1OEDE

Structure of acetylcholine receptor pore from electron images
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
260
structure length
128
Chain Sequence
b'PLFYIINIIAPCVLISSLVVLVYFLPAQAGGQKCTLSISVLLAQTIFLFLIAQKVPETSLNVPLIGKYLIFVMFVSMLIVMNCVIVLNVSLRTGKVIDKACFWIALLLFSIGTLAIFLTGHFNQVPEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ACETYLCHOLINE RECEPTOR PROTEIN, ALPHA CHAIN
publication title Structure and Gating Mechanism of the Acetylcholine Receptor Pore.
pubmed doi rcsb
molecule tags Ion channel/receptor
total genus 52
structure length 128
sequence length 260
ec nomenclature
pdb deposition date 2003-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02932 Neur_chan_memb Neurotransmitter-gated ion-channel transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 1oedE00
3EAMA 5J0ZA 1OEDB 2BG9A 4ILAA 3TLSA 4Z91A 5HEOA 4TNWA 3UU8A 5IUXA 5LG3A 4HFIA 2XQ4A 3JADA 4IL9A 5L4HA 2XQ8A 3P50A 2YOEA 3RQUA 2BG9E 5HCMA 3UU3A 2LKGA 5HEJA 5HEGA 2XQAA 3UU4A 1OEDE 3TLTA 4TWHA 2XQ9A 4IL4A 4HFCA 4ILBA 3UU6A 2YKSA 4HFBA 3JAEA 1OEDA 3UUBA 2KSRA 2M6BA 4IREA 4A97A 4TWDA 3TLVA 2XQ5A 3EHZA 3UQ7A 5L47A 3TLUA 4LMKA 4ILCA 3TLWA 4TNVA 5HCJA 4HFEA 3RQWA 3UU5A 3EI0A 4QH4A 3RIAA 3UQ4A 2XQ6A 2BG9C 4X5TA 1OEDC 5HEHA 4ZZBA 2LKHA 3P4WA 2YN6A 4LMJA 4TWFA 4HFHA 4QH1A 5HEUA 2VL0A 2LLYA 4NPPA 4COFA 4LMLA 4ZZCA 4QH5A 4Z90A 2M6IA 3JAFA 2XQ7A 4A98A 3RI5A 5L4EA 3LSVA 3RIFA 4HFDA 2LM2A 3RHWA 4F8HA 2MAWA 2XQ3A 3ZKRA 5CFBA 2BG9B
chains in the Genus database with same CATH superfamily
4QWNB 4WW0A 3KV4A 2UXDT 4EYUA 4IE0A 3O9XA 2OLTA 1HCIA 4ZI7E 2C5IT 3B57A 1W09A 4L9IA 1QUUA 2LT3A 5AQKB 5FL1A 2RA1A 4ZI3C 2V8SV 3WI3A 2A3DA 3C4ZA 2XHEB 1QSDA 4KI0F 2SPCA 2MYSA 1WFDA 3TLWA 4TV9E 5LJNA 4AXPA 4IE5A 3VR9A 3Q2MA 3PUAA 3UQ4A 3ZT6A 4UV8B 4ZZBA 4TWFA 4F6RC 2YEVC 2WSSV 4TV8E 1W0AA 4JI4T 2LRLA 3BQKA 2V6XA 4YY3T 4DR4T 1SE7A 3N9OA 3QOFA 5AQSB 4XAXB 1WYCA 3I1AA 4CN6A 2BS2A 4AKIA 3A7MA 2ZM8A 2W67A 1MMGA 3N9NA 2WS3A 1UURA 5LHHB 2YK0A 2ZM0A 3OVUA 5H6QB 2E9XB 1XMOT 1Y01A 3E0ZA 3PJAA 3Q5XA 3ONJA 4C91A 3UU8A 1J1JA 2YDSA 2LM9A 2J4GA 4HFIA 3HKCE 2XAFB 4EIWA 1WYBA 2X66A 5L4HA 5LA6E 4DMVA 2BVMA 2KWIB 4UELA 4KP3C 4JI6T 1X79A 4OYKA 5LGUB 5AQPB 4DNDA 5JDLA 5EK3A 3EABA 2YKSA 2VKJA 5KMGP 4JEUB 2CHOA 5FYMA 3UUBA 4CI1B 3PUVF 2H3RA 2W0GA 3AE9A 3AE6A 4I43B 3EHZA 2C0SA 3MZKB 3TLUA 1KFYA 2LEHA 3SFEA 2K5BB 2X67A 4GYRA 2XAGB 2WP9A 4X5TA 3E08A 4TX5A 5ABEA 2DI4A 3AAAB 4OK0A 4NXMT 2KXPB 2E5LT 4PFOA 3EVYA 4IGUA 5ABGA 5L3GB 2LJLA 1S94A 1T8BA 3AAEB 3M3ZB 1ZP0A 4YJ3E 2NP9A 2JJ9A 4Z8XA 3RIFA 5F3JA 4F8HA 2NW8A 3VKHA 5ABFB 1LVKA 2V7IA 3ZC1A 1D0YA 4IDZA 1Z0PA 3IEEA 1UCUA 3ZEFB 3EAMA 4ZEYA 3AXJB 2VKHA 1GQEA 1HS7A 2X51A 2XQ8A 2BS3A 3FXEB 1UX4A 4X1IE 2ES0A 4IE7A 4DO0A 4CXWA 5J2UE 3QUJA 4P0BA 4ILBA 3G06A 2KSRA 5HXCA 3ZJ1A 4ADZA 2VVNA 5FXZA 4IIJE 2JIWA 5KX5E 4DR1T 2Q9QA 3CK6A 2YN6A 2HPLA 1QLBA 2VVSA 4IDPA 4PNIA 5FVKA 2CM0A 5BMVE 3ZPOA 5FXWA 5AQUB 1FEWA 4QH5A 2WU5A 4Z90A 4XBFB 3QNUA 2J1DG 4DV6T 2XAQB 2WY2A 5L4EA 1N34T 2I59A 2LHRA 5JQGE 2JQ9A 2DWKA 2W61A 4AISA 4ERRA 1KF6A 3GWHA 2BG9B 5AQVB 2CPTA 2Q9QC 1ZHCA 1KNRA 2V7MA 3N2GE 3KV5A 2OA5A 2BG9E 3MA9A 4YLHA 5HEJA 5FNVE 4OYJA 2CBIA 1VOMA 3V5UA 4EZ4A 3ESLA 3UU6A 5KDMC 3PE0A 1OEDA 5LP6E 3LG7A 3PUWF 4FI5A 2WQYA 4DV2T 2UXXB 4EOZB 1WLXA 2DL1A 3UU5A 2F4VT 2VL8A 1J5ET 5AQTB 4L5GA 4YFSA 3ZN1B 2E2AA 4HFHA 5H6RB 3ZMSB 1XZYA 4CI3B 4QXCB 3LFMA 2CLYC 3P7IA 5BR8T 4JI2T 4B3TT 4B3ST 5JTGA 2JQHA 4EXTA 3HKDE 3C50A 2K9AA 3K3QC 3N9LA 3RRCA 5JRCA 3A5XA 3T1HT 2CHNA 4Q25A 3ZT5A 1MMNA 4ZI2C 3RX6A 3FZFB 3MACA 2LM2A 5HYAA 1BR4A 5FKYA 2Y6XA 3OJAA 4DV0T 2K48A 1AJ3A 5CFBA 4IDQA 1W9RA 5CB4E 2XY8B 4ASKA 4UF0B 5JREA 3ONXA 2V7LA 3ZJ2A 3E22E 1HFAA 3RIUA 1V9DA 1O3XA 4DR6T 5TAOA 4QXHB 1UX5A 3EDUA 4IL4A 3AE5A 3OBVE 5LG4A 4HFBA 3AVRA 3RLFF 3U3IA 2P9BA 2YU1A 4IE6A 5L3CB 5LHIB 4LFBT 3BQIA 4LMKA 3KVAA 3MK7C 4DMWA 1HG5A 1HX1B 3AECA 3FZKB 4UV9B 4HN9A 2D0UA 3HR0A 4H9RC 4I55E 3RIUC 3RGLA 4JEHB 2CXDA 3R6NA 2V5DA 2XM1A 4LF6T 5KXJA 1LKXA 3WAKA 3UTKA 4YSZA 5LXTE 3KV6A 2IC9A 1VCTA 3LSVA 4GIWA 3VHLA 2V26A 4ANJA 2XQ3A 2OV9A 3NBXX 2N2NA 4UVCB 4E7SA 2E9XA 3ZMZB 3RPUA 2L9QA 4HWHA 3OPCA 2V7KA 1S35A 2WBLA 2RPAA 2XQAA 4DR3T 2FJAA 1UGOA 1T7SA 3AE8A 2VKDA 3AEGA 5IHYA 3N9QA 4QX8B 4HWCA 1NWMX 1N36T 3C4XA 5FMNA 2I6HA 3KBUA 3PUZF 2V6YA 5F5WA 4ZS2A 3CVRA 5HCJA 3J9X1 4H9OC 4XZCA 4TUYE 4HWDA 3LDQB 3P4QA 2E9XC 5J1GA 3UFGA 2FBWA 2WDVA 3NVOA 2UUAT 1WCRA 2H88A 2JRKA 3HI2A 1MNEA 4NPPA 4O2AE 2WMNA 5FY0A 3ZT7A 5LNKA 2MTQA 4WBOA 2W66A 1US7B 4ZHQE 5FXVA 2VASA 3CPZA 3C4WA 3C51A 2XPKA 2CRBA 5LBMA 5CA1E 5HXRA 5ABFA 2WZIA 3KBTA 5AQGB 2NWBA 5IUXA 3RKGA 4U7YA 3M65A 4LFAT 2LSKA 2L8KA 4K0UA 3HA4A 3JC6C 2W4XA 4O4IE 2HN1A 3AA7B 1HF8A 3N2OA 4DVDA 4A97A 3L09A 4JBWF 4PAGA 2JMHA 1T72A 2LSGA 4EEBA 3O1JA 1E7PA 4G2AA 2IIUA 3C98B 1M7KA 4IHJE 4YJ2E 5LYJE 2W2UA 4AKGA 1VRBA 4DBQA 2EHOD 4AKLA 3PU8A 4ISSA 2KZ7B 4JYAT 4MLKA 2FJBA 4PW8A 2UXBT 4QHOA 1XMQT 3GMIA 2UU9T 4U33A 3UFEA 3PU3A 3PURA 1Y64B 3H37A 2BG9A 4ILAA 2NTXA 1MIWA 2JQQA 4HFVA 4H63H 4U2ZA 5LG3A 1CUNA 2WMOA 4OHFA 4CI2B 2Q9QD 1D0ZA 3PUSA 3CX6B 4YTPA 2GK9A 4DR2T 5DJQC 3TLTA 4EAHA 4GK5E 5DQWA 3DTOA 4YXDA 3JAEA 2ODUA 2YU2A 4DBRA 3P4RA 5L47A 2EHOA 4X1KE 4EB6E 4HFEA 2H7OA 2BG9C 2WDRA 2NR4A 2NW9A 4PK6A 3GN5B 2IC6A 2V7JA 3IA3A 5AQMB 2X9WA 3SFDA 1IBLT 3AA1B 3CQGB 2NOXA 4DIDB 5C8YE 5HEUA 1G8XA 1HNXT 2J62A 3AVSA 4O8SA 4COFA 4ZS3A 4KBMB 3GA8A 5L3EB 2JQKA 4JLEA 4IDNA 4U72A 2WAUA 2N9DA 3OKQA 2FJEA 5JH7E 1BR1A 2XSBA 3B13A 3AA0B 3KINB 3RI5A 1CHUA 2CWYA 2EHOC 2X0LB 4DV5T 4P0AA 2MAWA 3PJAJ 4ZI2D 3FZLB 2YDQA 1T98A 4BJNA 1VCSA 1NAFA 2CMRA 4UF0A 2BKPA 3AE2A 3PTRB 3JADA 1HNWT 1L0VA 4B3RT 4UIGA 1YKHB 4QKNA 1JNZA 2XQ9A 2D0TA 5AQOB 2IMLA 5FY1A 3AE1A 3VKGA 2K24A 3MKDA 3N9MA 5GONE 2M6BA 4CZZB 4M1PA 4TWDA 1FJGT 4KX6A 5JR9B 4YTMA 2WZHA 2KLQA 1YKEB 3O1IA 1NEKA 2H7VC 3NKZA 3VRBA 4AQFA 1MMAA 2M67A 5AQHB 2DHRA 4CXYA 2LOPA 1M62A 2PTFA 4DV1T 2IDOB 5HWYA 4BA9A 1SHZC 4KUMB 4ZOLE 2BZBA 1KNPA 3QK6A 4YTNA 3AE7A 3K3NA 3HKBE 2VB6A 2ZLYA 3CX8B 2M6IA 3ABVA 2XASB 1XWMA 5LMNT 1IJ5A 4A98A 2HH7A 3EDVA 2ACXA 3ZCJA 3ZSTA 2QRXA 5ADXL 1HR0T 2PJQA 4FJOA 4AQFC 4K0KT 1D1CA 3AEFA 3ZCIA 4J2CA 5J0ZA 3U78A 4TNWA 2C5JA 1IBKT 4HKAA 3PUYF 2D9DA 4DR7T 3P50A 4BAYB 1KK7A 3RQUA 1SUMB 2LSYA 2V1DB 3T1YT 2LKGA 1IAPA 1ZOYA 3ANWB 5HXHA 5FY7A 2YINA 2DWGA 2C5KT 5LBQB 2DLRA 3QB5A 1U5PA 2I0MA 2LSIA 4TNVA 4LF4T 3EI0A 2XQ6A 4CXXA 3LBXB 4JI3T 1E1HB 3NZPA 4O4HE 1BR2A 2LKHA 2E9XD 2CCQA 3AAIA 2ZM6T 3AEAA 1XNQT 4LF5T 4PJMA 2ZMAA 1LVFA 3NRXA 2J47A 3F2EA 4HGAA 1I94T 2KT9A 3O1HA 4HFDA 2X0YA 4WBNE 4UVAB 5JVDE 2LE8A 4MBQA 5C3JA 2MBGA 2FJDA 2HPJA 2BBHA 3WAJA 4AKRB 1OEDB 2KNDA 4WZXA 4UR9A 2XQ4A 3RYIE 2N1GA 2CEAA 1OEDE 3PDYA 4P09A 4TWHA 4EV6A 4PK4A 1MMDA 3C64A 5AQNB 1XDOA 3L8RA 5HWXA 3VR8A 3CQCB 3AB3B 3JCFA 5FXXA 3JC6D 3NZQA 4UVBB 3B5MA 2XQ5A 3MJXA 3UQ7A 2V5CA 4V1Av 2RP4A 3I0QA 4EEDA 4X66T 4U74A 3SS1A 2BDEA 3I9YA 4YT0A 5AQJB 3PUXF 5FL0A 1OXZA 2L3LA 5JDQA 4H9NC 4WYVA 1HNZT 4DV7T 3IHRA 4QH1A 2VL0A 3S4UA 2D5UA 3ZYLA 4HTEA 3UUXB 1XNRT 4LMLA 4A5XA 2FUPA 5AQIB 1UUSA 5JDFA 3RRWA 5EK4A 4LFCT 4U31A 3ZN0B 3OYXA 2XM2A 1R8IA 4ISTA 5HAXA 3HL6A 4JI1T 2MOZA 2XAHB 4BJMA 3MXZA 1N33T 2Y8DA 5FVLA 2Z6EA 5AQLB 2VK9A 2CWOA 4JI5T 5HEOA 2XQYA 3A8YC 3LK3B 1HG2A 2ODVA 4CN4A 2WU2A 4O4LE 4L0RA 3FBZA 3K3OA 3RF1A 4X64T 4YSYA 5A1LA 5JDMA 3KV9A 5HCMA 4U7IA 3PUQA 5E0OA 2QYWA 3RC3A 2VQET 3KDSE 2IAKA 3QC9A 5LGNB 3AXJA 5L3DB 5EK2A 3TLVA 5LCYA 3H3AA 4IE4A 2H89A 2A72A 2XAJB 2DCFA 1BR0A 1FMWA 3SOLA 2XZEA 2LHNA 4G63A 2AXDS 2BKOA 2NTYA 1YD8G 3GN5A 4X20E 2KWHA 2LLYA 5HXSA 4QX7B 2E8IA 5HXEA 4NXNT 4OFZA 5AQFB 3JAFA 1WR6A 4DR5T 5DABA 3P4SA 2CE7A 3H3MA 3RYFE 3PV0F 1UK5A 3BQLA 4I4TE 1D1AA 2V6YB 3RC8A 4X1YE 4MHCA 4CN1A 4GKJT 5IWAT 3I0OA 3ZYMA 2BVLA 3I9WA 3ETUA 3R84B 4NUVA 2X68A 2CXLA 5LHGB 1YXRA 1ZEEA 3Q5EA 4LF9T 3DP7A 4E7ZA 1Z8UA 3N2KE 2LOSA 1W0BA 3LJCA 4AQYT 3N9PA 4TN7B 3ZYKA 5JR9A 4ILCA 4IT4A 2QVAA 4QH4A 1IBMT 4U2YA 2HHHT 3PUGA 5EZYE 1LRZA 3AE4A 4LMJA 3FB2A 2D2SA 2Y48B 4P1NA 1WR0A 4TZ4C 3HKEE 1FMVA 4H9PC 4H9QC 2VQFT 3RYCE 4ZZCA 2PG8A 1U4QA 4DV3T 2XQ7A 3LK42 4HWFA 3ONLC 3CX7B 3P8CD 4WNKA 3SWHA 3K8PC 1YQ3A 4KHPT 1EZ3A 5JR9C 3RH3A 1B7TA 3ZKRA 3UUNA 3EUHA 3AA6B 4I0UA 1J5WA 4HE8A 2LRKA 4MFRA 1WRDA 1MNDA 4JI0T 4I50E 4PFPA 2JMKA 2ZM2A 3UU4A 4X62T 3W15B 2CA5A 1YQ4A 3ZMUB 1SA0E 1IZNB 3Q9DA 3FZMB 4A56A 2CBJA 2E5VA 4IREA 3ANWA 5CA0E 2XSAA 4ZXLA 4MALA 4ILUA 2VKOA 3CMLA 4LF8T 3RIAA 2QA7A 2CXFA 1X9BA 5J2TE 5ABHA 2VWAA 4JV5T 4AI6A 3LBXA 1D0XA 4B6XA 3CQXC 4AQGA 3RKOA 3L39A 5CJ5A 2UXCT 5JDHA 1JNRA 1NENA 5LJMA 2UUCT 2W62A 4PJNA 3RHWA 4JI8T 3Q5DA 1FIOA 4PJJA 2LSJA 1IJ6A 2X9HA 2JPFA 3CIRA 3TLSA 4Z91A 2VURA 3FBLA 5ETWA 2A9UA 3J7Yq 1DU2A 3DJBA 1H7CA 2BS4A 2EHOB 3FXDB 3AEEA 1N32T 4CQIA 4GOUA 5F8PA 3UU3A 3TKLB 4YHHT 3D0TA 5L2LA 1ZV4X 5L3FB 4X65T 4B3MT 2W00A 2WWUA 4JUYA 4YSXA 2ACZA 5FP3A 3ZLIA 2WM9A 2XUEA 3VU7H 2XJ7A 4LF7T 2B76A 3AE3A 2X0HA 4HEAA 3ZC0A 2Q9QB 1HTJF 5M4YA 3T8OA 1OEDC 5HEHA 3BK9A 3RYHE 3P4WA 3F31A 5LB7B 4OX9T 4C90A 5AQQB 3FHNA 2G0UA 2K3WA 4UEMA 3LK2B 2IW5B 2KMFA 2DNXA 4JI7T 3Q5WA 2X9YA 2AE9A 5JDGA 4QXBB 4AKHA 3KFWX 2WCAA 4AIUA 1E2AA 4EZHA 3SRZA 2KINB 4H63V 5LOVE 1YW0A 4UXNB 3AEDA 3O4XE 1D1BA 1MIYA 2WB5A 3OYZA 3NRYA 1XDPA 4O4JE 2IHR1 3OTOT 2IUBA 2NW7A 3UT5E 2WDQA 2UUBT 4DUZT 3ETVA 4ZI3D 5CGMA 5DQVA 3NWIA 2CLYB 3X1DA 1ZKEA 3ZMTB 4IL9A 2YDRA 2YOEA 4O2BE 5HEGA 4DUYT 1KEYA 2A2FX 4GK0E 4HFCA 3AEBA 5JDNA 2R6GF 4N78D 4YHJA 4PJLA 5C2TA 2PFVA 3IF8B 4GYSA 3CKDA 3L3PA 2BBJA 4DV4T 3RQWA 3P4PA 3ZMVB 1OWAA 1HX8A 2WWVA 4PK5A 3UULA 3VRAA 4EYYR 4NUUA 5AFUL 1I6ZA 4H9SE 2XTLA 1G73A 5LMUT 4KHZF 4GKKT 3V5SA 4EGWA 2QGSA 2UXNB 4NIQA 3CWZB 3UUMA 3F57A 2X9XA 5L3BB 5JRCB 3FZHB 1KNZA 2BKNA 3QB5K 4U3CA 3KVBA 3ZSSA 2W63A 4HWIB 5IYZE 2MPKA 3IBPA 5LGTB 3K1SA 2B1EA 4KMCA 4IDOA 5AQRB 2HN2A 1MIVA 2PBIA 3N5LA
chains in the Genus database with same CATH topology
3EAMA 5J0ZA 1OEDB 2BG9A 4ILAA 3TLSA 4Z91A 5HEOA 4TNWA 3UU8A 5IUXA 5LG3A 4HFIA 2XQ4A 3JADA 4IL9A 5L4HA 2XQ8A 3P50A 2YOEA 3RQUA 2BG9E 5HCMA 3UU3A 2LKGA 5HEJA 5HEGA 2XQAA 3UU4A 1OEDE 3TLTA 4TWHA 2XQ9A 4IL4A 4HFCA 4ILBA 3UU6A 2YKSA 4HFBA 3JAEA 1OEDA 3UUBA 2KSRA 2M6BA 4IREA 4A97A 4TWDA 3TLVA 2XQ5A 3EHZA 3UQ7A 5L47A 3TLUA 4LMKA 4ILCA 3TLWA 4TNVA 5HCJA 4HFEA 3RQWA 3UU5A 3EI0A 4QH4A 3RIAA 3UQ4A 2XQ6A 2BG9C 4X5TA 1OEDC 5HEHA 4ZZBA 2LKHA 3P4WA 2YN6A 4LMJA 4TWFA 4HFHA 4QH1A 5HEUA 2VL0A 2LLYA 4NPPA 4COFA 4LMLA 4ZZCA 4QH5A 4Z90A 2M6IA 3JAFA 2XQ7A 4A98A 3RI5A 5L4EA 3LSVA 3RIFA 4HFDA 2LM2A 3RHWA 4F8HA 2MAWA 2XQ3A 3ZKRA 5CFBA 2BG9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EAM A;  5J0Z A;  1OED B;  2BG9 A;  4ILA A;  3TLS A;  4Z91 A;  5HEO A;  4TNW A;  3UU8 A;  5IUX A;  5LG3 A;  4HFI A;  2XQ4 A;  3JAD A;  4IL9 A;  5L4H A;  2XQ8 A;  3P50 A;  2YOE A;  3RQU A;  2BG9 E;  5HCM A;  3UU3 A;  2LKG A;  5HEJ A;  5HEG A;  2XQA A;  3UU4 A;  1OED E;  3TLT A;  4TWH A;  2XQ9 A;  4IL4 A;  4HFC A;  4ILB A;  3UU6 A;  2YKS A;  4HFB A;  3JAE A;  1OED A;  3UUB A;  2KSR A;  2M6B A;  4IRE A;  4A97 A;  4TWD A;  3TLV A;  2XQ5 A;  3EHZ A;  3UQ7 A;  5L47 A;  3TLU A;  4LMK A;  4ILC A;  3TLW A;  4TNV A;  5HCJ A;  4HFE A;  3RQW A;  3UU5 A;  3EI0 A;  4QH4 A;  3RIA A;  3UQ4 A;  2XQ6 A;  2BG9 C;  4X5T A;  1OED C;  5HEH A;  4ZZB A;  2LKH A;  3P4W A;  2YN6 A;  4LMJ A;  4TWF A;  4HFH A;  4QH1 A;  5HEU A;  2VL0 A;  2LLY A;  4NPP A;  4COF A;  4LML A;  4ZZC A;  4QH5 A;  4Z90 A;  2M6I A;  3JAF A;  2XQ7 A;  4A98 A;  3RI5 A;  5L4E A;  3LSV A;  3RIF A;  4HFD A;  2LM2 A;  3RHW A;  4F8H A;  2MAW A;  2XQ3 A;  3ZKR A;  5CFB A;  2BG9 B; 
#chains in the Genus database with same CATH topology
 4QWN B;  4WW0 A;  3KV4 A;  2UXD T;  4EYU A;  4IE0 A;  3O9X A;  2OLT A;  1HCI A;  4ZI7 E;  2C5I T;  3B57 A;  1W09 A;  4L9I A;  1QUU A;  2LT3 A;  5AQK B;  5FL1 A;  2RA1 A;  4ZI3 C;  2V8S V;  3WI3 A;  2A3D A;  3C4Z A;  2XHE B;  1QSD A;  4KI0 F;  2SPC A;  2MYS A;  1WFD A;  3TLW A;  4TV9 E;  5LJN A;  4AXP A;  4IE5 A;  3VR9 A;  3Q2M A;  3PUA A;  3UQ4 A;  3ZT6 A;  4UV8 B;  4ZZB A;  4TWF A;  4F6R C;  2YEV C;  2WSS V;  4TV8 E;  1W0A A;  4JI4 T;  2LRL A;  3BQK A;  2V6X A;  4YY3 T;  4DR4 T;  1SE7 A;  3N9O A;  3QOF A;  5AQS B;  4XAX B;  1WYC A;  3I1A A;  4CN6 A;  2BS2 A;  4AKI A;  3A7M A;  2ZM8 A;  2W67 A;  1MMG A;  3N9N A;  2WS3 A;  1UUR A;  5LHH B;  2YK0 A;  2ZM0 A;  3OVU A;  5H6Q B;  2E9X B;  1XMO T;  1Y01 A;  3E0Z A;  3PJA A;  3Q5X A;  3ONJ A;  4C91 A;  3UU8 A;  1J1J A;  2YDS A;  2LM9 A;  2J4G A;  4HFI A;  3HKC E;  2XAF B;  4EIW A;  1WYB A;  2X66 A;  5L4H A;  5LA6 E;  4DMV A;  2BVM A;  2KWI B;  4UEL A;  4KP3 C;  4JI6 T;  1X79 A;  4OYK A;  5LGU B;  5AQP B;  4DND A;  5JDL A;  5EK3 A;  3EAB A;  2YKS A;  2VKJ A;  5KMG P;  4JEU B;  2CHO A;  5FYM A;  3UUB A;  4CI1 B;  3PUV F;  2H3R A;  2W0G A;  3AE9 A;  3AE6 A;  4I43 B;  3EHZ A;  2C0S A;  3MZK B;  3TLU A;  1KFY A;  2LEH A;  3SFE A;  2K5B B;  2X67 A;  4GYR A;  2XAG B;  2WP9 A;  4X5T A;  3E08 A;  4TX5 A;  5ABE A;  2DI4 A;  3AAA B;  4OK0 A;  4NXM T;  2KXP B;  2E5L T;  4PFO A;  3EVY A;  4IGU A;  5ABG A;  5L3G B;  2LJL A;  1S94 A;  1T8B A;  3AAE B;  3M3Z B;  1ZP0 A;  4YJ3 E;  2NP9 A;  2JJ9 A;  4Z8X A;  3RIF A;  5F3J A;  4F8H A;  2NW8 A;  3VKH A;  5ABF B;  1LVK A;  2V7I A;  3ZC1 A;  1D0Y A;  4IDZ A;  1Z0P A;  3IEE A;  1UCU A;  3ZEF B;  3EAM A;  4ZEY A;  3AXJ B;  2VKH A;  1GQE A;  1HS7 A;  2X51 A;  2XQ8 A;  2BS3 A;  3FXE B;  1UX4 A;  4X1I E;  2ES0 A;  4IE7 A;  4DO0 A;  4CXW A;  5J2U E;  3QUJ A;  4P0B A;  4ILB A;  3G06 A;  2KSR A;  5HXC A;  3ZJ1 A;  4ADZ A;  2VVN A;  5FXZ A;  4IIJ E;  2JIW A;  5KX5 E;  4DR1 T;  2Q9Q A;  3CK6 A;  2YN6 A;  2HPL A;  1QLB A;  2VVS A;  4IDP A;  4PNI A;  5FVK A;  2CM0 A;  5BMV E;  3ZPO A;  5FXW A;  5AQU B;  1FEW A;  4QH5 A;  2WU5 A;  4Z90 A;  4XBF B;  3QNU A;  2J1D G;  4DV6 T;  2XAQ B;  2WY2 A;  5L4E A;  1N34 T;  2I59 A;  2LHR A;  5JQG E;  2JQ9 A;  2DWK A;  2W61 A;  4AIS A;  4ERR A;  1KF6 A;  3GWH A;  2BG9 B;  5AQV B;  2CPT A;  2Q9Q C;  1ZHC A;  1KNR A;  2V7M A;  3N2G E;  3KV5 A;  2OA5 A;  2BG9 E;  3MA9 A;  4YLH A;  5HEJ A;  5FNV E;  4OYJ A;  2CBI A;  1VOM A;  3V5U A;  4EZ4 A;  3ESL A;  3UU6 A;  5KDM C;  3PE0 A;  1OED A;  5LP6 E;  3LG7 A;  3PUW F;  4FI5 A;  2WQY A;  4DV2 T;  2UXX B;  4EOZ B;  1WLX A;  2DL1 A;  3UU5 A;  2F4V T;  2VL8 A;  1J5E T;  5AQT B;  4L5G A;  4YFS A;  3ZN1 B;  2E2A A;  4HFH A;  5H6R B;  3ZMS B;  1XZY A;  4CI3 B;  4QXC B;  3LFM A;  2CLY C;  3P7I A;  5BR8 T;  4JI2 T;  4B3T T;  4B3S T;  5JTG A;  2JQH A;  4EXT A;  3HKD E;  3C50 A;  2K9A A;  3K3Q C;  3N9L A;  3RRC A;  5JRC A;  3A5X A;  3T1H T;  2CHN A;  4Q25 A;  3ZT5 A;  1MMN A;  4ZI2 C;  3RX6 A;  3FZF B;  3MAC A;  2LM2 A;  5HYA A;  1BR4 A;  5FKY A;  2Y6X A;  3OJA A;  4DV0 T;  2K48 A;  1AJ3 A;  5CFB A;  4IDQ A;  1W9R A;  5CB4 E;  2XY8 B;  4ASK A;  4UF0 B;  5JRE A;  3ONX A;  2V7L A;  3ZJ2 A;  3E22 E;  1HFA A;  3RIU A;  1V9D A;  1O3X A;  4DR6 T;  5TAO A;  4QXH B;  1UX5 A;  3EDU A;  4IL4 A;  3AE5 A;  3OBV E;  5LG4 A;  4HFB A;  3AVR A;  3RLF F;  3U3I A;  2P9B A;  2YU1 A;  4IE6 A;  5L3C B;  5LHI B;  4LFB T;  3BQI A;  4LMK A;  3KVA A;  3MK7 C;  4DMW A;  1HG5 A;  1HX1 B;  3AEC A;  3FZK B;  4UV9 B;  4HN9 A;  2D0U A;  3HR0 A;  4H9R C;  4I55 E;  3RIU C;  3RGL A;  4JEH B;  2CXD A;  3R6N A;  2V5D A;  2XM1 A;  4LF6 T;  5KXJ A;  1LKX A;  3WAK A;  3UTK A;  4YSZ A;  5LXT E;  3KV6 A;  2IC9 A;  1VCT A;  3LSV A;  4GIW A;  3VHL A;  2V26 A;  4ANJ A;  2XQ3 A;  2OV9 A;  3NBX X;  2N2N A;  4UVC B;  4E7S A;  2E9X A;  3ZMZ B;  3RPU A;  2L9Q A;  4HWH A;  3OPC A;  2V7K A;  1S35 A;  2WBL A;  2RPA A;  2XQA A;  4DR3 T;  2FJA A;  1UGO A;  1T7S A;  3AE8 A;  2VKD A;  3AEG A;  5IHY A;  3N9Q A;  4QX8 B;  4HWC A;  1NWM X;  1N36 T;  3C4X A;  5FMN A;  2I6H A;  3KBU A;  3PUZ F;  2V6Y A;  5F5W A;  4ZS2 A;  3CVR A;  5HCJ A;  3J9X 1;  4H9O C;  4XZC A;  4TUY E;  4HWD A;  3LDQ B;  3P4Q A;  2E9X C;  5J1G A;  3UFG A;  2FBW A;  2WDV A;  3NVO A;  2UUA T;  1WCR A;  2H88 A;  2JRK A;  3HI2 A;  1MNE A;  4NPP A;  4O2A E;  2WMN A;  5FY0 A;  3ZT7 A;  5LNK A;  2MTQ A;  4WBO A;  2W66 A;  1US7 B;  4ZHQ E;  5FXV A;  2VAS A;  3CPZ A;  3C4W A;  3C51 A;  2XPK A;  2CRB A;  5LBM A;  5CA1 E;  5HXR A;  5ABF A;  2WZI A;  3KBT A;  5AQG B;  2NWB A;  5IUX A;  3RKG A;  4U7Y A;  3M65 A;  4LFA T;  2LSK A;  2L8K A;  4K0U A;  3HA4 A;  3JC6 C;  2W4X A;  4O4I E;  2HN1 A;  3AA7 B;  1HF8 A;  3N2O A;  4DVD A;  4A97 A;  3L09 A;  4JBW F;  4PAG A;  2JMH A;  1T72 A;  2LSG A;  4EEB A;  3O1J A;  1E7P A;  4G2A A;  2IIU A;  3C98 B;  1M7K A;  4IHJ E;  4YJ2 E;  5LYJ E;  2W2U A;  4AKG A;  1VRB A;  4DBQ A;  2EHO D;  4AKL A;  3PU8 A;  4ISS A;  2KZ7 B;  4JYA T;  4MLK A;  2FJB A;  4PW8 A;  2UXB T;  4QHO A;  1XMQ T;  3GMI A;  2UU9 T;  4U33 A;  3UFE A;  3PU3 A;  3PUR A;  1Y64 B;  3H37 A;  2BG9 A;  4ILA A;  2NTX A;  1MIW A;  2JQQ A;  4HFV A;  4H63 H;  4U2Z A;  5LG3 A;  1CUN A;  2WMO A;  4OHF A;  4CI2 B;  2Q9Q D;  1D0Z A;  3PUS A;  3CX6 B;  4YTP A;  2GK9 A;  4DR2 T;  5DJQ C;  3TLT A;  4EAH A;  4GK5 E;  5DQW A;  3DTO A;  4YXD A;  3JAE A;  2ODU A;  2YU2 A;  4DBR A;  3P4R A;  5L47 A;  2EHO A;  4X1K E;  4EB6 E;  4HFE A;  2H7O A;  2BG9 C;  2WDR A;  2NR4 A;  2NW9 A;  4PK6 A;  3GN5 B;  2IC6 A;  2V7J A;  3IA3 A;  5AQM B;  2X9W A;  3SFD A;  1IBL T;  3AA1 B;  3CQG B;  2NOX A;  4DID B;  5C8Y E;  5HEU A;  1G8X A;  1HNX T;  2J62 A;  3AVS A;  4O8S A;  4COF A;  4ZS3 A;  4KBM B;  3GA8 A;  5L3E B;  2JQK A;  4JLE A;  4IDN A;  4U72 A;  2WAU A;  2N9D A;  3OKQ A;  2FJE A;  5JH7 E;  1BR1 A;  2XSB A;  3B13 A;  3AA0 B;  3KIN B;  3RI5 A;  1CHU A;  2CWY A;  2EHO C;  2X0L B;  4DV5 T;  4P0A A;  2MAW A;  3PJA J;  4ZI2 D;  3FZL B;  2YDQ A;  1T98 A;  4BJN A;  1VCS A;  1NAF A;  2CMR A;  4UF0 A;  2BKP A;  3AE2 A;  3PTR B;  3JAD A;  1HNW T;  1L0V A;  4B3R T;  4UIG A;  1YKH B;  4QKN A;  1JNZ A;  2XQ9 A;  2D0T A;  5AQO B;  2IML A;  5FY1 A;  3AE1 A;  3VKG A;  2K24 A;  3MKD A;  3N9M A;  5GON E;  2M6B A;  4CZZ B;  4M1P A;  4TWD A;  1FJG T;  4KX6 A;  5JR9 B;  4YTM A;  2WZH A;  2KLQ A;  1YKE B;  3O1I A;  1NEK A;  2H7V C;  3NKZ A;  3VRB A;  4AQF A;  1MMA A;  2M67 A;  5AQH B;  2DHR A;  4CXY A;  2LOP A;  1M62 A;  2PTF A;  4DV1 T;  2IDO B;  5HWY A;  4BA9 A;  1SHZ C;  4KUM B;  4ZOL E;  2BZB A;  1KNP A;  3QK6 A;  4YTN A;  3AE7 A;  3K3N A;  3HKB E;  2VB6 A;  2ZLY A;  3CX8 B;  2M6I A;  3ABV A;  2XAS B;  1XWM A;  5LMN T;  1IJ5 A;  4A98 A;  2HH7 A;  3EDV A;  2ACX A;  3ZCJ A;  3ZST A;  2QRX A;  5ADX L;  1HR0 T;  2PJQ A;  4FJO A;  4AQF C;  4K0K T;  1D1C A;  3AEF A;  3ZCI A;  4J2C A;  5J0Z A;  3U78 A;  4TNW A;  2C5J A;  1IBK T;  4HKA A;  3PUY F;  2D9D A;  4DR7 T;  3P50 A;  4BAY B;  1KK7 A;  3RQU A;  1SUM B;  2LSY A;  2V1D B;  3T1Y T;  2LKG A;  1IAP A;  1ZOY A;  3ANW B;  5HXH A;  5FY7 A;  2YIN A;  2DWG A;  2C5K T;  5LBQ B;  2DLR A;  3QB5 A;  1U5P A;  2I0M A;  2LSI A;  4TNV A;  4LF4 T;  3EI0 A;  2XQ6 A;  4CXX A;  3LBX B;  4JI3 T;  1E1H B;  3NZP A;  4O4H E;  1BR2 A;  2LKH A;  2E9X D;  2CCQ A;  3AAI A;  2ZM6 T;  3AEA A;  1XNQ T;  4LF5 T;  4PJM A;  2ZMA A;  1LVF A;  3NRX A;  2J47 A;  3F2E A;  4HGA A;  1I94 T;  2KT9 A;  3O1H A;  4HFD A;  2X0Y A;  4WBN E;  4UVA B;  5JVD E;  2LE8 A;  4MBQ A;  5C3J A;  2MBG A;  2FJD A;  2HPJ A;  2BBH A;  3WAJ A;  4AKR B;  1OED B;  2KND A;  4WZX A;  4UR9 A;  2XQ4 A;  3RYI E;  2N1G A;  2CEA A;  1OED E;  3PDY A;  4P09 A;  4TWH A;  4EV6 A;  4PK4 A;  1MMD A;  3C64 A;  5AQN B;  1XDO A;  3L8R A;  5HWX A;  3VR8 A;  3CQC B;  3AB3 B;  3JCF A;  5FXX A;  3JC6 D;  3NZQ A;  4UVB B;  3B5M A;  2XQ5 A;  3MJX A;  3UQ7 A;  2V5C A;  4V1A v;  2RP4 A;  3I0Q A;  4EED A;  4X66 T;  4U74 A;  3SS1 A;  2BDE A;  3I9Y A;  4YT0 A;  5AQJ B;  3PUX F;  5FL0 A;  1OXZ A;  2L3L A;  5JDQ A;  4H9N C;  4WYV A;  1HNZ T;  4DV7 T;  3IHR A;  4QH1 A;  2VL0 A;  3S4U A;  2D5U A;  3ZYL A;  4HTE A;  3UUX B;  1XNR T;  4LML A;  4A5X A;  2FUP A;  5AQI B;  1UUS A;  5JDF A;  3RRW A;  5EK4 A;  4LFC T;  4U31 A;  3ZN0 B;  3OYX A;  2XM2 A;  1R8I A;  4IST A;  5HAX A;  3HL6 A;  4JI1 T;  2MOZ A;  2XAH B;  4BJM A;  3MXZ A;  1N33 T;  2Y8D A;  5FVL A;  2Z6E A;  5AQL B;  2VK9 A;  2CWO A;  4JI5 T;  5HEO A;  2XQY A;  3A8Y C;  3LK3 B;  1HG2 A;  2ODV A;  4CN4 A;  2WU2 A;  4O4L E;  4L0R A;  3FBZ A;  3K3O A;  3RF1 A;  4X64 T;  4YSY A;  5A1L A;  5JDM A;  3KV9 A;  5HCM A;  4U7I A;  3PUQ A;  5E0O A;  2QYW A;  3RC3 A;  2VQE T;  3KDS E;  2IAK A;  3QC9 A;  5LGN B;  3AXJ A;  5L3D B;  5EK2 A;  3TLV A;  5LCY A;  3H3A A;  4IE4 A;  2H89 A;  2A72 A;  2XAJ B;  2DCF A;  1BR0 A;  1FMW A;  3SOL A;  2XZE A;  2LHN A;  4G63 A;  2AXD S;  2BKO A;  2NTY A;  1YD8 G;  3GN5 A;  4X20 E;  2KWH A;  2LLY A;  5HXS A;  4QX7 B;  2E8I A;  5HXE A;  4NXN T;  4OFZ A;  5AQF B;  3JAF A;  1WR6 A;  4DR5 T;  5DAB A;  3P4S A;  2CE7 A;  3H3M A;  3RYF E;  3PV0 F;  1UK5 A;  3BQL A;  4I4T E;  1D1A A;  2V6Y B;  3RC8 A;  4X1Y E;  4MHC A;  4CN1 A;  4GKJ T;  5IWA T;  3I0O A;  3ZYM A;  2BVL A;  3I9W A;  3ETU A;  3R84 B;  4NUV A;  2X68 A;  2CXL A;  5LHG B;  1YXR A;  1ZEE A;  3Q5E A;  4LF9 T;  3DP7 A;  4E7Z A;  1Z8U A;  3N2K E;  2LOS A;  1W0B A;  3LJC A;  4AQY T;  3N9P A;  4TN7 B;  3ZYK A;  5JR9 A;  4ILC A;  4IT4 A;  2QVA A;  4QH4 A;  1IBM T;  4U2Y A;  2HHH T;  3PUG A;  5EZY E;  1LRZ A;  3AE4 A;  4LMJ A;  3FB2 A;  2D2S A;  2Y48 B;  4P1N A;  1WR0 A;  4TZ4 C;  3HKE E;  1FMV A;  4H9P C;  4H9Q C;  2VQF T;  3RYC E;  4ZZC A;  2PG8 A;  1U4Q A;  4DV3 T;  2XQ7 A;  3LK4 2;  4HWF A;  3ONL C;  3CX7 B;  3P8C D;  4WNK A;  3SWH A;  3K8P C;  1YQ3 A;  4KHP T;  1EZ3 A;  5JR9 C;  3RH3 A;  1B7T A;  3ZKR A;  3UUN A;  3EUH A;  3AA6 B;  4I0U A;  1J5W A;  4HE8 A;  2LRK A;  4MFR A;  1WRD A;  1MND A;  4JI0 T;  4I50 E;  4PFP A;  2JMK A;  2ZM2 A;  3UU4 A;  4X62 T;  3W15 B;  2CA5 A;  1YQ4 A;  3ZMU B;  1SA0 E;  1IZN B;  3Q9D A;  3FZM B;  4A56 A;  2CBJ A;  2E5V A;  4IRE A;  3ANW A;  5CA0 E;  2XSA A;  4ZXL A;  4MAL A;  4ILU A;  2VKO A;  3CML A;  4LF8 T;  3RIA A;  2QA7 A;  2CXF A;  1X9B A;  5J2T E;  5ABH A;  2VWA A;  4JV5 T;  4AI6 A;  3LBX A;  1D0X A;  4B6X A;  3CQX C;  4AQG A;  3RKO A;  3L39 A;  5CJ5 A;  2UXC T;  5JDH A;  1JNR A;  1NEN A;  5LJM A;  2UUC T;  2W62 A;  4PJN A;  3RHW A;  4JI8 T;  3Q5D A;  1FIO A;  4PJJ A;  2LSJ A;  1IJ6 A;  2X9H A;  2JPF A;  3CIR A;  3TLS A;  4Z91 A;  2VUR A;  3FBL A;  5ETW A;  2A9U A;  3J7Y q;  1DU2 A;  3DJB A;  1H7C A;  2BS4 A;  2EHO B;  3FXD B;  3AEE A;  1N32 T;  4CQI A;  4GOU A;  5F8P A;  3UU3 A;  3TKL B;  4YHH T;  3D0T A;  5L2L A;  1ZV4 X;  5L3F B;  4X65 T;  4B3M T;  2W00 A;  2WWU A;  4JUY A;  4YSX A;  2ACZ A;  5FP3 A;  3ZLI A;  2WM9 A;  2XUE A;  3VU7 H;  2XJ7 A;  4LF7 T;  2B76 A;  3AE3 A;  2X0H A;  4HEA A;  3ZC0 A;  2Q9Q B;  1HTJ F;  5M4Y A;  3T8O A;  1OED C;  5HEH A;  3BK9 A;  3RYH E;  3P4W A;  3F31 A;  5LB7 B;  4OX9 T;  4C90 A;  5AQQ B;  3FHN A;  2G0U A;  2K3W A;  4UEM A;  3LK2 B;  2IW5 B;  2KMF A;  2DNX A;  4JI7 T;  3Q5W A;  2X9Y A;  2AE9 A;  5JDG A;  4QXB B;  4AKH A;  3KFW X;  2WCA A;  4AIU A;  1E2A A;  4EZH A;  3SRZ A;  2KIN B;  4H63 V;  5LOV E;  1YW0 A;  4UXN B;  3AED A;  3O4X E;  1D1B A;  1MIY A;  2WB5 A;  3OYZ A;  3NRY A;  1XDP A;  4O4J E;  2IHR 1;  3OTO T;  2IUB A;  2NW7 A;  3UT5 E;  2WDQ A;  2UUB T;  4DUZ T;  3ETV A;  4ZI3 D;  5CGM A;  5DQV A;  3NWI A;  2CLY B;  3X1D A;  1ZKE A;  3ZMT B;  4IL9 A;  2YDR A;  2YOE A;  4O2B E;  5HEG A;  4DUY T;  1KEY A;  2A2F X;  4GK0 E;  4HFC A;  3AEB A;  5JDN A;  2R6G F;  4N78 D;  4YHJ A;  4PJL A;  5C2T A;  2PFV A;  3IF8 B;  4GYS A;  3CKD A;  3L3P A;  2BBJ A;  4DV4 T;  3RQW A;  3P4P A;  3ZMV B;  1OWA A;  1HX8 A;  2WWV A;  4PK5 A;  3UUL A;  3VRA A;  4EYY R;  4NUU A;  5AFU L;  1I6Z A;  4H9S E;  2XTL A;  1G73 A;  5LMU T;  4KHZ F;  4GKK T;  3V5S A;  4EGW A;  2QGS A;  2UXN B;  4NIQ A;  3CWZ B;  3UUM A;  3F57 A;  2X9X A;  5L3B B;  5JRC B;  3FZH B;  1KNZ A;  2BKN A;  3QB5 K;  4U3C A;  3KVB A;  3ZSS A;  2W63 A;  4HWI B;  5IYZ E;  2MPK A;  3IBP A;  5LGT B;  3K1S A;  2B1E A;  4KMC A;  4IDO A;  5AQR B;  2HN2 A;  1MIV A;  2PBI A;  3N5L A; 
#chains in the Genus database with same CATH homology
 3EAM A;  5J0Z A;  1OED B;  2BG9 A;  4ILA A;  3TLS A;  4Z91 A;  5HEO A;  4TNW A;  3UU8 A;  5IUX A;  5LG3 A;  4HFI A;  2XQ4 A;  3JAD A;  4IL9 A;  5L4H A;  2XQ8 A;  3P50 A;  2YOE A;  3RQU A;  2BG9 E;  5HCM A;  3UU3 A;  2LKG A;  5HEJ A;  5HEG A;  2XQA A;  3UU4 A;  1OED E;  3TLT A;  4TWH A;  2XQ9 A;  4IL4 A;  4HFC A;  4ILB A;  3UU6 A;  2YKS A;  4HFB A;  3JAE A;  1OED A;  3UUB A;  2KSR A;  2M6B A;  4IRE A;  4A97 A;  4TWD A;  3TLV A;  2XQ5 A;  3EHZ A;  3UQ7 A;  5L47 A;  3TLU A;  4LMK A;  4ILC A;  3TLW A;  4TNV A;  5HCJ A;  4HFE A;  3RQW A;  3UU5 A;  3EI0 A;  4QH4 A;  3RIA A;  3UQ4 A;  2XQ6 A;  2BG9 C;  4X5T A;  1OED C;  5HEH A;  4ZZB A;  2LKH A;  3P4W A;  2YN6 A;  4LMJ A;  4TWF A;  4HFH A;  4QH1 A;  5HEU A;  2VL0 A;  2LLY A;  4NPP A;  4COF A;  4LML A;  4ZZC A;  4QH5 A;  4Z90 A;  2M6I A;  3JAF A;  2XQ7 A;  4A98 A;  3RI5 A;  5L4E A;  3LSV A;  3RIF A;  4HFD A;  2LM2 A;  3RHW A;  4F8H A;  2MAW A;  2XQ3 A;  3ZKR A;  5CFB A;  2BG9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...