4DIDB

Crystal structure of salmonella effector n-terminal domain sopb in complex with cdc42
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
127
structure length
127
Chain Sequence
ARPEIIVLREPGATWGNYLQHQKASNHSLHNLYNLQRDLLTVAATVLGKQDPVLTSMANQMELAKVKADRPATKQEEAAAKALKKNLIELIAARTQQQDGLPAKEAHRFAAVAFRDAQVKQLNNQPW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase
molecule keywords Cell division control protein 42 homolog
publication title Structure of Salmonella Effector Protein SopB N-terminal Domain in Complex with Host Rho GTPase Cdc42.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 127
sequence length 127
ec nomenclature ec 3.1.3.-:
pdb deposition date 2012-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.450 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Cell division control protein 42 homolog 4didB01
4DIDB
chains in the Genus database with same CATH superfamily
4C91A 3RYCE 2W62A 2H3RA 3ZYLA 5EK2A 2H88A 1ZKEA 4YSYA 3RX6A 5FVKA 2IIUA 3K3OA 3RKOA 4JEUB 3AEDA 3RI5A 3ANWB 1VCTA 2CXFA 4I0UA 3AE7A 3RYFE 4TZ4C 3LG7A 2W63A 1SE7A 2CWOA 4DV5T 4ZXLA 1L0VA 4ZZCA 5AQVB 4MHCA 2VVSA 3EUHA 5J2TE 3VR9A 2PJQA 2YU2A 3GN5A 4NUVA 2BKPA 3GA8A 4DMWA 3U78A 5FMNA 3PURA 3CMLA 3BQKA 4GKKT 2CA5A 2UU9T 3KV5A 5FL1A 5HWYA 2HHHT 2OV9A 5HXSA 1SUMB 3ZYMA 2YEVC 1T7SA 4IE6A 4LF9T 1G73A 4XAXB 4EGWA 2VK9A 3NRXA 4YJ3E 4JI3T 1OEDC 2XQ9A 4NUUA 4TNWA 4YTMA 4H63H 1IBMT 1BR0A 2X51A 1IJ5A 3ZT7A 1MIVA 3KBUA 1MNDA 5JH7E 3UQ7A 3ZSSA 3B5MA 2XSBA 4LFAT 5TAOA 5KDMC 4DUZT 3AE9A 5JTGA 1HR0T 4H9SE 1KNRA 3FZMB 4JI7T 4J2CA 5CJ5A 3WAJA 1UUSA 3ZMSB 3P50A 3JAFA 3IEEA 3OYZA 2W00A 3DP7A 2K9AA 1VRBA 1UCUA 3ONLC 3ZMTB 2WMOA 2K5BB 4YSZA 3LK3B 3UUMA 2UXBT 3PDYA 4YFSA 5ABEA 5F5WA 4KHPT 4LFBT 3NRYA 2VQET 4EEBA 5HEUA 3JCFA 4IDQA 4JLEA 4CXYA 4AKLA 4IDPA 5AQOB 2YN6A 2WSSV 3NBXX 4JI8T 1LRZA 4O8SA 3FXEB 3UUBA 1KEYA 4UELA 3G06A 2K48A 4JI2T 1WR0A 4P0BA 5LJNA 4IGUA 3C4ZA 5L3GB 1D0YA 2BS3A 3C98B 1M62A 2WDQA 4LF8T 1BR1A 4PK4A 4X65T 2XQAA 4WNKA 2FBWA 2UXNB 2HPLA 3QNUA 2V6YB 5AQUB 2RPAA 3K1SA 1ZV4X 4AIUA 4QXBB 3FZFB 3C64A 4U7YA 4JBWF 2L9QA 4EB6E 3Q9DA 4DR7T 2HH7A 4FI5A 4DR6T 5FYMA 3AE5A 2NR4A 5BR8T 3UQ4A 5LBMA 1MIWA 1G8XA 3K3NA 4X66T 4QH5A 4U2ZA 4WW0A 3SOLA 3SFEA 4UF0A 2XQ8A 4LF6T 2BS2A 2A72A 4G2AA 2MPKA 3WI3A 2A2FX 2C5JA 2F4VT 3UFEA 4LMLA 2X9YA 2RP4A 5LMUT 3AEEA 2Q9QD 3B13A 3ETVA 4GK5E 3HI2A 5HCJA 4AKRB 1MIYA 3VKHA 4UIGA 2LLYA 2WB5A 3RYHE 3Q5XA 1YXRA 3L8RA 3N2GE 2YDSA 3I0QA 5LMNT 1Z8UA 2JMHA 4CXWA 5LGNB 3BQLA 4CI1B 2EHOA 1WYBA 1E2AA 5IYZE 3DJBA 5JR9A 2X9XA 2D9DA 5C3JA 3UU4A 5L47A 5ETWA 3UULA 4DV1T 5C8YE 3KINB 3VR8A 2VKJA 1FMVA 5AQSB 3QC9A 2XQYA 5ABGA 2VL0A 4C90A 2DI4A 3FB2A 4YXDA 3CQXC 4E7SA 2H89A 3ZT5A 3ZCJA 2I6HA 4PJLA 2XQ4A 3H3MA 1UURA 2VASA 2WZHA 3OYXA 5L3EB 2OA5A 1MMDA 3FBZA 2L3LA 5AQJB 3AB3B 4PFOA 5HYAA 1NAFA 2V8SV 4KX6A 5HEHA 1QSDA 5LJMA 5EK4A 2X66A 3E0ZA 4NXMT 4CN4A 3AEAA 3O4XE 4L9IA 5LGTB 4IIJE 5AFUL 3K3QC 4B6XA 2YKSA 2V7MA 4AKIA 3QOFA 1E7PA 1CHUA 3RIUA 3O9XA 3P4WA 3AE3A 2I59A 4HFEA 1KNPA 3ZCIA 3HKCE 5HAXA 4GIWA 3FZLB 3EAMA 1JNRA 3GN5B 3NZPA 2M67A 4QHOA 4QWNB 2IC9A 5JDQA 3DTOA 1QUUA 3K8PC 1Y64B 4U31A 4EZHA 2NOXA 2CCQA 3IHRA 5AQNB 4ZEYA 3PUYF 5IUXA 1US7B 4TWHA 2WBLA 5ABFA 5HXRA 3T1YT 1WRDA 2Y8DA 5LHHB 4NXNT 3MK7C 3EI0A 3PU3A 2G0UA 4DBQA 4YTPA 2LHNA 2RA1A 3S4UA 4Z90A 3TLWA 3PUXF 4X62T 2LSIA 1XDPA 5AQGB 1D0XA 4ERRA 4HFBA 3R84B 2UUBT 3BQIA 5JDGA 2KNDA 2BVLA 2DL1A 5CA0E 4IE7A 2VURA 4U33A 1X9BA 2LM2A 2LSYA 1IZNB 5JRCA 3EDUA 2E9XC 3EDVA 4HE8A 5FXXA 3AE2A 4YT0A 1KNZA 4HFIA 3JC6D 2E5LT 2KMFA 2JQ9A 2W67A 5AQTB 3MA9A 3D0TA 3CX6B 2J1DG 3J7Yq 1D0ZA 3T8OA 2XY8B 2WU2A 4K0KT 3CVRA 2MTQA 4DR1T 3UFGA 1T72A 2P9BA 2WAUA 4DR4T 1FIOA 2AXDS 3EHZA 4HWCA 4O4LE 5JDFA 4IT4A 3N9MA 4AQFA 4QX8B 3AE8A 2ACZA 4H9RC 5JDNA 5C2TA 4IHJE 4CZZB 2JJ9A 3O1HA 1J5ET 3TLUA 3RRWA 3HL6A 1D1AA 1SA0E 3O1IA 1BR2A 2BKNA 4UV8B 4LFCT 1ZEEA 3KBTA 1OEDE 4HWHA 2MOZA 4Q25A 3VRBA 2WQYA 2CEAA 3E22E 2WZIA 2BG9A 3ZJ1A 2KWHA 2ODUA 5L4HA 3A5XA 5JDHA 4L0RA 4TV8E 3KDSE 3AXJA 5A1LA 2D5UA 4X1IE 2CLYB 2LM9A 1N36T 4H9PC 3QB5K 4MBQA 2N2NA 5LOVE 4IL4A 3N5LA 2XUEA 3P7IA 1YKHB 1YQ4A 3KV4A 3UTKA 5LBQB 3N9QA 4YJ2E 3ZC0A 3F2EA 1ZHCA 4UF0B 4DV6T 3PJAJ 2QA7A 1SHZC 2C5KT 3I1AA 2QYWA 3AE6A 3VU7H 4HFCA 2CBJA 4OYKA 5BMVE 4JI6T 3LSVA 2E9XA 4X1YE 2Q9QC 2FUPA 1WFDA 3QK6A 4KHZF 1S35A 4PK6A 3ZLIA 3ZMZB 4PJNA 2EHOB 3ZJ2A 1I6ZA 3FXDB 3X1DA 4HFVA 5JR9B 3LK2B 4CXXA 2N9DA 3OVUA 2XQ3A 1VCSA 4YSXA 4O4HE 4A56A 4B3TT 4CN6A 1LVFA 1XWMA 3W15B 3RC3A 5F8PA 4LMJA 4OYJA 5IHYA 1WYCA 4L5GA 5CGMA 3UU8A 3RPUA 3KFWX 5DJQC 2V6XA 4YHJA 4UXNB 4KI0F 3GWHA 2DLRA 1IBKT 5AQFB 4LF7T 2LHRA 2I0MA 3IBPA 3C51A 2ACXA 3PUQA 5FXWA 2C5IT 4AXPA 4YHHT 2NTYA 4IREA 5HCMA 3AE4A 2K3WA 4PW8A 2QGSA 3OTOT 1HCIA 3RIFA 1JNZA 3AA6B 3QUJA 4ZS3A 2C0SA 1HG2A 4O2AE 4JUYA 4I4TE 4QXHB 5CFBA 1OEDA 3RH3A 1S94A 2V1DB 5FY1A 4WBNE 2IUBA 4F8HA 5HEGA 1H7CA 4A97A 3MJXA 2JQKA 4IDNA 1O3XA 2WDVA 2GK9A 1T98A 1HNZT 4A5XA 4EYYR 4MALA 1YKEB 4Z91A 4DIDB 2IAKA 3MKDA 1U5PA 3P4QA 1XNQT 2MYSA 2R6GF 5AQIB 1HFAA 2YINA 2EHOD 2VWAA 4GYSA 5HEOA 4U2YA 2DNXA 1FMWA 4B3MT 5LNKA 3CX8B 4PFPA 5FY7A 2LOSA 5ABFB 4PNIA 2VKDA 3ONJA 5LHGB 1YQ3A 3VHLA 1D1CA 5JREA 4HWIB 2XQ5A 3N9LA 4I50E 4M1PA 1BR4A 3HR0A 4GYRA 2ZM6T 5EZYE 2HN2A 2KSRA 2XTLA 4KMCA 5EK3A 4TX5A 2FJBA 2H7VC 3KVAA 2KXPB 3J9X1 2YDQA 2PBIA 4O2BE 2CE7A 3H37A 4HTEA 1FJGT 5LP6E 4F6RC 3TLVA 3P4PA 2LKHA 2LOPA 4UVCB 3V5UA 3ZN1B 2LSKA 5JRCB 3PV0F 2N1GA 5HXHA 3CX7B 2XASB 5HWXA 3AEFA 2BVMA 2PFVA 4ILAA 5LYJE 4ASKA 1W0AA 3KV6A 3L3PA 5L3DB 1MMAA 5FP3A 4ILCA 3JC6C 3KVBA 2DHRA 2LEHA 4DMVA 5CA1E 3FZKB 3WAKA 2WP9A 3A8YC 2JMKA 4JI5T 2XQ6A 3C4WA 2XAFB 1U4QA 2Y6XA 2IDOB 3ZC1A 5LGUB 3F31A 2LSJA 2BG9E 3PUVF 3SS1A 2BDEA 2ZM8A 3PUSA 2NTXA 1XZYA 4DUYT 4EIWA 4IDZA 4FJOA 2CRBA 3ZKRA 2NW9A 2PG8A 3CKDA 1YW0A 3ZT6A 3Q5DA 4YTNA 2HPJA 2MBGA 5AQKB 1YD8G 2XAJB 2VVNA 4KBMB 5HXEA 1J1JA 4DV2T 4EOZB 1D1BA 2XM1A 1OXZA 5DABA 1XDOA 2D0TA 3O1JA 2BG9B 3OBVE 3A7MA 3MXZA 4AKHA 2IMLA 2XHEB 2CBIA 1FEWA 2A3DA 4HGAA 2UXXB 1ZOYA 3AEGA 2A9UA 2BKOA 1Z0PA 2XPKA 2D0UA 3AXJB 2E5VA 2ZM2A 1HNWT 4P0AA 2UXCT 3RKGA 3T1HT 2E2AA 5JQGE 2LRKA 4IE4A 3UT5E 1LKXA 1XNRT 3R6NA 4JYAT 1ZP0A 3FHNA 4H9NC 2BBHA 5AQPB 4X20E 5J1GA 4EAHA 3PU8A 5J0ZA 3LBXA 2XQ7A 5F3JA 4TUYE 3RC8A 2V26A 1GQEA 1UK5A 4MLKA 4GK0E 3L39A 3JADA 2BS4A 5IWAT 2X0YA 3OKQA 3RF1A 2WS3A 2M6IA 2XAGB 4IL9A 3I9YA 4ANJA 4DNDA 3ZPOA 3AAEB 1N34T 3LDQB 2LKGA 3PE0A 2YDRA 1WLXA 2NW8A 4HN9A 2X0LB 3SWHA 4AI6A 5LB7B 2E9XB 2LT3A 4UEMA 3ONXA 4PAGA 4ZI2D 2W0GA 2XSAA 1I94T 1UX5A 2LE8A 3C4XA 5FNVE 4LF4T 5LHIB 1EZ3A 4COFA 2XZEA 5KXJA 4WYVA 3ZSTA 2XAQB 5FKYA 4QH4A 4OK0A 2YU1A 3I0OA 3AE1A 2V5CA 4ZI3D 2HN1A 3TKLB 4E7ZA 3F57A 4BJNA 4ZI7E 3AEBA 3FZHB 1B7TA 2VB6A 2AE9A 3OPCA 1VOMA 2W61A 1MMNA 3CQGB 3M65A 2IHR1 4P1NA 4AKGA 3SRZA 4AISA 4DR3T 2Z6EA 4UV9B 2ODVA 2XM2A 2CLYC 4ZZBA 4MFRA 4JI1T 1KFYA 1IJ6A 4U72A 5LG4A 2CHOA 4U3CA 5E0OA 1XMOT 2UUAT 5DQWA 1OWAA 3IF8B 4NPPA 2CMRA 1OEDB 2CXLA 2L8KA 3AVSA 5FXZA 2V7IA 4HKAA 4WBOA 2H7OA 4JI4T 4EEDA 2B76A 4OX9T 3MACA 4WZXA 3RYIE 2WWVA 3NWIA 2E9XD 2D2SA 4PK5A 3ZYKA 4PJMA 3TLSA 3CWZB 5FL0A 2J62A 3BK9A 4B3ST 5FXVA 4IE5A 3ZEFB 2WCAA 5H6QB 1UGOA 4ISTA 4I43B 1R8IA 3MZKB 4EYUA 2V7KA 4B3RT 2W66A 3SFDA 5L2LA 3ZMVB 2EHOC 4UR9A 4O4JE 2CWYA 2V7JA 5JR9C 3L09A 2W4XA 2Q9QB 4U7IA 3EABA 5JVDE 5H6RB 2J4GA 3RLFF 3NZQA 4U74A 3ANWA 4CI2B 2PTFA 4X64T 3AAIA 4DBRA 5AQHB 3P8CD 1DU2A 3HA4A 5ABHA 4DR5T 2WWUA 4N78D 3AVRA 4ILUA 5JDLA 3RRCA 4JV5T 2BZBA 3PUZF 3EVYA 2JQQA 4X1KE 3U3IA 2KZ7B 5FY0A 5LCYA 5HXCA 4YLHA 4HWDA 1NWMX 3CK6A 1V9DA 1UX4A 3FBLA 1X79A 1W0BA 4TN7B 1J5WA 2OLTA 3TLTA 4HFHA 4CN1A 2E8IA 2KT9A 4JEHB 1XMQT 4X5TA 4TV9E 3ABVA 4QKNA 2DCFA 3ESLA 5GONE 3E08A 1KF6A 3RIUC 2UXDT 2FJDA 3C50A 2ZMAA 4G63A 3ZN0B 3RQUA 4BA9A 4EZ4A 2XJ7A 2DWGA 2DWKA 4AQGA 4LF5T 2CPTA 2SPCA 2LSGA 3CPZA 4PJJA 2V7LA 4HWFA 2KWIB 5AQLB 4OHFA 1HS7A 2CM0A 3PUGA 4A98A 4XBFB 3JAEA 3QB5A 4O4IE 1M7KA 4XZCA 1LVKA 3IA3A 3N2OA 2VL8A 2K24A 3N9PA 1NEKA 4HFDA 2WU5A 4OFZA 1N33T 1HNXT 3PTRB 2Q9QA 5L4EA 4ZS2A 2MAWA 4P09A 3PJAA 3VKGA 5AQQB 4ADZA 3Q2MA 4ZOLE 4CQIA 1W9RA 2V5DA 3B57A 5CB4E 2XAHB 2M6BA 4EXTA 1WR6A 3LBXB 3AA0B 2JIWA 3V5SA 3AA7B 2B1EA 2X68A 4GOUA 4DV0T 2IW5B 1HG5A 5LXTE 4ISSA 4ZHQE 4UVAB 5M4YA 1N32T 1AJ3A 4DV7T 3AECA 1MNEA 3LFMA 3N9OA 2ES0A 4BAYB 2WY2A 4V1Av 3N9NA 1T8BA 5DQVA 3HKEE 1KK7A 5KX5E 4KP3C 4Z8XA 5LG3A 2LJLA 4IE0A 2QRXA 4KUMB 3CQCB 4HEAA 4QH1A 4YY3T 2WMNA 2V6YA 5HEJA 5L3BB 1NENA 2ZLYA 2JPFA 3PUWF 4BJMA 2CHNA 3H3AA 4ILBA 1WCRA 4TWFA 2WDRA 3HKBE 2Y48B 1HX8A 3GMIA 1CUNA 2YOEA 3RIAA 2UUCT 2KINB 5J2UE 5KMGP 1MMGA 4AQFC 4ZI2C 2VKOA 3NKZA 3UU3A 4LMKA 5AQRB 2KLQA 3ETUA 4QXCB 4TNVA 2W2UA 2WM9A 4H9OC 3UUXB 4H63V 2BBJA 3RQWA 5L3CB 5LA6E 2JQHA 2FJEA 4JI0T 2FJAA 3PUAA 4I55E 4CI3B 4ZI3C 2X0HA 2NWBA 3ZMUB 3LK42 2BG9C 4AQYT 4DR2T 2QVAA 3P4RA 4DV4T 2VKHA 2JRKA 4GKJT 4TWDA 3AA1B 4QX7B 4K0UA 2ZM0A 2X9HA 4NIQA 3UU5A 1HTJF 3NVOA 3Q5EA 3M3ZB 2VQFT 5FVLA 3I9WA 2IC6A 3KV9A 4DVDA 2NW7A 3RHWA 1IBLT 3P4SA 5AQMB 4UVBB 3OJAA 1IAPA 3RGLA 3HKDE 5JDMA 1HX1B 4EV6A 2J47A 3AAAB 3Q5WA 1Y01A 4IDOA 5L3FB 2X9WA 3UUNA 4DO0A 3UU6A 3VRAA 1HF8A 3LJCA 2NP9A 1QLBA 2X67A 3CIRA 2LRLA 2CXDA 4H9QC 4DV3T 1W09A 2YK0A 1E1HB 5ADXL 3N2KE
chains in the Genus database with same CATH topology
4DIDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DID B; 
#chains in the Genus database with same CATH topology
 4C91 A;  3RYC E;  2W62 A;  2H3R A;  3ZYL A;  5EK2 A;  2H88 A;  1ZKE A;  4YSY A;  3RX6 A;  5FVK A;  2IIU A;  3K3O A;  3RKO A;  4JEU B;  3AED A;  3RI5 A;  3ANW B;  1VCT A;  2CXF A;  4I0U A;  3AE7 A;  3RYF E;  4TZ4 C;  3LG7 A;  2W63 A;  1SE7 A;  2CWO A;  4DV5 T;  4ZXL A;  1L0V A;  4ZZC A;  5AQV B;  4MHC A;  2VVS A;  3EUH A;  5J2T E;  3VR9 A;  2PJQ A;  2YU2 A;  3GN5 A;  4NUV A;  2BKP A;  3GA8 A;  4DMW A;  3U78 A;  5FMN A;  3PUR A;  3CML A;  3BQK A;  4GKK T;  2CA5 A;  2UU9 T;  3KV5 A;  5FL1 A;  5HWY A;  2HHH T;  2OV9 A;  5HXS A;  1SUM B;  3ZYM A;  2YEV C;  1T7S A;  4IE6 A;  4LF9 T;  1G73 A;  4XAX B;  4EGW A;  2VK9 A;  3NRX A;  4YJ3 E;  4JI3 T;  1OED C;  2XQ9 A;  4NUU A;  4TNW A;  4YTM A;  4H63 H;  1IBM T;  1BR0 A;  2X51 A;  1IJ5 A;  3ZT7 A;  1MIV A;  3KBU A;  1MND A;  5JH7 E;  3UQ7 A;  3ZSS A;  3B5M A;  2XSB A;  4LFA T;  5TAO A;  5KDM C;  4DUZ T;  3AE9 A;  5JTG A;  1HR0 T;  4H9S E;  1KNR A;  3FZM B;  4JI7 T;  4J2C A;  5CJ5 A;  3WAJ A;  1UUS A;  3ZMS B;  3P50 A;  3JAF A;  3IEE A;  3OYZ A;  2W00 A;  3DP7 A;  2K9A A;  1VRB A;  1UCU A;  3ONL C;  3ZMT B;  2WMO A;  2K5B B;  4YSZ A;  3LK3 B;  3UUM A;  2UXB T;  3PDY A;  4YFS A;  5ABE A;  5F5W A;  4KHP T;  4LFB T;  3NRY A;  2VQE T;  4EEB A;  5HEU A;  3JCF A;  4IDQ A;  4JLE A;  4CXY A;  4AKL A;  4IDP A;  5AQO B;  2YN6 A;  2WSS V;  3NBX X;  4JI8 T;  1LRZ A;  4O8S A;  3FXE B;  3UUB A;  1KEY A;  4UEL A;  3G06 A;  2K48 A;  4JI2 T;  1WR0 A;  4P0B A;  5LJN A;  4IGU A;  3C4Z A;  5L3G B;  1D0Y A;  2BS3 A;  3C98 B;  1M62 A;  2WDQ A;  4LF8 T;  1BR1 A;  4PK4 A;  4X65 T;  2XQA A;  4WNK A;  2FBW A;  2UXN B;  2HPL A;  3QNU A;  2V6Y B;  5AQU B;  2RPA A;  3K1S A;  1ZV4 X;  4AIU A;  4QXB B;  3FZF B;  3C64 A;  4U7Y A;  4JBW F;  2L9Q A;  4EB6 E;  3Q9D A;  4DR7 T;  2HH7 A;  4FI5 A;  4DR6 T;  5FYM A;  3AE5 A;  2NR4 A;  5BR8 T;  3UQ4 A;  5LBM A;  1MIW A;  1G8X A;  3K3N A;  4X66 T;  4QH5 A;  4U2Z A;  4WW0 A;  3SOL A;  3SFE A;  4UF0 A;  2XQ8 A;  4LF6 T;  2BS2 A;  2A72 A;  4G2A A;  2MPK A;  3WI3 A;  2A2F X;  2C5J A;  2F4V T;  3UFE A;  4LML A;  2X9Y A;  2RP4 A;  5LMU T;  3AEE A;  2Q9Q D;  3B13 A;  3ETV A;  4GK5 E;  3HI2 A;  5HCJ A;  4AKR B;  1MIY A;  3VKH A;  4UIG A;  2LLY A;  2WB5 A;  3RYH E;  3Q5X A;  1YXR A;  3L8R A;  3N2G E;  2YDS A;  3I0Q A;  5LMN T;  1Z8U A;  2JMH A;  4CXW A;  5LGN B;  3BQL A;  4CI1 B;  2EHO A;  1WYB A;  1E2A A;  5IYZ E;  3DJB A;  5JR9 A;  2X9X A;  2D9D A;  5C3J A;  3UU4 A;  5L47 A;  5ETW A;  3UUL A;  4DV1 T;  5C8Y E;  3KIN B;  3VR8 A;  2VKJ A;  1FMV A;  5AQS B;  3QC9 A;  2XQY A;  5ABG A;  2VL0 A;  4C90 A;  2DI4 A;  3FB2 A;  4YXD A;  3CQX C;  4E7S A;  2H89 A;  3ZT5 A;  3ZCJ A;  2I6H A;  4PJL A;  2XQ4 A;  3H3M A;  1UUR A;  2VAS A;  2WZH A;  3OYX A;  5L3E B;  2OA5 A;  1MMD A;  3FBZ A;  2L3L A;  5AQJ B;  3AB3 B;  4PFO A;  5HYA A;  1NAF A;  2V8S V;  4KX6 A;  5HEH A;  1QSD A;  5LJM A;  5EK4 A;  2X66 A;  3E0Z A;  4NXM T;  4CN4 A;  3AEA A;  3O4X E;  4L9I A;  5LGT B;  4IIJ E;  5AFU L;  3K3Q C;  4B6X A;  2YKS A;  2V7M A;  4AKI A;  3QOF A;  1E7P A;  1CHU A;  3RIU A;  3O9X A;  3P4W A;  3AE3 A;  2I59 A;  4HFE A;  1KNP A;  3ZCI A;  3HKC E;  5HAX A;  4GIW A;  3FZL B;  3EAM A;  1JNR A;  3GN5 B;  3NZP A;  2M67 A;  4QHO A;  4QWN B;  2IC9 A;  5JDQ A;  3DTO A;  1QUU A;  3K8P C;  1Y64 B;  4U31 A;  4EZH A;  2NOX A;  2CCQ A;  3IHR A;  5AQN B;  4ZEY A;  3PUY F;  5IUX A;  1US7 B;  4TWH A;  2WBL A;  5ABF A;  5HXR A;  3T1Y T;  1WRD A;  2Y8D A;  5LHH B;  4NXN T;  3MK7 C;  3EI0 A;  3PU3 A;  2G0U A;  4DBQ A;  4YTP A;  2LHN A;  2RA1 A;  3S4U A;  4Z90 A;  3TLW A;  3PUX F;  4X62 T;  2LSI A;  1XDP A;  5AQG B;  1D0X A;  4ERR A;  4HFB A;  3R84 B;  2UUB T;  3BQI A;  5JDG A;  2KND A;  2BVL A;  2DL1 A;  5CA0 E;  4IE7 A;  2VUR A;  4U33 A;  1X9B A;  2LM2 A;  2LSY A;  1IZN B;  5JRC A;  3EDU A;  2E9X C;  3EDV A;  4HE8 A;  5FXX A;  3AE2 A;  4YT0 A;  1KNZ A;  4HFI A;  3JC6 D;  2E5L T;  2KMF A;  2JQ9 A;  2W67 A;  5AQT B;  3MA9 A;  3D0T A;  3CX6 B;  2J1D G;  3J7Y q;  1D0Z A;  3T8O A;  2XY8 B;  2WU2 A;  4K0K T;  3CVR A;  2MTQ A;  4DR1 T;  3UFG A;  1T72 A;  2P9B A;  2WAU A;  4DR4 T;  1FIO A;  2AXD S;  3EHZ A;  4HWC A;  4O4L E;  5JDF A;  4IT4 A;  3N9M A;  4AQF A;  4QX8 B;  3AE8 A;  2ACZ A;  4H9R C;  5JDN A;  5C2T A;  4IHJ E;  4CZZ B;  2JJ9 A;  3O1H A;  1J5E T;  3TLU A;  3RRW A;  3HL6 A;  1D1A A;  1SA0 E;  3O1I A;  1BR2 A;  2BKN A;  4UV8 B;  4LFC T;  1ZEE A;  3KBT A;  1OED E;  4HWH A;  2MOZ A;  4Q25 A;  3VRB A;  2WQY A;  2CEA A;  3E22 E;  2WZI A;  2BG9 A;  3ZJ1 A;  2KWH A;  2ODU A;  5L4H A;  3A5X A;  5JDH A;  4L0R A;  4TV8 E;  3KDS E;  3AXJ A;  5A1L A;  2D5U A;  4X1I E;  2CLY B;  2LM9 A;  1N36 T;  4H9P C;  3QB5 K;  4MBQ A;  2N2N A;  5LOV E;  4IL4 A;  3N5L A;  2XUE A;  3P7I A;  1YKH B;  1YQ4 A;  3KV4 A;  3UTK A;  5LBQ B;  3N9Q A;  4YJ2 E;  3ZC0 A;  3F2E A;  1ZHC A;  4UF0 B;  4DV6 T;  3PJA J;  2QA7 A;  1SHZ C;  2C5K T;  3I1A A;  2QYW A;  3AE6 A;  3VU7 H;  4HFC A;  2CBJ A;  4OYK A;  5BMV E;  4JI6 T;  3LSV A;  2E9X A;  4X1Y E;  2Q9Q C;  2FUP A;  1WFD A;  3QK6 A;  4KHZ F;  1S35 A;  4PK6 A;  3ZLI A;  3ZMZ B;  4PJN A;  2EHO B;  3ZJ2 A;  1I6Z A;  3FXD B;  3X1D A;  4HFV A;  5JR9 B;  3LK2 B;  4CXX A;  2N9D A;  3OVU A;  2XQ3 A;  1VCS A;  4YSX A;  4O4H E;  4A56 A;  4B3T T;  4CN6 A;  1LVF A;  1XWM A;  3W15 B;  3RC3 A;  5F8P A;  4LMJ A;  4OYJ A;  5IHY A;  1WYC A;  4L5G A;  5CGM A;  3UU8 A;  3RPU A;  3KFW X;  5DJQ C;  2V6X A;  4YHJ A;  4UXN B;  4KI0 F;  3GWH A;  2DLR A;  1IBK T;  5AQF B;  4LF7 T;  2LHR A;  2I0M A;  3IBP A;  3C51 A;  2ACX A;  3PUQ A;  5FXW A;  2C5I T;  4AXP A;  4YHH T;  2NTY A;  4IRE A;  5HCM A;  3AE4 A;  2K3W A;  4PW8 A;  2QGS A;  3OTO T;  1HCI A;  3RIF A;  1JNZ A;  3AA6 B;  3QUJ A;  4ZS3 A;  2C0S A;  1HG2 A;  4O2A E;  4JUY A;  4I4T E;  4QXH B;  5CFB A;  1OED A;  3RH3 A;  1S94 A;  2V1D B;  5FY1 A;  4WBN E;  2IUB A;  4F8H A;  5HEG A;  1H7C A;  4A97 A;  3MJX A;  2JQK A;  4IDN A;  1O3X A;  2WDV A;  2GK9 A;  1T98 A;  1HNZ T;  4A5X A;  4EYY R;  4MAL A;  1YKE B;  4Z91 A;  4DID B;  2IAK A;  3MKD A;  1U5P A;  3P4Q A;  1XNQ T;  2MYS A;  2R6G F;  5AQI B;  1HFA A;  2YIN A;  2EHO D;  2VWA A;  4GYS A;  5HEO A;  4U2Y A;  2DNX A;  1FMW A;  4B3M T;  5LNK A;  3CX8 B;  4PFP A;  5FY7 A;  2LOS A;  5ABF B;  4PNI A;  2VKD A;  3ONJ A;  5LHG B;  1YQ3 A;  3VHL A;  1D1C A;  5JRE A;  4HWI B;  2XQ5 A;  3N9L A;  4I50 E;  4M1P A;  1BR4 A;  3HR0 A;  4GYR A;  2ZM6 T;  5EZY E;  2HN2 A;  2KSR A;  2XTL A;  4KMC A;  5EK3 A;  4TX5 A;  2FJB A;  2H7V C;  3KVA A;  2KXP B;  3J9X 1;  2YDQ A;  2PBI A;  4O2B E;  2CE7 A;  3H37 A;  4HTE A;  1FJG T;  5LP6 E;  4F6R C;  3TLV A;  3P4P A;  2LKH A;  2LOP A;  4UVC B;  3V5U A;  3ZN1 B;  2LSK A;  5JRC B;  3PV0 F;  2N1G A;  5HXH A;  3CX7 B;  2XAS B;  5HWX A;  3AEF A;  2BVM A;  2PFV A;  4ILA A;  5LYJ E;  4ASK A;  1W0A A;  3KV6 A;  3L3P A;  5L3D B;  1MMA A;  5FP3 A;  4ILC A;  3JC6 C;  3KVB A;  2DHR A;  2LEH A;  4DMV A;  5CA1 E;  3FZK B;  3WAK A;  2WP9 A;  3A8Y C;  2JMK A;  4JI5 T;  2XQ6 A;  3C4W A;  2XAF B;  1U4Q A;  2Y6X A;  2IDO B;  3ZC1 A;  5LGU B;  3F31 A;  2LSJ A;  2BG9 E;  3PUV F;  3SS1 A;  2BDE A;  2ZM8 A;  3PUS A;  2NTX A;  1XZY A;  4DUY T;  4EIW A;  4IDZ A;  4FJO A;  2CRB A;  3ZKR A;  2NW9 A;  2PG8 A;  3CKD A;  1YW0 A;  3ZT6 A;  3Q5D A;  4YTN A;  2HPJ A;  2MBG A;  5AQK B;  1YD8 G;  2XAJ B;  2VVN A;  4KBM B;  5HXE A;  1J1J A;  4DV2 T;  4EOZ B;  1D1B A;  2XM1 A;  1OXZ A;  5DAB A;  1XDO A;  2D0T A;  3O1J A;  2BG9 B;  3OBV E;  3A7M A;  3MXZ A;  4AKH A;  2IML A;  2XHE B;  2CBI A;  1FEW A;  2A3D A;  4HGA A;  2UXX B;  1ZOY A;  3AEG A;  2A9U A;  2BKO A;  1Z0P A;  2XPK A;  2D0U A;  3AXJ B;  2E5V A;  2ZM2 A;  1HNW T;  4P0A A;  2UXC T;  3RKG A;  3T1H T;  2E2A A;  5JQG E;  2LRK A;  4IE4 A;  3UT5 E;  1LKX A;  1XNR T;  3R6N A;  4JYA T;  1ZP0 A;  3FHN A;  4H9N C;  2BBH A;  5AQP B;  4X20 E;  5J1G A;  4EAH A;  3PU8 A;  5J0Z A;  3LBX A;  2XQ7 A;  5F3J A;  4TUY E;  3RC8 A;  2V26 A;  1GQE A;  1UK5 A;  4MLK A;  4GK0 E;  3L39 A;  3JAD A;  2BS4 A;  5IWA T;  2X0Y A;  3OKQ A;  3RF1 A;  2WS3 A;  2M6I A;  2XAG B;  4IL9 A;  3I9Y A;  4ANJ A;  4DND A;  3ZPO A;  3AAE B;  1N34 T;  3LDQ B;  2LKG A;  3PE0 A;  2YDR A;  1WLX A;  2NW8 A;  4HN9 A;  2X0L B;  3SWH A;  4AI6 A;  5LB7 B;  2E9X B;  2LT3 A;  4UEM A;  3ONX A;  4PAG A;  4ZI2 D;  2W0G A;  2XSA A;  1I94 T;  1UX5 A;  2LE8 A;  3C4X A;  5FNV E;  4LF4 T;  5LHI B;  1EZ3 A;  4COF A;  2XZE A;  5KXJ A;  4WYV A;  3ZST A;  2XAQ B;  5FKY A;  4QH4 A;  4OK0 A;  2YU1 A;  3I0O A;  3AE1 A;  2V5C A;  4ZI3 D;  2HN1 A;  3TKL B;  4E7Z A;  3F57 A;  4BJN A;  4ZI7 E;  3AEB A;  3FZH B;  1B7T A;  2VB6 A;  2AE9 A;  3OPC A;  1VOM A;  2W61 A;  1MMN A;  3CQG B;  3M65 A;  2IHR 1;  4P1N A;  4AKG A;  3SRZ A;  4AIS A;  4DR3 T;  2Z6E A;  4UV9 B;  2ODV A;  2XM2 A;  2CLY C;  4ZZB A;  4MFR A;  4JI1 T;  1KFY A;  1IJ6 A;  4U72 A;  5LG4 A;  2CHO A;  4U3C A;  5E0O A;  1XMO T;  2UUA T;  5DQW A;  1OWA A;  3IF8 B;  4NPP A;  2CMR A;  1OED B;  2CXL A;  2L8K A;  3AVS A;  5FXZ A;  2V7I A;  4HKA A;  4WBO A;  2H7O A;  4JI4 T;  4EED A;  2B76 A;  4OX9 T;  3MAC A;  4WZX A;  3RYI E;  2WWV A;  3NWI A;  2E9X D;  2D2S A;  4PK5 A;  3ZYK A;  4PJM A;  3TLS A;  3CWZ B;  5FL0 A;  2J62 A;  3BK9 A;  4B3S T;  5FXV A;  4IE5 A;  3ZEF B;  2WCA A;  5H6Q B;  1UGO A;  4IST A;  4I43 B;  1R8I A;  3MZK B;  4EYU A;  2V7K A;  4B3R T;  2W66 A;  3SFD A;  5L2L A;  3ZMV B;  2EHO C;  4UR9 A;  4O4J E;  2CWY A;  2V7J A;  5JR9 C;  3L09 A;  2W4X A;  2Q9Q B;  4U7I A;  3EAB A;  5JVD E;  5H6R B;  2J4G A;  3RLF F;  3NZQ A;  4U74 A;  3ANW A;  4CI2 B;  2PTF A;  4X64 T;  3AAI A;  4DBR A;  5AQH B;  3P8C D;  1DU2 A;  3HA4 A;  5ABH A;  4DR5 T;  2WWU A;  4N78 D;  3AVR A;  4ILU A;  5JDL A;  3RRC A;  4JV5 T;  2BZB A;  3PUZ F;  3EVY A;  2JQQ A;  4X1K E;  3U3I A;  2KZ7 B;  5FY0 A;  5LCY A;  5HXC A;  4YLH A;  4HWD A;  1NWM X;  3CK6 A;  1V9D A;  1UX4 A;  3FBL A;  1X79 A;  1W0B A;  4TN7 B;  1J5W A;  2OLT A;  3TLT A;  4HFH A;  4CN1 A;  2E8I A;  2KT9 A;  4JEH B;  1XMQ T;  4X5T A;  4TV9 E;  3ABV A;  4QKN A;  2DCF A;  3ESL A;  5GON E;  3E08 A;  1KF6 A;  3RIU C;  2UXD T;  2FJD A;  3C50 A;  2ZMA A;  4G63 A;  3ZN0 B;  3RQU A;  4BA9 A;  4EZ4 A;  2XJ7 A;  2DWG A;  2DWK A;  4AQG A;  4LF5 T;  2CPT A;  2SPC A;  2LSG A;  3CPZ A;  4PJJ A;  2V7L A;  4HWF A;  2KWI B;  5AQL B;  4OHF A;  1HS7 A;  2CM0 A;  3PUG A;  4A98 A;  4XBF B;  3JAE A;  3QB5 A;  4O4I E;  1M7K A;  4XZC A;  1LVK A;  3IA3 A;  3N2O A;  2VL8 A;  2K24 A;  3N9P A;  1NEK A;  4HFD A;  2WU5 A;  4OFZ A;  1N33 T;  1HNX T;  3PTR B;  2Q9Q A;  5L4E A;  4ZS2 A;  2MAW A;  4P09 A;  3PJA A;  3VKG A;  5AQQ B;  4ADZ A;  3Q2M A;  4ZOL E;  4CQI A;  1W9R A;  2V5D A;  3B57 A;  5CB4 E;  2XAH B;  2M6B A;  4EXT A;  1WR6 A;  3LBX B;  3AA0 B;  2JIW A;  3V5S A;  3AA7 B;  2B1E A;  2X68 A;  4GOU A;  4DV0 T;  2IW5 B;  1HG5 A;  5LXT E;  4ISS A;  4ZHQ E;  4UVA B;  5M4Y A;  1N32 T;  1AJ3 A;  4DV7 T;  3AEC A;  1MNE A;  3LFM A;  3N9O A;  2ES0 A;  4BAY B;  2WY2 A;  4V1A v;  3N9N A;  1T8B A;  5DQV A;  3HKE E;  1KK7 A;  5KX5 E;  4KP3 C;  4Z8X A;  5LG3 A;  2LJL A;  4IE0 A;  2QRX A;  4KUM B;  3CQC B;  4HEA A;  4QH1 A;  4YY3 T;  2WMN A;  2V6Y A;  5HEJ A;  5L3B B;  1NEN A;  2ZLY A;  2JPF A;  3PUW F;  4BJM A;  2CHN A;  3H3A A;  4ILB A;  1WCR A;  4TWF A;  2WDR A;  3HKB E;  2Y48 B;  1HX8 A;  3GMI A;  1CUN A;  2YOE A;  3RIA A;  2UUC T;  2KIN B;  5J2U E;  5KMG P;  1MMG A;  4AQF C;  4ZI2 C;  2VKO A;  3NKZ A;  3UU3 A;  4LMK A;  5AQR B;  2KLQ A;  3ETU A;  4QXC B;  4TNV A;  2W2U A;  2WM9 A;  4H9O C;  3UUX B;  4H63 V;  2BBJ A;  3RQW A;  5L3C B;  5LA6 E;  2JQH A;  2FJE A;  4JI0 T;  2FJA A;  3PUA A;  4I55 E;  4CI3 B;  4ZI3 C;  2X0H A;  2NWB A;  3ZMU B;  3LK4 2;  2BG9 C;  4AQY T;  4DR2 T;  2QVA A;  3P4R A;  4DV4 T;  2VKH A;  2JRK A;  4GKJ T;  4TWD A;  3AA1 B;  4QX7 B;  4K0U A;  2ZM0 A;  2X9H A;  4NIQ A;  3UU5 A;  1HTJ F;  3NVO A;  3Q5E A;  3M3Z B;  2VQF T;  5FVL A;  3I9W A;  2IC6 A;  3KV9 A;  4DVD A;  2NW7 A;  3RHW A;  1IBL T;  3P4S A;  5AQM B;  4UVB B;  3OJA A;  1IAP A;  3RGL A;  3HKD E;  5JDM A;  1HX1 B;  4EV6 A;  2J47 A;  3AAA B;  3Q5W A;  1Y01 A;  4IDO A;  5L3F B;  2X9W A;  3UUN A;  4DO0 A;  3UU6 A;  3VRA A;  1HF8 A;  3LJC A;  2NP9 A;  1QLB A;  2X67 A;  3CIR A;  2LRL A;  2CXD A;  4H9Q C;  4DV3 T;  1W09 A;  2YK0 A;  1E1H B;  5ADX L;  3N2K E; 
#chains in the Genus database with same CATH homology
 4DID B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...