1OEDE

Structure of acetylcholine receptor pore from electron images
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
260
structure length
128
Chain Sequence
PLFYIINIIAPCVLISSLVVLVYFLPAQAGGQKCTLSISVLLAQTIFLFLIAQKVPETSLNVPLIGKYLIFVMFVSMLIVMNCVIVLNVSLRTGKVIDKACFWIALLLFSIGTLAIFLTGHFNQVPEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ACETYLCHOLINE RECEPTOR PROTEIN, ALPHA CHAIN
publication title Structure and Gating Mechanism of the Acetylcholine Receptor Pore.
pubmed doi rcsb
molecule tags Ion channel/receptor
total genus 52
structure length 128
sequence length 260
ec nomenclature
pdb deposition date 2003-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02932 Neur_chan_memb Neurotransmitter-gated ion-channel transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 1oedE00
3TLSA 2XQ4A 3ZKRA 1OEDB 5HCJA 2XQ7A 5L47A 3UU4A 4TNVA 5HCMA 3UU3A 2BG9B 2YN6A 2LKGA 3UU8A 5HEUA 2BG9C 4ILCA 4TWFA 3UQ7A 3TLVA 5HEHA 3P50A 3EHZA 3RIAA 5HEOA 3JAFA 3EI0A 4QH5A 5J0ZA 5CFBA 4TNWA 2LKHA 1OEDC 4IREA 5L4EA 4HFDA 2XQAA 2YOEA 2M6IA 5LG3A 4TWDA 3RI5A 3UQ4A 3RIFA 3TLUA 4NPPA 5IUXA 3P4WA 5L4HA 3RQUA 2XQ9A 4X5TA 2XQ3A 2LLYA 2M6BA 4LMLA 2XQ5A 2MAWA 4TWHA 1OEDA 3JADA 4Z91A 2BG9E 3TLTA 4QH1A 2BG9A 5HEGA 4HFBA 2YKSA 4ILAA 4HFCA 4ZZBA 4HFIA 2KSRA 4F8HA 5HEJA 3RQWA 4IL4A 4QH4A 3LSVA 2LM2A 3JAEA 3UUBA 4ZZCA 4LMJA 4A97A 1OEDE 4IL9A 3RHWA 2XQ6A 4Z90A 3EAMA 4ILBA 4LMKA 3UU5A 4A98A 2XQ8A 3TLWA 3UU6A 4HFHA 2VL0A 4HFEA 4COFA
chains in the Genus database with same CATH superfamily
2QVAA 3ANWB 3J7Yq 1HTJF 5AFUL 2JRKA 4DVDA 4OYJA 2X9YA 5FY1A 2V7IA 5LHGB 3CKDA 1CUNA 1W0AA 3A7MA 3ZYMA 2D5UA 3E22E 3AAIA 3RIAA 4JI8T 1HFAA 5JDFA 1N33T 2UUBT 3CX8B 4B6XA 3N9QA 2NR4A 5JVDE 3I0QA 1WFDA 4X62T 2X0LB 3MACA 3K3QC 2M6BA 3HKBE 4HWFA 2AXDS 2VK9A 1H7CA 2E2AA 3TLTA 3RIUA 4O4JE 5EK2A 3KVBA 5F3JA 1VCSA 3RF1A 4XAXB 3OJAA 1XDPA 4MFRA 2X0YA 2PFVA 2CHNA 5LCYA 3ZYKA 2ZM0A 4KP3C 2A72A 1X79A 2IDOB 4PJJA 1OEDE 1WYCA 4H9OC 3J9X1 4CI2B 2ZM2A 1J5ET 2CBIA 2HPJA 4LMKA 3AE8A 1N34T 4ZHQE 2NOXA 2CXLA 4DV0T 2XAFB 5JDGA 1JNRA 1YW0A 5FP3A 1XNQT 2ODUA 4LFBT 1T8BA 3AA6B 3NVOA 3UUXB 1UK5A 2CXDA 3O1IA 3FXDB 2AE9A 3P50A 3FXEB 3EHZA 2LEHA 1XDOA 3PDYA 3ANWA 1UX5A 4KHPT 5ADXL 2W66A 3X1DA 2XQAA 2CLYB 3E0ZA 4IDNA 5IHYA 3EDUA 2K9AA 5FKYA 3Q5WA 1W0BA 2LHRA 2N1GA 1YD8G 2FJBA 5C3JA 1J5WA 3IHRA 5TAOA 1D1BA 2VVNA 5AQVB 3MXZA 1OXZA 4HFBA 2YKSA 3RH3A 3O4XE 3L39A 4DNDA 3I1AA 2MYSA 2E9XB 3PJAJ 3EDVA 4IL4A 3LSVA 3AE4A 2H88A 3ZN0B 2XAGB 4IE6A 3PUZF 1HCIA 2NTXA 3ETUA 2XQ8A 1BR2A 2D9DA 5EK3A 4JLEA 2A3DA 5C2TA 4HKAA 2XQ7A 4BJMA 3FZLB 3ONXA 5DQWA 4G2AA 2LKGA 3UU8A 3U3IA 4IIJE 5DJQC 3I9YA 3N9LA 3KV5A 3ZMZB 4PK4A 3EABA 4CI3B 5HXRA 1S35A 2LSIA 2Q9QD 2XAQB 4BA9A 2QA7A 3R6NA 1N36T 1FMWA 3R84B 4UF0B 1JNZA 5L4EA 3ZJ2A 2DWKA 4X20E 5LG3A 3HL6A 3PJAA 1G8XA 3P4SA 4LMLA 3NZPA 2ACZA 4TWHA 3AEAA 2XHEB 4A56A 1LVFA 4Z91A 5KXJA 5L3BB 2NWBA 2VL8A 5DQVA 2BG9A 3QUJA 1BR1A 3K8PC 1J1JA 3T1YT 2SPCA 5C8YE 3O1JA 2CBJA 3JAEA 1AJ3A 4LMJA 1IZNB 1G73A 3WAJA 5FYMA 2PJQA 2Z6EA 3EAMA 4TZ4C 4I4TE 1SHZC 3MK7C 4HFHA 1NWMX 2KMFA 5AQIB 3AA0B 2LJLA 2E9XA 4XZCA 2JQKA 4ILUA 3P4QA 4QXCB 5L3FB 4EYYR 1HF8A 3SFDA 2W0GA 4JI2T 3C50A 5JTGA 1UCUA 4ZI3D 2XUEA 1ZP0A 2W61A 5J0ZA 2LKHA 4P0BA 3ZC1A 2BDEA 5JR9B 2LOSA 2Q9QB 2BS4A 1KNRA 3OKQA 2OV9A 4UVCB 2YEVC 3OBVE 3TLUA 5LGTB 3GWHA 4O2AE 2WQYA 2W2UA 4K0UA 4EAHA 5EZYE 2FJEA 3ZLIA 2FBWA 4QHOA 1DU2A 2KWHA 2FUPA 1W9RA 5KDMC 1YXRA 2FJDA 2QGSA 2DI4A 2KSRA 1LVKA 2PBIA 2VQFT 2ZMAA 2XY8B 4QH4A 4L0RA 4YSYA 1ZOYA 4JI4T 3UFEA 2WY2A 5L2LA 4IE5A 1MMGA 1CHUA 3CX7B 2NW8A 2CPTA 2HN2A 4O4LE 5LJMA 4GIWA 3KINB 5AQGB 3MJXA 3AAEB 3SOLA 2WCAA 5FXWA 1LKXA 3LK42 3IA3A 3CX6B 2CEAA 3HKEE 4PK5A 3ZJ1A 2XQYA 4HN9A 3AE2A 1MNEA 5FNVE 4WYVA 5CFBA 4LF6T 4E7SA 5LJNA 4HE8A 2UXBT 3AA7B 4HGAA 3AEBA 3C4ZA 4FI5A 4QWNB 4TWDA 1HR0T 3SRZA 1T72A 1QUUA 3NWIA 5L4HA 4YT0A 3LBXA 3C4WA 1MIVA 3NRYA 2H7VC 3QOFA 5ABFA 5FVKA 4HFCA 4F8HA 2BVLA 5JDQA 3VKHA 3LK3B 3CQXC 1XWMA 2BZBA 3RLFF 4ZI2D 5ABHA 4H63V 2CM0A 1NENA 4AKHA 2J4GA 1D1AA 4G63A 5FY0A 4AISA 4HEAA 3NRXA 1ZHCA 3T8OA 4DMWA 1WRDA 4J2CA 2NP9A 3EVYA 1FIOA 3ZKRA 5L47A 4X65T 5M4YA 5HCMA 2BVMA 3FZFB 5AQPB 3WAKA 2I0MA 4X1YE 4EIWA 3UUMA 3UQ7A 5AQQB 4IDZA 5HEHA 3T1HT 2EHOA 4ADZA 3QK6A 2D2SA 2CWOA 2XJ7A 4YTNA 1WR0A 2BKPA 3AE3A 5ETWA 5CA0E 4ZS2A 2R6GF 3RIFA 5LMNT 2VKHA 4A5XA 2WDQA 3U78A 3GN5B 3KDSE 5F5WA 3FZHB 4U31A 2BS2A 3RRWA 5L3CB 1S94A 2KINB 4PJMA 2JQQA 3JCFA 1HNZT 3VRAA 2RPAA 4CXWA 4UXNB 2XQ6A 2YK0A 3IBPA 2BKOA 4DO0A 2LM9A 4EEBA 3RKGA 4X66T 4EEDA 4YY3T 3E08A 1KEYA 3CWZB 2KT9A 5JRCB 2DLRA 2P9BA 5BMVE 4ASKA 4KMCA 5LGNB 5A1LA 4ISTA 4BAYB 3IEEA 4TWFA 4EB6E 3SWHA 5AQNB 5GONE 2ZM8A 3GMIA 2C5IT 1E1HB 5ABGA 5HEOA 4QX8B 4CN1A 2V6XA 2RA1A 4PJLA 3TKLB 3LFMA 3PUYF 2VQET 3FZMB 4IREA 5AQOB 2HN1A 4U2YA 2K24A 2MPKA 4ZS3A 3ESLA 3RYIE 4I0UA 1MIWA 4JI5T 2V8SV 4UELA 4H9SE 3VR8A 2VKOA 3ZC0A 2YDSA 3ZCJA 1IBLT 4C91A 2XPKA 5HEGA 1IAPA 2KZ7B 3KV9A 4ZZBA 5JR9C 2Q9QC 5AQTB 3RQWA 4N78D 2LM2A 2MBGA 2LRKA 2LOPA 1MIYA 3VHLA 2WU2A 4P1NA 1YKHB 4AKRB 2L8KA 3PUWF 5KX5E 4DV5T 2RP4A 5AQMB 3UU5A 2DHRA 1E2AA 3UU6A 3RYFE 1M62A 2LHNA 1IJ6A 4PFPA 4HFEA 5LXTE 2V7MA 2WU5A 4U7IA 2BBJA 4IDOA 5L3DB 3N9NA 4OHFA 5FMNA 3UT5E 3IF8B 4HWHA 3BK9A 4AKIA 1BR0A 3MZKB 2YU1A 3AE9A 3TLVA 2X9XA 2V5DA 1KK7A 4U33A 1MMAA 2CCQA 3H3MA 3D0TA 4IE0A 4GYRA 3EI0A 3ETVA 4YHJA 5JRCA 5H6RB 3VRBA 2LSGA 5JREA 2F4VT 3DP7A 4DBQA 2N9DA 5J2UE 4K0KT 2C5KT 4ZI3C 4AQYT 5AQFB 3KVAA 4NXNT 2VVSA 4ZOLE 5J2TE 5BR8T 2X51A 1T7SA 4U2ZA 2CE7A 1B7TA 2V6YB 3ONJA 3UULA 3P4RA 2XM1A 2LSJA 1W09A 3RRCA 3RYHE 5IYZE 2X9HA 4DR6T 1HG2A 1YQ4A 4L5GA 4PNIA 4YSXA 2A9UA 3OVUA 4Z8XA 5HCJA 3AA1B 4JV5T 5LB7B 3SFEA 1KF6A 4KHZF 5L3EB 4CQIA 4JYAT 2CWYA 3RYCE 4X1IE 2IW5B 1FEWA 4LFAT 2FJAA 2E5LT 2NW9A 4JI3T 3ZSSA 4B3RT 2EHOD 4UEMA 4ZEYA 4HTEA 2WWUA 3A5XA 4JI6T 3P4WA 4UVAB 1MMNA 4V1Av 3RQUA 2E8IA 5AQRB 5JDLA 4X5TA 2VASA 4X64T 2H89A 3P4PA 3PUAA 3AE1A 1I94T 1D0YA 3JC6D 4HWIB 3PUXF 3AXJB 2H3RA 2WZHA 4PK6A 2J1DG 1WYBA 4ZI7E 3C98B 2DCFA 4DUYT 2W63A 4EZHA 5AQSB 1HS7A 5J1GA 4EV6A 1YKEB 4YSZA 3MKDA 5E0OA 5LNKA 3TLWA 4UF0A 3AB3B 5CJ5A 4EXTA 3Q5XA 2E5VA 3PUGA 2K3WA 4CZZB 1OEDB 2KNDA 1ZKEA 4UV8B 4TNVA 3GA8A 4IDPA 5CB4E 5JQGE 1KFYA 4TN7B 3OYXA 4FJOA 2V6YA 4TUYE 1SE7A 2XM2A 1D0XA 1FMVA 4U74A 2WB5A 1GQEA 3ONLC 4GK0E 3C4XA 3PURA 2CHOA 3UTKA 4QH5A 4PW8A 1WCRA 1N32T 3AVRA 2J62A 4B3MT 1HX8A 2K48A 2L3LA 4EOZB 5FL1A 3CQCB 3UQ4A 4IHJE 1R8IA 2WAUA 4JEHB 5LGUB 3FBZA 1T98A 3HKCE 5HYAA 3CK6A 2MAWA 1I6ZA 2UXXB 3K3OA 3O9XA 4EYUA 4AKGA 3UFGA 4JEUB 2WWVA 4DR4T 4YLHA 3RKOA 1IJ5A 1KNPA 4YJ3E 2Y8DA 2UUAT 5HXEA 3RHWA 1ZV4X 3SS1A 3DTOA 4EGWA 3AE7A 5JR9A 2Q9QA 5CA1E 3C51A 4TV8E 3TLSA 5EK4A 4NUUA 1X9BA 5IWAT 4DV1T 3OPCA 4C90A 3L8RA 4OK0A 4DIDB 2BG9C 3N9MA 4U3CA 1LRZA 5FY7A 4XBFB 4B3TT 4IDQA 2JQHA 2B76A 4NIQA 3C64A 5JDMA 2Y48B 1HG5A 3RGLA 5LBMA 1BR4A 2M6IA 2LT3A 2VURA 2VB6A 4AQFC 3ZMSB 5IUXA 4AKLA 4WZXA 3PUVF 3BQKA 4QKNA 3ABVA 3ZT7A 4IGUA 4CN6A 2K5BB 3NKZA 4WNKA 3JADA 3MA9A 4DV7T 4DR5T 3LDQB 4GYSA 1XNRT 2WM9A 4NXMT 2C0SA 4HFIA 1Z0PA 3M65A 2IC6A 5F8PA 4P0AA 1UUSA 2B1EA 3HI2A 3V5SA 3Q5EA 2IAKA 3RC8A 1NEKA 5LP6E 3AECA 4KI0F 4AQGA 3LG7A 1QLBA 4IT4A 4P09A 2W62A 4COFA 2M67A 3Q9DA 2BBHA 3NZQA 4CXYA 2DL1A 3P7IA 5JH7E 4UV9B 2LE8A 4JI1T 5JDHA 3K3NA 4I55E 5FXZA 1QSDA 2IMLA 4MHCA 2ACXA 1Y64B 3CQGB 3AAAB 4I50E 2DNXA 1OWAA 4JBWF 3PUQA 1HNWT 3JAFA 4WBOA 3BQLA 2IUBA 3CIRA 3H37A 2V26A 2XSBA 1XMOT 2HPLA 5CGMA 4X1KE 4U7YA 4DV3T 2E9XD 3W15B 2X9WA 4WW0A 4H9PC 4DR1T 4I43B 2CMRA 3ZMUB 3H3AA 3KV6A 3AVSA 2WMOA 2W4XA 3K1SA 3N2KE 3M3ZB 2A2FX 4BJNA 3N5LA 2C5JA 4YHHT 5AQKB 1US7B 4ILAA 3V5UA 3DJBA 3PE0A 3CPZA 2WBLA 4GK5E 2MTQA 5LOVE 5ABEA 1NAFA 2I6HA 4YXDA 1VCTA 4LFCT 4CI1B 3Q5DA 2WMNA 4Z90A 3ZT5A 3QB5A 1V9DA 1D1CA 4QXBB 1MMDA 5LG4A 2I59A 4HWDA 4F6RC 2BG9B 1UURA 2VKDA 3CVRA 3AE5A 3GN5A 4U72A 3VU7H 2XAHB 4ILCA 3RX6A 4DMVA 4OYKA 2V7LA 1WLXA 3PV0F 1ZEEA 2NTYA 4OX9T 4TNWA 4ANJA 5FXVA 1OEDC 4DR2T 1EZ3A 3AE6A 2VKJA 5AQJB 4B3ST 4LF4T 3A8YC 2LRLA 1Z8UA 1E7PA 4PJNA 3QNUA 2XQ9A 5JDNA 3PUSA 2XQ3A 4ERRA 2OA5A 2XQ5A 4NUVA 3HKDE 3EUHA 3B13A 2XTLA 2XASB 3WI3A 1IBMT 4YFSA 3VKGA 2BS3A 4O2BE 4CXXA 3FBLA 2ES0A 2WDRA 2IIUA 4ISSA 2EHOC 4GKKT 2UXCT 4YJ2E 1U5PA 3PTRB 1HNXT 4GOUA 4UIGA 3KBUA 1U4QA 3RC3A 4ILBA 4PFOA 2ZM6T 1KNZA 3JC6C 2V1DB 1VOMA 2X67A 2H7OA 3PU8A 2JMHA 5HWYA 3VR9A 3Q2MA 5HEUA 5HXCA 2HHHT 2GK9A 4M1PA 4LF9T 4JI0T 4JI7T 2YU2A 1UX4A 3FB2A 4AIUA 5LMUT 2IHR1 4HFDA 3RIUC 2JQ9A 3L09A 4YTMA 3RI5A 3F2EA 2V7KA 3L3PA 1SUMB 3KFWX 5HWXA 4TX5A 3BQIA 2VWAA 1UGOA 5HXHA 3ZPOA 2X68A 5KMGP 2N2NA 3F31A 4QH1A 1HX1B 4IE7A 5LHIB 3FZKB 4MALA 4AQFA 4GKJT 5HEJA 1XZYA 2KWIB 1L0VA 4O4HE 3UUNA 2XAJB 4ZZCA 4LF8T 2WZIA 4DV6T 4WBNE 2X66A 3KBTA 4OFZA 4DR3T 4Q25A 4ZXLA 3AEEA 2G0UA 3FHNA 3ZEFB 5LHHB 2OLTA 5LA6E 2JMKA 3OTOT 2UXDT 3LBXB 4AXPA 1XMQT 4IE4A 2XQ4A 5FVLA 3UU4A 2YDRA 3UU3A 5ABFB 4UR9A 4MLKA 5FXXA 3LJCA 2Y6XA 3HR0A 2UUCT 2UU9T 1FJGT 2CXFA 3OYZA 3ZSTA 4KX6A 2PG8A 3QC9A 4H9QC 2W00A 3QB5K 2HH7A 3AEDA 5AQHB 4O8SA 4H9NC 2LSYA 4PAGA 1D0ZA 2DWGA 2LSKA 5HXSA 4ZI2C 1YQ3A 5LYJE 4HWCA 2ODVA 4DUZT 2LLYA 4QX7B 3B57A 2L9QA 4CN4A 1Y01A 2IC9A 3PU3A 4YTPA 2BG9E 2KLQA 5L3GB 1SA0E 2QYWA 3ZMVB 3O1HA 3ZN1B 2EHOB 5H6QB 4KUMB 3ZYLA 3B5MA 2BKNA 4HFVA 2V5CA 2JJ9A 4DR7T 3CMLA 4IL9A 2J47A 4DV2T 1M7KA 5DABA 1VRBA 1MNDA 4O4IE 3KV4A 4A98A 4JUYA 2VL0A 2PTFA 3NBXX 2QRXA 4H9RC 2WS3A 2CA5A 4DV4T 3LK2B 5AQLB 4TV9E 2YN6A 3ZCIA 5AQUB 4E7ZA 4EZ4A 3AXJA 4MBQA 2YDQA 2KXPB 3I0OA 3AEGA 2WSSV 3ZMTB 2W67A 2WP9A 4AI6A 4H63H 3AEFA 3N2OA 4QXHB 3S4UA 3P8CD 1O3XA 2YOEA 2JIWA 3RPUA 4UVBB 2XZEA 4KBMB 3N2GE 2CLYC 3HA4A 4NPPA 4LF7T 2D0TA 2JPFA 3G06A 2MOZA 2CRBA 1OEDA 2UXNB 3ZT6A 3N9OA 5FL0A 2D0UA 2YINA 2WDVA 4DBRA 3F57A 1WR6A 3UUBA 2E9XC 1IBKT 3N9PA 2V7JA 2XSAA 4A97A 4LF5T 3I9WA 2X0HA 5LBQB 2NW7A 2ZLYA 5HAXA 4L9IA
chains in the Genus database with same CATH topology
3TLSA 2XQ4A 3ZKRA 1OEDB 5HCJA 2XQ7A 5L47A 3UU4A 4TNVA 5HCMA 3UU3A 2BG9B 2YN6A 2LKGA 3UU8A 5HEUA 2BG9C 4ILCA 4TWFA 3UQ7A 3TLVA 5HEHA 3P50A 3EHZA 3RIAA 5HEOA 3JAFA 3EI0A 4QH5A 5J0ZA 5CFBA 4TNWA 2LKHA 1OEDC 4IREA 5L4EA 4HFDA 2XQAA 2YOEA 2M6IA 5LG3A 4TWDA 3RI5A 3UQ4A 3RIFA 3TLUA 4NPPA 5IUXA 3P4WA 5L4HA 3RQUA 2XQ9A 4X5TA 2XQ3A 2LLYA 2M6BA 4LMLA 2XQ5A 2MAWA 4TWHA 1OEDA 3JADA 4Z91A 2BG9E 3TLTA 4QH1A 2BG9A 5HEGA 4HFBA 2YKSA 4ILAA 4HFCA 4ZZBA 4HFIA 2KSRA 4F8HA 5HEJA 3RQWA 4IL4A 4QH4A 3LSVA 2LM2A 3JAEA 3UUBA 4ZZCA 4LMJA 4A97A 1OEDE 4IL9A 3RHWA 2XQ6A 4Z90A 3EAMA 4ILBA 4LMKA 3UU5A 4A98A 2XQ8A 3TLWA 3UU6A 4HFHA 2VL0A 4HFEA 4COFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TLS A;  2XQ4 A;  3ZKR A;  1OED B;  5HCJ A;  2XQ7 A;  5L47 A;  3UU4 A;  4TNV A;  5HCM A;  3UU3 A;  2BG9 B;  2YN6 A;  2LKG A;  3UU8 A;  5HEU A;  2BG9 C;  4ILC A;  4TWF A;  3UQ7 A;  3TLV A;  5HEH A;  3P50 A;  3EHZ A;  3RIA A;  5HEO A;  3JAF A;  3EI0 A;  4QH5 A;  5J0Z A;  5CFB A;  4TNW A;  2LKH A;  1OED C;  4IRE A;  5L4E A;  4HFD A;  2XQA A;  2YOE A;  2M6I A;  5LG3 A;  4TWD A;  3RI5 A;  3UQ4 A;  3RIF A;  3TLU A;  4NPP A;  5IUX A;  3P4W A;  5L4H A;  3RQU A;  2XQ9 A;  4X5T A;  2XQ3 A;  2LLY A;  2M6B A;  4LML A;  2XQ5 A;  2MAW A;  4TWH A;  1OED A;  3JAD A;  4Z91 A;  2BG9 E;  3TLT A;  4QH1 A;  2BG9 A;  5HEG A;  4HFB A;  2YKS A;  4ILA A;  4HFC A;  4ZZB A;  4HFI A;  2KSR A;  4F8H A;  5HEJ A;  3RQW A;  4IL4 A;  4QH4 A;  3LSV A;  2LM2 A;  3JAE A;  3UUB A;  4ZZC A;  4LMJ A;  4A97 A;  1OED E;  4IL9 A;  3RHW A;  2XQ6 A;  4Z90 A;  3EAM A;  4ILB A;  4LMK A;  3UU5 A;  4A98 A;  2XQ8 A;  3TLW A;  3UU6 A;  4HFH A;  2VL0 A;  4HFE A;  4COF A; 
#chains in the Genus database with same CATH topology
 2QVA A;  3ANW B;  3J7Y q;  1HTJ F;  5AFU L;  2JRK A;  4DVD A;  4OYJ A;  2X9Y A;  5FY1 A;  2V7I A;  5LHG B;  3CKD A;  1CUN A;  1W0A A;  3A7M A;  3ZYM A;  2D5U A;  3E22 E;  3AAI A;  3RIA A;  4JI8 T;  1HFA A;  5JDF A;  1N33 T;  2UUB T;  3CX8 B;  4B6X A;  3N9Q A;  2NR4 A;  5JVD E;  3I0Q A;  1WFD A;  4X62 T;  2X0L B;  3MAC A;  3K3Q C;  2M6B A;  3HKB E;  4HWF A;  2AXD S;  2VK9 A;  1H7C A;  2E2A A;  3TLT A;  3RIU A;  4O4J E;  5EK2 A;  3KVB A;  5F3J A;  1VCS A;  3RF1 A;  4XAX B;  3OJA A;  1XDP A;  4MFR A;  2X0Y A;  2PFV A;  2CHN A;  5LCY A;  3ZYK A;  2ZM0 A;  4KP3 C;  2A72 A;  1X79 A;  2IDO B;  4PJJ A;  1OED E;  1WYC A;  4H9O C;  3J9X 1;  4CI2 B;  2ZM2 A;  1J5E T;  2CBI A;  2HPJ A;  4LMK A;  3AE8 A;  1N34 T;  4ZHQ E;  2NOX A;  2CXL A;  4DV0 T;  2XAF B;  5JDG A;  1JNR A;  1YW0 A;  5FP3 A;  1XNQ T;  2ODU A;  4LFB T;  1T8B A;  3AA6 B;  3NVO A;  3UUX B;  1UK5 A;  2CXD A;  3O1I A;  3FXD B;  2AE9 A;  3P50 A;  3FXE B;  3EHZ A;  2LEH A;  1XDO A;  3PDY A;  3ANW A;  1UX5 A;  4KHP T;  5ADX L;  2W66 A;  3X1D A;  2XQA A;  2CLY B;  3E0Z A;  4IDN A;  5IHY A;  3EDU A;  2K9A A;  5FKY A;  3Q5W A;  1W0B A;  2LHR A;  2N1G A;  1YD8 G;  2FJB A;  5C3J A;  1J5W A;  3IHR A;  5TAO A;  1D1B A;  2VVN A;  5AQV B;  3MXZ A;  1OXZ A;  4HFB A;  2YKS A;  3RH3 A;  3O4X E;  3L39 A;  4DND A;  3I1A A;  2MYS A;  2E9X B;  3PJA J;  3EDV A;  4IL4 A;  3LSV A;  3AE4 A;  2H88 A;  3ZN0 B;  2XAG B;  4IE6 A;  3PUZ F;  1HCI A;  2NTX A;  3ETU A;  2XQ8 A;  1BR2 A;  2D9D A;  5EK3 A;  4JLE A;  2A3D A;  5C2T A;  4HKA A;  2XQ7 A;  4BJM A;  3FZL B;  3ONX A;  5DQW A;  4G2A A;  2LKG A;  3UU8 A;  3U3I A;  4IIJ E;  5DJQ C;  3I9Y A;  3N9L A;  3KV5 A;  3ZMZ B;  4PK4 A;  3EAB A;  4CI3 B;  5HXR A;  1S35 A;  2LSI A;  2Q9Q D;  2XAQ B;  4BA9 A;  2QA7 A;  3R6N A;  1N36 T;  1FMW A;  3R84 B;  4UF0 B;  1JNZ A;  5L4E A;  3ZJ2 A;  2DWK A;  4X20 E;  5LG3 A;  3HL6 A;  3PJA A;  1G8X A;  3P4S A;  4LML A;  3NZP A;  2ACZ A;  4TWH A;  3AEA A;  2XHE B;  4A56 A;  1LVF A;  4Z91 A;  5KXJ A;  5L3B B;  2NWB A;  2VL8 A;  5DQV A;  2BG9 A;  3QUJ A;  1BR1 A;  3K8P C;  1J1J A;  3T1Y T;  2SPC A;  5C8Y E;  3O1J A;  2CBJ A;  3JAE A;  1AJ3 A;  4LMJ A;  1IZN B;  1G73 A;  3WAJ A;  5FYM A;  2PJQ A;  2Z6E A;  3EAM A;  4TZ4 C;  4I4T E;  1SHZ C;  3MK7 C;  4HFH A;  1NWM X;  2KMF A;  5AQI B;  3AA0 B;  2LJL A;  2E9X A;  4XZC A;  2JQK A;  4ILU A;  3P4Q A;  4QXC B;  5L3F B;  4EYY R;  1HF8 A;  3SFD A;  2W0G A;  4JI2 T;  3C50 A;  5JTG A;  1UCU A;  4ZI3 D;  2XUE A;  1ZP0 A;  2W61 A;  5J0Z A;  2LKH A;  4P0B A;  3ZC1 A;  2BDE A;  5JR9 B;  2LOS A;  2Q9Q B;  2BS4 A;  1KNR A;  3OKQ A;  2OV9 A;  4UVC B;  2YEV C;  3OBV E;  3TLU A;  5LGT B;  3GWH A;  4O2A E;  2WQY A;  2W2U A;  4K0U A;  4EAH A;  5EZY E;  2FJE A;  3ZLI A;  2FBW A;  4QHO A;  1DU2 A;  2KWH A;  2FUP A;  1W9R A;  5KDM C;  1YXR A;  2FJD A;  2QGS A;  2DI4 A;  2KSR A;  1LVK A;  2PBI A;  2VQF T;  2ZMA A;  2XY8 B;  4QH4 A;  4L0R A;  4YSY A;  1ZOY A;  4JI4 T;  3UFE A;  2WY2 A;  5L2L A;  4IE5 A;  1MMG A;  1CHU A;  3CX7 B;  2NW8 A;  2CPT A;  2HN2 A;  4O4L E;  5LJM A;  4GIW A;  3KIN B;  5AQG B;  3MJX A;  3AAE B;  3SOL A;  2WCA A;  5FXW A;  1LKX A;  3LK4 2;  3IA3 A;  3CX6 B;  2CEA A;  3HKE E;  4PK5 A;  3ZJ1 A;  2XQY A;  4HN9 A;  3AE2 A;  1MNE A;  5FNV E;  4WYV A;  5CFB A;  4LF6 T;  4E7S A;  5LJN A;  4HE8 A;  2UXB T;  3AA7 B;  4HGA A;  3AEB A;  3C4Z A;  4FI5 A;  4QWN B;  4TWD A;  1HR0 T;  3SRZ A;  1T72 A;  1QUU A;  3NWI A;  5L4H A;  4YT0 A;  3LBX A;  3C4W A;  1MIV A;  3NRY A;  2H7V C;  3QOF A;  5ABF A;  5FVK A;  4HFC A;  4F8H A;  2BVL A;  5JDQ A;  3VKH A;  3LK3 B;  3CQX C;  1XWM A;  2BZB A;  3RLF F;  4ZI2 D;  5ABH A;  4H63 V;  2CM0 A;  1NEN A;  4AKH A;  2J4G A;  1D1A A;  4G63 A;  5FY0 A;  4AIS A;  4HEA A;  3NRX A;  1ZHC A;  3T8O A;  4DMW A;  1WRD A;  4J2C A;  2NP9 A;  3EVY A;  1FIO A;  3ZKR A;  5L47 A;  4X65 T;  5M4Y A;  5HCM A;  2BVM A;  3FZF B;  5AQP B;  3WAK A;  2I0M A;  4X1Y E;  4EIW A;  3UUM A;  3UQ7 A;  5AQQ B;  4IDZ A;  5HEH A;  3T1H T;  2EHO A;  4ADZ A;  3QK6 A;  2D2S A;  2CWO A;  2XJ7 A;  4YTN A;  1WR0 A;  2BKP A;  3AE3 A;  5ETW A;  5CA0 E;  4ZS2 A;  2R6G F;  3RIF A;  5LMN T;  2VKH A;  4A5X A;  2WDQ A;  3U78 A;  3GN5 B;  3KDS E;  5F5W A;  3FZH B;  4U31 A;  2BS2 A;  3RRW A;  5L3C B;  1S94 A;  2KIN B;  4PJM A;  2JQQ A;  3JCF A;  1HNZ T;  3VRA A;  2RPA A;  4CXW A;  4UXN B;  2XQ6 A;  2YK0 A;  3IBP A;  2BKO A;  4DO0 A;  2LM9 A;  4EEB A;  3RKG A;  4X66 T;  4EED A;  4YY3 T;  3E08 A;  1KEY A;  3CWZ B;  2KT9 A;  5JRC B;  2DLR A;  2P9B A;  5BMV E;  4ASK A;  4KMC A;  5LGN B;  5A1L A;  4IST A;  4BAY B;  3IEE A;  4TWF A;  4EB6 E;  3SWH A;  5AQN B;  5GON E;  2ZM8 A;  3GMI A;  2C5I T;  1E1H B;  5ABG A;  5HEO A;  4QX8 B;  4CN1 A;  2V6X A;  2RA1 A;  4PJL A;  3TKL B;  3LFM A;  3PUY F;  2VQE T;  3FZM B;  4IRE A;  5AQO B;  2HN1 A;  4U2Y A;  2K24 A;  2MPK A;  4ZS3 A;  3ESL A;  3RYI E;  4I0U A;  1MIW A;  4JI5 T;  2V8S V;  4UEL A;  4H9S E;  3VR8 A;  2VKO A;  3ZC0 A;  2YDS A;  3ZCJ A;  1IBL T;  4C91 A;  2XPK A;  5HEG A;  1IAP A;  2KZ7 B;  3KV9 A;  4ZZB A;  5JR9 C;  2Q9Q C;  5AQT B;  3RQW A;  4N78 D;  2LM2 A;  2MBG A;  2LRK A;  2LOP A;  1MIY A;  3VHL A;  2WU2 A;  4P1N A;  1YKH B;  4AKR B;  2L8K A;  3PUW F;  5KX5 E;  4DV5 T;  2RP4 A;  5AQM B;  3UU5 A;  2DHR A;  1E2A A;  3UU6 A;  3RYF E;  1M62 A;  2LHN A;  1IJ6 A;  4PFP A;  4HFE A;  5LXT E;  2V7M A;  2WU5 A;  4U7I A;  2BBJ A;  4IDO A;  5L3D B;  3N9N A;  4OHF A;  5FMN A;  3UT5 E;  3IF8 B;  4HWH A;  3BK9 A;  4AKI A;  1BR0 A;  3MZK B;  2YU1 A;  3AE9 A;  3TLV A;  2X9X A;  2V5D A;  1KK7 A;  4U33 A;  1MMA A;  2CCQ A;  3H3M A;  3D0T A;  4IE0 A;  4GYR A;  3EI0 A;  3ETV A;  4YHJ A;  5JRC A;  5H6R B;  3VRB A;  2LSG A;  5JRE A;  2F4V T;  3DP7 A;  4DBQ A;  2N9D A;  5J2U E;  4K0K T;  2C5K T;  4ZI3 C;  4AQY T;  5AQF B;  3KVA A;  4NXN T;  2VVS A;  4ZOL E;  5J2T E;  5BR8 T;  2X51 A;  1T7S A;  4U2Z A;  2CE7 A;  1B7T A;  2V6Y B;  3ONJ A;  3UUL A;  3P4R A;  2XM1 A;  2LSJ A;  1W09 A;  3RRC A;  3RYH E;  5IYZ E;  2X9H A;  4DR6 T;  1HG2 A;  1YQ4 A;  4L5G A;  4PNI A;  4YSX A;  2A9U A;  3OVU A;  4Z8X A;  5HCJ A;  3AA1 B;  4JV5 T;  5LB7 B;  3SFE A;  1KF6 A;  4KHZ F;  5L3E B;  4CQI A;  4JYA T;  2CWY A;  3RYC E;  4X1I E;  2IW5 B;  1FEW A;  4LFA T;  2FJA A;  2E5L T;  2NW9 A;  4JI3 T;  3ZSS A;  4B3R T;  2EHO D;  4UEM A;  4ZEY A;  4HTE A;  2WWU A;  3A5X A;  4JI6 T;  3P4W A;  4UVA B;  1MMN A;  4V1A v;  3RQU A;  2E8I A;  5AQR B;  5JDL A;  4X5T A;  2VAS A;  4X64 T;  2H89 A;  3P4P A;  3PUA A;  3AE1 A;  1I94 T;  1D0Y A;  3JC6 D;  4HWI B;  3PUX F;  3AXJ B;  2H3R A;  2WZH A;  4PK6 A;  2J1D G;  1WYB A;  4ZI7 E;  3C98 B;  2DCF A;  4DUY T;  2W63 A;  4EZH A;  5AQS B;  1HS7 A;  5J1G A;  4EV6 A;  1YKE B;  4YSZ A;  3MKD A;  5E0O A;  5LNK A;  3TLW A;  4UF0 A;  3AB3 B;  5CJ5 A;  4EXT A;  3Q5X A;  2E5V A;  3PUG A;  2K3W A;  4CZZ B;  1OED B;  2KND A;  1ZKE A;  4UV8 B;  4TNV A;  3GA8 A;  4IDP A;  5CB4 E;  5JQG E;  1KFY A;  4TN7 B;  3OYX A;  4FJO A;  2V6Y A;  4TUY E;  1SE7 A;  2XM2 A;  1D0X A;  1FMV A;  4U74 A;  2WB5 A;  1GQE A;  3ONL C;  4GK0 E;  3C4X A;  3PUR A;  2CHO A;  3UTK A;  4QH5 A;  4PW8 A;  1WCR A;  1N32 T;  3AVR A;  2J62 A;  4B3M T;  1HX8 A;  2K48 A;  2L3L A;  4EOZ B;  5FL1 A;  3CQC B;  3UQ4 A;  4IHJ E;  1R8I A;  2WAU A;  4JEH B;  5LGU B;  3FBZ A;  1T98 A;  3HKC E;  5HYA A;  3CK6 A;  2MAW A;  1I6Z A;  2UXX B;  3K3O A;  3O9X A;  4EYU A;  4AKG A;  3UFG A;  4JEU B;  2WWV A;  4DR4 T;  4YLH A;  3RKO A;  1IJ5 A;  1KNP A;  4YJ3 E;  2Y8D A;  2UUA T;  5HXE A;  3RHW A;  1ZV4 X;  3SS1 A;  3DTO A;  4EGW A;  3AE7 A;  5JR9 A;  2Q9Q A;  5CA1 E;  3C51 A;  4TV8 E;  3TLS A;  5EK4 A;  4NUU A;  1X9B A;  5IWA T;  4DV1 T;  3OPC A;  4C90 A;  3L8R A;  4OK0 A;  4DID B;  2BG9 C;  3N9M A;  4U3C A;  1LRZ A;  5FY7 A;  4XBF B;  4B3T T;  4IDQ A;  2JQH A;  2B76 A;  4NIQ A;  3C64 A;  5JDM A;  2Y48 B;  1HG5 A;  3RGL A;  5LBM A;  1BR4 A;  2M6I A;  2LT3 A;  2VUR A;  2VB6 A;  4AQF C;  3ZMS B;  5IUX A;  4AKL A;  4WZX A;  3PUV F;  3BQK A;  4QKN A;  3ABV A;  3ZT7 A;  4IGU A;  4CN6 A;  2K5B B;  3NKZ A;  4WNK A;  3JAD A;  3MA9 A;  4DV7 T;  4DR5 T;  3LDQ B;  4GYS A;  1XNR T;  2WM9 A;  4NXM T;  2C0S A;  4HFI A;  1Z0P A;  3M65 A;  2IC6 A;  5F8P A;  4P0A A;  1UUS A;  2B1E A;  3HI2 A;  3V5S A;  3Q5E A;  2IAK A;  3RC8 A;  1NEK A;  5LP6 E;  3AEC A;  4KI0 F;  4AQG A;  3LG7 A;  1QLB A;  4IT4 A;  4P09 A;  2W62 A;  4COF A;  2M67 A;  3Q9D A;  2BBH A;  3NZQ A;  4CXY A;  2DL1 A;  3P7I A;  5JH7 E;  4UV9 B;  2LE8 A;  4JI1 T;  5JDH A;  3K3N A;  4I55 E;  5FXZ A;  1QSD A;  2IML A;  4MHC A;  2ACX A;  1Y64 B;  3CQG B;  3AAA B;  4I50 E;  2DNX A;  1OWA A;  4JBW F;  3PUQ A;  1HNW T;  3JAF A;  4WBO A;  3BQL A;  2IUB A;  3CIR A;  3H37 A;  2V26 A;  2XSB A;  1XMO T;  2HPL A;  5CGM A;  4X1K E;  4U7Y A;  4DV3 T;  2E9X D;  3W15 B;  2X9W A;  4WW0 A;  4H9P C;  4DR1 T;  4I43 B;  2CMR A;  3ZMU B;  3H3A A;  3KV6 A;  3AVS A;  2WMO A;  2W4X A;  3K1S A;  3N2K E;  3M3Z B;  2A2F X;  4BJN A;  3N5L A;  2C5J A;  4YHH T;  5AQK B;  1US7 B;  4ILA A;  3V5U A;  3DJB A;  3PE0 A;  3CPZ A;  2WBL A;  4GK5 E;  2MTQ A;  5LOV E;  5ABE A;  1NAF A;  2I6H A;  4YXD A;  1VCT A;  4LFC T;  4CI1 B;  3Q5D A;  2WMN A;  4Z90 A;  3ZT5 A;  3QB5 A;  1V9D A;  1D1C A;  4QXB B;  1MMD A;  5LG4 A;  2I59 A;  4HWD A;  4F6R C;  2BG9 B;  1UUR A;  2VKD A;  3CVR A;  3AE5 A;  3GN5 A;  4U72 A;  3VU7 H;  2XAH B;  4ILC A;  3RX6 A;  4DMV A;  4OYK A;  2V7L A;  1WLX A;  3PV0 F;  1ZEE A;  2NTY A;  4OX9 T;  4TNW A;  4ANJ A;  5FXV A;  1OED C;  4DR2 T;  1EZ3 A;  3AE6 A;  2VKJ A;  5AQJ B;  4B3S T;  4LF4 T;  3A8Y C;  2LRL A;  1Z8U A;  1E7P A;  4PJN A;  3QNU A;  2XQ9 A;  5JDN A;  3PUS A;  2XQ3 A;  4ERR A;  2OA5 A;  2XQ5 A;  4NUV A;  3HKD E;  3EUH A;  3B13 A;  2XTL A;  2XAS B;  3WI3 A;  1IBM T;  4YFS A;  3VKG A;  2BS3 A;  4O2B E;  4CXX A;  3FBL A;  2ES0 A;  2WDR A;  2IIU A;  4ISS A;  2EHO C;  4GKK T;  2UXC T;  4YJ2 E;  1U5P A;  3PTR B;  1HNX T;  4GOU A;  4UIG A;  3KBU A;  1U4Q A;  3RC3 A;  4ILB A;  4PFO A;  2ZM6 T;  1KNZ A;  3JC6 C;  2V1D B;  1VOM A;  2X67 A;  2H7O A;  3PU8 A;  2JMH A;  5HWY A;  3VR9 A;  3Q2M A;  5HEU A;  5HXC A;  2HHH T;  2GK9 A;  4M1P A;  4LF9 T;  4JI0 T;  4JI7 T;  2YU2 A;  1UX4 A;  3FB2 A;  4AIU A;  5LMU T;  2IHR 1;  4HFD A;  3RIU C;  2JQ9 A;  3L09 A;  4YTM A;  3RI5 A;  3F2E A;  2V7K A;  3L3P A;  1SUM B;  3KFW X;  5HWX A;  4TX5 A;  3BQI A;  2VWA A;  1UGO A;  5HXH A;  3ZPO A;  2X68 A;  5KMG P;  2N2N A;  3F31 A;  4QH1 A;  1HX1 B;  4IE7 A;  5LHI B;  3FZK B;  4MAL A;  4AQF A;  4GKJ T;  5HEJ A;  1XZY A;  2KWI B;  1L0V A;  4O4H E;  3UUN A;  2XAJ B;  4ZZC A;  4LF8 T;  2WZI A;  4DV6 T;  4WBN E;  2X66 A;  3KBT A;  4OFZ A;  4DR3 T;  4Q25 A;  4ZXL A;  3AEE A;  2G0U A;  3FHN A;  3ZEF B;  5LHH B;  2OLT A;  5LA6 E;  2JMK A;  3OTO T;  2UXD T;  3LBX B;  4AXP A;  1XMQ T;  4IE4 A;  2XQ4 A;  5FVL A;  3UU4 A;  2YDR A;  3UU3 A;  5ABF B;  4UR9 A;  4MLK A;  5FXX A;  3LJC A;  2Y6X A;  3HR0 A;  2UUC T;  2UU9 T;  1FJG T;  2CXF A;  3OYZ A;  3ZST A;  4KX6 A;  2PG8 A;  3QC9 A;  4H9Q C;  2W00 A;  3QB5 K;  2HH7 A;  3AED A;  5AQH B;  4O8S A;  4H9N C;  2LSY A;  4PAG A;  1D0Z A;  2DWG A;  2LSK A;  5HXS A;  4ZI2 C;  1YQ3 A;  5LYJ E;  4HWC A;  2ODV A;  4DUZ T;  2LLY A;  4QX7 B;  3B57 A;  2L9Q A;  4CN4 A;  1Y01 A;  2IC9 A;  3PU3 A;  4YTP A;  2BG9 E;  2KLQ A;  5L3G B;  1SA0 E;  2QYW A;  3ZMV B;  3O1H A;  3ZN1 B;  2EHO B;  5H6Q B;  4KUM B;  3ZYL A;  3B5M A;  2BKN A;  4HFV A;  2V5C A;  2JJ9 A;  4DR7 T;  3CML A;  4IL9 A;  2J47 A;  4DV2 T;  1M7K A;  5DAB A;  1VRB A;  1MND A;  4O4I E;  3KV4 A;  4A98 A;  4JUY A;  2VL0 A;  2PTF A;  3NBX X;  2QRX A;  4H9R C;  2WS3 A;  2CA5 A;  4DV4 T;  3LK2 B;  5AQL B;  4TV9 E;  2YN6 A;  3ZCI A;  5AQU B;  4E7Z A;  4EZ4 A;  3AXJ A;  4MBQ A;  2YDQ A;  2KXP B;  3I0O A;  3AEG A;  2WSS V;  3ZMT B;  2W67 A;  2WP9 A;  4AI6 A;  4H63 H;  3AEF A;  3N2O A;  4QXH B;  3S4U A;  3P8C D;  1O3X A;  2YOE A;  2JIW A;  3RPU A;  4UVB B;  2XZE A;  4KBM B;  3N2G E;  2CLY C;  3HA4 A;  4NPP A;  4LF7 T;  2D0T A;  2JPF A;  3G06 A;  2MOZ A;  2CRB A;  1OED A;  2UXN B;  3ZT6 A;  3N9O A;  5FL0 A;  2D0U A;  2YIN A;  2WDV A;  4DBR A;  3F57 A;  1WR6 A;  3UUB A;  2E9X C;  1IBK T;  3N9P A;  2V7J A;  2XSA A;  4A97 A;  4LF5 T;  3I9W A;  2X0H A;  5LBQ B;  2NW7 A;  2ZLY A;  5HAX A;  4L9I A; 
#chains in the Genus database with same CATH homology
 3TLS A;  2XQ4 A;  3ZKR A;  1OED B;  5HCJ A;  2XQ7 A;  5L47 A;  3UU4 A;  4TNV A;  5HCM A;  3UU3 A;  2BG9 B;  2YN6 A;  2LKG A;  3UU8 A;  5HEU A;  2BG9 C;  4ILC A;  4TWF A;  3UQ7 A;  3TLV A;  5HEH A;  3P50 A;  3EHZ A;  3RIA A;  5HEO A;  3JAF A;  3EI0 A;  4QH5 A;  5J0Z A;  5CFB A;  4TNW A;  2LKH A;  1OED C;  4IRE A;  5L4E A;  4HFD A;  2XQA A;  2YOE A;  2M6I A;  5LG3 A;  4TWD A;  3RI5 A;  3UQ4 A;  3RIF A;  3TLU A;  4NPP A;  5IUX A;  3P4W A;  5L4H A;  3RQU A;  2XQ9 A;  4X5T A;  2XQ3 A;  2LLY A;  2M6B A;  4LML A;  2XQ5 A;  2MAW A;  4TWH A;  1OED A;  3JAD A;  4Z91 A;  2BG9 E;  3TLT A;  4QH1 A;  2BG9 A;  5HEG A;  4HFB A;  2YKS A;  4ILA A;  4HFC A;  4ZZB A;  4HFI A;  2KSR A;  4F8H A;  5HEJ A;  3RQW A;  4IL4 A;  4QH4 A;  3LSV A;  2LM2 A;  3JAE A;  3UUB A;  4ZZC A;  4LMJ A;  4A97 A;  1OED E;  4IL9 A;  3RHW A;  2XQ6 A;  4Z90 A;  3EAM A;  4ILB A;  4LMK A;  3UU5 A;  4A98 A;  2XQ8 A;  3TLW A;  3UU6 A;  4HFH A;  2VL0 A;  4HFE A;  4COF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...