5AQQB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
111
structure length
106
Chain Sequence
SNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
total genus 44
structure length 106
sequence length 111
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqqB00
1M62A 3A8YC 4HWCA 1HX1B 1UGOA 1I6ZA 5AQLB 1M7KA 4HWDA 1UK5A 3FZKB 5AQTB 5AQOB 5AQGB 5AQKB 5AQIB 5AQFB 4HWFA 4HWIB 5AQSB 3FZHB 3M3ZB 2D9DA 5AQNB 1T7SA 3LDQB 3FZFB 4HWHA 5AQPB 5AQHB 5AQJB 5AQQB 3FZLB 5AQVB 5AQRB 5AQUB 5AQMB 3FZMB
chains in the Genus database with same CATH superfamily
1ZEEA 2LOPA 2E9XD 2FBWA 3I9YA 4FI5A 4TV8E 3CX8B 5L2LA 3F31A 3LK2B 5L3EB 1FEWA 4PFPA 2X68A 4U7YA 5L3GB 3MXZA 3CQGB 2W62A 2ODVA 2UXCT 2RA1A 3JC6C 3AE8A 4M1PA 3AA7B 4IL9A 4X1KE 5AQGB 1Y01A 2XQ8A 3RYIE 4EB6E 3PE0A 2X9HA 5HWXA 2YK0A 3UU5A 4I4TE 4LF7T 1W9RA 3ZN1B 3UU4A 2H88A 3ZCIA 1W0BA 4QH4A 5DQVA 2N9DA 4AIUA 1LVFA 4ZI3D 5LNKA 3WAJA 4LF9T 4JV5T 3QUJA 3CK6A 3EI0A 2VL0A 2NP9A 3Q5WA 2DWKA 1L0VA 3UFEA 1N36T 4XBFB 2MYSA 3ZJ1A 4ILCA 2H7VC 2WBLA 3U3IA 2E8IA 4X65T 3FZLB 4UVAB 5FXXA 3RC8A 2UXXB 5HEGA 1IJ5A 2RPAA 5AQMB 1UUSA 2QVAA 3RIUC 4WBOA 4G2AA 3ESLA 2VKJA 3Q2MA 2IDOB 3E22E 2A9UA 4B3RT 3CX7B 4IE7A 4UR9A 2EHOA 3PJAJ 5AQLB 5LBQB 3T8OA 3I0QA 3ZT6A 4EGWA 3LFMA 3NBXX 1MIVA 2YU2A 4O8SA 2HN1A 5L4EA 5FKYA 3OBVE 2V6XA 3RHWA 3T1YT 4U74A 4DR7T 3LBXB 1UCUA 2KMFA 3ZCJA 1UX5A 3BQKA 4CN4A 2CCQA 4H9SE 4U72A 2D0UA 5HCMA 1E2AA 3ZT5A 2EHOB 4IT4A 4DR6T 1D1BA 3H3MA 3GMIA 3RGLA 3UUNA 2WS3A 3F57A 5JDGA 2JQ9A 1Z0PA 2XAHB 3GA8A 1MMDA 3ANWA 4EEBA 2X0YA 4EYUA 5L3FB 2W67A 3DTOA 4PK5A 2W00A 2FJAA 3RQUA 3TLVA 4DR4T 5ABHA 3P4WA 1ZKEA 3GWHA 4U31A 3HI2A 4DV3T 2JJ9A 4UEMA 4O4LE 4E7SA 5LBMA 2DL1A 3NZPA 2D0TA 4X1YE 4C91A 4HFIA 4NPPA 2PBIA 2XM1A 5LG3A 2WSSV 4DV5T 4MLKA 3ZMZB 1HNXT 3PJAA 3O1IA 2XQ9A 2VURA 4WZXA 1HNZT 2V7JA 4WNKA 1ZOYA 5ABFA 4V1Av 2KNDA 2Y8DA 2C5KT 2C5IT 2CA5A 3HKCE 4L0RA 3AA6B 2JMKA 3NRYA 3PU3A 4NUVA 4U7IA 4AQGA 2XAFB 5L3DB 2IC6A 1BR4A 2WQYA 4HN9A 2WZHA 4Q25A 4DR2T 1KK7A 3LJCA 2AXDS 4UV9B 1E1HB 2MTQA 1MNDA 4DR5T 1KF6A 2YEVC 3MK7C 4IDPA 4BJNA 3DJBA 5CA1E 3A5XA 3SFDA 4UF0A 1W09A 3AXJB 3KV6A 3P4SA 3A8YC 3L3PA 5EK4A 1HX8A 1OWAA 1X79A 2LM9A 2Y6XA 5JR9B 2XHEB 3IA3A 3O9XA 1LKXA 3X1DA 4XAXB 5JDQA 1T8BA 2C5JA 3I9WA 4ILAA 3KV4A 5AQTB 5FXVA 4HFCA 4CXWA 5JDHA 5L3BB 5LG4A 5LMUT 1J5WA 3AXJA 3MKDA 4YTPA 2WCAA 5AQFB 1IBLT 2M67A 3O4XE 2X0HA 5LGTB 2PJQA 4GIWA 5JR9A 2UUAT 2J1DG 2LRKA 4TNWA 4DIDB 2P9BA 4X5TA 4UVBB 1WYBA 3N9MA 5AQNB 2LRLA 2YU1A 1T7SA 2QA7A 2KSRA 2LLYA 4L9IA 5AQJB 2E9XB 2FJEA 1MNEA 2JPFA 4ZS2A 3RC3A 3ZN0B 1D1CA 2VASA 2XQ3A 3NWIA 3TLSA 4JI1T 4AKIA 4TWDA 4UELA 3L09A 2F4VT 2CWOA 2WB5A 4ASKA 4IGUA 5LB7B 3C50A 1NENA 2I0MA 2NR4A 2Q9QD 1M7KA 3FBZA 2I6HA 2W4XA 1D0ZA 2X67A 4JUYA 2XJ7A 3RPUA 5KMGP 1MIYA 5LMNT 4DV1T 4HFDA 4LFCT 4P09A 2D5UA 4YJ2E 2KLQA 2V7KA 2L3LA 1YKEB 3PTRB 2VB6A 4IHJE 4MHCA 5JREA 1N32T 4PJLA 2CWYA 2ZM0A 3IF8B 3K3OA 3PUVF 3TKLB 1OEDB 4UV8B 4O4JE 2FJBA 2ES0A 5LGUB 4A97A 3RYHE 5LHGB 3PDYA 1I94T 2LHRA 4TWFA 3N9OA 2XAGB 4UVCB 3Q5DA 2X0LB 4CN1A 3EDUA 1GQEA 5IUXA 4IDZA 2UXBT 2IMLA 4IL4A 5HXEA 2K3WA 2PG8A 4JI8T 5IWAT 4U33A 2N2NA 3OYZA 2V7MA 4QKNA 3EUHA 3N2KE 2I59A 4KX6A 4KP3C 4HGAA 2ZM8A 5LYJE 5LA6E 4NXMT 5IHYA 4QX7B 3C98B 2WM9A 3MA9A 4A56A 4BAYB 1NWMX 2Q9QB 3J7Yq 3KVBA 3AEEA 2LHNA 3CX6B 3C4XA 3NKZA 4HWFA 1OEDE 1BR1A 2VL8A 2WMOA 2PFVA 2IHR1 1SE7A 3DP7A 3P4QA 5FYMA 1KFYA 4ISSA 4QXCB 3B13A 2K9AA 3IEEA 1U4QA 4CZZB 4DBRA 2Q9QA 4GYSA 4HWHA 4JLEA 5J2UE 2CM0A 2N1GA 3VR8A 2BG9E 2X51A 3Q5EA 4GYRA 5AQUB 2XQAA 1UURA 4IE5A 3NRXA 3RI5A 2ODUA 4P0BA 3OTOT 2YKSA 3AA1B 4MBQA 4QWNB 2NWBA 4ADZA 2JQHA 1HS7A 2DWGA 2MPKA 4JI7T 2HHHT 4KHPT 1D0YA 2XM2A 2YDSA 4X20E 2NW7A 4GKKT 5JRCA 3VKHA 2J4GA 1G8XA 3KDSE 3ZKRA 3N9NA 2NOXA 2XQ7A 3I1AA 2XUEA 1FMWA 4YSYA 4XZCA 2WU2A 4EYYR 3AVRA 5HWYA 2BVLA 4GKJT 5FXWA 4PK6A 2YDRA 3ZMTB 3V5UA 3SS1A 1SHZC 2CXDA 3KFWX 2V6YA 3JAFA 3QK6A 3Q5XA 1J1JA 3JCFA 4JI2T 1ZHCA 4EV6A 2E5LT 4DBQA 3FBLA 4DUZT 4F8HA 2D2SA 2X66A 3LG7A 1DU2A 2JMHA 3VKGA 3H3AA 2K5BB 4AXPA 4AQFC 5ABFB 2LM2A 4TN7B 5DQWA 3AEAA 3JC6D 4H63H 2KT9A 5JDNA 3BK9A 3Q9DA 2GK9A 2KWHA 3N9LA 3PUYF 4CQIA 5E0OA 4HFHA 5CGMA 1UK5A 3AEDA 2VKDA 3CIRA 3FZKB 5JVDE 4HEAA 5JDMA 3QC9A 2WDQA 2BKNA 2HPJA 2YDQA 5HCJA 2V5CA 4I50E 3GN5A 5FP3A 4AKGA 4GOUA 4TUYE 5LHHB 4O2AE 2LSJA 4YY3T 4H9QC 5JTGA 2W63A 1J5ET 2JRKA 5FVKA 2LEHA 1S94A 1YW0A 4Z91A 5JDLA 3ZSSA 4YHHT 1KNZA 2YINA 2VK9A 2LSGA 1HCIA 1KNRA 3AE1A 3CQXC 4OFZA 4ZI2C 4AKLA 4IE0A 2H3RA 2XSAA 3HKDE 3LBXA 4H9OC 4PAGA 3KBTA 3RX6A 2UUBT 3PUZF 2BBJA 2XSBA 3I0OA 2A72A 2X9XA 4TV9E 4UIGA 5JDFA 3UTKA 4G63A 3S4UA 4CI2B 3UUXB 4WW0A 1XNQT 1XWMA 4MFRA 5LJMA 1KEYA 2UUCT 1VCSA 3UT5E 3ZPOA 2XQYA 1VCTA 1ZP0A 2BBHA 2Z6EA 5H6RB 2MAWA 2IC9A 3ETVA 4H9NC 4P0AA 1KNPA 2IW5B 1E7PA 3AECA 4DMWA 4JI4T 4PW8A 1EZ3A 4LMJA 1IZNB 3K3QC 2WY2A 2CRBA 4X1IE 2DI4A 4HE8A 3ETUA 2XQ5A 4LMKA 3OPCA 1D0XA 4IDOA 1V9DA 4JBWF 3IBPA 5C2TA 2QGSA 2HPLA 2D9DA 3RYCE 5ABEA 3SRZA 4YXDA 2NTYA 3RIFA 3O1HA 3ZJ2A 4CN6A 3VRAA 3ONJA 1BR0A 1QLBA 4QXHB 5TAOA 3VR9A 4KI0F 2QRXA 4I55E 2JQKA 1WR0A 4FJOA 3LK3B 4YSXA 4X62T 3AE3A 2WWUA 3AEGA 3PURA 3AAAB 3TLUA 4U2YA 5CA0E 3WAKA 1T98A 4N78D 2M6BA 5L3CB 4AI6A 3T1HT 1WCRA 1X9BA 4HWDA 2VQFT 2E5VA 3ZMVB 4YTNA 1AJ3A 2X9YA 5FMNA 2LKHA 2WU5A 4EIWA 1YXRA 5AQOB 1IAPA 4IIJE 3ABVA 3QOFA 2CBJA 4UF0B 4Z8XA 3J9X1 4DR1T 1HNWT 1XMQT 5CJ5A 2XTLA 3KINB 5HEUA 3C64A 5AQSB 4UXNB 4Z90A 1T72A 3FZHB 3M3ZB 2UXNB 1HG2A 4QH5A 3C4ZA 1U5PA 4TX5A 3U78A 4H9PC 3ZMSB 3PUSA 5CFBA 4KUMB 2H7OA 5HXHA 4ZHQE 2CEAA 3QNUA 4L5GA 5FY1A 2W61A 1FIOA 3ZYLA 2LSKA 5EK3A 1YQ4A 2YOEA 3CMLA 1WLXA 2XQ4A 2XQ6A 2XY8B 3L39A 4ZI3C 1NEKA 4HFBA 3LSVA 5AQRB 2MBGA 2HH7A 3AAIA 4IDNA 5L4HA 3R84B 4HKAA 2OA5A 3FZMB 1YKHB 3IHRA 3AE4A 1NAFA 2CHOA 3FXDB 3K3NA 4LF5T 2B1EA 3VHLA 2ACXA 4DMVA 1HX1B 3ZMUB 4EEDA 4E7ZA 4B3MT 2UXDT 2AE9A 3NVOA 4JI5T 4F6RC 2WWVA 5A1LA 3SWHA 3C51A 1YD8G 5DJQC 5HYAA 3ZT7A 4ANJA 5EZYE 4DV0T 2E9XA 3P4RA 3P4PA 1HTJF 5HAXA 4NIQA 3MACA 5LOVE 3SOLA 4IREA 3KV5A 4YTMA 3UU8A 2BVMA 2EHOC 3UULA 4QXBB 4I0UA 4EOZB 3D0TA 4AQYT 2XAJB 4YFSA 3ZYKA 3HL6A 2K24A 5LP6E 4O4IE 2BS2A 2OV9A 2QYWA 4DV7T 2BDEA 2L9QA 3UU3A 4BA9A 3AAEB 1YQ3A 3HKEE 4HFVA 1N33T 5AQQB 4JI0T 4DV4T 3PUXF 4LFAT 4ZXLA 3WI3A 4I43B 1O3XA 4QX8B 2MOZA 3N2GE 3F2EA 5DABA 1XMOT 3L8RA 4PNIA 1VOMA 3JAEA 4CI1B 2ZM6T 1OEDA 2ACZA 2DNXA 3N9PA 2WP9A 2J62A 1SA0E 3EABA 4YJ3E 2LOSA 1JNZA 2VVNA 5AQIB 3RRWA 2JQQA 4PJNA 2HN2A 2A3DA 3KBUA 4JEUB 3RYFE 1IJ6A 1Y64B 1MIWA 3AE9A 1UX4A 4LF8T 1HF8A 2V7LA 2LKGA 4ISTA 4LFBT 4LMLA 2EHOD 3UQ7A 3KV9A 5H6QB 4EAHA 2ZM2A 2CE7A 4PJMA 2M6IA 1WFDA 2A2FX 5JQGE 2LT3A 3LDQB 3FXEB 5AFUL 2WZIA 2ZLYA 3FZFB 5LCYA 2ZMAA 4EXTA 2V8SV 2FJDA 3O1JA 4NXNT 2BS4A 3RKOA 4WBNE 2CPTA 5HXCA 4DVDA 1M62A 3RIUA 4ZEYA 5KX5E 4WYVA 3R6NA 5FY0A 3CPZA 3RLFF 4H63V 3ZC0A 1D1AA 4AKHA 2H89A 5FXZA 5HXSA 2K48A 4QHOA 2CXLA 2DLRA 1VRBA 2BG9B 4OX9T 2FUPA 2SPCA 4YSZA 1MMAA 3AVSA 3MJXA 2CLYB 3NZQA 2KWIB 2YN6A 2E2AA 3N5LA 2BZBA 3AEBA 3P50A 2X9WA 2Y48B 1SUMB 3BQLA 4X64T 5L47A 5IYZE 4K0KT 5KXJA 4TNVA 3QB5K 1OXZA 5ABGA 4JI3T 4DO0A 2LJLA 3UUMA 2V7IA 2BKOA 1QSDA 2LSIA 5F3JA 4OYKA 4NUUA 4CXXA 2XAQB 4PFOA 2CBIA 2KXPB 5LXTE 4ZOLE 1BR2A 1HG5A 2CMRA 5HEJA 3V5SA 3K8PC 5KDMC 1WYCA 1JNRA 5GONE 4DR3T 3PUGA 5HXRA 4HWCA 2G0UA 5J0ZA 3CQCB 3FHNA 2UU9T 5EK2A 2XPKA 5JR9C 4O2BE 3LK42 2R6GF 2W2UA 3N2OA 4K0UA 4ILBA 2WAUA 2NTXA 3CWZB 3EAMA 4ZI7E 2RP4A 3G06A 3OKQA 3PUWF 2DCFA 5FNVE 2VWAA 5HEHA 3CKDA 3VU7H 3ZSTA 1XNRT 3SFEA 2LSYA 1WR6A 4KBMB 1FJGT 2B76A 2VVSA 4HFEA 4QH1A 4PJJA 4AISA 1H7CA 5BMVE 5BR8T 3A7MA 2KZ7B 1QUUA 4J2CA 1S35A 1MMNA 2BG9A 3VRBA 3ONXA 4KHZF 3HR0A 3UQ4A 5JRCB 4YLHA 3OVUA 2WDVA 2PTFA 3C4WA 4YHJA 5F5WA 5FL1A 3FB2A 3AE2A 1W0AA 2CHNA 3PUAA 4GK5E 4U2ZA 2BKPA 3P8CD 1MMGA 5F8PA 1IBKT 3ZEFB 4MALA 2VKOA 4H9RC 1XDPA 3AB3B 2C0SA 3AE6A 3B57A 4O4HE 4OHFA 5LGNB 4IE4A 1I6ZA 3PV0F 4OK0A 1WRDA 4A5XA 5C3JA 3ANWB 3EVYA 3EDVA 1FMVA 1CHUA 1US7B 5AQKB 4C90A 4YT0A 3P7IA 2L8KA 4ZZBA 2BG9C 5LHIB 1LRZA 2IUBA 3E0ZA 3RF1A 2WDRA 3AE7A 3PUQA 2CLYC 5ETWA 3CVRA 4DV6T 1G73A 3H37A 3QB5A 4HTEA 4P1NA 4HWIB 1HFAA 3RH3A 4B3TT 3JADA 4LF6T 1OEDC 2DHRA 5HEOA 2NW9A 1CUNA 4ILUA 3TLTA 4OYJA 3W15B 1XZYA 4ERRA 4DV2T 3EHZA 3ZYMA 4COFA 4CI3B 2V5DA 3TLWA 3HA4A 2IIUA 3N9QA 4CXYA 3OYXA 3MZKB 3PU8A 4AQFA 2Q9QC 4A98A 2V26A 4BJMA 5LJNA 2OLTA 2IAKA 3RQWA 4AKRB 4DNDA 3HKBE 2V6YB 4LF4T 5C8YE 2JIWA 3OJAA 4JEHB 3BQIA 3GN5B 2V1DB 4JI6T 4X66T 1UGOA 5ADXL 4DUYT 5CB4E 5M4YA 3UFGA 2LE8A 3M65A 3UUBA 5FL0A 4TZ4C 3UU6A 3ZC1A 2XASB 2E9XC 2XZEA 3RKGA 3RRCA 4ZS3A 4EZHA 3AEFA 4IE6A 4B6XA 3E08A 3KVAA 4GK0E 3ZLIA 1N34T 4KMCA 5JH7E 2W0GA 2WMNA 1LVKA 1B7TA 4B3ST 3K1SA 4ZZCA 3B5MA 2VKHA 3ONLC 4ZI2D 1R8IA 5J1GA 2BS3A 4IDQA 1HR0T 2CXFA 4PK4A 1ZV4X 3AE5A 1XDOA 2J47A 1Z8UA 2NW8A 2W66A 3AA0B 5AQHB 5AQPB 5J2TE 4TWHA 5AQVB 2KINB 4EZ4A 5FY7A 5FVLA 3RIAA 4U3CA 2VQET 1IBMT 4JYAT
chains in the Genus database with same CATH topology
1M62A 3A8YC 4HWCA 1HX1B 1UGOA 1I6ZA 5AQLB 1M7KA 4HWDA 1UK5A 3FZKB 5AQTB 5AQOB 5AQGB 5AQKB 5AQIB 5AQFB 4HWFA 4HWIB 5AQSB 3FZHB 3M3ZB 2D9DA 5AQNB 1T7SA 3LDQB 3FZFB 4HWHA 5AQPB 5AQHB 5AQJB 5AQQB 3FZLB 5AQVB 5AQRB 5AQUB 5AQMB 3FZMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M62 A;  3A8Y C;  4HWC A;  1HX1 B;  1UGO A;  1I6Z A;  5AQL B;  1M7K A;  4HWD A;  1UK5 A;  3FZK B;  5AQT B;  5AQO B;  5AQG B;  5AQK B;  5AQI B;  5AQF B;  4HWF A;  4HWI B;  5AQS B;  3FZH B;  3M3Z B;  2D9D A;  5AQN B;  1T7S A;  3LDQ B;  3FZF B;  4HWH A;  5AQP B;  5AQH B;  5AQJ B;  5AQQ B;  3FZL B;  5AQV B;  5AQR B;  5AQU B;  5AQM B;  3FZM B; 
#chains in the Genus database with same CATH topology
 1ZEE A;  2LOP A;  2E9X D;  2FBW A;  3I9Y A;  4FI5 A;  4TV8 E;  3CX8 B;  5L2L A;  3F31 A;  3LK2 B;  5L3E B;  1FEW A;  4PFP A;  2X68 A;  4U7Y A;  5L3G B;  3MXZ A;  3CQG B;  2W62 A;  2ODV A;  2UXC T;  2RA1 A;  3JC6 C;  3AE8 A;  4M1P A;  3AA7 B;  4IL9 A;  4X1K E;  5AQG B;  1Y01 A;  2XQ8 A;  3RYI E;  4EB6 E;  3PE0 A;  2X9H A;  5HWX A;  2YK0 A;  3UU5 A;  4I4T E;  4LF7 T;  1W9R A;  3ZN1 B;  3UU4 A;  2H88 A;  3ZCI A;  1W0B A;  4QH4 A;  5DQV A;  2N9D A;  4AIU A;  1LVF A;  4ZI3 D;  5LNK A;  3WAJ A;  4LF9 T;  4JV5 T;  3QUJ A;  3CK6 A;  3EI0 A;  2VL0 A;  2NP9 A;  3Q5W A;  2DWK A;  1L0V A;  3UFE A;  1N36 T;  4XBF B;  2MYS A;  3ZJ1 A;  4ILC A;  2H7V C;  2WBL A;  3U3I A;  2E8I A;  4X65 T;  3FZL B;  4UVA B;  5FXX A;  3RC8 A;  2UXX B;  5HEG A;  1IJ5 A;  2RPA A;  5AQM B;  1UUS A;  2QVA A;  3RIU C;  4WBO A;  4G2A A;  3ESL A;  2VKJ A;  3Q2M A;  2IDO B;  3E22 E;  2A9U A;  4B3R T;  3CX7 B;  4IE7 A;  4UR9 A;  2EHO A;  3PJA J;  5AQL B;  5LBQ B;  3T8O A;  3I0Q A;  3ZT6 A;  4EGW A;  3LFM A;  3NBX X;  1MIV A;  2YU2 A;  4O8S A;  2HN1 A;  5L4E A;  5FKY A;  3OBV E;  2V6X A;  3RHW A;  3T1Y T;  4U74 A;  4DR7 T;  3LBX B;  1UCU A;  2KMF A;  3ZCJ A;  1UX5 A;  3BQK A;  4CN4 A;  2CCQ A;  4H9S E;  4U72 A;  2D0U A;  5HCM A;  1E2A A;  3ZT5 A;  2EHO B;  4IT4 A;  4DR6 T;  1D1B A;  3H3M A;  3GMI A;  3RGL A;  3UUN A;  2WS3 A;  3F57 A;  5JDG A;  2JQ9 A;  1Z0P A;  2XAH B;  3GA8 A;  1MMD A;  3ANW A;  4EEB A;  2X0Y A;  4EYU A;  5L3F B;  2W67 A;  3DTO A;  4PK5 A;  2W00 A;  2FJA A;  3RQU A;  3TLV A;  4DR4 T;  5ABH A;  3P4W A;  1ZKE A;  3GWH A;  4U31 A;  3HI2 A;  4DV3 T;  2JJ9 A;  4UEM A;  4O4L E;  4E7S A;  5LBM A;  2DL1 A;  3NZP A;  2D0T A;  4X1Y E;  4C91 A;  4HFI A;  4NPP A;  2PBI A;  2XM1 A;  5LG3 A;  2WSS V;  4DV5 T;  4MLK A;  3ZMZ B;  1HNX T;  3PJA A;  3O1I A;  2XQ9 A;  2VUR A;  4WZX A;  1HNZ T;  2V7J A;  4WNK A;  1ZOY A;  5ABF A;  4V1A v;  2KND A;  2Y8D A;  2C5K T;  2C5I T;  2CA5 A;  3HKC E;  4L0R A;  3AA6 B;  2JMK A;  3NRY A;  3PU3 A;  4NUV A;  4U7I A;  4AQG A;  2XAF B;  5L3D B;  2IC6 A;  1BR4 A;  2WQY A;  4HN9 A;  2WZH A;  4Q25 A;  4DR2 T;  1KK7 A;  3LJC A;  2AXD S;  4UV9 B;  1E1H B;  2MTQ A;  1MND A;  4DR5 T;  1KF6 A;  2YEV C;  3MK7 C;  4IDP A;  4BJN A;  3DJB A;  5CA1 E;  3A5X A;  3SFD A;  4UF0 A;  1W09 A;  3AXJ B;  3KV6 A;  3P4S A;  3A8Y C;  3L3P A;  5EK4 A;  1HX8 A;  1OWA A;  1X79 A;  2LM9 A;  2Y6X A;  5JR9 B;  2XHE B;  3IA3 A;  3O9X A;  1LKX A;  3X1D A;  4XAX B;  5JDQ A;  1T8B A;  2C5J A;  3I9W A;  4ILA A;  3KV4 A;  5AQT B;  5FXV A;  4HFC A;  4CXW A;  5JDH A;  5L3B B;  5LG4 A;  5LMU T;  1J5W A;  3AXJ A;  3MKD A;  4YTP A;  2WCA A;  5AQF B;  1IBL T;  2M67 A;  3O4X E;  2X0H A;  5LGT B;  2PJQ A;  4GIW A;  5JR9 A;  2UUA T;  2J1D G;  2LRK A;  4TNW A;  4DID B;  2P9B A;  4X5T A;  4UVB B;  1WYB A;  3N9M A;  5AQN B;  2LRL A;  2YU1 A;  1T7S A;  2QA7 A;  2KSR A;  2LLY A;  4L9I A;  5AQJ B;  2E9X B;  2FJE A;  1MNE A;  2JPF A;  4ZS2 A;  3RC3 A;  3ZN0 B;  1D1C A;  2VAS A;  2XQ3 A;  3NWI A;  3TLS A;  4JI1 T;  4AKI A;  4TWD A;  4UEL A;  3L09 A;  2F4V T;  2CWO A;  2WB5 A;  4ASK A;  4IGU A;  5LB7 B;  3C50 A;  1NEN A;  2I0M A;  2NR4 A;  2Q9Q D;  1M7K A;  3FBZ A;  2I6H A;  2W4X A;  1D0Z A;  2X67 A;  4JUY A;  2XJ7 A;  3RPU A;  5KMG P;  1MIY A;  5LMN T;  4DV1 T;  4HFD A;  4LFC T;  4P09 A;  2D5U A;  4YJ2 E;  2KLQ A;  2V7K A;  2L3L A;  1YKE B;  3PTR B;  2VB6 A;  4IHJ E;  4MHC A;  5JRE A;  1N32 T;  4PJL A;  2CWY A;  2ZM0 A;  3IF8 B;  3K3O A;  3PUV F;  3TKL B;  1OED B;  4UV8 B;  4O4J E;  2FJB A;  2ES0 A;  5LGU B;  4A97 A;  3RYH E;  5LHG B;  3PDY A;  1I94 T;  2LHR A;  4TWF A;  3N9O A;  2XAG B;  4UVC B;  3Q5D A;  2X0L B;  4CN1 A;  3EDU A;  1GQE A;  5IUX A;  4IDZ A;  2UXB T;  2IML A;  4IL4 A;  5HXE A;  2K3W A;  2PG8 A;  4JI8 T;  5IWA T;  4U33 A;  2N2N A;  3OYZ A;  2V7M A;  4QKN A;  3EUH A;  3N2K E;  2I59 A;  4KX6 A;  4KP3 C;  4HGA A;  2ZM8 A;  5LYJ E;  5LA6 E;  4NXM T;  5IHY A;  4QX7 B;  3C98 B;  2WM9 A;  3MA9 A;  4A56 A;  4BAY B;  1NWM X;  2Q9Q B;  3J7Y q;  3KVB A;  3AEE A;  2LHN A;  3CX6 B;  3C4X A;  3NKZ A;  4HWF A;  1OED E;  1BR1 A;  2VL8 A;  2WMO A;  2PFV A;  2IHR 1;  1SE7 A;  3DP7 A;  3P4Q A;  5FYM A;  1KFY A;  4ISS A;  4QXC B;  3B13 A;  2K9A A;  3IEE A;  1U4Q A;  4CZZ B;  4DBR A;  2Q9Q A;  4GYS A;  4HWH A;  4JLE A;  5J2U E;  2CM0 A;  2N1G A;  3VR8 A;  2BG9 E;  2X51 A;  3Q5E A;  4GYR A;  5AQU B;  2XQA A;  1UUR A;  4IE5 A;  3NRX A;  3RI5 A;  2ODU A;  4P0B A;  3OTO T;  2YKS A;  3AA1 B;  4MBQ A;  4QWN B;  2NWB A;  4ADZ A;  2JQH A;  1HS7 A;  2DWG A;  2MPK A;  4JI7 T;  2HHH T;  4KHP T;  1D0Y A;  2XM2 A;  2YDS A;  4X20 E;  2NW7 A;  4GKK T;  5JRC A;  3VKH A;  2J4G A;  1G8X A;  3KDS E;  3ZKR A;  3N9N A;  2NOX A;  2XQ7 A;  3I1A A;  2XUE A;  1FMW A;  4YSY A;  4XZC A;  2WU2 A;  4EYY R;  3AVR A;  5HWY A;  2BVL A;  4GKJ T;  5FXW A;  4PK6 A;  2YDR A;  3ZMT B;  3V5U A;  3SS1 A;  1SHZ C;  2CXD A;  3KFW X;  2V6Y A;  3JAF A;  3QK6 A;  3Q5X A;  1J1J A;  3JCF A;  4JI2 T;  1ZHC A;  4EV6 A;  2E5L T;  4DBQ A;  3FBL A;  4DUZ T;  4F8H A;  2D2S A;  2X66 A;  3LG7 A;  1DU2 A;  2JMH A;  3VKG A;  3H3A A;  2K5B B;  4AXP A;  4AQF C;  5ABF B;  2LM2 A;  4TN7 B;  5DQW A;  3AEA A;  3JC6 D;  4H63 H;  2KT9 A;  5JDN A;  3BK9 A;  3Q9D A;  2GK9 A;  2KWH A;  3N9L A;  3PUY F;  4CQI A;  5E0O A;  4HFH A;  5CGM A;  1UK5 A;  3AED A;  2VKD A;  3CIR A;  3FZK B;  5JVD E;  4HEA A;  5JDM A;  3QC9 A;  2WDQ A;  2BKN A;  2HPJ A;  2YDQ A;  5HCJ A;  2V5C A;  4I50 E;  3GN5 A;  5FP3 A;  4AKG A;  4GOU A;  4TUY E;  5LHH B;  4O2A E;  2LSJ A;  4YY3 T;  4H9Q C;  5JTG A;  2W63 A;  1J5E T;  2JRK A;  5FVK A;  2LEH A;  1S94 A;  1YW0 A;  4Z91 A;  5JDL A;  3ZSS A;  4YHH T;  1KNZ A;  2YIN A;  2VK9 A;  2LSG A;  1HCI A;  1KNR A;  3AE1 A;  3CQX C;  4OFZ A;  4ZI2 C;  4AKL A;  4IE0 A;  2H3R A;  2XSA A;  3HKD E;  3LBX A;  4H9O C;  4PAG A;  3KBT A;  3RX6 A;  2UUB T;  3PUZ F;  2BBJ A;  2XSB A;  3I0O A;  2A72 A;  2X9X A;  4TV9 E;  4UIG A;  5JDF A;  3UTK A;  4G63 A;  3S4U A;  4CI2 B;  3UUX B;  4WW0 A;  1XNQ T;  1XWM A;  4MFR A;  5LJM A;  1KEY A;  2UUC T;  1VCS A;  3UT5 E;  3ZPO A;  2XQY A;  1VCT A;  1ZP0 A;  2BBH A;  2Z6E A;  5H6R B;  2MAW A;  2IC9 A;  3ETV A;  4H9N C;  4P0A A;  1KNP A;  2IW5 B;  1E7P A;  3AEC A;  4DMW A;  4JI4 T;  4PW8 A;  1EZ3 A;  4LMJ A;  1IZN B;  3K3Q C;  2WY2 A;  2CRB A;  4X1I E;  2DI4 A;  4HE8 A;  3ETU A;  2XQ5 A;  4LMK A;  3OPC A;  1D0X A;  4IDO A;  1V9D A;  4JBW F;  3IBP A;  5C2T A;  2QGS A;  2HPL A;  2D9D A;  3RYC E;  5ABE A;  3SRZ A;  4YXD A;  2NTY A;  3RIF A;  3O1H A;  3ZJ2 A;  4CN6 A;  3VRA A;  3ONJ A;  1BR0 A;  1QLB A;  4QXH B;  5TAO A;  3VR9 A;  4KI0 F;  2QRX A;  4I55 E;  2JQK A;  1WR0 A;  4FJO A;  3LK3 B;  4YSX A;  4X62 T;  3AE3 A;  2WWU A;  3AEG A;  3PUR A;  3AAA B;  3TLU A;  4U2Y A;  5CA0 E;  3WAK A;  1T98 A;  4N78 D;  2M6B A;  5L3C B;  4AI6 A;  3T1H T;  1WCR A;  1X9B A;  4HWD A;  2VQF T;  2E5V A;  3ZMV B;  4YTN A;  1AJ3 A;  2X9Y A;  5FMN A;  2LKH A;  2WU5 A;  4EIW A;  1YXR A;  5AQO B;  1IAP A;  4IIJ E;  3ABV A;  3QOF A;  2CBJ A;  4UF0 B;  4Z8X A;  3J9X 1;  4DR1 T;  1HNW T;  1XMQ T;  5CJ5 A;  2XTL A;  3KIN B;  5HEU A;  3C64 A;  5AQS B;  4UXN B;  4Z90 A;  1T72 A;  3FZH B;  3M3Z B;  2UXN B;  1HG2 A;  4QH5 A;  3C4Z A;  1U5P A;  4TX5 A;  3U78 A;  4H9P C;  3ZMS B;  3PUS A;  5CFB A;  4KUM B;  2H7O A;  5HXH A;  4ZHQ E;  2CEA A;  3QNU A;  4L5G A;  5FY1 A;  2W61 A;  1FIO A;  3ZYL A;  2LSK A;  5EK3 A;  1YQ4 A;  2YOE A;  3CML A;  1WLX A;  2XQ4 A;  2XQ6 A;  2XY8 B;  3L39 A;  4ZI3 C;  1NEK A;  4HFB A;  3LSV A;  5AQR B;  2MBG A;  2HH7 A;  3AAI A;  4IDN A;  5L4H A;  3R84 B;  4HKA A;  2OA5 A;  3FZM B;  1YKH B;  3IHR A;  3AE4 A;  1NAF A;  2CHO A;  3FXD B;  3K3N A;  4LF5 T;  2B1E A;  3VHL A;  2ACX A;  4DMV A;  1HX1 B;  3ZMU B;  4EED A;  4E7Z A;  4B3M T;  2UXD T;  2AE9 A;  3NVO A;  4JI5 T;  4F6R C;  2WWV A;  5A1L A;  3SWH A;  3C51 A;  1YD8 G;  5DJQ C;  5HYA A;  3ZT7 A;  4ANJ A;  5EZY E;  4DV0 T;  2E9X A;  3P4R A;  3P4P A;  1HTJ F;  5HAX A;  4NIQ A;  3MAC A;  5LOV E;  3SOL A;  4IRE A;  3KV5 A;  4YTM A;  3UU8 A;  2BVM A;  2EHO C;  3UUL A;  4QXB B;  4I0U A;  4EOZ B;  3D0T A;  4AQY T;  2XAJ B;  4YFS A;  3ZYK A;  3HL6 A;  2K24 A;  5LP6 E;  4O4I E;  2BS2 A;  2OV9 A;  2QYW A;  4DV7 T;  2BDE A;  2L9Q A;  3UU3 A;  4BA9 A;  3AAE B;  1YQ3 A;  3HKE E;  4HFV A;  1N33 T;  5AQQ B;  4JI0 T;  4DV4 T;  3PUX F;  4LFA T;  4ZXL A;  3WI3 A;  4I43 B;  1O3X A;  4QX8 B;  2MOZ A;  3N2G E;  3F2E A;  5DAB A;  1XMO T;  3L8R A;  4PNI A;  1VOM A;  3JAE A;  4CI1 B;  2ZM6 T;  1OED A;  2ACZ A;  2DNX A;  3N9P A;  2WP9 A;  2J62 A;  1SA0 E;  3EAB A;  4YJ3 E;  2LOS A;  1JNZ A;  2VVN A;  5AQI B;  3RRW A;  2JQQ A;  4PJN A;  2HN2 A;  2A3D A;  3KBU A;  4JEU B;  3RYF E;  1IJ6 A;  1Y64 B;  1MIW A;  3AE9 A;  1UX4 A;  4LF8 T;  1HF8 A;  2V7L A;  2LKG A;  4IST A;  4LFB T;  4LML A;  2EHO D;  3UQ7 A;  3KV9 A;  5H6Q B;  4EAH A;  2ZM2 A;  2CE7 A;  4PJM A;  2M6I A;  1WFD A;  2A2F X;  5JQG E;  2LT3 A;  3LDQ B;  3FXE B;  5AFU L;  2WZI A;  2ZLY A;  3FZF B;  5LCY A;  2ZMA A;  4EXT A;  2V8S V;  2FJD A;  3O1J A;  4NXN T;  2BS4 A;  3RKO A;  4WBN E;  2CPT A;  5HXC A;  4DVD A;  1M62 A;  3RIU A;  4ZEY A;  5KX5 E;  4WYV A;  3R6N A;  5FY0 A;  3CPZ A;  3RLF F;  4H63 V;  3ZC0 A;  1D1A A;  4AKH A;  2H89 A;  5FXZ A;  5HXS A;  2K48 A;  4QHO A;  2CXL A;  2DLR A;  1VRB A;  2BG9 B;  4OX9 T;  2FUP A;  2SPC A;  4YSZ A;  1MMA A;  3AVS A;  3MJX A;  2CLY B;  3NZQ A;  2KWI B;  2YN6 A;  2E2A A;  3N5L A;  2BZB A;  3AEB A;  3P50 A;  2X9W A;  2Y48 B;  1SUM B;  3BQL A;  4X64 T;  5L47 A;  5IYZ E;  4K0K T;  5KXJ A;  4TNV A;  3QB5 K;  1OXZ A;  5ABG A;  4JI3 T;  4DO0 A;  2LJL A;  3UUM A;  2V7I A;  2BKO A;  1QSD A;  2LSI A;  5F3J A;  4OYK A;  4NUU A;  4CXX A;  2XAQ B;  4PFO A;  2CBI A;  2KXP B;  5LXT E;  4ZOL E;  1BR2 A;  1HG5 A;  2CMR A;  5HEJ A;  3V5S A;  3K8P C;  5KDM C;  1WYC A;  1JNR A;  5GON E;  4DR3 T;  3PUG A;  5HXR A;  4HWC A;  2G0U A;  5J0Z A;  3CQC B;  3FHN A;  2UU9 T;  5EK2 A;  2XPK A;  5JR9 C;  4O2B E;  3LK4 2;  2R6G F;  2W2U A;  3N2O A;  4K0U A;  4ILB A;  2WAU A;  2NTX A;  3CWZ B;  3EAM A;  4ZI7 E;  2RP4 A;  3G06 A;  3OKQ A;  3PUW F;  2DCF A;  5FNV E;  2VWA A;  5HEH A;  3CKD A;  3VU7 H;  3ZST A;  1XNR T;  3SFE A;  2LSY A;  1WR6 A;  4KBM B;  1FJG T;  2B76 A;  2VVS A;  4HFE A;  4QH1 A;  4PJJ A;  4AIS A;  1H7C A;  5BMV E;  5BR8 T;  3A7M A;  2KZ7 B;  1QUU A;  4J2C A;  1S35 A;  1MMN A;  2BG9 A;  3VRB A;  3ONX A;  4KHZ F;  3HR0 A;  3UQ4 A;  5JRC B;  4YLH A;  3OVU A;  2WDV A;  2PTF A;  3C4W A;  4YHJ A;  5F5W A;  5FL1 A;  3FB2 A;  3AE2 A;  1W0A A;  2CHN A;  3PUA A;  4GK5 E;  4U2Z A;  2BKP A;  3P8C D;  1MMG A;  5F8P A;  1IBK T;  3ZEF B;  4MAL A;  2VKO A;  4H9R C;  1XDP A;  3AB3 B;  2C0S A;  3AE6 A;  3B57 A;  4O4H E;  4OHF A;  5LGN B;  4IE4 A;  1I6Z A;  3PV0 F;  4OK0 A;  1WRD A;  4A5X A;  5C3J A;  3ANW B;  3EVY A;  3EDV A;  1FMV A;  1CHU A;  1US7 B;  5AQK B;  4C90 A;  4YT0 A;  3P7I A;  2L8K A;  4ZZB A;  2BG9 C;  5LHI B;  1LRZ A;  2IUB A;  3E0Z A;  3RF1 A;  2WDR A;  3AE7 A;  3PUQ A;  2CLY C;  5ETW A;  3CVR A;  4DV6 T;  1G73 A;  3H37 A;  3QB5 A;  4HTE A;  4P1N A;  4HWI B;  1HFA A;  3RH3 A;  4B3T T;  3JAD A;  4LF6 T;  1OED C;  2DHR A;  5HEO A;  2NW9 A;  1CUN A;  4ILU A;  3TLT A;  4OYJ A;  3W15 B;  1XZY A;  4ERR A;  4DV2 T;  3EHZ A;  3ZYM A;  4COF A;  4CI3 B;  2V5D A;  3TLW A;  3HA4 A;  2IIU A;  3N9Q A;  4CXY A;  3OYX A;  3MZK B;  3PU8 A;  4AQF A;  2Q9Q C;  4A98 A;  2V26 A;  4BJM A;  5LJN A;  2OLT A;  2IAK A;  3RQW A;  4AKR B;  4DND A;  3HKB E;  2V6Y B;  4LF4 T;  5C8Y E;  2JIW A;  3OJA A;  4JEH B;  3BQI A;  3GN5 B;  2V1D B;  4JI6 T;  4X66 T;  1UGO A;  5ADX L;  4DUY T;  5CB4 E;  5M4Y A;  3UFG A;  2LE8 A;  3M65 A;  3UUB A;  5FL0 A;  4TZ4 C;  3UU6 A;  3ZC1 A;  2XAS B;  2E9X C;  2XZE A;  3RKG A;  3RRC A;  4ZS3 A;  4EZH A;  3AEF A;  4IE6 A;  4B6X A;  3E08 A;  3KVA A;  4GK0 E;  3ZLI A;  1N34 T;  4KMC A;  5JH7 E;  2W0G A;  2WMN A;  1LVK A;  1B7T A;  4B3S T;  3K1S A;  4ZZC A;  3B5M A;  2VKH A;  3ONL C;  4ZI2 D;  1R8I A;  5J1G A;  2BS3 A;  4IDQ A;  1HR0 T;  2CXF A;  4PK4 A;  1ZV4 X;  3AE5 A;  1XDO A;  2J47 A;  1Z8U A;  2NW8 A;  2W66 A;  3AA0 B;  5AQH B;  5AQP B;  5J2T E;  4TWH A;  5AQV B;  2KIN B;  4EZ4 A;  5FY7 A;  5FVL A;  3RIA A;  4U3C A;  2VQE T;  1IBM T;  4JYA T; 
#chains in the Genus database with same CATH homology
 1M62 A;  3A8Y C;  4HWC A;  1HX1 B;  1UGO A;  1I6Z A;  5AQL B;  1M7K A;  4HWD A;  1UK5 A;  3FZK B;  5AQT B;  5AQO B;  5AQG B;  5AQK B;  5AQI B;  5AQF B;  4HWF A;  4HWI B;  5AQS B;  3FZH B;  3M3Z B;  2D9D A;  5AQN B;  1T7S A;  3LDQ B;  3FZF B;  4HWH A;  5AQP B;  5AQH B;  5AQJ B;  5AQQ B;  3FZL B;  5AQV B;  5AQR B;  5AQU B;  5AQM B;  3FZM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...