3OTOT

Crystal structure of the 30s ribosomal subunit from a ksga mutant of thermus thermophilus (hb8)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Modification of 16S ribosomal RNA by the KsgA methyltransferase restructures the 30S subunit to optimize ribosome function.
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2010-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 3otoT00
4LFAT 5LMNT 4DV7T 1I94T 1HNWT 4LF4T 1J5ET 4JI5T 4DV5T 4LF5T 4JYAT 4X65T 5IWAT 3T1HT 1HNXT 1N34T 4JI8T 4JI0T 4JI7T 4YY3T 3T1YT 3OTOT 1IBKT 4LF9T 4DV3T 4DV4T 4DUZT 5BR8T 4OX9T 2UU9T 5LMUT 4B3RT 4DR2T 4YHHT 4X64T 4DV0T 4X66T 4LF7T 4LFCT 4JI4T 2UXBT 2HHHT 2F4VT 4KHPT 4DR6T 2UXCT 4LF8T 2UUAT 1XNQT 4K0KT 1FJGT 4NXNT 4DR7T 4DUYT 4DV1T 4B3TT 1XMQT 1IBLT 4DR1T 4JI2T 4DV2T 4GKJT 1N36T 4LFBT 2UUCT 2E5LT 2UXDT 1HNZT 4NXMT 2UUBT 4B3ST 4JV5T 2VQFT 4JI3T 4DV6T 1XMOT 4DR3T 2VQET 4B3MT 4LF6T 2ZM6T 1HR0T 4GKKT 1XNRT 4JI1T 4AQYT 1N32T 4DR5T 4X62T 1IBMT 4DR4T 1N33T 4JI6T
chains in the Genus database with same CATH superfamily
4QH5A 3K3OA 2XAHB 4OYJA 5LP6E 4DMVA 4DV5T 2IW5B 3GA8A 3TLSA 3GN5B 5IWAT 2KWHA 2X9XA 1L0VA 2JMKA 2BKNA 4TX5A 2WM9A 2G0UA 4ILUA 3DTOA 4O2AE 5LGTB 5JVDE 5FYMA 5JREA 3AE2A 4QH1A 2ZM2A 2NTYA 3EVYA 3CQCB 1ZEEA 4PJJA 4LF7T 3ETUA 2XHEB 1B7TA 2XTLA 4HWIB 4TV9E 5JDFA 5JQGE 5KXJA 3R84B 3P4PA 2X0YA 4AQGA 4DV1T 2XQ3A 2KXPB 3ZCIA 5HXRA 1WYBA 3AA7B 1OEDC 2JQ9A 3AEBA 5LHGB 4EIWA 4ASKA 2YOEA 4B3MT 3V5UA 1VCSA 3RX6A 2WMNA 1FMWA 5JDNA 3P4WA 2LKGA 5EK2A 4ZI2C 1VOMA 4IE7A 1EZ3A 2VKHA 3HI2A 4AQFC 4WBNE 4ZEYA 3QK6A 4IDPA 3N9QA 5AQUB 2LLYA 4KI0F 2OA5A 2C5KT 2J47A 3N2KE 3AAEB 5AQPB 4NUVA 4DIDB 3LDQB 3LK2B 2V6XA 2Y6XA 2CA5A 3IF8B 1IBKT 3JC6D 1IJ5A 2ODVA 2H88A 4COFA 1O3XA 4PW8A 4PFPA 2NWBA 3FBZA 5E0OA 1HCIA 4U3CA 5L3CB 3ONJA 3UUNA 3SWHA 2VL0A 3AE6A 2XQAA 3ZSTA 3RRCA 1WCRA 5JRCA 5HCMA 2HN2A 3TLVA 3NWIA 2CEAA 1GQEA 1U4QA 3PTRB 1XNQT 4H9QC 3F2EA 4H9SE 2YDSA 3SFEA 2I0MA 3QNUA 3DP7A 2JIWA 4DUYT 2N1GA 3PURA 1XMQT 5AQMB 4DV2T 3RRWA 2ACZA 5FKYA 2WQYA 2ACXA 3SOLA 2W61A 2WWVA 3LFMA 3OPCA 2MBGA 3E22E 5C2TA 4GKKT 3S4UA 2BVLA 2LSGA 4I50E 4YHJA 2X0LB 4I55E 5HXCA 4YTNA 4ZI3D 4X62T 2EHOD 5FMNA 5ETWA 2VVNA 3LBXA 2E9XA 1CUNA 5LGUB 2BDEA 2ZM0A 4U74A 4HKAA 5F3JA 1T7SA 4LF5T 1IJ6A 3RIAA 5HEHA 3UU3A 3J7Yq 2LHRA 4HFCA 5AQFB 5CA1E 2DHRA 4KMCA 1BR0A 5F8PA 4QX7B 2X68A 3EI0A 1JNZA 1W9RA 3VU7H 3QC9A 3PJAJ 4TN7B 4H63V 4ZZBA 1QSDA 2CXDA 4UR9A 3C4XA 2V7KA 4AKLA 2DLRA 4DR2T 4L9IA 3AVRA 3ONLC 3AECA 2RPAA 4IE0A 3NKZA 3RYFE 3AAIA 4KBMB 4GYSA 3R6NA 3L39A 2W2UA 1YXRA 2FBWA 2QA7A 3NZPA 2WCAA 4H9NC 3AA6B 3CPZA 5HEOA 3W15B 3UT5E 3K3NA 3C98B 2MTQA 2BS3A 2V5CA 4CXYA 5EK3A 4ADZA 3CX8B 2YN6A 2BBJA 3LJCA 5AQIB 4JUYA 5IUXA 1HF8A 3PUGA 2DCFA 3A8YC 4PJNA 4LFAT 1OEDA 2FJAA 3AE1A 5LMNT 3AXJA 1ZHCA 3QB5A 1VCTA 2Z6EA 4HGAA 3C4ZA 4I0UA 2NTXA 3T1YT 4CZZB 3PUQA 2J4GA 4AQFA 2CWYA 4IE4A 3TLWA 2JJ9A 4UV9B 1NENA 1HG5A 2XAFB 3GN5A 4DBQA 2KT9A 3ZC0A 4F6RC 3P8CD 4CI3B 3AE9A 2LM2A 3D0TA 3ANWB 2UUAT 2VL8A 1FJGT 3I0OA 2XAGB 4ILBA 5KDMC 1KEYA 3AEGA 3ZT5A 4EZHA 1XWMA 1LVKA 4ZXLA 3TKLB 1IBLT 2CRBA 1J1JA 3ZMSB 1N36T 3CQGB 4AIUA 1Y64B 2YK0A 1HNZT 4P0BA 1UGOA 1FEWA 2PTFA 3M65A 5HEGA 1ZP0A 4ILCA 1IBMT 3ETVA 5DQVA 5ABEA 5AQHB 5FY1A 3LBXB 1G73A 3MJXA 2IDOB 4UV8B 3G06A 1KNZA 2V7MA 3KV4A 4NUUA 1MMAA 1LKXA 2V6YB 1YQ3A 4XBFB 4H9RC 4HE8A 3LG7A 4BJNA 2XM2A 4BAYB 3LK3B 1IAPA 5FXXA 1MNEA 3CMLA 2XQYA 4NXNT 3N9NA 5AFUL 2WU2A 1J5WA 2NW8A 3Q5EA 2H89A 3L3PA 2X0HA 2WZHA 2ZLYA 1S35A 3UUBA 4O4JE 3IHRA 1YW0A 5AQOB 3B57A 4QHOA 2K9AA 5M4YA 2Q9QD 3CIRA 4YXDA 2LT3A 4YFSA 1XNRT 1HS7A 4J2CA 3OKQA 3AE3A 5J1GA 4E7SA 3VRAA 2A9UA 2JMHA 4XAXB 4O8SA 3ESLA 3PE0A 1HNWT 4LF4T 2IMLA 3N9PA 4G2AA 1KNPA 3UUXB 2BBHA 5AQVB 2BKPA 5LBMA 2V5DA 3HL6A 4O4HE 5GONE 4JI8T 3BQKA 3RGLA 4JI7T 3UQ7A 3ZC1A 2HPLA 2LSYA 4ERRA 1SE7A 4DV4T 3M3ZB 4PJMA 4AKGA 2V26A 4B3RT 3ZYKA 5L4HA 2KLQA 5LG3A 5AQJB 2YU1A 4PJLA 2WDRA 2HHHT 5IHYA 4KHPT 5FP3A 4V1Av 2X51A 1NAFA 4MFRA 1HX1B 3H3MA 3HR0A 3UFGA 3KINB 3FHNA 2W4XA 3ZMZB 4HN9A 3VKGA 2KINB 5AQTB 2N9DA 5ABHA 3FBLA 3FXEB 2L3LA 5HWYA 4HTEA 4IHJE 3O1JA 2VKDA 4IL4A 3OYZA 3PJAA 3CWZB 5L2LA 3RC8A 1I6ZA 4YTMA 4Z8XA 3QB5K 4HWHA 3WAJA 5KX5E 4KX6A 2D0UA 4DR4T 4WNKA 3Q2MA 2IHR1 3FXDB 2WBLA 3EUHA 3U3IA 4DV7T 4PK4A 3RIUC 4ISSA 4A97A 5H6QB 5LYJE 2JQKA 5LCYA 3T8OA 5EK4A 2DWGA 4IDQA 2FJBA 3A7MA 2LEHA 1E1HB 2X67A 3CQXC 3C50A 4X1KE 1HFAA 4IE6A 2WAUA 1NWMX 3RLFF 3MK7C 4IDZA 2UU9T 4YSYA 2FJEA 4GK5E 2V1DB 3TLUA 1D1BA 2XQ6A 3RYIE 4U33A 4CXWA 2QYWA 5C3JA 4QH4A 2CBJA 4FI5A 5LA6E 4MALA 3PUXF 3PUAA 1ZOYA 4DR7T 1X79A 1FIOA 3AA0B 5LOVE 4ZS2A 3SFDA 2K48A 1H7CA 3OVUA 3ANWA 3VR8A 2E5LT 2D5UA 1E7PA 2W66A 1UUSA 3JAEA 4DV6T 1Y01A 2K3WA 2XY8B 3FB2A 2VQET 1HR0T 2XQ5A 5HAXA 2OLTA 2E9XD 3RYHE 3KV5A 5L47A 3ZPOA 4QXHB 3RKOA 1R8IA 2N2NA 3ZLIA 4NPPA 2CE7A 2PFVA 1MMDA 1ZV4X 5FY0A 3AE8A 2WS3A 4MLKA 4N78D 4DV3T 5DABA 3X1DA 2L8KA 5FVKA 4BJMA 4JI4T 3AEDA 4IL9A 4AKIA 4WYVA 1DU2A 2F4VT 4JBWF 3UU8A 2BS2A 3CKDA 3C64A 4YLHA 3HKDE 2V6YA 3O9XA 3ZSSA 2KNDA 2W00A 4TZ4C 5AQNB 4AKRB 3FZFB 4LMJA 3CX6B 3OJAA 4JI2T 2VVSA 2YINA 2EHOA 2DNXA 3AA1B 4DO0A 4EOZB 4UELA 3ZJ2A 2XPKA 4X1YE 2IUBA 3IA3A 2H7VC 3NZQA 2OV9A 5JDQA 3CVRA 3U78A 2BKOA 4I43B 4UVBB 3ZMUB 3Q5XA 4L5GA 4JEHB 2CXLA 2K5BB 1I94T 3MZKB 5CFBA 1J5ET 3H37A 3TLTA 1UX4A 4QXBB 2NOXA 2Y48B 4ZI2D 1US7B 4HWCA 3I0QA 4Z91A 2FUPA 2JQQA 3UFEA 4DVDA 4HWDA 2R6GF 3N2GE 4TWHA 4YY3T 2LHNA 2MOZA 3I1AA 4O4LE 3MXZA 5JDLA 3EDUA 4LF9T 4DUZT 4PNIA 3RIUA 2XAQB 5AQGB 4DBRA 3QOFA 4QWNB 2WY2A 5LMUT 4YHHT 3VKHA 1UK5A 4DMWA 4WZXA 2XQ7A 2IC9A 2W67A 3AEEA 1D0ZA 5JDGA 5L3DB 3L8RA 4C90A 5FY7A 2VASA 2XZEA 4H9OC 2LM9A 2WWUA 2CBIA 2M6BA 2I59A 4B3TT 3PDYA 4WW0A 3PUWF 4UVCB 1LVFA 2IIUA 2UUCT 4P1NA 3OYXA 3F31A 2VKJA 2UXDT 4TWDA 3ZT6A 4EEBA 3JADA 4JEUB 2QRXA 1YKEB 5C8YE 4JV5T 4L0RA 4KHZF 4IDOA 3AVSA 4NIQA 3PUZF 2ZM6T 4ISTA 3ZKRA 3K3QC 2XJ7A 3P4RA 4AQYT 1Z0PA 3C51A 4H9PC 2QGSA 4IREA 2RA1A 1MMGA 4AI6A 1U5PA 1Z8UA 2P9BA 4JI5T 4EZ4A 2J1DG 5LBQB 4YSXA 3HKBE 5BMVE 4HFIA 4A5XA 1V9DA 4E7ZA 5CJ5A 3OBVE 4FJOA 4HFDA 4CI2B 3UU5A 4OX9T 2KSRA 3KDSE 5KMGP 4DV0T 3EDVA 3PU8A 2WZIA 4EYUA 2CHNA 2WU5A 3O1IA 2WP9A 4U31A 4GK0E 5L3BB 2VWAA 3O1HA 4AISA 2YEVC 3ABVA 5FNVE 4X5TA 4X20E 1BR2A 1G8XA 3AE5A 2L9QA 3NVOA 3KBUA 5HEJA 3O4XE 5TAOA 2D9DA 4U7YA 1T8BA 4EV6A 2LSKA 2UUBT 5ABFA 2EHOB 4ZZCA 5FL1A 2IC6A 3F57A 4MBQA 3SRZA 5HCJA 1M7KA 2I6HA 2MAWA 2B1EA 1BR1A 4JI6T 4HFHA 1KF6A 3KVBA 3NBXX 2QVAA 3P4SA 1SA0E 3JC6C 2DWKA 1D0YA 3IEEA 2CLYB 5HEUA 1NEKA 3OTOT 3HA4A 1WR0A 4OYKA 3RF1A 2LRKA 5FVLA 2VB6A 5AQQB 2ODUA 4X64T 4P0AA 3RQUA 2UXBT 2WDQA 4CN6A 4XZCA 4IT4A 3MA9A 2XM1A 4DNDA 1HTJF 2YKSA 2X9HA 3AE4A 4K0KT 1WFDA 2NR4A 3I9WA 3E0ZA 1LRZA 3P50A 3RH3A 4KUMB 1HG2A 2M6IA 4ZI3C 2V7JA 3B5MA 2H3RA 2YDRA 2EHOC 4U2YA 2XQ4A 1MNDA 4LF6T 2Y8DA 3KVAA 2LSIA 4TV8E 4UXNB 1N33T 2B76A 2FJDA 2D2SA 2PJQA 4PK6A 3Q5DA 2LE8A 3T1HT 2CHOA 2DL1A 2KZ7B 3EHZA 4Z90A 5ADXL 5JDMA 3EAMA 3RHWA 4JI0T 2CLYC 1WRDA 3ZJ1A 4GYRA 1XDOA 4UVAB 2PBIA 2KMFA 3AE7A 5L3FB 1D1AA 5LJNA 3C4WA 3AB3B 3ZYLA 4HFBA 2A3DA 4BA9A 5A1LA 2YU2A 3IBPA 2X9YA 3NRYA 2PG8A 5CB4E 2HH7A 4HWFA 1OXZA 4MHCA 5L3GB 3PV0F 3JAFA 3LSVA 5F5WA 2RP4A 3KV9A 2LSJA 1CHUA 2SPCA 1XZYA 2ZM8A 3FZMB 3ZMTB 4ILAA 5LHIB 4U7IA 3RYCE 2V7IA 5ABFB 2W62A 2YDQA 2WSSV 5H6RB 1QLBA 4EB6E 2WB5A 4B6XA 2CPTA 1N32T 3GWHA 5LHHB 3N9OA 2CXFA 1KFYA 4YT0A 2JRKA 3N2OA 3PUVF 4TNWA 2XSBA 4IGUA 5FXVA 3KV6A 4LMLA 2NP9A 3P7IA 3ZMVB 2LOSA 3PUYF 4OHFA 2HPJA 4X1IE 5HXSA 1SUMB 4LMKA 3BK9A 2BG9B 2BG9E 3VR9A 4CQIA 4HFEA 1ZKEA 2LRLA 2XASB 2CCQA 2XSAA 5JDHA 1OWAA 5L4EA 4C91A 3N9MA 1MMNA 1BR4A 1X9BA 3HKCE 3RIFA 3UQ4A 2BS4A 5JH7E 5LGNB 4JLEA 2V7LA 5JR9B 3FZKB 4UIGA 5HXEA 2LKHA 1VRBA 4YTPA 5HYAA 1W0BA 5DQWA 4GKJT 4K0UA 3RI5A 5J2UE 2Q9QB 2C5IT 4LFBT 1D0XA 3V5SA 4U72A 2X9WA 4TWFA 1D1CA 4A56A 1MIYA 1FMVA 1SHZC 3N5LA 5FXWA 5CGMA 4I4TE 1YQ4A 2UXXB 1MIWA 4EYYR 5LJMA 4Q25A 4CXXA 4X65T 1M62A 3KFWX 1HNXT 2DI4A 4ZS3A 4GIWA 2BG9C 4UEMA 4U2ZA 5L3EB 5J2TE 1WR6A 2GK9A 4QKNA 2XAJB 4LFCT 3I9YA 1UX5A 2BVMA 5LNKA 4TNVA 2WMOA 4LF8T 2D0TA 3L09A 5JR9C 3B13A 3CK6A 3LK42 2VK9A 5HWXA 3KBTA 5FL0A 5EZYE 2XQ8A 2Q9QC 4YJ2E 3HKEE 4G63A 1T98A 2CWOA 1QUUA 2HN1A 3GMIA 5AQRB 1XMOT 5J0ZA 3JCFA 2KWIB 2VURA 4UF0A 3UUMA 1YD8G 3DJBA 3ZEFB 3FZLB 3ZN0B 3AEAA 3SS1A 1KNRA 1WLXA 2MPKA 5AQSB 4QX8B 3EABA 2A72A 1W0AA 2UXNB 3AEFA 3PUSA 2AXDS 2XUEA 3K8PC 4PAGA 2E8IA 4YSZA 2WDVA 4HFVA 3VHLA 2ES0A 5JRCB 2W63A 2VKOA 1JNRA 3NRXA 4GOUA 3J9X1 5BR8T 4YJ3E 1KK7A 3A5XA 4QXCB 2E5VA 2LOPA 3FZHB 2LJLA 4A98A 4DR6T 4F8HA 3UU4A 2AE9A 1S94A 2XQ9A 1IZNB 4O4IE 3N9LA 3Q9DA 4O2BE 2C5JA 4AKHA 1UCUA 1UURA 1WYCA 1HX8A 2ZMAA 5FXZA 4EXTA 3E08A 4OFZA 3UULA 3WI3A 2NW7A 4PK5A 2E9XB 2VQFT 1W09A 4HEAA 5AQKB 2JQHA 4JI1T 5JTGA 5HXHA 2C0SA 3RPUA 4ZOLE 5AQLB 2CMRA 1MIVA 5LXTE 2H7OA 1AJ3A 4PFOA 2BZBA 3WAKA 4JYAT 4P09A 5LB7B 3Q5WA 3MKDA 4M1PA 1N34T 5LG4A 4IIJE 3K1SA 2CM0A 2X66A 3P4QA 3UU6A 4H63H 3VRBA 2A2FX 3MACA 4ZHQE 5ABGA 5IYZE 3AAAB 4CN1A 4X66T 2E2AA 4IDNA 1T72A 2K24A 2MYSA 3CX7B 4AXPA 1E2AA 2BG9A 3BQLA 3ZCJA 4EEDA 4ANJA 2M67A 4CI1B 2UXCT 2IAKA 3RKGA 3QUJA 2V8SV 4OK0A 4WBOA 4DR1T 3BQIA 2J62A 3ZYMA 4IE5A 3PU3A 5CA0E 4EGWA 4EAHA 1OEDB 1OEDE 4KP3C 4NXMT 2E9XC 4B3ST 3RC3A 1XDPA 5JR9A 4CN4A 4JI3T 2W0GA 3AXJB 3UTKA 3ZT7A 3ZN1B 4DR3T 3RQWA 1YKHB 4UF0B 2JPFA 5DJQC 2NW9A 3H3AA 2Q9QA 4TUYE 4DR5T 4ZI7E 3ONXA
chains in the Genus database with same CATH topology
4LFAT 5LMNT 4DV7T 1I94T 1HNWT 4LF4T 1J5ET 4JI5T 4DV5T 4LF5T 4JYAT 4X65T 5IWAT 3T1HT 1HNXT 1N34T 4JI8T 4JI0T 4JI7T 4YY3T 3T1YT 3OTOT 1IBKT 4LF9T 4DV3T 4DV4T 4DUZT 5BR8T 4OX9T 2UU9T 5LMUT 4B3RT 4DR2T 4YHHT 4X64T 4DV0T 4X66T 4LF7T 4LFCT 4JI4T 2UXBT 2HHHT 2F4VT 4KHPT 4DR6T 2UXCT 4LF8T 2UUAT 1XNQT 4K0KT 1FJGT 4NXNT 4DR7T 4DUYT 4DV1T 4B3TT 1XMQT 1IBLT 4DR1T 4JI2T 4DV2T 4GKJT 1N36T 4LFBT 2UUCT 2E5LT 2UXDT 1HNZT 4NXMT 2UUBT 4B3ST 4JV5T 2VQFT 4JI3T 4DV6T 1XMOT 4DR3T 2VQET 4B3MT 4LF6T 2ZM6T 1HR0T 4GKKT 1XNRT 4JI1T 4AQYT 1N32T 4DR5T 4X62T 1IBMT 4DR4T 1N33T 4JI6T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFA T;  5LMN T;  4DV7 T;  1I94 T;  1HNW T;  4LF4 T;  1J5E T;  4JI5 T;  4DV5 T;  4LF5 T;  4JYA T;  4X65 T;  5IWA T;  3T1H T;  1HNX T;  1N34 T;  4JI8 T;  4JI0 T;  4JI7 T;  4YY3 T;  3T1Y T;  3OTO T;  1IBK T;  4LF9 T;  4DV3 T;  4DV4 T;  4DUZ T;  5BR8 T;  4OX9 T;  2UU9 T;  5LMU T;  4B3R T;  4DR2 T;  4YHH T;  4X64 T;  4DV0 T;  4X66 T;  4LF7 T;  4LFC T;  4JI4 T;  2UXB T;  2HHH T;  2F4V T;  4KHP T;  4DR6 T;  2UXC T;  4LF8 T;  2UUA T;  1XNQ T;  4K0K T;  1FJG T;  4NXN T;  4DR7 T;  4DUY T;  4DV1 T;  4B3T T;  1XMQ T;  1IBL T;  4DR1 T;  4JI2 T;  4DV2 T;  4GKJ T;  1N36 T;  4LFB T;  2UUC T;  2E5L T;  2UXD T;  1HNZ T;  4NXM T;  2UUB T;  4B3S T;  4JV5 T;  2VQF T;  4JI3 T;  4DV6 T;  1XMO T;  4DR3 T;  2VQE T;  4B3M T;  4LF6 T;  2ZM6 T;  1HR0 T;  4GKK T;  1XNR T;  4JI1 T;  4AQY T;  1N32 T;  4DR5 T;  4X62 T;  1IBM T;  4DR4 T;  1N33 T;  4JI6 T; 
#chains in the Genus database with same CATH topology
 4QH5 A;  3K3O A;  2XAH B;  4OYJ A;  5LP6 E;  4DMV A;  4DV5 T;  2IW5 B;  3GA8 A;  3TLS A;  3GN5 B;  5IWA T;  2KWH A;  2X9X A;  1L0V A;  2JMK A;  2BKN A;  4TX5 A;  2WM9 A;  2G0U A;  4ILU A;  3DTO A;  4O2A E;  5LGT B;  5JVD E;  5FYM A;  5JRE A;  3AE2 A;  4QH1 A;  2ZM2 A;  2NTY A;  3EVY A;  3CQC B;  1ZEE A;  4PJJ A;  4LF7 T;  3ETU A;  2XHE B;  1B7T A;  2XTL A;  4HWI B;  4TV9 E;  5JDF A;  5JQG E;  5KXJ A;  3R84 B;  3P4P A;  2X0Y A;  4AQG A;  4DV1 T;  2XQ3 A;  2KXP B;  3ZCI A;  5HXR A;  1WYB A;  3AA7 B;  1OED C;  2JQ9 A;  3AEB A;  5LHG B;  4EIW A;  4ASK A;  2YOE A;  4B3M T;  3V5U A;  1VCS A;  3RX6 A;  2WMN A;  1FMW A;  5JDN A;  3P4W A;  2LKG A;  5EK2 A;  4ZI2 C;  1VOM A;  4IE7 A;  1EZ3 A;  2VKH A;  3HI2 A;  4AQF C;  4WBN E;  4ZEY A;  3QK6 A;  4IDP A;  3N9Q A;  5AQU B;  2LLY A;  4KI0 F;  2OA5 A;  2C5K T;  2J47 A;  3N2K E;  3AAE B;  5AQP B;  4NUV A;  4DID B;  3LDQ B;  3LK2 B;  2V6X A;  2Y6X A;  2CA5 A;  3IF8 B;  1IBK T;  3JC6 D;  1IJ5 A;  2ODV A;  2H88 A;  4COF A;  1O3X A;  4PW8 A;  4PFP A;  2NWB A;  3FBZ A;  5E0O A;  1HCI A;  4U3C A;  5L3C B;  3ONJ A;  3UUN A;  3SWH A;  2VL0 A;  3AE6 A;  2XQA A;  3ZST A;  3RRC A;  1WCR A;  5JRC A;  5HCM A;  2HN2 A;  3TLV A;  3NWI A;  2CEA A;  1GQE A;  1U4Q A;  3PTR B;  1XNQ T;  4H9Q C;  3F2E A;  4H9S E;  2YDS A;  3SFE A;  2I0M A;  3QNU A;  3DP7 A;  2JIW A;  4DUY T;  2N1G A;  3PUR A;  1XMQ T;  5AQM B;  4DV2 T;  3RRW A;  2ACZ A;  5FKY A;  2WQY A;  2ACX A;  3SOL A;  2W61 A;  2WWV A;  3LFM A;  3OPC A;  2MBG A;  3E22 E;  5C2T A;  4GKK T;  3S4U A;  2BVL A;  2LSG A;  4I50 E;  4YHJ A;  2X0L B;  4I55 E;  5HXC A;  4YTN A;  4ZI3 D;  4X62 T;  2EHO D;  5FMN A;  5ETW A;  2VVN A;  3LBX A;  2E9X A;  1CUN A;  5LGU B;  2BDE A;  2ZM0 A;  4U74 A;  4HKA A;  5F3J A;  1T7S A;  4LF5 T;  1IJ6 A;  3RIA A;  5HEH A;  3UU3 A;  3J7Y q;  2LHR A;  4HFC A;  5AQF B;  5CA1 E;  2DHR A;  4KMC A;  1BR0 A;  5F8P A;  4QX7 B;  2X68 A;  3EI0 A;  1JNZ A;  1W9R A;  3VU7 H;  3QC9 A;  3PJA J;  4TN7 B;  4H63 V;  4ZZB A;  1QSD A;  2CXD A;  4UR9 A;  3C4X A;  2V7K A;  4AKL A;  2DLR A;  4DR2 T;  4L9I A;  3AVR A;  3ONL C;  3AEC A;  2RPA A;  4IE0 A;  3NKZ A;  3RYF E;  3AAI A;  4KBM B;  4GYS A;  3R6N A;  3L39 A;  2W2U A;  1YXR A;  2FBW A;  2QA7 A;  3NZP A;  2WCA A;  4H9N C;  3AA6 B;  3CPZ A;  5HEO A;  3W15 B;  3UT5 E;  3K3N A;  3C98 B;  2MTQ A;  2BS3 A;  2V5C A;  4CXY A;  5EK3 A;  4ADZ A;  3CX8 B;  2YN6 A;  2BBJ A;  3LJC A;  5AQI B;  4JUY A;  5IUX A;  1HF8 A;  3PUG A;  2DCF A;  3A8Y C;  4PJN A;  4LFA T;  1OED A;  2FJA A;  3AE1 A;  5LMN T;  3AXJ A;  1ZHC A;  3QB5 A;  1VCT A;  2Z6E A;  4HGA A;  3C4Z A;  4I0U A;  2NTX A;  3T1Y T;  4CZZ B;  3PUQ A;  2J4G A;  4AQF A;  2CWY A;  4IE4 A;  3TLW A;  2JJ9 A;  4UV9 B;  1NEN A;  1HG5 A;  2XAF B;  3GN5 A;  4DBQ A;  2KT9 A;  3ZC0 A;  4F6R C;  3P8C D;  4CI3 B;  3AE9 A;  2LM2 A;  3D0T A;  3ANW B;  2UUA T;  2VL8 A;  1FJG T;  3I0O A;  2XAG B;  4ILB A;  5KDM C;  1KEY A;  3AEG A;  3ZT5 A;  4EZH A;  1XWM A;  1LVK A;  4ZXL A;  3TKL B;  1IBL T;  2CRB A;  1J1J A;  3ZMS B;  1N36 T;  3CQG B;  4AIU A;  1Y64 B;  2YK0 A;  1HNZ T;  4P0B A;  1UGO A;  1FEW A;  2PTF A;  3M65 A;  5HEG A;  1ZP0 A;  4ILC A;  1IBM T;  3ETV A;  5DQV A;  5ABE A;  5AQH B;  5FY1 A;  3LBX B;  1G73 A;  3MJX A;  2IDO B;  4UV8 B;  3G06 A;  1KNZ A;  2V7M A;  3KV4 A;  4NUU A;  1MMA A;  1LKX A;  2V6Y B;  1YQ3 A;  4XBF B;  4H9R C;  4HE8 A;  3LG7 A;  4BJN A;  2XM2 A;  4BAY B;  3LK3 B;  1IAP A;  5FXX A;  1MNE A;  3CML A;  2XQY A;  4NXN T;  3N9N A;  5AFU L;  2WU2 A;  1J5W A;  2NW8 A;  3Q5E A;  2H89 A;  3L3P A;  2X0H A;  2WZH A;  2ZLY A;  1S35 A;  3UUB A;  4O4J E;  3IHR A;  1YW0 A;  5AQO B;  3B57 A;  4QHO A;  2K9A A;  5M4Y A;  2Q9Q D;  3CIR A;  4YXD A;  2LT3 A;  4YFS A;  1XNR T;  1HS7 A;  4J2C A;  3OKQ A;  3AE3 A;  5J1G A;  4E7S A;  3VRA A;  2A9U A;  2JMH A;  4XAX B;  4O8S A;  3ESL A;  3PE0 A;  1HNW T;  4LF4 T;  2IML A;  3N9P A;  4G2A A;  1KNP A;  3UUX B;  2BBH A;  5AQV B;  2BKP A;  5LBM A;  2V5D A;  3HL6 A;  4O4H E;  5GON E;  4JI8 T;  3BQK A;  3RGL A;  4JI7 T;  3UQ7 A;  3ZC1 A;  2HPL A;  2LSY A;  4ERR A;  1SE7 A;  4DV4 T;  3M3Z B;  4PJM A;  4AKG A;  2V26 A;  4B3R T;  3ZYK A;  5L4H A;  2KLQ A;  5LG3 A;  5AQJ B;  2YU1 A;  4PJL A;  2WDR A;  2HHH T;  5IHY A;  4KHP T;  5FP3 A;  4V1A v;  2X51 A;  1NAF A;  4MFR A;  1HX1 B;  3H3M A;  3HR0 A;  3UFG A;  3KIN B;  3FHN A;  2W4X A;  3ZMZ B;  4HN9 A;  3VKG A;  2KIN B;  5AQT B;  2N9D A;  5ABH A;  3FBL A;  3FXE B;  2L3L A;  5HWY A;  4HTE A;  4IHJ E;  3O1J A;  2VKD A;  4IL4 A;  3OYZ A;  3PJA A;  3CWZ B;  5L2L A;  3RC8 A;  1I6Z A;  4YTM A;  4Z8X A;  3QB5 K;  4HWH A;  3WAJ A;  5KX5 E;  4KX6 A;  2D0U A;  4DR4 T;  4WNK A;  3Q2M A;  2IHR 1;  3FXD B;  2WBL A;  3EUH A;  3U3I A;  4DV7 T;  4PK4 A;  3RIU C;  4ISS A;  4A97 A;  5H6Q B;  5LYJ E;  2JQK A;  5LCY A;  3T8O A;  5EK4 A;  2DWG A;  4IDQ A;  2FJB A;  3A7M A;  2LEH A;  1E1H B;  2X67 A;  3CQX C;  3C50 A;  4X1K E;  1HFA A;  4IE6 A;  2WAU A;  1NWM X;  3RLF F;  3MK7 C;  4IDZ A;  2UU9 T;  4YSY A;  2FJE A;  4GK5 E;  2V1D B;  3TLU A;  1D1B A;  2XQ6 A;  3RYI E;  4U33 A;  4CXW A;  2QYW A;  5C3J A;  4QH4 A;  2CBJ A;  4FI5 A;  5LA6 E;  4MAL A;  3PUX F;  3PUA A;  1ZOY A;  4DR7 T;  1X79 A;  1FIO A;  3AA0 B;  5LOV E;  4ZS2 A;  3SFD A;  2K48 A;  1H7C A;  3OVU A;  3ANW A;  3VR8 A;  2E5L T;  2D5U A;  1E7P A;  2W66 A;  1UUS A;  3JAE A;  4DV6 T;  1Y01 A;  2K3W A;  2XY8 B;  3FB2 A;  2VQE T;  1HR0 T;  2XQ5 A;  5HAX A;  2OLT A;  2E9X D;  3RYH E;  3KV5 A;  5L47 A;  3ZPO A;  4QXH B;  3RKO A;  1R8I A;  2N2N A;  3ZLI A;  4NPP A;  2CE7 A;  2PFV A;  1MMD A;  1ZV4 X;  5FY0 A;  3AE8 A;  2WS3 A;  4MLK A;  4N78 D;  4DV3 T;  5DAB A;  3X1D A;  2L8K A;  5FVK A;  4BJM A;  4JI4 T;  3AED A;  4IL9 A;  4AKI A;  4WYV A;  1DU2 A;  2F4V T;  4JBW F;  3UU8 A;  2BS2 A;  3CKD A;  3C64 A;  4YLH A;  3HKD E;  2V6Y A;  3O9X A;  3ZSS A;  2KND A;  2W00 A;  4TZ4 C;  5AQN B;  4AKR B;  3FZF B;  4LMJ A;  3CX6 B;  3OJA A;  4JI2 T;  2VVS A;  2YIN A;  2EHO A;  2DNX A;  3AA1 B;  4DO0 A;  4EOZ B;  4UEL A;  3ZJ2 A;  2XPK A;  4X1Y E;  2IUB A;  3IA3 A;  2H7V C;  3NZQ A;  2OV9 A;  5JDQ A;  3CVR A;  3U78 A;  2BKO A;  4I43 B;  4UVB B;  3ZMU B;  3Q5X A;  4L5G A;  4JEH B;  2CXL A;  2K5B B;  1I94 T;  3MZK B;  5CFB A;  1J5E T;  3H37 A;  3TLT A;  1UX4 A;  4QXB B;  2NOX A;  2Y48 B;  4ZI2 D;  1US7 B;  4HWC A;  3I0Q A;  4Z91 A;  2FUP A;  2JQQ A;  3UFE A;  4DVD A;  4HWD A;  2R6G F;  3N2G E;  4TWH A;  4YY3 T;  2LHN A;  2MOZ A;  3I1A A;  4O4L E;  3MXZ A;  5JDL A;  3EDU A;  4LF9 T;  4DUZ T;  4PNI A;  3RIU A;  2XAQ B;  5AQG B;  4DBR A;  3QOF A;  4QWN B;  2WY2 A;  5LMU T;  4YHH T;  3VKH A;  1UK5 A;  4DMW A;  4WZX A;  2XQ7 A;  2IC9 A;  2W67 A;  3AEE A;  1D0Z A;  5JDG A;  5L3D B;  3L8R A;  4C90 A;  5FY7 A;  2VAS A;  2XZE A;  4H9O C;  2LM9 A;  2WWU A;  2CBI A;  2M6B A;  2I59 A;  4B3T T;  3PDY A;  4WW0 A;  3PUW F;  4UVC B;  1LVF A;  2IIU A;  2UUC T;  4P1N A;  3OYX A;  3F31 A;  2VKJ A;  2UXD T;  4TWD A;  3ZT6 A;  4EEB A;  3JAD A;  4JEU B;  2QRX A;  1YKE B;  5C8Y E;  4JV5 T;  4L0R A;  4KHZ F;  4IDO A;  3AVS A;  4NIQ A;  3PUZ F;  2ZM6 T;  4IST A;  3ZKR A;  3K3Q C;  2XJ7 A;  3P4R A;  4AQY T;  1Z0P A;  3C51 A;  4H9P C;  2QGS A;  4IRE A;  2RA1 A;  1MMG A;  4AI6 A;  1U5P A;  1Z8U A;  2P9B A;  4JI5 T;  4EZ4 A;  2J1D G;  5LBQ B;  4YSX A;  3HKB E;  5BMV E;  4HFI A;  4A5X A;  1V9D A;  4E7Z A;  5CJ5 A;  3OBV E;  4FJO A;  4HFD A;  4CI2 B;  3UU5 A;  4OX9 T;  2KSR A;  3KDS E;  5KMG P;  4DV0 T;  3EDV A;  3PU8 A;  2WZI A;  4EYU A;  2CHN A;  2WU5 A;  3O1I A;  2WP9 A;  4U31 A;  4GK0 E;  5L3B B;  2VWA A;  3O1H A;  4AIS A;  2YEV C;  3ABV A;  5FNV E;  4X5T A;  4X20 E;  1BR2 A;  1G8X A;  3AE5 A;  2L9Q A;  3NVO A;  3KBU A;  5HEJ A;  3O4X E;  5TAO A;  2D9D A;  4U7Y A;  1T8B A;  4EV6 A;  2LSK A;  2UUB T;  5ABF A;  2EHO B;  4ZZC A;  5FL1 A;  2IC6 A;  3F57 A;  4MBQ A;  3SRZ A;  5HCJ A;  1M7K A;  2I6H A;  2MAW A;  2B1E A;  1BR1 A;  4JI6 T;  4HFH A;  1KF6 A;  3KVB A;  3NBX X;  2QVA A;  3P4S A;  1SA0 E;  3JC6 C;  2DWK A;  1D0Y A;  3IEE A;  2CLY B;  5HEU A;  1NEK A;  3OTO T;  3HA4 A;  1WR0 A;  4OYK A;  3RF1 A;  2LRK A;  5FVL A;  2VB6 A;  5AQQ B;  2ODU A;  4X64 T;  4P0A A;  3RQU A;  2UXB T;  2WDQ A;  4CN6 A;  4XZC A;  4IT4 A;  3MA9 A;  2XM1 A;  4DND A;  1HTJ F;  2YKS A;  2X9H A;  3AE4 A;  4K0K T;  1WFD A;  2NR4 A;  3I9W A;  3E0Z A;  1LRZ A;  3P50 A;  3RH3 A;  4KUM B;  1HG2 A;  2M6I A;  4ZI3 C;  2V7J A;  3B5M A;  2H3R A;  2YDR A;  2EHO C;  4U2Y A;  2XQ4 A;  1MND A;  4LF6 T;  2Y8D A;  3KVA A;  2LSI A;  4TV8 E;  4UXN B;  1N33 T;  2B76 A;  2FJD A;  2D2S A;  2PJQ A;  4PK6 A;  3Q5D A;  2LE8 A;  3T1H T;  2CHO A;  2DL1 A;  2KZ7 B;  3EHZ A;  4Z90 A;  5ADX L;  5JDM A;  3EAM A;  3RHW A;  4JI0 T;  2CLY C;  1WRD A;  3ZJ1 A;  4GYR A;  1XDO A;  4UVA B;  2PBI A;  2KMF A;  3AE7 A;  5L3F B;  1D1A A;  5LJN A;  3C4W A;  3AB3 B;  3ZYL A;  4HFB A;  2A3D A;  4BA9 A;  5A1L A;  2YU2 A;  3IBP A;  2X9Y A;  3NRY A;  2PG8 A;  5CB4 E;  2HH7 A;  4HWF A;  1OXZ A;  4MHC A;  5L3G B;  3PV0 F;  3JAF A;  3LSV A;  5F5W A;  2RP4 A;  3KV9 A;  2LSJ A;  1CHU A;  2SPC A;  1XZY A;  2ZM8 A;  3FZM B;  3ZMT B;  4ILA A;  5LHI B;  4U7I A;  3RYC E;  2V7I A;  5ABF B;  2W62 A;  2YDQ A;  2WSS V;  5H6R B;  1QLB A;  4EB6 E;  2WB5 A;  4B6X A;  2CPT A;  1N32 T;  3GWH A;  5LHH B;  3N9O A;  2CXF A;  1KFY A;  4YT0 A;  2JRK A;  3N2O A;  3PUV F;  4TNW A;  2XSB A;  4IGU A;  5FXV A;  3KV6 A;  4LML A;  2NP9 A;  3P7I A;  3ZMV B;  2LOS A;  3PUY F;  4OHF A;  2HPJ A;  4X1I E;  5HXS A;  1SUM B;  4LMK A;  3BK9 A;  2BG9 B;  2BG9 E;  3VR9 A;  4CQI A;  4HFE A;  1ZKE A;  2LRL A;  2XAS B;  2CCQ A;  2XSA A;  5JDH A;  1OWA A;  5L4E A;  4C91 A;  3N9M A;  1MMN A;  1BR4 A;  1X9B A;  3HKC E;  3RIF A;  3UQ4 A;  2BS4 A;  5JH7 E;  5LGN B;  4JLE A;  2V7L A;  5JR9 B;  3FZK B;  4UIG A;  5HXE A;  2LKH A;  1VRB A;  4YTP A;  5HYA A;  1W0B A;  5DQW A;  4GKJ T;  4K0U A;  3RI5 A;  5J2U E;  2Q9Q B;  2C5I T;  4LFB T;  1D0X A;  3V5S A;  4U72 A;  2X9W A;  4TWF A;  1D1C A;  4A56 A;  1MIY A;  1FMV A;  1SHZ C;  3N5L A;  5FXW A;  5CGM A;  4I4T E;  1YQ4 A;  2UXX B;  1MIW A;  4EYY R;  5LJM A;  4Q25 A;  4CXX A;  4X65 T;  1M62 A;  3KFW X;  1HNX T;  2DI4 A;  4ZS3 A;  4GIW A;  2BG9 C;  4UEM A;  4U2Z A;  5L3E B;  5J2T E;  1WR6 A;  2GK9 A;  4QKN A;  2XAJ B;  4LFC T;  3I9Y A;  1UX5 A;  2BVM A;  5LNK A;  4TNV A;  2WMO A;  4LF8 T;  2D0T A;  3L09 A;  5JR9 C;  3B13 A;  3CK6 A;  3LK4 2;  2VK9 A;  5HWX A;  3KBT A;  5FL0 A;  5EZY E;  2XQ8 A;  2Q9Q C;  4YJ2 E;  3HKE E;  4G63 A;  1T98 A;  2CWO A;  1QUU A;  2HN1 A;  3GMI A;  5AQR B;  1XMO T;  5J0Z A;  3JCF A;  2KWI B;  2VUR A;  4UF0 A;  3UUM A;  1YD8 G;  3DJB A;  3ZEF B;  3FZL B;  3ZN0 B;  3AEA A;  3SS1 A;  1KNR A;  1WLX A;  2MPK A;  5AQS B;  4QX8 B;  3EAB A;  2A72 A;  1W0A A;  2UXN B;  3AEF A;  3PUS A;  2AXD S;  2XUE A;  3K8P C;  4PAG A;  2E8I A;  4YSZ A;  2WDV A;  4HFV A;  3VHL A;  2ES0 A;  5JRC B;  2W63 A;  2VKO A;  1JNR A;  3NRX A;  4GOU A;  3J9X 1;  5BR8 T;  4YJ3 E;  1KK7 A;  3A5X A;  4QXC B;  2E5V A;  2LOP A;  3FZH B;  2LJL A;  4A98 A;  4DR6 T;  4F8H A;  3UU4 A;  2AE9 A;  1S94 A;  2XQ9 A;  1IZN B;  4O4I E;  3N9L A;  3Q9D A;  4O2B E;  2C5J A;  4AKH A;  1UCU A;  1UUR A;  1WYC A;  1HX8 A;  2ZMA A;  5FXZ A;  4EXT A;  3E08 A;  4OFZ A;  3UUL A;  3WI3 A;  2NW7 A;  4PK5 A;  2E9X B;  2VQF T;  1W09 A;  4HEA A;  5AQK B;  2JQH A;  4JI1 T;  5JTG A;  5HXH A;  2C0S A;  3RPU A;  4ZOL E;  5AQL B;  2CMR A;  1MIV A;  5LXT E;  2H7O A;  1AJ3 A;  4PFO A;  2BZB A;  3WAK A;  4JYA T;  4P09 A;  5LB7 B;  3Q5W A;  3MKD A;  4M1P A;  1N34 T;  5LG4 A;  4IIJ E;  3K1S A;  2CM0 A;  2X66 A;  3P4Q A;  3UU6 A;  4H63 H;  3VRB A;  2A2F X;  3MAC A;  4ZHQ E;  5ABG A;  5IYZ E;  3AAA B;  4CN1 A;  4X66 T;  2E2A A;  4IDN A;  1T72 A;  2K24 A;  2MYS A;  3CX7 B;  4AXP A;  1E2A A;  2BG9 A;  3BQL A;  3ZCJ A;  4EED A;  4ANJ A;  2M67 A;  4CI1 B;  2UXC T;  2IAK A;  3RKG A;  3QUJ A;  2V8S V;  4OK0 A;  4WBO A;  4DR1 T;  3BQI A;  2J62 A;  3ZYM A;  4IE5 A;  3PU3 A;  5CA0 E;  4EGW A;  4EAH A;  1OED B;  1OED E;  4KP3 C;  4NXM T;  2E9X C;  4B3S T;  3RC3 A;  1XDP A;  5JR9 A;  4CN4 A;  4JI3 T;  2W0G A;  3AXJ B;  3UTK A;  3ZT7 A;  3ZN1 B;  4DR3 T;  3RQW A;  1YKH B;  4UF0 B;  2JPF A;  5DJQ C;  2NW9 A;  3H3A A;  2Q9Q A;  4TUY E;  4DR5 T;  4ZI7 E;  3ONX A; 
#chains in the Genus database with same CATH homology
 4LFA T;  5LMN T;  4DV7 T;  1I94 T;  1HNW T;  4LF4 T;  1J5E T;  4JI5 T;  4DV5 T;  4LF5 T;  4JYA T;  4X65 T;  5IWA T;  3T1H T;  1HNX T;  1N34 T;  4JI8 T;  4JI0 T;  4JI7 T;  4YY3 T;  3T1Y T;  3OTO T;  1IBK T;  4LF9 T;  4DV3 T;  4DV4 T;  4DUZ T;  5BR8 T;  4OX9 T;  2UU9 T;  5LMU T;  4B3R T;  4DR2 T;  4YHH T;  4X64 T;  4DV0 T;  4X66 T;  4LF7 T;  4LFC T;  4JI4 T;  2UXB T;  2HHH T;  2F4V T;  4KHP T;  4DR6 T;  2UXC T;  4LF8 T;  2UUA T;  1XNQ T;  4K0K T;  1FJG T;  4NXN T;  4DR7 T;  4DUY T;  4DV1 T;  4B3T T;  1XMQ T;  1IBL T;  4DR1 T;  4JI2 T;  4DV2 T;  4GKJ T;  1N36 T;  4LFB T;  2UUC T;  2E5L T;  2UXD T;  1HNZ T;  4NXM T;  2UUB T;  4B3S T;  4JV5 T;  2VQF T;  4JI3 T;  4DV6 T;  1XMO T;  4DR3 T;  2VQE T;  4B3M T;  4LF6 T;  2ZM6 T;  1HR0 T;  4GKK T;  1XNR T;  4JI1 T;  4AQY T;  1N32 T;  4DR5 T;  4X62 T;  1IBM T;  4DR4 T;  1N33 T;  4JI6 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...