5AQQB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
111
structure length
106
Chain Sequence
SNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
total genus 44
structure length 106
sequence length 111
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqqB00
1I6ZA 1HX1B 5AQQB 5AQRB 3FZMB 3FZLB 4HWFA 5AQPB 5AQFB 4HWCA 5AQIB 3FZHB 5AQTB 3FZFB 3M3ZB 5AQOB 5AQSB 5AQMB 1M62A 1UK5A 1M7KA 5AQVB 5AQKB 3A8YC 4HWHA 2D9DA 5AQUB 1UGOA 3LDQB 4HWDA 3FZKB 5AQGB 5AQJB 5AQNB 5AQLB 4HWIB 5AQHB 1T7SA
chains in the Genus database with same CATH superfamily
1HX1B 4DV4T 5H6QB 3NKZA 2MPKA 2BKNA 4JUYA 2YDRA 3F31A 5AQRB 3UU5A 3FBZA 1W0AA 3Q5DA 5IYZE 5JDGA 4IREA 2X9XA 3AAIA 1MNEA 2XAQB 5JDQA 3HR0A 4DR4T 5AQOB 3C4ZA 1NENA 2NW8A 3AAEB 3AXJB 4U72A 4GYSA 5JDFA 3TLSA 1YD8G 4CXWA 2NW9A 5HXHA 3ZEFB 4JEHB 1HNWT 2W66A 3MKDA 2LOSA 2QRXA 3NVOA 4PK5A 4B3MT 1I94T 1SHZC 5KDMC 2WZIA 2XSAA 3AEDA 5TAOA 2HHHT 3I0OA 3UTKA 3K1SA 2YINA 2N2NA 3AE1A 2HPJA 4AIUA 4H9SE 4HFCA 4LMKA 4LF6T 3LBXA 5ABFB 4GKJT 2KLQA 4AKGA 4B6XA 3WI3A 4BJMA 3P7IA 1I6ZA 2C5KT 2CCQA 3C4XA 4B3RT 5CJ5A 1KNRA 2J47A 3GA8A 2I59A 2ODUA 3EVYA 3QB5A 1FMVA 3ZKRA 5JQGE 3ZCJA 2CWOA 4DV3T 3ZMTB 1R8IA 3R84B 1O3XA 2EHOA 2ES0A 3Q2MA 2XSBA 4IL9A 3RH3A 4WBNE 5JREA 2UU9T 5GONE 2HN1A 3TLWA 2ACXA 4MHCA 3C50A 4COFA 4B3ST 3UU8A 1AJ3A 3C98B 2HH7A 2XQ5A 4YJ2E 5ABFA 2CXFA 1Y01A 3WAKA 3K3OA 3IA3A 4BJNA 3I0QA 5LGTB 5M4YA 2VQET 2VKHA 2UXXB 2XAHB 2E9XA 4HTEA 4UR9A 5AQGB 5F3JA 3VKHA 3JAFA 1XDPA 3AE6A 4IIJE 1XNQT 5EK4A 1OXZA 1OEDB 2ZLYA 3U78A 4EEBA 2PJQA 2KZ7B 3AEEA 1YKHB 4PJLA 3CK6A 4AXPA 4ILAA 3NWIA 2RP4A 2XTLA 1BR2A 3AE4A 5ABHA 3K3NA 4I43B 4UF0A 3ZT7A 5JDLA 2JMHA 4DV2T 4DBRA 2HPLA 2CPTA 3RLFF 2ZM8A 5LJMA 4ZI2C 1WRDA 3M3ZB 4DIDB 3F2EA 4KP3C 4DR3T 4CN6A 3P50A 3GN5A 1MIVA 3H3AA 2E5LT 5IWAT 4E7ZA 3E08A 1U4QA 4ZS3A 2Z6EA 4E7SA 4HWHA 4ZZCA 4AKIA 2V6YB 3GMIA 3LBXB 4UVAB 3ABVA 5HXEA 2ZM6T 4ZI3C 2B1EA 5CA0E 4CQIA 3AAAB 4PAGA 4KUMB 1OWAA 5FXVA 2Q9QB 4EZ4A 2BG9A 3K8PC 4PNIA 4ADZA 4DVDA 2WQYA 4EYYR 1BR0A 5JDMA 3HKEE 2JJ9A 4A98A 4JI7T 4I50E 4KBMB 5HYAA 4L9IA 4YSXA 1HX8A 3FZMB 1SUMB 3P8CD 5L3CB 3FZLB 3H3MA 5LG4A 1N36T 3EI0A 3BK9A 1KNZA 2V5DA 3P4QA 1KEYA 2FUPA 3D0TA 5FL0A 2WB5A 4UV9B 4ZS2A 2WDVA 3UUBA 3AEAA 1YW0A 3PURA 4WBOA 2CHNA 1HTJF 2WBLA 5AQSB 4IE6A 4O4IE 4HFEA 4X65T 5CFBA 4WZXA 2JQQA 3P4RA 2X9HA 4DMVA 4DR2T 3B57A 3AE3A 2LT3A 3H37A 2L9QA 3C51A 3A8YC 3KV4A 2K9AA 4LMLA 5JR9C 4EGWA 2UUAT 2WWVA 2X51A 3RRCA 2FJAA 2LSIA 2PTFA 3ZMVB 4DR7T 2BVMA 4WYVA 3R6NA 2H88A 3PUSA 4YFSA 5LG3A 4B3TT 5F5WA 1T8BA 2PFVA 4EYUA 2IDOB 4JEUB 4JYAT 4A56A 4P0AA 2J62A 4U7YA 3DP7A 3TKLB 3UQ4A 4AQFC 3KVAA 5AQHB 5LBQB 4O8SA 5LMNT 5LBMA 4EIWA 5LOVE 1DU2A 2DL1A 2KWIB 3PE0A 5J2UE 3AA6B 4UV8B 3MACA 2V7LA 4AQGA 1XMQT 3VRBA 4YT0A 1UUSA 5AQFB 3FXDB 1KFYA 2WWUA 5DJQC 3ZN0B 5C2TA 2XY8B 4YXDA 5ADXL 5A1LA 1H7CA 4PW8A 2KMFA 3JCFA 5ABGA 4YHHT 2DWGA 3JC6D 4NIQA 3RIUA 4GYRA 5IHYA 3LK2B 5L3EB 3KBUA 4IE4A 5AQVB 5FVLA 2WP9A 2QVAA 5FXXA 1NWMX 2H7OA 2IW5B 3Q5WA 1UX5A 4TWFA 3RKGA 4JI8T 2XJ7A 4ZEYA 5L47A 2CHOA 4DV7T 1VOMA 2W63A 3B5MA 4UEMA 4QKNA 1LVKA 3ZPOA 3CPZA 4WNKA 3JC6C 4U74A 3KBTA 5LB7B 3UU3A 4EZHA 3RI5A 2K5BB 4O4HE 2E9XB 2W62A 5HXRA 4DV6T 2A3DA 5CA1E 4EOZB 1ZHCA 5JDNA 4H9OC 2V8SV 2WM9A 2B76A 3CX6B 4IE7A 4TWDA 4X1YE 3ZN1B 4KMCA 1MMAA 4TV8E 4YLHA 3ZSSA 5LGUB 4LF5T 1E7PA 4HWCA 2CBJA 1D1CA 1VCTA 3ONXA 4H9QC 4LF9T 2AXDS 2ZM2A 2DWKA 3C64A 4ISSA 2M6BA 4G63A 4UVCB 5HCMA 3RYFE 4G2AA 3OVUA 2H3RA 2X9WA 2IAKA 3AA0B 3CMLA 3N9QA 4UVBB 4KHZF 1N33T 2IHR1 1ZOYA 5HWXA 2JPFA 3Q5EA 2MYSA 4U31A 2LSJA 4HFVA 2LM2A 5FKYA 3ZYMA 4ILUA 1HNZT 1W9RA 2CE7A 3SRZA 4X1IE 2A72A 2KNDA 4FJOA 4HFBA 2BKOA 1FJGT 4YSZA 4QH1A 2M6IA 1HR0T 2X67A 2BKPA 1LVFA 2E2AA 5HWYA 2KWHA 4LF7T 4NXMT 2X9YA 2IC6A 3EDUA 3L8RA 5LA6E 4Z91A 3X1DA 4EXTA 1D1BA 5L4EA 2JIWA 2CXLA 2Y6XA 1HG2A 2NW7A 2XQ4A 3AE8A 4IL4A 3CWZB 2CA5A 2X0HA 3BQIA 3HKBE 3N2OA 3MA9A 3VR8A 5HEJA 3CX7B 1QUUA 2BG9C 4IHJE 4PJNA 2X66A 1FEWA 3PUWF 1QSDA 2JQ9A 2L3LA 1YXRA 3EDVA 3HL6A 3NRXA 3PU8A 4IDZA 4BAYB 3L3PA 3NZPA 4JI0T 1WCRA 5AQUB 2YKSA 5HEOA 2UXCT 2CRBA 2X0LB 4P0BA 2CLYC 1UX4A 2HN2A 2A9UA 1HCIA 3N9NA 4PFPA 4HFDA 3ZT5A 4AKRB 2UUBT 3ANWA 1HF8A 4ZI7E 3AA1B 4LF8T 1T7SA 1JNRA 4XAXB 2XQ8A 2LEHA 2KT9A 4H63H 2C0SA 5LYJE 4DR6T 2N9DA 4MLKA 1HG5A 2OA5A 5LHHB 2XQ3A 2MOZA 4YSYA 2VVNA 3G06A 3OPCA 1IBMT 5HEGA 4O2AE 3UFEA 1IJ5A 3PUZF 3SOLA 2J1DG 1U5PA 2YOEA 2WS3A 1L0VA 2LHNA 5DABA 1J5WA 2K24A 2UXDT 1M62A 2EHOD 2YDSA 4JBWF 5FY0A 4OFZA 4JLEA 1SA0E 1WYBA 1N34T 2QYWA 2DI4A 3KFWX 3RYHE 5DQWA 4LMJA 3RC8A 2DLRA 1MMNA 2VK9A 2DHRA 3LDQB 2VWAA 3RIUC 2BBHA 4LFBT 4MALA 4QX7B 2BG9E 3ETUA 5LGNB 4TN7B 2V6YA 4HWIB 5JRCA 3ONJA 4GIWA 3MXZA 3V5SA 4PJMA 2VASA 3ZSTA 5LHGB 2NWBA 2V7MA 3GN5B 3ZYLA 4I4TE 4JI1T 1IJ6A 2L8KA 5JDHA 2LHRA 4L5GA 3PUXF 4A97A 4YTPA 2EHOC 4TWHA 2BS2A 4CZZB 5BMVE 3ETVA 4FI5A 4QH4A 4TV9E 1E2AA 3ZMUB 3PJAJ 2I0MA 1HFAA 1S35A 2LSYA 2QA7A 2CLYB 3LG7A 4M1PA 1M7KA 2WCAA 1WLXA 5EZYE 2VQFT 5L3GB 2CXDA 3AECA 4XZCA 1CHUA 3I9WA 4EV6A 4DBQA 1GQEA 4ISTA 3ANWB 2D9DA 5CB4E 1UCUA 2FJBA 5FVKA 1T98A 4ZHQE 5C8YE 1JNZA 4HGAA 1Z0PA 2BZBA 4O4LE 3CVRA 3ZT6A 5J0ZA 3EHZA 4OYJA 2E8IA 2WDQA 3QUJA 5FP3A 3N2KE 4X64T 4C91A 1BR4A 2E5VA 3OYXA 3UU4A 3AA7B 4JI5T 2VL0A 4QX8B 3LJCA 3A5XA 4H9RC 3AVSA 1XZYA 2LRLA 2CWYA 2VKJA 2XASB 2XHEB 5BR8T 3OTOT 3NZQA 4UIGA 4CI1B 4P1NA 2CMRA 3VHLA 1SE7A 4NXNT 3CQGB 2SPCA 2NOXA 2XPKA 3O4XE 5IUXA 3ESLA 5AQTB 1XMOT 4N78D 1X79A 4HN9A 5KXJA 3P4PA 2X68A 2XM1A 3AXJA 3KDSE 2LRKA 4F6RC 2LJLA 2A2FX 3L39A 2K48A 3FHNA 1D0YA 1E1HB 4PK4A 5AQKB 2VKOA 4HFHA 2XQ7A 5DQVA 4IDOA 3LSVA 4V1Av 4HE8A 3T8OA 3PUGA 2PG8A 3AEGA 3SFDA 2N1GA 5H6RB 5HXCA 3VU7H 2KXPB 4GOUA 5J1GA 3ZLIA 2W00A 5LHIB 5LMUT 3FBLA 3N9PA 5AQLB 3HKCE 2F4VT 3P4SA 3P4WA 1G73A 4GK5E 2XQ6A 2LSGA 2YK0A 3IHRA 4Z90A 1MIYA 5AQQB 3VR9A 4PJJA 3RQWA 4U7IA 1NAFA 3PUYF 5AFUL 4DV5T 1ZKEA 4HFIA 4BA9A 2WMOA 4O4JE 3MJXA 4DR5T 3AEBA 1LRZA 3PV0F 1QLBA 4O2BE 4IE5A 5HEHA 3ZMSB 4ERRA 5JH7E 4QHOA 5L2LA 1ZEEA 2DNXA 3AEFA 4YY3T 2H7VC 1WYCA 3N5LA 4TUYE 4F8HA 5C3JA 4DUZT 2UXBT 3ZJ1A 4K0UA 4DV1T 3SS1A 4QXHB 3SFEA 4DO0A 3LFMA 4X1KE 5F8PA 2JQHA 3AVRA 5FMNA 4X20E 2XAGB 4AISA 2W0GA 1W0BA 3E22E 2IC9A 3PUVF 3I9YA 2PBIA 4QXCB 3N9MA 4YHJA 5E0OA 3PUQA 2WU5A 2E9XC 2OLTA 2KINB 2WDRA 1VCSA 3IF8B 4C90A 3CIRA 3CX8B 2LLYA 3RF1A 2XUEA 1XNRT 4EEDA 2CBIA 2RPAA 2V7IA 2FBWA 3OJAA 3I1AA 4GK0E 4U2ZA 5L3DB 1HNXT 3UULA 4LFCT 4ZI2D 2WAUA 2WZHA 4MFRA 2WU2A 1YQ4A 5JVDE 2JMKA 2JRKA 3ZC1A 2FJEA 1WR0A 2XQAA 2YEVC 3QC9A 3GWHA 4EB6E 2BVLA 5AQMB 3LK42 1WR6A 4PK6A 1UK5A 2D2SA 3KVBA 3RIFA 3SWHA 1EZ3A 3DTOA 3RYCE 2C5IT 4HEAA 4H9NC 4NUUA 2K3WA 3KINB 1MIWA 2ODVA 4U2YA 5EK2A 3EAMA 2BBJA 5LNKA 2E9XD 3DJBA 3KV5A 3UUMA 4YTMA 1YKEB 3CQXC 3KV6A 3OYZA 4ASKA 1KNPA 2WY2A 3T1YT 4AKLA 4ILCA 3HKDE 2V7JA 4KX6A 4NUVA 2V6XA 4H63V 2BG9B 2Q9QA 3ZC0A 4IE0A 4OK0A 5ETWA 1FMWA 2D5UA 2Q9QD 3VKGA 5AQPB 4AKHA 2JQKA 3UT5E 3T1HT 4TZ4C 2D0UA 3BQKA 3C4WA 4OHFA 5KMGP 3ZCIA 2W2UA 3PDYA 3QNUA 5L4HA 1IAPA 2V7KA 4ZZBA 3L09A 3ONLC 3QB5K 4UELA 4UF0B 2P9BA 2ACZA 2I6HA 4ILBA 5LJNA 1B7TA 1T72A 4Q25A 4AQFA 3RHWA 3FXEB 2Y48B 2G0UA 4HWDA 4CXYA 4J2CA 2VB6A 2UXNB 2XAFB 4QWNB 2OV9A 4GKKT 2WMNA 2ZM0A 1NEKA 3HI2A 3O1HA 1MMGA 3HA4A 5HXSA 5LP6E 4P09A 3QOFA 2XAJB 2J4GA 2YU2A 3F57A 3IBPA 3O1IA 1V9DA 5FNVE 5FXWA 5HEUA 3RKOA 3VRAA 5HAXA 2EHOB 2BS3A 3RGLA 3FB2A 4EAHA 3WAJA 4TNVA 1OEDC 2CM0A 3AE9A 3FZFB 3OBVE 3JAEA 3K3QC 1CUNA 3RC3A 4L0RA 4YTNA 5ABEA 4U33A 1VRBA 1D1AA 4QH5A 2XQYA 3V5UA 4CXXA 4YJ3E 2WSSV 3ZJ2A 4ANJA 3B13A 2XQ9A 2LOPA 1ZP0A 2XZEA 3N9LA 1S94A 2ZMAA 3N2GE 2GK9A 3Q9DA 3JADA 3TLTA 4LF4T 4IGUA 3PJAA 4JV5T 1UGOA 4DNDA 2RA1A 3AE7A 4DR1T 4IDPA 5AQNB 2XM2A 1KK7A 3PU3A 3RX6A 4WW0A 2YU1A 4U3CA 4JI3T 4X66T 3M65A 1XDOA 3PUAA 1D0XA 3RIAA 2NTXA 2NP9A 4NPPA 4IT4A 4HWFA 2LKHA 1J5ET 5FXZA 4AI6A 1BR1A 2YDQA 1FIOA 3TLUA 2LSKA 2LM9A 3AE2A 4X5TA 2LE8A 4DMWA 5LXTE 2LKGA 5AQIB 3FZHB 2Y8DA 5CGMA 2H89A 1HS7A 2KSRA 2NTYA 2VURA 3PTRB 3CQCB 3UQ7A 4DUYT 3NBXX 2QGSA 1UURA 1YQ3A 1MNDA 1ZV4X 3QK6A 5JR9A 3RYIE 2MTQA 5LCYA 2X0YA 3AE5A 4X62T 3BQLA 4XBFB 4PFOA 4CI2B 1IZNB 2AE9A 5JTGA 4JI6T 1IBLT 4CN4A 4H9PC 1MMDA 3EUHA 2BDEA 4HKAA 3ZYKA 1OEDE 4TX5A 4OX9T 4K0KT 4KHPT 1X9BA 3MZKB 2M67A 4DV0T 5FY1A 4TNWA 5JRCB 1Y64B 3NRYA 3TLVA 2MBGA 1IBKT 4I0UA 3W15B 2UUCT 2W61A 2FJDA 1XWMA 3LK3B 4OYKA 2VVSA 1J1JA 4LFAT 2IUBA 3OKQA 4JI2T 4IDNA 5HCJA 3IEEA 3RQUA 5FL1A 3N9OA 4MBQA 5EK3A 4Z8XA 5JR9B 1KF6A 1W09A 4ZOLE 5KX5E 3J9X1 1G8XA 2IMLA 4A5XA 3O9XA 3Q5XA 4QXBB 2W4XA 1N32T 2VKDA 2IIUA 3A7MA 2V5CA 1US7B 1WFDA 2CEAA 2R6GF 3EABA 3RPUA 4KI0F 3RRWA 2MAWA 3U3IA 4ZXLA 3E0ZA 3ZMZB 4ZI3D 5L3BB 5L3FB 4UXNB 5FYMA 4AQYT 2Q9QC 2V26A 3UU6A 3UUNA 3UUXB 3KV9A 2DCFA 3AB3B 2C5JA 3FZKB 3CKDA 3MK7C 5AQJB 3S4UA 3UFGA 1D0ZA 4IDQA 4CN1A 5FY7A 2BS4A 1LKXA 1OEDA 1Z8UA 2V1DB 2VL8A 5J2TE 2NR4A 3J7Yq 4JI4T 2D0TA 2W67A 3O1JA 2YN6A 4I55E 4CI3B
chains in the Genus database with same CATH topology
1I6ZA 1HX1B 5AQQB 5AQRB 3FZMB 3FZLB 4HWFA 5AQPB 5AQFB 4HWCA 5AQIB 3FZHB 5AQTB 3FZFB 3M3ZB 5AQOB 5AQSB 5AQMB 1M62A 1UK5A 1M7KA 5AQVB 5AQKB 3A8YC 4HWHA 2D9DA 5AQUB 1UGOA 3LDQB 4HWDA 3FZKB 5AQGB 5AQJB 5AQNB 5AQLB 4HWIB 5AQHB 1T7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I6Z A;  1HX1 B;  5AQQ B;  5AQR B;  3FZM B;  3FZL B;  4HWF A;  5AQP B;  5AQF B;  4HWC A;  5AQI B;  3FZH B;  5AQT B;  3FZF B;  3M3Z B;  5AQO B;  5AQS B;  5AQM B;  1M62 A;  1UK5 A;  1M7K A;  5AQV B;  5AQK B;  3A8Y C;  4HWH A;  2D9D A;  5AQU B;  1UGO A;  3LDQ B;  4HWD A;  3FZK B;  5AQG B;  5AQJ B;  5AQN B;  5AQL B;  4HWI B;  5AQH B;  1T7S A; 
#chains in the Genus database with same CATH topology
 1HX1 B;  4DV4 T;  5H6Q B;  3NKZ A;  2MPK A;  2BKN A;  4JUY A;  2YDR A;  3F31 A;  5AQR B;  3UU5 A;  3FBZ A;  1W0A A;  3Q5D A;  5IYZ E;  5JDG A;  4IRE A;  2X9X A;  3AAI A;  1MNE A;  2XAQ B;  5JDQ A;  3HR0 A;  4DR4 T;  5AQO B;  3C4Z A;  1NEN A;  2NW8 A;  3AAE B;  3AXJ B;  4U72 A;  4GYS A;  5JDF A;  3TLS A;  1YD8 G;  4CXW A;  2NW9 A;  5HXH A;  3ZEF B;  4JEH B;  1HNW T;  2W66 A;  3MKD A;  2LOS A;  2QRX A;  3NVO A;  4PK5 A;  4B3M T;  1I94 T;  1SHZ C;  5KDM C;  2WZI A;  2XSA A;  3AED A;  5TAO A;  2HHH T;  3I0O A;  3UTK A;  3K1S A;  2YIN A;  2N2N A;  3AE1 A;  2HPJ A;  4AIU A;  4H9S E;  4HFC A;  4LMK A;  4LF6 T;  3LBX A;  5ABF B;  4GKJ T;  2KLQ A;  4AKG A;  4B6X A;  3WI3 A;  4BJM A;  3P7I A;  1I6Z A;  2C5K T;  2CCQ A;  3C4X A;  4B3R T;  5CJ5 A;  1KNR A;  2J47 A;  3GA8 A;  2I59 A;  2ODU A;  3EVY A;  3QB5 A;  1FMV A;  3ZKR A;  5JQG E;  3ZCJ A;  2CWO A;  4DV3 T;  3ZMT B;  1R8I A;  3R84 B;  1O3X A;  2EHO A;  2ES0 A;  3Q2M A;  2XSB A;  4IL9 A;  3RH3 A;  4WBN E;  5JRE A;  2UU9 T;  5GON E;  2HN1 A;  3TLW A;  2ACX A;  4MHC A;  3C50 A;  4COF A;  4B3S T;  3UU8 A;  1AJ3 A;  3C98 B;  2HH7 A;  2XQ5 A;  4YJ2 E;  5ABF A;  2CXF A;  1Y01 A;  3WAK A;  3K3O A;  3IA3 A;  4BJN A;  3I0Q A;  5LGT B;  5M4Y A;  2VQE T;  2VKH A;  2UXX B;  2XAH B;  2E9X A;  4HTE A;  4UR9 A;  5AQG B;  5F3J A;  3VKH A;  3JAF A;  1XDP A;  3AE6 A;  4IIJ E;  1XNQ T;  5EK4 A;  1OXZ A;  1OED B;  2ZLY A;  3U78 A;  4EEB A;  2PJQ A;  2KZ7 B;  3AEE A;  1YKH B;  4PJL A;  3CK6 A;  4AXP A;  4ILA A;  3NWI A;  2RP4 A;  2XTL A;  1BR2 A;  3AE4 A;  5ABH A;  3K3N A;  4I43 B;  4UF0 A;  3ZT7 A;  5JDL A;  2JMH A;  4DV2 T;  4DBR A;  2HPL A;  2CPT A;  3RLF F;  2ZM8 A;  5LJM A;  4ZI2 C;  1WRD A;  3M3Z B;  4DID B;  3F2E A;  4KP3 C;  4DR3 T;  4CN6 A;  3P50 A;  3GN5 A;  1MIV A;  3H3A A;  2E5L T;  5IWA T;  4E7Z A;  3E08 A;  1U4Q A;  4ZS3 A;  2Z6E A;  4E7S A;  4HWH A;  4ZZC A;  4AKI A;  2V6Y B;  3GMI A;  3LBX B;  4UVA B;  3ABV A;  5HXE A;  2ZM6 T;  4ZI3 C;  2B1E A;  5CA0 E;  4CQI A;  3AAA B;  4PAG A;  4KUM B;  1OWA A;  5FXV A;  2Q9Q B;  4EZ4 A;  2BG9 A;  3K8P C;  4PNI A;  4ADZ A;  4DVD A;  2WQY A;  4EYY R;  1BR0 A;  5JDM A;  3HKE E;  2JJ9 A;  4A98 A;  4JI7 T;  4I50 E;  4KBM B;  5HYA A;  4L9I A;  4YSX A;  1HX8 A;  3FZM B;  1SUM B;  3P8C D;  5L3C B;  3FZL B;  3H3M A;  5LG4 A;  1N36 T;  3EI0 A;  3BK9 A;  1KNZ A;  2V5D A;  3P4Q A;  1KEY A;  2FUP A;  3D0T A;  5FL0 A;  2WB5 A;  4UV9 B;  4ZS2 A;  2WDV A;  3UUB A;  3AEA A;  1YW0 A;  3PUR A;  4WBO A;  2CHN A;  1HTJ F;  2WBL A;  5AQS B;  4IE6 A;  4O4I E;  4HFE A;  4X65 T;  5CFB A;  4WZX A;  2JQQ A;  3P4R A;  2X9H A;  4DMV A;  4DR2 T;  3B57 A;  3AE3 A;  2LT3 A;  3H37 A;  2L9Q A;  3C51 A;  3A8Y C;  3KV4 A;  2K9A A;  4LML A;  5JR9 C;  4EGW A;  2UUA T;  2WWV A;  2X51 A;  3RRC A;  2FJA A;  2LSI A;  2PTF A;  3ZMV B;  4DR7 T;  2BVM A;  4WYV A;  3R6N A;  2H88 A;  3PUS A;  4YFS A;  5LG3 A;  4B3T T;  5F5W A;  1T8B A;  2PFV A;  4EYU A;  2IDO B;  4JEU B;  4JYA T;  4A56 A;  4P0A A;  2J62 A;  4U7Y A;  3DP7 A;  3TKL B;  3UQ4 A;  4AQF C;  3KVA A;  5AQH B;  5LBQ B;  4O8S A;  5LMN T;  5LBM A;  4EIW A;  5LOV E;  1DU2 A;  2DL1 A;  2KWI B;  3PE0 A;  5J2U E;  3AA6 B;  4UV8 B;  3MAC A;  2V7L A;  4AQG A;  1XMQ T;  3VRB A;  4YT0 A;  1UUS A;  5AQF B;  3FXD B;  1KFY A;  2WWU A;  5DJQ C;  3ZN0 B;  5C2T A;  2XY8 B;  4YXD A;  5ADX L;  5A1L A;  1H7C A;  4PW8 A;  2KMF A;  3JCF A;  5ABG A;  4YHH T;  2DWG A;  3JC6 D;  4NIQ A;  3RIU A;  4GYR A;  5IHY A;  3LK2 B;  5L3E B;  3KBU A;  4IE4 A;  5AQV B;  5FVL A;  2WP9 A;  2QVA A;  5FXX A;  1NWM X;  2H7O A;  2IW5 B;  3Q5W A;  1UX5 A;  4TWF A;  3RKG A;  4JI8 T;  2XJ7 A;  4ZEY A;  5L47 A;  2CHO A;  4DV7 T;  1VOM A;  2W63 A;  3B5M A;  4UEM A;  4QKN A;  1LVK A;  3ZPO A;  3CPZ A;  4WNK A;  3JC6 C;  4U74 A;  3KBT A;  5LB7 B;  3UU3 A;  4EZH A;  3RI5 A;  2K5B B;  4O4H E;  2E9X B;  2W62 A;  5HXR A;  4DV6 T;  2A3D A;  5CA1 E;  4EOZ B;  1ZHC A;  5JDN A;  4H9O C;  2V8S V;  2WM9 A;  2B76 A;  3CX6 B;  4IE7 A;  4TWD A;  4X1Y E;  3ZN1 B;  4KMC A;  1MMA A;  4TV8 E;  4YLH A;  3ZSS A;  5LGU B;  4LF5 T;  1E7P A;  4HWC A;  2CBJ A;  1D1C A;  1VCT A;  3ONX A;  4H9Q C;  4LF9 T;  2AXD S;  2ZM2 A;  2DWK A;  3C64 A;  4ISS A;  2M6B A;  4G63 A;  4UVC B;  5HCM A;  3RYF E;  4G2A A;  3OVU A;  2H3R A;  2X9W A;  2IAK A;  3AA0 B;  3CML A;  3N9Q A;  4UVB B;  4KHZ F;  1N33 T;  2IHR 1;  1ZOY A;  5HWX A;  2JPF A;  3Q5E A;  2MYS A;  4U31 A;  2LSJ A;  4HFV A;  2LM2 A;  5FKY A;  3ZYM A;  4ILU A;  1HNZ T;  1W9R A;  2CE7 A;  3SRZ A;  4X1I E;  2A72 A;  2KND A;  4FJO A;  4HFB A;  2BKO A;  1FJG T;  4YSZ A;  4QH1 A;  2M6I A;  1HR0 T;  2X67 A;  2BKP A;  1LVF A;  2E2A A;  5HWY A;  2KWH A;  4LF7 T;  4NXM T;  2X9Y A;  2IC6 A;  3EDU A;  3L8R A;  5LA6 E;  4Z91 A;  3X1D A;  4EXT A;  1D1B A;  5L4E A;  2JIW A;  2CXL A;  2Y6X A;  1HG2 A;  2NW7 A;  2XQ4 A;  3AE8 A;  4IL4 A;  3CWZ B;  2CA5 A;  2X0H A;  3BQI A;  3HKB E;  3N2O A;  3MA9 A;  3VR8 A;  5HEJ A;  3CX7 B;  1QUU A;  2BG9 C;  4IHJ E;  4PJN A;  2X66 A;  1FEW A;  3PUW F;  1QSD A;  2JQ9 A;  2L3L A;  1YXR A;  3EDV A;  3HL6 A;  3NRX A;  3PU8 A;  4IDZ A;  4BAY B;  3L3P A;  3NZP A;  4JI0 T;  1WCR A;  5AQU B;  2YKS A;  5HEO A;  2UXC T;  2CRB A;  2X0L B;  4P0B A;  2CLY C;  1UX4 A;  2HN2 A;  2A9U A;  1HCI A;  3N9N A;  4PFP A;  4HFD A;  3ZT5 A;  4AKR B;  2UUB T;  3ANW A;  1HF8 A;  4ZI7 E;  3AA1 B;  4LF8 T;  1T7S A;  1JNR A;  4XAX B;  2XQ8 A;  2LEH A;  2KT9 A;  4H63 H;  2C0S A;  5LYJ E;  4DR6 T;  2N9D A;  4MLK A;  1HG5 A;  2OA5 A;  5LHH B;  2XQ3 A;  2MOZ A;  4YSY A;  2VVN A;  3G06 A;  3OPC A;  1IBM T;  5HEG A;  4O2A E;  3UFE A;  1IJ5 A;  3PUZ F;  3SOL A;  2J1D G;  1U5P A;  2YOE A;  2WS3 A;  1L0V A;  2LHN A;  5DAB A;  1J5W A;  2K24 A;  2UXD T;  1M62 A;  2EHO D;  2YDS A;  4JBW F;  5FY0 A;  4OFZ A;  4JLE A;  1SA0 E;  1WYB A;  1N34 T;  2QYW A;  2DI4 A;  3KFW X;  3RYH E;  5DQW A;  4LMJ A;  3RC8 A;  2DLR A;  1MMN A;  2VK9 A;  2DHR A;  3LDQ B;  2VWA A;  3RIU C;  2BBH A;  4LFB T;  4MAL A;  4QX7 B;  2BG9 E;  3ETU A;  5LGN B;  4TN7 B;  2V6Y A;  4HWI B;  5JRC A;  3ONJ A;  4GIW A;  3MXZ A;  3V5S A;  4PJM A;  2VAS A;  3ZST A;  5LHG B;  2NWB A;  2V7M A;  3GN5 B;  3ZYL A;  4I4T E;  4JI1 T;  1IJ6 A;  2L8K A;  5JDH A;  2LHR A;  4L5G A;  3PUX F;  4A97 A;  4YTP A;  2EHO C;  4TWH A;  2BS2 A;  4CZZ B;  5BMV E;  3ETV A;  4FI5 A;  4QH4 A;  4TV9 E;  1E2A A;  3ZMU B;  3PJA J;  2I0M A;  1HFA A;  1S35 A;  2LSY A;  2QA7 A;  2CLY B;  3LG7 A;  4M1P A;  1M7K A;  2WCA A;  1WLX A;  5EZY E;  2VQF T;  5L3G B;  2CXD A;  3AEC A;  4XZC A;  1CHU A;  3I9W A;  4EV6 A;  4DBQ A;  1GQE A;  4IST A;  3ANW B;  2D9D A;  5CB4 E;  1UCU A;  2FJB A;  5FVK A;  1T98 A;  4ZHQ E;  5C8Y E;  1JNZ A;  4HGA A;  1Z0P A;  2BZB A;  4O4L E;  3CVR A;  3ZT6 A;  5J0Z A;  3EHZ A;  4OYJ A;  2E8I A;  2WDQ A;  3QUJ A;  5FP3 A;  3N2K E;  4X64 T;  4C91 A;  1BR4 A;  2E5V A;  3OYX A;  3UU4 A;  3AA7 B;  4JI5 T;  2VL0 A;  4QX8 B;  3LJC A;  3A5X A;  4H9R C;  3AVS A;  1XZY A;  2LRL A;  2CWY A;  2VKJ A;  2XAS B;  2XHE B;  5BR8 T;  3OTO T;  3NZQ A;  4UIG A;  4CI1 B;  4P1N A;  2CMR A;  3VHL A;  1SE7 A;  4NXN T;  3CQG B;  2SPC A;  2NOX A;  2XPK A;  3O4X E;  5IUX A;  3ESL A;  5AQT B;  1XMO T;  4N78 D;  1X79 A;  4HN9 A;  5KXJ A;  3P4P A;  2X68 A;  2XM1 A;  3AXJ A;  3KDS E;  2LRK A;  4F6R C;  2LJL A;  2A2F X;  3L39 A;  2K48 A;  3FHN A;  1D0Y A;  1E1H B;  4PK4 A;  5AQK B;  2VKO A;  4HFH A;  2XQ7 A;  5DQV A;  4IDO A;  3LSV A;  4V1A v;  4HE8 A;  3T8O A;  3PUG A;  2PG8 A;  3AEG A;  3SFD A;  2N1G A;  5H6R B;  5HXC A;  3VU7 H;  2KXP B;  4GOU A;  5J1G A;  3ZLI A;  2W00 A;  5LHI B;  5LMU T;  3FBL A;  3N9P A;  5AQL B;  3HKC E;  2F4V T;  3P4S A;  3P4W A;  1G73 A;  4GK5 E;  2XQ6 A;  2LSG A;  2YK0 A;  3IHR A;  4Z90 A;  1MIY A;  5AQQ B;  3VR9 A;  4PJJ A;  3RQW A;  4U7I A;  1NAF A;  3PUY F;  5AFU L;  4DV5 T;  1ZKE A;  4HFI A;  4BA9 A;  2WMO A;  4O4J E;  3MJX A;  4DR5 T;  3AEB A;  1LRZ A;  3PV0 F;  1QLB A;  4O2B E;  4IE5 A;  5HEH A;  3ZMS B;  4ERR A;  5JH7 E;  4QHO A;  5L2L A;  1ZEE A;  2DNX A;  3AEF A;  4YY3 T;  2H7V C;  1WYC A;  3N5L A;  4TUY E;  4F8H A;  5C3J A;  4DUZ T;  2UXB T;  3ZJ1 A;  4K0U A;  4DV1 T;  3SS1 A;  4QXH B;  3SFE A;  4DO0 A;  3LFM A;  4X1K E;  5F8P A;  2JQH A;  3AVR A;  5FMN A;  4X20 E;  2XAG B;  4AIS A;  2W0G A;  1W0B A;  3E22 E;  2IC9 A;  3PUV F;  3I9Y A;  2PBI A;  4QXC B;  3N9M A;  4YHJ A;  5E0O A;  3PUQ A;  2WU5 A;  2E9X C;  2OLT A;  2KIN B;  2WDR A;  1VCS A;  3IF8 B;  4C90 A;  3CIR A;  3CX8 B;  2LLY A;  3RF1 A;  2XUE A;  1XNR T;  4EED A;  2CBI A;  2RPA A;  2V7I A;  2FBW A;  3OJA A;  3I1A A;  4GK0 E;  4U2Z A;  5L3D B;  1HNX T;  3UUL A;  4LFC T;  4ZI2 D;  2WAU A;  2WZH A;  4MFR A;  2WU2 A;  1YQ4 A;  5JVD E;  2JMK A;  2JRK A;  3ZC1 A;  2FJE A;  1WR0 A;  2XQA A;  2YEV C;  3QC9 A;  3GWH A;  4EB6 E;  2BVL A;  5AQM B;  3LK4 2;  1WR6 A;  4PK6 A;  1UK5 A;  2D2S A;  3KVB A;  3RIF A;  3SWH A;  1EZ3 A;  3DTO A;  3RYC E;  2C5I T;  4HEA A;  4H9N C;  4NUU A;  2K3W A;  3KIN B;  1MIW A;  2ODV A;  4U2Y A;  5EK2 A;  3EAM A;  2BBJ A;  5LNK A;  2E9X D;  3DJB A;  3KV5 A;  3UUM A;  4YTM A;  1YKE B;  3CQX C;  3KV6 A;  3OYZ A;  4ASK A;  1KNP A;  2WY2 A;  3T1Y T;  4AKL A;  4ILC A;  3HKD E;  2V7J A;  4KX6 A;  4NUV A;  2V6X A;  4H63 V;  2BG9 B;  2Q9Q A;  3ZC0 A;  4IE0 A;  4OK0 A;  5ETW A;  1FMW A;  2D5U A;  2Q9Q D;  3VKG A;  5AQP B;  4AKH A;  2JQK A;  3UT5 E;  3T1H T;  4TZ4 C;  2D0U A;  3BQK A;  3C4W A;  4OHF A;  5KMG P;  3ZCI A;  2W2U A;  3PDY A;  3QNU A;  5L4H A;  1IAP A;  2V7K A;  4ZZB A;  3L09 A;  3ONL C;  3QB5 K;  4UEL A;  4UF0 B;  2P9B A;  2ACZ A;  2I6H A;  4ILB A;  5LJN A;  1B7T A;  1T72 A;  4Q25 A;  4AQF A;  3RHW A;  3FXE B;  2Y48 B;  2G0U A;  4HWD A;  4CXY A;  4J2C A;  2VB6 A;  2UXN B;  2XAF B;  4QWN B;  2OV9 A;  4GKK T;  2WMN A;  2ZM0 A;  1NEK A;  3HI2 A;  3O1H A;  1MMG A;  3HA4 A;  5HXS A;  5LP6 E;  4P09 A;  3QOF A;  2XAJ B;  2J4G A;  2YU2 A;  3F57 A;  3IBP A;  3O1I A;  1V9D A;  5FNV E;  5FXW A;  5HEU A;  3RKO A;  3VRA A;  5HAX A;  2EHO B;  2BS3 A;  3RGL A;  3FB2 A;  4EAH A;  3WAJ A;  4TNV A;  1OED C;  2CM0 A;  3AE9 A;  3FZF B;  3OBV E;  3JAE A;  3K3Q C;  1CUN A;  3RC3 A;  4L0R A;  4YTN A;  5ABE A;  4U33 A;  1VRB A;  1D1A A;  4QH5 A;  2XQY A;  3V5U A;  4CXX A;  4YJ3 E;  2WSS V;  3ZJ2 A;  4ANJ A;  3B13 A;  2XQ9 A;  2LOP A;  1ZP0 A;  2XZE A;  3N9L A;  1S94 A;  2ZMA A;  3N2G E;  2GK9 A;  3Q9D A;  3JAD A;  3TLT A;  4LF4 T;  4IGU A;  3PJA A;  4JV5 T;  1UGO A;  4DND A;  2RA1 A;  3AE7 A;  4DR1 T;  4IDP A;  5AQN B;  2XM2 A;  1KK7 A;  3PU3 A;  3RX6 A;  4WW0 A;  2YU1 A;  4U3C A;  4JI3 T;  4X66 T;  3M65 A;  1XDO A;  3PUA A;  1D0X A;  3RIA A;  2NTX A;  2NP9 A;  4NPP A;  4IT4 A;  4HWF A;  2LKH A;  1J5E T;  5FXZ A;  4AI6 A;  1BR1 A;  2YDQ A;  1FIO A;  3TLU A;  2LSK A;  2LM9 A;  3AE2 A;  4X5T A;  2LE8 A;  4DMW A;  5LXT E;  2LKG A;  5AQI B;  3FZH B;  2Y8D A;  5CGM A;  2H89 A;  1HS7 A;  2KSR A;  2NTY A;  2VUR A;  3PTR B;  3CQC B;  3UQ7 A;  4DUY T;  3NBX X;  2QGS A;  1UUR A;  1YQ3 A;  1MND A;  1ZV4 X;  3QK6 A;  5JR9 A;  3RYI E;  2MTQ A;  5LCY A;  2X0Y A;  3AE5 A;  4X62 T;  3BQL A;  4XBF B;  4PFO A;  4CI2 B;  1IZN B;  2AE9 A;  5JTG A;  4JI6 T;  1IBL T;  4CN4 A;  4H9P C;  1MMD A;  3EUH A;  2BDE A;  4HKA A;  3ZYK A;  1OED E;  4TX5 A;  4OX9 T;  4K0K T;  4KHP T;  1X9B A;  3MZK B;  2M67 A;  4DV0 T;  5FY1 A;  4TNW A;  5JRC B;  1Y64 B;  3NRY A;  3TLV A;  2MBG A;  1IBK T;  4I0U A;  3W15 B;  2UUC T;  2W61 A;  2FJD A;  1XWM A;  3LK3 B;  4OYK A;  2VVS A;  1J1J A;  4LFA T;  2IUB A;  3OKQ A;  4JI2 T;  4IDN A;  5HCJ A;  3IEE A;  3RQU A;  5FL1 A;  3N9O A;  4MBQ A;  5EK3 A;  4Z8X A;  5JR9 B;  1KF6 A;  1W09 A;  4ZOL E;  5KX5 E;  3J9X 1;  1G8X A;  2IML A;  4A5X A;  3O9X A;  3Q5X A;  4QXB B;  2W4X A;  1N32 T;  2VKD A;  2IIU A;  3A7M A;  2V5C A;  1US7 B;  1WFD A;  2CEA A;  2R6G F;  3EAB A;  3RPU A;  4KI0 F;  3RRW A;  2MAW A;  3U3I A;  4ZXL A;  3E0Z A;  3ZMZ B;  4ZI3 D;  5L3B B;  5L3F B;  4UXN B;  5FYM A;  4AQY T;  2Q9Q C;  2V26 A;  3UU6 A;  3UUN A;  3UUX B;  3KV9 A;  2DCF A;  3AB3 B;  2C5J A;  3FZK B;  3CKD A;  3MK7 C;  5AQJ B;  3S4U A;  3UFG A;  1D0Z A;  4IDQ A;  4CN1 A;  5FY7 A;  2BS4 A;  1LKX A;  1OED A;  1Z8U A;  2V1D B;  2VL8 A;  5J2T E;  2NR4 A;  3J7Y q;  4JI4 T;  2D0T A;  2W67 A;  3O1J A;  2YN6 A;  4I55 E;  4CI3 B; 
#chains in the Genus database with same CATH homology
 1I6Z A;  1HX1 B;  5AQQ B;  5AQR B;  3FZM B;  3FZL B;  4HWF A;  5AQP B;  5AQF B;  4HWC A;  5AQI B;  3FZH B;  5AQT B;  3FZF B;  3M3Z B;  5AQO B;  5AQS B;  5AQM B;  1M62 A;  1UK5 A;  1M7K A;  5AQV B;  5AQK B;  3A8Y C;  4HWH A;  2D9D A;  5AQU B;  1UGO A;  3LDQ B;  4HWD A;  3FZK B;  5AQG B;  5AQJ B;  5AQN B;  5AQL B;  4HWI B;  5AQH B;  1T7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...