4DIDB

Crystal structure of salmonella effector n-terminal domain sopb in complex with cdc42
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
127
structure length
127
Chain Sequence
ARPEIIVLREPGATWGNYLQHQKASNHSLHNLYNLQRDLLTVAATVLGKQDPVLTSMANQMELAKVKADRPATKQEEAAAKALKKNLIELIAARTQQQDGLPAKEAHRFAAVAFRDAQVKQLNNQPW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Salmonella Effector Protein SopB N-terminal Domain in Complex with Host Rho GTPase Cdc42.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase
molecule keywords Cell division control protein 42 homolog
total genus 44
structure length 127
sequence length 127
ec nomenclature ec 3.1.3.-:
pdb deposition date 2012-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.450 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Cell division control protein 42 homolog 4didB01
4DIDB
chains in the Genus database with same CATH superfamily
2E5LT 3AB3B 3HL6A 2LKHA 3FZKB 3Q9DA 2VASA 4KBMB 4PJJA 2E9XB 5HCJA 4EYUA 4XAXB 4ZI2D 5HCMA 2V26A 4U7IA 2A72A 4I55E 4DVDA 4QXCB 2CHNA 5LP6E 3H37A 1IJ5A 2CXFA 3AE6A 4IREA 5ETWA 3UT5E 3ZMUB 5IWAT 1O3XA 4OYKA 5HWYA 3RI5A 4QXBB 1WCRA 5GONE 2KSRA 2LSYA 5FNVE 4H9QC 5FY7A 3VKHA 3K3NA 1FMVA 2XSBA 4IE7A 2XQ7A 1I94T 3RIAA 1HF8A 4HN9A 5AQHB 2VWAA 3UU5A 3RYCE 3ZT5A 2CE7A 1YKHB 4PJMA 2WP9A 3ANWB 4H9NC 4JBWF 4TX5A 1MNDA 4X5TA 1LVKA 2N9DA 1R8IA 4EGWA 5LBQB 3NZPA 5CJ5A 5CA1E 3RH3A 4XBFB 3RRCA 5DJQC 2MOZA 4NUUA 3RIUC 4ZHQE 2BG9B 3MZKB 4UXNB 4U2YA 1UUSA 2MYSA 2W0GA 2W66A 2RPAA 3OYZA 3FZLB 3KFWX 4P1NA 5HXHA 2K3WA 4UF0A 1WRDA 2CM0A 4L0RA 4UVAB 4CXWA 1B7TA 5L3BB 4CI1B 5LMUT 1QLBA 3ZMVB 5LHIB 5L4HA 3AECA 3EVYA 3N9MA 2OV9A 4KHZF 3C4WA 2NW7A 2RA1A 3KV9A 2J1DG 3A7MA 3IBPA 4H9SE 4U2ZA 4X1KE 2M6IA 4YXDA 1OEDC 4H9RC 2HH7A 2R6GF 4DMVA 5M4YA 2SPCA 2LSKA 3I0QA 3N9OA 3RPUA 1N36T 1DU2A 1HR0T 1YKEB 2WDQA 4IDOA 5LJMA 3UU3A 4UR9A 4LF9T 2WDRA 3VRBA 1J1JA 2C0SA 3G06A 2A9UA 3AE8A 4DR4T 1X9BA 2CXLA 3TLVA 1UX5A 1S35A 3N2KE 3R84B 4BJNA 4MFRA 2WCAA 2VVSA 2Q9QB 2H7VC 4QX7B 3NWIA 2Q9QD 5HEHA 3SWHA 5AQQB 3UU4A 4CN4A 2OA5A 1IBLT 3N2OA 1M7KA 2LJLA 4DV3T 4PAGA 3B57A 3RYHE 2AE9A 2LT3A 3O1IA 1OWAA 4GOUA 1LVFA 2W62A 4BAYB 2V5CA 2ODVA 2BVMA 3TLUA 3K8PC 3OYXA 4H63H 2ES0A 2VK9A 4LF5T 3ZT7A 2K48A 4EV6A 3P4QA 2HPLA 2YDQA 2ZMAA 5DABA 1N34T 4IE6A 4YTNA 2D0TA 1MMNA 2I0MA 2Q9QC 2IMLA 4EZHA 3GN5B 4OK0A 4LF6T 2XAJB 4GIWA 4IDNA 5HXRA 4ILUA 2V5DA 4LF8T 5EK3A 3FZMB 2JMKA 3FXEB 4AKLA 2NR4A 2KLQA 5HXCA 3OKQA 4HWIB 5L47A 4DV5T 4JI3T 4KMCA 1J5WA 4PJLA 4TWFA 2CCQA 4KP3C 5JDNA 1WYBA 2X0YA 4U74A 5L3DB 2WSSV 2JQKA 4EYYR 1IAPA 3LK2B 4ILCA 5LB7B 4HFHA 4DNDA 5JDLA 4KI0F 2HN1A 4DR7T 2MTQA 2VKDA 2J4GA 2LKGA 2XQ8A 1YQ3A 1D1BA 3AEEA 1JNZA 5AQNB 1S94A 4ZXLA 4IE5A 5IHYA 4DR2T 2ZLYA 2WWUA 2CBIA 4LMLA 2JPFA 2LOSA 2LSIA 2EHOA 3MJXA 2XQAA 4I4TE 4Z90A 2NP9A 5ABEA 5KXJA 3JAFA 1BR4A 5KMGP 1OEDB 3F31A 3M65A 3SRZA 1GQEA 3ZCIA 2NTXA 2ZM8A 3RX6A 1CHUA 1G73A 3EAMA 3QNUA 2CLYC 3LG7A 3OJAA 4HGAA 5F5WA 5H6RB 5HYAA 3HKDE 3SS1A 5JDHA 2VQFT 3AE4A 1LRZA 5L2LA 4CI3B 3FBZA 3PUSA 4X1YE 2KXPB 4FI5A 2ZM6T 4WBNE 4JEHB 4ILAA 2V8SV 3S4UA 4ERRA 4TV9E 4TZ4C 5HEGA 2LRLA 2FJDA 4OFZA 4IDPA 1VCSA 3C51A 4HWDA 3BQLA 3BQIA 4GK0E 3LFMA 3N9LA 2Q9QA 4ISTA 5HEUA 3K3QC 3AA6B 3NVOA 3U78A 4B6XA 2UUBT 4NXNT 1XDOA 5LJNA 4AKIA 4Q25A 2M6BA 3FZFB 4YLHA 2LM9A 2K5BB 3AEAA 4GK5E 4X1IE 5JR9A 4TUYE 3AA1B 1WFDA 2NW9A 2D9DA 5FYMA 4ZZBA 1SUMB 2CA5A 3LSVA 4ZI3D 2E9XA 4JI7T 2D5UA 3ONLC 4L9IA 2QRXA 3RHWA 2BVLA 4EXTA 4AQYT 4JI1T 3PU8A 4Z91A 3GN5A 4AQFA 2HHHT 2JQHA 4IHJE 2JQQA 3RF1A 3AEBA 3R6NA 4CXYA 5IYZE 3P4WA 2BBHA 5BR8T 4QXHB 3VU7H 3AAAB 3ZN0B 5A1LA 2DCFA 1OEDE 1YQ4A 4IDQA 3TKLB 4DR1T 2BKPA 3OPCA 1MNEA 1KNZA 2DWKA 1W09A 3LK42 3L8RA 3A5XA 3OVUA 4H63V 3RC3A 5L4EA 4DR6T 4ZZCA 3AEFA 2XJ7A 1U5PA 2CBJA 4QH1A 2K9AA 4ISSA 1W0AA 5AQRB 5J0ZA 4COFA 4JI8T 3C4ZA 3UQ4A 5HWXA 1HX1B 3UU6A 4LF7T 2X66A 5E0OA 4WZXA 1Y64B 2NWBA 2WZIA 5FKYA 5AQSB 2Y48B 3O4XE 3O9XA 2YOEA 2ZM0A 1N33T 3AVRA 4PNIA 2D2SA 5AQKB 3RYIE 2LRKA 4TV8E 2X9XA 3MACA 2HPJA 1MMAA 2VKHA 3ZMTB 4P0AA 5L3GB 3ZC0A 1WYCA 3KVAA 5LNKA 3AA7B 3A8YC 3RGLA 3CX6B 3ESLA 4O8SA 3UULA 3FHNA 4GKKT 2PJQA 2IHR1 3GMIA 4YJ3E 3C50A 3T8OA 4OX9T 1KNRA 2BS2A 2CPTA 1KEYA 3W15B 4ZS2A 4CN6A 2WWVA 3DP7A 3O1HA 4HE8A 3EUHA 1HNZT 3V5SA 3B13A 4B3ST 2EHOB 4PK6A 5JDMA 1T72A 4I50E 4ADZA 5LG4A 4AKRB 4ILBA 1MIVA 2QGSA 1X79A 2FUPA 1ZV4X 3JAEA 3QK6A 4NXMT 1T7SA 2LLYA 2IC6A 2ZM2A 3SFEA 1LKXA 4EEDA 3ZKRA 2VVNA 4UV8B 4A56A 2CWOA 2X9YA 5EK4A 5AFUL 1ZHCA 5LGNB 2LSGA 5LHHB 4F6RC 3GWHA 2I59A 2PFVA 4LFAT 2ACXA 1NWMX 2XAQB 1IJ6A 3AE1A 2BZBA 2WMNA 4JYAT 1NEKA 1FIOA 3CK6A 3LJCA 3T1YT 4PFOA 1XMOT 2W00A 4JI0T 2XHEB 1IZNB 3AAEB 4OYJA 2H89A 3M3ZB 3EHZA 3N5LA 3PU3A 3ONJA 4C91A 2WU2A 2QA7A 3T1HT 3LBXB 3HR0A 5FP3A 4H9PC 4YTMA 2V7LA 5AQMB 3RRWA 1IBKT 3PUAA 3NZQA 3IEEA 5FL0A 4HFIA 4LMJA 5L3FB 4X66T 3F2EA 3TLWA 3EI0A 3PDYA 1OEDA 2YDRA 2P9BA 2UXXB 4UELA 1OXZA 4AI6A 2UXCT 1AJ3A 2LOPA 5LCYA 5L3EB 3PUWF 4PW8A 5HEOA 3L39A 4ZI2C 3Q5WA 3AEDA 4YY3T 4NPPA 4HFBA 4B3MT 1KFYA 5ABFA 4TWDA 2LEHA 3PV0F 3ZPOA 1JNRA 2N1GA 3BK9A 2VKOA 1US7B 1M62A 2I6HA 4MALA 5LBMA 1HCIA 2X9WA 3PJAJ 4WBOA 1XNRT 5C2TA 2X9HA 3N2GE 1VOMA 3QC9A 2XAGB 3RQWA 2F4VT 2V1DB 1NAFA 1J5ET 2QVAA 4NUVA 1ZP0A 2FBWA 3Q5EA 2VQET 2E9XC 3P4PA 2C5JA 2BDEA 2BKNA 3L3PA 4JI4T 4IIJE 2XUEA 2Z6EA 2HN2A 4UV9B 3RIUA 1IBMT 1FJGT 4QH4A 2NOXA 2DLRA 3N9NA 4UF0B 5L3CB 4DV1T 1D1CA 4U3CA 4HEAA 4QWNB 3VRAA 1E2AA 1D0YA 2E9XD 2LM2A 2J47A 1SHZC 3JADA 2G0UA 4PJNA 5C3JA 4WYVA 3QB5K 2ACZA 1SA0E 2BG9C 4PFPA 2XAHB 1N32T 4AKGA 4GYRA 4B3TT 3EABA 1QUUA 5F8PA 2QYWA 3RQUA 3KV5A 3P50A 1SE7A 2W63A 3H3MA 3AXJA 3HI2A 3DTOA 4ZOLE 5DQWA 3SOLA 4YSXA 1MMDA 2D0UA 1VRBA 4O4IE 4YTPA 4DR5T 5FXXA 3C98B 4O4HE 2XQYA 3FXDB 5EZYE 3L09A 4CXXA 2BS4A 2K24A 2KNDA 2H3RA 3D0TA 2MBGA 3U3IA 5JDGA 4DUYT 4AIUA 4DBRA 2V7JA 2RP4A 2VB6A 2JRKA 4UEMA 3DJBA 2IDOB 4IGUA 2KMFA 4JLEA 1XMQT 1HNXT 2B76A 5CFBA 5AQJB 3AE9A 2CLYB 2YU1A 3AXJB 2XTLA 3UUBA 3ZEFB 2XAFB 3GA8A 2VL8A 1XNQT 3E0ZA 2H7OA 4U31A 1UCUA 3CX7B 3H3AA 1KNPA 2E5VA 1HTJF 3MXZA 2DWGA 3CQXC 3UUXB 2XASB 5FVKA 3PUXF 4EOZB 3TLSA 4ZI7E 3ETUA 2UXNB 4UIGA 3ZYLA 3ZSSA 2DI4A 3SFDA 4JV5T 5FXVA 4OHFA 4HFVA 2BS3A 1YXRA 3WAKA 2YN6A 4HWFA 5AQLB 1ZKEA 5JR9B 3J9X1 4GYSA 3I9WA 1WR6A 1Z8UA 3CIRA 1W9RA 3VR9A 5FL1A 1HX8A 4L5GA 3ABVA 3RC8A 2FJBA 2NTYA 5JH7E 5LHGB 3ZYMA 5TAOA 4YJ2E 2UUAT 4IT4A 3PUYF 3CX8B 3CKDA 3HA4A 3QUJA 2L9QA 4TN7B 4N78D 3K1SA 2FJAA 5J2TE 2EHOD 2ODUA 4J2CA 5CB4E 5HXEA 1HNWT 1D0XA 4PK5A 2XPKA 3QB5A 3P4SA 3ZT6A 2N2NA 5BMVE 2PBIA 3MA9A 1U4QA 4QX8B 4IE0A 5KDMC 5FVLA 2H88A 3P7IA 3RKOA 2WZHA 4WW0A 5JVDE 3PTRB 3LBXA 3TLTA 5JREA 4B3RT 1KF6A 2X0LB 3P8CD 2GK9A 4U7YA 4EAHA 2J62A 4QHOA 2WB5A 5JTGA 3KV6A 2CHOA 4JI5T 3E22E 4C90A 4X62T 1WLXA 5FXZA 3IHRA 5HEJA 4DMWA 1T8BA 1WR0A 4PK4A 2YEVC 4HKAA 2NW8A 3AVSA 4TWHA 1MMGA 1NENA 4O4LE 2V6XA 5CGMA 5IUXA 5JDQA 1EZ3A 3N9PA 4U72A 1HS7A 2MAWA 3F57A 4X64T 2WU5A 3AAIA 4HFEA 5FY1A 4E7ZA 3C4XA 5C8YE 4JI6T 4DBQA 3RKGA 3HKBE 3JC6D 3VHLA 2IW5B 3K3OA 2V6YB 3KVBA 4I0UA 3PUGA 5AQUB 4P0BA 4YHJA 4GKJT 4YSYA 3PUVF 2UU9T 2WBLA 4O4JE 4O2AE 4EEBA 5ADXL 4ZS3A 5J2UE 2XQ3A 4DV0T 2C5IT 5ABFB 4F8HA 3ONXA 3RIFA 2Y8DA 2A2FX 1UK5A 4AXPA 1XWMA 4DIDB 2VL0A 3KBUA 3VR8A 4CI2B 3ZMSB 1H7CA 4KUMB 3UUNA 2C5KT 3Q5XA 2DHRA 2XQ6A 5CA0E 1MIWA 2AXDS 4IE4A 5AQFB 5F3JA 3AE2A 2CWYA 2EHOC 5LG3A 1BR0A 3HKEE 3KBTA 2WM9A 3HKCE 4HFDA 4P09A 3UQ7A 5LXTE 4LF4T 2KT9A 2JJ9A 2WS3A 4JEUB 5LYJE 1V9DA 2BG9E 3FBLA 3OTOT 3PURA 4IL9A 2DL1A 2XQ4A 2W2UA 3UTKA 5ABHA 3NRYA 3PJAA 3FB2A 1I6ZA 1D1AA 2YK0A 4HFCA 1G8XA 4CZZB 5EK2A 3WAJA 2CXDA 1HFAA 3KV4A 4DO0A 5FMNA 5FXWA 2XZEA 2YINA 2DNXA 2FJEA 4UVCB 4CN1A 3B5MA 4DV7T 4KX6A 3UUMA 1UX4A 2CEAA 3AA0B 5AQIB 4QH5A 2CMRA 3JCFA 5H6QB 3ZYKA 4YT0A 2BBJA 5AQGB 4LFCT 4ASKA 2WMOA 4YHHT 3EDVA 5JQGE 2IIUA 2XM1A 3NRXA 3RYFE 3AEGA 5AQPB 5JRCB 3ZLIA 4A5XA 2WDVA 4H9OC 2V7MA 2XSAA 3N9QA 2XQ5A 4MBQA 3UFEA 3VKGA 2UUCT 3Q5DA 3CPZA 2LE8A 2UXDT 1XDPA 5KX5E 5LGUB 1BR2A 4G2AA 5FY0A 5LOVE 5LA6E 1HG5A 2V6YA 1E7PA 2IUBA 2VURA 4K0UA 3ZN1B 2IAKA 4QKNA 3IA3A 4U33A 3RLFF 1YD8G 4CQIA 1CUNA 3Q2MA 3LK3B 2CRBA 3PE0A 4YSZA 4DUZT 5AQTB 2KINB 1MIYA 4MLKA 4ZI3C 1UURA 4M1PA 2PG8A 3ANWA 4EZ4A 4LFBT 4AKHA 3I9YA 2B1EA 2L8KA 1UGOA 2W4XA 4HTEA 3ZJ1A 2YDSA 4KHPT 5AQOB 2Y6XA 4HWCA 3NBXX 4JI2T 3UU8A 4DV4T 2XM2A 4UVBB 4TNVA 4BA9A 5ABGA 2MPKA 5LMNT 3J7Yq 2L3LA 1Y01A 3C64A 4YFSA 2W67A 2A3DA 3PUQA 1D0ZA 4I43B 5LGTB 3BQKA 2KWHA 3NKZA 1YW0A 3JC6C 1FEWA 1Z0PA 3AE3A 3O1JA 4AQGA 2X0HA 1QSDA 2M67A 1E1HB 3LDQB 4IDZA 1L0VA 4TNWA 3CQCB 3EDUA 3FZHB 4LMKA 1XZYA 3WI3A 4JUYA 5JDFA 2JIWA 4EIWA 3PUZF 2IC9A 3IF8B 5DQVA 1T98A 4DR3T 2E2AA 2X68A 4V1Av 2LHNA 2VKJA 4AQFC 2UXBT 1BR1A 2WAUA 4FJOA 4X65T 4MHCA 2JMHA 2YU2A 1HG2A 1FMWA 2BKOA 2WQYA 3CWZB 2XQ9A 2KWIB 3P4RA 3QOFA 4DV2T 5JRCA 4DV6T 4AISA 4ZEYA 2OLTA 4IL4A 2WY2A 4EB6E 3AE5A 3ETVA 3I0OA 5HXSA 4XZCA 2JQ9A 2X67A 3CMLA 3ZC1A 2PTFA 4HWHA 2BG9A 1W0BA 3OBVE 4A97A 3I1AA 3KDSE 3MK7C 5HAXA 3ZSTA 4K0KT 2YKSA 4Z8XA 1ZEEA 4ANJA 2KZ7B 3ZJ2A 3CQGB 3ZCJA 3E08A 5JR9C 2E8IA 3V5UA 3CVRA 2V7IA 4X20E 3X1DA 3ZMZB 2LHRA 3MKDA 4A98A 2V7KA 4WNKA 1VCTA 4BJMA 2X51A 2LSJA 5AQVB 2XY8B 4O2BE 3UFGA 3KINB 2W61A 3AE7A 5J1GA 1KK7A 4NIQA 1ZOYA 4G63A 4E7SA
chains in the Genus database with same CATH topology
4DIDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DID B; 
#chains in the Genus database with same CATH topology
 2E5L T;  3AB3 B;  3HL6 A;  2LKH A;  3FZK B;  3Q9D A;  2VAS A;  4KBM B;  4PJJ A;  2E9X B;  5HCJ A;  4EYU A;  4XAX B;  4ZI2 D;  5HCM A;  2V26 A;  4U7I A;  2A72 A;  4I55 E;  4DVD A;  4QXC B;  2CHN A;  5LP6 E;  3H37 A;  1IJ5 A;  2CXF A;  3AE6 A;  4IRE A;  5ETW A;  3UT5 E;  3ZMU B;  5IWA T;  1O3X A;  4OYK A;  5HWY A;  3RI5 A;  4QXB B;  1WCR A;  5GON E;  2KSR A;  2LSY A;  5FNV E;  4H9Q C;  5FY7 A;  3VKH A;  3K3N A;  1FMV A;  2XSB A;  4IE7 A;  2XQ7 A;  1I94 T;  3RIA A;  1HF8 A;  4HN9 A;  5AQH B;  2VWA A;  3UU5 A;  3RYC E;  3ZT5 A;  2CE7 A;  1YKH B;  4PJM A;  2WP9 A;  3ANW B;  4H9N C;  4JBW F;  4TX5 A;  1MND A;  4X5T A;  1LVK A;  2N9D A;  1R8I A;  4EGW A;  5LBQ B;  3NZP A;  5CJ5 A;  5CA1 E;  3RH3 A;  4XBF B;  3RRC A;  5DJQ C;  2MOZ A;  4NUU A;  3RIU C;  4ZHQ E;  2BG9 B;  3MZK B;  4UXN B;  4U2Y A;  1UUS A;  2MYS A;  2W0G A;  2W66 A;  2RPA A;  3OYZ A;  3FZL B;  3KFW X;  4P1N A;  5HXH A;  2K3W A;  4UF0 A;  1WRD A;  2CM0 A;  4L0R A;  4UVA B;  4CXW A;  1B7T A;  5L3B B;  4CI1 B;  5LMU T;  1QLB A;  3ZMV B;  5LHI B;  5L4H A;  3AEC A;  3EVY A;  3N9M A;  2OV9 A;  4KHZ F;  3C4W A;  2NW7 A;  2RA1 A;  3KV9 A;  2J1D G;  3A7M A;  3IBP A;  4H9S E;  4U2Z A;  4X1K E;  2M6I A;  4YXD A;  1OED C;  4H9R C;  2HH7 A;  2R6G F;  4DMV A;  5M4Y A;  2SPC A;  2LSK A;  3I0Q A;  3N9O A;  3RPU A;  1N36 T;  1DU2 A;  1HR0 T;  1YKE B;  2WDQ A;  4IDO A;  5LJM A;  3UU3 A;  4UR9 A;  4LF9 T;  2WDR A;  3VRB A;  1J1J A;  2C0S A;  3G06 A;  2A9U A;  3AE8 A;  4DR4 T;  1X9B A;  2CXL A;  3TLV A;  1UX5 A;  1S35 A;  3N2K E;  3R84 B;  4BJN A;  4MFR A;  2WCA A;  2VVS A;  2Q9Q B;  2H7V C;  4QX7 B;  3NWI A;  2Q9Q D;  5HEH A;  3SWH A;  5AQQ B;  3UU4 A;  4CN4 A;  2OA5 A;  1IBL T;  3N2O A;  1M7K A;  2LJL A;  4DV3 T;  4PAG A;  3B57 A;  3RYH E;  2AE9 A;  2LT3 A;  3O1I A;  1OWA A;  4GOU A;  1LVF A;  2W62 A;  4BAY B;  2V5C A;  2ODV A;  2BVM A;  3TLU A;  3K8P C;  3OYX A;  4H63 H;  2ES0 A;  2VK9 A;  4LF5 T;  3ZT7 A;  2K48 A;  4EV6 A;  3P4Q A;  2HPL A;  2YDQ A;  2ZMA A;  5DAB A;  1N34 T;  4IE6 A;  4YTN A;  2D0T A;  1MMN A;  2I0M A;  2Q9Q C;  2IML A;  4EZH A;  3GN5 B;  4OK0 A;  4LF6 T;  2XAJ B;  4GIW A;  4IDN A;  5HXR A;  4ILU A;  2V5D A;  4LF8 T;  5EK3 A;  3FZM B;  2JMK A;  3FXE B;  4AKL A;  2NR4 A;  2KLQ A;  5HXC A;  3OKQ A;  4HWI B;  5L47 A;  4DV5 T;  4JI3 T;  4KMC A;  1J5W A;  4PJL A;  4TWF A;  2CCQ A;  4KP3 C;  5JDN A;  1WYB A;  2X0Y A;  4U74 A;  5L3D B;  2WSS V;  2JQK A;  4EYY R;  1IAP A;  3LK2 B;  4ILC A;  5LB7 B;  4HFH A;  4DND A;  5JDL A;  4KI0 F;  2HN1 A;  4DR7 T;  2MTQ A;  2VKD A;  2J4G A;  2LKG A;  2XQ8 A;  1YQ3 A;  1D1B A;  3AEE A;  1JNZ A;  5AQN B;  1S94 A;  4ZXL A;  4IE5 A;  5IHY A;  4DR2 T;  2ZLY A;  2WWU A;  2CBI A;  4LML A;  2JPF A;  2LOS A;  2LSI A;  2EHO A;  3MJX A;  2XQA A;  4I4T E;  4Z90 A;  2NP9 A;  5ABE A;  5KXJ A;  3JAF A;  1BR4 A;  5KMG P;  1OED B;  3F31 A;  3M65 A;  3SRZ A;  1GQE A;  3ZCI A;  2NTX A;  2ZM8 A;  3RX6 A;  1CHU A;  1G73 A;  3EAM A;  3QNU A;  2CLY C;  3LG7 A;  3OJA A;  4HGA A;  5F5W A;  5H6R B;  5HYA A;  3HKD E;  3SS1 A;  5JDH A;  2VQF T;  3AE4 A;  1LRZ A;  5L2L A;  4CI3 B;  3FBZ A;  3PUS A;  4X1Y E;  2KXP B;  4FI5 A;  2ZM6 T;  4WBN E;  4JEH B;  4ILA A;  2V8S V;  3S4U A;  4ERR A;  4TV9 E;  4TZ4 C;  5HEG A;  2LRL A;  2FJD A;  4OFZ A;  4IDP A;  1VCS A;  3C51 A;  4HWD A;  3BQL A;  3BQI A;  4GK0 E;  3LFM A;  3N9L A;  2Q9Q A;  4IST A;  5HEU A;  3K3Q C;  3AA6 B;  3NVO A;  3U78 A;  4B6X A;  2UUB T;  4NXN T;  1XDO A;  5LJN A;  4AKI A;  4Q25 A;  2M6B A;  3FZF B;  4YLH A;  2LM9 A;  2K5B B;  3AEA A;  4GK5 E;  4X1I E;  5JR9 A;  4TUY E;  3AA1 B;  1WFD A;  2NW9 A;  2D9D A;  5FYM A;  4ZZB A;  1SUM B;  2CA5 A;  3LSV A;  4ZI3 D;  2E9X A;  4JI7 T;  2D5U A;  3ONL C;  4L9I A;  2QRX A;  3RHW A;  2BVL A;  4EXT A;  4AQY T;  4JI1 T;  3PU8 A;  4Z91 A;  3GN5 A;  4AQF A;  2HHH T;  2JQH A;  4IHJ E;  2JQQ A;  3RF1 A;  3AEB A;  3R6N A;  4CXY A;  5IYZ E;  3P4W A;  2BBH A;  5BR8 T;  4QXH B;  3VU7 H;  3AAA B;  3ZN0 B;  5A1L A;  2DCF A;  1OED E;  1YQ4 A;  4IDQ A;  3TKL B;  4DR1 T;  2BKP A;  3OPC A;  1MNE A;  1KNZ A;  2DWK A;  1W09 A;  3LK4 2;  3L8R A;  3A5X A;  3OVU A;  4H63 V;  3RC3 A;  5L4E A;  4DR6 T;  4ZZC A;  3AEF A;  2XJ7 A;  1U5P A;  2CBJ A;  4QH1 A;  2K9A A;  4ISS A;  1W0A A;  5AQR B;  5J0Z A;  4COF A;  4JI8 T;  3C4Z A;  3UQ4 A;  5HWX A;  1HX1 B;  3UU6 A;  4LF7 T;  2X66 A;  5E0O A;  4WZX A;  1Y64 B;  2NWB A;  2WZI A;  5FKY A;  5AQS B;  2Y48 B;  3O4X E;  3O9X A;  2YOE A;  2ZM0 A;  1N33 T;  3AVR A;  4PNI A;  2D2S A;  5AQK B;  3RYI E;  2LRK A;  4TV8 E;  2X9X A;  3MAC A;  2HPJ A;  1MMA A;  2VKH A;  3ZMT B;  4P0A A;  5L3G B;  3ZC0 A;  1WYC A;  3KVA A;  5LNK A;  3AA7 B;  3A8Y C;  3RGL A;  3CX6 B;  3ESL A;  4O8S A;  3UUL A;  3FHN A;  4GKK T;  2PJQ A;  2IHR 1;  3GMI A;  4YJ3 E;  3C50 A;  3T8O A;  4OX9 T;  1KNR A;  2BS2 A;  2CPT A;  1KEY A;  3W15 B;  4ZS2 A;  4CN6 A;  2WWV A;  3DP7 A;  3O1H A;  4HE8 A;  3EUH A;  1HNZ T;  3V5S A;  3B13 A;  4B3S T;  2EHO B;  4PK6 A;  5JDM A;  1T72 A;  4I50 E;  4ADZ A;  5LG4 A;  4AKR B;  4ILB A;  1MIV A;  2QGS A;  1X79 A;  2FUP A;  1ZV4 X;  3JAE A;  3QK6 A;  4NXM T;  1T7S A;  2LLY A;  2IC6 A;  2ZM2 A;  3SFE A;  1LKX A;  4EED A;  3ZKR A;  2VVN A;  4UV8 B;  4A56 A;  2CWO A;  2X9Y A;  5EK4 A;  5AFU L;  1ZHC A;  5LGN B;  2LSG A;  5LHH B;  4F6R C;  3GWH A;  2I59 A;  2PFV A;  4LFA T;  2ACX A;  1NWM X;  2XAQ B;  1IJ6 A;  3AE1 A;  2BZB A;  2WMN A;  4JYA T;  1NEK A;  1FIO A;  3CK6 A;  3LJC A;  3T1Y T;  4PFO A;  1XMO T;  2W00 A;  4JI0 T;  2XHE B;  1IZN B;  3AAE B;  4OYJ A;  2H89 A;  3M3Z B;  3EHZ A;  3N5L A;  3PU3 A;  3ONJ A;  4C91 A;  2WU2 A;  2QA7 A;  3T1H T;  3LBX B;  3HR0 A;  5FP3 A;  4H9P C;  4YTM A;  2V7L A;  5AQM B;  3RRW A;  1IBK T;  3PUA A;  3NZQ A;  3IEE A;  5FL0 A;  4HFI A;  4LMJ A;  5L3F B;  4X66 T;  3F2E A;  3TLW A;  3EI0 A;  3PDY A;  1OED A;  2YDR A;  2P9B A;  2UXX B;  4UEL A;  1OXZ A;  4AI6 A;  2UXC T;  1AJ3 A;  2LOP A;  5LCY A;  5L3E B;  3PUW F;  4PW8 A;  5HEO A;  3L39 A;  4ZI2 C;  3Q5W A;  3AED A;  4YY3 T;  4NPP A;  4HFB A;  4B3M T;  1KFY A;  5ABF A;  4TWD A;  2LEH A;  3PV0 F;  3ZPO A;  1JNR A;  2N1G A;  3BK9 A;  2VKO A;  1US7 B;  1M62 A;  2I6H A;  4MAL A;  5LBM A;  1HCI A;  2X9W A;  3PJA J;  4WBO A;  1XNR T;  5C2T A;  2X9H A;  3N2G E;  1VOM A;  3QC9 A;  2XAG B;  3RQW A;  2F4V T;  2V1D B;  1NAF A;  1J5E T;  2QVA A;  4NUV A;  1ZP0 A;  2FBW A;  3Q5E A;  2VQE T;  2E9X C;  3P4P A;  2C5J A;  2BDE A;  2BKN A;  3L3P A;  4JI4 T;  4IIJ E;  2XUE A;  2Z6E A;  2HN2 A;  4UV9 B;  3RIU A;  1IBM T;  1FJG T;  4QH4 A;  2NOX A;  2DLR A;  3N9N A;  4UF0 B;  5L3C B;  4DV1 T;  1D1C A;  4U3C A;  4HEA A;  4QWN B;  3VRA A;  1E2A A;  1D0Y A;  2E9X D;  2LM2 A;  2J47 A;  1SHZ C;  3JAD A;  2G0U A;  4PJN A;  5C3J A;  4WYV A;  3QB5 K;  2ACZ A;  1SA0 E;  2BG9 C;  4PFP A;  2XAH B;  1N32 T;  4AKG A;  4GYR A;  4B3T T;  3EAB A;  1QUU A;  5F8P A;  2QYW A;  3RQU A;  3KV5 A;  3P50 A;  1SE7 A;  2W63 A;  3H3M A;  3AXJ A;  3HI2 A;  3DTO A;  4ZOL E;  5DQW A;  3SOL A;  4YSX A;  1MMD A;  2D0U A;  1VRB A;  4O4I E;  4YTP A;  4DR5 T;  5FXX A;  3C98 B;  4O4H E;  2XQY A;  3FXD B;  5EZY E;  3L09 A;  4CXX A;  2BS4 A;  2K24 A;  2KND A;  2H3R A;  3D0T A;  2MBG A;  3U3I A;  5JDG A;  4DUY T;  4AIU A;  4DBR A;  2V7J A;  2RP4 A;  2VB6 A;  2JRK A;  4UEM A;  3DJB A;  2IDO B;  4IGU A;  2KMF A;  4JLE A;  1XMQ T;  1HNX T;  2B76 A;  5CFB A;  5AQJ B;  3AE9 A;  2CLY B;  2YU1 A;  3AXJ B;  2XTL A;  3UUB A;  3ZEF B;  2XAF B;  3GA8 A;  2VL8 A;  1XNQ T;  3E0Z A;  2H7O A;  4U31 A;  1UCU A;  3CX7 B;  3H3A A;  1KNP A;  2E5V A;  1HTJ F;  3MXZ A;  2DWG A;  3CQX C;  3UUX B;  2XAS B;  5FVK A;  3PUX F;  4EOZ B;  3TLS A;  4ZI7 E;  3ETU A;  2UXN B;  4UIG A;  3ZYL A;  3ZSS A;  2DI4 A;  3SFD A;  4JV5 T;  5FXV A;  4OHF A;  4HFV A;  2BS3 A;  1YXR A;  3WAK A;  2YN6 A;  4HWF A;  5AQL B;  1ZKE A;  5JR9 B;  3J9X 1;  4GYS A;  3I9W A;  1WR6 A;  1Z8U A;  3CIR A;  1W9R A;  3VR9 A;  5FL1 A;  1HX8 A;  4L5G A;  3ABV A;  3RC8 A;  2FJB A;  2NTY A;  5JH7 E;  5LHG B;  3ZYM A;  5TAO A;  4YJ2 E;  2UUA T;  4IT4 A;  3PUY F;  3CX8 B;  3CKD A;  3HA4 A;  3QUJ A;  2L9Q A;  4TN7 B;  4N78 D;  3K1S A;  2FJA A;  5J2T E;  2EHO D;  2ODU A;  4J2C A;  5CB4 E;  5HXE A;  1HNW T;  1D0X A;  4PK5 A;  2XPK A;  3QB5 A;  3P4S A;  3ZT6 A;  2N2N A;  5BMV E;  2PBI A;  3MA9 A;  1U4Q A;  4QX8 B;  4IE0 A;  5KDM C;  5FVL A;  2H88 A;  3P7I A;  3RKO A;  2WZH A;  4WW0 A;  5JVD E;  3PTR B;  3LBX A;  3TLT A;  5JRE A;  4B3R T;  1KF6 A;  2X0L B;  3P8C D;  2GK9 A;  4U7Y A;  4EAH A;  2J62 A;  4QHO A;  2WB5 A;  5JTG A;  3KV6 A;  2CHO A;  4JI5 T;  3E22 E;  4C90 A;  4X62 T;  1WLX A;  5FXZ A;  3IHR A;  5HEJ A;  4DMW A;  1T8B A;  1WR0 A;  4PK4 A;  2YEV C;  4HKA A;  2NW8 A;  3AVS A;  4TWH A;  1MMG A;  1NEN A;  4O4L E;  2V6X A;  5CGM A;  5IUX A;  5JDQ A;  1EZ3 A;  3N9P A;  4U72 A;  1HS7 A;  2MAW A;  3F57 A;  4X64 T;  2WU5 A;  3AAI A;  4HFE A;  5FY1 A;  4E7Z A;  3C4X A;  5C8Y E;  4JI6 T;  4DBQ A;  3RKG A;  3HKB E;  3JC6 D;  3VHL A;  2IW5 B;  3K3O A;  2V6Y B;  3KVB A;  4I0U A;  3PUG A;  5AQU B;  4P0B A;  4YHJ A;  4GKJ T;  4YSY A;  3PUV F;  2UU9 T;  2WBL A;  4O4J E;  4O2A E;  4EEB A;  5ADX L;  4ZS3 A;  5J2U E;  2XQ3 A;  4DV0 T;  2C5I T;  5ABF B;  4F8H A;  3ONX A;  3RIF A;  2Y8D A;  2A2F X;  1UK5 A;  4AXP A;  1XWM A;  4DID B;  2VL0 A;  3KBU A;  3VR8 A;  4CI2 B;  3ZMS B;  1H7C A;  4KUM B;  3UUN A;  2C5K T;  3Q5X A;  2DHR A;  2XQ6 A;  5CA0 E;  1MIW A;  2AXD S;  4IE4 A;  5AQF B;  5F3J A;  3AE2 A;  2CWY A;  2EHO C;  5LG3 A;  1BR0 A;  3HKE E;  3KBT A;  2WM9 A;  3HKC E;  4HFD A;  4P09 A;  3UQ7 A;  5LXT E;  4LF4 T;  2KT9 A;  2JJ9 A;  2WS3 A;  4JEU B;  5LYJ E;  1V9D A;  2BG9 E;  3FBL A;  3OTO T;  3PUR A;  4IL9 A;  2DL1 A;  2XQ4 A;  2W2U A;  3UTK A;  5ABH A;  3NRY A;  3PJA A;  3FB2 A;  1I6Z A;  1D1A A;  2YK0 A;  4HFC A;  1G8X A;  4CZZ B;  5EK2 A;  3WAJ A;  2CXD A;  1HFA A;  3KV4 A;  4DO0 A;  5FMN A;  5FXW A;  2XZE A;  2YIN A;  2DNX A;  2FJE A;  4UVC B;  4CN1 A;  3B5M A;  4DV7 T;  4KX6 A;  3UUM A;  1UX4 A;  2CEA A;  3AA0 B;  5AQI B;  4QH5 A;  2CMR A;  3JCF A;  5H6Q B;  3ZYK A;  4YT0 A;  2BBJ A;  5AQG B;  4LFC T;  4ASK A;  2WMO A;  4YHH T;  3EDV A;  5JQG E;  2IIU A;  2XM1 A;  3NRX A;  3RYF E;  3AEG A;  5AQP B;  5JRC B;  3ZLI A;  4A5X A;  2WDV A;  4H9O C;  2V7M A;  2XSA A;  3N9Q A;  2XQ5 A;  4MBQ A;  3UFE A;  3VKG A;  2UUC T;  3Q5D A;  3CPZ A;  2LE8 A;  2UXD T;  1XDP A;  5KX5 E;  5LGU B;  1BR2 A;  4G2A A;  5FY0 A;  5LOV E;  5LA6 E;  1HG5 A;  2V6Y A;  1E7P A;  2IUB A;  2VUR A;  4K0U A;  3ZN1 B;  2IAK A;  4QKN A;  3IA3 A;  4U33 A;  3RLF F;  1YD8 G;  4CQI A;  1CUN A;  3Q2M A;  3LK3 B;  2CRB A;  3PE0 A;  4YSZ A;  4DUZ T;  5AQT B;  2KIN B;  1MIY A;  4MLK A;  4ZI3 C;  1UUR A;  4M1P A;  2PG8 A;  3ANW A;  4EZ4 A;  4LFB T;  4AKH A;  3I9Y A;  2B1E A;  2L8K A;  1UGO A;  2W4X A;  4HTE A;  3ZJ1 A;  2YDS A;  4KHP T;  5AQO B;  2Y6X A;  4HWC A;  3NBX X;  4JI2 T;  3UU8 A;  4DV4 T;  2XM2 A;  4UVB B;  4TNV A;  4BA9 A;  5ABG A;  2MPK A;  5LMN T;  3J7Y q;  2L3L A;  1Y01 A;  3C64 A;  4YFS A;  2W67 A;  2A3D A;  3PUQ A;  1D0Z A;  4I43 B;  5LGT B;  3BQK A;  2KWH A;  3NKZ A;  1YW0 A;  3JC6 C;  1FEW A;  1Z0P A;  3AE3 A;  3O1J A;  4AQG A;  2X0H A;  1QSD A;  2M67 A;  1E1H B;  3LDQ B;  4IDZ A;  1L0V A;  4TNW A;  3CQC B;  3EDU A;  3FZH B;  4LMK A;  1XZY A;  3WI3 A;  4JUY A;  5JDF A;  2JIW A;  4EIW A;  3PUZ F;  2IC9 A;  3IF8 B;  5DQV A;  1T98 A;  4DR3 T;  2E2A A;  2X68 A;  4V1A v;  2LHN A;  2VKJ A;  4AQF C;  2UXB T;  1BR1 A;  2WAU A;  4FJO A;  4X65 T;  4MHC A;  2JMH A;  2YU2 A;  1HG2 A;  1FMW A;  2BKO A;  2WQY A;  3CWZ B;  2XQ9 A;  2KWI B;  3P4R A;  3QOF A;  4DV2 T;  5JRC A;  4DV6 T;  4AIS A;  4ZEY A;  2OLT A;  4IL4 A;  2WY2 A;  4EB6 E;  3AE5 A;  3ETV A;  3I0O A;  5HXS A;  4XZC A;  2JQ9 A;  2X67 A;  3CML A;  3ZC1 A;  2PTF A;  4HWH A;  2BG9 A;  1W0B A;  3OBV E;  4A97 A;  3I1A A;  3KDS E;  3MK7 C;  5HAX A;  3ZST A;  4K0K T;  2YKS A;  4Z8X A;  1ZEE A;  4ANJ A;  2KZ7 B;  3ZJ2 A;  3CQG B;  3ZCJ A;  3E08 A;  5JR9 C;  2E8I A;  3V5U A;  3CVR A;  2V7I A;  4X20 E;  3X1D A;  3ZMZ B;  2LHR A;  3MKD A;  4A98 A;  2V7K A;  4WNK A;  1VCT A;  4BJM A;  2X51 A;  2LSJ A;  5AQV B;  2XY8 B;  4O2B E;  3UFG A;  3KIN B;  2W61 A;  3AE7 A;  5J1G A;  1KK7 A;  4NIQ A;  1ZOY A;  4G63 A;  4E7S A; 
#chains in the Genus database with same CATH homology
 4DID B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...