3OTOT

Crystal structure of the 30s ribosomal subunit from a ksga mutant of thermus thermophilus (hb8)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Modification of 16S ribosomal RNA by the KsgA methyltransferase restructures the 30S subunit to optimize ribosome function.
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2010-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 3otoT00
2UXCT 4B3RT 4JI2T 4JI6T 1N32T 1XNQT 4JI1T 1HR0T 3OTOT 2F4VT 4JI4T 4JYAT 4DV5T 2ZM6T 4DR3T 4DUYT 1FJGT 1IBKT 5LMNT 1HNXT 2E5LT 4JI7T 4LF8T 3T1HT 4JI8T 4B3ST 4DR7T 4JI3T 4X65T 4DUZT 2VQFT 1I94T 1IBLT 4LF5T 4X62T 4DR1T 1N33T 4JV5T 4DR2T 1XNRT 4AQYT 1HNWT 1HNZT 4OX9T 4NXMT 4LF6T 4DR4T 4DV1T 4LF7T 4DV7T 1N34T 4LFCT 5LMUT 1IBMT 2VQET 2UU9T 2UUBT 4X64T 4K0KT 1N36T 4DV2T 4DV0T 4B3MT 4X66T 4LFAT 4DR6T 2UXDT 4YHHT 3T1YT 1J5ET 4GKKT 5IWAT 4JI0T 4NXNT 4DV3T 4DR5T 5BR8T 1XMQT 4LFBT 1XMOT 4GKJT 4LF9T 4DV4T 2HHHT 4LF4T 2UUAT 4B3TT 4YY3T 4JI5T 4DV6T 2UUCT 4KHPT 2UXBT
chains in the Genus database with same CATH superfamily
2V26A 2JQHA 2C5IT 4JI6T 1HG5A 1ZOYA 3ZYMA 4NIQA 1U5PA 3EHZA 3N2GE 3AEAA 3AE1A 2KZ7B 3K8PC 1WFDA 3M65A 3ZJ2A 3IF8B 4H63H 4FI5A 4OYKA 1M7KA 4Q25A 1YW0A 1HF8A 1E7PA 2DHRA 4A97A 4I55E 1W9RA 3K1SA 1BR0A 4DR2T 4CI1B 2VWAA 2CBIA 2H89A 4HFVA 5AQOB 4EOZB 2IMLA 3CKDA 4QX8B 5AQRB 4I0UA 3SFEA 2YK0A 3ONLC 2N2NA 1N36T 3O1JA 2HH7A 4DV0T 3G06A 1QUUA 3VR9A 5IWAT 3PUAA 4DR5T 4IE4A 3FZLB 5JDNA 3HKEE 1XMOT 4UV8B 3ZMUB 2BKOA 4MHCA 3FZFB 3N2KE 4LMJA 4IDQA 3UU5A 3CWZB 2IAKA 2VVNA 3H3AA 4U2ZA 3ZLIA 4JYAT 2BVLA 4YTMA 2XHEB 3TLVA 3UU3A 1HNXT 2X68A 2CXFA 1WR0A 3N9MA 2A9UA 4I50E 4IE5A 2YU1A 2X9WA 1NWMX 2J62A 4L5GA 3WAKA 4OHFA 4ZZBA 4ZZCA 1UCUA 3T8OA 3U3IA 3ABVA 2ODVA 4HFHA 4WZXA 1N33T 5LBMA 4LMLA 3RIUC 1BR4A 5LGNB 2NW7A 3TLUA 3O4XE 2XM2A 3ZC1A 2EHOA 3KVAA 2W0GA 2I59A 2XQ9A 3RX6A 4P1NA 5C3JA 5L4EA 4X20E 5C2TA 1LKXA 3RH3A 4K0UA 2JQ9A 2CHNA 4YSXA 2WDQA 3NRXA 2V7LA 2YKSA 4Z8XA 2FJAA 2WMOA 2BS2A 1WCRA 1XDPA 5IYZE 3BQKA 4ASKA 1KNPA 4EXTA 4GOUA 3FBLA 3ZMVB 3CIRA 3AECA 3CMLA 3AAEB 2P9BA 1L0VA 3RQWA 3IA3A 3AA1B 1MMDA 5FXVA 3LK3B 3TLTA 1KK7A 4ERRA 2V7JA 1Y01A 4XAXB 2VKDA 2XQ7A 3RGLA 3UUMA 4Z91A 2BG9C 3KBUA 1Z8UA 2QRXA 2NTYA 3PUSA 4AISA 1WRDA 2X9HA 3R6NA 3AVRA 4J2CA 3RLFF 4EAHA 1CHUA 5AQSB 4DR4T 3DJBA 4PJMA 5CA0E 3PUZF 2LKHA 4DV7T 3VKGA 3O1HA 3ZYKA 5EZYE 3PE0A 4PJNA 4QKNA 2VQET 1Z0PA 1MIVA 5DABA 5FVLA 3GN5A 3ZT5A 4CZZB 4EZHA 2XAFB 4MLKA 4EGWA 2WDRA 3ZN1B 4GK5E 2V1DB 5F3JA 2IW5B 4YTNA 4UVBB 3HR0A 4DV3T 2GK9A 4C90A 5LHIB 4PJLA 1XMQT 3PUGA 4HFEA 2WCAA 4B3TT 4IDNA 2Y6XA 3P4PA 4P0BA 2UUCT 4Z90A 5LA6E 1I6ZA 4GYRA 4BA9A 2RPAA 3OTOT 4JI4T 3VRBA 4U7IA 1HX8A 5LMNT 2X9YA 4MBQA 4CQIA 2PBIA 1MMNA 2AE9A 5E0OA 5FL0A 2E9XB 2LE8A 1R8IA 4QWNB 5LJNA 3RKOA 1FIOA 2D0UA 3I9YA 2C0SA 5FP3A 4ADZA 2KWHA 2VQFT 3FZHB 3CK6A 4EYUA 1HNWT 3ZYLA 3NRYA 3X1DA 1E2AA 4JUYA 4EZ4A 4IT4A 1UX4A 5JRCA 2WZIA 2J4GA 5LMUT 3JC6C 3Q5WA 1ZV4X 2BVMA 3RC8A 4QX7B 1MIWA 4MALA 4E7ZA 3FZKB 4HFCA 2X0YA 2UXDT 4YXDA 4YTPA 4YJ2E 2FUPA 3QOFA 2NWBA 2WWUA 2WDVA 2Q9QA 2XPKA 5BR8T 5F5WA 3HKCE 5LYJE 2D0TA 1NEKA 2V5CA 3JC6D 5ABHA 2E8IA 3Q9DA 5FL1A 2UXCT 1UX5A 5L3FB 5LB7B 3I0OA 4JI1T 4U3CA 2XTLA 3ZT7A 4DUYT 4PK5A 2CRBA 5H6QB 2ZMAA 4YJ3E 2LSGA 4JI3T 2LOPA 3HKDE 2K9AA 5AFUL 3S4UA 3BQIA 4QXHB 3QB5A 2E2AA 4L0RA 3LBXB 3RIFA 2JMHA 1D0XA 3TLSA 4ZI7E 5JR9A 5HEUA 4PNIA 3ZCJA 2LSIA 3J9X1 2PTFA 2KXPB 2W2UA 1J5WA 4X66T 3LSVA 4H9OC 4PK4A 1Y64B 2MOZA 4HWCA 3EUHA 3RYFE 3E0ZA 2PG8A 5HEJA 3GWHA 2QA7A 3F57A 4CI3B 4NPPA 5AQHB 2E9XC 2FBWA 5L3CB 4GKJT 5AQGB 3E22E 3GMIA 4QH1A 2UXNB 2YINA 4DV6T 2LLYA 1BR1A 2XUEA 1MNDA 2K5BB 3AEBA 2JIWA 5AQFB 2CE7A 2LM9A 2ZM2A 3MKDA 2FJDA 4ZI3C 3A8YC 5J0ZA 1LVKA 5L2LA 4H9NC 2ZM6T 2WP9A 4JEHB 1NAFA 1OWAA 2E9XD 3K3NA 5GONE 3VHLA 4GYSA 1VCTA 2L9QA 3HA4A 4LF8T 1ZEEA 3CVRA 3RIAA 5KDMC 1IZNB 2VL0A 2A3DA 1IJ5A 3B57A 3UUBA 4IE0A 5TAOA 4YLHA 4DUZT 1UK5A 3RKGA 4G2AA 3NZPA 2QVAA 5FMNA 2Y8DA 4ZI3D 2PFVA 1LVFA 1BR2A 1S94A 2LJLA 4NXMT 4HE8A 1KNRA 2YU2A 4WW0A 2DLRA 3M3ZB 4V1Av 4AQFA 2V6YB 2YDSA 2XSAA 2W63A 3FZMB 3PDYA 4DR6T 4UVCB 4CN1A 2FJEA 2BBHA 4DVDA 4GK0E 3MZKB 3ZT6A 4YHJA 3ZN0B 2ZM8A 2CMRA 2LSYA 4L9IA 1U4QA 4A5XA 3C4ZA 2XAGB 1O3XA 3ETUA 4I4TE 2BG9B 5LGUB 3TLWA 2WQYA 4JEUB 4CN4A 2KNDA 5LP6E 1T8BA 4UVAB 1NENA 2BG9E 5AQLB 2CM0A 4WNKA 4AIUA 3CQGB 4F6RC 4EYYR 4YSYA 2IIUA 5HEGA 2BS4A 3ZKRA 3ZSSA 3AE9A 4KBMB 2K3WA 2HPJA 3C4WA 2FJBA 4HKAA 3AEGA 1X9BA 4B3ST 4P0AA 2LSJA 5FY7A 2V7KA 4IDOA 1FMWA 2ACZA 3FBZA 4CI2B 3L09A 4U33A 3FB2A 3FXDB 4QXBB 1OEDB 4AQYT 3A5XA 2JJ9A 3JAFA 4UF0A 3ETVA 4OK0A 1OEDE 4PW8A 1W09A 2CLYB 1S35A 2XQAA 4DIDB 3P7IA 5HEHA 2J47A 1QSDA 3RF1A 1OXZA 2LRLA 3KV4A 1SE7A 3Q5XA 2KINB 4ZS2A 4LFAT 1KEYA 5FY1A 1J5ET 1YKHB 3N2OA 5AQTB 4AI6A 3N9OA 2XQ6A 4BJMA 5JDLA 1LRZA 2YOEA 3VU7H 5HXRA 2LSKA 2RP4A 3C98B 4FJOA 2UXBT 5ABFA 2LEHA 4DMWA 3N9PA 3IBPA 1W0AA 2IHR1 5FKYA 5HWYA 2H7VC 3FXEB 1FEWA 3ZSTA 2ES0A 3PUVF 5LNKA 3D0TA 4G63A 2LKGA 5JH7E 2XM1A 2LRKA 2YDRA 3AA6B 4U31A 3A7MA 5FYMA 3ONXA 3ANWA 4M1PA 2M6BA 3NBXX 3OJAA 5HXSA 1IBLT 4JV5T 1QLBA 2OV9A 4EV6A 5IHYA 3IEEA 3AXJA 4O4IE 4LF7T 3GA8A 1HTJF 2ACXA 3C50A 3CPZA 3K3QC 3C51A 4ZI2C 3CX8B 4JBWF 4PK6A 3RYCE 2X0HA 4NUVA 1YKEB 5LHHB 5AQJB 3RRCA 4ILCA 4YHHT 5HWXA 4O2AE 3MACA 2JQQA 2MYSA 2YEVC 1JNZA 3Q5EA 3AVSA 4LFBT 4ZI2D 3LK42 2VKHA 2LM2A 3JCFA 5HXHA 3F2EA 3PU3A 2XY8B 2DWGA 3QK6A 4KHPT 2LT3A 1IJ6A 2G0UA 4PJJA 1OEDC 3RYHE 2JRKA 2W66A 4HWHA 3AE7A 1M62A 3QNUA 3I9WA 1J1JA 4AKRB 5IUXA 4TUYE 4HFDA 2CLYC 3RIUA 4JI7T 2BS3A 4ILBA 3K3OA 5CFBA 3AE2A 4X65T 5C8YE 4ZS3A 3VR8A 3AA0B 3HKBE 2BZBA 2VL8A 3N5LA 3RPUA 2NOXA 2VKOA 2NTXA 5KXJA 4LF6T 1FMVA 5AQIB 2WBLA 4OYJA 2UXXB 4CXWA 4XZCA 3NZQA 3C64A 3ZMSB 4TV8E 5FY0A 3DTOA 2XAJB 4KUMB 2WMNA 4IIJE 3ZCIA 4C91A 4U74A 2MPKA 3L3PA 3Q5DA 1WYCA 2N1GA 4X1YE 3ZPOA 3LK2B 2KSRA 1YXRA 3RYIE 2WU2A 2HHHT 2XQ3A 3ZJ1A 4IE7A 4HWDA 4TWDA 1ZP0A 2W61A 4JI2T 5AQPB 3UFGA 2W67A 5HEOA 3BK9A 1IBKT 2EHOB 3CX7B 2D9DA 4TWFA 2R6GF 5HCJA 5J2UE 1UURA 2CA5A 4XBFB 3L8RA 1EZ3A 3NWIA 3MXZA 2JQKA 4TNWA 4H9SE 4YT0A 1D1AA 1T72A 4AXPA 2WZHA 1N34T 3PV0F 5JDFA 1MIYA 1IBMT 2DL1A 2UU9T 2V8SV 4X64T 2K48A 5LJMA 5CA1E 2CXDA 3LG7A 4DV2T 1VRBA 4WYVA 2SPCA 4ZHQE 4QH4A 3WI3A 2IC9A 2IUBA 3Q2MA 2CWOA 3UFEA 3C4XA 5FXXA 3W15B 2UUAT 4AKLA 3RC3A 2QGSA 1SUMB 5CJ5A 4EEDA 1IAPA 4IE6A 5HCMA 1X79A 4X5TA 3OYZA 4F8HA 3H37A 4IL9A 4TNVA 3PU8A 2NP9A 5LXTE 2D5UA 3IHRA 3GN5B 4CXYA 3LFMA 5LOVE 5M4YA 1YD8G 5JTGA 3MA9A 2DNXA 2YN6A 4QXCB 5JDMA 2X0LB 3P4QA 5F8PA 3AA7B 1HX1B 4P09A 1MMAA 4ISSA 2ZM0A 3AE4A 3OPCA 4IDZA 5HAXA 2VK9A 3FHNA 2WWVA 5ADXL 1WR6A 4O4HE 4COFA 4B3MT 3J7Yq 1HS7A 4B6XA 4O2BE 4AQGA 5JDHA 2JMKA 4MFRA 1HG2A 3LJCA 3RHWA 2XZEA 1MNEA 2LHNA 2EHOC 3PUQA 4CN6A 4PFOA 5DQWA 4TWHA 2HN2A 4DV4T 2H3RA 4DNDA 3N9NA 4HN9A 1YQ3A 2B76A 3PUYF 4HWFA 1XNQT 3EDUA 4EEBA 1G8XA 4E7SA 5KMGP 5LG3A 2F4VT 4A98A 3B13A 2EHOD 3PTRB 2KLQA 4JLEA 2M6IA 2DCFA 3N9LA 4KX6A 4IDPA 5KX5E 5JRCB 3AE5A 3QUJA 3KINB 4N78D 3SOLA 3ZEFB 2OA5A 1W0BA 3PUWF 3T1HT 2H7OA 3R84B 2VVSA 5AQQB 4UV9B 4BAYB 1B7TA 3UU8A 1H7CA 2Q9QB 2XQ8A 5AQVB 2X66A 1VOMA 4ILAA 3EABA 3MK7C 1SHZC 5HYAA 1US7B 3AE6A 4TV9E 2E9XA 5HXEA 3AEDA 4BJNA 2XQ4A 4TN7B 4QH5A 3T1YT 4H63V 4UR9A 1CUNA 2HN1A 2I0MA 4NXNT 3QC9A 3NVOA 4GIWA 2W4XA 4ZXLA 1UUSA 2MTQA 3PJAA 4YY3T 4JI5T 4YFSA 3EAMA 3UTKA 1D0YA 3AE3A 4AKHA 1KFYA 4EIWA 4IHJE 3CQXC 3HL6A 1N32T 2Y48B 3PURA 3SRZA 4O8SA 1AJ3A 1FJGT 2WB5A 5JR9B 2RA1A 5A1LA 2DI4A 2XAHB 1D0ZA 4DR7T 4HFBA 1XWMA 4UIGA 2V5DA 4PAGA 1I94T 3KFWX 4X62T 3RI5A 1YQ4A 1XZYA 5LHGB 2XAQB 2IC6A 2D2SA 3PJAJ 2HPLA 2K24A 2QYWA 3HI2A 2UUBT 5JVDE 4K0KT 4DBRA 1ZHCA 3O9XA 1ZKEA 2V7IA 2KMFA 3DP7A 4AKGA 2CHOA 4YSZA 4GKKT 5AQMB 3P50A 1DU2A 5CB4E 2IDOB 2Z6EA 1T7SA 3BQLA 3UUNA 3V5SA 2A72A 1G73A 3KV5A 5ETWA 3LBXA 5FXWA 2L8KA 3EI0A 5L3BB 5EK3A 4UEMA 1JNRA 5LG4A 2Q9QC 4TZ4C 3ZC0A 4KHZF 5ABGA 2AXDS 5L3GB 2BKPA 4DR3T 1KNZA 3AB3B 2BBJA 4DBQA 5JDQA 4JI8T 3L39A 3VRAA 4IL4A 5LGTB 3UU6A 5L47A 2ODUA 2Q9QD 2NW9A 4LF5T 4X1IE 1XNRT 3JAEA 1HNZT 3I1AA 2WM9A 4DV1T 1WLXA 2E5VA 5AQKB 4QHOA 3CX6B 3P4SA 4IGUA 3SS1A 1E1HB 2J1DG 3OYXA 4TX5A 4LFCT 3UU4A 4WBOA 4HGAA 3EDVA 4IREA 4I43B 3UT5E 4ISTA 5BMVE 1SA0E 3AEFA 2XJ7A 3LDQB 5JR9C 5DJQC 4EB6E 2CWYA 3TKLB 3ZMZB 4H9PC 5HXCA 4LF4T 2X67A 3KBTA 4HEAA 3SFDA 3UQ4A 4ILUA 2V6YA 2YDQA 4DMVA 3AAIA 1HR0T 2C5JA 2XQYA 5AQUB 4UF0B 4KP3C 2X51A 3AAAB 3OBVE 2CXLA 4HWIB 2CEAA 3F31A 2E5LT 3PUXF 3UUXB 2VB6A 2C5KT 2N9DA 3E08A 4HTEA 4U7YA 3RQUA 5ABEA 3OVUA 2X9XA 2XQ5A 2PJQA 2BG9A 2WY2A 5JREA 2LOSA 3NKZA 2I6HA 5JDGA 3H3MA 3MJXA 1D1BA 1V9DA 2BKNA 2CPTA 3RRWA 2NR4A 4OX9T 2V6XA 5LCYA 1HCIA 4A56A 4AKIA 3QB5K 2B1EA 3AEEA 5FNVE 5ABFB 2MAWA 4H9RC 5AQNB 3UQ7A 2VKJA 2W00A 3P4WA 2LHRA 3ESLA 3N9QA 4NUUA 4JI0T 3B5MA 3O1IA 2H88A 5L3EB 1KF6A 3UULA 1OEDA 3AE8A 2WSSV 4AQFC 4LF9T 5JQGE 5LBQB 5J1GA 5L4HA 4U2YA 3ANWB 3CQCB 4B3RT 3EVYA 3I0QA 3WAJA 3JADA 3AXJB 4WBNE 2CCQA 1MMGA 1HFAA 4DO0A 4DV5T 2M67A 2XSBA 4H9QC 2W62A 3SWHA 5J2TE 2MBGA 4LMKA 4U72A 2WS3A 3KV9A 4HFIA 1T98A 4PFPA 3ZMTB 2VASA 2L3LA 3V5UA 4DR1T 4KMCA 5EK2A 3VKHA 4ZOLE 3KVBA 1XDOA 4UELA 5DQVA 4ZEYA 4O4LE 2OLTA 1VCSA 5L3DB 2CBJA 4O4JE 2JPFA 3ONJA 3P4RA 2WAUA 5EK4A 2VURA 2ZLYA 2BDEA 5CGMA 2WU5A 5FXZA 4KI0F 3P8CD 2DWKA 2XASB 2KWIB 1WYBA 4X1KE 2NW8A 3U78A 4OFZA 1UGOA 5FVKA 1GQEA 2V7MA 4UXNB 2KT9A 4ANJA 2A2FX 5H6RB 4CXXA 3KDSE 3KV6A 3OKQA 1D1CA
chains in the Genus database with same CATH topology
2UXCT 4B3RT 4JI2T 4JI6T 1N32T 1XNQT 4JI1T 1HR0T 3OTOT 2F4VT 4JI4T 4JYAT 4DV5T 2ZM6T 4DR3T 4DUYT 1FJGT 1IBKT 5LMNT 1HNXT 2E5LT 4JI7T 4LF8T 3T1HT 4JI8T 4B3ST 4DR7T 4JI3T 4X65T 4DUZT 2VQFT 1I94T 1IBLT 4LF5T 4X62T 4DR1T 1N33T 4JV5T 4DR2T 1XNRT 4AQYT 1HNWT 1HNZT 4OX9T 4NXMT 4LF6T 4DR4T 4DV1T 4LF7T 4DV7T 1N34T 4LFCT 5LMUT 1IBMT 2VQET 2UU9T 2UUBT 4X64T 4K0KT 1N36T 4DV2T 4DV0T 4B3MT 4X66T 4LFAT 4DR6T 2UXDT 4YHHT 3T1YT 1J5ET 4GKKT 5IWAT 4JI0T 4NXNT 4DV3T 4DR5T 5BR8T 1XMQT 4LFBT 1XMOT 4GKJT 4LF9T 4DV4T 2HHHT 4LF4T 2UUAT 4B3TT 4YY3T 4JI5T 4DV6T 2UUCT 4KHPT 2UXBT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXC T;  4B3R T;  4JI2 T;  4JI6 T;  1N32 T;  1XNQ T;  4JI1 T;  1HR0 T;  3OTO T;  2F4V T;  4JI4 T;  4JYA T;  4DV5 T;  2ZM6 T;  4DR3 T;  4DUY T;  1FJG T;  1IBK T;  5LMN T;  1HNX T;  2E5L T;  4JI7 T;  4LF8 T;  3T1H T;  4JI8 T;  4B3S T;  4DR7 T;  4JI3 T;  4X65 T;  4DUZ T;  2VQF T;  1I94 T;  1IBL T;  4LF5 T;  4X62 T;  4DR1 T;  1N33 T;  4JV5 T;  4DR2 T;  1XNR T;  4AQY T;  1HNW T;  1HNZ T;  4OX9 T;  4NXM T;  4LF6 T;  4DR4 T;  4DV1 T;  4LF7 T;  4DV7 T;  1N34 T;  4LFC T;  5LMU T;  1IBM T;  2VQE T;  2UU9 T;  2UUB T;  4X64 T;  4K0K T;  1N36 T;  4DV2 T;  4DV0 T;  4B3M T;  4X66 T;  4LFA T;  4DR6 T;  2UXD T;  4YHH T;  3T1Y T;  1J5E T;  4GKK T;  5IWA T;  4JI0 T;  4NXN T;  4DV3 T;  4DR5 T;  5BR8 T;  1XMQ T;  4LFB T;  1XMO T;  4GKJ T;  4LF9 T;  4DV4 T;  2HHH T;  4LF4 T;  2UUA T;  4B3T T;  4YY3 T;  4JI5 T;  4DV6 T;  2UUC T;  4KHP T;  2UXB T; 
#chains in the Genus database with same CATH topology
 2V26 A;  2JQH A;  2C5I T;  4JI6 T;  1HG5 A;  1ZOY A;  3ZYM A;  4NIQ A;  1U5P A;  3EHZ A;  3N2G E;  3AEA A;  3AE1 A;  2KZ7 B;  3K8P C;  1WFD A;  3M65 A;  3ZJ2 A;  3IF8 B;  4H63 H;  4FI5 A;  4OYK A;  1M7K A;  4Q25 A;  1YW0 A;  1HF8 A;  1E7P A;  2DHR A;  4A97 A;  4I55 E;  1W9R A;  3K1S A;  1BR0 A;  4DR2 T;  4CI1 B;  2VWA A;  2CBI A;  2H89 A;  4HFV A;  5AQO B;  4EOZ B;  2IML A;  3CKD A;  4QX8 B;  5AQR B;  4I0U A;  3SFE A;  2YK0 A;  3ONL C;  2N2N A;  1N36 T;  3O1J A;  2HH7 A;  4DV0 T;  3G06 A;  1QUU A;  3VR9 A;  5IWA T;  3PUA A;  4DR5 T;  4IE4 A;  3FZL B;  5JDN A;  3HKE E;  1XMO T;  4UV8 B;  3ZMU B;  2BKO A;  4MHC A;  3FZF B;  3N2K E;  4LMJ A;  4IDQ A;  3UU5 A;  3CWZ B;  2IAK A;  2VVN A;  3H3A A;  4U2Z A;  3ZLI A;  4JYA T;  2BVL A;  4YTM A;  2XHE B;  3TLV A;  3UU3 A;  1HNX T;  2X68 A;  2CXF A;  1WR0 A;  3N9M A;  2A9U A;  4I50 E;  4IE5 A;  2YU1 A;  2X9W A;  1NWM X;  2J62 A;  4L5G A;  3WAK A;  4OHF A;  4ZZB A;  4ZZC A;  1UCU A;  3T8O A;  3U3I A;  3ABV A;  2ODV A;  4HFH A;  4WZX A;  1N33 T;  5LBM A;  4LML A;  3RIU C;  1BR4 A;  5LGN B;  2NW7 A;  3TLU A;  3O4X E;  2XM2 A;  3ZC1 A;  2EHO A;  3KVA A;  2W0G A;  2I59 A;  2XQ9 A;  3RX6 A;  4P1N A;  5C3J A;  5L4E A;  4X20 E;  5C2T A;  1LKX A;  3RH3 A;  4K0U A;  2JQ9 A;  2CHN A;  4YSX A;  2WDQ A;  3NRX A;  2V7L A;  2YKS A;  4Z8X A;  2FJA A;  2WMO A;  2BS2 A;  1WCR A;  1XDP A;  5IYZ E;  3BQK A;  4ASK A;  1KNP A;  4EXT A;  4GOU A;  3FBL A;  3ZMV B;  3CIR A;  3AEC A;  3CML A;  3AAE B;  2P9B A;  1L0V A;  3RQW A;  3IA3 A;  3AA1 B;  1MMD A;  5FXV A;  3LK3 B;  3TLT A;  1KK7 A;  4ERR A;  2V7J A;  1Y01 A;  4XAX B;  2VKD A;  2XQ7 A;  3RGL A;  3UUM A;  4Z91 A;  2BG9 C;  3KBU A;  1Z8U A;  2QRX A;  2NTY A;  3PUS A;  4AIS A;  1WRD A;  2X9H A;  3R6N A;  3AVR A;  4J2C A;  3RLF F;  4EAH A;  1CHU A;  5AQS B;  4DR4 T;  3DJB A;  4PJM A;  5CA0 E;  3PUZ F;  2LKH A;  4DV7 T;  3VKG A;  3O1H A;  3ZYK A;  5EZY E;  3PE0 A;  4PJN A;  4QKN A;  2VQE T;  1Z0P A;  1MIV A;  5DAB A;  5FVL A;  3GN5 A;  3ZT5 A;  4CZZ B;  4EZH A;  2XAF B;  4MLK A;  4EGW A;  2WDR A;  3ZN1 B;  4GK5 E;  2V1D B;  5F3J A;  2IW5 B;  4YTN A;  4UVB B;  3HR0 A;  4DV3 T;  2GK9 A;  4C90 A;  5LHI B;  4PJL A;  1XMQ T;  3PUG A;  4HFE A;  2WCA A;  4B3T T;  4IDN A;  2Y6X A;  3P4P A;  4P0B A;  2UUC T;  4Z90 A;  5LA6 E;  1I6Z A;  4GYR A;  4BA9 A;  2RPA A;  3OTO T;  4JI4 T;  3VRB A;  4U7I A;  1HX8 A;  5LMN T;  2X9Y A;  4MBQ A;  4CQI A;  2PBI A;  1MMN A;  2AE9 A;  5E0O A;  5FL0 A;  2E9X B;  2LE8 A;  1R8I A;  4QWN B;  5LJN A;  3RKO A;  1FIO A;  2D0U A;  3I9Y A;  2C0S A;  5FP3 A;  4ADZ A;  2KWH A;  2VQF T;  3FZH B;  3CK6 A;  4EYU A;  1HNW T;  3ZYL A;  3NRY A;  3X1D A;  1E2A A;  4JUY A;  4EZ4 A;  4IT4 A;  1UX4 A;  5JRC A;  2WZI A;  2J4G A;  5LMU T;  3JC6 C;  3Q5W A;  1ZV4 X;  2BVM A;  3RC8 A;  4QX7 B;  1MIW A;  4MAL A;  4E7Z A;  3FZK B;  4HFC A;  2X0Y A;  2UXD T;  4YXD A;  4YTP A;  4YJ2 E;  2FUP A;  3QOF A;  2NWB A;  2WWU A;  2WDV A;  2Q9Q A;  2XPK A;  5BR8 T;  5F5W A;  3HKC E;  5LYJ E;  2D0T A;  1NEK A;  2V5C A;  3JC6 D;  5ABH A;  2E8I A;  3Q9D A;  5FL1 A;  2UXC T;  1UX5 A;  5L3F B;  5LB7 B;  3I0O A;  4JI1 T;  4U3C A;  2XTL A;  3ZT7 A;  4DUY T;  4PK5 A;  2CRB A;  5H6Q B;  2ZMA A;  4YJ3 E;  2LSG A;  4JI3 T;  2LOP A;  3HKD E;  2K9A A;  5AFU L;  3S4U A;  3BQI A;  4QXH B;  3QB5 A;  2E2A A;  4L0R A;  3LBX B;  3RIF A;  2JMH A;  1D0X A;  3TLS A;  4ZI7 E;  5JR9 A;  5HEU A;  4PNI A;  3ZCJ A;  2LSI A;  3J9X 1;  2PTF A;  2KXP B;  2W2U A;  1J5W A;  4X66 T;  3LSV A;  4H9O C;  4PK4 A;  1Y64 B;  2MOZ A;  4HWC A;  3EUH A;  3RYF E;  3E0Z A;  2PG8 A;  5HEJ A;  3GWH A;  2QA7 A;  3F57 A;  4CI3 B;  4NPP A;  5AQH B;  2E9X C;  2FBW A;  5L3C B;  4GKJ T;  5AQG B;  3E22 E;  3GMI A;  4QH1 A;  2UXN B;  2YIN A;  4DV6 T;  2LLY A;  1BR1 A;  2XUE A;  1MND A;  2K5B B;  3AEB A;  2JIW A;  5AQF B;  2CE7 A;  2LM9 A;  2ZM2 A;  3MKD A;  2FJD A;  4ZI3 C;  3A8Y C;  5J0Z A;  1LVK A;  5L2L A;  4H9N C;  2ZM6 T;  2WP9 A;  4JEH B;  1NAF A;  1OWA A;  2E9X D;  3K3N A;  5GON E;  3VHL A;  4GYS A;  1VCT A;  2L9Q A;  3HA4 A;  4LF8 T;  1ZEE A;  3CVR A;  3RIA A;  5KDM C;  1IZN B;  2VL0 A;  2A3D A;  1IJ5 A;  3B57 A;  3UUB A;  4IE0 A;  5TAO A;  4YLH A;  4DUZ T;  1UK5 A;  3RKG A;  4G2A A;  3NZP A;  2QVA A;  5FMN A;  2Y8D A;  4ZI3 D;  2PFV A;  1LVF A;  1BR2 A;  1S94 A;  2LJL A;  4NXM T;  4HE8 A;  1KNR A;  2YU2 A;  4WW0 A;  2DLR A;  3M3Z B;  4V1A v;  4AQF A;  2V6Y B;  2YDS A;  2XSA A;  2W63 A;  3FZM B;  3PDY A;  4DR6 T;  4UVC B;  4CN1 A;  2FJE A;  2BBH A;  4DVD A;  4GK0 E;  3MZK B;  3ZT6 A;  4YHJ A;  3ZN0 B;  2ZM8 A;  2CMR A;  2LSY A;  4L9I A;  1U4Q A;  4A5X A;  3C4Z A;  2XAG B;  1O3X A;  3ETU A;  4I4T E;  2BG9 B;  5LGU B;  3TLW A;  2WQY A;  4JEU B;  4CN4 A;  2KND A;  5LP6 E;  1T8B A;  4UVA B;  1NEN A;  2BG9 E;  5AQL B;  2CM0 A;  4WNK A;  4AIU A;  3CQG B;  4F6R C;  4EYY R;  4YSY A;  2IIU A;  5HEG A;  2BS4 A;  3ZKR A;  3ZSS A;  3AE9 A;  4KBM B;  2K3W A;  2HPJ A;  3C4W A;  2FJB A;  4HKA A;  3AEG A;  1X9B A;  4B3S T;  4P0A A;  2LSJ A;  5FY7 A;  2V7K A;  4IDO A;  1FMW A;  2ACZ A;  3FBZ A;  4CI2 B;  3L09 A;  4U33 A;  3FB2 A;  3FXD B;  4QXB B;  1OED B;  4AQY T;  3A5X A;  2JJ9 A;  3JAF A;  4UF0 A;  3ETV A;  4OK0 A;  1OED E;  4PW8 A;  1W09 A;  2CLY B;  1S35 A;  2XQA A;  4DID B;  3P7I A;  5HEH A;  2J47 A;  1QSD A;  3RF1 A;  1OXZ A;  2LRL A;  3KV4 A;  1SE7 A;  3Q5X A;  2KIN B;  4ZS2 A;  4LFA T;  1KEY A;  5FY1 A;  1J5E T;  1YKH B;  3N2O A;  5AQT B;  4AI6 A;  3N9O A;  2XQ6 A;  4BJM A;  5JDL A;  1LRZ A;  2YOE A;  3VU7 H;  5HXR A;  2LSK A;  2RP4 A;  3C98 B;  4FJO A;  2UXB T;  5ABF A;  2LEH A;  4DMW A;  3N9P A;  3IBP A;  1W0A A;  2IHR 1;  5FKY A;  5HWY A;  2H7V C;  3FXE B;  1FEW A;  3ZST A;  2ES0 A;  3PUV F;  5LNK A;  3D0T A;  4G63 A;  2LKG A;  5JH7 E;  2XM1 A;  2LRK A;  2YDR A;  3AA6 B;  4U31 A;  3A7M A;  5FYM A;  3ONX A;  3ANW A;  4M1P A;  2M6B A;  3NBX X;  3OJA A;  5HXS A;  1IBL T;  4JV5 T;  1QLB A;  2OV9 A;  4EV6 A;  5IHY A;  3IEE A;  3AXJ A;  4O4I E;  4LF7 T;  3GA8 A;  1HTJ F;  2ACX A;  3C50 A;  3CPZ A;  3K3Q C;  3C51 A;  4ZI2 C;  3CX8 B;  4JBW F;  4PK6 A;  3RYC E;  2X0H A;  4NUV A;  1YKE B;  5LHH B;  5AQJ B;  3RRC A;  4ILC A;  4YHH T;  5HWX A;  4O2A E;  3MAC A;  2JQQ A;  2MYS A;  2YEV C;  1JNZ A;  3Q5E A;  3AVS A;  4LFB T;  4ZI2 D;  3LK4 2;  2VKH A;  2LM2 A;  3JCF A;  5HXH A;  3F2E A;  3PU3 A;  2XY8 B;  2DWG A;  3QK6 A;  4KHP T;  2LT3 A;  1IJ6 A;  2G0U A;  4PJJ A;  1OED C;  3RYH E;  2JRK A;  2W66 A;  4HWH A;  3AE7 A;  1M62 A;  3QNU A;  3I9W A;  1J1J A;  4AKR B;  5IUX A;  4TUY E;  4HFD A;  2CLY C;  3RIU A;  4JI7 T;  2BS3 A;  4ILB A;  3K3O A;  5CFB A;  3AE2 A;  4X65 T;  5C8Y E;  4ZS3 A;  3VR8 A;  3AA0 B;  3HKB E;  2BZB A;  2VL8 A;  3N5L A;  3RPU A;  2NOX A;  2VKO A;  2NTX A;  5KXJ A;  4LF6 T;  1FMV A;  5AQI B;  2WBL A;  4OYJ A;  2UXX B;  4CXW A;  4XZC A;  3NZQ A;  3C64 A;  3ZMS B;  4TV8 E;  5FY0 A;  3DTO A;  2XAJ B;  4KUM B;  2WMN A;  4IIJ E;  3ZCI A;  4C91 A;  4U74 A;  2MPK A;  3L3P A;  3Q5D A;  1WYC A;  2N1G A;  4X1Y E;  3ZPO A;  3LK2 B;  2KSR A;  1YXR A;  3RYI E;  2WU2 A;  2HHH T;  2XQ3 A;  3ZJ1 A;  4IE7 A;  4HWD A;  4TWD A;  1ZP0 A;  2W61 A;  4JI2 T;  5AQP B;  3UFG A;  2W67 A;  5HEO A;  3BK9 A;  1IBK T;  2EHO B;  3CX7 B;  2D9D A;  4TWF A;  2R6G F;  5HCJ A;  5J2U E;  1UUR A;  2CA5 A;  4XBF B;  3L8R A;  1EZ3 A;  3NWI A;  3MXZ A;  2JQK A;  4TNW A;  4H9S E;  4YT0 A;  1D1A A;  1T72 A;  4AXP A;  2WZH A;  1N34 T;  3PV0 F;  5JDF A;  1MIY A;  1IBM T;  2DL1 A;  2UU9 T;  2V8S V;  4X64 T;  2K48 A;  5LJM A;  5CA1 E;  2CXD A;  3LG7 A;  4DV2 T;  1VRB A;  4WYV A;  2SPC A;  4ZHQ E;  4QH4 A;  3WI3 A;  2IC9 A;  2IUB A;  3Q2M A;  2CWO A;  3UFE A;  3C4X A;  5FXX A;  3W15 B;  2UUA T;  4AKL A;  3RC3 A;  2QGS A;  1SUM B;  5CJ5 A;  4EED A;  1IAP A;  4IE6 A;  5HCM A;  1X79 A;  4X5T A;  3OYZ A;  4F8H A;  3H37 A;  4IL9 A;  4TNV A;  3PU8 A;  2NP9 A;  5LXT E;  2D5U A;  3IHR A;  3GN5 B;  4CXY A;  3LFM A;  5LOV E;  5M4Y A;  1YD8 G;  5JTG A;  3MA9 A;  2DNX A;  2YN6 A;  4QXC B;  5JDM A;  2X0L B;  3P4Q A;  5F8P A;  3AA7 B;  1HX1 B;  4P09 A;  1MMA A;  4ISS A;  2ZM0 A;  3AE4 A;  3OPC A;  4IDZ A;  5HAX A;  2VK9 A;  3FHN A;  2WWV A;  5ADX L;  1WR6 A;  4O4H E;  4COF A;  4B3M T;  3J7Y q;  1HS7 A;  4B6X A;  4O2B E;  4AQG A;  5JDH A;  2JMK A;  4MFR A;  1HG2 A;  3LJC A;  3RHW A;  2XZE A;  1MNE A;  2LHN A;  2EHO C;  3PUQ A;  4CN6 A;  4PFO A;  5DQW A;  4TWH A;  2HN2 A;  4DV4 T;  2H3R A;  4DND A;  3N9N A;  4HN9 A;  1YQ3 A;  2B76 A;  3PUY F;  4HWF A;  1XNQ T;  3EDU A;  4EEB A;  1G8X A;  4E7S A;  5KMG P;  5LG3 A;  2F4V T;  4A98 A;  3B13 A;  2EHO D;  3PTR B;  2KLQ A;  4JLE A;  2M6I A;  2DCF A;  3N9L A;  4KX6 A;  4IDP A;  5KX5 E;  5JRC B;  3AE5 A;  3QUJ A;  3KIN B;  4N78 D;  3SOL A;  3ZEF B;  2OA5 A;  1W0B A;  3PUW F;  3T1H T;  2H7O A;  3R84 B;  2VVS A;  5AQQ B;  4UV9 B;  4BAY B;  1B7T A;  3UU8 A;  1H7C A;  2Q9Q B;  2XQ8 A;  5AQV B;  2X66 A;  1VOM A;  4ILA A;  3EAB A;  3MK7 C;  1SHZ C;  5HYA A;  1US7 B;  3AE6 A;  4TV9 E;  2E9X A;  5HXE A;  3AED A;  4BJN A;  2XQ4 A;  4TN7 B;  4QH5 A;  3T1Y T;  4H63 V;  4UR9 A;  1CUN A;  2HN1 A;  2I0M A;  4NXN T;  3QC9 A;  3NVO A;  4GIW A;  2W4X A;  4ZXL A;  1UUS A;  2MTQ A;  3PJA A;  4YY3 T;  4JI5 T;  4YFS A;  3EAM A;  3UTK A;  1D0Y A;  3AE3 A;  4AKH A;  1KFY A;  4EIW A;  4IHJ E;  3CQX C;  3HL6 A;  1N32 T;  2Y48 B;  3PUR A;  3SRZ A;  4O8S A;  1AJ3 A;  1FJG T;  2WB5 A;  5JR9 B;  2RA1 A;  5A1L A;  2DI4 A;  2XAH B;  1D0Z A;  4DR7 T;  4HFB A;  1XWM A;  4UIG A;  2V5D A;  4PAG A;  1I94 T;  3KFW X;  4X62 T;  3RI5 A;  1YQ4 A;  1XZY A;  5LHG B;  2XAQ B;  2IC6 A;  2D2S A;  3PJA J;  2HPL A;  2K24 A;  2QYW A;  3HI2 A;  2UUB T;  5JVD E;  4K0K T;  4DBR A;  1ZHC A;  3O9X A;  1ZKE A;  2V7I A;  2KMF A;  3DP7 A;  4AKG A;  2CHO A;  4YSZ A;  4GKK T;  5AQM B;  3P50 A;  1DU2 A;  5CB4 E;  2IDO B;  2Z6E A;  1T7S A;  3BQL A;  3UUN A;  3V5S A;  2A72 A;  1G73 A;  3KV5 A;  5ETW A;  3LBX A;  5FXW A;  2L8K A;  3EI0 A;  5L3B B;  5EK3 A;  4UEM A;  1JNR A;  5LG4 A;  2Q9Q C;  4TZ4 C;  3ZC0 A;  4KHZ F;  5ABG A;  2AXD S;  5L3G B;  2BKP A;  4DR3 T;  1KNZ A;  3AB3 B;  2BBJ A;  4DBQ A;  5JDQ A;  4JI8 T;  3L39 A;  3VRA A;  4IL4 A;  5LGT B;  3UU6 A;  5L47 A;  2ODU A;  2Q9Q D;  2NW9 A;  4LF5 T;  4X1I E;  1XNR T;  3JAE A;  1HNZ T;  3I1A A;  2WM9 A;  4DV1 T;  1WLX A;  2E5V A;  5AQK B;  4QHO A;  3CX6 B;  3P4S A;  4IGU A;  3SS1 A;  1E1H B;  2J1D G;  3OYX A;  4TX5 A;  4LFC T;  3UU4 A;  4WBO A;  4HGA A;  3EDV A;  4IRE A;  4I43 B;  3UT5 E;  4IST A;  5BMV E;  1SA0 E;  3AEF A;  2XJ7 A;  3LDQ B;  5JR9 C;  5DJQ C;  4EB6 E;  2CWY A;  3TKL B;  3ZMZ B;  4H9P C;  5HXC A;  4LF4 T;  2X67 A;  3KBT A;  4HEA A;  3SFD A;  3UQ4 A;  4ILU A;  2V6Y A;  2YDQ A;  4DMV A;  3AAI A;  1HR0 T;  2C5J A;  2XQY A;  5AQU B;  4UF0 B;  4KP3 C;  2X51 A;  3AAA B;  3OBV E;  2CXL A;  4HWI B;  2CEA A;  3F31 A;  2E5L T;  3PUX F;  3UUX B;  2VB6 A;  2C5K T;  2N9D A;  3E08 A;  4HTE A;  4U7Y A;  3RQU A;  5ABE A;  3OVU A;  2X9X A;  2XQ5 A;  2PJQ A;  2BG9 A;  2WY2 A;  5JRE A;  2LOS A;  3NKZ A;  2I6H A;  5JDG A;  3H3M A;  3MJX A;  1D1B A;  1V9D A;  2BKN A;  2CPT A;  3RRW A;  2NR4 A;  4OX9 T;  2V6X A;  5LCY A;  1HCI A;  4A56 A;  4AKI A;  3QB5 K;  2B1E A;  3AEE A;  5FNV E;  5ABF B;  2MAW A;  4H9R C;  5AQN B;  3UQ7 A;  2VKJ A;  2W00 A;  3P4W A;  2LHR A;  3ESL A;  3N9Q A;  4NUU A;  4JI0 T;  3B5M A;  3O1I A;  2H88 A;  5L3E B;  1KF6 A;  3UUL A;  1OED A;  3AE8 A;  2WSS V;  4AQF C;  4LF9 T;  5JQG E;  5LBQ B;  5J1G A;  5L4H A;  4U2Y A;  3ANW B;  3CQC B;  4B3R T;  3EVY A;  3I0Q A;  3WAJ A;  3JAD A;  3AXJ B;  4WBN E;  2CCQ A;  1MMG A;  1HFA A;  4DO0 A;  4DV5 T;  2M67 A;  2XSB A;  4H9Q C;  2W62 A;  3SWH A;  5J2T E;  2MBG A;  4LMK A;  4U72 A;  2WS3 A;  3KV9 A;  4HFI A;  1T98 A;  4PFP A;  3ZMT B;  2VAS A;  2L3L A;  3V5U A;  4DR1 T;  4KMC A;  5EK2 A;  3VKH A;  4ZOL E;  3KVB A;  1XDO A;  4UEL A;  5DQV A;  4ZEY A;  4O4L E;  2OLT A;  1VCS A;  5L3D B;  2CBJ A;  4O4J E;  2JPF A;  3ONJ A;  3P4R A;  2WAU A;  5EK4 A;  2VUR A;  2ZLY A;  2BDE A;  5CGM A;  2WU5 A;  5FXZ A;  4KI0 F;  3P8C D;  2DWK A;  2XAS B;  2KWI B;  1WYB A;  4X1K E;  2NW8 A;  3U78 A;  4OFZ A;  1UGO A;  5FVK A;  1GQE A;  2V7M A;  4UXN B;  2KT9 A;  4ANJ A;  2A2F X;  5H6R B;  4CXX A;  3KDS E;  3KV6 A;  3OKQ A;  1D1C A; 
#chains in the Genus database with same CATH homology
 2UXC T;  4B3R T;  4JI2 T;  4JI6 T;  1N32 T;  1XNQ T;  4JI1 T;  1HR0 T;  3OTO T;  2F4V T;  4JI4 T;  4JYA T;  4DV5 T;  2ZM6 T;  4DR3 T;  4DUY T;  1FJG T;  1IBK T;  5LMN T;  1HNX T;  2E5L T;  4JI7 T;  4LF8 T;  3T1H T;  4JI8 T;  4B3S T;  4DR7 T;  4JI3 T;  4X65 T;  4DUZ T;  2VQF T;  1I94 T;  1IBL T;  4LF5 T;  4X62 T;  4DR1 T;  1N33 T;  4JV5 T;  4DR2 T;  1XNR T;  4AQY T;  1HNW T;  1HNZ T;  4OX9 T;  4NXM T;  4LF6 T;  4DR4 T;  4DV1 T;  4LF7 T;  4DV7 T;  1N34 T;  4LFC T;  5LMU T;  1IBM T;  2VQE T;  2UU9 T;  2UUB T;  4X64 T;  4K0K T;  1N36 T;  4DV2 T;  4DV0 T;  4B3M T;  4X66 T;  4LFA T;  4DR6 T;  2UXD T;  4YHH T;  3T1Y T;  1J5E T;  4GKK T;  5IWA T;  4JI0 T;  4NXN T;  4DV3 T;  4DR5 T;  5BR8 T;  1XMQ T;  4LFB T;  1XMO T;  4GKJ T;  4LF9 T;  4DV4 T;  2HHH T;  4LF4 T;  2UUA T;  4B3T T;  4YY3 T;  4JI5 T;  4DV6 T;  2UUC T;  4KHP T;  2UXB T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...