3OTOT

Crystal structure of the 30s ribosomal subunit from a ksga mutant of thermus thermophilus (hb8)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Modification of 16S ribosomal RNA by the KsgA methyltransferase restructures the 30S subunit to optimize ribosome function.
pubmed doi rcsb
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2010-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 3otoT00
4JI8T 4YY3T 2UXDT 4KHPT 1HNXT 4DUZT 2E5LT 4DR1T 1HR0T 4JI3T 4B3RT 4DUYT 4GKKT 1J5ET 4DV3T 1IBMT 3OTOT 2VQET 5BR8T 4LF4T 4GKJT 4X62T 1XMQT 1HNWT 4YHHT 4LFBT 2ZM6T 4LF8T 1N36T 1I94T 5IWAT 4NXNT 5LMUT 4DV0T 4DV2T 4DR4T 1N33T 2UUCT 2UUAT 1XNQT 2UUBT 4LF5T 4X66T 3T1YT 1N34T 4JI4T 1FJGT 4DV7T 4DV6T 2HHHT 4NXMT 2UXBT 4JI0T 2UXCT 1N32T 4DV5T 4DR5T 4LFAT 4B3TT 4X64T 4JYAT 4LF9T 4B3MT 5LMNT 3T1HT 4K0KT 4JV5T 4DR7T 1HNZT 2VQFT 4DV4T 4JI6T 4JI2T 4B3ST 1IBKT 2UU9T 4DR2T 4JI1T 4LF7T 2F4VT 4X65T 4DV1T 4DR3T 4LF6T 4OX9T 1IBLT 4JI7T 4AQYT 4JI5T 4LFCT 4DR6T 1XNRT 1XMOT
chains in the Genus database with same CATH superfamily
5FY7A 2LSJA 2C0SA 4QH4A 4QH5A 1HR0T 5FXXA 1HTJF 4U31A 2WP9A 4YJ2E 1J5ET 4Q25A 4AKRB 5BR8T 3AE6A 3BQKA 2NR4A 4HE8A 3UUNA 2BG9A 3ZJ1A 1LVFA 5AQRB 4KUMB 4DR4T 1N33T 4H9NC 2SPCA 2XTLA 4HGAA 1T7SA 4LMJA 4LF5T 2X9HA 3P4PA 4X66T 4Z8XA 3AEFA 3UU5A 1D0YA 2HHHT 1NENA 4QX8B 4JBWF 4CN1A 4EOZB 4U7YA 3DP7A 3HA4A 2UXNB 3LBXB 2JPFA 4TV9E 3PUXF 4HFCA 2ACXA 4TWHA 3SOLA 4PK5A 1ZKEA 3EABA 5JH7E 1E2AA 4JI6T 1U4QA 3RPUA 4P09A 2BKOA 4EGWA 2DWGA 3O9XA 3O1IA 1BR0A 2XSAA 4MALA 2QGSA 2BVMA 1X79A 4NPPA 5HCMA 4EZHA 2W61A 5L3EB 4X1KE 4UR9A 3F31A 1E1HB 2D9DA 4EYYR 3FXEB 5AQFB 5LYJE 2FJEA 2DWKA 2NOXA 2XAFB 2ZMAA 3O1HA 3PU3A 5JQGE 3VU7H 2ACZA 4X1IE 3PUQA 4MBQA 2C5JA 2XZEA 3ZSSA 4H9SE 3QNUA 4KMCA 1FEWA 4IDZA 3R6NA 1US7B 1WFDA 4YJ3E 5JDFA 2CE7A 3CQCB 1XDPA 3M65A 3AXJB 2B76A 2KWIB 1YQ3A 2XAQB 2D5UA 4IE6A 5LG3A 2DI4A 3ZKRA 1LVKA 5AQKB 1Z8UA 4M1PA 3E22E 2JQKA 3EAMA 2LKGA 1IZNB 3ETVA 1IJ6A 5HEJA 5L2LA 5ABHA 2WS3A 4DIDB 4I55E 4PJJA 5LMNT 4JV5T 3UU3A 2JMHA 3UU4A 4CI1B 4DV4T 4AKGA 2XM1A 2C5KT 3N2GE 2BG9C 4LF7T 3P7IA 5AQUB 3KINB 2X67A 3AEAA 2ZM2A 5FL0A 3A8YC 3PV0F 4AQYT 1UUSA 2E2AA 2WQYA 2KSRA 3RHWA 2V6YA 3QB5A 5CFBA 1KFYA 3SRZA 3RYHE 3K3OA 3QOFA 3RKGA 2WY2A 3W15B 2YKSA 4QWNB 4DBRA 2AE9A 2CWYA 4Z90A 2Z6EA 1R8IA 2D2SA 4PNIA 1MMNA 3T8OA 4E7SA 3L39A 2DNXA 3LK3B 4UVBB 5JREA 2WDQA 4PK4A 2K5BB 2IUBA 3L09A 3SWHA 4H9QC 2WU5A 4QHOA 2L9QA 3V5SA 4YT0A 5LBQB 5L3DB 2YU1A 3CMLA 3GA8A 2XQYA 5LBMA 4DO0A 2V7KA 4CI3B 2BZBA 4G63A 4EEDA 5DQWA 3AA1B 4TN7B 2OA5A 2FJBA 4JI2T 1UX4A 1WRDA 3P4WA 2V7IA 3ABVA 4KP3C 3H3AA 2RPAA 4CN4A 5C3JA 3LJCA 1ZOYA 2XQ8A 3FZFB 2LHRA 5LGUB 2PFVA 4X5TA 2I6HA 3TKLB 1U5PA 3GWHA 4KBMB 4UF0A 2YU2A 5LP6E 3AVSA 2Q9QA 3NZQA 3UFGA 3DJBA 1CHUA 3VRBA 5L3GB 2E9XA 1WYBA 5FXVA 2CPTA 2KXPB 3UUBA 4QH1A 3OYZA 2L3LA 3ETUA 3KFWX 2CRBA 5HXCA 2VKDA 4EEBA 3SFEA 5FVKA 3KV4A 1I6ZA 1ZHCA 3VR8A 2VWAA 3EUHA 2ODUA 3DTOA 3ZC0A 4KHZF 3U78A 2XAJB 4HWIB 4ZS2A 3LDQB 3B57A 5JDMA 4HFEA 5AQQB 4B6XA 4IE7A 4K0KT 2XSBA 3AE7A 2BBJA 1EZ3A 2WWUA 4MLKA 4U33A 2XQ4A 4DMVA 2PJQA 1AJ3A 2ZM8A 2H89A 2D0TA 3QB5K 5AQJB 2QVAA 3WAJA 5EK2A 5FMNA 1IJ5A 1VRBA 1NAFA 1UGOA 2WZIA 1S94A 5JDHA 4K0UA 1OEDE 1VOMA 2QYWA 2NW9A 2LOPA 2IW5B 3RRCA 2VL0A 3UUMA 3KV6A 5IWAT 4DV0T 5LNKA 2EHOD 2WB5A 1VCTA 2LOSA 3VKHA 3ZLIA 4O4HE 1HG2A 2QA7A 2YDSA 4WNKA 2LSKA 1MIWA 3ANWA 3RF1A 1D1BA 3RX6A 1J5WA 2WMNA 2Q9QC 2W62A 4QXBB 2E9XC 2A72A 1YKEB 4WBOA 2EHOA 4DR7T 3ZN0B 2LSYA 5GONE 5ABFB 4V1Av 3ZJ2A 2F4VT 4X65T 4DV1T 2IMLA 3C4WA 3N9NA 2MTQA 2BKNA 2HN1A 2FJAA 2ES0A 3NRYA 1KF6A 2X9YA 4PJMA 1T98A 2XUEA 3MXZA 3BQLA 4O2AE 1HX1B 3A7MA 2AXDS 5LHHB 4P1NA 2PTFA 3K3QC 4DR1T 2YN6A 3TLUA 5JTGA 1OEDB 4FJOA 2DL1A 4O4JE 4DV3T 3M3ZB 4GK0E 3V5UA 5HXHA 5L3FB 4XAXB 4ADZA 3P50A 2ZM6T 1N36T 4AQGA 2J47A 1HX8A 2CA5A 3EHZA 3AVRA 3EDUA 3C64A 4P0AA 5H6RB 4AI6A 4IREA 3NVOA 4TNVA 3PDYA 4WZXA 1UCUA 4ISTA 5FKYA 1D1AA 5AFUL 3ZMUB 5EZYE 1SUMB 3AA0B 1YXRA 4E7ZA 3VR9A 5L4EA 3PTRB 3I0QA 3RC3A 1Z0PA 3FZHB 2XPKA 3IA3A 2WDVA 4LF6T 4ZI2D 1V9DA 3OYXA 4EB6E 4YXDA 3D0TA 1O3XA 4UV9B 4PJNA 4KHPT 5LB7B 1ZEEA 4TWDA 5JDQA 3K8PC 3ZSTA 1GQEA 3I9YA 3ZMVB 4B3RT 5HEUA 4PFOA 2EHOC 3JAEA 1CUNA 3AB3B 5LCYA 4AIUA 4ZXLA 3C98B 4MFRA 3ZC1A 3I1AA 4DV2T 4BJNA 4ILUA 4JLEA 4LMKA 5C8YE 4P0BA 2UUBT 5EK4A 3TLWA 5JRCA 2WMOA 2LRLA 4DV6T 2W0GA 2D0UA 4UVAB 1W0AA 1LRZA 2X51A 4X64T 2Y8DA 2FJDA 3RYFE 5C2TA 5HWYA 3ZCJA 2FBWA 4ILAA 4AISA 2KZ7B 4IT4A 4IDNA 4UVCB 5E0OA 3JC6D 3U3IA 1D1CA 4WW0A 3FZMB 3I0OA 2CBJA 4YLHA 1MIYA 3ZCIA 3AECA 1XMOT 3PUZF 1JNZA 1ZP0A 2V26A 2WAUA 2DHRA 3MZKB 2WWVA 4O4LE 3N5LA 4H63H 3LBXA 5AQNB 5JR9B 3FBZA 2XQ9A 2W63A 3OVUA 4CI2B 3AE9A 3AA6B 4AKIA 3N9PA 5AQGB 5AQHB 5LHIB 3Q9DA 4CN6A 2W67A 2H88A 4GIWA 2JRKA 5BMVE 4IIJE 2LKHA 3JAFA 1T72A 2CEAA 5LOVE 2UXCT 2G0UA 2V1DB 3PJAJ 4DR5T 1WYCA 3OBVE 2CLYC 4I4TE 4BA9A 4GK5E 2V5DA 5LJNA 3CQXC 3J9X1 4ZI2C 5FXWA 5H6QB 5HCJA 2V7LA 2ODVA 3UT5E 3RQUA 4IDOA 2VK9A 4LMLA 5DQVA 5AQMB 2KINB 3AXJA 3GN5B 3ZMSB 1HS7A 2W4XA 5FVLA 1XDOA 2A3DA 2LSIA 4OX9T 3FBLA 2VURA 3HR0A 5F8PA 1X9BA 3RGLA 4JI8T 1XZYA 1VCSA 4L0RA 4I43B 1WR6A 4IDPA 5HXRA 2CHOA 3WI3A 5IUXA 4IDQA 1Y01A 3AEBA 3FZLB 4OFZA 3HKCE 2WZHA 4O8SA 3KBTA 3UQ4A 4HTEA 3RI5A 4LF8T 2LSGA 3PUVF 3RIFA 4KI0F 4PK6A 2VVSA 2R6GF 1T8BA 2MOZA 2VVNA 4CXYA 4ZI7E 3OKQA 1G73A 2CMRA 5KMGP 4QKNA 5DJQC 1KNZA 4U7IA 2XQ7A 4EIWA 2Y48B 1SA0E 1BR4A 1ZV4X 2VB6A 4LF9T 4O2BE 1D0ZA 3P4QA 4H9PC 4HFIA 4X20E 3J7Yq 4ZHQE 2FUPA 1L0VA 2XQ6A 4I0UA 5ETWA 4ZEYA 2NW7A 2OLTA 3FZKB 2BDEA 3S4UA 2VKHA 4TUYE 1JNRA 4JUYA 4A98A 2BKPA 4HFBA 1BR1A 2VL8A 3ZYMA 1MIVA 5LXTE 5AQSB 2CM0A 3PUYF 2KMFA 2KNDA 3Q5DA 4JI5T 4DBQA 3TLSA 5CA1E 1XNRT 3AAEB 4UELA 2XAHB 2J62A 3A5XA 3H3MA 1Y64B 2H7VC 4YTNA 2XAGB 2LM2A 4GOUA 1KNPA 5FL1A 2W2UA 2V7JA 4DMWA 1MMDA 5AQOB 4YTMA 3UU6A 4X62T 4HWDA 4TV8E 1M62A 3RLFF 1E7PA 4U2YA 4EXTA 2DLRA 2UUCT 4NIQA 2UUAT 4YHJA 4JI4T 2JIWA 5EK3A 2CWOA 3CX7B 3B13A 3Q5WA 4U72A 3RIAA 4B3TT 2C5IT 2NW8A 3Q5EA 2A9UA 3ZEFB 4AQFA 3ZMTB 3RKOA 2V5CA 4IL9A 3CQGB 2CXDA 3PUWF 4A5XA 4EAHA 2BG9B 3SFDA 4QX7B 3CPZA 4I50E 4TNWA 5IHYA 3IF8B 4EZ4A 2V7MA 2J1DG 1UURA 1MNDA 3G06A 3TLVA 5ABEA 3CKDA 3L8RA 4IL4A 3CVRA 1HNXT 4HWHA 5HEOA 3P8CD 5LA6E 4CXXA 5JDGA 3ZN1B 2KT9A 5HXEA 1FMVA 3HKEE 3OTOT 5L4HA 5HWXA 4GKJT 2NTYA 4ZI3D 3MKDA 1OXZA 3KV5A 2CXLA 1I94T 1SHZC 4A97A 2NP9A 5JVDE 1YQ4A 3NKZA 2X9WA 3H37A 1DU2A 3R84B 2PBIA 3N9LA 1N34T 2WM9A 2LT3A 3IHRA 4X1YE 5J1GA 2JMKA 4JI0T 4ILBA 4H9OC 3IBPA 3QK6A 4TX5A 4BJMA 2WDRA 3O1JA 4UXNB 2XM2A 1HFAA 2BS3A 4ZS3A 3TLTA 3VHLA 2XQ5A 1S35A 1OWAA 3AEGA 4PAGA 2YK0A 2YOEA 2XHEB 2PG8A 3CX8B 2BS4A 1HCIA 3AAAB 2IC6A 4YSXA 4MHCA 4DR6T 1HG5A 1BR2A 1M7KA 2IC9A 3HL6A 1YW0A 3KV9A 5KDMC 4DUZT 4OHFA 4GYRA 3NBXX 5CJ5A 3PE0A 5HAXA 4CXWA 4OYKA 3C50A 4AQFC 4F6RC 1NEKA 2I59A 4LF4T 5ABFA 4IE5A 4L9IA 3AE8A 3FXDB 4AXPA 4NXNT 2VKJA 5LGTB 2GK9A 5LHGB 5FY1A 3CWZB 3N9QA 3LFMA 2IDOB 1WR0A 2M67A 3HKBE 3ZT7A 4UEMA 5AQTB 3T1YT 3RRWA 2V6YB 5A1LA 2V6XA 4ZZBA 4JEUB 5F3JA 3IEEA 2WU2A 4NUVA 2E5VA 2M6BA 1OEDA 2V8SV 3NZPA 3ZMZB 3AEDA 4ISSA 4J2CA 4IE4A 3PUAA 4JEHB 4IHJE 2UXXB 3C4XA 4HEAA 5HEHA 2K48A 5IYZE 5FNVE 4DVDA 4AKLA 4DR3T 5HYAA 1MNEA 3AE3A 2HN2A 3ONLC 5CGMA 3CIRA 4ZOLE 2E5LT 3F57A 4ZI3C 4YSZA 5J2UE 3ONJA 3VRAA 3F2EA 4YSYA 2LM9A 5L3CB 1KEYA 3AE5A 3ZYKA 3RIUA 2JQ9A 2XY8B 3RH3A 2IHR1 1G8XA 1XMQT 5LJMA 5AQVB 5M4YA 2CHNA 2OV9A 3UULA 4HWFA 5TAOA 2BS2A 3QUJA 1XWMA 5CA0E 2QRXA 2N9DA 4XZCA 2W00A 4DV7T 4F8HA 1H7CA 4FI5A 2Y6XA 3GMIA 4IE0A 4NXMT 4GYSA 2UXBT 2MPKA 4UF0B 5HXSA 4JYAT 3OJAA 2BVLA 3KBUA 5DABA 2Q9QB 4N78D 2E9XB 3MACA 5AQLB 4DR2T 1UK5A 3EI0A 2MBGA 2HPLA 5ADXL 1QSDA 2I0MA 4UV8B 4TZ4C 2CCQA 1HF8A 1YKHB 5LGNB 4YTPA 5ABGA 3K1SA 3L3PA 1OEDC 5L47A 2N1GA 3EVYA 4BAYB 4DUYT 4AKHA 2LE8A 5J2TE 2HH7A 1IBMT 3JCFA 3RYCE 3ZT5A 4OYJA 1YD8G 4CQIA 4A56A 1HNWT 3AE2A 3ZT6A 3KVBA 4LFBT 4H63V 2K3WA 5LMUT 3UU8A 2KLQA 3O4XE 4ZZCA 4HKAA 2X0HA 2NTXA 3BQIA 1XNQT 1MMGA 1QUUA 2B1EA 4YFSA 2XQAA 3AA7B 2Q9QD 3PUSA 3ZPOA 5AQIB 2E9XD 2XQ3A 2BBHA 3CK6A 4HFHA 5JR9A 3OPCA 5L3BB 3HKDE 3RYIE 5AQPB 3RIUC 2J4GA 4UIGA 3P4RA 1UX5A 2M6IA 4PW8A 1NWMX 3PU8A 4O4IE 5JDNA 2P9BA 5KX5E 3E0ZA 2CBIA 1KK7A 4HFVA 2VKOA 2WCAA 3SS1A 5HEGA 3JC6C 2ZM0A 1IBLT 4JI7T 1FMWA 4HN9A 1SE7A 3PJAA 3BK9A 4YY3T 2UXDT 3ANWB 3WAKA 4WYVA 2WSSV 2JQQA 3FHNA 4PJLA 4JI3T 1LKXA 4KX6A 2BG9E 4ANJA 3RC8A 1KNRA 2YINA 4IGUA 2EHOB 2VQET 3ESLA 2MYSA 3PUGA 3PURA 2L8KA 3X1DA 2KWHA 4YHHT 3GN5A 2X0YA 2DCFA 2LHNA 1WLXA 2HPJA 3NRXA 3N9OA 2LEHA 2E8IA 4QXHB 2LLYA 2X0LB 4COFA 3B5MA 3UQ7A 3CX6B 4NUUA 2H3RA 1FJGT 2LJLA 3UFEA 4TWFA 1QLBA 3LK42 2N2NA 4DV5T 1MMAA 5KXJA 4LFAT 3E08A 4OK0A 4U3CA 2MAWA 4G2AA 4C91A 4B3MT 1W09A 3LK2B 3ZYLA 3MJXA 1HNZT 2VQFT 3C51A 1IBKT 2UU9T 2RA1A 4JI1T 4HFDA 3AE4A 2X68A 2VASA 4XBFB 2YEVC 1B7TA 3N2OA 4U74A 3JADA 4Z91A 3UTKA 4LFCT 2IIUA 2X66A 2X9XA 3ONXA 3N9MA 3LSVA 3LG7A 5CB4E 4U2ZA 5JR9C 4GKKT 2IAKA 4EYUA 5JDLA 2RP4A 4C90A 3AE1A 5FY0A 3C4ZA 4EV6A 2JJ9A 4ILCA 2XASB 1W9RA 5FP3A 3VKGA 3I9WA 4DNDA 4ASKA 2YDRA 2YDQA 1FIOA 3Q5XA 3UUXB 3EDVA 2H7OA 1J1JA 5FXZA 2LRKA 3KVAA 1N32T 3AAIA 5J0ZA 4L5GA 2CLYB 2NWBA 2XJ7A 3MA9A 4H9RC 2JQHA 3N2KE 3P4SA 3T1HT 1IAPA 4ERRA 5F5WA 2K24A 4PFPA 2CXFA 5LG4A 4B3ST 4QXCB 3NWIA 3Q2MA 2ZLYA 1W0BA 4CZZB 1WCRA 2A2FX 5FYMA 2WBLA 2K9AA 3FB2A 4HWCA 3MK7C 3K3NA 3AEEA 1D0XA 3RQWA 4WBNE 3KDSE 3QC9A 2W66A 3HI2A 5JRCB
chains in the Genus database with same CATH topology
4JI8T 4YY3T 2UXDT 4KHPT 1HNXT 4DUZT 2E5LT 4DR1T 1HR0T 4JI3T 4B3RT 4DUYT 4GKKT 1J5ET 4DV3T 1IBMT 3OTOT 2VQET 5BR8T 4LF4T 4GKJT 4X62T 1XMQT 1HNWT 4YHHT 4LFBT 2ZM6T 4LF8T 1N36T 1I94T 5IWAT 4NXNT 5LMUT 4DV0T 4DV2T 4DR4T 1N33T 2UUCT 2UUAT 1XNQT 2UUBT 4LF5T 4X66T 3T1YT 1N34T 4JI4T 1FJGT 4DV7T 4DV6T 2HHHT 4NXMT 2UXBT 4JI0T 2UXCT 1N32T 4DV5T 4DR5T 4LFAT 4B3TT 4X64T 4JYAT 4LF9T 4B3MT 5LMNT 3T1HT 4K0KT 4JV5T 4DR7T 1HNZT 2VQFT 4DV4T 4JI6T 4JI2T 4B3ST 1IBKT 2UU9T 4DR2T 4JI1T 4LF7T 2F4VT 4X65T 4DV1T 4DR3T 4LF6T 4OX9T 1IBLT 4JI7T 4AQYT 4JI5T 4LFCT 4DR6T 1XNRT 1XMOT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI8 T;  4YY3 T;  2UXD T;  4KHP T;  1HNX T;  4DUZ T;  2E5L T;  4DR1 T;  1HR0 T;  4JI3 T;  4B3R T;  4DUY T;  4GKK T;  1J5E T;  4DV3 T;  1IBM T;  3OTO T;  2VQE T;  5BR8 T;  4LF4 T;  4GKJ T;  4X62 T;  1XMQ T;  1HNW T;  4YHH T;  4LFB T;  2ZM6 T;  4LF8 T;  1N36 T;  1I94 T;  5IWA T;  4NXN T;  5LMU T;  4DV0 T;  4DV2 T;  4DR4 T;  1N33 T;  2UUC T;  2UUA T;  1XNQ T;  2UUB T;  4LF5 T;  4X66 T;  3T1Y T;  1N34 T;  4JI4 T;  1FJG T;  4DV7 T;  4DV6 T;  2HHH T;  4NXM T;  2UXB T;  4JI0 T;  2UXC T;  1N32 T;  4DV5 T;  4DR5 T;  4LFA T;  4B3T T;  4X64 T;  4JYA T;  4LF9 T;  4B3M T;  5LMN T;  3T1H T;  4K0K T;  4JV5 T;  4DR7 T;  1HNZ T;  2VQF T;  4DV4 T;  4JI6 T;  4JI2 T;  4B3S T;  1IBK T;  2UU9 T;  4DR2 T;  4JI1 T;  4LF7 T;  2F4V T;  4X65 T;  4DV1 T;  4DR3 T;  4LF6 T;  4OX9 T;  1IBL T;  4JI7 T;  4AQY T;  4JI5 T;  4LFC T;  4DR6 T;  1XNR T;  1XMO T; 
#chains in the Genus database with same CATH topology
 5FY7 A;  2LSJ A;  2C0S A;  4QH4 A;  4QH5 A;  1HR0 T;  5FXX A;  1HTJ F;  4U31 A;  2WP9 A;  4YJ2 E;  1J5E T;  4Q25 A;  4AKR B;  5BR8 T;  3AE6 A;  3BQK A;  2NR4 A;  4HE8 A;  3UUN A;  2BG9 A;  3ZJ1 A;  1LVF A;  5AQR B;  4KUM B;  4DR4 T;  1N33 T;  4H9N C;  2SPC A;  2XTL A;  4HGA A;  1T7S A;  4LMJ A;  4LF5 T;  2X9H A;  3P4P A;  4X66 T;  4Z8X A;  3AEF A;  3UU5 A;  1D0Y A;  2HHH T;  1NEN A;  4QX8 B;  4JBW F;  4CN1 A;  4EOZ B;  4U7Y A;  3DP7 A;  3HA4 A;  2UXN B;  3LBX B;  2JPF A;  4TV9 E;  3PUX F;  4HFC A;  2ACX A;  4TWH A;  3SOL A;  4PK5 A;  1ZKE A;  3EAB A;  5JH7 E;  1E2A A;  4JI6 T;  1U4Q A;  3RPU A;  4P09 A;  2BKO A;  4EGW A;  2DWG A;  3O9X A;  3O1I A;  1BR0 A;  2XSA A;  4MAL A;  2QGS A;  2BVM A;  1X79 A;  4NPP A;  5HCM A;  4EZH A;  2W61 A;  5L3E B;  4X1K E;  4UR9 A;  3F31 A;  1E1H B;  2D9D A;  4EYY R;  3FXE B;  5AQF B;  5LYJ E;  2FJE A;  2DWK A;  2NOX A;  2XAF B;  2ZMA A;  3O1H A;  3PU3 A;  5JQG E;  3VU7 H;  2ACZ A;  4X1I E;  3PUQ A;  4MBQ A;  2C5J A;  2XZE A;  3ZSS A;  4H9S E;  3QNU A;  4KMC A;  1FEW A;  4IDZ A;  3R6N A;  1US7 B;  1WFD A;  4YJ3 E;  5JDF A;  2CE7 A;  3CQC B;  1XDP A;  3M65 A;  3AXJ B;  2B76 A;  2KWI B;  1YQ3 A;  2XAQ B;  2D5U A;  4IE6 A;  5LG3 A;  2DI4 A;  3ZKR A;  1LVK A;  5AQK B;  1Z8U A;  4M1P A;  3E22 E;  2JQK A;  3EAM A;  2LKG A;  1IZN B;  3ETV A;  1IJ6 A;  5HEJ A;  5L2L A;  5ABH A;  2WS3 A;  4DID B;  4I55 E;  4PJJ A;  5LMN T;  4JV5 T;  3UU3 A;  2JMH A;  3UU4 A;  4CI1 B;  4DV4 T;  4AKG A;  2XM1 A;  2C5K T;  3N2G E;  2BG9 C;  4LF7 T;  3P7I A;  5AQU B;  3KIN B;  2X67 A;  3AEA A;  2ZM2 A;  5FL0 A;  3A8Y C;  3PV0 F;  4AQY T;  1UUS A;  2E2A A;  2WQY A;  2KSR A;  3RHW A;  2V6Y A;  3QB5 A;  5CFB A;  1KFY A;  3SRZ A;  3RYH E;  3K3O A;  3QOF A;  3RKG A;  2WY2 A;  3W15 B;  2YKS A;  4QWN B;  4DBR A;  2AE9 A;  2CWY A;  4Z90 A;  2Z6E A;  1R8I A;  2D2S A;  4PNI A;  1MMN A;  3T8O A;  4E7S A;  3L39 A;  2DNX A;  3LK3 B;  4UVB B;  5JRE A;  2WDQ A;  4PK4 A;  2K5B B;  2IUB A;  3L09 A;  3SWH A;  4H9Q C;  2WU5 A;  4QHO A;  2L9Q A;  3V5S A;  4YT0 A;  5LBQ B;  5L3D B;  2YU1 A;  3CML A;  3GA8 A;  2XQY A;  5LBM A;  4DO0 A;  2V7K A;  4CI3 B;  2BZB A;  4G63 A;  4EED A;  5DQW A;  3AA1 B;  4TN7 B;  2OA5 A;  2FJB A;  4JI2 T;  1UX4 A;  1WRD A;  3P4W A;  2V7I A;  3ABV A;  4KP3 C;  3H3A A;  2RPA A;  4CN4 A;  5C3J A;  3LJC A;  1ZOY A;  2XQ8 A;  3FZF B;  2LHR A;  5LGU B;  2PFV A;  4X5T A;  2I6H A;  3TKL B;  1U5P A;  3GWH A;  4KBM B;  4UF0 A;  2YU2 A;  5LP6 E;  3AVS A;  2Q9Q A;  3NZQ A;  3UFG A;  3DJB A;  1CHU A;  3VRB A;  5L3G B;  2E9X A;  1WYB A;  5FXV A;  2CPT A;  2KXP B;  3UUB A;  4QH1 A;  3OYZ A;  2L3L A;  3ETU A;  3KFW X;  2CRB A;  5HXC A;  2VKD A;  4EEB A;  3SFE A;  5FVK A;  3KV4 A;  1I6Z A;  1ZHC A;  3VR8 A;  2VWA A;  3EUH A;  2ODU A;  3DTO A;  3ZC0 A;  4KHZ F;  3U78 A;  2XAJ B;  4HWI B;  4ZS2 A;  3LDQ B;  3B57 A;  5JDM A;  4HFE A;  5AQQ B;  4B6X A;  4IE7 A;  4K0K T;  2XSB A;  3AE7 A;  2BBJ A;  1EZ3 A;  2WWU A;  4MLK A;  4U33 A;  2XQ4 A;  4DMV A;  2PJQ A;  1AJ3 A;  2ZM8 A;  2H89 A;  2D0T A;  3QB5 K;  5AQJ B;  2QVA A;  3WAJ A;  5EK2 A;  5FMN A;  1IJ5 A;  1VRB A;  1NAF A;  1UGO A;  2WZI A;  1S94 A;  5JDH A;  4K0U A;  1OED E;  1VOM A;  2QYW A;  2NW9 A;  2LOP A;  2IW5 B;  3RRC A;  2VL0 A;  3UUM A;  3KV6 A;  5IWA T;  4DV0 T;  5LNK A;  2EHO D;  2WB5 A;  1VCT A;  2LOS A;  3VKH A;  3ZLI A;  4O4H E;  1HG2 A;  2QA7 A;  2YDS A;  4WNK A;  2LSK A;  1MIW A;  3ANW A;  3RF1 A;  1D1B A;  3RX6 A;  1J5W A;  2WMN A;  2Q9Q C;  2W62 A;  4QXB B;  2E9X C;  2A72 A;  1YKE B;  4WBO A;  2EHO A;  4DR7 T;  3ZN0 B;  2LSY A;  5GON E;  5ABF B;  4V1A v;  3ZJ2 A;  2F4V T;  4X65 T;  4DV1 T;  2IML A;  3C4W A;  3N9N A;  2MTQ A;  2BKN A;  2HN1 A;  2FJA A;  2ES0 A;  3NRY A;  1KF6 A;  2X9Y A;  4PJM A;  1T98 A;  2XUE A;  3MXZ A;  3BQL A;  4O2A E;  1HX1 B;  3A7M A;  2AXD S;  5LHH B;  4P1N A;  2PTF A;  3K3Q C;  4DR1 T;  2YN6 A;  3TLU A;  5JTG A;  1OED B;  4FJO A;  2DL1 A;  4O4J E;  4DV3 T;  3M3Z B;  4GK0 E;  3V5U A;  5HXH A;  5L3F B;  4XAX B;  4ADZ A;  3P50 A;  2ZM6 T;  1N36 T;  4AQG A;  2J47 A;  1HX8 A;  2CA5 A;  3EHZ A;  3AVR A;  3EDU A;  3C64 A;  4P0A A;  5H6R B;  4AI6 A;  4IRE A;  3NVO A;  4TNV A;  3PDY A;  4WZX A;  1UCU A;  4IST A;  5FKY A;  1D1A A;  5AFU L;  3ZMU B;  5EZY E;  1SUM B;  3AA0 B;  1YXR A;  4E7Z A;  3VR9 A;  5L4E A;  3PTR B;  3I0Q A;  3RC3 A;  1Z0P A;  3FZH B;  2XPK A;  3IA3 A;  2WDV A;  4LF6 T;  4ZI2 D;  1V9D A;  3OYX A;  4EB6 E;  4YXD A;  3D0T A;  1O3X A;  4UV9 B;  4PJN A;  4KHP T;  5LB7 B;  1ZEE A;  4TWD A;  5JDQ A;  3K8P C;  3ZST A;  1GQE A;  3I9Y A;  3ZMV B;  4B3R T;  5HEU A;  4PFO A;  2EHO C;  3JAE A;  1CUN A;  3AB3 B;  5LCY A;  4AIU A;  4ZXL A;  3C98 B;  4MFR A;  3ZC1 A;  3I1A A;  4DV2 T;  4BJN A;  4ILU A;  4JLE A;  4LMK A;  5C8Y E;  4P0B A;  2UUB T;  5EK4 A;  3TLW A;  5JRC A;  2WMO A;  2LRL A;  4DV6 T;  2W0G A;  2D0U A;  4UVA B;  1W0A A;  1LRZ A;  2X51 A;  4X64 T;  2Y8D A;  2FJD A;  3RYF E;  5C2T A;  5HWY A;  3ZCJ A;  2FBW A;  4ILA A;  4AIS A;  2KZ7 B;  4IT4 A;  4IDN A;  4UVC B;  5E0O A;  3JC6 D;  3U3I A;  1D1C A;  4WW0 A;  3FZM B;  3I0O A;  2CBJ A;  4YLH A;  1MIY A;  3ZCI A;  3AEC A;  1XMO T;  3PUZ F;  1JNZ A;  1ZP0 A;  2V26 A;  2WAU A;  2DHR A;  3MZK B;  2WWV A;  4O4L E;  3N5L A;  4H63 H;  3LBX A;  5AQN B;  5JR9 B;  3FBZ A;  2XQ9 A;  2W63 A;  3OVU A;  4CI2 B;  3AE9 A;  3AA6 B;  4AKI A;  3N9P A;  5AQG B;  5AQH B;  5LHI B;  3Q9D A;  4CN6 A;  2W67 A;  2H88 A;  4GIW A;  2JRK A;  5BMV E;  4IIJ E;  2LKH A;  3JAF A;  1T72 A;  2CEA A;  5LOV E;  2UXC T;  2G0U A;  2V1D B;  3PJA J;  4DR5 T;  1WYC A;  3OBV E;  2CLY C;  4I4T E;  4BA9 A;  4GK5 E;  2V5D A;  5LJN A;  3CQX C;  3J9X 1;  4ZI2 C;  5FXW A;  5H6Q B;  5HCJ A;  2V7L A;  2ODV A;  3UT5 E;  3RQU A;  4IDO A;  2VK9 A;  4LML A;  5DQV A;  5AQM B;  2KIN B;  3AXJ A;  3GN5 B;  3ZMS B;  1HS7 A;  2W4X A;  5FVL A;  1XDO A;  2A3D A;  2LSI A;  4OX9 T;  3FBL A;  2VUR A;  3HR0 A;  5F8P A;  1X9B A;  3RGL A;  4JI8 T;  1XZY A;  1VCS A;  4L0R A;  4I43 B;  1WR6 A;  4IDP A;  5HXR A;  2CHO A;  3WI3 A;  5IUX A;  4IDQ A;  1Y01 A;  3AEB A;  3FZL B;  4OFZ A;  3HKC E;  2WZH A;  4O8S A;  3KBT A;  3UQ4 A;  4HTE A;  3RI5 A;  4LF8 T;  2LSG A;  3PUV F;  3RIF A;  4KI0 F;  4PK6 A;  2VVS A;  2R6G F;  1T8B A;  2MOZ A;  2VVN A;  4CXY A;  4ZI7 E;  3OKQ A;  1G73 A;  2CMR A;  5KMG P;  4QKN A;  5DJQ C;  1KNZ A;  4U7I A;  2XQ7 A;  4EIW A;  2Y48 B;  1SA0 E;  1BR4 A;  1ZV4 X;  2VB6 A;  4LF9 T;  4O2B E;  1D0Z A;  3P4Q A;  4H9P C;  4HFI A;  4X20 E;  3J7Y q;  4ZHQ E;  2FUP A;  1L0V A;  2XQ6 A;  4I0U A;  5ETW A;  4ZEY A;  2NW7 A;  2OLT A;  3FZK B;  2BDE A;  3S4U A;  2VKH A;  4TUY E;  1JNR A;  4JUY A;  4A98 A;  2BKP A;  4HFB A;  1BR1 A;  2VL8 A;  3ZYM A;  1MIV A;  5LXT E;  5AQS B;  2CM0 A;  3PUY F;  2KMF A;  2KND A;  3Q5D A;  4JI5 T;  4DBQ A;  3TLS A;  5CA1 E;  1XNR T;  3AAE B;  4UEL A;  2XAH B;  2J62 A;  3A5X A;  3H3M A;  1Y64 B;  2H7V C;  4YTN A;  2XAG B;  2LM2 A;  4GOU A;  1KNP A;  5FL1 A;  2W2U A;  2V7J A;  4DMW A;  1MMD A;  5AQO B;  4YTM A;  3UU6 A;  4X62 T;  4HWD A;  4TV8 E;  1M62 A;  3RLF F;  1E7P A;  4U2Y A;  4EXT A;  2DLR A;  2UUC T;  4NIQ A;  2UUA T;  4YHJ A;  4JI4 T;  2JIW A;  5EK3 A;  2CWO A;  3CX7 B;  3B13 A;  3Q5W A;  4U72 A;  3RIA A;  4B3T T;  2C5I T;  2NW8 A;  3Q5E A;  2A9U A;  3ZEF B;  4AQF A;  3ZMT B;  3RKO A;  2V5C A;  4IL9 A;  3CQG B;  2CXD A;  3PUW F;  4A5X A;  4EAH A;  2BG9 B;  3SFD A;  4QX7 B;  3CPZ A;  4I50 E;  4TNW A;  5IHY A;  3IF8 B;  4EZ4 A;  2V7M A;  2J1D G;  1UUR A;  1MND A;  3G06 A;  3TLV A;  5ABE A;  3CKD A;  3L8R A;  4IL4 A;  3CVR A;  1HNX T;  4HWH A;  5HEO A;  3P8C D;  5LA6 E;  4CXX A;  5JDG A;  3ZN1 B;  2KT9 A;  5HXE A;  1FMV A;  3HKE E;  3OTO T;  5L4H A;  5HWX A;  4GKJ T;  2NTY A;  4ZI3 D;  3MKD A;  1OXZ A;  3KV5 A;  2CXL A;  1I94 T;  1SHZ C;  4A97 A;  2NP9 A;  5JVD E;  1YQ4 A;  3NKZ A;  2X9W A;  3H37 A;  1DU2 A;  3R84 B;  2PBI A;  3N9L A;  1N34 T;  2WM9 A;  2LT3 A;  3IHR A;  4X1Y E;  5J1G A;  2JMK A;  4JI0 T;  4ILB A;  4H9O C;  3IBP A;  3QK6 A;  4TX5 A;  4BJM A;  2WDR A;  3O1J A;  4UXN B;  2XM2 A;  1HFA A;  2BS3 A;  4ZS3 A;  3TLT A;  3VHL A;  2XQ5 A;  1S35 A;  1OWA A;  3AEG A;  4PAG A;  2YK0 A;  2YOE A;  2XHE B;  2PG8 A;  3CX8 B;  2BS4 A;  1HCI A;  3AAA B;  2IC6 A;  4YSX A;  4MHC A;  4DR6 T;  1HG5 A;  1BR2 A;  1M7K A;  2IC9 A;  3HL6 A;  1YW0 A;  3KV9 A;  5KDM C;  4DUZ T;  4OHF A;  4GYR A;  3NBX X;  5CJ5 A;  3PE0 A;  5HAX A;  4CXW A;  4OYK A;  3C50 A;  4AQF C;  4F6R C;  1NEK A;  2I59 A;  4LF4 T;  5ABF A;  4IE5 A;  4L9I A;  3AE8 A;  3FXD B;  4AXP A;  4NXN T;  2VKJ A;  5LGT B;  2GK9 A;  5LHG B;  5FY1 A;  3CWZ B;  3N9Q A;  3LFM A;  2IDO B;  1WR0 A;  2M67 A;  3HKB E;  3ZT7 A;  4UEM A;  5AQT B;  3T1Y T;  3RRW A;  2V6Y B;  5A1L A;  2V6X A;  4ZZB A;  4JEU B;  5F3J A;  3IEE A;  2WU2 A;  4NUV A;  2E5V A;  2M6B A;  1OED A;  2V8S V;  3NZP A;  3ZMZ B;  3AED A;  4ISS A;  4J2C A;  4IE4 A;  3PUA A;  4JEH B;  4IHJ E;  2UXX B;  3C4X A;  4HEA A;  5HEH A;  2K48 A;  5IYZ E;  5FNV E;  4DVD A;  4AKL A;  4DR3 T;  5HYA A;  1MNE A;  3AE3 A;  2HN2 A;  3ONL C;  5CGM A;  3CIR A;  4ZOL E;  2E5L T;  3F57 A;  4ZI3 C;  4YSZ A;  5J2U E;  3ONJ A;  3VRA A;  3F2E A;  4YSY A;  2LM9 A;  5L3C B;  1KEY A;  3AE5 A;  3ZYK A;  3RIU A;  2JQ9 A;  2XY8 B;  3RH3 A;  2IHR 1;  1G8X A;  1XMQ T;  5LJM A;  5AQV B;  5M4Y A;  2CHN A;  2OV9 A;  3UUL A;  4HWF A;  5TAO A;  2BS2 A;  3QUJ A;  1XWM A;  5CA0 E;  2QRX A;  2N9D A;  4XZC A;  2W00 A;  4DV7 T;  4F8H A;  1H7C A;  4FI5 A;  2Y6X A;  3GMI A;  4IE0 A;  4NXM T;  4GYS A;  2UXB T;  2MPK A;  4UF0 B;  5HXS A;  4JYA T;  3OJA A;  2BVL A;  3KBU A;  5DAB A;  2Q9Q B;  4N78 D;  2E9X B;  3MAC A;  5AQL B;  4DR2 T;  1UK5 A;  3EI0 A;  2MBG A;  2HPL A;  5ADX L;  1QSD A;  2I0M A;  4UV8 B;  4TZ4 C;  2CCQ A;  1HF8 A;  1YKH B;  5LGN B;  4YTP A;  5ABG A;  3K1S A;  3L3P A;  1OED C;  5L47 A;  2N1G A;  3EVY A;  4BAY B;  4DUY T;  4AKH A;  2LE8 A;  5J2T E;  2HH7 A;  1IBM T;  3JCF A;  3RYC E;  3ZT5 A;  4OYJ A;  1YD8 G;  4CQI A;  4A56 A;  1HNW T;  3AE2 A;  3ZT6 A;  3KVB A;  4LFB T;  4H63 V;  2K3W A;  5LMU T;  3UU8 A;  2KLQ A;  3O4X E;  4ZZC A;  4HKA A;  2X0H A;  2NTX A;  3BQI A;  1XNQ T;  1MMG A;  1QUU A;  2B1E A;  4YFS A;  2XQA A;  3AA7 B;  2Q9Q D;  3PUS A;  3ZPO A;  5AQI B;  2E9X D;  2XQ3 A;  2BBH A;  3CK6 A;  4HFH A;  5JR9 A;  3OPC A;  5L3B B;  3HKD E;  3RYI E;  5AQP B;  3RIU C;  2J4G A;  4UIG A;  3P4R A;  1UX5 A;  2M6I A;  4PW8 A;  1NWM X;  3PU8 A;  4O4I E;  5JDN A;  2P9B A;  5KX5 E;  3E0Z A;  2CBI A;  1KK7 A;  4HFV A;  2VKO A;  2WCA A;  3SS1 A;  5HEG A;  3JC6 C;  2ZM0 A;  1IBL T;  4JI7 T;  1FMW A;  4HN9 A;  1SE7 A;  3PJA A;  3BK9 A;  4YY3 T;  2UXD T;  3ANW B;  3WAK A;  4WYV A;  2WSS V;  2JQQ A;  3FHN A;  4PJL A;  4JI3 T;  1LKX A;  4KX6 A;  2BG9 E;  4ANJ A;  3RC8 A;  1KNR A;  2YIN A;  4IGU A;  2EHO B;  2VQE T;  3ESL A;  2MYS A;  3PUG A;  3PUR A;  2L8K A;  3X1D A;  2KWH A;  4YHH T;  3GN5 A;  2X0Y A;  2DCF A;  2LHN A;  1WLX A;  2HPJ A;  3NRX A;  3N9O A;  2LEH A;  2E8I A;  4QXH B;  2LLY A;  2X0L B;  4COF A;  3B5M A;  3UQ7 A;  3CX6 B;  4NUU A;  2H3R A;  1FJG T;  2LJL A;  3UFE A;  4TWF A;  1QLB A;  3LK4 2;  2N2N A;  4DV5 T;  1MMA A;  5KXJ A;  4LFA T;  3E08 A;  4OK0 A;  4U3C A;  2MAW A;  4G2A A;  4C91 A;  4B3M T;  1W09 A;  3LK2 B;  3ZYL A;  3MJX A;  1HNZ T;  2VQF T;  3C51 A;  1IBK T;  2UU9 T;  2RA1 A;  4JI1 T;  4HFD A;  3AE4 A;  2X68 A;  2VAS A;  4XBF B;  2YEV C;  1B7T A;  3N2O A;  4U74 A;  3JAD A;  4Z91 A;  3UTK A;  4LFC T;  2IIU A;  2X66 A;  2X9X A;  3ONX A;  3N9M A;  3LSV A;  3LG7 A;  5CB4 E;  4U2Z A;  5JR9 C;  4GKK T;  2IAK A;  4EYU A;  5JDL A;  2RP4 A;  4C90 A;  3AE1 A;  5FY0 A;  3C4Z A;  4EV6 A;  2JJ9 A;  4ILC A;  2XAS B;  1W9R A;  5FP3 A;  3VKG A;  3I9W A;  4DND A;  4ASK A;  2YDR A;  2YDQ A;  1FIO A;  3Q5X A;  3UUX B;  3EDV A;  2H7O A;  1J1J A;  5FXZ A;  2LRK A;  3KVA A;  1N32 T;  3AAI A;  5J0Z A;  4L5G A;  2CLY B;  2NWB A;  2XJ7 A;  3MA9 A;  4H9R C;  2JQH A;  3N2K E;  3P4S A;  3T1H T;  1IAP A;  4ERR A;  5F5W A;  2K24 A;  4PFP A;  2CXF A;  5LG4 A;  4B3S T;  4QXC B;  3NWI A;  3Q2M A;  2ZLY A;  1W0B A;  4CZZ B;  1WCR A;  2A2F X;  5FYM A;  2WBL A;  2K9A A;  3FB2 A;  4HWC A;  3MK7 C;  3K3N A;  3AEE A;  1D0X A;  3RQW A;  4WBN E;  3KDS E;  3QC9 A;  2W66 A;  3HI2 A;  5JRC B; 
#chains in the Genus database with same CATH homology
 4JI8 T;  4YY3 T;  2UXD T;  4KHP T;  1HNX T;  4DUZ T;  2E5L T;  4DR1 T;  1HR0 T;  4JI3 T;  4B3R T;  4DUY T;  4GKK T;  1J5E T;  4DV3 T;  1IBM T;  3OTO T;  2VQE T;  5BR8 T;  4LF4 T;  4GKJ T;  4X62 T;  1XMQ T;  1HNW T;  4YHH T;  4LFB T;  2ZM6 T;  4LF8 T;  1N36 T;  1I94 T;  5IWA T;  4NXN T;  5LMU T;  4DV0 T;  4DV2 T;  4DR4 T;  1N33 T;  2UUC T;  2UUA T;  1XNQ T;  2UUB T;  4LF5 T;  4X66 T;  3T1Y T;  1N34 T;  4JI4 T;  1FJG T;  4DV7 T;  4DV6 T;  2HHH T;  4NXM T;  2UXB T;  4JI0 T;  2UXC T;  1N32 T;  4DV5 T;  4DR5 T;  4LFA T;  4B3T T;  4X64 T;  4JYA T;  4LF9 T;  4B3M T;  5LMN T;  3T1H T;  4K0K T;  4JV5 T;  4DR7 T;  1HNZ T;  2VQF T;  4DV4 T;  4JI6 T;  4JI2 T;  4B3S T;  1IBK T;  2UU9 T;  4DR2 T;  4JI1 T;  4LF7 T;  2F4V T;  4X65 T;  4DV1 T;  4DR3 T;  4LF6 T;  4OX9 T;  1IBL T;  4JI7 T;  4AQY T;  4JI5 T;  4LFC T;  4DR6 T;  1XNR T;  1XMO T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...