2HHHT

Crystal structure of kasugamycin bound to the 30s ribosomal subunit
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title The antibiotic kasugamycin mimics mRNA nucleotides to destabilize tRNA binding and inhibit canonical translation initiation.
pubmed doi rcsb
total genus 32
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 2hhhT00
4OX9T 1XNQT 4KHPT 4LF5T 2UUCT 3T1YT 4JI1T 1N32T 4DV5T 4DR4T 1N33T 4X62T 4X66T 4JYAT 2ZM6T 1FJGT 4DR2T 3T1HT 2UUAT 4B3ST 1N36T 4JI7T 1XNRT 2F4VT 4DUZT 1HNZT 4DR5T 4DR3T 4X64T 4LF7T 4DV6T 4NXMT 2UUBT 4DV0T 4LF6T 4DR6T 4DV2T 4DV3T 4LFAT 4LFCT 2UXDT 4JI2T 4JI8T 1I94T 3OTOT 5LMNT 1HNXT 4DUYT 4LFBT 4X65T 4DV4T 4JI4T 4JI0T 1IBMT 4K0KT 4LF4T 4B3MT 1IBKT 4LF9T 4DV1T 4YY3T 4DR1T 4JI5T 2UXCT 4GKJT 4DR7T 4B3TT 2UU9T 4YHHT 4B3RT 1XMQT 1N34T 5IWAT 5BR8T 4AQYT 4JV5T 4NXNT 1IBLT 5LMUT 1HNWT 4JI6T 4LF8T 4DV7T 1J5ET 1XMOT 1HR0T 2UXBT 2VQFT 2HHHT 4GKKT 2E5LT 4JI3T 2VQET
chains in the Genus database with same CATH superfamily
3P50A 1KFYA 1MMGA 3U3IA 3DTOA 4UV9B 4DVDA 3T1YT 1UX4A 4EGWA 1SUMB 3RH3A 2LRKA 2VKJA 2PTFA 4QXCB 2F4VT 2X9HA 3HKEE 2YEVC 2W67A 4TWDA 3UU5A 5C8YE 5ABGA 5ABEA 1W0BA 5EK2A 3BQLA 2JMKA 1US7B 3OTOT 5KX5E 3HKBE 3O4XE 2D0TA 5ABHA 5C2TA 1IZNB 2JRKA 2XTLA 5JVDE 4HGAA 2LEHA 2K9AA 5L3FB 4WBOA 2IMLA 4FJOA 4YTNA 3PUZF 4IE4A 2VB6A 2V7KA 4C90A 3CKDA 2DI4A 2NTXA 3CQXC 3FB2A 2XQAA 1WRDA 4BAYB 1UUSA 4AKGA 4X1YE 3FHNA 3UUXB 4ZHQE 2NW9A 2EHOB 4ZOLE 5CJ5A 4BJNA 1LVFA 1JNRA 2VQFT 2VKOA 5LA6E 4HFHA 2KT9A 5A1LA 4DMWA 3ZMTB 4IE5A 3UULA 5AQOB 5FYMA 2XUEA 1LRZA 2ZM6T 4DR2T 2IC9A 3VR9A 3I0OA 4HWCA 2H88A 3S4UA 5FL0A 4DUZT 3RGLA 2LSIA 2UUBT 5FXXA 5F5WA 1DU2A 2DHRA 5HAXA 4JI8T 4HFVA 3LBXB 3O1IA 5LP6E 4DV4T 4EB6E 3Q5XA 4QX7B 3ZYLA 1IBMT 2LHNA 4JEHB 3N2KE 4I50E 3AE3A 4Z91A 1XDOA 2GK9A 5L3GB 5JREA 4OFZA 2W4XA 2MBGA 3EAMA 5J2TE 2KINB 5HCJA 3ZEFB 4ILBA 3R6NA 1VCTA 2CMRA 3TLSA 5L3DB 3ZMSB 5JRCB 2OA5A 1HNWT 3EVYA 3F57A 3NVOA 4UELA 5EK3A 4AQFA 4LF8T 2V1DB 5AQSB 1SHZC 1EZ3A 1KEYA 4TNWA 2M67A 5EK4A 2I0MA 2J62A 3GMIA 3UQ4A 4H63V 4L0RA 1QSDA 3RYHE 3TLWA 2DWGA 1W0AA 1KNPA 4JBWF 3QNUA 1XDPA 5FL1A 4QH5A 2N9DA 1T72A 4DBQA 5L4HA 1HS7A 2UUAT 1R8IA 5JDQA 3TKLB 3LG7A 3AE2A 5HYAA 4UVCB 2R6GF 3ANWA 4IE0A 3E08A 4LF6T 2WQYA 4PJJA 2B1EA 2XQ6A 3PUSA 5ABFA 4JI2T 3KVAA 4HFCA 2E9XC 5M4YA 2JMHA 4DUYT 4LFBT 3B5MA 4O4JE 1YKEB 1BR1A 2LRLA 3TLUA 5JDFA 4Q25A 3FXDB 2CCQA 5DQWA 1N34T 2YK0A 4I43B 5FXZA 3L3PA 3N9MA 4ISTA 5J0ZA 2VURA 3AXJB 2YN6A 1YQ3A 3AE4A 3LJCA 2IUBA 4IHJE 5HEOA 4AXPA 2Y6XA 4O4IE 2J4GA 3AE8A 3PU8A 4EAHA 3PTRB 4A97A 2HPJA 2HHHT 3EI0A 5F3JA 3C4XA 3AECA 2WAUA 5AQQB 5CFBA 4IDQA 4NUVA 5CB4E 1HCIA 4ASKA 4O2BE 4X66T 4AKRB 4QH1A 1HF8A 2XAHB 3D0TA 5EZYE 2ODVA 2I59A 4DV0T 4O4LE 5AQFB 4QHOA 2CE7A 2L3LA 3AVSA 4AIUA 2H7OA 2KSRA 4HEAA 4ERRA 4X65T 4AQGA 3NZPA 2J1DG 3P4WA 3EDVA 4H9OC 4FI5A 4DIDB 3SFDA 2OV9A 2N1GA 4HFBA 4PFPA 4GKJT 3KV5A 4WW0A 3RIAA 3UU8A 2PBIA 3MACA 3Q5DA 4CZZB 3H37A 3K8PC 4QXBB 1SA0E 2DNXA 1Z8UA 1HX8A 3NWIA 4JEUB 3Q5WA 2BKNA 3BQIA 3DP7A 1S35A 1IBLT 3EABA 2CHOA 4TNVA 3SWHA 3LSVA 5AQUB 5HEJA 1WYBA 1HR0T 2E9XB 2HH7A 3FZFB 3ETVA 2VKHA 3P7IA 2LT3A 2XAGB 4IL4A 3BK9A 4TZ4C 4PNIA 1N32T 4ZI2C 2JQ9A 1N33T 4P09A 4H9RC 2VKDA 1H7CA 4IREA 1D0XA 3N2OA 3QUJA 3N9NA 3C4WA 5HXHA 5JR9A 4LFAT 4BJMA 3B13A 3FBZA 2OLTA 2W2UA 2VL0A 1CHUA 3K3QC 2NP9A 3KVBA 4B3MT 4J2CA 3AE9A 3ONJA 4UIGA 2XQYA 3PUVF 4ILCA 1U4QA 2HPLA 2WWVA 5FVLA 2BDEA 3T8OA 3EHZA 5BR8T 2IC6A 3RKGA 2V7LA 2LSKA 3VKGA 4HWIB 1D0YA 2MAWA 1WCRA 4NUUA 3RRWA 3TLVA 4ISSA 2XPKA 5FY7A 5FVKA 5HWXA 2CRBA 1G73A 4QWNB 3GN5B 1BR2A 1UK5A 4IDOA 5BMVE 4CXWA 4KHPT 5HWYA 1AJ3A 3MA9A 3LFMA 4PJLA 2WDRA 4X62T 2KMFA 1FJGT 4B3ST 5HXSA 3ONXA 4HKAA 5L3EB 2BKOA 2LSJA 3OBVE 4UF0B 4CQIA 3RIFA 3VU7H 1J1JA 4U7IA 2X0YA 1NAFA 2W61A 4H9QC 1MIWA 2JQHA 3AE1A 2X0LB 3AB3B 4O8SA 4LF4T 1ZP0A 4Z90A 2BG9E 4WYVA 3CIRA 3VHLA 4JI5T 4B3TT 3BQKA 2K48A 3G06A 4TV8E 2XSBA 1WR0A 1M7KA 5AQVB 5LHGB 1Y01A 4QX8B 4YSYA 3VKHA 3AE7A 3P4PA 3PURA 2BS2A 2V6YA 3A7MA 2PFVA 3C50A 2DCFA 4M1PA 2NOXA 2XAJB 4ZEYA 2A9UA 1LVKA 4PW8A 3HL6A 3JC6D 1XWMA 2W66A 3ZPOA 4YTMA 3VRBA 4GKKT 4PJNA 2XQ5A 2BBHA 2YU1A 4YXDA 2Z6EA 4HN9A 4KUMB 4UV8B 2Q9QA 5LGUB 3K3OA 2L9QA 4UR9A 3RLFF 4E7SA 4ZXLA 2X67A 3CMLA 2EHOA 4EXTA 2JPFA 2FBWA 4AI6A 1QUUA 4AISA 4A5XA 1HNXT 3PU3A 2LJLA 4H9NC 2FJDA 4K0KT 5HXEA 1U5PA 4O2AE 4DR7T 2LHRA 2UU9T 3ZCIA 2CEAA 2XAQB 2KXPB 3QB5A 3F31A 2K3WA 2V7IA 2Q9QD 4AQYT 2V7MA 4JV5T 3DJBA 2MOZA 4MBQA 2EHOD 2CA5A 3RRCA 1D1AA 5LOVE 5AQNB 4X5TA 2XQ3A 4U74A 4OK0A 5HEHA 5E0OA 5LHHB 3RKOA 2ZM8A 2FJAA 2LOSA 2A2FX 3PUGA 2VVNA 3AE6A 4PK6A 4CXYA 4P0BA 4U33A 1T8BA 4TN7B 1CUNA 2FJEA 3T1HT 2XM2A 2YKSA 2LM9A 1UCUA 4E7ZA 4U3CA 2CLYC 5JRCA 5IUXA 5LGTB 3MKDA 4DR6T 1NEKA 5AFUL 4DV2T 1MIYA 2M6IA 3AA6B 2XY8B 3QK6A 4HE8A 3E0ZA 4ANJA 5JDGA 4P0AA 3UTKA 3UQ7A 4AKIA 1WLXA 2CHNA 4X1IE 3ANWB 1VCSA 4JUYA 1I6ZA 2PG8A 1ZHCA 5JDHA 2H7VC 3ONLC 2WU2A 3CWZB 5ABFB 3FZHB 3OVUA 3ZN1B 3SS1A 4EYYR 3AAEB 4K0UA 4GIWA 4A56A 4YT0A 3OJAA 4ZI3D 4U7YA 2CM0A 2D0UA 3RX6A 3MJXA 4KMCA 2J47A 4TWHA 4I55E 3V5SA 2HN1A 4LMKA 3JAFA 2UXXB 2IIUA 3AEAA 5LXTE 3AA1B 1YQ4A 3B57A 2V5DA 4IDNA 4MFRA 4CN4A 5KDMC 5DABA 4LF5T 4DNDA 5L3BB 1YXRA 1ZV4X 3AEBA 4YFSA 5AQTB 3ZYKA 3LK2B 3CVRA 3RQUA 5L3CB 4DR5T 4DR3T 2W00A 2I6HA 3C51A 5TAOA 4QXHB 3GA8A 3H3AA 2UXDT 3L8RA 3M3ZB 3TLTA 5DJQC 2L8KA 2YDSA 3PJAJ 4OYJA 4YJ2E 4YY3T 3X1DA 2G0UA 5LG4A 3MZKB 3WI3A 4TV9E 3N9LA 2CWOA 2BBJA 5FP3A 1J5WA 3KINB 3OYXA 4L5GA 3C64A 1HG2A 4UVAB 4NXNT 2CLYB 4CN6A 3AVRA 2VK9A 3AA7B 3N9OA 2VL8A 5GONE 3SOLA 2XASB 4IGUA 3CPZA 1YD8G 5LGNB 2WZHA 3WAKA 1M62A 2X9WA 1BR0A 4G2AA 3OPCA 2QVAA 3FZLB 3I9YA 1MMDA 2IDOB 2E5LT 4HWHA 1YKHB 4KP3C 2WMNA 2E2AA 2UUCT 2WB5A 4DV5T 5FY0A 4UVBB 2C5JA 4IT4A 4HTEA 3R84B 4WZXA 3ZMUB 3KBUA 4GK0E 3I9WA 1HNZT 3MXZA 5LCYA 3UUNA 4EOZB 5KMGP 4DV3T 4LFCT 2IW5B 3CQCB 4JI4T 4EYUA 3RHWA 2C5KT 3AE5A 1B7TA 5AQRB 2XSAA 4DR1T 1QLBA 2UXCT 2JQKA 3ZLIA 4PJMA 3N2GE 4MALA 4O4HE 5HCMA 1HG5A 3OKQA 1GQEA 3KV4A 3L39A 4ILAA 2PJQA 3RQWA 2HN2A 2W62A 3AEDA 2ACZA 3ZC0A 1MNDA 1OEDA 1KNRA 3Q2MA 3KFWX 5ETWA 2BG9A 5CA0E 4DMVA 2KWIB 4NPPA 2B76A 2Q9QC 2LE8A 3QC9A 2MPKA 4Z8XA 2V7JA 3ZC1A 2WSSV 2X9YA 1XNQT 1Z0PA 3OYZA 5LBMA 5FY1A 2MTQA 2EHOC 3K3NA 1IAPA 5L47A 1FEWA 4N78D 3RIUA 4AKHA 2ZMAA 4IIJE 2NTYA 3ZT6A 3MK7C 4EV6A 4B6XA 2YINA 4H9PC 3ZKRA 4DV6T 2XQ9A 2XAFB 3CX8B 5AQKB 5LG3A 2V8SV 3JCFA 1I94T 5F8PA 3FXEB 4IDZA 2ODUA 1HTJF 3FBLA 1KNZA 2WCAA 2XQ4A 2XM1A 1O3XA 3AEGA 2XQ7A 4COFA 1XMQT 4A98A 3LK42 3V5UA 4ZZCA 2H89A 1MNEA 4PAGA 2M6BA 3QB5K 4OHFA 5FXVA 1OEDE 5L4EA 2W63A 4UF0A 3NRXA 2WWUA 2CBJA 3ZT7A 2WP9A 3J9X1 4AQFC 2SPCA 2YDQA 2UXBT 1WYCA 5LBQB 5DQVA 3N5LA 5C3JA 3EDUA 4U31A 4LMJA 3IF8B 1XZYA 3HKCE 5LYJE 2V6YB 4YSZA 3IA3A 4ZI3C 3A8YC 4DR4T 5H6QB 3KDSE 4XAXB 3ETUA 3EUHA 4IE7A 2JQQA 3FZMB 2DL1A 1N36T 4JI7T 2NWBA 4KI0F 3P8CD 2BZBA 3P4QA 3SFEA 2CXLA 3IEEA 4U2YA 3RC3A 4TX5A 5AQPB 2RPAA 5AQHB 3CX6B 4JI0T 2NW7A 2BS4A 1FMVA 2Q9QB 4DV1T 4ZI2D 4TWFA 3N9QA 5J1GA 4YHHT 4B3RT 5JTGA 2X9XA 4CI2B 1D1CA 2E5VA 1UGOA 4WBNE 2WBLA 5ADXL 2D9DA 2NR4A 1SE7A 2BVMA 2ZM2A 3NBXX 3ZJ1A 1ZKEA 2DWKA 3P4RA 4HFIA 4F8HA 1XMOT 2XHEB 1KK7A 5HXRA 2LLYA 3RC8A 3PUAA 2AE9A 3ZCJA 4KHZF 4YSXA 1ZOYA 2XQ8A 4OX9T 3O1HA 4MHCA 3Q9DA 2H3RA 5J2UE 3N9PA 4JI1T 3LBXA 4NIQA 1VRBA 5JDMA 2P9BA 3NZQA 4G63A 2V6XA 1VOMA 2KLQA 3NRYA 2X66A 4X1KE 2K24A 3ZSSA 3M65A 3AAAB 3UU3A 3LK3B 3E22E 3ABVA 3W15B 1E1HB 4BA9A 3VR8A 1KF6A 1NWMX 3U78A 2JIWA 3ZMZB 1X79A 3RYIE 5H6RB 5LB7B 1FIOA 2YU2A 5FNVE 3UUMA 3ESLA 3JAEA 4TUYE 2V26A 1OXZA 4U72A 4F6RC 3HA4A 4ADZA 3ZYMA 4YJ3E 3WAJA 2Y8DA 1T7SA 3UT5E 3GWHA 4ILUA 2N2NA 3PV0F 2ZM0A 3H3MA 2VASA 2WU5A 4I4TE 4PFOA 2RP4A 1IJ6A 2VVSA 1UX5A 1W09A 4CN1A 2CWYA 4JI6T 1J5ET 3ZN0B 5JDLA 5CA1E 3SRZA 4GOUA 4QH4A 5AQGB 2E8IA 1S94A 4EZHA 2BKPA 3UFEA 2VQET 3HI2A 2FJBA 1BR4A 4L9IA 4IDPA 2C0SA 4HWDA 2A3DA 3ZMVB 3PUXF 2WS3A 2IAKA 1XNRT 4IE6A 2CXFA 3JADA 2QYWA 4UEMA 4OYKA 3AA0B 2ACXA 2WDQA 5JR9C 1IJ5A 3AXJA 4KX6A 3L09A 5AQLB 5CGMA 5AQIB 3ZJ2A 2A72A 4ZS2A 3ZT5A 4MLKA 4QKNA 4YTPA 3PDYA 4U2ZA 3Q5EA 4GYSA 4GK5E 1UURA 1OEDC 4V1Av 2KNDA 2CXDA 5IWAT 1WR6A 2BG9C 2D5UA 2CPTA 3IBPA 3K1SA 2LOPA 2X68A 1Y64B 4HFDA 1MMAA 1NENA 3C4ZA 4CI3B 2LM2A 3PE0A 4ZI7E 3I1AA 4ZS3A 1FMWA 3RIUC 4PK5A 4P1NA 3HR0A 2C5IT 2WY2A 5FKYA 5AQMB 5LHIB 1YW0A 3PUYF 4XZCA 3UU6A 2LSYA 2VWAA 3QOFA 3AEEA 1G8XA 5JDNA 3I0QA 4EEDA 3O1JA 3AAIA 1MMNA 5IYZE 4JYAT 2WM9A 2XZEA 3ZSTA 5JQGE 3A5XA 2NW8A 1V9DA 4EEBA 2QGSA 5LJNA 2AXDS 4X64T 2LKHA 4NXMT 3CK6A 2QRXA 2XJ7A 2BS3A 2QA7A 5FXWA 5L2LA 5AQJB 4YLHA 5KXJA 2UXNB 2RA1A 2IHR1 3KBTA 3JC6C 1ZEEA 3RF1A 3HKDE 4AKLA 5LJMA 4HWFA 4H63H 2WZIA 4DO0A 3RPUA 2E9XA 5HEGA 4YHJA 2KWHA 3IHRA 1T98A 4PK4A 1E7PA 3NKZA 2JJ9A 2WDVA 4DV7T 4GYRA 5JR9B 1L0VA 5IHYA 2MYSA 3KV6A 2CBIA 4CI1B 5LNKA 3CX7B 1HFAA 3UU4A 3PJAA 2K5BB 2E9XD 4IL9A 3CQGB 4JLEA 4X20E 1WFDA 1OEDB 4ZZBA 4XBFB 2BG9B 2FUPA 4C91A 2ZLYA 1D1BA 3RYCE 2D2SA 4LF7T 2BVLA 4WNKA 3F2EA 1LKXA 5FMNA 1X9BA 2LSGA 4I0UA 3KV9A 5LMNT 2YDRA 4LMLA 2YOEA 3J7Yq 3FZKB 1IBKT 4LF9T 4EIWA 3UFGA 3PUWF 1D0ZA 4DBRA 3O9XA 1JNZA 4EZ4A 4UXNB 2ES0A 5HEUA 2Y48B 4HFEA 3LDQB 3P4SA 3RI5A 3GN5A 3UUBA 4H9SE 2KZ7B 2WMOA 5HXCA 1HX1B 3PUQA 2W0GA 3AEFA 5LMUT 1W9RA 4KBMB 5JH7E 2LKGA 3RYFE 2DLRA 2X0HA 3VRAA 1OWAA 2X51A 1E2AA 1MIVA 3C98B 2V5CA 4JI3T 4CXXA
chains in the Genus database with same CATH topology
4OX9T 1XNQT 4KHPT 4LF5T 2UUCT 3T1YT 4JI1T 1N32T 4DV5T 4DR4T 1N33T 4X62T 4X66T 4JYAT 2ZM6T 1FJGT 4DR2T 3T1HT 2UUAT 4B3ST 1N36T 4JI7T 1XNRT 2F4VT 4DUZT 1HNZT 4DR5T 4DR3T 4X64T 4LF7T 4DV6T 4NXMT 2UUBT 4DV0T 4LF6T 4DR6T 4DV2T 4DV3T 4LFAT 4LFCT 2UXDT 4JI2T 4JI8T 1I94T 3OTOT 5LMNT 1HNXT 4DUYT 4LFBT 4X65T 4DV4T 4JI4T 4JI0T 1IBMT 4K0KT 4LF4T 4B3MT 1IBKT 4LF9T 4DV1T 4YY3T 4DR1T 4JI5T 2UXCT 4GKJT 4DR7T 4B3TT 2UU9T 4YHHT 4B3RT 1XMQT 1N34T 5IWAT 5BR8T 4AQYT 4JV5T 4NXNT 1IBLT 5LMUT 1HNWT 4JI6T 4LF8T 4DV7T 1J5ET 1XMOT 1HR0T 2UXBT 2VQFT 2HHHT 4GKKT 2E5LT 4JI3T 2VQET
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OX9 T;  1XNQ T;  4KHP T;  4LF5 T;  2UUC T;  3T1Y T;  4JI1 T;  1N32 T;  4DV5 T;  4DR4 T;  1N33 T;  4X62 T;  4X66 T;  4JYA T;  2ZM6 T;  1FJG T;  4DR2 T;  3T1H T;  2UUA T;  4B3S T;  1N36 T;  4JI7 T;  1XNR T;  2F4V T;  4DUZ T;  1HNZ T;  4DR5 T;  4DR3 T;  4X64 T;  4LF7 T;  4DV6 T;  4NXM T;  2UUB T;  4DV0 T;  4LF6 T;  4DR6 T;  4DV2 T;  4DV3 T;  4LFA T;  4LFC T;  2UXD T;  4JI2 T;  4JI8 T;  1I94 T;  3OTO T;  5LMN T;  1HNX T;  4DUY T;  4LFB T;  4X65 T;  4DV4 T;  4JI4 T;  4JI0 T;  1IBM T;  4K0K T;  4LF4 T;  4B3M T;  1IBK T;  4LF9 T;  4DV1 T;  4YY3 T;  4DR1 T;  4JI5 T;  2UXC T;  4GKJ T;  4DR7 T;  4B3T T;  2UU9 T;  4YHH T;  4B3R T;  1XMQ T;  1N34 T;  5IWA T;  5BR8 T;  4AQY T;  4JV5 T;  4NXN T;  1IBL T;  5LMU T;  1HNW T;  4JI6 T;  4LF8 T;  4DV7 T;  1J5E T;  1XMO T;  1HR0 T;  2UXB T;  2VQF T;  2HHH T;  4GKK T;  2E5L T;  4JI3 T;  2VQE T; 
#chains in the Genus database with same CATH topology
 3P50 A;  1KFY A;  1MMG A;  3U3I A;  3DTO A;  4UV9 B;  4DVD A;  3T1Y T;  1UX4 A;  4EGW A;  1SUM B;  3RH3 A;  2LRK A;  2VKJ A;  2PTF A;  4QXC B;  2F4V T;  2X9H A;  3HKE E;  2YEV C;  2W67 A;  4TWD A;  3UU5 A;  5C8Y E;  5ABG A;  5ABE A;  1W0B A;  5EK2 A;  3BQL A;  2JMK A;  1US7 B;  3OTO T;  5KX5 E;  3HKB E;  3O4X E;  2D0T A;  5ABH A;  5C2T A;  1IZN B;  2JRK A;  2XTL A;  5JVD E;  4HGA A;  2LEH A;  2K9A A;  5L3F B;  4WBO A;  2IML A;  4FJO A;  4YTN A;  3PUZ F;  4IE4 A;  2VB6 A;  2V7K A;  4C90 A;  3CKD A;  2DI4 A;  2NTX A;  3CQX C;  3FB2 A;  2XQA A;  1WRD A;  4BAY B;  1UUS A;  4AKG A;  4X1Y E;  3FHN A;  3UUX B;  4ZHQ E;  2NW9 A;  2EHO B;  4ZOL E;  5CJ5 A;  4BJN A;  1LVF A;  1JNR A;  2VQF T;  2VKO A;  5LA6 E;  4HFH A;  2KT9 A;  5A1L A;  4DMW A;  3ZMT B;  4IE5 A;  3UUL A;  5AQO B;  5FYM A;  2XUE A;  1LRZ A;  2ZM6 T;  4DR2 T;  2IC9 A;  3VR9 A;  3I0O A;  4HWC A;  2H88 A;  3S4U A;  5FL0 A;  4DUZ T;  3RGL A;  2LSI A;  2UUB T;  5FXX A;  5F5W A;  1DU2 A;  2DHR A;  5HAX A;  4JI8 T;  4HFV A;  3LBX B;  3O1I A;  5LP6 E;  4DV4 T;  4EB6 E;  3Q5X A;  4QX7 B;  3ZYL A;  1IBM T;  2LHN A;  4JEH B;  3N2K E;  4I50 E;  3AE3 A;  4Z91 A;  1XDO A;  2GK9 A;  5L3G B;  5JRE A;  4OFZ A;  2W4X A;  2MBG A;  3EAM A;  5J2T E;  2KIN B;  5HCJ A;  3ZEF B;  4ILB A;  3R6N A;  1VCT A;  2CMR A;  3TLS A;  5L3D B;  3ZMS B;  5JRC B;  2OA5 A;  1HNW T;  3EVY A;  3F57 A;  3NVO A;  4UEL A;  5EK3 A;  4AQF A;  4LF8 T;  2V1D B;  5AQS B;  1SHZ C;  1EZ3 A;  1KEY A;  4TNW A;  2M67 A;  5EK4 A;  2I0M A;  2J62 A;  3GMI A;  3UQ4 A;  4H63 V;  4L0R A;  1QSD A;  3RYH E;  3TLW A;  2DWG A;  1W0A A;  1KNP A;  4JBW F;  3QNU A;  1XDP A;  5FL1 A;  4QH5 A;  2N9D A;  1T72 A;  4DBQ A;  5L4H A;  1HS7 A;  2UUA T;  1R8I A;  5JDQ A;  3TKL B;  3LG7 A;  3AE2 A;  5HYA A;  4UVC B;  2R6G F;  3ANW A;  4IE0 A;  3E08 A;  4LF6 T;  2WQY A;  4PJJ A;  2B1E A;  2XQ6 A;  3PUS A;  5ABF A;  4JI2 T;  3KVA A;  4HFC A;  2E9X C;  5M4Y A;  2JMH A;  4DUY T;  4LFB T;  3B5M A;  4O4J E;  1YKE B;  1BR1 A;  2LRL A;  3TLU A;  5JDF A;  4Q25 A;  3FXD B;  2CCQ A;  5DQW A;  1N34 T;  2YK0 A;  4I43 B;  5FXZ A;  3L3P A;  3N9M A;  4IST A;  5J0Z A;  2VUR A;  3AXJ B;  2YN6 A;  1YQ3 A;  3AE4 A;  3LJC A;  2IUB A;  4IHJ E;  5HEO A;  4AXP A;  2Y6X A;  4O4I E;  2J4G A;  3AE8 A;  3PU8 A;  4EAH A;  3PTR B;  4A97 A;  2HPJ A;  2HHH T;  3EI0 A;  5F3J A;  3C4X A;  3AEC A;  2WAU A;  5AQQ B;  5CFB A;  4IDQ A;  4NUV A;  5CB4 E;  1HCI A;  4ASK A;  4O2B E;  4X66 T;  4AKR B;  4QH1 A;  1HF8 A;  2XAH B;  3D0T A;  5EZY E;  2ODV A;  2I59 A;  4DV0 T;  4O4L E;  5AQF B;  4QHO A;  2CE7 A;  2L3L A;  3AVS A;  4AIU A;  2H7O A;  2KSR A;  4HEA A;  4ERR A;  4X65 T;  4AQG A;  3NZP A;  2J1D G;  3P4W A;  3EDV A;  4H9O C;  4FI5 A;  4DID B;  3SFD A;  2OV9 A;  2N1G A;  4HFB A;  4PFP A;  4GKJ T;  3KV5 A;  4WW0 A;  3RIA A;  3UU8 A;  2PBI A;  3MAC A;  3Q5D A;  4CZZ B;  3H37 A;  3K8P C;  4QXB B;  1SA0 E;  2DNX A;  1Z8U A;  1HX8 A;  3NWI A;  4JEU B;  3Q5W A;  2BKN A;  3BQI A;  3DP7 A;  1S35 A;  1IBL T;  3EAB A;  2CHO A;  4TNV A;  3SWH A;  3LSV A;  5AQU B;  5HEJ A;  1WYB A;  1HR0 T;  2E9X B;  2HH7 A;  3FZF B;  3ETV A;  2VKH A;  3P7I A;  2LT3 A;  2XAG B;  4IL4 A;  3BK9 A;  4TZ4 C;  4PNI A;  1N32 T;  4ZI2 C;  2JQ9 A;  1N33 T;  4P09 A;  4H9R C;  2VKD A;  1H7C A;  4IRE A;  1D0X A;  3N2O A;  3QUJ A;  3N9N A;  3C4W A;  5HXH A;  5JR9 A;  4LFA T;  4BJM A;  3B13 A;  3FBZ A;  2OLT A;  2W2U A;  2VL0 A;  1CHU A;  3K3Q C;  2NP9 A;  3KVB A;  4B3M T;  4J2C A;  3AE9 A;  3ONJ A;  4UIG A;  2XQY A;  3PUV F;  4ILC A;  1U4Q A;  2HPL A;  2WWV A;  5FVL A;  2BDE A;  3T8O A;  3EHZ A;  5BR8 T;  2IC6 A;  3RKG A;  2V7L A;  2LSK A;  3VKG A;  4HWI B;  1D0Y A;  2MAW A;  1WCR A;  4NUU A;  3RRW A;  3TLV A;  4ISS A;  2XPK A;  5FY7 A;  5FVK A;  5HWX A;  2CRB A;  1G73 A;  4QWN B;  3GN5 B;  1BR2 A;  1UK5 A;  4IDO A;  5BMV E;  4CXW A;  4KHP T;  5HWY A;  1AJ3 A;  3MA9 A;  3LFM A;  4PJL A;  2WDR A;  4X62 T;  2KMF A;  1FJG T;  4B3S T;  5HXS A;  3ONX A;  4HKA A;  5L3E B;  2BKO A;  2LSJ A;  3OBV E;  4UF0 B;  4CQI A;  3RIF A;  3VU7 H;  1J1J A;  4U7I A;  2X0Y A;  1NAF A;  2W61 A;  4H9Q C;  1MIW A;  2JQH A;  3AE1 A;  2X0L B;  3AB3 B;  4O8S A;  4LF4 T;  1ZP0 A;  4Z90 A;  2BG9 E;  4WYV A;  3CIR A;  3VHL A;  4JI5 T;  4B3T T;  3BQK A;  2K48 A;  3G06 A;  4TV8 E;  2XSB A;  1WR0 A;  1M7K A;  5AQV B;  5LHG B;  1Y01 A;  4QX8 B;  4YSY A;  3VKH A;  3AE7 A;  3P4P A;  3PUR A;  2BS2 A;  2V6Y A;  3A7M A;  2PFV A;  3C50 A;  2DCF A;  4M1P A;  2NOX A;  2XAJ B;  4ZEY A;  2A9U A;  1LVK A;  4PW8 A;  3HL6 A;  3JC6 D;  1XWM A;  2W66 A;  3ZPO A;  4YTM A;  3VRB A;  4GKK T;  4PJN A;  2XQ5 A;  2BBH A;  2YU1 A;  4YXD A;  2Z6E A;  4HN9 A;  4KUM B;  4UV8 B;  2Q9Q A;  5LGU B;  3K3O A;  2L9Q A;  4UR9 A;  3RLF F;  4E7S A;  4ZXL A;  2X67 A;  3CML A;  2EHO A;  4EXT A;  2JPF A;  2FBW A;  4AI6 A;  1QUU A;  4AIS A;  4A5X A;  1HNX T;  3PU3 A;  2LJL A;  4H9N C;  2FJD A;  4K0K T;  5HXE A;  1U5P A;  4O2A E;  4DR7 T;  2LHR A;  2UU9 T;  3ZCI A;  2CEA A;  2XAQ B;  2KXP B;  3QB5 A;  3F31 A;  2K3W A;  2V7I A;  2Q9Q D;  4AQY T;  2V7M A;  4JV5 T;  3DJB A;  2MOZ A;  4MBQ A;  2EHO D;  2CA5 A;  3RRC A;  1D1A A;  5LOV E;  5AQN B;  4X5T A;  2XQ3 A;  4U74 A;  4OK0 A;  5HEH A;  5E0O A;  5LHH B;  3RKO A;  2ZM8 A;  2FJA A;  2LOS A;  2A2F X;  3PUG A;  2VVN A;  3AE6 A;  4PK6 A;  4CXY A;  4P0B A;  4U33 A;  1T8B A;  4TN7 B;  1CUN A;  2FJE A;  3T1H T;  2XM2 A;  2YKS A;  2LM9 A;  1UCU A;  4E7Z A;  4U3C A;  2CLY C;  5JRC A;  5IUX A;  5LGT B;  3MKD A;  4DR6 T;  1NEK A;  5AFU L;  4DV2 T;  1MIY A;  2M6I A;  3AA6 B;  2XY8 B;  3QK6 A;  4HE8 A;  3E0Z A;  4ANJ A;  5JDG A;  4P0A A;  3UTK A;  3UQ7 A;  4AKI A;  1WLX A;  2CHN A;  4X1I E;  3ANW B;  1VCS A;  4JUY A;  1I6Z A;  2PG8 A;  1ZHC A;  5JDH A;  2H7V C;  3ONL C;  2WU2 A;  3CWZ B;  5ABF B;  3FZH B;  3OVU A;  3ZN1 B;  3SS1 A;  4EYY R;  3AAE B;  4K0U A;  4GIW A;  4A56 A;  4YT0 A;  3OJA A;  4ZI3 D;  4U7Y A;  2CM0 A;  2D0U A;  3RX6 A;  3MJX A;  4KMC A;  2J47 A;  4TWH A;  4I55 E;  3V5S A;  2HN1 A;  4LMK A;  3JAF A;  2UXX B;  2IIU A;  3AEA A;  5LXT E;  3AA1 B;  1YQ4 A;  3B57 A;  2V5D A;  4IDN A;  4MFR A;  4CN4 A;  5KDM C;  5DAB A;  4LF5 T;  4DND A;  5L3B B;  1YXR A;  1ZV4 X;  3AEB A;  4YFS A;  5AQT B;  3ZYK A;  3LK2 B;  3CVR A;  3RQU A;  5L3C B;  4DR5 T;  4DR3 T;  2W00 A;  2I6H A;  3C51 A;  5TAO A;  4QXH B;  3GA8 A;  3H3A A;  2UXD T;  3L8R A;  3M3Z B;  3TLT A;  5DJQ C;  2L8K A;  2YDS A;  3PJA J;  4OYJ A;  4YJ2 E;  4YY3 T;  3X1D A;  2G0U A;  5LG4 A;  3MZK B;  3WI3 A;  4TV9 E;  3N9L A;  2CWO A;  2BBJ A;  5FP3 A;  1J5W A;  3KIN B;  3OYX A;  4L5G A;  3C64 A;  1HG2 A;  4UVA B;  4NXN T;  2CLY B;  4CN6 A;  3AVR A;  2VK9 A;  3AA7 B;  3N9O A;  2VL8 A;  5GON E;  3SOL A;  2XAS B;  4IGU A;  3CPZ A;  1YD8 G;  5LGN B;  2WZH A;  3WAK A;  1M62 A;  2X9W A;  1BR0 A;  4G2A A;  3OPC A;  2QVA A;  3FZL B;  3I9Y A;  1MMD A;  2IDO B;  2E5L T;  4HWH A;  1YKH B;  4KP3 C;  2WMN A;  2E2A A;  2UUC T;  2WB5 A;  4DV5 T;  5FY0 A;  4UVB B;  2C5J A;  4IT4 A;  4HTE A;  3R84 B;  4WZX A;  3ZMU B;  3KBU A;  4GK0 E;  3I9W A;  1HNZ T;  3MXZ A;  5LCY A;  3UUN A;  4EOZ B;  5KMG P;  4DV3 T;  4LFC T;  2IW5 B;  3CQC B;  4JI4 T;  4EYU A;  3RHW A;  2C5K T;  3AE5 A;  1B7T A;  5AQR B;  2XSA A;  4DR1 T;  1QLB A;  2UXC T;  2JQK A;  3ZLI A;  4PJM A;  3N2G E;  4MAL A;  4O4H E;  5HCM A;  1HG5 A;  3OKQ A;  1GQE A;  3KV4 A;  3L39 A;  4ILA A;  2PJQ A;  3RQW A;  2HN2 A;  2W62 A;  3AED A;  2ACZ A;  3ZC0 A;  1MND A;  1OED A;  1KNR A;  3Q2M A;  3KFW X;  5ETW A;  2BG9 A;  5CA0 E;  4DMV A;  2KWI B;  4NPP A;  2B76 A;  2Q9Q C;  2LE8 A;  3QC9 A;  2MPK A;  4Z8X A;  2V7J A;  3ZC1 A;  2WSS V;  2X9Y A;  1XNQ T;  1Z0P A;  3OYZ A;  5LBM A;  5FY1 A;  2MTQ A;  2EHO C;  3K3N A;  1IAP A;  5L47 A;  1FEW A;  4N78 D;  3RIU A;  4AKH A;  2ZMA A;  4IIJ E;  2NTY A;  3ZT6 A;  3MK7 C;  4EV6 A;  4B6X A;  2YIN A;  4H9P C;  3ZKR A;  4DV6 T;  2XQ9 A;  2XAF B;  3CX8 B;  5AQK B;  5LG3 A;  2V8S V;  3JCF A;  1I94 T;  5F8P A;  3FXE B;  4IDZ A;  2ODU A;  1HTJ F;  3FBL A;  1KNZ A;  2WCA A;  2XQ4 A;  2XM1 A;  1O3X A;  3AEG A;  2XQ7 A;  4COF A;  1XMQ T;  4A98 A;  3LK4 2;  3V5U A;  4ZZC A;  2H89 A;  1MNE A;  4PAG A;  2M6B A;  3QB5 K;  4OHF A;  5FXV A;  1OED E;  5L4E A;  2W63 A;  4UF0 A;  3NRX A;  2WWU A;  2CBJ A;  3ZT7 A;  2WP9 A;  3J9X 1;  4AQF C;  2SPC A;  2YDQ A;  2UXB T;  1WYC A;  5LBQ B;  5DQV A;  3N5L A;  5C3J A;  3EDU A;  4U31 A;  4LMJ A;  3IF8 B;  1XZY A;  3HKC E;  5LYJ E;  2V6Y B;  4YSZ A;  3IA3 A;  4ZI3 C;  3A8Y C;  4DR4 T;  5H6Q B;  3KDS E;  4XAX B;  3ETU A;  3EUH A;  4IE7 A;  2JQQ A;  3FZM B;  2DL1 A;  1N36 T;  4JI7 T;  2NWB A;  4KI0 F;  3P8C D;  2BZB A;  3P4Q A;  3SFE A;  2CXL A;  3IEE A;  4U2Y A;  3RC3 A;  4TX5 A;  5AQP B;  2RPA A;  5AQH B;  3CX6 B;  4JI0 T;  2NW7 A;  2BS4 A;  1FMV A;  2Q9Q B;  4DV1 T;  4ZI2 D;  4TWF A;  3N9Q A;  5J1G A;  4YHH T;  4B3R T;  5JTG A;  2X9X A;  4CI2 B;  1D1C A;  2E5V A;  1UGO A;  4WBN E;  2WBL A;  5ADX L;  2D9D A;  2NR4 A;  1SE7 A;  2BVM A;  2ZM2 A;  3NBX X;  3ZJ1 A;  1ZKE A;  2DWK A;  3P4R A;  4HFI A;  4F8H A;  1XMO T;  2XHE B;  1KK7 A;  5HXR A;  2LLY A;  3RC8 A;  3PUA A;  2AE9 A;  3ZCJ A;  4KHZ F;  4YSX A;  1ZOY A;  2XQ8 A;  4OX9 T;  3O1H A;  4MHC A;  3Q9D A;  2H3R A;  5J2U E;  3N9P A;  4JI1 T;  3LBX A;  4NIQ A;  1VRB A;  5JDM A;  2P9B A;  3NZQ A;  4G63 A;  2V6X A;  1VOM A;  2KLQ A;  3NRY A;  2X66 A;  4X1K E;  2K24 A;  3ZSS A;  3M65 A;  3AAA B;  3UU3 A;  3LK3 B;  3E22 E;  3ABV A;  3W15 B;  1E1H B;  4BA9 A;  3VR8 A;  1KF6 A;  1NWM X;  3U78 A;  2JIW A;  3ZMZ B;  1X79 A;  3RYI E;  5H6R B;  5LB7 B;  1FIO A;  2YU2 A;  5FNV E;  3UUM A;  3ESL A;  3JAE A;  4TUY E;  2V26 A;  1OXZ A;  4U72 A;  4F6R C;  3HA4 A;  4ADZ A;  3ZYM A;  4YJ3 E;  3WAJ A;  2Y8D A;  1T7S A;  3UT5 E;  3GWH A;  4ILU A;  2N2N A;  3PV0 F;  2ZM0 A;  3H3M A;  2VAS A;  2WU5 A;  4I4T E;  4PFO A;  2RP4 A;  1IJ6 A;  2VVS A;  1UX5 A;  1W09 A;  4CN1 A;  2CWY A;  4JI6 T;  1J5E T;  3ZN0 B;  5JDL A;  5CA1 E;  3SRZ A;  4GOU A;  4QH4 A;  5AQG B;  2E8I A;  1S94 A;  4EZH A;  2BKP A;  3UFE A;  2VQE T;  3HI2 A;  2FJB A;  1BR4 A;  4L9I A;  4IDP A;  2C0S A;  4HWD A;  2A3D A;  3ZMV B;  3PUX F;  2WS3 A;  2IAK A;  1XNR T;  4IE6 A;  2CXF A;  3JAD A;  2QYW A;  4UEM A;  4OYK A;  3AA0 B;  2ACX A;  2WDQ A;  5JR9 C;  1IJ5 A;  3AXJ A;  4KX6 A;  3L09 A;  5AQL B;  5CGM A;  5AQI B;  3ZJ2 A;  2A72 A;  4ZS2 A;  3ZT5 A;  4MLK A;  4QKN A;  4YTP A;  3PDY A;  4U2Z A;  3Q5E A;  4GYS A;  4GK5 E;  1UUR A;  1OED C;  4V1A v;  2KND A;  2CXD A;  5IWA T;  1WR6 A;  2BG9 C;  2D5U A;  2CPT A;  3IBP A;  3K1S A;  2LOP A;  2X68 A;  1Y64 B;  4HFD A;  1MMA A;  1NEN A;  3C4Z A;  4CI3 B;  2LM2 A;  3PE0 A;  4ZI7 E;  3I1A A;  4ZS3 A;  1FMW A;  3RIU C;  4PK5 A;  4P1N A;  3HR0 A;  2C5I T;  2WY2 A;  5FKY A;  5AQM B;  5LHI B;  1YW0 A;  3PUY F;  4XZC A;  3UU6 A;  2LSY A;  2VWA A;  3QOF A;  3AEE A;  1G8X A;  5JDN A;  3I0Q A;  4EED A;  3O1J A;  3AAI A;  1MMN A;  5IYZ E;  4JYA T;  2WM9 A;  2XZE A;  3ZST A;  5JQG E;  3A5X A;  2NW8 A;  1V9D A;  4EEB A;  2QGS A;  5LJN A;  2AXD S;  4X64 T;  2LKH A;  4NXM T;  3CK6 A;  2QRX A;  2XJ7 A;  2BS3 A;  2QA7 A;  5FXW A;  5L2L A;  5AQJ B;  4YLH A;  5KXJ A;  2UXN B;  2RA1 A;  2IHR 1;  3KBT A;  3JC6 C;  1ZEE A;  3RF1 A;  3HKD E;  4AKL A;  5LJM A;  4HWF A;  4H63 H;  2WZI A;  4DO0 A;  3RPU A;  2E9X A;  5HEG A;  4YHJ A;  2KWH A;  3IHR A;  1T98 A;  4PK4 A;  1E7P A;  3NKZ A;  2JJ9 A;  2WDV A;  4DV7 T;  4GYR A;  5JR9 B;  1L0V A;  5IHY A;  2MYS A;  3KV6 A;  2CBI A;  4CI1 B;  5LNK A;  3CX7 B;  1HFA A;  3UU4 A;  3PJA A;  2K5B B;  2E9X D;  4IL9 A;  3CQG B;  4JLE A;  4X20 E;  1WFD A;  1OED B;  4ZZB A;  4XBF B;  2BG9 B;  2FUP A;  4C91 A;  2ZLY A;  1D1B A;  3RYC E;  2D2S A;  4LF7 T;  2BVL A;  4WNK A;  3F2E A;  1LKX A;  5FMN A;  1X9B A;  2LSG A;  4I0U A;  3KV9 A;  5LMN T;  2YDR A;  4LML A;  2YOE A;  3J7Y q;  3FZK B;  1IBK T;  4LF9 T;  4EIW A;  3UFG A;  3PUW F;  1D0Z A;  4DBR A;  3O9X A;  1JNZ A;  4EZ4 A;  4UXN B;  2ES0 A;  5HEU A;  2Y48 B;  4HFE A;  3LDQ B;  3P4S A;  3RI5 A;  3GN5 A;  3UUB A;  4H9S E;  2KZ7 B;  2WMO A;  5HXC A;  1HX1 B;  3PUQ A;  2W0G A;  3AEF A;  5LMU T;  1W9R A;  4KBM B;  5JH7 E;  2LKG A;  3RYF E;  2DLR A;  2X0H A;  3VRA A;  1OWA A;  2X51 A;  1E2A A;  1MIV A;  3C98 B;  2V5C A;  4JI3 T;  4CXX A; 
#chains in the Genus database with same CATH homology
 4OX9 T;  1XNQ T;  4KHP T;  4LF5 T;  2UUC T;  3T1Y T;  4JI1 T;  1N32 T;  4DV5 T;  4DR4 T;  1N33 T;  4X62 T;  4X66 T;  4JYA T;  2ZM6 T;  1FJG T;  4DR2 T;  3T1H T;  2UUA T;  4B3S T;  1N36 T;  4JI7 T;  1XNR T;  2F4V T;  4DUZ T;  1HNZ T;  4DR5 T;  4DR3 T;  4X64 T;  4LF7 T;  4DV6 T;  4NXM T;  2UUB T;  4DV0 T;  4LF6 T;  4DR6 T;  4DV2 T;  4DV3 T;  4LFA T;  4LFC T;  2UXD T;  4JI2 T;  4JI8 T;  1I94 T;  3OTO T;  5LMN T;  1HNX T;  4DUY T;  4LFB T;  4X65 T;  4DV4 T;  4JI4 T;  4JI0 T;  1IBM T;  4K0K T;  4LF4 T;  4B3M T;  1IBK T;  4LF9 T;  4DV1 T;  4YY3 T;  4DR1 T;  4JI5 T;  2UXC T;  4GKJ T;  4DR7 T;  4B3T T;  2UU9 T;  4YHH T;  4B3R T;  1XMQ T;  1N34 T;  5IWA T;  5BR8 T;  4AQY T;  4JV5 T;  4NXN T;  1IBL T;  5LMU T;  1HNW T;  4JI6 T;  4LF8 T;  4DV7 T;  1J5E T;  1XMO T;  1HR0 T;  2UXB T;  2VQF T;  2HHH T;  4GKK T;  2E5L T;  4JI3 T;  2VQE T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...