4DIDB

Crystal structure of salmonella effector n-terminal domain sopb in complex with cdc42
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
127
structure length
127
Chain Sequence
ARPEIIVLREPGATWGNYLQHQKASNHSLHNLYNLQRDLLTVAATVLGKQDPVLTSMANQMELAKVKADRPATKQEEAAAKALKKNLIELIAARTQQQDGLPAKEAHRFAAVAFRDAQVKQLNNQPW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Salmonella Effector Protein SopB N-terminal Domain in Complex with Host Rho GTPase Cdc42.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase
molecule keywords Cell division control protein 42 homolog
total genus 44
structure length 127
sequence length 127
ec nomenclature ec 3.1.3.-:
pdb deposition date 2012-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.450 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Cell division control protein 42 homolog 4didB01
4DIDB
chains in the Genus database with same CATH superfamily
4PFPA 2WWVA 3O1IA 4U74A 4UV8B 4P0AA 5FL0A 4YHHT 2X67A 2X0YA 3BK9A 4IDZA 4U31A 4EXTA 3LK3B 3UU4A 4DV3T 3C4ZA 1SE7A 4HTEA 4JEHB 3N9QA 4L5GA 2BS4A 4L0RA 3EVYA 3KV9A 4O4LE 5FMNA 3VR9A 4HWHA 4AQFA 2HN2A 4DVDA 2UUAT 2KMFA 1BR1A 5TAOA 4IE5A 4X65T 4IREA 1BR4A 4I50E 4QH5A 2HH7A 3H3MA 1CHUA 3PDYA 3SWHA 2WP9A 3GMIA 4GYRA 4EZ4A 1FMVA 3AEDA 3AE3A 2BS2A 1T8BA 2X0HA 5H6QB 1OWAA 4OX9T 3ZC1A 1B7TA 3K1SA 2G0UA 3KBUA 1MMGA 3MA9A 1X9BA 3LSVA 3CX7B 3O9XA 3RI5A 5C3JA 2N2NA 2ODUA 3Q9DA 3RX6A 4PK6A 2CA5A 4HFDA 4EIWA 2XQ5A 3AA6B 4B3ST 2HN1A 2KSRA 5AQJB 1D0YA 4HE8A 2WCAA 3HKEE 2BZBA 2RPAA 2E9XB 3A7MA 4H63H 4UR9A 3ZSSA 2YN6A 2E5LT 3RYFE 5ABFB 2XSAA 5HEOA 3SS1A 3VRAA 3CKDA 2WM9A 3AXJA 5L3GB 3HL6A 4TV9E 5LG4A 2VQFT 2HHHT 2D5UA 2LRLA 4GYSA 4ISTA 3Q5XA 3ETVA 4UVCB 4UXNB 1ZP0A 5FXWA 2K9AA 2X68A 4X66T 1MIVA 1YQ3A 1S94A 3C64A 5HXSA 4JI4T 1FMWA 4Z90A 3WAJA 1E1HB 5F5WA 3I0QA 5CGMA 1YQ4A 2WSSV 3HA4A 3LDQB 4ZOLE 2W00A 2NTYA 1VRBA 2CCQA 5EZYE 4DBRA 2WQYA 4IIJE 3N2KE 1BR2A 2Y48B 3QC9A 3TKLB 3LBXB 3TLTA 3MKDA 2BVLA 2BKOA 2XM1A 4IT4A 3TLVA 4ZHQE 3KBTA 3NRXA 3AVSA 3CQXC 2SPCA 1D0ZA 1ZEEA 2XQYA 4I0UA 3AE5A 4OFZA 4LFAT 2ZM6T 2WS3A 1XNRT 4LMJA 3ZT7A 2C0SA 2I6HA 3ZCIA 3ANWB 4I43B 4ZI3C 1ZHCA 1MMNA 5CB4E 3ZT6A 4JBWF 1M7KA 1SA0E 4YLHA 5HWYA 3JAEA 2ZM0A 3FZHB 4U7YA 2XAGB 5LBMA 5C8YE 3VU7H 4AKHA 5BR8T 3OKQA 3IF8B 4AISA 3ABVA 2KXPB 1MIYA 5A1LA 4JI6T 3CPZA 4TNWA 4KUMB 4X5TA 2DLRA 2VURA 2WDRA 3WI3A 4K0KT 4UEMA 3RYCE 5FY0A 5LG3A 3AE8A 3NVOA 3RGLA 2XAJB 4QH1A 3WAKA 3C4XA 2WMNA 3F31A 4DV4T 1X79A 4ILUA 4YHJA 2V7JA 4O8SA 1N36T 5AFUL 1HTJF 1E7PA 3HKCE 4DV1T 1HR0T 4TWFA 4M1PA 4KMCA 3CX6B 4GK0E 5L4HA 3U78A 2E5VA 3AAIA 1YW0A 3AAAB 3C98B 3RRWA 1YKHB 4EV6A 4G2AA 3T8OA 3NZPA 3F57A 5HXEA 3AEBA 1J1JA 3BQIA 2DCFA 4KP3C 3AE1A 3H37A 4IDQA 2LSYA 1HCIA 3LK42 4GIWA 4HFEA 3N9PA 4ZS2A 5AQHB 2BBJA 4BJMA 4FI5A 2UXBT 2JPFA 3P4PA 2CBIA 3MK7C 3Q5EA 4PJMA 2H7VC 4CN4A 1FJGT 5FL1A 3EDUA 1HS7A 1KFYA 1YD8G 2QGSA 2H89A 1XDPA 3EDVA 2JQHA 4A98A 2LLYA 2OLTA 3Q5DA 2CE7A 5FKYA 4EEBA 3PUSA 3ZT5A 3VKHA 1YKEB 2RA1A 4Z8XA 3O1HA 4X1IE 4YTNA 2Q9QA 5L3DB 2CWYA 2Y8DA 3AEGA 4ILCA 5LNKA 3AAEB 3N9LA 3TLUA 1W9RA 3I1AA 2ES0A 2WU5A 4UVBB 1NAFA 5ABEA 2XM2A 1HG2A 3CQGB 3ZCJA 5CFBA 1MMDA 2WDVA 4J2CA 3UQ4A 3TLWA 3OTOT 2YINA 3FZKB 3J7Yq 2OA5A 2V7IA 3O4XE 3ONJA 4BA9A 1IBMT 4DR2T 2VKJA 4WYVA 2D0UA 1T7SA 4O2BE 4EOZB 5JVDE 1I6ZA 2WBLA 3P4RA 4LFCT 5JQGE 4I4TE 3RKOA 4ILAA 4CI3B 4CQIA 2XTLA 1JNRA 3P8CD 2KZ7B 2YOEA 5FP3A 3CK6A 5ETWA 1HG5A 2D2SA 4NPPA 4IL4A 5KXJA 2WWUA 2XY8B 1IAPA 2H3RA 3CQCB 2UXNB 3ESLA 3UUNA 5JDQA 1XMQT 4QX7B 2ACXA 2A2FX 4JUYA 2YK0A 5HCJA 4XBFB 2V6YA 3RIUA 5LGNB 3N2GE 3PV0F 2W2UA 4U72A 4AQFC 2DL1A 2X66A 2AXDS 1IZNB 4OHFA 4C90A 4DV7T 3NBXX 1T72A 1LVFA 1XWMA 5KX5E 4QX8B 4ZI3D 3AEAA 5AQVB 4AIUA 1VCTA 2K5BB 4JEUB 2LE8A 5AQKB 4OYKA 5JR9C 5F3JA 4IE4A 4CXWA 1NEKA 4X1KE 4JV5T 5AQSB 2A3DA 2A72A 3L3PA 1HNXT 3N9NA 4PJJA 1OEDC 4O4IE 3AE6A 1WR0A 3KV5A 2WB5A 3DP7A 5C2TA 1L0VA 5LGUB 2XASB 5AQFB 2ZM2A 5LGTB 2L8KA 2DNXA 1Z8UA 3B13A 4I55E 4ZZBA 3OYXA 5L2LA 1YXRA 2DWKA 2FJDA 1W0BA 3JCFA 3L09A 4U2ZA 1WYBA 4KHZF 4EGWA 1HNWT 3CIRA 3AA0B 2W61A 3K3OA 5JDFA 2W66A 3JAFA 4PAGA 3V5SA 3ZN1B 5HYAA 2K3WA 1H7CA 3RC3A 2CBJA 1M62A 2IW5B 3OYZA 4H9RC 5CJ5A 4YJ2E 3K3QC 2VKDA 1Z0PA 3PE0A 3QK6A 1OEDE 2EHOC 2XSBA 3DTOA 4MBQA 4AQGA 5LMUT 5HEGA 2BKPA 2K24A 3MZKB 5AQNB 3LG7A 3RF1A 4DR3T 1IBLT 2CXFA 3ZYLA 3FXEB 4LMLA 2BKNA 1UURA 4TZ4C 2LSGA 2JJ9A 4WZXA 5KDMC 4OK0A 4ZZCA 4HFIA 4PK4A 3F2EA 4JI8T 3PURA 5AQOB 1MIWA 4JI7T 4MALA 3I9WA 3RIUC 4CN6A 1SUMB 2V6YB 3R84B 3JADA 4N78D 1UGOA 4NUUA 4CXXA 2LRKA 3OVUA 3ZMTB 1AJ3A 4QXCB 4YT0A 5JDMA 2IDOB 3ANWA 4DMWA 2KWIB 3IBPA 3UQ7A 4PW8A 2UXXB 3IHRA 1EZ3A 2PBIA 5CA1E 5ABFA 2M6BA 2QVAA 3ONXA 2XAQB 3CX8B 2WZIA 4IDOA 2W0GA 1W0AA 3FB2A 4TN7B 3RIAA 3AE2A 2B1EA 3JC6D 2MAWA 4HFBA 3JC6C 4P09A 2KWHA 5HEUA 3VKGA 2WMOA 2WDQA 4YJ3E 4WNKA 4X20E 1ZV4X 3UFGA 5EK2A 3QUJA 4UIGA 1UUSA 2IAKA 2ODVA 4A97A 3T1HT 2LKHA 3RC8A 1UCUA 5HAXA 4H63V 3R6NA 2A9UA 1Y01A 3EABA 2PJQA 2IC6A 2BG9E 3GN5B 2NW9A 2L3LA 5LHGB 5M4YA 1BR0A 5FXZA 2M67A 4P1NA 3BQLA 4LF7T 1LKXA 4NXNT 3C51A 1S35A 3RIFA 5KMGP 1HX1B 3KV4A 2XJ7A 4V1Av 2VVSA 2J62A 3ZYKA 5LYJE 4DUYT 1W09A 3FHNA 3FXDB 3V5UA 2E9XA 3SFEA 3ZMZB 2CM0A 4JI2T 1QUUA 3E08A 3VR8A 2CWOA 5LOVE 2W62A 4ZI2C 4HEAA 2V8SV 4TWHA 3UU6A 4A5XA 3AEFA 3KVAA 2V5DA 4IGUA 2WZHA 3ONLC 3RPUA 4EEDA 3AE9A 4IE7A 3ZLIA 2JQ9A 5JH7E 1KNRA 1J5WA 2VWAA 3RYHE 4DR6T 3RH3A 4DUZT 2V1DB 2YDSA 2J4GA 2VK9A 2LHNA 4E7ZA 4UF0A 3BQKA 1QSDA 4YTMA 4DR1T 3J9X1 2IC9A 4CI1B 5ABGA 4QWNB 1US7B 3QB5A 3NWIA 4DV0T 5JRCB 2CMRA 4LMKA 2MYSA 3PUVF 2CHNA 2V7LA 2YU2A 3FBLA 3FZMB 4H9OC 2EHOB 1D1CA 4HWCA 4TNVA 4XZCA 4YTPA 2LKGA 5LCYA 4HN9A 4X1YE 4LF8T 2JMKA 4LF6T 3B57A 3PUAA 3DJBA 2VKOA 5AQMB 3RYIE 5JREA 4B3MT 4JI3T 4DR7T 2VB6A 2V5CA 4AKIA 4KHPT 2LSIA 2FBWA 2L9QA 2MOZA 3HKDE 5AQQB 3C50A 3PJAJ 3PU8A 3PUZF 5L3CB 4YXDA 4PFOA 2EHOD 4JYAT 4CZZB 2H88A 3UTKA 3ZMUB 3PUYF 2VL0A 4DMVA 4B3RT 2X9YA 3K3NA 2E9XD 3Q5WA 3RQUA 2YKSA 2E9XC 2JMHA 2XQ3A 5JTGA 2VL8A 3S4UA 4Z91A 4AKRB 3PUXF 2NWBA 4GKKT 2CXLA 1O3XA 4K0UA 2WAUA 3I0OA 1HF8A 2IMLA 2C5KT 3PUQA 5AQPB 2W63A 2IUBA 3ZKRA 5LJMA 4LF5T 2LHRA 4YSZA 3PUGA 3SRZA 3O1JA 1D1AA 2BVMA 5FY7A 4O2AE 5LHHB 4YY3T 5LMNT 4AI6A 2LOPA 5ADXL 4CN1A 2LSKA 1Y64B 3E22E 4KX6A 4HWFA 2V7MA 4HKAA 4ASKA 4TWDA 2LM9A 4F6RC 4TUYE 1OXZA 1HX8A 2XQ6A 1ZKEA 4IHJE 4IE0A 2DHRA 2B76A 3UUBA 5JDHA 2XUEA 5J1GA 4EYYR 4YSXA 1N33T 2UXCT 3QOFA 4AKLA 3A8YC 5AQUB 4IDNA 3IA3A 4JLEA 2HPLA 2Z6EA 3MXZA 3X1DA 3ZC0A 5FXVA 5HEHA 3L39A 3RLFF 3AXJB 1G8XA 1MNEA 2J1DG 2NR4A 2J47A 2VKHA 2Q9QC 4EAHA 2XQ9A 3EHZA 3LK2B 4G63A 2BBHA 3U3IA 4PJLA 1MNDA 4BJNA 1I94T 4B3TT 2ZLYA 2NOXA 2W67A 4IE6A 3LBXA 1SHZC 2UXDT 2YDQA 4WBNE 2VVNA 4U2YA 2C5IT 3KV6A 2V7KA 4PNIA 2ACZA 3NZQA 4GK5E 2CHOA 2CXDA 5GONE 2CLYC 4FJOA 2V26A 3ZN0B 5L47A 4H9NC 2NW7A 5IYZE 3I9YA 2YEVC 1XMOT 4UV9B 4DR5T 1UK5A 5L3FB 1VOMA 3AE4A 3P4SA 5DJQC 5FVKA 4DBQA 5ABHA 5IUXA 4YSYA 4AKGA 4GOUA 4PJNA 1WCRA 3QNUA 3IEEA 3N5LA 4L9IA 4COFA 2H7OA 3P7IA 5AQTB 3N9OA 5IHYA 3ZEFB 5DQVA 2I59A 2NTXA 2Q9QD 2EHOA 2N9DA 3P4WA 5AQRB 1D0XA 4P0BA 2LM2A 2V6XA 1U5PA 2ZMAA 2P9BA 1T98A 5JRCA 5HWXA 3KINB 4OYJA 4WW0A 5L3BB 4X64T 4UF0B 1CUNA 2KNDA 2LEHA 4KBMB 5E0OA 2LT3A 1ZOYA 2Q9QB 2YDRA 5DABA 3LFMA 3MJXA 2OV9A 3PU3A 2CPTA 4IL9A 5L3EB 1KK7A 2YU1A 2X9XA 1KEYA 1WRDA 1OEDB 2W4XA 2D9DA 3EAMA 4QHOA 4TV8E 4UELA 3LJCA 4WBOA 2IIUA 4HGAA 2JQKA 1WYCA 2HPJA 4PK5A 5EK4A 1J5ET 1V9DA 3ZYMA 3M3ZB 4LF9T 3L8RA 2KLQA 1WR6A 4ISSA 1KF6A 2CEAA 1MMAA 4U7IA 1XZYA 2Y6XA 3EI0A 3E0ZA 4ADZA 5AQGB 1E2AA 3QB5K 2N1GA 4TX5A 1OEDA 1UX4A 4MHCA 5HCMA 5HXRA 4AQYT 3FZLB 2BS3A 4HWDA 2XQ4A 3VHLA 1IJ5A 4O4JE 3ZSTA 1N34T 2LOSA 3W15B 4HFHA 5LXTE 5JR9A 1IJ6A 1WFDA 2JRKA 4XAXB 2XQ7A 3GN5A 2PG8A 2QYWA 1JNZA 3C4WA 4JI0T 4DV6T 4CXYA 3ZJ1A 4AXPA 4QH4A 5LBQB 4EZHA 4DO0A 4DV5T 5FVLA 2RP4A 3ZMVB 2KINB 3AVRA 2M6IA 2UUBT 4EB6E 3D0TA 4MFRA 2CRBA 4CI2B 4QXHB 1NENA 3CVRA 3KDSE 4E7SA 2UUCT 3K8PC 3HI2A 5LB7B 3CMLA 5JDLA 1D1BA 1HFAA 3MACA 5LJNA 2MPKA 4LF4T 1KNZA 2I0MA 1VCSA 2DI4A 3M65A 3NRYA 3OPCA 4H9QC 3HKBE 2FJBA 4BAYB 2JQQA 3RKGA 2FJAA 2BG9A 2JIWA 2X0LB 3AA7B 4IDPA 5EK3A 1LRZA 5FNVE 3SOLA 1IBKT 3TLSA 4B6XA 4C91A 3NKZA 4HFVA 4DNDA 5J2UE 4ZI7E 5DQWA 2VQET 3VRBA 1N32T 2C5JA 3OBVE 4NUVA 5JDGA 3UT5E 2BDEA 4DV2T 1XNQT 1DU2A 2E8IA 2FUPA 4GKJT 3UU3A 2X51A 2E2AA 5AQIB 3FZFB 4ILBA 4MLKA 1FIOA 2X9WA 5AQLB 2IHR1 4KI0F 5HEJA 5FY1A 2X9HA 3OJAA 4H9PC 2QA7A 2BG9B 3B5MA 1G73A 3N2OA 4ZI2D 3T1YT 1U4QA 3UULA 3UFEA 2K48A 5CA0E 3ETUA 5LP6E 4ZS3A 2MBGA 2MTQA 2PFVA 4LFBT 3UU5A 4QKNA 4F8HA 2XAFB 1R8IA 4Q25A 3RQWA 2BG9C 4NIQA 5HXCA 3UU8A 2XPKA 2KT9A 5IWAT 4ERRA 5LA6E 4DR4T 3P4QA 3N9MA 3Q2MA 3SFDA 2NW8A 2R6GF 2FJEA 2ZM8A 2XQ8A 3KFWX 3PJAA 3GA8A 3RRCA 3PUWF 5HXHA 4JI1T 5JR9B 4UVAB 4U3CA 2VASA 2GK9A 3PTRB 5LHIB 1UX5A 3AEEA 4HFCA 1WLXA 1FEWA 1NWMX 2XHEB 5BMVE 2WU2A 3EUHA 3KVBA 1LVKA 4JI5T 4ZXLA 2D0TA 2NP9A 3AE7A 2F4VT 1GQEA 5J2TE 4X62T 4YFSA 3AECA 2LJLA 2PTFA 4HWIB 4O4HE 3UUXB 2QRXA 4NXMT 2AE9A 5L4EA 1HNZT 2UU9T 3RHWA 4ZEYA 5FXXA 4QXBB 2CLYB 1XDOA 3GWHA 3HR0A 2DWGA 3UUMA 3ZPOA 4DIDB 5FYMA 3FBZA 3G06A 4A56A 5JDNA 3P50A 2XQAA 1QLBA 2LSJA 5F8PA 4EYUA 4ANJA 4U33A 2XZEA 3AA1B 3ZMSB 3A5XA 1KNPA 5J0ZA 4H9SE 2XAHB 5H6RB 2WY2A 3AB3B 3H3AA 3CWZB 3ZJ2A
chains in the Genus database with same CATH topology
4DIDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DID B; 
#chains in the Genus database with same CATH topology
 4PFP A;  2WWV A;  3O1I A;  4U74 A;  4UV8 B;  4P0A A;  5FL0 A;  4YHH T;  2X67 A;  2X0Y A;  3BK9 A;  4IDZ A;  4U31 A;  4EXT A;  3LK3 B;  3UU4 A;  4DV3 T;  3C4Z A;  1SE7 A;  4HTE A;  4JEH B;  3N9Q A;  4L5G A;  2BS4 A;  4L0R A;  3EVY A;  3KV9 A;  4O4L E;  5FMN A;  3VR9 A;  4HWH A;  4AQF A;  2HN2 A;  4DVD A;  2UUA T;  2KMF A;  1BR1 A;  5TAO A;  4IE5 A;  4X65 T;  4IRE A;  1BR4 A;  4I50 E;  4QH5 A;  2HH7 A;  3H3M A;  1CHU A;  3PDY A;  3SWH A;  2WP9 A;  3GMI A;  4GYR A;  4EZ4 A;  1FMV A;  3AED A;  3AE3 A;  2BS2 A;  1T8B A;  2X0H A;  5H6Q B;  1OWA A;  4OX9 T;  3ZC1 A;  1B7T A;  3K1S A;  2G0U A;  3KBU A;  1MMG A;  3MA9 A;  1X9B A;  3LSV A;  3CX7 B;  3O9X A;  3RI5 A;  5C3J A;  2N2N A;  2ODU A;  3Q9D A;  3RX6 A;  4PK6 A;  2CA5 A;  4HFD A;  4EIW A;  2XQ5 A;  3AA6 B;  4B3S T;  2HN1 A;  2KSR A;  5AQJ B;  1D0Y A;  4HE8 A;  2WCA A;  3HKE E;  2BZB A;  2RPA A;  2E9X B;  3A7M A;  4H63 H;  4UR9 A;  3ZSS A;  2YN6 A;  2E5L T;  3RYF E;  5ABF B;  2XSA A;  5HEO A;  3SS1 A;  3VRA A;  3CKD A;  2WM9 A;  3AXJ A;  5L3G B;  3HL6 A;  4TV9 E;  5LG4 A;  2VQF T;  2HHH T;  2D5U A;  2LRL A;  4GYS A;  4IST A;  3Q5X A;  3ETV A;  4UVC B;  4UXN B;  1ZP0 A;  5FXW A;  2K9A A;  2X68 A;  4X66 T;  1MIV A;  1YQ3 A;  1S94 A;  3C64 A;  5HXS A;  4JI4 T;  1FMW A;  4Z90 A;  3WAJ A;  1E1H B;  5F5W A;  3I0Q A;  5CGM A;  1YQ4 A;  2WSS V;  3HA4 A;  3LDQ B;  4ZOL E;  2W00 A;  2NTY A;  1VRB A;  2CCQ A;  5EZY E;  4DBR A;  2WQY A;  4IIJ E;  3N2K E;  1BR2 A;  2Y48 B;  3QC9 A;  3TKL B;  3LBX B;  3TLT A;  3MKD A;  2BVL A;  2BKO A;  2XM1 A;  4IT4 A;  3TLV A;  4ZHQ E;  3KBT A;  3NRX A;  3AVS A;  3CQX C;  2SPC A;  1D0Z A;  1ZEE A;  2XQY A;  4I0U A;  3AE5 A;  4OFZ A;  4LFA T;  2ZM6 T;  2WS3 A;  1XNR T;  4LMJ A;  3ZT7 A;  2C0S A;  2I6H A;  3ZCI A;  3ANW B;  4I43 B;  4ZI3 C;  1ZHC A;  1MMN A;  5CB4 E;  3ZT6 A;  4JBW F;  1M7K A;  1SA0 E;  4YLH A;  5HWY A;  3JAE A;  2ZM0 A;  3FZH B;  4U7Y A;  2XAG B;  5LBM A;  5C8Y E;  3VU7 H;  4AKH A;  5BR8 T;  3OKQ A;  3IF8 B;  4AIS A;  3ABV A;  2KXP B;  1MIY A;  5A1L A;  4JI6 T;  3CPZ A;  4TNW A;  4KUM B;  4X5T A;  2DLR A;  2VUR A;  2WDR A;  3WI3 A;  4K0K T;  4UEM A;  3RYC E;  5FY0 A;  5LG3 A;  3AE8 A;  3NVO A;  3RGL A;  2XAJ B;  4QH1 A;  3WAK A;  3C4X A;  2WMN A;  3F31 A;  4DV4 T;  1X79 A;  4ILU A;  4YHJ A;  2V7J A;  4O8S A;  1N36 T;  5AFU L;  1HTJ F;  1E7P A;  3HKC E;  4DV1 T;  1HR0 T;  4TWF A;  4M1P A;  4KMC A;  3CX6 B;  4GK0 E;  5L4H A;  3U78 A;  2E5V A;  3AAI A;  1YW0 A;  3AAA B;  3C98 B;  3RRW A;  1YKH B;  4EV6 A;  4G2A A;  3T8O A;  3NZP A;  3F57 A;  5HXE A;  3AEB A;  1J1J A;  3BQI A;  2DCF A;  4KP3 C;  3AE1 A;  3H37 A;  4IDQ A;  2LSY A;  1HCI A;  3LK4 2;  4GIW A;  4HFE A;  3N9P A;  4ZS2 A;  5AQH B;  2BBJ A;  4BJM A;  4FI5 A;  2UXB T;  2JPF A;  3P4P A;  2CBI A;  3MK7 C;  3Q5E A;  4PJM A;  2H7V C;  4CN4 A;  1FJG T;  5FL1 A;  3EDU A;  1HS7 A;  1KFY A;  1YD8 G;  2QGS A;  2H89 A;  1XDP A;  3EDV A;  2JQH A;  4A98 A;  2LLY A;  2OLT A;  3Q5D A;  2CE7 A;  5FKY A;  4EEB A;  3PUS A;  3ZT5 A;  3VKH A;  1YKE B;  2RA1 A;  4Z8X A;  3O1H A;  4X1I E;  4YTN A;  2Q9Q A;  5L3D B;  2CWY A;  2Y8D A;  3AEG A;  4ILC A;  5LNK A;  3AAE B;  3N9L A;  3TLU A;  1W9R A;  3I1A A;  2ES0 A;  2WU5 A;  4UVB B;  1NAF A;  5ABE A;  2XM2 A;  1HG2 A;  3CQG B;  3ZCJ A;  5CFB A;  1MMD A;  2WDV A;  4J2C A;  3UQ4 A;  3TLW A;  3OTO T;  2YIN A;  3FZK B;  3J7Y q;  2OA5 A;  2V7I A;  3O4X E;  3ONJ A;  4BA9 A;  1IBM T;  4DR2 T;  2VKJ A;  4WYV A;  2D0U A;  1T7S A;  4O2B E;  4EOZ B;  5JVD E;  1I6Z A;  2WBL A;  3P4R A;  4LFC T;  5JQG E;  4I4T E;  3RKO A;  4ILA A;  4CI3 B;  4CQI A;  2XTL A;  1JNR A;  3P8C D;  2KZ7 B;  2YOE A;  5FP3 A;  3CK6 A;  5ETW A;  1HG5 A;  2D2S A;  4NPP A;  4IL4 A;  5KXJ A;  2WWU A;  2XY8 B;  1IAP A;  2H3R A;  3CQC B;  2UXN B;  3ESL A;  3UUN A;  5JDQ A;  1XMQ T;  4QX7 B;  2ACX A;  2A2F X;  4JUY A;  2YK0 A;  5HCJ A;  4XBF B;  2V6Y A;  3RIU A;  5LGN B;  3N2G E;  3PV0 F;  2W2U A;  4U72 A;  4AQF C;  2DL1 A;  2X66 A;  2AXD S;  1IZN B;  4OHF A;  4C90 A;  4DV7 T;  3NBX X;  1T72 A;  1LVF A;  1XWM A;  5KX5 E;  4QX8 B;  4ZI3 D;  3AEA A;  5AQV B;  4AIU A;  1VCT A;  2K5B B;  4JEU B;  2LE8 A;  5AQK B;  4OYK A;  5JR9 C;  5F3J A;  4IE4 A;  4CXW A;  1NEK A;  4X1K E;  4JV5 T;  5AQS B;  2A3D A;  2A72 A;  3L3P A;  1HNX T;  3N9N A;  4PJJ A;  1OED C;  4O4I E;  3AE6 A;  1WR0 A;  3KV5 A;  2WB5 A;  3DP7 A;  5C2T A;  1L0V A;  5LGU B;  2XAS B;  5AQF B;  2ZM2 A;  5LGT B;  2L8K A;  2DNX A;  1Z8U A;  3B13 A;  4I55 E;  4ZZB A;  3OYX A;  5L2L A;  1YXR A;  2DWK A;  2FJD A;  1W0B A;  3JCF A;  3L09 A;  4U2Z A;  1WYB A;  4KHZ F;  4EGW A;  1HNW T;  3CIR A;  3AA0 B;  2W61 A;  3K3O A;  5JDF A;  2W66 A;  3JAF A;  4PAG A;  3V5S A;  3ZN1 B;  5HYA A;  2K3W A;  1H7C A;  3RC3 A;  2CBJ A;  1M62 A;  2IW5 B;  3OYZ A;  4H9R C;  5CJ5 A;  4YJ2 E;  3K3Q C;  2VKD A;  1Z0P A;  3PE0 A;  3QK6 A;  1OED E;  2EHO C;  2XSB A;  3DTO A;  4MBQ A;  4AQG A;  5LMU T;  5HEG A;  2BKP A;  2K24 A;  3MZK B;  5AQN B;  3LG7 A;  3RF1 A;  4DR3 T;  1IBL T;  2CXF A;  3ZYL A;  3FXE B;  4LML A;  2BKN A;  1UUR A;  4TZ4 C;  2LSG A;  2JJ9 A;  4WZX A;  5KDM C;  4OK0 A;  4ZZC A;  4HFI A;  4PK4 A;  3F2E A;  4JI8 T;  3PUR A;  5AQO B;  1MIW A;  4JI7 T;  4MAL A;  3I9W A;  3RIU C;  4CN6 A;  1SUM B;  2V6Y B;  3R84 B;  3JAD A;  4N78 D;  1UGO A;  4NUU A;  4CXX A;  2LRK A;  3OVU A;  3ZMT B;  1AJ3 A;  4QXC B;  4YT0 A;  5JDM A;  2IDO B;  3ANW A;  4DMW A;  2KWI B;  3IBP A;  3UQ7 A;  4PW8 A;  2UXX B;  3IHR A;  1EZ3 A;  2PBI A;  5CA1 E;  5ABF A;  2M6B A;  2QVA A;  3ONX A;  2XAQ B;  3CX8 B;  2WZI A;  4IDO A;  2W0G A;  1W0A A;  3FB2 A;  4TN7 B;  3RIA A;  3AE2 A;  2B1E A;  3JC6 D;  2MAW A;  4HFB A;  3JC6 C;  4P09 A;  2KWH A;  5HEU A;  3VKG A;  2WMO A;  2WDQ A;  4YJ3 E;  4WNK A;  4X20 E;  1ZV4 X;  3UFG A;  5EK2 A;  3QUJ A;  4UIG A;  1UUS A;  2IAK A;  2ODV A;  4A97 A;  3T1H T;  2LKH A;  3RC8 A;  1UCU A;  5HAX A;  4H63 V;  3R6N A;  2A9U A;  1Y01 A;  3EAB A;  2PJQ A;  2IC6 A;  2BG9 E;  3GN5 B;  2NW9 A;  2L3L A;  5LHG B;  5M4Y A;  1BR0 A;  5FXZ A;  2M67 A;  4P1N A;  3BQL A;  4LF7 T;  1LKX A;  4NXN T;  3C51 A;  1S35 A;  3RIF A;  5KMG P;  1HX1 B;  3KV4 A;  2XJ7 A;  4V1A v;  2VVS A;  2J62 A;  3ZYK A;  5LYJ E;  4DUY T;  1W09 A;  3FHN A;  3FXD B;  3V5U A;  2E9X A;  3SFE A;  3ZMZ B;  2CM0 A;  4JI2 T;  1QUU A;  3E08 A;  3VR8 A;  2CWO A;  5LOV E;  2W62 A;  4ZI2 C;  4HEA A;  2V8S V;  4TWH A;  3UU6 A;  4A5X A;  3AEF A;  3KVA A;  2V5D A;  4IGU A;  2WZH A;  3ONL C;  3RPU A;  4EED A;  3AE9 A;  4IE7 A;  3ZLI A;  2JQ9 A;  5JH7 E;  1KNR A;  1J5W A;  2VWA A;  3RYH E;  4DR6 T;  3RH3 A;  4DUZ T;  2V1D B;  2YDS A;  2J4G A;  2VK9 A;  2LHN A;  4E7Z A;  4UF0 A;  3BQK A;  1QSD A;  4YTM A;  4DR1 T;  3J9X 1;  2IC9 A;  4CI1 B;  5ABG A;  4QWN B;  1US7 B;  3QB5 A;  3NWI A;  4DV0 T;  5JRC B;  2CMR A;  4LMK A;  2MYS A;  3PUV F;  2CHN A;  2V7L A;  2YU2 A;  3FBL A;  3FZM B;  4H9O C;  2EHO B;  1D1C A;  4HWC A;  4TNV A;  4XZC A;  4YTP A;  2LKG A;  5LCY A;  4HN9 A;  4X1Y E;  4LF8 T;  2JMK A;  4LF6 T;  3B57 A;  3PUA A;  3DJB A;  2VKO A;  5AQM B;  3RYI E;  5JRE A;  4B3M T;  4JI3 T;  4DR7 T;  2VB6 A;  2V5C A;  4AKI A;  4KHP T;  2LSI A;  2FBW A;  2L9Q A;  2MOZ A;  3HKD E;  5AQQ B;  3C50 A;  3PJA J;  3PU8 A;  3PUZ F;  5L3C B;  4YXD A;  4PFO A;  2EHO D;  4JYA T;  4CZZ B;  2H88 A;  3UTK A;  3ZMU B;  3PUY F;  2VL0 A;  4DMV A;  4B3R T;  2X9Y A;  3K3N A;  2E9X D;  3Q5W A;  3RQU A;  2YKS A;  2E9X C;  2JMH A;  2XQ3 A;  5JTG A;  2VL8 A;  3S4U A;  4Z91 A;  4AKR B;  3PUX F;  2NWB A;  4GKK T;  2CXL A;  1O3X A;  4K0U A;  2WAU A;  3I0O A;  1HF8 A;  2IML A;  2C5K T;  3PUQ A;  5AQP B;  2W63 A;  2IUB A;  3ZKR A;  5LJM A;  4LF5 T;  2LHR A;  4YSZ A;  3PUG A;  3SRZ A;  3O1J A;  1D1A A;  2BVM A;  5FY7 A;  4O2A E;  5LHH B;  4YY3 T;  5LMN T;  4AI6 A;  2LOP A;  5ADX L;  4CN1 A;  2LSK A;  1Y64 B;  3E22 E;  4KX6 A;  4HWF A;  2V7M A;  4HKA A;  4ASK A;  4TWD A;  2LM9 A;  4F6R C;  4TUY E;  1OXZ A;  1HX8 A;  2XQ6 A;  1ZKE A;  4IHJ E;  4IE0 A;  2DHR A;  2B76 A;  3UUB A;  5JDH A;  2XUE A;  5J1G A;  4EYY R;  4YSX A;  1N33 T;  2UXC T;  3QOF A;  4AKL A;  3A8Y C;  5AQU B;  4IDN A;  3IA3 A;  4JLE A;  2HPL A;  2Z6E A;  3MXZ A;  3X1D A;  3ZC0 A;  5FXV A;  5HEH A;  3L39 A;  3RLF F;  3AXJ B;  1G8X A;  1MNE A;  2J1D G;  2NR4 A;  2J47 A;  2VKH A;  2Q9Q C;  4EAH A;  2XQ9 A;  3EHZ A;  3LK2 B;  4G63 A;  2BBH A;  3U3I A;  4PJL A;  1MND A;  4BJN A;  1I94 T;  4B3T T;  2ZLY A;  2NOX A;  2W67 A;  4IE6 A;  3LBX A;  1SHZ C;  2UXD T;  2YDQ A;  4WBN E;  2VVN A;  4U2Y A;  2C5I T;  3KV6 A;  2V7K A;  4PNI A;  2ACZ A;  3NZQ A;  4GK5 E;  2CHO A;  2CXD A;  5GON E;  2CLY C;  4FJO A;  2V26 A;  3ZN0 B;  5L47 A;  4H9N C;  2NW7 A;  5IYZ E;  3I9Y A;  2YEV C;  1XMO T;  4UV9 B;  4DR5 T;  1UK5 A;  5L3F B;  1VOM A;  3AE4 A;  3P4S A;  5DJQ C;  5FVK A;  4DBQ A;  5ABH A;  5IUX A;  4YSY A;  4AKG A;  4GOU A;  4PJN A;  1WCR A;  3QNU A;  3IEE A;  3N5L A;  4L9I A;  4COF A;  2H7O A;  3P7I A;  5AQT B;  3N9O A;  5IHY A;  3ZEF B;  5DQV A;  2I59 A;  2NTX A;  2Q9Q D;  2EHO A;  2N9D A;  3P4W A;  5AQR B;  1D0X A;  4P0B A;  2LM2 A;  2V6X A;  1U5P A;  2ZMA A;  2P9B A;  1T98 A;  5JRC A;  5HWX A;  3KIN B;  4OYJ A;  4WW0 A;  5L3B B;  4X64 T;  4UF0 B;  1CUN A;  2KND A;  2LEH A;  4KBM B;  5E0O A;  2LT3 A;  1ZOY A;  2Q9Q B;  2YDR A;  5DAB A;  3LFM A;  3MJX A;  2OV9 A;  3PU3 A;  2CPT A;  4IL9 A;  5L3E B;  1KK7 A;  2YU1 A;  2X9X A;  1KEY A;  1WRD A;  1OED B;  2W4X A;  2D9D A;  3EAM A;  4QHO A;  4TV8 E;  4UEL A;  3LJC A;  4WBO A;  2IIU A;  4HGA A;  2JQK A;  1WYC A;  2HPJ A;  4PK5 A;  5EK4 A;  1J5E T;  1V9D A;  3ZYM A;  3M3Z B;  4LF9 T;  3L8R A;  2KLQ A;  1WR6 A;  4ISS A;  1KF6 A;  2CEA A;  1MMA A;  4U7I A;  1XZY A;  2Y6X A;  3EI0 A;  3E0Z A;  4ADZ A;  5AQG B;  1E2A A;  3QB5 K;  2N1G A;  4TX5 A;  1OED A;  1UX4 A;  4MHC A;  5HCM A;  5HXR A;  4AQY T;  3FZL B;  2BS3 A;  4HWD A;  2XQ4 A;  3VHL A;  1IJ5 A;  4O4J E;  3ZST A;  1N34 T;  2LOS A;  3W15 B;  4HFH A;  5LXT E;  5JR9 A;  1IJ6 A;  1WFD A;  2JRK A;  4XAX B;  2XQ7 A;  3GN5 A;  2PG8 A;  2QYW A;  1JNZ A;  3C4W A;  4JI0 T;  4DV6 T;  4CXY A;  3ZJ1 A;  4AXP A;  4QH4 A;  5LBQ B;  4EZH A;  4DO0 A;  4DV5 T;  5FVL A;  2RP4 A;  3ZMV B;  2KIN B;  3AVR A;  2M6I A;  2UUB T;  4EB6 E;  3D0T A;  4MFR A;  2CRB A;  4CI2 B;  4QXH B;  1NEN A;  3CVR A;  3KDS E;  4E7S A;  2UUC T;  3K8P C;  3HI2 A;  5LB7 B;  3CML A;  5JDL A;  1D1B A;  1HFA A;  3MAC A;  5LJN A;  2MPK A;  4LF4 T;  1KNZ A;  2I0M A;  1VCS A;  2DI4 A;  3M65 A;  3NRY A;  3OPC A;  4H9Q C;  3HKB E;  2FJB A;  4BAY B;  2JQQ A;  3RKG A;  2FJA A;  2BG9 A;  2JIW A;  2X0L B;  3AA7 B;  4IDP A;  5EK3 A;  1LRZ A;  5FNV E;  3SOL A;  1IBK T;  3TLS A;  4B6X A;  4C91 A;  3NKZ A;  4HFV A;  4DND A;  5J2U E;  4ZI7 E;  5DQW A;  2VQE T;  3VRB A;  1N32 T;  2C5J A;  3OBV E;  4NUV A;  5JDG A;  3UT5 E;  2BDE A;  4DV2 T;  1XNQ T;  1DU2 A;  2E8I A;  2FUP A;  4GKJ T;  3UU3 A;  2X51 A;  2E2A A;  5AQI B;  3FZF B;  4ILB A;  4MLK A;  1FIO A;  2X9W A;  5AQL B;  2IHR 1;  4KI0 F;  5HEJ A;  5FY1 A;  2X9H A;  3OJA A;  4H9P C;  2QA7 A;  2BG9 B;  3B5M A;  1G73 A;  3N2O A;  4ZI2 D;  3T1Y T;  1U4Q A;  3UUL A;  3UFE A;  2K48 A;  5CA0 E;  3ETU A;  5LP6 E;  4ZS3 A;  2MBG A;  2MTQ A;  2PFV A;  4LFB T;  3UU5 A;  4QKN A;  4F8H A;  2XAF B;  1R8I A;  4Q25 A;  3RQW A;  2BG9 C;  4NIQ A;  5HXC A;  3UU8 A;  2XPK A;  2KT9 A;  5IWA T;  4ERR A;  5LA6 E;  4DR4 T;  3P4Q A;  3N9M A;  3Q2M A;  3SFD A;  2NW8 A;  2R6G F;  2FJE A;  2ZM8 A;  2XQ8 A;  3KFW X;  3PJA A;  3GA8 A;  3RRC A;  3PUW F;  5HXH A;  4JI1 T;  5JR9 B;  4UVA B;  4U3C A;  2VAS A;  2GK9 A;  3PTR B;  5LHI B;  1UX5 A;  3AEE A;  4HFC A;  1WLX A;  1FEW A;  1NWM X;  2XHE B;  5BMV E;  2WU2 A;  3EUH A;  3KVB A;  1LVK A;  4JI5 T;  4ZXL A;  2D0T A;  2NP9 A;  3AE7 A;  2F4V T;  1GQE A;  5J2T E;  4X62 T;  4YFS A;  3AEC A;  2LJL A;  2PTF A;  4HWI B;  4O4H E;  3UUX B;  2QRX A;  4NXM T;  2AE9 A;  5L4E A;  1HNZ T;  2UU9 T;  3RHW A;  4ZEY A;  5FXX A;  4QXB B;  2CLY B;  1XDO A;  3GWH A;  3HR0 A;  2DWG A;  3UUM A;  3ZPO A;  4DID B;  5FYM A;  3FBZ A;  3G06 A;  4A56 A;  5JDN A;  3P50 A;  2XQA A;  1QLB A;  2LSJ A;  5F8P A;  4EYU A;  4ANJ A;  4U33 A;  2XZE A;  3AA1 B;  3ZMS B;  3A5X A;  1KNP A;  5J0Z A;  4H9S E;  2XAH B;  5H6R B;  2WY2 A;  3AB3 B;  3H3A A;  3CWZ B;  3ZJ2 A; 
#chains in the Genus database with same CATH homology
 4DID B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...