5AQQB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
111
structure length
106
Chain Sequence
SNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 44
structure length 106
sequence length 111
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqqB00
5AQJB 5AQPB 1HX1B 5AQSB 1T7SA 4HWFA 1M7KA 5AQLB 5AQRB 3FZHB 5AQUB 3A8YC 1I6ZA 3LDQB 5AQTB 5AQHB 5AQMB 1UK5A 2D9DA 3FZLB 1UGOA 4HWCA 5AQFB 3FZKB 5AQNB 1M62A 5AQOB 5AQVB 5AQQB 5AQGB 4HWDA 4HWIB 3M3ZB 3FZFB 4HWHA 3FZMB 5AQKB 5AQIB
chains in the Genus database with same CATH superfamily
2JQHA 4HFBA 2XSBA 3AAAB 2BG9C 3Q5XA 4YTMA 3KVBA 3DTOA 3LG7A 4X5TA 1E7PA 2CHNA 1D1CA 4EYYR 2HN2A 4NIQA 2LSKA 2IW5B 2DWKA 2V5CA 3Q5WA 3AE4A 5E0OA 4X1KE 2L8KA 5CA0E 4QXBB 3BQLA 2VKHA 2YEVC 4DV1T 1T8BA 2K48A 1YQ4A 3RYHE 3QB5K 4MHCA 5J2UE 2X68A 5AQJB 2VKJA 4CXYA 5KX5E 4TNWA 5FYMA 2IAKA 4OYKA 2YINA 5AQGB 5A1LA 2YU1A 5F3JA 3JAEA 3FB2A 1ZP0A 3AA6B 2VWAA 4CZZB 3LDQB 1U4QA 2BBJA 3PUXF 3PUQA 2E8IA 4LFCT 3B5MA 5L3EB 1XDPA 3VKGA 5F5WA 1MIYA 3LK42 4ZI3C 2XQ8A 4FJOA 4Z8XA 3NRYA 2FUPA 4GK5E 2LE8A 2PFVA 1UX4A 1HTJF 2Q9QA 1WR6A 4QX8B 2C0SA 3PUVF 2ZM0A 1HNZT 4X1YE 3CQGB 4A5XA 3MA9A 3PE0A 2XASB 5LGTB 1OEDA 4ZOLE 3TLSA 3NVOA 4B3MT 4WYVA 3IEEA 4PK5A 2YU2A 5AQVB 5AFUL 2E5LT 4I0UA 3B57A 4WBNE 3AEGA 3J9X1 3CVRA 4IDZA 5DQVA 4HKAA 3PTRB 1HS7A 1YW0A 2CEAA 3SWHA 4LFBT 2BG9E 4ILBA 3HR0A 3AEBA 4KHZF 2WS3A 5LGUB 5KMGP 3IA3A 4UELA 2L3LA 2RA1A 5LBMA 3CX6B 2ZM6T 2LM2A 3NZPA 2LSIA 3GA8A 2NW7A 3ESLA 1WYCA 4UEMA 4H9NC 1H7CA 4HWIB 3ZJ1A 4HFVA 1ZV4X 3AE1A 5LNKA 4JI1T 2XAFB 4H9SE 2BS3A 3RYCE 3AVSA 4EV6A 1Z8UA 2CWYA 3NKZA 2V1DB 4LF4T 2XQ5A 4GKKT 2V6YA 3PUSA 2LOSA 2BKNA 3AA1B 2CWOA 4B3ST 2EHOA 2WU2A 1IAPA 4EZHA 2N9DA 2LT3A 5L3GB 5LB7B 3A5XA 4KBMB 5LOVE 3T1YT 5L4HA 1MMNA 3O1JA 1NEKA 4ZI2C 4PW8A 1M62A 3N9LA 1WR0A 4CN6A 5HEGA 3RYFE 4YSYA 4ASKA 4H63H 1FEWA 4OYJA 2KXPB 2YK0A 4J2CA 5FKYA 4AKHA 1OXZA 2GK9A 2CLYC 3M65A 2K24A 4AIUA 3QUJA 3RC3A 3HKDE 5DQWA 3N5LA 4IE5A 4TV8E 5L47A 3KDSE 3UUBA 4FI5A 3AEDA 2OV9A 3RC8A 3C4ZA 4LF9T 4EYUA 5JDNA 3KV4A 2VASA 4C90A 2QGSA 2CBJA 3OYZA 2P9BA 3NZQA 2LM9A 4JI0T 5HXRA 3N9OA 5AQIB 3OJAA 3ZMUB 4YLHA 2E9XA 4DV6T 5FY0A 2H3RA 4B6XA 3L3PA 2LSYA 1XDOA 4NPPA 3BQKA 3H37A 1KF6A 4ZZBA 4NUVA 5F8PA 1ZKEA 2X9XA 2JIWA 1D0XA 4ISTA 1WRDA 4F6RC 4YT0A 2Q9QB 3F31A 5LBQB 3K3QC 2DHRA 4ILAA 2V7MA 4PJNA 1XNQT 4KUMB 2HN1A 1V9DA 3TKLB 5JR9C 3BQIA 3ZYMA 3VKHA 2XHEB 4X62T 4PJJA 4DR1T 4Z90A 4K0UA 3RIAA 3FBLA 3VHLA 2BG9A 3UFGA 4E7SA 5IWAT 5FY7A 4EGWA 3T1HT 5C3JA 2X0HA 3OPCA 4H9RC 1CHUA 5HYAA 5LMNT 1NWMX 1DU2A 2I59A 5J0ZA 5HXEA 2C5JA 4OFZA 3V5SA 3P4PA 3EDUA 4NUUA 3UT5E 3PDYA 3QNUA 1CUNA 5AQQB 5HAXA 3SOLA 4U7YA 4HFDA 4U3CA 4JI8T 3PUWF 2VQFT 2D9DA 3ZYKA 1KNZA 2EHOB 5LXTE 4UV9B 3UU3A 4X20E 5ABFA 2QYWA 1Y01A 3VU7H 2DI4A 3OKQA 2K5BB 1N36T 3ONLC 2PG8A 1XZYA 2H89A 2E5VA 4XBFB 2Q9QD 4IDOA 4CI1B 4L9IA 4HWDA 2B1EA 3AE7A 3U3IA 1E1HB 2NW9A 4O8SA 2BS4A 1WCRA 4MALA 4CN4A 2LKHA 4AKLA 2NW8A 2E2AA 1QSDA 5HEOA 1W0AA 4TWFA 3RH3A 2UUBT 2V5DA 1B7TA 2VQET 1OEDE 4QXCB 3FXEB 5HEJA 2B76A 1Z0PA 2WB5A 3I9YA 2Y48B 4YHJA 3VR9A 3CK6A 4I4TE 5H6QB 5IYZE 3HI2A 1N32T 2NP9A 3AE9A 3IBPA 1LKXA 3FZMB 3ONJA 4QKNA 2I0MA 2LHRA 3L09A 4WW0A 4DV7T 2WWUA 4O4JE 3AXJB 2KWIB 1HNXT 2WMOA 3QK6A 1NENA 1L0VA 4AQGA 4M1PA 4UF0B 2NR4A 3W15B 3R6NA 1KNRA 1WYBA 5LHIB 3E22E 5CGMA 4NXMT 4CI3B 5AQUB 2XTLA 4OHFA 3RLFF 3PU8A 4G2AA 3QOFA 3RYIE 2JQKA 3EDVA 3B13A 2EHOD 2WU5A 2X9HA 2V7KA 4DIDB 3ANWA 4PK4A 4LFAT 4GOUA 1X9BA 2NTYA 5FNVE 3QB5A 2I6HA 5L3BB 3ZMTB 2V26A 2IHR1 2FJBA 1BR2A 2LRKA 2LEHA 3ABVA 4YTPA 2ZLYA 4HN9A 2UUAT 2XSAA 5ABEA 4ERRA 1YKHB 4JI7T 2JJ9A 1AJ3A 4DBQA 3N2KE 4AQFC 5JRCB 3BK9A 2UXNB 4B3TT 2AE9A 4HWHA 3EUHA 4N78D 4ZHQE 2X67A 2K9AA 2LRLA 2YDSA 3MZKB 4O4LE 1WLXA 2A2FX 4Z91A 5ABFB 3KBTA 3A8YC 3RF1A 3AAEB 4AXPA 3TLUA 4DUYT 2LOPA 1D0YA 1LVKA 2Z6EA 4YJ2E 3LBXA 2QRXA 3AE3A 3DP7A 4GYSA 3AEAA 5EZYE 3F2EA 2C5KT 2K3WA 2JMHA 2CXDA 3KV9A 4WZXA 4JUYA 5CB4E 1FMWA 3AE8A 2A9UA 3X1DA 4KP3C 5ABHA 5IUXA 5GONE 3NBXX 4TN7B 3RPUA 4HGAA 1R8IA 4QXHB 2J4GA 3HKBE 4PFOA 4KX6A 2LSJA 3EVYA 5HWXA 3ZMSB 5LA6E 5JR9A 2WDVA 4UVAB 2FBWA 1D1BA 4QHOA 4I55E 3C64A 5LJMA 4LMJA 2W63A 3N9PA 4QH4A 2VB6A 2WSSV 1MNDA 5LP6E 2RP4A 3N9QA 3FBZA 4QH1A 5FP3A 3AVRA 4YHHT 3UUMA 3AB3B 5CJ5A 2N2NA 3RKGA 3Q5EA 2MTQA 4F8HA 4DV0T 2VVNA 2J62A 5FVLA 5BMVE 4UR9A 4CI2B 2ES0A 4X66T 2M67A 2KMFA 4UV8B 2V7JA 4EEBA 4JBWF 2ZM8A 5L2LA 1J5WA 3C4XA 1I6ZA 3ZC1A 1I94T 3O4XE 2WDRA 1QUUA 2C5IT 3RIUC 3F57A 3HL6A 2WM9A 2MBGA 3CIRA 2WAUA 4BJMA 1E2AA 2QA7A 1O3XA 2X51A 3CQXC 4DV4T 3IF8B 3PU3A 4OX9T 3AA7B 2HHHT 3MJXA 4AI6A 5JTGA 1UURA 4QH5A 4B3RT 5FY1A 2FJAA 2XQ7A 1JNZA 4BJNA 5EK4A 2D0TA 3ZN0B 3L39A 3N9NA 5DABA 3SRZA 5JDMA 3NRXA 5AQMB 1YXRA 5L4EA 4JEHB 3UU8A 4IE0A 2PJQA 3O1HA 3U78A 4JEUB 3KVAA 3TLWA 5AQSB 3Q5DA 4DV2T 3KV5A 3FHNA 3TLVA 2BS2A 2JQQA 2DL1A 2FJDA 4EXTA 1UCUA 2V8SV 4EAHA 3KV6A 1HX8A 3OYXA 5CA1E 4U7IA 5AQRB 3PJAJ 5LG3A 4YTNA 1OEDB 3CKDA 3C50A 2WZIA 2X9YA 3JC6C 4O2AE 1HG5A 4PFPA 5FL0A 1MMAA 2XY8B 4JI4T 4DR2T 2XAQB 3ZEFB 4QX7B 1HG2A 2JQ9A 5AQTB 4JI6T 5C8YE 4MLKA 1UGOA 1JNRA 4TWDA 4IL4A 2KWHA 2BKOA 3MKDA 4YXDA 4GIWA 3ZC0A 4TV9E 2CA5A 2ACZA 3TLTA 2XQ3A 2DLRA 2ODVA 3JCFA 4HE8A 3SFEA 4P0BA 1T98A 2H7OA 4ZI2D 3ZLIA 4EIWA 3I0OA 1HR0T 1LRZA 5LG4A 4DR3T 3MK7C 4U33A 2CBIA 3HA4A 4ANJA 3MACA 4YJ3E 4WNKA 1D1AA 2WZHA 1OWAA 1W0BA 2IDOB 4X65T 4UVCB 2IC6A 1FMVA 4ILCA 3FZKB 5FMNA 2WMNA 5DJQC 3CQCB 2V6YB 4IDNA 3PUZF 4AQFA 5FXVA 5JQGE 4G63A 4DV3T 2L9QA 3G06A 2ZM2A 1N34T 4V1Av 2NWBA 3IHRA 1YKEB 2X0LB 1BR0A 2UUCT 2ODUA 3O9XA 2XQ6A 2PBIA 2XQYA 2LLYA 1HX1B 3SFDA 2BKPA 4YY3T 2JPFA 4AKGA 4IDPA 3LK2B 4MFRA 4IE6A 2ZMAA 4LMLA 2D5UA 3UU5A 4DO0A 4UXNB 3OTOT 2M6BA 2VKDA 2WBLA 4JI3T 4HFHA 3C98B 1MNEA 3ETVA 3K3OA 1HFAA 1IZNB 5LGNB 2RPAA 3ZMZB 3AA0B 5LHHB 4JYAT 5AQNB 2N1GA 4PAGA 4EEDA 3RQWA 4U2ZA 1US7B 4E7ZA 4NXNT 2VKOA 4IGUA 3LFMA 3UTKA 3LJCA 1VCTA 2E9XB 3GMIA 3ZCIA 1KNPA 2CPTA 1HNWT 1MMDA 1G73A 3PURA 4Q25A 4JI2T 3P4SA 2XQAA 5J2TE 3O1IA 4DR6T 3FZFB 2BBHA 1FJGT 2A3DA 5L3CB 2W67A 2Y8DA 2WCAA 5JDGA 1EZ3A 5EK2A 1S94A 4LF7T 2V6XA 2R6GF 4X64T 2LSGA 1ZHCA 5JDLA 3EAMA 3AE2A 3AECA 4ISSA 2IIUA 3KINB 2IMLA 5JDFA 1M7KA 3RIFA 3FZHB 1S35A 2BG9B 4EOZB 4DMWA 4U72A 1D0ZA 4XZCA 5J1GA 4A97A 2XQ9A 2J1DG 2MOZA 3CPZA 2VVSA 4HWFA 4O4IE 3CMLA 3ZT5A 5HCMA 1GQEA 2BZBA 3T8OA 4H9QC 2UU9T 4IIJE 5HEUA 2KT9A 3RIUA 2JMKA 4A98A 5LYJE 4XAXB 2KINB 1HCIA 4EB6E 4TX5A 5HXSA 3KBUA 1XMOT 4ZI7E 4YSXA 2XAJB 4JI5T 2XAGB 2VK9A 4UVBB 2F4VT 4KMCA 1UUSA 4PJMA 4TZ4C 2E9XD 3Q2MA 5L3FB 4HEAA 4U31A 3A7MA 4GK0E 1YQ3A 3UQ7A 2OLTA 3JAFA 4P1NA 3OBVE 2Y6XA 4IREA 5AQHB 1IJ5A 2KLQA 1UK5A 2BVLA 2XPKA 3KFWX 5ABGA 4HTEA 5FVKA 4GYRA 3I1AA 5L3DB 4C91A 2XZEA 1NAFA 4IT4A 2W61A 1FIOA 5JVDE 2XUEA 4A56A 2HPJA 1VOMA 2YKSA 5LMUT 2KSRA 3VRAA 4DNDA 4L5GA 5BR8T 3K8PC 1W09A 5FXZA 3Q9DA 3CX8B 3J7Yq 4GKJT 3RRWA 1MMGA 2UXDT 4ZEYA 1LVFA 3HKEE 4I43B 3MXZA 3LSVA 4ZZCA 2QVAA 1WFDA 3P50A 2KNDA 2CM0A 1IJ6A 2DWGA 4P09A 3ZPOA 3ZCJA 3ZSTA 4LF5T 3UUXB 2H7VC 5AQFB 5JDHA 1IBLT 2WQYA 4HFCA 1IBKT 1ZEEA 2M6IA 1T72A 1VCSA 4AKRB 1BR1A 1QLBA 3WAJA 3UQ4A 3ZT7A 5H6RB 3UU6A 2IC9A 4PJLA 2DCFA 4PK6A 3D0TA 4ILUA 3ZJ2A 5AQPB 3C4WA 3ANWB 4ZXLA 5TAOA 4HFEA 1SE7A 3I9WA 5EK3A 2YDRA 1SHZC 4YFSA 2LKGA 5LJNA 1U5PA 2XAHB 4ZI3D 3VR8A 4ZS3A 3P4QA 1W9RA 3I0QA 3PUYF 2UXXB 2KZ7B 4DR4T 3PUAA 3PV0F 4TWHA 1XNRT 1Y64B 1J1JA 3UU4A 2CCQA 1KEYA 3UFEA 4YSZA 4DBRA 3AAIA 2CHOA 3CWZB 2CRBA 3AE5A 3ZKRA 3N2GE 2W4XA 2MYSA 3ZN1B 3E0ZA 4TNVA 3K1SA 1KK7A 2V7LA 2X9WA 3QC9A 4IE7A 4CXWA 2CLYB 4DVDA 4AKIA 2XM2A 3RI5A 3RGLA 2LJLA 3GN5A 4EZ4A 4LF8T 5JDQA 1SA0E 3RKOA 1X79A 3OVUA 4CXXA 2J47A 3GWHA 2UXBT 3JADA 5LHGB 4JV5T 5KDMC 5JH7E 2Q9QC 3LBXB 5HWYA 4P0AA 2NOXA 3AXJA 4DR7T 1OEDC 3N2OA 2W62A 4BAYB 2AXDS 3AEFA 1XMQT 1SUMB 2H88A 2CMRA 4UF0A 4PNIA 4H9OC 4TUYE 3RHWA 4X1IE 3NWIA 4MBQA 3E08A 3WI3A 4KI0F 3M3ZB 3H3MA 2V7IA 5FL1A 3VRBA 4IE4A 3DJBA 3RRCA 1MIWA 5JR9B 2DNXA 3ZYLA 5HEHA 4JLEA 3N9MA 2W2UA 5CFBA 4L0RA 4AISA 4I50E 3P8CD 3R84B 3ZMVB 5KXJA 3H3AA 1N33T 4UIGA 5FXXA 2ACXA 3HKCE 5AQKB 1XWMA 2WY2A 2WP9A 4KHPT 5HCJA 2CXLA 2WWVA 1HF8A 4HFIA 3V5UA 1ZOYA 4HWCA 1KFYA 1IBMT 2EHOC 5JRCA 5IHYA 2NTXA 1VRBA 2XQ4A 2CXFA 3P4RA 3S4UA 3LK3B 3FXDB 2UXCT 5AQLB 4ZS2A 4H63V 2JRKA 4DR5T 4IHJE 3PUGA 2YOEA 5JREA 4COFA 1BR4A 4WBOA 2G0UA 2HPLA 2VL0A 3AEEA 4U2YA 1J5ET 3EABA 2YDQA 4O2BE 2A72A 3EHZA 2WDQA 3UULA 1G8XA 5FXWA 2X0YA 2X66A 5C2TA 5HXCA 2PTFA 4QWNB 3CX7B 5AQOB 2XJ7A 3EI0A 4LMKA 4IL9A 3RX6A 4CQIA 4H9PC 3K3NA 4OK0A 4O4HE 2FJEA 2BVMA 2VURA 5HXHA 3ZSSA 4AQYT 3JC6D 4DMVA 3FZLB 4U74A 4K0KT 4CN1A 2OA5A 3WAKA 5ADXL 4LF6T 2MPKA 3GN5B 3SS1A 2E9XC 3L8RA 2MAWA 2CE7A 3P7IA 2W0GA 4BA9A 2BDEA 5LCYA 2HH7A 2D0UA 2D2SA 2IUBA 4ADZA 2W66A 3RQUA 2YN6A 3ZT6A 3ETUA 2XM1A 4DV5T 1T7SA 3AE6A 1YD8G 3PJAA 2SPCA 1MIVA 4IDQA 5ETWA 3P4WA 2W00A 3UUNA 2VL8A 5M4YA 2LHNA 3C51A 4DUZT 3ONXA 1UX5A
chains in the Genus database with same CATH topology
5AQJB 5AQPB 1HX1B 5AQSB 1T7SA 4HWFA 1M7KA 5AQLB 5AQRB 3FZHB 5AQUB 3A8YC 1I6ZA 3LDQB 5AQTB 5AQHB 5AQMB 1UK5A 2D9DA 3FZLB 1UGOA 4HWCA 5AQFB 3FZKB 5AQNB 1M62A 5AQOB 5AQVB 5AQQB 5AQGB 4HWDA 4HWIB 3M3ZB 3FZFB 4HWHA 3FZMB 5AQKB 5AQIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQJ B;  5AQP B;  1HX1 B;  5AQS B;  1T7S A;  4HWF A;  1M7K A;  5AQL B;  5AQR B;  3FZH B;  5AQU B;  3A8Y C;  1I6Z A;  3LDQ B;  5AQT B;  5AQH B;  5AQM B;  1UK5 A;  2D9D A;  3FZL B;  1UGO A;  4HWC A;  5AQF B;  3FZK B;  5AQN B;  1M62 A;  5AQO B;  5AQV B;  5AQQ B;  5AQG B;  4HWD A;  4HWI B;  3M3Z B;  3FZF B;  4HWH A;  3FZM B;  5AQK B;  5AQI B; 
#chains in the Genus database with same CATH topology
 2JQH A;  4HFB A;  2XSB A;  3AAA B;  2BG9 C;  3Q5X A;  4YTM A;  3KVB A;  3DTO A;  3LG7 A;  4X5T A;  1E7P A;  2CHN A;  1D1C A;  4EYY R;  2HN2 A;  4NIQ A;  2LSK A;  2IW5 B;  2DWK A;  2V5C A;  3Q5W A;  3AE4 A;  5E0O A;  4X1K E;  2L8K A;  5CA0 E;  4QXB B;  3BQL A;  2VKH A;  2YEV C;  4DV1 T;  1T8B A;  2K48 A;  1YQ4 A;  3RYH E;  3QB5 K;  4MHC A;  5J2U E;  2X68 A;  5AQJ B;  2VKJ A;  4CXY A;  5KX5 E;  4TNW A;  5FYM A;  2IAK A;  4OYK A;  2YIN A;  5AQG B;  5A1L A;  2YU1 A;  5F3J A;  3JAE A;  3FB2 A;  1ZP0 A;  3AA6 B;  2VWA A;  4CZZ B;  3LDQ B;  1U4Q A;  2BBJ A;  3PUX F;  3PUQ A;  2E8I A;  4LFC T;  3B5M A;  5L3E B;  1XDP A;  3VKG A;  5F5W A;  1MIY A;  3LK4 2;  4ZI3 C;  2XQ8 A;  4FJO A;  4Z8X A;  3NRY A;  2FUP A;  4GK5 E;  2LE8 A;  2PFV A;  1UX4 A;  1HTJ F;  2Q9Q A;  1WR6 A;  4QX8 B;  2C0S A;  3PUV F;  2ZM0 A;  1HNZ T;  4X1Y E;  3CQG B;  4A5X A;  3MA9 A;  3PE0 A;  2XAS B;  5LGT B;  1OED A;  4ZOL E;  3TLS A;  3NVO A;  4B3M T;  4WYV A;  3IEE A;  4PK5 A;  2YU2 A;  5AQV B;  5AFU L;  2E5L T;  4I0U A;  3B57 A;  4WBN E;  3AEG A;  3J9X 1;  3CVR A;  4IDZ A;  5DQV A;  4HKA A;  3PTR B;  1HS7 A;  1YW0 A;  2CEA A;  3SWH A;  4LFB T;  2BG9 E;  4ILB A;  3HR0 A;  3AEB A;  4KHZ F;  2WS3 A;  5LGU B;  5KMG P;  3IA3 A;  4UEL A;  2L3L A;  2RA1 A;  5LBM A;  3CX6 B;  2ZM6 T;  2LM2 A;  3NZP A;  2LSI A;  3GA8 A;  2NW7 A;  3ESL A;  1WYC A;  4UEM A;  4H9N C;  1H7C A;  4HWI B;  3ZJ1 A;  4HFV A;  1ZV4 X;  3AE1 A;  5LNK A;  4JI1 T;  2XAF B;  4H9S E;  2BS3 A;  3RYC E;  3AVS A;  4EV6 A;  1Z8U A;  2CWY A;  3NKZ A;  2V1D B;  4LF4 T;  2XQ5 A;  4GKK T;  2V6Y A;  3PUS A;  2LOS A;  2BKN A;  3AA1 B;  2CWO A;  4B3S T;  2EHO A;  2WU2 A;  1IAP A;  4EZH A;  2N9D A;  2LT3 A;  5L3G B;  5LB7 B;  3A5X A;  4KBM B;  5LOV E;  3T1Y T;  5L4H A;  1MMN A;  3O1J A;  1NEK A;  4ZI2 C;  4PW8 A;  1M62 A;  3N9L A;  1WR0 A;  4CN6 A;  5HEG A;  3RYF E;  4YSY A;  4ASK A;  4H63 H;  1FEW A;  4OYJ A;  2KXP B;  2YK0 A;  4J2C A;  5FKY A;  4AKH A;  1OXZ A;  2GK9 A;  2CLY C;  3M65 A;  2K24 A;  4AIU A;  3QUJ A;  3RC3 A;  3HKD E;  5DQW A;  3N5L A;  4IE5 A;  4TV8 E;  5L47 A;  3KDS E;  3UUB A;  4FI5 A;  3AED A;  2OV9 A;  3RC8 A;  3C4Z A;  4LF9 T;  4EYU A;  5JDN A;  3KV4 A;  2VAS A;  4C90 A;  2QGS A;  2CBJ A;  3OYZ A;  2P9B A;  3NZQ A;  2LM9 A;  4JI0 T;  5HXR A;  3N9O A;  5AQI B;  3OJA A;  3ZMU B;  4YLH A;  2E9X A;  4DV6 T;  5FY0 A;  2H3R A;  4B6X A;  3L3P A;  2LSY A;  1XDO A;  4NPP A;  3BQK A;  3H37 A;  1KF6 A;  4ZZB A;  4NUV A;  5F8P A;  1ZKE A;  2X9X A;  2JIW A;  1D0X A;  4IST A;  1WRD A;  4F6R C;  4YT0 A;  2Q9Q B;  3F31 A;  5LBQ B;  3K3Q C;  2DHR A;  4ILA A;  2V7M A;  4PJN A;  1XNQ T;  4KUM B;  2HN1 A;  1V9D A;  3TKL B;  5JR9 C;  3BQI A;  3ZYM A;  3VKH A;  2XHE B;  4X62 T;  4PJJ A;  4DR1 T;  4Z90 A;  4K0U A;  3RIA A;  3FBL A;  3VHL A;  2BG9 A;  3UFG A;  4E7S A;  5IWA T;  5FY7 A;  4EGW A;  3T1H T;  5C3J A;  2X0H A;  3OPC A;  4H9R C;  1CHU A;  5HYA A;  5LMN T;  1NWM X;  1DU2 A;  2I59 A;  5J0Z A;  5HXE A;  2C5J A;  4OFZ A;  3V5S A;  3P4P A;  3EDU A;  4NUU A;  3UT5 E;  3PDY A;  3QNU A;  1CUN A;  5AQQ B;  5HAX A;  3SOL A;  4U7Y A;  4HFD A;  4U3C A;  4JI8 T;  3PUW F;  2VQF T;  2D9D A;  3ZYK A;  1KNZ A;  2EHO B;  5LXT E;  4UV9 B;  3UU3 A;  4X20 E;  5ABF A;  2QYW A;  1Y01 A;  3VU7 H;  2DI4 A;  3OKQ A;  2K5B B;  1N36 T;  3ONL C;  2PG8 A;  1XZY A;  2H89 A;  2E5V A;  4XBF B;  2Q9Q D;  4IDO A;  4CI1 B;  4L9I A;  4HWD A;  2B1E A;  3AE7 A;  3U3I A;  1E1H B;  2NW9 A;  4O8S A;  2BS4 A;  1WCR A;  4MAL A;  4CN4 A;  2LKH A;  4AKL A;  2NW8 A;  2E2A A;  1QSD A;  5HEO A;  1W0A A;  4TWF A;  3RH3 A;  2UUB T;  2V5D A;  1B7T A;  2VQE T;  1OED E;  4QXC B;  3FXE B;  5HEJ A;  2B76 A;  1Z0P A;  2WB5 A;  3I9Y A;  2Y48 B;  4YHJ A;  3VR9 A;  3CK6 A;  4I4T E;  5H6Q B;  5IYZ E;  3HI2 A;  1N32 T;  2NP9 A;  3AE9 A;  3IBP A;  1LKX A;  3FZM B;  3ONJ A;  4QKN A;  2I0M A;  2LHR A;  3L09 A;  4WW0 A;  4DV7 T;  2WWU A;  4O4J E;  3AXJ B;  2KWI B;  1HNX T;  2WMO A;  3QK6 A;  1NEN A;  1L0V A;  4AQG A;  4M1P A;  4UF0 B;  2NR4 A;  3W15 B;  3R6N A;  1KNR A;  1WYB A;  5LHI B;  3E22 E;  5CGM A;  4NXM T;  4CI3 B;  5AQU B;  2XTL A;  4OHF A;  3RLF F;  3PU8 A;  4G2A A;  3QOF A;  3RYI E;  2JQK A;  3EDV A;  3B13 A;  2EHO D;  2WU5 A;  2X9H A;  2V7K A;  4DID B;  3ANW A;  4PK4 A;  4LFA T;  4GOU A;  1X9B A;  2NTY A;  5FNV E;  3QB5 A;  2I6H A;  5L3B B;  3ZMT B;  2V26 A;  2IHR 1;  2FJB A;  1BR2 A;  2LRK A;  2LEH A;  3ABV A;  4YTP A;  2ZLY A;  4HN9 A;  2UUA T;  2XSA A;  5ABE A;  4ERR A;  1YKH B;  4JI7 T;  2JJ9 A;  1AJ3 A;  4DBQ A;  3N2K E;  4AQF C;  5JRC B;  3BK9 A;  2UXN B;  4B3T T;  2AE9 A;  4HWH A;  3EUH A;  4N78 D;  4ZHQ E;  2X67 A;  2K9A A;  2LRL A;  2YDS A;  3MZK B;  4O4L E;  1WLX A;  2A2F X;  4Z91 A;  5ABF B;  3KBT A;  3A8Y C;  3RF1 A;  3AAE B;  4AXP A;  3TLU A;  4DUY T;  2LOP A;  1D0Y A;  1LVK A;  2Z6E A;  4YJ2 E;  3LBX A;  2QRX A;  3AE3 A;  3DP7 A;  4GYS A;  3AEA A;  5EZY E;  3F2E A;  2C5K T;  2K3W A;  2JMH A;  2CXD A;  3KV9 A;  4WZX A;  4JUY A;  5CB4 E;  1FMW A;  3AE8 A;  2A9U A;  3X1D A;  4KP3 C;  5ABH A;  5IUX A;  5GON E;  3NBX X;  4TN7 B;  3RPU A;  4HGA A;  1R8I A;  4QXH B;  2J4G A;  3HKB E;  4PFO A;  4KX6 A;  2LSJ A;  3EVY A;  5HWX A;  3ZMS B;  5LA6 E;  5JR9 A;  2WDV A;  4UVA B;  2FBW A;  1D1B A;  4QHO A;  4I55 E;  3C64 A;  5LJM A;  4LMJ A;  2W63 A;  3N9P A;  4QH4 A;  2VB6 A;  2WSS V;  1MND A;  5LP6 E;  2RP4 A;  3N9Q A;  3FBZ A;  4QH1 A;  5FP3 A;  3AVR A;  4YHH T;  3UUM A;  3AB3 B;  5CJ5 A;  2N2N A;  3RKG A;  3Q5E A;  2MTQ A;  4F8H A;  4DV0 T;  2VVN A;  2J62 A;  5FVL A;  5BMV E;  4UR9 A;  4CI2 B;  2ES0 A;  4X66 T;  2M67 A;  2KMF A;  4UV8 B;  2V7J A;  4EEB A;  4JBW F;  2ZM8 A;  5L2L A;  1J5W A;  3C4X A;  1I6Z A;  3ZC1 A;  1I94 T;  3O4X E;  2WDR A;  1QUU A;  2C5I T;  3RIU C;  3F57 A;  3HL6 A;  2WM9 A;  2MBG A;  3CIR A;  2WAU A;  4BJM A;  1E2A A;  2QA7 A;  1O3X A;  2X51 A;  3CQX C;  4DV4 T;  3IF8 B;  3PU3 A;  4OX9 T;  3AA7 B;  2HHH T;  3MJX A;  4AI6 A;  5JTG A;  1UUR A;  4QH5 A;  4B3R T;  5FY1 A;  2FJA A;  2XQ7 A;  1JNZ A;  4BJN A;  5EK4 A;  2D0T A;  3ZN0 B;  3L39 A;  3N9N A;  5DAB A;  3SRZ A;  5JDM A;  3NRX A;  5AQM B;  1YXR A;  5L4E A;  4JEH B;  3UU8 A;  4IE0 A;  2PJQ A;  3O1H A;  3U78 A;  4JEU B;  3KVA A;  3TLW A;  5AQS B;  3Q5D A;  4DV2 T;  3KV5 A;  3FHN A;  3TLV A;  2BS2 A;  2JQQ A;  2DL1 A;  2FJD A;  4EXT A;  1UCU A;  2V8S V;  4EAH A;  3KV6 A;  1HX8 A;  3OYX A;  5CA1 E;  4U7I A;  5AQR B;  3PJA J;  5LG3 A;  4YTN A;  1OED B;  3CKD A;  3C50 A;  2WZI A;  2X9Y A;  3JC6 C;  4O2A E;  1HG5 A;  4PFP A;  5FL0 A;  1MMA A;  2XY8 B;  4JI4 T;  4DR2 T;  2XAQ B;  3ZEF B;  4QX7 B;  1HG2 A;  2JQ9 A;  5AQT B;  4JI6 T;  5C8Y E;  4MLK A;  1UGO A;  1JNR A;  4TWD A;  4IL4 A;  2KWH A;  2BKO A;  3MKD A;  4YXD A;  4GIW A;  3ZC0 A;  4TV9 E;  2CA5 A;  2ACZ A;  3TLT A;  2XQ3 A;  2DLR A;  2ODV A;  3JCF A;  4HE8 A;  3SFE A;  4P0B A;  1T98 A;  2H7O A;  4ZI2 D;  3ZLI A;  4EIW A;  3I0O A;  1HR0 T;  1LRZ A;  5LG4 A;  4DR3 T;  3MK7 C;  4U33 A;  2CBI A;  3HA4 A;  4ANJ A;  3MAC A;  4YJ3 E;  4WNK A;  1D1A A;  2WZH A;  1OWA A;  1W0B A;  2IDO B;  4X65 T;  4UVC B;  2IC6 A;  1FMV A;  4ILC A;  3FZK B;  5FMN A;  2WMN A;  5DJQ C;  3CQC B;  2V6Y B;  4IDN A;  3PUZ F;  4AQF A;  5FXV A;  5JQG E;  4G63 A;  4DV3 T;  2L9Q A;  3G06 A;  2ZM2 A;  1N34 T;  4V1A v;  2NWB A;  3IHR A;  1YKE B;  2X0L B;  1BR0 A;  2UUC T;  2ODU A;  3O9X A;  2XQ6 A;  2PBI A;  2XQY A;  2LLY A;  1HX1 B;  3SFD A;  2BKP A;  4YY3 T;  2JPF A;  4AKG A;  4IDP A;  3LK2 B;  4MFR A;  4IE6 A;  2ZMA A;  4LML A;  2D5U A;  3UU5 A;  4DO0 A;  4UXN B;  3OTO T;  2M6B A;  2VKD A;  2WBL A;  4JI3 T;  4HFH A;  3C98 B;  1MNE A;  3ETV A;  3K3O A;  1HFA A;  1IZN B;  5LGN B;  2RPA A;  3ZMZ B;  3AA0 B;  5LHH B;  4JYA T;  5AQN B;  2N1G A;  4PAG A;  4EED A;  3RQW A;  4U2Z A;  1US7 B;  4E7Z A;  4NXN T;  2VKO A;  4IGU A;  3LFM A;  3UTK A;  3LJC A;  1VCT A;  2E9X B;  3GMI A;  3ZCI A;  1KNP A;  2CPT A;  1HNW T;  1MMD A;  1G73 A;  3PUR A;  4Q25 A;  4JI2 T;  3P4S A;  2XQA A;  5J2T E;  3O1I A;  4DR6 T;  3FZF B;  2BBH A;  1FJG T;  2A3D A;  5L3C B;  2W67 A;  2Y8D A;  2WCA A;  5JDG A;  1EZ3 A;  5EK2 A;  1S94 A;  4LF7 T;  2V6X A;  2R6G F;  4X64 T;  2LSG A;  1ZHC A;  5JDL A;  3EAM A;  3AE2 A;  3AEC A;  4ISS A;  2IIU A;  3KIN B;  2IML A;  5JDF A;  1M7K A;  3RIF A;  3FZH B;  1S35 A;  2BG9 B;  4EOZ B;  4DMW A;  4U72 A;  1D0Z A;  4XZC A;  5J1G A;  4A97 A;  2XQ9 A;  2J1D G;  2MOZ A;  3CPZ A;  2VVS A;  4HWF A;  4O4I E;  3CML A;  3ZT5 A;  5HCM A;  1GQE A;  2BZB A;  3T8O A;  4H9Q C;  2UU9 T;  4IIJ E;  5HEU A;  2KT9 A;  3RIU A;  2JMK A;  4A98 A;  5LYJ E;  4XAX B;  2KIN B;  1HCI A;  4EB6 E;  4TX5 A;  5HXS A;  3KBU A;  1XMO T;  4ZI7 E;  4YSX A;  2XAJ B;  4JI5 T;  2XAG B;  2VK9 A;  4UVB B;  2F4V T;  4KMC A;  1UUS A;  4PJM A;  4TZ4 C;  2E9X D;  3Q2M A;  5L3F B;  4HEA A;  4U31 A;  3A7M A;  4GK0 E;  1YQ3 A;  3UQ7 A;  2OLT A;  3JAF A;  4P1N A;  3OBV E;  2Y6X A;  4IRE A;  5AQH B;  1IJ5 A;  2KLQ A;  1UK5 A;  2BVL A;  2XPK A;  3KFW X;  5ABG A;  4HTE A;  5FVK A;  4GYR A;  3I1A A;  5L3D B;  4C91 A;  2XZE A;  1NAF A;  4IT4 A;  2W61 A;  1FIO A;  5JVD E;  2XUE A;  4A56 A;  2HPJ A;  1VOM A;  2YKS A;  5LMU T;  2KSR A;  3VRA A;  4DND A;  4L5G A;  5BR8 T;  3K8P C;  1W09 A;  5FXZ A;  3Q9D A;  3CX8 B;  3J7Y q;  4GKJ T;  3RRW A;  1MMG A;  2UXD T;  4ZEY A;  1LVF A;  3HKE E;  4I43 B;  3MXZ A;  3LSV A;  4ZZC A;  2QVA A;  1WFD A;  3P50 A;  2KND A;  2CM0 A;  1IJ6 A;  2DWG A;  4P09 A;  3ZPO A;  3ZCJ A;  3ZST A;  4LF5 T;  3UUX B;  2H7V C;  5AQF B;  5JDH A;  1IBL T;  2WQY A;  4HFC A;  1IBK T;  1ZEE A;  2M6I A;  1T72 A;  1VCS A;  4AKR B;  1BR1 A;  1QLB A;  3WAJ A;  3UQ4 A;  3ZT7 A;  5H6R B;  3UU6 A;  2IC9 A;  4PJL A;  2DCF A;  4PK6 A;  3D0T A;  4ILU A;  3ZJ2 A;  5AQP B;  3C4W A;  3ANW B;  4ZXL A;  5TAO A;  4HFE A;  1SE7 A;  3I9W A;  5EK3 A;  2YDR A;  1SHZ C;  4YFS A;  2LKG A;  5LJN A;  1U5P A;  2XAH B;  4ZI3 D;  3VR8 A;  4ZS3 A;  3P4Q A;  1W9R A;  3I0Q A;  3PUY F;  2UXX B;  2KZ7 B;  4DR4 T;  3PUA A;  3PV0 F;  4TWH A;  1XNR T;  1Y64 B;  1J1J A;  3UU4 A;  2CCQ A;  1KEY A;  3UFE A;  4YSZ A;  4DBR A;  3AAI A;  2CHO A;  3CWZ B;  2CRB A;  3AE5 A;  3ZKR A;  3N2G E;  2W4X A;  2MYS A;  3ZN1 B;  3E0Z A;  4TNV A;  3K1S A;  1KK7 A;  2V7L A;  2X9W A;  3QC9 A;  4IE7 A;  4CXW A;  2CLY B;  4DVD A;  4AKI A;  2XM2 A;  3RI5 A;  3RGL A;  2LJL A;  3GN5 A;  4EZ4 A;  4LF8 T;  5JDQ A;  1SA0 E;  3RKO A;  1X79 A;  3OVU A;  4CXX A;  2J47 A;  3GWH A;  2UXB T;  3JAD A;  5LHG B;  4JV5 T;  5KDM C;  5JH7 E;  2Q9Q C;  3LBX B;  5HWY A;  4P0A A;  2NOX A;  3AXJ A;  4DR7 T;  1OED C;  3N2O A;  2W62 A;  4BAY B;  2AXD S;  3AEF A;  1XMQ T;  1SUM B;  2H88 A;  2CMR A;  4UF0 A;  4PNI A;  4H9O C;  4TUY E;  3RHW A;  4X1I E;  3NWI A;  4MBQ A;  3E08 A;  3WI3 A;  4KI0 F;  3M3Z B;  3H3M A;  2V7I A;  5FL1 A;  3VRB A;  4IE4 A;  3DJB A;  3RRC A;  1MIW A;  5JR9 B;  2DNX A;  3ZYL A;  5HEH A;  4JLE A;  3N9M A;  2W2U A;  5CFB A;  4L0R A;  4AIS A;  4I50 E;  3P8C D;  3R84 B;  3ZMV B;  5KXJ A;  3H3A A;  1N33 T;  4UIG A;  5FXX A;  2ACX A;  3HKC E;  5AQK B;  1XWM A;  2WY2 A;  2WP9 A;  4KHP T;  5HCJ A;  2CXL A;  2WWV A;  1HF8 A;  4HFI A;  3V5U A;  1ZOY A;  4HWC A;  1KFY A;  1IBM T;  2EHO C;  5JRC A;  5IHY A;  2NTX A;  1VRB A;  2XQ4 A;  2CXF A;  3P4R A;  3S4U A;  3LK3 B;  3FXD B;  2UXC T;  5AQL B;  4ZS2 A;  4H63 V;  2JRK A;  4DR5 T;  4IHJ E;  3PUG A;  2YOE A;  5JRE A;  4COF A;  1BR4 A;  4WBO A;  2G0U A;  2HPL A;  2VL0 A;  3AEE A;  4U2Y A;  1J5E T;  3EAB A;  2YDQ A;  4O2B E;  2A72 A;  3EHZ A;  2WDQ A;  3UUL A;  1G8X A;  5FXW A;  2X0Y A;  2X66 A;  5C2T A;  5HXC A;  2PTF A;  4QWN B;  3CX7 B;  5AQO B;  2XJ7 A;  3EI0 A;  4LMK A;  4IL9 A;  3RX6 A;  4CQI A;  4H9P C;  3K3N A;  4OK0 A;  4O4H E;  2FJE A;  2BVM A;  2VUR A;  5HXH A;  3ZSS A;  4AQY T;  3JC6 D;  4DMV A;  3FZL B;  4U74 A;  4K0K T;  4CN1 A;  2OA5 A;  3WAK A;  5ADX L;  4LF6 T;  2MPK A;  3GN5 B;  3SS1 A;  2E9X C;  3L8R A;  2MAW A;  2CE7 A;  3P7I A;  2W0G A;  4BA9 A;  2BDE A;  5LCY A;  2HH7 A;  2D0U A;  2D2S A;  2IUB A;  4ADZ A;  2W66 A;  3RQU A;  2YN6 A;  3ZT6 A;  3ETU A;  2XM1 A;  4DV5 T;  1T7S A;  3AE6 A;  1YD8 G;  3PJA A;  2SPC A;  1MIV A;  4IDQ A;  5ETW A;  3P4W A;  2W00 A;  3UUN A;  2VL8 A;  5M4Y A;  2LHN A;  3C51 A;  4DUZ T;  3ONX A;  1UX5 A; 
#chains in the Genus database with same CATH homology
 5AQJ B;  5AQP B;  1HX1 B;  5AQS B;  1T7S A;  4HWF A;  1M7K A;  5AQL B;  5AQR B;  3FZH B;  5AQU B;  3A8Y C;  1I6Z A;  3LDQ B;  5AQT B;  5AQH B;  5AQM B;  1UK5 A;  2D9D A;  3FZL B;  1UGO A;  4HWC A;  5AQF B;  3FZK B;  5AQN B;  1M62 A;  5AQO B;  5AQV B;  5AQQ B;  5AQG B;  4HWD A;  4HWI B;  3M3Z B;  3FZF B;  4HWH A;  3FZM B;  5AQK B;  5AQI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...