDT 5LHHB 4DV1T 4X64T 3ANWB 3E0ZA 2KLQA 3AAEB 4EIWA 4AQFC 3UFGA 3PUAA 4O4JE 2N1GA 3P4RA 5JR9B 5IUXA 1HNZT 1NWMX 2BKOA 4YXDA 4GKKT 3AE2A 3FXDB 4TWHA 5LGNB 2YINA 1KFYA 4QX8B 4FJOA 2Q9QA 4A56A 4DV7T 4G2AA 4HWHA 2X0LB 4JEHB 2W0GA 3VU7H 3OYZA 5AQSB 4HWDA 1MNDA 2MTQA 5J0ZA 4TZ4C 4YFSA 5FYMA 3NBXX 4CI1B 3ZSSA 5LGTB 3CX7B 5LP6E 2BG9C 3BQIA 3CK6A 2BS2A 2FJBA 4O4LE 2KWIB 3KV6A 3ZYMA 3ZSTA 4NUVA 3ZMZB 1WR6A 3ZKRA 3SS1A 3UU4A 1WYCA 4EYYR 3C4ZA 2D0UA 5C8YE 5KX5E 2XSAA 2G0UA 3ZN1B 3I0OA 4CN1A 2FJAA 4DUYT 3H3AA 2JQHA 1NAFA 3ZJ2A 3PUXF 3OJAA 2IW5B 3RX6A 2CRBA 4AISA 1BR2A 4DIDB 3LBXB 3AE6A 5HXRA 3O1IA 2MOZA 1XDPA 4ISTA 2H7OA 3BQKA 3CKDA 1N32T 4U31A 3ANWA 2QRXA 4WBNE 1V9DA 3IF8B 1DU2A 5EZYE 2XPKA 5HEGA 2X9WA 3C98B 3AE4A 4O2AE 2HH7A 3I9WA 4H9OC 2D9DA 2YK0A 4HFCA 4BJNA 4B3MT 3IA3A 4UVAB 2MAWA 3Q5EA 5FL0A 4GYRA 1AJ3A 5FVKA 5JDGA 2I6HA 3AE1A 3OYXA 3ONXA 2D2SA 2DI4A 3LK3B 2V5CA 2LM2A 1UK5A 3V5UA 2XY8B 4DR5T 2LSKA 3CX8B 1HFAA 2R6GF 4NUUA 2OV9A 2F4VT 4I0UA 4X1YE 3PJAA 4IHJE 3KBUA 1IBKT 1G8XA 3K1SA 2BZBA 3N9QA 2W61A 4KP3C 1D1BA 1UURA 2X0HA 2I59A 3O1HA 1HR0T 2LRKA 4HFDA 3P7IA 4QH5A 1S94A 2A72A 4HFVA 2W2UA 3LBXA 3PUQA 1ZP0A 3B13A 1YKEB 3HKDE 1T7SA 4MALA 3ZT5A 5HXSA 3A8YC 4ANJA 3AXJB 4E7SA 2NW7A 5IHYA 3JAFA 4K0UA 4IIJE 1D0YA 3CX6B 5CB4E 2X9HA 4ILBA 3GWHA 5FXZA 2V7LA 3S4UA 3QB5A 1IJ5A 3ZN0B 3TKLB 2YN6A 5FXXA 5AQFB 3B57A 2VWAA 3L39A 2XQ9A 1FMVA 2Z6EA 2Q9QD 5LG3A 2E2AA 2UXXB 4U7IA 2NW9A 4JI1T 1QUUA 1MMGA 5FMNA 3QNUA 5JREA 4P0AA 4KX6A 4YHJA 4C91A 4LF9T 4AQYT 4Z8XA 3PUVF 2CWYA 1VCSA 2BG9E 3PUYF 4UR9A 5A1LA 4XBFB 1XNRT 3F31A 4P1NA 3UU6A 2KZ7B 1T8BA 2J1DG 4DR4T 2BKNA 5ABEA 5FXVA 1WR0A 2WY2A 1CHUA 3ONLC 3AEAA 3N9NA 3ZT6A 5CA0E 2UXNB 2DNXA 2QGSA 2YDQA 2RP4A 1NEKA 3AAAB 2WWUA 1N34T 3T1HT 4ADZA 4DUZT 4TV8E 1HTJF 2ACZA 3P4PA 4HE8A 3F2EA 5L3GB 2ZM8A 1OEDC 3GN5B 4K0KT 3UULA 1XZYA 4P0BA 3CIRA 5AQHB 2C5KT 3P4QA 3AXJA 4AQFA 4AKGA 3OVUA 3ZMSB 3TLTA 2W63A 1UUSA 2CLYB 2GK9A 5AQOB 2LLYA 2D5UA 4YJ3E 2V1DB 4LFAT 3QK6A 3OBVE 2CHOA 3N9MA 4X5TA 2B76A 2VL0A 4QH1A 4YTMA 3RF1A 2FUPA 3WAJA 5LMUT 4B3RT 4GK5E 5ABHA 4EOZB 4QHOA 3KINB 2EHOC 4MFRA 1XMQT 1HF8A 3N5LA 3LSVA 1XWMA 1YXRA 2BG9A 2PJQA 5HEJA 3EABA 3PURA 5AQIB 3FZHB 1LKXA 4E7ZA 3MXZA 4IE4A 2XZEA 2Q9QB 3RIUC 4PJMA 5HEUA 5L2LA 5H6RB 1E2AA 3SOLA 2CCQA 5L47A 2UXBT 5LNKA 2V26A 4PFPA 1FIOA 3ZLIA 4EB6E 2XM2A 2D0TA 4ZI3C 3QUJA 3ZMVB 5LHGB 2VKDA 3NZPA 1XNQT 3RKOA 4IDNA 4PNIA 3QOFA 3LDQB 2CXFA 2CPTA 1KEYA 3D0TA 5L4HA 3FB2A 2W00A 2RA1A 1W9RA 4DMWA 4PK6A 1LRZA 2WAUA 5HEOA 4OHFA 4DV2T 2W66A 3FXEB 4KHZF 1G73A 1Z0PA 2HN1A 5JDMA 4U33A 2KSRA 5C3JA 5FKYA 2X0YA 2KNDA 1WRDA 4HWFA 1ZKEA 2VB6A 3GMIA 3HKBE 5HWYA 2LOPA 3ONJA 4ZI7E 4I43B 3MZKB 2DHRA 3AE5A 3UT5E 2XAGB 4DV4T 4PJJA 2VKOA 2W67A 4AQGA 2LSGA 2A2FX 2CMRA 3UTKA 2XQ4A 2HN2A 5DQWA 3J7Yq 3X1DA 3AAIA 4O4HE 4LF7T 5LBMA 4AI6A 4HN9A 2X9XA 3KV9A 4MHCA 5AQGB 2KWHA 4CXWA 4YSYA 5EK2A 4B6XA 2WQYA 4AXPA 4DVDA 4JYAT 2JMHA 5GONE 2MBGA 2L9QA 3UUMA 2IC6A 5AFUL 1H7CA 3PU3A 1IZNB 5KMGP 3VR8A 2VK9A 4PAGA 4JI6T 2IIUA 4DBRA 1HNWT 4EZ4A 2JMKA 4QXHB 2OA5A 3RQUA 3B5MA 4IDPA 3LK2B 4IE0A 4NXNT 2M6BA 4WYVA 2VKHA 4U2YA 1OEDE 4ZOLE 4YT0A 2LHNA 4H63H 3EHZA 5HCJA 1HX1B 4YSXA 3DP7A 1E7PA 4CN6A 3MKDA 2JIWA 2IC9A 5AQKB 3MK7C 5IYZE 5FXWA 4QXCB 2V6XA 2BS4A 3ZJ1A 2CM0A 2SPCA 2WCAA 5EK4A 2XHEB 1M62A 5AQNB 5CGMA 2JQKA 3C4XA 3EDUA 3N2KE 3DTOA 3RYIE 2LEHA 1X79A 4GIWA 4B3TT 1LVKA 5FP3A 4EGWA 4JUYA 3Q9DA 2ODUA 3NWIA 3UFEA 4DV6T 1BR4A 1MIYA 3FZLB 3RLFF 5CA1E 3AEGA 4L9IA 4MLKA 1UGOA 3RC8A 2UUCT 4U72A 2CE7A 3ZCIA 3A5XA 2QYWA 3AEDA 3AVSA 4H9RC 4WNKA 2LT3A 3R84B 2LE8A 1SA0E 5LXTE 4UF0B 2LHRA 1OWAA 3PJAJ 5AQRB 4XZCA 3G06A 2V6YA 3SFDA 3RYHE 2LRLA 4DR2T 3AVRA 5JH7E 5JDFA 3FBZA 3CMLA 4BA9A 3RRCA 3FZFB 3AA1B 4GYSA 2K3WA 3HI2A 3KVBA 3C51A 4DR3T 1M7KA 3H37A 5ABFA 4EZHA 2FJDA 4BJMA 3UU5A 5FY0A 4PFOA 4AKLA 2WDVA 3AE3A 2XSBA 2CHNA 2V7MA 4H9PC 2WZHA 1VRBA 5AQJB 1VOMA 2C5JA 5FY1A 3PUGA 2WBLA 4WZXA 3FZMB 3RHWA 1SHZC 4JI7T 2EHOA 2V7IA 2PG8A 4L0RA 2RPAA 2H89A 3LG7A 2DCFA 4KI0F 3RI5A 3I0QA 1YQ4A 4JI8T 3EUHA 3RIUA 3VRBA 2CEAA 1LVFA 2WM9A 5EK3A 3PTRB 5H6QB 4LF6T 2IUBA 2E9XC 3ZMUB 3AB3B 3GA8A 4ZEYA 3AA0B 5L3FB 2BBJA 3BK9A 1U4QA 2CWOA 4C90A 2A9UA 2CXDA 3FHNA 3P4SA 1MMAA 3PDYA 4UF0A 2BG9B 2WU2A 2UXCT 2J4GA 2NP9A 4ILAA 4CN4A 4LFCT 3PE0A 4UV8B 2AXDS 2ODVA 3R6NA 2X51A 2VVSA 5ETWA 3CPZA 1HCIA 2XJ7A 2MPKA 1XDOA 5JR9C 5DABA 5FL1A 2XQ7A 4LF4T 4EAHA 2Y8DA 1QLBA 5HCMA 3ESLA 3UU8A 3Q5DA 3ZC0A 1MIWA 4ZI2C 5LJNA 4YTNA 3RPUA 3KFWX 3EI0A 3I1AA 3N2GE 1YKHB 2Y48B 2IMLA 2ZLYA 4JI4T 3KBTA 2WMOA 4IDQA 2K9AA 4ISSA 2N9DA 2E9XD 4ERRA 4ZHQE 4CXXA 4OYJA 4TV9E 2X9YA 4CI3B 1WCRA 3U3IA 2B1EA 1I6ZA 3QB5K 2LSJA 3Q2MA 3PUWF 2CXLA 3MA9A 4HFBA 2K48A 1FMWA 2WWVA 4CQIA 2WDQA 3N9PA 3CWZB 1WLXA 5AQUB 3JAEA 3MACA 2XQAA 4CXYA 4AKIA 4DR6T 2YOEA 1J5ET 3JADA 2BBHA 4U3CA 4OK0A 4LFBT 1B7TA 1D0ZA 4GKJT 2MYSA 4ZZCA 2PTFA 5JVDE 5HEHA 5M4YA 4KHPT 4Z91A 2HHHT 2VQFT 2XAQB 1YQ3A 5LCYA 4H63V 3N9LA 2C0SA 2XQ6A 2XAHB 5L3CB 2IHR1 2BKPA 3WI3A 1E1HB 4LMLA 1Y64B 5AQMB 2XUEA 4EXTA 3I9YA 2BDEA 2LSIA 4HFHA 3AE9A 3ZT7A 2JJ9A 1KNRA 4IDZA 3AA6B 1BR0A 1OXZA 3ZPOA 4M1PA 5AQLB 2KT9A 3BQLA 3P8CD 2K5BB 4JEUB 5J1GA 3KVAA 4UVCB 1ZOYA 4ZS3A 3E22E 3L3PA 3NVOA 1ZV4X 1Z8UA 3VR9A 2LSYA 4TN7B 2V7KA 1J5WA 4TWFA 2XAFB 1MMNA 4U2ZA 1KK7A 4X1KE 4KBMB 2V5DA 3UUNA 2EHOD 2P9BA 1IAPA 4JV5T 4HEAA 3UQ7A 4Q25A 2E9XB 3KV4A 3AEBA 3L09A 5E0OA 1IBMT 2NTYA 4TUYE 1FEWA 3N2OA 5J2TE 3OTOT 4DR7T 2LKHA 3SRZA 3UUBA 4UXNB 3LFMA 3L8RA 4DR1T 1S35A 3TLUA 2FJEA 2NW8A 2QA7A 4ZI3D 2W4XA 3E08A 1CUNA 3K3OA 2M6IA 5JDQA 4IL9A 3IHRA 3HA4A 2X68A 2H3RA 3O4XE 2XQ3A 3KV5A 3UQ4A 3ETUA 3U78A 1EZ3A 5AQPB 3FZKB 4LMKA 2WZIA 2WB5A 4DMVA 5L4EA 4LMJA 4X20E 3CQCB 2E5LT 1Y01A 2WDRA 2V6YB 4XAXB 5J2UE 3TLSA 3LK42 1OEDB 5LGUB 3C64A 2XQYA 1IJ6A 2K24A 3TLVA 3ZMTB 5ABFB 1HG5A 2I0MA 2LOSA 4EV6A 4UIGA 1HX8A 1NENA 3AEEA 5AQTB 4EEDA 2BS3A 2E8IA 3RIFA 4KMCA 4HWIB 2LM9A 3M3ZB 4HFEA 4IREA 5JDNA 4X1IE 2NOXA 4DV0T 3P4WA 4JI3T 2X66A 5HWXA 5LB7B 2UUAT 4IDOA 2E9XA 4X62T 3AE8A 1BR1A 1JNRA 2DL1A 2WS3A 2EHOB 3AECA 2VURA 2Y6XA 1W09A 3ZYLA 5DQVA 4H9NC 4JBWF 1MMDA 5LYJE 4QXBB 5AQVB 5JDLA 4EEBA 2CBIA 2N2NA 4PK4A 3ETVA 3NZQA 2VQET 4CZZB 4YHHT 3A7MA 3HL6A 5IWAT 2XTLA 4U7YA 2NWBA 4X65T 4AKHA 1QSDA 2VL8A 5JQGE 1W0BA 2BVLA 2CA5A 3SFEA 1HNXT 3RH3A 5JR9A 4QWNB 2CLYC 4GK0E 1MNEA 3VKHA 3O9XA 4JI2T 2A3DA 4IGUA 4UVBB 1YW0A 3HR0A 4O2BE 2WMNA 3VRAA 5L3DB 4OX9T 3K3NA 4ILCA 4V1Av 1OEDA 4AKRB 4TX5A 2KINB 3DJBA 2YU1A 4HGAA 4UELA 5BR8T 5LMNT 4AIUA 1JNZA 4UV9B 3KDSE 3H3MA 3ZYKA 2VKJA 4IT4A 5JRCB 3AE7A 2ZM2A 5HAXA 3EAMA 2ES0A 2Q9QC 2WSSV 4HTEA 3EVYA 5LJMA 1N33T 3ZEFB 4JI5T 4NPPA 3IEEA 2M67A 3AA7B 5F5WA 4ILUA 2XQ5A 2JQQA 4UEMA 5F3JA 4HWCA 3VHLA 2JRKA 3PUSA 3EDVA 2ZMAA 4DBQA 3ZC1A 1YD8G 3RIAA 5LG4A 1UCUA 5LHIB 2YU2A 3K3QC 5LA6E 2E5VA 1D0XA 2XQ8A 4G63A 4H9SE 4IE6A 5BMVE 5LOVE 4NXMT 1WFDA 1X9BA 4I4TE 4JI0T 3TLWA 1UX5A 5FY7A 2UU9T 3MJXA 5DJQC 2YDRA 3CQXC 4PJNA 3Q5XA 5ADXL 3VKGA 4WW0A 4CI2B 5KDMC 5KXJA 3JCFA
chains in the Genus database with same CATH topology
3A8YC 5AQTB 5AQPB 3FZKB 3FZMB 3LDQB 5AQSB 3FZFB 4HWDA 3FZLB 5AQQB 2D9DA 5AQGB 5AQFB 5AQKB 5AQLB 4HWFA 5AQMB 4HWIB 5AQRB 5AQUB 3M3ZB 5AQIB 3FZHB 1UGOA 5AQJB 1M7KA 1I6ZA 5AQVB 5AQOB 1M62A 5AQNB 1UK5A 4HWCA 5AQHB 1HX1B 1T7SA 4HWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A8Y C;  5AQT B;  5AQP B;  3FZK B;  3FZM B;  3LDQ B;  5AQS B;  3FZF B;  4HWD A;  3FZL B;  5AQQ B;  2D9D A;  5AQG B;  5AQF B;  5AQK B;  5AQL B;  4HWF A;  5AQM B;  4HWI B;  5AQR B;  5AQU B;  3M3Z B;  5AQI B;  3FZH B;  1UGO A;  5AQJ B;  1M7K A;  1I6Z A;  5AQV B;  5AQO B;  1M62 A;  5AQN B;  1UK5 A;  4HWC A;  5AQH B;  1HX1 B;  1T7S A;  4HWH A; 
#chains in the Genus database with same CATH topology
 3OKQ A;  2J62 A;  3CQG B;  1I94 T;  2LJL A;  2JPF A;  3C4W A;  4F6R C;  1D1C A;  4TWD A;  3WAK A;  3RGL A;  2XAJ B;  4ZXL A;  2ZM0 A;  3RKG A;  3PU8 A;  4A97 A;  5LBQ B;  4LF8 T;  4YLH A;  2H7V C;  5JRC A;  3LJC A;  4F8H A;  1KNP A;  2NTX A;  3J9X 1;  4ZZB A;  1MIV A;  1D1A A;  3T8O A;  1US7 B;  2VVN A;  2KXP B;  4TNV A;  1J1J A;  4COF A;  5L3B B;  4FI5 A;  3RYC E;  3C50 A;  3K8P C;  2UUB T;  4NIQ A;  2NR4 A;  3M65 A;  2X67 A;  5HYA A;  4H9Q C;  4DV5 T;  4J2C A;  5ABG A;  4I55 E;  2QVA A;  2VAS A;  4O8S A;  2JQ9 A;  2W62 A;  4ASK A;  2OLT A;  1R8I A;  4ZS2 A;  5HXE A;  2XM1 A;  3PV0 F;  4YY3 T;  2DLR A;  3NKZ A;  3UU3 A;  1XMO T;  4IE5 A;  4HKA A;  4O4I E;  5AQQ B;  1W0A A;  3UUX B;  5TAO A;  4N78 D;  2ZM6 T;  2FBW A;  2LKG A;  3NRX A;  4P09 A;  3NRY A;  4MBQ A;  2XAS B;  4PW8 A;  1WYB A;  4HFI A;  2C5I T;  3JC6 C;  4DND A;  2WP9 A;  3RYF E;  1KF6 A;  2L3L A;  1L0V A;  2YKS A;  4LF5 T;  4ZI2 D;  3AEF A;  4QX7 B;  1VCT A;  1GQE A;  2IAK A;  4KUM B;  4QH4 A;  1SE7 A;  5C2T A;  3V5S A;  3ZCJ A;  5FVL A;  5HXH A;  4U74 A;  3Q5W A;  1ZEE A;  4GOU A;  4YJ2 E;  3HKC E;  4BAY B;  5FNV E;  4Z90 A;  2DWK A;  1T72 A;  1ZHC A;  4JLE A;  4PJL A;  3RRW A;  2HPJ A;  4YSZ A;  4EYU A;  4PK5 A;  4OFZ A;  2PBI A;  3CVR A;  1IBL T;  2AE9 A;  4DV3 T;  3RC3 A;  4A98 A;  3P50 A;  2CBJ A;  1FJG T;  5CFB A;  1U5P A;  2PFV A;  4IL4 A;  5HXC A;  3O1J A;  3JC6 D;  3RQW A;  3SWH A;  5JDH A;  1SUM B;  3GN5 A;  4A5X A;  1O3X A;  4OYK A;  3HKE E;  4B3S T;  2DWG A;  5CJ5 A;  2YDS A;  1HS7 A;  3IBP A;  2J47 A;  3F57 A;  2YEV C;  1T98 A;  3W15 B;  1UX4 A;  2ACX A;  2V7J A;  3ABV A;  4WBO A;  2BVM A;  4YTP A;  3T1Y T;  2V8S V;  4IE7 A;  4L5G A;  1KNZ A;  4DO0 A;  3FBL A;  5L3E B;  3PUZ F;  5F8P A;  2KMF A;  4TNW A;  3N9O A;  4QKN A;  5JTG A;  2H88 A;  3QC9 A;  4I50 E;  4X66 T;  3OPC A;  2HPL A;  2WU5 A;  1HG2 A;  2IDO B;  2L8K A;  1N36 T;  2UXD T;  5LHH B;  4DV1 T;  4X64 T;  3ANW B;  3E0Z A;  2KLQ A;  3AAE B;  4EIW A;  4AQF C;  3UFG A;  3PUA A;  4O4J E;  2N1G A;  3P4R A;  5JR9 B;  5IUX A;  1HNZ T;  1NWM X;  2BKO A;  4YXD A;  4GKK T;  3AE2 A;  3FXD B;  4TWH A;  5LGN B;  2YIN A;  1KFY A;  4QX8 B;  4FJO A;  2Q9Q A;  4A56 A;  4DV7 T;  4G2A A;  4HWH A;  2X0L B;  4JEH B;  2W0G A;  3VU7 H;  3OYZ A;  5AQS B;  4HWD A;  1MND A;  2MTQ A;  5J0Z A;  4TZ4 C;  4YFS A;  5FYM A;  3NBX X;  4CI1 B;  3ZSS A;  5LGT B;  3CX7 B;  5LP6 E;  2BG9 C;  3BQI A;  3CK6 A;  2BS2 A;  2FJB A;  4O4L E;  2KWI B;  3KV6 A;  3ZYM A;  3ZST A;  4NUV A;  3ZMZ B;  1WR6 A;  3ZKR A;  3SS1 A;  3UU4 A;  1WYC A;  4EYY R;  3C4Z A;  2D0U A;  5C8Y E;  5KX5 E;  2XSA A;  2G0U A;  3ZN1 B;  3I0O A;  4CN1 A;  2FJA A;  4DUY T;  3H3A A;  2JQH A;  1NAF A;  3ZJ2 A;  3PUX F;  3OJA A;  2IW5 B;  3RX6 A;  2CRB A;  4AIS A;  1BR2 A;  4DID B;  3LBX B;  3AE6 A;  5HXR A;  3O1I A;  2MOZ A;  1XDP A;  4IST A;  2H7O A;  3BQK A;  3CKD A;  1N32 T;  4U31 A;  3ANW A;  2QRX A;  4WBN E;  1V9D A;  3IF8 B;  1DU2 A;  5EZY E;  2XPK A;  5HEG A;  2X9W A;  3C98 B;  3AE4 A;  4O2A E;  2HH7 A;  3I9W A;  4H9O C;  2D9D A;  2YK0 A;  4HFC A;  4BJN A;  4B3M T;  3IA3 A;  4UVA B;  2MAW A;  3Q5E A;  5FL0 A;  4GYR A;  1AJ3 A;  5FVK A;  5JDG A;  2I6H A;  3AE1 A;  3OYX A;  3ONX A;  2D2S A;  2DI4 A;  3LK3 B;  2V5C A;  2LM2 A;  1UK5 A;  3V5U A;  2XY8 B;  4DR5 T;  2LSK A;  3CX8 B;  1HFA A;  2R6G F;  4NUU A;  2OV9 A;  2F4V T;  4I0U A;  4X1Y E;  3PJA A;  4IHJ E;  3KBU A;  1IBK T;  1G8X A;  3K1S A;  2BZB A;  3N9Q A;  2W61 A;  4KP3 C;  1D1B A;  1UUR A;  2X0H A;  2I59 A;  3O1H A;  1HR0 T;  2LRK A;  4HFD A;  3P7I A;  4QH5 A;  1S94 A;  2A72 A;  4HFV A;  2W2U A;  3LBX A;  3PUQ A;  1ZP0 A;  3B13 A;  1YKE B;  3HKD E;  1T7S A;  4MAL A;  3ZT5 A;  5HXS A;  3A8Y C;  4ANJ A;  3AXJ B;  4E7S A;  2NW7 A;  5IHY A;  3JAF A;  4K0U A;  4IIJ E;  1D0Y A;  3CX6 B;  5CB4 E;  2X9H A;  4ILB A;  3GWH A;  5FXZ A;  2V7L A;  3S4U A;  3QB5 A;  1IJ5 A;  3ZN0 B;  3TKL B;  2YN6 A;  5FXX A;  5AQF B;  3B57 A;  2VWA A;  3L39 A;  2XQ9 A;  1FMV A;  2Z6E A;  2Q9Q D;  5LG3 A;  2E2A A;  2UXX B;  4U7I A;  2NW9 A;  4JI1 T;  1QUU A;  1MMG A;  5FMN A;  3QNU A;  5JRE A;  4P0A A;  4KX6 A;  4YHJ A;  4C91 A;  4LF9 T;  4AQY T;  4Z8X A;  3PUV F;  2CWY A;  1VCS A;  2BG9 E;  3PUY F;  4UR9 A;  5A1L A;  4XBF B;  1XNR T;  3F31 A;  4P1N A;  3UU6 A;  2KZ7 B;  1T8B A;  2J1D G;  4DR4 T;  2BKN A;  5ABE A;  5FXV A;  1WR0 A;  2WY2 A;  1CHU A;  3ONL C;  3AEA A;  3N9N A;  3ZT6 A;  5CA0 E;  2UXN B;  2DNX A;  2QGS A;  2YDQ A;  2RP4 A;  1NEK A;  3AAA B;  2WWU A;  1N34 T;  3T1H T;  4ADZ A;  4DUZ T;  4TV8 E;  1HTJ F;  2ACZ A;  3P4P A;  4HE8 A;  3F2E A;  5L3G B;  2ZM8 A;  1OED C;  3GN5 B;  4K0K T;  3UUL A;  1XZY A;  4P0B A;  3CIR A;  5AQH B;  2C5K T;  3P4Q A;  3AXJ A;  4AQF A;  4AKG A;  3OVU A;  3ZMS B;  3TLT A;  2W63 A;  1UUS A;  2CLY B;  2GK9 A;  5AQO B;  2LLY A;  2D5U A;  4YJ3 E;  2V1D B;  4LFA T;  3QK6 A;  3OBV E;  2CHO A;  3N9M A;  4X5T A;  2B76 A;  2VL0 A;  4QH1 A;  4YTM A;  3RF1 A;  2FUP A;  3WAJ A;  5LMU T;  4B3R T;  4GK5 E;  5ABH A;  4EOZ B;  4QHO A;  3KIN B;  2EHO C;  4MFR A;  1XMQ T;  1HF8 A;  3N5L A;  3LSV A;  1XWM A;  1YXR A;  2BG9 A;  2PJQ A;  5HEJ A;  3EAB A;  3PUR A;  5AQI B;  3FZH B;  1LKX A;  4E7Z A;  3MXZ A;  4IE4 A;  2XZE A;  2Q9Q B;  3RIU C;  4PJM A;  5HEU A;  5L2L A;  5H6R B;  1E2A A;  3SOL A;  2CCQ A;  5L47 A;  2UXB T;  5LNK A;  2V26 A;  4PFP A;  1FIO A;  3ZLI A;  4EB6 E;  2XM2 A;  2D0T A;  4ZI3 C;  3QUJ A;  3ZMV B;  5LHG B;  2VKD A;  3NZP A;  1XNQ T;  3RKO A;  4IDN A;  4PNI A;  3QOF A;  3LDQ B;  2CXF A;  2CPT A;  1KEY A;  3D0T A;  5L4H A;  3FB2 A;  2W00 A;  2RA1 A;  1W9R A;  4DMW A;  4PK6 A;  1LRZ A;  2WAU A;  5HEO A;  4OHF A;  4DV2 T;  2W66 A;  3FXE B;  4KHZ F;  1G73 A;  1Z0P A;  2HN1 A;  5JDM A;  4U33 A;  2KSR A;  5C3J A;  5FKY A;  2X0Y A;  2KND A;  1WRD A;  4HWF A;  1ZKE A;  2VB6 A;  3GMI A;  3HKB E;  5HWY A;  2LOP A;  3ONJ A;  4ZI7 E;  4I43 B;  3MZK B;  2DHR A;  3AE5 A;  3UT5 E;  2XAG B;  4DV4 T;  4PJJ A;  2VKO A;  2W67 A;  4AQG A;  2LSG A;  2A2F X;  2CMR A;  3UTK A;  2XQ4 A;  2HN2 A;  5DQW A;  3J7Y q;  3X1D A;  3AAI A;  4O4H E;  4LF7 T;  5LBM A;  4AI6 A;  4HN9 A;  2X9X A;  3KV9 A;  4MHC A;  5AQG B;  2KWH A;  4CXW A;  4YSY A;  5EK2 A;  4B6X A;  2WQY A;  4AXP A;  4DVD A;  4JYA T;  2JMH A;  5GON E;  2MBG A;  2L9Q A;  3UUM A;  2IC6 A;  5AFU L;  1H7C A;  3PU3 A;  1IZN B;  5KMG P;  3VR8 A;  2VK9 A;  4PAG A;  4JI6 T;  2IIU A;  4DBR A;  1HNW T;  4EZ4 A;  2JMK A;  4QXH B;  2OA5 A;  3RQU A;  3B5M A;  4IDP A;  3LK2 B;  4IE0 A;  4NXN T;  2M6B A;  4WYV A;  2VKH A;  4U2Y A;  1OED E;  4ZOL E;  4YT0 A;  2LHN A;  4H63 H;  3EHZ A;  5HCJ A;  1HX1 B;  4YSX A;  3DP7 A;  1E7P A;  4CN6 A;  3MKD A;  2JIW A;  2IC9 A;  5AQK B;  3MK7 C;  5IYZ E;  5FXW A;  4QXC B;  2V6X A;  2BS4 A;  3ZJ1 A;  2CM0 A;  2SPC A;  2WCA A;  5EK4 A;  2XHE B;  1M62 A;  5AQN B;  5CGM A;  2JQK A;  3C4X A;  3EDU A;  3N2K E;  3DTO A;  3RYI E;  2LEH A;  1X79 A;  4GIW A;  4B3T T;  1LVK A;  5FP3 A;  4EGW A;  4JUY A;  3Q9D A;  2ODU A;  3NWI A;  3UFE A;  4DV6 T;  1BR4 A;  1MIY A;  3FZL B;  3RLF F;  5CA1 E;  3AEG A;  4L9I A;  4MLK A;  1UGO A;  3RC8 A;  2UUC T;  4U72 A;  2CE7 A;  3ZCI A;  3A5X A;  2QYW A;  3AED A;  3AVS A;  4H9R C;  4WNK A;  2LT3 A;  3R84 B;  2LE8 A;  1SA0 E;  5LXT E;  4UF0 B;  2LHR A;  1OWA A;  3PJA J;  5AQR B;  4XZC A;  3G06 A;  2V6Y A;  3SFD A;  3RYH E;  2LRL A;  4DR2 T;  3AVR A;  5JH7 E;  5JDF A;  3FBZ A;  3CML A;  4BA9 A;  3RRC A;  3FZF B;  3AA1 B;  4GYS A;  2K3W A;  3HI2 A;  3KVB A;  3C51 A;  4DR3 T;  1M7K A;  3H37 A;  5ABF A;  4EZH A;  2FJD A;  4BJM A;  3UU5 A;  5FY0 A;  4PFO A;  4AKL A;  2WDV A;  3AE3 A;  2XSB A;  2CHN A;  2V7M A;  4H9P C;  2WZH A;  1VRB A;  5AQJ B;  1VOM A;  2C5J A;  5FY1 A;  3PUG A;  2WBL A;  4WZX A;  3FZM B;  3RHW A;  1SHZ C;  4JI7 T;  2EHO A;  2V7I A;  2PG8 A;  4L0R A;  2RPA A;  2H89 A;  3LG7 A;  2DCF A;  4KI0 F;  3RI5 A;  3I0Q A;  1YQ4 A;  4JI8 T;  3EUH A;  3RIU A;  3VRB A;  2CEA A;  1LVF A;  2WM9 A;  5EK3 A;  3PTR B;  5H6Q B;  4LF6 T;  2IUB A;  2E9X C;  3ZMU B;  3AB3 B;  3GA8 A;  4ZEY A;  3AA0 B;  5L3F B;  2BBJ A;  3BK9 A;  1U4Q A;  2CWO A;  4C90 A;  2A9U A;  2CXD A;  3FHN A;  3P4S A;  1MMA A;  3PDY A;  4UF0 A;  2BG9 B;  2WU2 A;  2UXC T;  2J4G A;  2NP9 A;  4ILA A;  4CN4 A;  4LFC T;  3PE0 A;  4UV8 B;  2AXD S;  2ODV A;  3R6N A;  2X51 A;  2VVS A;  5ETW A;  3CPZ A;  1HCI A;  2XJ7 A;  2MPK A;  1XDO A;  5JR9 C;  5DAB A;  5FL1 A;  2XQ7 A;  4LF4 T;  4EAH A;  2Y8D A;  1QLB A;  5HCM A;  3ESL A;  3UU8 A;  3Q5D A;  3ZC0 A;  1MIW A;  4ZI2 C;  5LJN A;  4YTN A;  3RPU A;  3KFW X;  3EI0 A;  3I1A A;  3N2G E;  1YKH B;  2Y48 B;  2IML A;  2ZLY A;  4JI4 T;  3KBT A;  2WMO A;  4IDQ A;  2K9A A;  4ISS A;  2N9D A;  2E9X D;  4ERR A;  4ZHQ E;  4CXX A;  4OYJ A;  4TV9 E;  2X9Y A;  4CI3 B;  1WCR A;  3U3I A;  2B1E A;  1I6Z A;  3QB5 K;  2LSJ A;  3Q2M A;  3PUW F;  2CXL A;  3MA9 A;  4HFB A;  2K48 A;  1FMW A;  2WWV A;  4CQI A;  2WDQ A;  3N9P A;  3CWZ B;  1WLX A;  5AQU B;  3JAE A;  3MAC A;  2XQA A;  4CXY A;  4AKI A;  4DR6 T;  2YOE A;  1J5E T;  3JAD A;  2BBH A;  4U3C A;  4OK0 A;  4LFB T;  1B7T A;  1D0Z A;  4GKJ T;  2MYS A;  4ZZC A;  2PTF A;  5JVD E;  5HEH A;  5M4Y A;  4KHP T;  4Z91 A;  2HHH T;  2VQF T;  2XAQ B;  1YQ3 A;  5LCY A;  4H63 V;  3N9L A;  2C0S A;  2XQ6 A;  2XAH B;  5L3C B;  2IHR 1;  2BKP A;  3WI3 A;  1E1H B;  4LML A;  1Y64 B;  5AQM B;  2XUE A;  4EXT A;  3I9Y A;  2BDE A;  2LSI A;  4HFH A;  3AE9 A;  3ZT7 A;  2JJ9 A;  1KNR A;  4IDZ A;  3AA6 B;  1BR0 A;  1OXZ A;  3ZPO A;  4M1P A;  5AQL B;  2KT9 A;  3BQL A;  3P8C D;  2K5B B;  4JEU B;  5J1G A;  3KVA A;  4UVC B;  1ZOY A;  4ZS3 A;  3E22 E;  3L3P A;  3NVO A;  1ZV4 X;  1Z8U A;  3VR9 A;  2LSY A;  4TN7 B;  2V7K A;  1J5W A;  4TWF A;  2XAF B;  1MMN A;  4U2Z A;  1KK7 A;  4X1K E;  4KBM B;  2V5D A;  3UUN A;  2EHO D;  2P9B A;  1IAP A;  4JV5 T;  4HEA A;  3UQ7 A;  4Q25 A;  2E9X B;  3KV4 A;  3AEB A;  3L09 A;  5E0O A;  1IBM T;  2NTY A;  4TUY E;  1FEW A;  3N2O A;  5J2T E;  3OTO T;  4DR7 T;  2LKH A;  3SRZ A;  3UUB A;  4UXN B;  3LFM A;  3L8R A;  4DR1 T;  1S35 A;  3TLU A;  2FJE A;  2NW8 A;  2QA7 A;  4ZI3 D;  2W4X A;  3E08 A;  1CUN A;  3K3O A;  2M6I A;  5JDQ A;  4IL9 A;  3IHR A;  3HA4 A;  2X68 A;  2H3R A;  3O4X E;  2XQ3 A;  3KV5 A;  3UQ4 A;  3ETU A;  3U78 A;  1EZ3 A;  5AQP B;  3FZK B;  4LMK A;  2WZI A;  2WB5 A;  4DMV A;  5L4E A;  4LMJ A;  4X20 E;  3CQC B;  2E5L T;  1Y01 A;  2WDR A;  2V6Y B;  4XAX B;  5J2U E;  3TLS A;  3LK4 2;  1OED B;  5LGU B;  3C64 A;  2XQY A;  1IJ6 A;  2K24 A;  3TLV A;  3ZMT B;  5ABF B;  1HG5 A;  2I0M A;  2LOS A;  4EV6 A;  4UIG A;  1HX8 A;  1NEN A;  3AEE A;  5AQT B;  4EED A;  2BS3 A;  2E8I A;  3RIF A;  4KMC A;  4HWI B;  2LM9 A;  3M3Z B;  4HFE A;  4IRE A;  5JDN A;  4X1I E;  2NOX A;  4DV0 T;  3P4W A;  4JI3 T;  2X66 A;  5HWX A;  5LB7 B;  2UUA T;  4IDO A;  2E9X A;  4X62 T;  3AE8 A;  1BR1 A;  1JNR A;  2DL1 A;  2WS3 A;  2EHO B;  3AEC A;  2VUR A;  2Y6X A;  1W09 A;  3ZYL A;  5DQV A;  4H9N C;  4JBW F;  1MMD A;  5LYJ E;  4QXB B;  5AQV B;  5JDL A;  4EEB A;  2CBI A;  2N2N A;  4PK4 A;  3ETV A;  3NZQ A;  2VQE T;  4CZZ B;  4YHH T;  3A7M A;  3HL6 A;  5IWA T;  2XTL A;  4U7Y A;  2NWB A;  4X65 T;  4AKH A;  1QSD A;  2VL8 A;  5JQG E;  1W0B A;  2BVL A;  2CA5 A;  3SFE A;  1HNX T;  3RH3 A;  5JR9 A;  4QWN B;  2CLY C;  4GK0 E;  1MNE A;  3VKH A;  3O9X A;  4JI2 T;  2A3D A;  4IGU A;  4UVB B;  1YW0 A;  3HR0 A;  4O2B E;  2WMN A;  3VRA A;  5L3D B;  4OX9 T;  3K3N A;  4ILC A;  4V1A v;  1OED A;  4AKR B;  4TX5 A;  2KIN B;  3DJB A;  2YU1 A;  4HGA A;  4UEL A;  5BR8 T;  5LMN T;  4AIU A;  1JNZ A;  4UV9 B;  3KDS E;  3H3M A;  3ZYK A;  2VKJ A;  4IT4 A;  5JRC B;  3AE7 A;  2ZM2 A;  5HAX A;  3EAM A;  2ES0 A;  2Q9Q C;  2WSS V;  4HTE A;  3EVY A;  5LJM A;  1N33 T;  3ZEF B;  4JI5 T;  4NPP A;  3IEE A;  2M67 A;  3AA7 B;  5F5W A;  4ILU A;  2XQ5 A;  2JQQ A;  4UEM A;  5F3J A;  4HWC A;  3VHL A;  2JRK A;  3PUS A;  3EDV A;  2ZMA A;  4DBQ A;  3ZC1 A;  1YD8 G;  3RIA A;  5LG4 A;  1UCU A;  5LHI B;  2YU2 A;  3K3Q C;  5LA6 E;  2E5V A;  1D0X A;  2XQ8 A;  4G63 A;  4H9S E;  4IE6 A;  5BMV E;  5LOV E;  4NXM T;  1WFD A;  1X9B A;  4I4T E;  4JI0 T;  3TLW A;  1UX5 A;  5FY7 A;  2UU9 T;  3MJX A;  5DJQ C;  2YDR A;  3CQX C;  4PJN A;  3Q5X A;  5ADX L;  3VKG A;  4WW0 A;  4CI2 B;  5KDM C;  5KXJ A;  3JCF A; 
#chains in the Genus database with same CATH homology
 3A8Y C;  5AQT B;  5AQP B;  3FZK B;  3FZM B;  3LDQ B;  5AQS B;  3FZF B;  4HWD A;  3FZL B;  5AQQ B;  2D9D A;  5AQG B;  5AQF B;  5AQK B;  5AQL B;  4HWF A;  5AQM B;  4HWI B;  5AQR B;  5AQU B;  3M3Z B;  5AQI B;  3FZH B;  1UGO A;  5AQJ B;  1M7K A;  1I6Z A;  5AQV B;  5AQO B;  1M62 A;  5AQN B;  1UK5 A;  4HWC A;  5AQH B;  1HX1 B;  1T7S A;  4HWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...