2HHHT

Crystal structure of kasugamycin bound to the 30s ribosomal subunit
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title The antibiotic kasugamycin mimics mRNA nucleotides to destabilize tRNA binding and inhibit canonical translation initiation.
pubmed doi rcsb
molecule tags Ribosome
total genus 32
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 2hhhT00
3T1HT 2ZM6T 4B3MT 4LFAT 1XMOT 4JI2T 4GKKT 4JI6T 4B3ST 4DR5T 1IBKT 4JI8T 4JI7T 4X64T 2UXCT 4DR2T 2UXDT 3T1YT 5IWAT 4LFBT 2E5LT 1FJGT 1N34T 2UUCT 4JV5T 4X62T 4DUYT 4B3TT 4LF8T 1XNQT 5BR8T 2UUBT 4DR7T 4DV1T 1HNWT 4DR3T 2UXBT 1J5ET 1I94T 1N33T 4JI5T 2HHHT 4LF6T 4JI1T 4JI4T 4KHPT 4DV4T 4DV6T 1XNRT 2UU9T 4DR6T 1N32T 1N36T 1HR0T 3OTOT 4NXMT 4DR4T 4GKJT 1HNZT 5LMUT 4OX9T 4YHHT 4K0KT 4YY3T 4DV7T 1IBMT 4JI3T 1XMQT 2F4VT 2VQFT 1IBLT 4NXNT 4LF7T 4DUZT 2VQET 4JYAT 4LF9T 4JI0T 4DV5T 4LFCT 4DV3T 4LF4T 4DR1T 5LMNT 4B3RT 4X65T 1HNXT 4AQYT 4X66T 4LF5T 2UUAT 4DV0T 4DV2T
chains in the Genus database with same CATH superfamily
2LRKA 2GK9A 5IUXA 4LMJA 2L9QA 2YOEA 3QB5K 4DBQA 3B13A 4B3ST 5LGUB 3ZCIA 4K0UA 5L3GB 4H9OC 2E5LT 1YD8G 4AKLA 4PJNA 3MJXA 2B76A 2FBWA 3R6NA 2Q9QD 4YFSA 3T8OA 1SA0E 2RPAA 1J5ET 1N33T 1MIYA 1IJ5A 2BG9B 2ZMAA 1NEKA 3RRCA 3Q5XA 3ZC0A 3GA8A 5L47A 4CN6A 4NXMT 1HNZT 4MFRA 2W2UA 4U7YA 3RYIE 4XZCA 3TLVA 3ETUA 3GWHA 4UVCB 3K3QC 2LOSA 2WZIA 4EEBA 4IT4A 2VVSA 2NW7A 4LF7T 2H88A 2M6IA 3M65A 5JREA 5M4YA 2CPTA 5HEOA 3U3IA 4LF4T 5FVKA 2XQ5A 5AQSB 3EDVA 4O8SA 3CX7B 2KMFA 4NUUA 4DMWA 3VHLA 1Y01A 3AECA 2VB6A 2C5IT 2V8SV 1JNZA 1SHZC 2UXCT 2XAGB 3T1YT 3OYZA 1UUSA 2X0HA 2YN6A 1VCSA 3DP7A 4AISA 5L2LA 4FI5A 2LM2A 4H63V 5LJMA 2WM9A 3ZYLA 3HKCE 2DI4A 1W09A 5JDLA 1LKXA 3PJAJ 4HKAA 2CCQA 5HYAA 1HX1B 5HCJA 2X9HA 4JEHB 4DV6T 3AE1A 3HA4A 2XTLA 5HXCA 2LHRA 3PUYF 4ILCA 3PUVF 4J2CA 3ZYKA 2CHOA 5LMUT 2V5CA 4MBQA 4AKIA 2KWIB 4CI2B 4QH4A 4JI3T 4KMCA 4MHCA 2WU5A 4U33A 4IE7A 5L4EA 1LVKA 3Q5EA 3ZEFB 3IA3A 4ZXLA 4Z91A 3PJAA 1KNPA 5TAOA 2YU2A 1MIVA 3AE2A 3C4ZA 4I43B 3PU3A 3AE5A 3RIFA 3CQCB 2OA5A 4A98A 4DV5T 4MALA 4L9IA 5LMNT 3ZC1A 1HCIA 4UVBB 5AQMB 2SPCA 5LG4A 3GN5A 2Q9QC 2LLYA 2IHR1 2XY8B 3I0QA 1WFDA 5E0OA 3CQXC 1LRZA 3TLWA 3CPZA 4GKKT 3QOFA 1SUMB 4X1KE 1OEDC 4CN1A 2PTFA 4TWHA 3ZPOA 1H7CA 5JDFA 5ADXL 4HWDA 5LA6E 2CMRA 2KXPB 2ZLYA 1ZV4X 5AQNB 1AJ3A 2UXBT 1GQEA 2JQ9A 2WU2A 2I0MA 3NRYA 4JI4T 4DV4T 3O4XE 4C91A 4H9SE 2VKJA 4QXCB 5ABGA 4H9QC 5EK2A 4LMLA 2D0UA 1UX4A 4YHHT 4KBMB 2VWAA 4CN4A 1YKEB 4WNKA 3MKDA 5HEUA 2KLQA 2C5KT 3PTRB 4QXHB 2QRXA 4O4JE 3FZFB 1D1BA 5FY7A 2XAHB 2WCAA 5FL0A 2BS4A 3CX8B 1WYBA 1IAPA 4O2BE 2P9BA 4ZZCA 3CX6B 3N9PA 2NW9A 3NKZA 5HWYA 3UUNA 2BKNA 2L3LA 4H9NC 1KNRA 1VRBA 2W66A 3HKBE 1XMOT 5LG3A 2J1DG 4JI6T 3P4WA 5IYZE 4XBFB 3FBZA 3AEFA 2K48A 5C8YE 3ANWB 2DWGA 1NENA 4X1IE 1WR6A 2WB5A 4CQIA 2YKSA 2WWVA 4DUYT 4PJMA 5AQPB 3BQIA 3ONJA 5AQLB 2X66A 4A97A 1HNWT 4DV1T 5F5WA 2W61A 5AQUB 1ZP0A 5JR9C 3N2OA 4CZZB 4KHPT 2X67A 3UQ4A 3O1JA 1KF6A 4IDZA 3TKLB 5LBQB 2E9XB 3ZCJA 3ZKRA 3AB3B 2LHNA 3UU6A 2KT9A 2D0TA 4ZI2D 1W0BA 3PURA 3KBUA 4A56A 3RKOA 3FZHB 2W4XA 3SFEA 3LDQB 4O2AE 5EZYE 2RA1A 2XAJB 3KVAA 5HXHA 2ZM8A 2VASA 3MACA 2NOXA 4AKHA 1HNXT 3OVUA 1JNRA 2V1DB 3UULA 4IE6A 2X9YA 3E0ZA 3N9QA 2H7VC 3NBXX 2K3WA 3D0TA 2WDVA 3Q9DA 1FMWA 2WMNA 2X51A 2I6HA 4IE4A 4JI8T 4DBRA 1WRDA 2YDRA 4TV9E 4JI7T 1XZYA 5DJQC 4X64T 3EI0A 3P4PA 4ZOLE 3JAFA 5AQKB 5AFUL 4LFBT 2V7KA 4N78D 2DLRA 2BDEA 5L3BB 2VL8A 5ABFA 1E7PA 4EYYR 2K9AA 2YEVC 2BBJA 1D1AA 3TLUA 4EXTA 2WAUA 3ZMTB 4LF6T 2CWYA 3BQLA 1WCRA 3B57A 4UF0B 2W67A 4O4LE 2CBJA 4UVAB 3RYFE 4K0KT 4AKGA 2YK0A 1FMVA 1HFAA 4YJ2E 1CHUA 2CXDA 3UFEA 4DUZT 4IDPA 4WBNE 3N9NA 3RPUA 3X1DA 3P8CD 4TUYE 3L39A 3ZT7A 5JDHA 2XASB 5EK3A 4LF5T 4MLKA 5HAXA 5AQIB 4GK0E 1YXRA 3PUGA 4FJOA 1CUNA 3KFWX 3LBXB 1OWAA 2VVNA 1KEYA 2FJEA 3PUAA 2ACXA 4YSXA 1WR0A 2VURA 2IC6A 2XQAA 3P50A 3VRBA 3HR0A 5HXEA 2UUCT 4IL4A 3JC6D 1D0ZA 2KNDA 3RIUA 3AEDA 3N2GE 4BA9A 3EVYA 4ZI2C 3AEEA 2MOZA 4JI5T 3BQKA 1ZHCA 5LBMA 1MMAA 4PNIA 3JAEA 4HWFA 1VCTA 5AQGB 2LJLA 5IHYA 5LYJE 3A5XA 4OX9T 5LGTB 4EGWA 4F6RC 3RGLA 1XMQT 3OBVE 5FNVE 3A8YC 3IEEA 4A5XA 4HWIB 4HTEA 3LJCA 4WZXA 1M62A 2ZM2A 4G63A 2W00A 4JI0T 3K3NA 3V5UA 2V5DA 2J4GA 2LSYA 3AXJB 2LSGA 5AQVB 4HN9A 4H9RC 5AQHB 4HWHA 3IHRA 4EYUA 3SFDA 1YQ4A 3ZLIA 3ZT6A 1O3XA 2W0GA 3WAJA 5J1GA 3HKEE 2YDSA 5JRCB 3AE4A 2IMLA 2WDQA 4WW0A 2HN2A 4CXXA 2QVAA 4X62T 1MMGA 3AE9A 3GMIA 4H9PC 2LM9A 4L0RA 2W62A 2X9XA 2D5UA 5AQRB 4UF0A 1HG5A 5J0ZA 2LKGA 5AQOB 2UU9T 4EV6A 3PDYA 1X9BA 4PK5A 1HR0T 3SS1A 4IE0A 1BR0A 2CRBA 3F57A 4IDOA 2HPLA 5C3JA 3UU4A 4UELA 2ODUA 2EHOB 1SE7A 3FZLB 2MPKA 4YY3T 2UXNB 3ESLA 3MA9A 5HWXA 3N5LA 1KNZA 2CM0A 2V7LA 4DIDB 3RKGA 2NTYA 2HPJA 3CK6A 4X20E 4UIGA 2K5BB 4YXDA 5FY0A 4O4HE 5JDQA 2HH7A 2QA7A 4EAHA 3JC6C 3RC8A 1L0VA 3RQUA 2R6GF 3HKDE 4UR9A 3AVSA 2VKDA 3AE3A 4CI1B 4B3MT 5LJNA 2IC9A 1BR4A 2XAFB 1U5PA 3P7IA 5L3CB 2JQQA 2LRLA 2XQ4A 4TV8E 2PBIA 3FB2A 2Q9QB 1N34T 3AA7B 3I9YA 5ETWA 5C2TA 5LHIB 3U78A 3KBTA 4QXBB 5KX5E 2OLTA 2V6YB 2E2AA 1E1HB 3OYXA 1XDOA 3AEGA 4I50E 2XHEB 3QK6A 4YTNA 5EK4A 3RLFF 2X0YA 4IHJE 3K1SA 3ZN1B 5JDGA 4GKJT 1D0YA 1QUUA 2BG9A 2CA5A 2IW5B 3AE6A 2WMOA 2Y8DA 2BZBA 4JEUB 3PUZF 3UU5A 2VQFT 3UFGA 4YJ3E 2VKHA 4QH5A 4AQFC 3I1AA 4GYSA 1XDPA 3AEAA 4IGUA 2G0UA 2WY2A 3SOLA 3N9LA 4DV3T 3C51A 1HTJF 1OEDE 1Z0PA 2JIWA 4QH1A 4TN7B 4CXWA 1WLXA 4X66T 4QX8B 2MYSA 4TNVA 2DWKA 3SWHA 4Z8XA 4CI3B 5F3JA 3QNUA 3I0OA 3QB5A 3UQ7A 4DR2T 2UXDT 4IREA 4JUYA 2XQ9A 3RRWA 2HN1A 3TLTA 5L4HA 4U74A 5J2UE 4LF8T 2M6BA 2CLYC 3J9X1 3UUXB 3NVOA 2LEHA 4WBOA 4ZS3A 3NZPA 4U31A 1ZEEA 3QUJA 2NWBA 3RH3A 2NW8A 4ZS2A 1XNRT 1D1CA 2KZ7B 3QC9A 4O4IE 5HEJA 2VK9A 4AKRB 4E7ZA 4OYJA 5JR9B 2Z6EA 1W9RA 2X68A 4NUVA 3FZKB 2E8IA 3C50A 1UCUA 4UEMA 3C98B 2L8KA 1I6ZA 1W0AA 4ZHQE 4QHOA 3RIUC 4X65T 1T7SA 1D0XA 3ZMZB 1IJ6A 2H3RA 4HFEA 1YQ3A 3ABVA 2NP9A 4TWDA 3KVBA 4DNDA 4JI2T 2YU1A 5KXJA 4UXNB 4KHZF 3H3MA 4PJLA 1UX5A 2V7MA 4HFHA 2AE9A 3AEBA 4U2ZA 4EIWA 3N9MA 3CMLA 1Z8UA 4IDQA 1FIOA 3PV0F 3PE0A 2ODVA 2XM2A 5HXRA 3C4XA 4AQFA 4M1PA 3AA0B 3KV9A 4X5TA 2CE7A 1MMDA 4U72A 2PJQA 2JJ9A 4HGAA 3OTOT 2XQ8A 4QKNA 2A2FX 4P1NA 3VU7H 2IIUA 2IDOB 2A9UA 2D9DA 1T98A 5FXZA 1J1JA 1HG2A 4ADZA 4TWFA 3IBPA 4AQGA 4AXPA 4LFCT 4L5GA 1S94A 4DR1T 1E2AA 3N9OA 4DV0T 4GOUA 5HXSA 4E7SA 3AE8A 3PUSA 4YTMA 4PFOA 2MBGA 5FL1A 3F2EA 5KMGP 1IBKT 3LFMA 3P4RA 2WP9A 2Y48B 3M3ZB 1MIWA 3HI2A 2NTXA 4TNWA 4OYKA 3MK7C 4ANJA 4GK5E 4JBWF 4ZEYA 2JPFA 3ANWA 2UUBT 3EABA 2FJDA 2FUPA 3RHWA 1J5WA 5ABEA 3H37A 5F8PA 4AIUA 2EHOD 3VKHA 1X79A 4I55E 2I59A 2JMHA 5AQFB 1NAFA 4EEDA 4YSZA 2E5VA 3FZMB 1IZNB 4P09A 1KFYA 4IIJE 4UV9B 4F8HA 3NZQA 4BAYB 2LKHA 2E9XA 3MXZA 3PUXF 5DQVA 3KV5A 2XUEA 4B6XA 4NXNT 4I0UA 2XQ3A 3EHZA 3GN5B 1HS7A 5FY1A 3OKQA 4HFBA 4V1Av 3PUWF 4EZHA 5AQTB 2ES0A 2WDRA 4YSYA 5L3EB 3ZSSA 3I9WA 4DMVA 5FXVA 4AQYT 3G06A 3Q2MA 2CXLA 4HE8A 1B7TA 2UUAT 2JRKA 1HX8A 3T1HT 3ZJ1A 3H3AA 3B5MA 2KWHA 2XQ6A 2ZM6T 4X1YE 3O1IA 3VR8A 3CQGB 3O9XA 2FJAA 2A72A 4YTPA 2VL0A 2QGSA 3L3PA 5A1LA 2BG9C 4ISSA 3RF1A 4U7IA 4ZI3D 4QWNB 3LK42 1XNQT 3P4SA 1US7B 4DR7T 1QLBA 2JMKA 5JDMA 1I94T 1HF8A 5CGMA 4NIQA 5DABA 3E08A 2M67A 4Q25A 3KINB 4UV8B 1QSDA 2LOPA 2XSBA 1N36T 5HCMA 4YLHA 3S4UA 2NR4A 1Y64B 4PK6A 3ZMVB 2BG9E 2VKOA 5GONE 3ZSTA 4EB6E 3AE7A 1XWMA 5L3DB 4COFA 4YHJA 3EAMA 4IE5A 5FVLA 3MZKB 3ZJ2A 2XJ7A 3AA1B 2D2SA 4LF9T 4PAGA 4ZZBA 5AQQB 4BJNA 2LSIA 4B3RT 3A7MA 3AVRA 3AA6B 4WYVA 3ZN0B 5LP6E 4LMKA 2Y6XA 5JQGE 3CIRA 1OXZA 2XPKA 3NRXA 2EHOC 4ILBA 2RP4A 5HEHA 2DCFA 2WBLA 1MMNA 5IWAT 3LBXA 3KV4A 4I4TE 1UURA 5LGNB 1WYCA 2WS3A 3R84B 3NWIA 3W15B 4U3CA 2QYWA 2JQHA 3Q5DA 4GYRA 5L3FB 4DR3T 3K8PC 3LSVA 4ILAA 2V7JA 4DR6T 4CXYA 2V26A 2BVLA 1FEWA 4P0BA 5FKYA 2XM1A 4DR4T 2E9XD 3UUBA 2W63A 3CWZB 1OEDB 3OJAA 3IF8B 3CVRA 1NWMX 5HEGA 2VQET 2N1GA 4JYAT 3AAEB 2A3DA 1DU2A 2OV9A 4Z90A 4ZI3C 3UT5E 3RIAA 1U4QA 5FMNA 1EZ3A 3C4WA 4GIWA 1KK7A 4OHFA 3AXJA 2JQKA 3VRAA 1MNDA 2N9DA 5ABFB 3WAKA 3JCFA 2ZM0A 4KI0F 3UU8A 5JRCA 2B1EA 4NPPA 1YKHB 4B3TT 3ETVA 2WZHA 2X0LB 2BBHA 4PK4A 3E22E 3BK9A 3ZT5A 3DTOA 4JI1T 4OFZA 4XAXB 3OPCA 3TLSA 3C64A 1N32T 4HFDA 2CLYB 3VR9A 2H7OA 5LHHB 3FBLA 2XQ7A 1IBMT 5KDMC 1UK5A 5JTGA 1LVFA 3L09A 1YW0A 3UU3A 1IBLT 4G2AA 3ONLC 4HFIA 2BS3A 2EHOA 3LK2B 1V9DA 5JVDE 4PW8A 3RI5A 4HFCA 2C0SA 5LOVE 1BR1A 3RC3A 4DV2T 3F31A 2LSJA 2CWOA 2CXFA 2MAWA 4BJMA 4LFAT 5FP3A 2LSKA 5AQJB 1BR2A 3Q5WA 5DQWA 3VKGA 1S35A 5BMVE 2UXXB 2XSAA 2KINB 2CBIA 4YT0A 2E9XC 2WSSV 2CEAA 4ILUA 2YDQA 3AAAB 2V7IA 1T72A 3KDSE 2IAKA 2Q9QA 2XZEA 2PFVA 2BVMA 4OK0A 3V5SA 4JLEA 3RQWA 4ISTA 3EDUA 5LHGB 4H63H 2AXDS 2V6YA 2PG8A 4TZ4C 2YINA 2J47A 3ZMUB 5ABHA 1OEDA 5CFBA 4KP3C 5LNKA 2ACZA 3RYCE 2WWUA 2F4VT 3ONXA 4ASKA 1T8BA 3DJBA 3RX6A 3UTKA 5CA1E 4AI6A 3WI3A 4QX7B 3UUMA 5H6RB 2J62A 2XAQB 4U2YA 4KUMB 4ZI7E 4TX5A 2DNXA 3PUQA 5LCYA 2KSRA 2DL1A 3P4QA 5LXTE 5J2TE 2X9WA 4IL9A 5H6QB 3RYHE 2BS2A 3FHNA 4HEAA 1R8IA 4DVDA 3SRZA 3LG7A 4DR5T 5LB7B 2LE8A 3JADA 3ZMSB 3N2KE 3LK3B 4KX6A 2V6XA 4PJJA 4EZ4A 3ZYMA 2XQYA 1FJGT 4JV5T 3FXEB 3FXDB 4HFVA 5JH7E 5FYMA 4HWCA 1G73A 2BKOA 1VOMA 2DHRA 4EOZB 5BR8T 5FXXA 3K3OA 4ERRA 3CKDA 3AAIA 1ZKEA 2K24A 2C5JA 2HHHT 5CJ5A 3O1HA 3HL6A 4PFPA 2N2NA 5FXWA 2LT3A 3J7Yq 2FJBA 4IDNA 2MTQA 2IUBA 4P0AA 1M7KA 5CB4E 4DV7T 1MNEA 2BKPA 3PU8A 2WQYA 1ZOYA 2H89A 5CA0E 2CHNA 3EUHA 5JR9A 5JDNA 4DO0A 3KV6A 1UGOA 1G8XA 3L8RA 4C90A
chains in the Genus database with same CATH topology
3T1HT 2ZM6T 4B3MT 4LFAT 1XMOT 4JI2T 4GKKT 4JI6T 4B3ST 4DR5T 1IBKT 4JI8T 4JI7T 4X64T 2UXCT 4DR2T 2UXDT 3T1YT 5IWAT 4LFBT 2E5LT 1FJGT 1N34T 2UUCT 4JV5T 4X62T 4DUYT 4B3TT 4LF8T 1XNQT 5BR8T 2UUBT 4DR7T 4DV1T 1HNWT 4DR3T 2UXBT 1J5ET 1I94T 1N33T 4JI5T 2HHHT 4LF6T 4JI1T 4JI4T 4KHPT 4DV4T 4DV6T 1XNRT 2UU9T 4DR6T 1N32T 1N36T 1HR0T 3OTOT 4NXMT 4DR4T 4GKJT 1HNZT 5LMUT 4OX9T 4YHHT 4K0KT 4YY3T 4DV7T 1IBMT 4JI3T 1XMQT 2F4VT 2VQFT 1IBLT 4NXNT 4LF7T 4DUZT 2VQET 4JYAT 4LF9T 4JI0T 4DV5T 4LFCT 4DV3T 4LF4T 4DR1T 5LMNT 4B3RT 4X65T 1HNXT 4AQYT 4X66T 4LF5T 2UUAT 4DV0T 4DV2T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1H T;  2ZM6 T;  4B3M T;  4LFA T;  1XMO T;  4JI2 T;  4GKK T;  4JI6 T;  4B3S T;  4DR5 T;  1IBK T;  4JI8 T;  4JI7 T;  4X64 T;  2UXC T;  4DR2 T;  2UXD T;  3T1Y T;  5IWA T;  4LFB T;  2E5L T;  1FJG T;  1N34 T;  2UUC T;  4JV5 T;  4X62 T;  4DUY T;  4B3T T;  4LF8 T;  1XNQ T;  5BR8 T;  2UUB T;  4DR7 T;  4DV1 T;  1HNW T;  4DR3 T;  2UXB T;  1J5E T;  1I94 T;  1N33 T;  4JI5 T;  2HHH T;  4LF6 T;  4JI1 T;  4JI4 T;  4KHP T;  4DV4 T;  4DV6 T;  1XNR T;  2UU9 T;  4DR6 T;  1N32 T;  1N36 T;  1HR0 T;  3OTO T;  4NXM T;  4DR4 T;  4GKJ T;  1HNZ T;  5LMU T;  4OX9 T;  4YHH T;  4K0K T;  4YY3 T;  4DV7 T;  1IBM T;  4JI3 T;  1XMQ T;  2F4V T;  2VQF T;  1IBL T;  4NXN T;  4LF7 T;  4DUZ T;  2VQE T;  4JYA T;  4LF9 T;  4JI0 T;  4DV5 T;  4LFC T;  4DV3 T;  4LF4 T;  4DR1 T;  5LMN T;  4B3R T;  4X65 T;  1HNX T;  4AQY T;  4X66 T;  4LF5 T;  2UUA T;  4DV0 T;  4DV2 T; 
#chains in the Genus database with same CATH topology
 2LRK A;  2GK9 A;  5IUX A;  4LMJ A;  2L9Q A;  2YOE A;  3QB5 K;  4DBQ A;  3B13 A;  4B3S T;  5LGU B;  3ZCI A;  4K0U A;  5L3G B;  4H9O C;  2E5L T;  1YD8 G;  4AKL A;  4PJN A;  3MJX A;  2B76 A;  2FBW A;  3R6N A;  2Q9Q D;  4YFS A;  3T8O A;  1SA0 E;  2RPA A;  1J5E T;  1N33 T;  1MIY A;  1IJ5 A;  2BG9 B;  2ZMA A;  1NEK A;  3RRC A;  3Q5X A;  3ZC0 A;  3GA8 A;  5L47 A;  4CN6 A;  4NXM T;  1HNZ T;  4MFR A;  2W2U A;  4U7Y A;  3RYI E;  4XZC A;  3TLV A;  3ETU A;  3GWH A;  4UVC B;  3K3Q C;  2LOS A;  2WZI A;  4EEB A;  4IT4 A;  2VVS A;  2NW7 A;  4LF7 T;  2H88 A;  2M6I A;  3M65 A;  5JRE A;  5M4Y A;  2CPT A;  5HEO A;  3U3I A;  4LF4 T;  5FVK A;  2XQ5 A;  5AQS B;  3EDV A;  4O8S A;  3CX7 B;  2KMF A;  4NUU A;  4DMW A;  3VHL A;  1Y01 A;  3AEC A;  2VB6 A;  2C5I T;  2V8S V;  1JNZ A;  1SHZ C;  2UXC T;  2XAG B;  3T1Y T;  3OYZ A;  1UUS A;  2X0H A;  2YN6 A;  1VCS A;  3DP7 A;  4AIS A;  5L2L A;  4FI5 A;  2LM2 A;  4H63 V;  5LJM A;  2WM9 A;  3ZYL A;  3HKC E;  2DI4 A;  1W09 A;  5JDL A;  1LKX A;  3PJA J;  4HKA A;  2CCQ A;  5HYA A;  1HX1 B;  5HCJ A;  2X9H A;  4JEH B;  4DV6 T;  3AE1 A;  3HA4 A;  2XTL A;  5HXC A;  2LHR A;  3PUY F;  4ILC A;  3PUV F;  4J2C A;  3ZYK A;  2CHO A;  5LMU T;  2V5C A;  4MBQ A;  4AKI A;  2KWI B;  4CI2 B;  4QH4 A;  4JI3 T;  4KMC A;  4MHC A;  2WU5 A;  4U33 A;  4IE7 A;  5L4E A;  1LVK A;  3Q5E A;  3ZEF B;  3IA3 A;  4ZXL A;  4Z91 A;  3PJA A;  1KNP A;  5TAO A;  2YU2 A;  1MIV A;  3AE2 A;  3C4Z A;  4I43 B;  3PU3 A;  3AE5 A;  3RIF A;  3CQC B;  2OA5 A;  4A98 A;  4DV5 T;  4MAL A;  4L9I A;  5LMN T;  3ZC1 A;  1HCI A;  4UVB B;  5AQM B;  2SPC A;  5LG4 A;  3GN5 A;  2Q9Q C;  2LLY A;  2IHR 1;  2XY8 B;  3I0Q A;  1WFD A;  5E0O A;  3CQX C;  1LRZ A;  3TLW A;  3CPZ A;  4GKK T;  3QOF A;  1SUM B;  4X1K E;  1OED C;  4CN1 A;  2PTF A;  4TWH A;  3ZPO A;  1H7C A;  5JDF A;  5ADX L;  4HWD A;  5LA6 E;  2CMR A;  2KXP B;  2ZLY A;  1ZV4 X;  5AQN B;  1AJ3 A;  2UXB T;  1GQE A;  2JQ9 A;  2WU2 A;  2I0M A;  3NRY A;  4JI4 T;  4DV4 T;  3O4X E;  4C91 A;  4H9S E;  2VKJ A;  4QXC B;  5ABG A;  4H9Q C;  5EK2 A;  4LML A;  2D0U A;  1UX4 A;  4YHH T;  4KBM B;  2VWA A;  4CN4 A;  1YKE B;  4WNK A;  3MKD A;  5HEU A;  2KLQ A;  2C5K T;  3PTR B;  4QXH B;  2QRX A;  4O4J E;  3FZF B;  1D1B A;  5FY7 A;  2XAH B;  2WCA A;  5FL0 A;  2BS4 A;  3CX8 B;  1WYB A;  1IAP A;  4O2B E;  2P9B A;  4ZZC A;  3CX6 B;  3N9P A;  2NW9 A;  3NKZ A;  5HWY A;  3UUN A;  2BKN A;  2L3L A;  4H9N C;  1KNR A;  1VRB A;  2W66 A;  3HKB E;  1XMO T;  5LG3 A;  2J1D G;  4JI6 T;  3P4W A;  5IYZ E;  4XBF B;  3FBZ A;  3AEF A;  2K48 A;  5C8Y E;  3ANW B;  2DWG A;  1NEN A;  4X1I E;  1WR6 A;  2WB5 A;  4CQI A;  2YKS A;  2WWV A;  4DUY T;  4PJM A;  5AQP B;  3BQI A;  3ONJ A;  5AQL B;  2X66 A;  4A97 A;  1HNW T;  4DV1 T;  5F5W A;  2W61 A;  5AQU B;  1ZP0 A;  5JR9 C;  3N2O A;  4CZZ B;  4KHP T;  2X67 A;  3UQ4 A;  3O1J A;  1KF6 A;  4IDZ A;  3TKL B;  5LBQ B;  2E9X B;  3ZCJ A;  3ZKR A;  3AB3 B;  2LHN A;  3UU6 A;  2KT9 A;  2D0T A;  4ZI2 D;  1W0B A;  3PUR A;  3KBU A;  4A56 A;  3RKO A;  3FZH B;  2W4X A;  3SFE A;  3LDQ B;  4O2A E;  5EZY E;  2RA1 A;  2XAJ B;  3KVA A;  5HXH A;  2ZM8 A;  2VAS A;  3MAC A;  2NOX A;  4AKH A;  1HNX T;  3OVU A;  1JNR A;  2V1D B;  3UUL A;  4IE6 A;  2X9Y A;  3E0Z A;  3N9Q A;  2H7V C;  3NBX X;  2K3W A;  3D0T A;  2WDV A;  3Q9D A;  1FMW A;  2WMN A;  2X51 A;  2I6H A;  4IE4 A;  4JI8 T;  4DBR A;  1WRD A;  2YDR A;  4TV9 E;  4JI7 T;  1XZY A;  5DJQ C;  4X64 T;  3EI0 A;  3P4P A;  4ZOL E;  3JAF A;  5AQK B;  5AFU L;  4LFB T;  2V7K A;  4N78 D;  2DLR A;  2BDE A;  5L3B B;  2VL8 A;  5ABF A;  1E7P A;  4EYY R;  2K9A A;  2YEV C;  2BBJ A;  1D1A A;  3TLU A;  4EXT A;  2WAU A;  3ZMT B;  4LF6 T;  2CWY A;  3BQL A;  1WCR A;  3B57 A;  4UF0 B;  2W67 A;  4O4L E;  2CBJ A;  4UVA B;  3RYF E;  4K0K T;  4AKG A;  2YK0 A;  1FMV A;  1HFA A;  4YJ2 E;  1CHU A;  2CXD A;  3UFE A;  4DUZ T;  4IDP A;  4WBN E;  3N9N A;  3RPU A;  3X1D A;  3P8C D;  4TUY E;  3L39 A;  3ZT7 A;  5JDH A;  2XAS B;  5EK3 A;  4LF5 T;  4MLK A;  5HAX A;  5AQI B;  4GK0 E;  1YXR A;  3PUG A;  4FJO A;  1CUN A;  3KFW X;  3LBX B;  1OWA A;  2VVN A;  1KEY A;  2FJE A;  3PUA A;  2ACX A;  4YSX A;  1WR0 A;  2VUR A;  2IC6 A;  2XQA A;  3P50 A;  3VRB A;  3HR0 A;  5HXE A;  2UUC T;  4IL4 A;  3JC6 D;  1D0Z A;  2KND A;  3RIU A;  3AED A;  3N2G E;  4BA9 A;  3EVY A;  4ZI2 C;  3AEE A;  2MOZ A;  4JI5 T;  3BQK A;  1ZHC A;  5LBM A;  1MMA A;  4PNI A;  3JAE A;  4HWF A;  1VCT A;  5AQG B;  2LJL A;  5IHY A;  5LYJ E;  3A5X A;  4OX9 T;  5LGT B;  4EGW A;  4F6R C;  3RGL A;  1XMQ T;  3OBV E;  5FNV E;  3A8Y C;  3IEE A;  4A5X A;  4HWI B;  4HTE A;  3LJC A;  4WZX A;  1M62 A;  2ZM2 A;  4G63 A;  2W00 A;  4JI0 T;  3K3N A;  3V5U A;  2V5D A;  2J4G A;  2LSY A;  3AXJ B;  2LSG A;  5AQV B;  4HN9 A;  4H9R C;  5AQH B;  4HWH A;  3IHR A;  4EYU A;  3SFD A;  1YQ4 A;  3ZLI A;  3ZT6 A;  1O3X A;  2W0G A;  3WAJ A;  5J1G A;  3HKE E;  2YDS A;  5JRC B;  3AE4 A;  2IML A;  2WDQ A;  4WW0 A;  2HN2 A;  4CXX A;  2QVA A;  4X62 T;  1MMG A;  3AE9 A;  3GMI A;  4H9P C;  2LM9 A;  4L0R A;  2W62 A;  2X9X A;  2D5U A;  5AQR B;  4UF0 A;  1HG5 A;  5J0Z A;  2LKG A;  5AQO B;  2UU9 T;  4EV6 A;  3PDY A;  1X9B A;  4PK5 A;  1HR0 T;  3SS1 A;  4IE0 A;  1BR0 A;  2CRB A;  3F57 A;  4IDO A;  2HPL A;  5C3J A;  3UU4 A;  4UEL A;  2ODU A;  2EHO B;  1SE7 A;  3FZL B;  2MPK A;  4YY3 T;  2UXN B;  3ESL A;  3MA9 A;  5HWX A;  3N5L A;  1KNZ A;  2CM0 A;  2V7L A;  4DID B;  3RKG A;  2NTY A;  2HPJ A;  3CK6 A;  4X20 E;  4UIG A;  2K5B B;  4YXD A;  5FY0 A;  4O4H E;  5JDQ A;  2HH7 A;  2QA7 A;  4EAH A;  3JC6 C;  3RC8 A;  1L0V A;  3RQU A;  2R6G F;  3HKD E;  4UR9 A;  3AVS A;  2VKD A;  3AE3 A;  4CI1 B;  4B3M T;  5LJN A;  2IC9 A;  1BR4 A;  2XAF B;  1U5P A;  3P7I A;  5L3C B;  2JQQ A;  2LRL A;  2XQ4 A;  4TV8 E;  2PBI A;  3FB2 A;  2Q9Q B;  1N34 T;  3AA7 B;  3I9Y A;  5ETW A;  5C2T A;  5LHI B;  3U78 A;  3KBT A;  4QXB B;  5KX5 E;  2OLT A;  2V6Y B;  2E2A A;  1E1H B;  3OYX A;  1XDO A;  3AEG A;  4I50 E;  2XHE B;  3QK6 A;  4YTN A;  5EK4 A;  3RLF F;  2X0Y A;  4IHJ E;  3K1S A;  3ZN1 B;  5JDG A;  4GKJ T;  1D0Y A;  1QUU A;  2BG9 A;  2CA5 A;  2IW5 B;  3AE6 A;  2WMO A;  2Y8D A;  2BZB A;  4JEU B;  3PUZ F;  3UU5 A;  2VQF T;  3UFG A;  4YJ3 E;  2VKH A;  4QH5 A;  4AQF C;  3I1A A;  4GYS A;  1XDP A;  3AEA A;  4IGU A;  2G0U A;  2WY2 A;  3SOL A;  3N9L A;  4DV3 T;  3C51 A;  1HTJ F;  1OED E;  1Z0P A;  2JIW A;  4QH1 A;  4TN7 B;  4CXW A;  1WLX A;  4X66 T;  4QX8 B;  2MYS A;  4TNV A;  2DWK A;  3SWH A;  4Z8X A;  4CI3 B;  5F3J A;  3QNU A;  3I0O A;  3QB5 A;  3UQ7 A;  4DR2 T;  2UXD T;  4IRE A;  4JUY A;  2XQ9 A;  3RRW A;  2HN1 A;  3TLT A;  5L4H A;  4U74 A;  5J2U E;  4LF8 T;  2M6B A;  2CLY C;  3J9X 1;  3UUX B;  3NVO A;  2LEH A;  4WBO A;  4ZS3 A;  3NZP A;  4U31 A;  1ZEE A;  3QUJ A;  2NWB A;  3RH3 A;  2NW8 A;  4ZS2 A;  1XNR T;  1D1C A;  2KZ7 B;  3QC9 A;  4O4I E;  5HEJ A;  2VK9 A;  4AKR B;  4E7Z A;  4OYJ A;  5JR9 B;  2Z6E A;  1W9R A;  2X68 A;  4NUV A;  3FZK B;  2E8I A;  3C50 A;  1UCU A;  4UEM A;  3C98 B;  2L8K A;  1I6Z A;  1W0A A;  4ZHQ E;  4QHO A;  3RIU C;  4X65 T;  1T7S A;  1D0X A;  3ZMZ B;  1IJ6 A;  2H3R A;  4HFE A;  1YQ3 A;  3ABV A;  2NP9 A;  4TWD A;  3KVB A;  4DND A;  4JI2 T;  2YU1 A;  5KXJ A;  4UXN B;  4KHZ F;  3H3M A;  4PJL A;  1UX5 A;  2V7M A;  4HFH A;  2AE9 A;  3AEB A;  4U2Z A;  4EIW A;  3N9M A;  3CML A;  1Z8U A;  4IDQ A;  1FIO A;  3PV0 F;  3PE0 A;  2ODV A;  2XM2 A;  5HXR A;  3C4X A;  4AQF A;  4M1P A;  3AA0 B;  3KV9 A;  4X5T A;  2CE7 A;  1MMD A;  4U72 A;  2PJQ A;  2JJ9 A;  4HGA A;  3OTO T;  2XQ8 A;  4QKN A;  2A2F X;  4P1N A;  3VU7 H;  2IIU A;  2IDO B;  2A9U A;  2D9D A;  1T98 A;  5FXZ A;  1J1J A;  1HG2 A;  4ADZ A;  4TWF A;  3IBP A;  4AQG A;  4AXP A;  4LFC T;  4L5G A;  1S94 A;  4DR1 T;  1E2A A;  3N9O A;  4DV0 T;  4GOU A;  5HXS A;  4E7S A;  3AE8 A;  3PUS A;  4YTM A;  4PFO A;  2MBG A;  5FL1 A;  3F2E A;  5KMG P;  1IBK T;  3LFM A;  3P4R A;  2WP9 A;  2Y48 B;  3M3Z B;  1MIW A;  3HI2 A;  2NTX A;  4TNW A;  4OYK A;  3MK7 C;  4ANJ A;  4GK5 E;  4JBW F;  4ZEY A;  2JPF A;  3ANW A;  2UUB T;  3EAB A;  2FJD A;  2FUP A;  3RHW A;  1J5W A;  5ABE A;  3H37 A;  5F8P A;  4AIU A;  2EHO D;  3VKH A;  1X79 A;  4I55 E;  2I59 A;  2JMH A;  5AQF B;  1NAF A;  4EED A;  4YSZ A;  2E5V A;  3FZM B;  1IZN B;  4P09 A;  1KFY A;  4IIJ E;  4UV9 B;  4F8H A;  3NZQ A;  4BAY B;  2LKH A;  2E9X A;  3MXZ A;  3PUX F;  5DQV A;  3KV5 A;  2XUE A;  4B6X A;  4NXN T;  4I0U A;  2XQ3 A;  3EHZ A;  3GN5 B;  1HS7 A;  5FY1 A;  3OKQ A;  4HFB A;  4V1A v;  3PUW F;  4EZH A;  5AQT B;  2ES0 A;  2WDR A;  4YSY A;  5L3E B;  3ZSS A;  3I9W A;  4DMV A;  5FXV A;  4AQY T;  3G06 A;  3Q2M A;  2CXL A;  4HE8 A;  1B7T A;  2UUA T;  2JRK A;  1HX8 A;  3T1H T;  3ZJ1 A;  3H3A A;  3B5M A;  2KWH A;  2XQ6 A;  2ZM6 T;  4X1Y E;  3O1I A;  3VR8 A;  3CQG B;  3O9X A;  2FJA A;  2A72 A;  4YTP A;  2VL0 A;  2QGS A;  3L3P A;  5A1L A;  2BG9 C;  4ISS A;  3RF1 A;  4U7I A;  4ZI3 D;  4QWN B;  3LK4 2;  1XNQ T;  3P4S A;  1US7 B;  4DR7 T;  1QLB A;  2JMK A;  5JDM A;  1I94 T;  1HF8 A;  5CGM A;  4NIQ A;  5DAB A;  3E08 A;  2M67 A;  4Q25 A;  3KIN B;  4UV8 B;  1QSD A;  2LOP A;  2XSB A;  1N36 T;  5HCM A;  4YLH A;  3S4U A;  2NR4 A;  1Y64 B;  4PK6 A;  3ZMV B;  2BG9 E;  2VKO A;  5GON E;  3ZST A;  4EB6 E;  3AE7 A;  1XWM A;  5L3D B;  4COF A;  4YHJ A;  3EAM A;  4IE5 A;  5FVL A;  3MZK B;  3ZJ2 A;  2XJ7 A;  3AA1 B;  2D2S A;  4LF9 T;  4PAG A;  4ZZB A;  5AQQ B;  4BJN A;  2LSI A;  4B3R T;  3A7M A;  3AVR A;  3AA6 B;  4WYV A;  3ZN0 B;  5LP6 E;  4LMK A;  2Y6X A;  5JQG E;  3CIR A;  1OXZ A;  2XPK A;  3NRX A;  2EHO C;  4ILB A;  2RP4 A;  5HEH A;  2DCF A;  2WBL A;  1MMN A;  5IWA T;  3LBX A;  3KV4 A;  4I4T E;  1UUR A;  5LGN B;  1WYC A;  2WS3 A;  3R84 B;  3NWI A;  3W15 B;  4U3C A;  2QYW A;  2JQH A;  3Q5D A;  4GYR A;  5L3F B;  4DR3 T;  3K8P C;  3LSV A;  4ILA A;  2V7J A;  4DR6 T;  4CXY A;  2V26 A;  2BVL A;  1FEW A;  4P0B A;  5FKY A;  2XM1 A;  4DR4 T;  2E9X D;  3UUB A;  2W63 A;  3CWZ B;  1OED B;  3OJA A;  3IF8 B;  3CVR A;  1NWM X;  5HEG A;  2VQE T;  2N1G A;  4JYA T;  3AAE B;  2A3D A;  1DU2 A;  2OV9 A;  4Z90 A;  4ZI3 C;  3UT5 E;  3RIA A;  1U4Q A;  5FMN A;  1EZ3 A;  3C4W A;  4GIW A;  1KK7 A;  4OHF A;  3AXJ A;  2JQK A;  3VRA A;  1MND A;  2N9D A;  5ABF B;  3WAK A;  3JCF A;  2ZM0 A;  4KI0 F;  3UU8 A;  5JRC A;  2B1E A;  4NPP A;  1YKH B;  4B3T T;  3ETV A;  2WZH A;  2X0L B;  2BBH A;  4PK4 A;  3E22 E;  3BK9 A;  3ZT5 A;  3DTO A;  4JI1 T;  4OFZ A;  4XAX B;  3OPC A;  3TLS A;  3C64 A;  1N32 T;  4HFD A;  2CLY B;  3VR9 A;  2H7O A;  5LHH B;  3FBL A;  2XQ7 A;  1IBM T;  5KDM C;  1UK5 A;  5JTG A;  1LVF A;  3L09 A;  1YW0 A;  3UU3 A;  1IBL T;  4G2A A;  3ONL C;  4HFI A;  2BS3 A;  2EHO A;  3LK2 B;  1V9D A;  5JVD E;  4PW8 A;  3RI5 A;  4HFC A;  2C0S A;  5LOV E;  1BR1 A;  3RC3 A;  4DV2 T;  3F31 A;  2LSJ A;  2CWO A;  2CXF A;  2MAW A;  4BJM A;  4LFA T;  5FP3 A;  2LSK A;  5AQJ B;  1BR2 A;  3Q5W A;  5DQW A;  3VKG A;  1S35 A;  5BMV E;  2UXX B;  2XSA A;  2KIN B;  2CBI A;  4YT0 A;  2E9X C;  2WSS V;  2CEA A;  4ILU A;  2YDQ A;  3AAA B;  2V7I A;  1T72 A;  3KDS E;  2IAK A;  2Q9Q A;  2XZE A;  2PFV A;  2BVM A;  4OK0 A;  3V5S A;  4JLE A;  3RQW A;  4IST A;  3EDU A;  5LHG B;  4H63 H;  2AXD S;  2V6Y A;  2PG8 A;  4TZ4 C;  2YIN A;  2J47 A;  3ZMU B;  5ABH A;  1OED A;  5CFB A;  4KP3 C;  5LNK A;  2ACZ A;  3RYC E;  2WWU A;  2F4V T;  3ONX A;  4ASK A;  1T8B A;  3DJB A;  3RX6 A;  3UTK A;  5CA1 E;  4AI6 A;  3WI3 A;  4QX7 B;  3UUM A;  5H6R B;  2J62 A;  2XAQ B;  4U2Y A;  4KUM B;  4ZI7 E;  4TX5 A;  2DNX A;  3PUQ A;  5LCY A;  2KSR A;  2DL1 A;  3P4Q A;  5LXT E;  5J2T E;  2X9W A;  4IL9 A;  5H6Q B;  3RYH E;  2BS2 A;  3FHN A;  4HEA A;  1R8I A;  4DVD A;  3SRZ A;  3LG7 A;  4DR5 T;  5LB7 B;  2LE8 A;  3JAD A;  3ZMS B;  3N2K E;  3LK3 B;  4KX6 A;  2V6X A;  4PJJ A;  4EZ4 A;  3ZYM A;  2XQY A;  1FJG T;  4JV5 T;  3FXE B;  3FXD B;  4HFV A;  5JH7 E;  5FYM A;  4HWC A;  1G73 A;  2BKO A;  1VOM A;  2DHR A;  4EOZ B;  5BR8 T;  5FXX A;  3K3O A;  4ERR A;  3CKD A;  3AAI A;  1ZKE A;  2K24 A;  2C5J A;  2HHH T;  5CJ5 A;  3O1H A;  3HL6 A;  4PFP A;  2N2N A;  5FXW A;  2LT3 A;  3J7Y q;  2FJB A;  4IDN A;  2MTQ A;  2IUB A;  4P0A A;  1M7K A;  5CB4 E;  4DV7 T;  1MNE A;  2BKP A;  3PU8 A;  2WQY A;  1ZOY A;  2H89 A;  5CA0 E;  2CHN A;  3EUH A;  5JR9 A;  5JDN A;  4DO0 A;  3KV6 A;  1UGO A;  1G8X A;  3L8R A;  4C90 A; 
#chains in the Genus database with same CATH homology
 3T1H T;  2ZM6 T;  4B3M T;  4LFA T;  1XMO T;  4JI2 T;  4GKK T;  4JI6 T;  4B3S T;  4DR5 T;  1IBK T;  4JI8 T;  4JI7 T;  4X64 T;  2UXC T;  4DR2 T;  2UXD T;  3T1Y T;  5IWA T;  4LFB T;  2E5L T;  1FJG T;  1N34 T;  2UUC T;  4JV5 T;  4X62 T;  4DUY T;  4B3T T;  4LF8 T;  1XNQ T;  5BR8 T;  2UUB T;  4DR7 T;  4DV1 T;  1HNW T;  4DR3 T;  2UXB T;  1J5E T;  1I94 T;  1N33 T;  4JI5 T;  2HHH T;  4LF6 T;  4JI1 T;  4JI4 T;  4KHP T;  4DV4 T;  4DV6 T;  1XNR T;  2UU9 T;  4DR6 T;  1N32 T;  1N36 T;  1HR0 T;  3OTO T;  4NXM T;  4DR4 T;  4GKJ T;  1HNZ T;  5LMU T;  4OX9 T;  4YHH T;  4K0K T;  4YY3 T;  4DV7 T;  1IBM T;  4JI3 T;  1XMQ T;  2F4V T;  2VQF T;  1IBL T;  4NXN T;  4LF7 T;  4DUZ T;  2VQE T;  4JYA T;  4LF9 T;  4JI0 T;  4DV5 T;  4LFC T;  4DV3 T;  4LF4 T;  4DR1 T;  5LMN T;  4B3R T;  4X65 T;  1HNX T;  4AQY T;  4X66 T;  4LF5 T;  2UUA T;  4DV0 T;  4DV2 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...