1OEDE

Structure of acetylcholine receptor pore from electron images
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
260
structure length
128
Chain Sequence
PLFYIINIIAPCVLISSLVVLVYFLPAQAGGQKCTLSISVLLAQTIFLFLIAQKVPETSLNVPLIGKYLIFVMFVSMLIVMNCVIVLNVSLRTGKVIDKACFWIALLLFSIGTLAIFLTGHFNQVPEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and Gating Mechanism of the Acetylcholine Receptor Pore.
pubmed doi rcsb
molecule tags Ion channel/receptor
molecule keywords ACETYLCHOLINE RECEPTOR PROTEIN, ALPHA CHAIN
total genus 52
structure length 128
sequence length 260
ec nomenclature
pdb deposition date 2003-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02932 Neur_chan_memb Neurotransmitter-gated ion-channel transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 1oedE00
4QH4A 4HFDA 2XQAA 4TWFA 5HEHA 4A97A 4ILAA 3RHWA 3EHZA 3TLSA 4QH1A 2XQ4A 3UU4A 2M6IA 1OEDB 4Z91A 3LSVA 3RQWA 3ZKRA 1OEDA 2YOEA 4IL9A 5IUXA 4IREA 3UQ4A 3P50A 3UU8A 4TWHA 2LLYA 2KSRA 3EI0A 5J0ZA 4LMLA 2XQ8A 4HFCA 3JADA 3RIAA 5HCJA 2YN6A 2LM2A 4NPPA 4TWDA 4COFA 2LKHA 4ILBA 5LG3A 3JAEA 2XQ7A 2BG9E 2XQ9A 3UU6A 3UUBA 5L47A 3RIFA 3P4WA 2XQ3A 2BG9A 3JAFA 5HCMA 2M6BA 2XQ5A 2BG9C 4ILCA 5HEJA 5L4HA 4IL4A 2YKSA 4HFEA 4Z90A 3UU3A 5L4EA 5HEUA 3TLWA 3RI5A 1OEDE 4TNVA 4HFHA 2MAWA 4LMJA 4ZZCA 2LKGA 2XQ6A 4TNWA 2BG9B 4F8HA 3TLTA 3UU5A 4HFIA 4A98A 4ZZBA 5HEGA 3EAMA 4HFBA 3UQ7A 2VL0A 1OEDC 4LMKA 4X5TA 3TLUA 4QH5A 3TLVA 5CFBA 3RQUA 5HEOA
chains in the Genus database with same CATH superfamily
2DNXA 2XQYA 3P4PA 3LBXA 4KX6A 3H3MA 2E9XB 4HFDA 2LHRA 1FIOA 2NTXA 3AAEB 3LDQB 1ZP0A 3C4ZA 2XQAA 2YU1A 4IHJE 4ZOLE 1U5PA 2W67A 2Q9QA 2E9XA 4ILAA 5FP3A 3RC3A 1KK7A 1YW0A 2V8SV 2V7IA 4O4LE 3TLSA 5AQKB 3EVYA 3ZYKA 2XAGB 2M6IA 5JDQA 5LHHB 4GYRA 4WBOA 5LMNT 2CCQA 2VWAA 3VHLA 4L9IA 3RIUC 2DWKA 1OEDA 2LJLA 2FJAA 4DMVA 3ETVA 3TKLB 4YJ3E 3VRAA 1IZNB 4DMWA 5IUXA 4TN7B 1XZYA 2KWIB 1ZOYA 4IREA 2I0MA 3UQ4A 3N9LA 4DR1T 4YHJA 2ODUA 4IDPA 4UVAB 5LBMA 2LLYA 2KSRA 3HR0A 2XASB 5LGUB 4QXBB 3ZJ1A 3RIFA 4MLKA 1S94A 4NUUA 4ILUA 3ZCJA 3JC6D 1J1JA 2BBHA 5J2UE 3ZPOA 4JYAT 4XZCA 5HEJA 5HCJA 1UGOA 1SA0E 5JDNA 4DR6T 4L0RA 1FMWA 4DV7T 2W4XA 4NPPA 4X20E 2UXBT 4COFA 2W00A 2XTLA 4JEHB 5KDMC 2WWVA 4O8SA 2CXLA 5JR9B 4I0UA 5JRCA 1W09A 2B76A 3M3ZB 4H9PC 4AKIA 1E1HB 3UUMA 2NR4A 5HXCA 1V9DA 3PUAA 2ODVA 5ABGA 4UF0A 2WQYA 3NWIA 2LT3A 1M7KA 3PU3A 5LJNA 1XMQT 3AE9A 4ASKA 2BG9E 1OWAA 3PU8A 4P0BA 4UF0B 2MBGA 3UU6A 5LNKA 3O4XE 3I0QA 3S4UA 1XNRT 3ZT7A 5JDMA 3W15B 4CN6A 3ZSTA 1W9RA 2WZIA 1GQEA 3QK6A 1Z8UA 3AEGA 3FZFB 2XSAA 3AE5A 4H9NC 2YDQA 5L3DB 3K8PC 3KDSE 1N34T 2MYSA 4IIJE 3ZT5A 4X62T 2LSIA 2WZHA 3L8RA 3GWHA 2NW8A 2D9DA 3MK7C 3MJXA 3L09A 2BKOA 2EHOB 3CVRA 4H9SE 2XQ3A 2BG9A 4MALA 4P1NA 4EEBA 5CJ5A 5KXJA 4EXTA 2FUPA 2E2AA 4O4JE 2ES0A 1KNRA 2I59A 4U72A 3SRZA 3RPUA 2NW7A 3Q5WA 3EUHA 4JI0T 2CWOA 3RRWA 4U7IA 2RP4A 5ETWA 5F8PA 3QC9A 3PE0A 4IL4A 5HWXA 3BQKA 2X67A 4HFEA 5LB7B 3DTOA 2WSSV 4YSXA 4DUZT 5FXXA 1HNWT 3RGLA 5JVDE 4JI1T 3IBPA 3EABA 4B3TT 3RKGA 2E5VA 2WMNA 4O2AE 3P4QA 2MAWA 4YT0A 2CWYA 3Q5DA 4ZZCA 5C3JA 1MMAA 1ZHCA 3HA4A 3CQXC 2AXDS 2VK9A 1XNQT 2EHOD 2XAHB 4TX5A 5HXHA 4ZI2D 1N36T 2V6YB 2CMRA 2XQ6A 3ESLA 3X1DA 1DU2A 2JPFA 4HFVA 1MNEA 2Q9QB 5CA1E 1HS7A 1WYBA 2ZM2A 5FXVA 3KV4A 4JUYA 4EIWA 4I55E 4BAYB 4DR5T 3ONXA 2XZEA 2CA5A 2VKOA 2YDRA 3AAAB 3HKBE 4IE0A 4Z8XA 2G0UA 2KLQA 5FNVE 5GONE 5HEGA 3JC6C 2V26A 5LHGB 3Q5XA 3OJAA 2WDVA 3N9PA 5EK4A 4LF9T 4GKJT 1QLBA 3B57A 4YTMA 2GK9A 4OX9T 1WLXA 2UXXB 3ZYLA 4F6RC 3WAKA 4KI0F 2ZLYA 3RYCE 2R6GF 4YSYA 2C5JA 2JQKA 3QB5A 3QUJA 4LMKA 2DCFA 2IHR1 2LSKA 3ONJA 1WR6A 4H9RC 1NENA 3H37A 4YXDA 5FXZA 5L3BB 3RC8A 3MKDA 4PJLA 4EOZB 1HNZT 1ZKEA 5CFBA 3FZKB 5HEOA 4WZXA 5L3EB 4DBRA 1LVKA 3LJCA 2VB6A 4X66T 4YTNA 4AQYT 1XWMA 2C0SA 3GN5A 3QNUA 5LXTE 4JI7T 5DABA 3PTRB 3HKEE 4KMCA 1MNDA 2LRLA 4CN1A 5JDLA 4PK6A 4TWFA 2XM2A 5HEHA 4AQGA 2VQET 1VCTA 3FBLA 3ZLIA 4ZI2C 5FXWA 5HAXA 2LE8A 4ZI3D 2CHOA 3T8OA 3UTKA 4DO0A 4GK5E 4JV5T 3FXDB 4WW0A 3ZKRA 4TUYE 4DR2T 3L39A 2C5KT 2CRBA 2UUBT 5JRCB 1UX5A 3UFEA 4EYUA 1G8XA 4BJNA 1UURA 2WS3A 3AE1A 3C98B 4XBFB 2MOZA 1SHZC 3P50A 4UV9B 2HPLA 2J1DG 4U7YA 2D5UA 2L8KA 3E08A 3ETUA 4TWHA 5LYJE 2Q9QD 5AQQB 4ADZA 2UXDT 2QVAA 1L0VA 2CLYB 3PUZF 1CUNA 2NWBA 2XAQB 3J9X1 5AQRB 3OYZA 4ISTA 2XSBA 2XQ8A 1YD8G 3P7IA 3JADA 5JDHA 3RYIE 3RIAA 4OFZA 5L2LA 5AQFB 3AEBA 3AA1B 5AQUB 4YHHT 2K9AA 4PNIA 2VASA 3ZMTB 3CKDA 4H63H 3GN5B 2LM9A 5IYZE 2CM0A 3PURA 4NXMT 3O1HA 3V5SA 1E7PA 4V1Av 4LFAT 2LKHA 3ANWA 4DR7T 4QKNA 1T72A 2XAFB 3N9QA 3C50A 3PUSA 3OVUA 4IT4A 2KWHA 3FBZA 5LG3A 3JAEA 4LF4T 4I43B 4DV3T 5M4YA 2QYWA 2XQ7A 4B3ST 4HWFA 4JLEA 2A72A 5LCYA 2JRKA 1FMVA 1BR0A 1QUUA 4I4TE 3SS1A 5AQLB 4LFBT 2MTQA 4UVCB 2A2FX 5JDGA 4GOUA 1U4QA 4A5XA 3MXZA 1MIVA 2D0TA 2H7OA 2X66A 4IE4A 5HWYA 2LHNA 3MA9A 3UUBA 4EEDA 1KF6A 5LOVE 1UCUA 2WM9A 3KINB 1CHUA 4K0UA 5FY0A 3AE7A 4JI6T 4IE5A 3ZEFB 4U33A 2W0GA 4B3RT 4MBQA 4B6XA 3K3NA 2E9XC 3N9MA 4OYJA 5L3GB 1UUSA 3A8YC 1LKXA 4ERRA 3SFEA 1UX4A 2M6BA 3AEAA 1D0XA 1Y64B 4U3CA 3ZT6A 2N2NA 5EZYE 3ZMZB 1N32T 5AFUL 5L4EA 4IE7A 3OTOT 2BS4A 4H9OC 3Q2MA 5HXRA 2JMHA 4WBNE 3TLWA 3ZMSB 3KVBA 2IIUA 2K5BB 2WMOA 2JJ9A 3OKQA 2C5IT 3LFMA 2OV9A 3B5MA 3PDYA 3AAIA 1X79A 3SOLA 5EK3A 1D1AA 3ZCIA 3AE8A 3NRYA 2VVNA 2PJQA 4CI2B 3ZSSA 3I9WA 2VVSA 4AIUA 4X1YE 4TV8E 3ZC0A 2V5CA 3BQIA 3EDVA 1LRZA 1BR1A 2JQQA 4MHCA 4UIGA 4WNKA 3K3OA 1BR4A 2XPKA 3NZPA 3RRCA 4HE8A 3NZQA 2B1EA 1YQ4A 2NTYA 2X9YA 4I50E 3UU5A 3U3IA 1SE7A 3P8CD 4CXYA 2YU2A 3FHNA 4GK0E 1HNXT 2QA7A 2CLYC 1LVFA 1WCRA 2E9XD 2J4GA 5LGNB 3C64A 3Q9DA 4KP3C 5HYAA 3CX6B 3Q5EA 2NP9A 4YTPA 5HXSA 5JH7E 5ABFA 4AQFA 4J2CA 2KT9A 4BA9A 2CBIA 2N9DA 4QX7B 4ZEYA 4IDZA 4PJJA 3UFGA 4CQIA 5JQGE 4O4HE 2LSJA 5LP6E 1G73A 5H6QB 4JI2T 1IBLT 1JNZA 2PG8A 2ZM0A 5BMVE 5IHYA 1MIYA 2X51A 3BQLA 3KFWX 3O1JA 5FL0A 4QH5A 5FY7A 1E2AA 3LK3B 5ABEA 4ZI3C 3VKHA 3RQWA 5JR9C 4FI5A 4X64T 3P4RA 3HKDE 2H88A 2DLRA 4PAGA 4PFPA 4TV9E 3RYFE 4HGAA 1T7SA 3F57A 4QH4A 3ZMUB 4DNDA 5LJMA 3PJAJ 5C8YE 5FVLA 2KZ7B 4GIWA 2KINB 2X68A 4A97A 5TAOA 3AVSA 3EHZA 4QH1A 2JMKA 2XQ4A 4GYSA 3R6NA 4ZS2A 3RHWA 1UK5A 1VOMA 2LEHA 3HI2A 3LSVA 3MACA 4NIQA 4UV8B 4ZS3A 2W61A 2YOEA 1I6ZA 3DJBA 3AA0B 1H7CA 3LK42 2XHEB 4E7ZA 4EYYR 1KFYA 3T1YT 4AQFC 4DBQA 2V7KA 2FJBA 2JIWA 3DP7A 2VKHA 5J0ZA 1XMOT 3VKGA 4OK0A 2NOXA 5DQVA 2QGSA 3UUNA 3NVOA 4IDQA 3RX6A 4DVDA 3N5LA 4JI3T 2X0HA 4IGUA 5AQGB 4G2AA 1O3XA 4TZ4C 2VKDA 2LM2A 2XM1A 2YN6A 3JCFA 4O4IE 4OYKA 3C4WA 4TWDA 3VU7H 2V7MA 3P4SA 4HKAA 4EGWA 2A3DA 4YSZA 4CXWA 4DUYT 1T8BA 3CIRA 5F3JA 1W0AA 2L9QA 4LF6T 2D0UA 3AVRA 3CX7B 5LBQB 3CPZA 3KV6A 2BS2A 2IDOB 3CQCB 4E7SA 4UELA 1S35A 2IUBA 2VURA 3AEEA 2A9UA 2IC6A 2MPKA 2YINA 4HTEA 5AQJB 1HG2A 5AQIB 1HX8A 1XDOA 2BBJA 5L47A 4CI1B 1ZV4X 3WI3A 2BS3A 2CHNA 1B7TA 2CPTA 2WB5A 2WY2A 1HX1B 3JAFA 1WR0A 4IDNA 5HCMA 5ADXL 1WRDA 1NAFA 3C51A 4IE6A 4UXNB 5JDFA 4PK5A 3D0TA 2XQ5A 5JREA 2CBJA 4YY3T 2H7VC 2BG9C 4ILCA 3SWHA 5ABFB 2H89A 2LOPA 5L4HA 2QRXA 3AECA 4UR9A 1HCIA 3N9OA 3ZN1B 2VKJA 4Z90A 3U78A 1HFAA 4PFOA 5HEUA 4ZHQE 3F31A 3N2OA 3AEFA 4N78D 3OPCA 4OHFA 5DQWA 3FZLB 5AQNB 3F2EA 3VR8A 3RI5A 2VL8A 3AA7B 3RYHE 2JQHA 2YK0A 4M1PA 1MMDA 1X9BA 5AQPB 3RH3A 5FMNA 5FY1A 2J62A 4A56A 5CA0E 2UXCT 4KHPT 4NUVA 2LOSA 4H9QC 2X0LB 5AQMB 5L3CB 3ABVA 5FL1A 2EHOA 4L5GA 3RF1A 5EK2A 4YFSA 2RA1A 4ISSA 2W66A 2PBIA 2Z6EA 2DWGA 2K3WA 2PFVA 4TNWA 4U74A 3V5UA 2UU9T 2FJEA 4XAXB 2WWUA 2M67A 3TLTA 4AKLA 2UUAT 2HPJA 4DV0T 4FJOA 1FJGT 4HFIA 2L3LA 4A98A 1M62A 2DHRA 2YEVC 5DJQC 2WDRA 4K0KT 4DIDB 3VRBA 2ACXA 2K48A 2YDSA 3IEEA 1HR0T 4ZZBA 4HFBA 1KNZA 4DV5T 2XY8B 3UQ7A 4AISA 2BKNA 3OBVE 4KUMB 2W2UA 3KBUA 1NEKA 3MZKB 3ZYMA 4AKHA 1YQ3A 3N9NA 3FZHB 1R8IA 5CGMA 3NKZA 2Y6XA 3AE4A 3N2KE 4X5TA 3L3PA 3AEDA 4AKGA 4EAHA 1KEYA 3A7MA 4EZ4A 1WYCA 1IBKT 3CWZB 3RIUA 4HWCA 3RQUA 3UULA 2BG9B 1Z0PA 3CQGB 3H3AA 2E8IA 3AA6B 5E0OA 3ZN0B 4CI3B 4KHZF 2KNDA 2X9XA 1N33T 4GKKT 3NRXA 2N1GA 2LRKA 3PUXF 2HHHT 2CEAA 5LG4A 3I9YA 3E0ZA 4HN9A 3IA3A 4UEMA 5FKYA 5C2TA 3RKOA 2J47A 5KMGP 3I1AA 5AQVB 4X1IE 4WYVA 4U2YA 3UUXB 3UU4A 1OEDB 4Z91A 3C4XA 3QB5K 4ZXLA 3ANWB 4QX8B 4LF7T 2V5DA 1EZ3A 2RPAA 4IL9A 5AQTB 3PV0F 2PTFA 3LK2B 4HEAA 4JBWF 5HXEA 4C91A 3PJAA 5ABHA 4EB6E 2UXNB 5LA6E 3UU8A 1IJ6A 2E5LT 5JTGA 3EI0A 3K3QC 4C90A 1HF8A 3PUQA 4LMLA 2V6XA 4DR4T 2BVMA 3NBXX 3KV5A 4EV6A 2IMLA 2XAJB 3UT5E 4DV2T 4HFCA 4NXNT 4BJMA 1YXRA 2XUEA 4LFCT 1AJ3A 5LGTB 2Y8DA 2CXFA 5JR9A 3FZMB 3PUGA 2I6HA 4YJ2E 3GA8A 5BR8T 5CB4E 4DV4T 3ZMVB 4UVBB 4KBMB 4QWNB 4DV6T 2WP9A 2X9WA 1WFDA 4ILBA 3O9XA 3M65A 2CE7A 3ZJ2A 1YKEB 2JQ9A 1J5WA 4ANJA 3AE3A 2IC9A 1FEWA 1OXZA 2WU2A 2XQ9A 3CK6A 4IDOA 4PW8A 5AQHB 1IBMT 3KBTA 1JNRA 5AQOB 5L3FB 2W62A 4JI4T 1VRBA 3B13A 1D0YA 5J2TE 1KNPA 3AE2A 4DR3T 3AXJB 3KVAA 2ZMAA 5AQSB 3GMIA 4U31A 2DL1A 3I0OA 3O1IA 3AXJA 5H6RB 5A1LA 3PUWF 4HWDA 4JEUB 4AKRB 1IJ5A 3P4WA 4PJNA 2EHOC 3FB2A 4QXHB 3CX8B 4B3MT 3FXEB 2X0YA 4LF8T 1VCSA 3HL6A 2H3RA 2HN2A 1MMGA 2BDEA 2V1DB 2UUCT 4JI8T 3AE6A 3CMLA 1IAPA 2WDQA 4DV1T 3T1HT 4X1KE 5KX5E 2WAUA 4O2BE 4PJMA 2P9BA 1HTJF 1I94T 3R84B 2YKSA 2IW5B 1XDPA 3UU3A 4JI5T 2K24A 3A5XA 4QHOA 4AI6A 4X65T 5FYMA 1T98A 2BVLA 1SUMB 1MMNA 2AE9A 2OLTA 1OEDE 4HWIB 4Q25A 1D0ZA 4TNVA 4CZZB 2V7JA 2LSGA 3ONLC 2HH7A 2HN1A 2SPCA 3IF8B 4HFHA 4P09A 3EDUA 2KXPB 1W0BA 3N2GE 2ACZA 2D2SA 2DI4A 2WBLA 2V6YA 3PUYF 4HWHA 4LMJA 2NW9A 3VR9A 3LG7A 2LKGA 1MIWA 1US7B 4U2ZA 3PUVF 5LHIB 1Y01A 3RLFF 3E22E 4F8HA 3QOFA 4LF5T 4G63A 2Y48B 5FVKA 5J1GA 2F4VT 3ZC1A 3J7Yq 2ZM6T 4MFRA 2KMFA 2WCAA 1NWMX 3G06A 5F5WA 2FBWA 2VQFT 2IAKA 4QXCB 2CXDA 2OA5A 2V7LA 3SFDA 1BR2A 3WAJA 3EAMA 1QSDA 4P0AA 4YLHA 2BKPA 2WU5A 4H63V 3IHRA 3K1SA 1D1BA 2VL0A 3BK9A 1J5ET 1ZEEA 2XJ7A 2LSYA 2W63A 2X9HA 2ZM8A 3KV9A 4CN4A 4EZHA 5IWAT 1OEDC 3HKCE 3OYXA 5LMUT 1YKHB 4PK4A 3TLUA 4CXXA 2FJDA 3AB3B 1D1CA 3TLVA 4AXPA 4ZI7E 1HG5A 2Q9QC 3LBXB 2BZBA
chains in the Genus database with same CATH topology
4QH4A 4HFDA 2XQAA 4TWFA 5HEHA 4A97A 4ILAA 3RHWA 3EHZA 3TLSA 4QH1A 2XQ4A 3UU4A 2M6IA 1OEDB 4Z91A 3LSVA 3RQWA 3ZKRA 1OEDA 2YOEA 4IL9A 5IUXA 4IREA 3UQ4A 3P50A 3UU8A 4TWHA 2LLYA 2KSRA 3EI0A 5J0ZA 4LMLA 2XQ8A 4HFCA 3JADA 3RIAA 5HCJA 2YN6A 2LM2A 4NPPA 4TWDA 4COFA 2LKHA 4ILBA 5LG3A 3JAEA 2XQ7A 2BG9E 2XQ9A 3UU6A 3UUBA 5L47A 3RIFA 3P4WA 2XQ3A 2BG9A 3JAFA 5HCMA 2M6BA 2XQ5A 2BG9C 4ILCA 5HEJA 5L4HA 4IL4A 2YKSA 4HFEA 4Z90A 3UU3A 5L4EA 5HEUA 3TLWA 3RI5A 1OEDE 4TNVA 4HFHA 2MAWA 4LMJA 4ZZCA 2LKGA 2XQ6A 4TNWA 2BG9B 4F8HA 3TLTA 3UU5A 4HFIA 4A98A 4ZZBA 5HEGA 3EAMA 4HFBA 3UQ7A 2VL0A 1OEDC 4LMKA 4X5TA 3TLUA 4QH5A 3TLVA 5CFBA 3RQUA 5HEOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QH4 A;  4HFD A;  2XQA A;  4TWF A;  5HEH A;  4A97 A;  4ILA A;  3RHW A;  3EHZ A;  3TLS A;  4QH1 A;  2XQ4 A;  3UU4 A;  2M6I A;  1OED B;  4Z91 A;  3LSV A;  3RQW A;  3ZKR A;  1OED A;  2YOE A;  4IL9 A;  5IUX A;  4IRE A;  3UQ4 A;  3P50 A;  3UU8 A;  4TWH A;  2LLY A;  2KSR A;  3EI0 A;  5J0Z A;  4LML A;  2XQ8 A;  4HFC A;  3JAD A;  3RIA A;  5HCJ A;  2YN6 A;  2LM2 A;  4NPP A;  4TWD A;  4COF A;  2LKH A;  4ILB A;  5LG3 A;  3JAE A;  2XQ7 A;  2BG9 E;  2XQ9 A;  3UU6 A;  3UUB A;  5L47 A;  3RIF A;  3P4W A;  2XQ3 A;  2BG9 A;  3JAF A;  5HCM A;  2M6B A;  2XQ5 A;  2BG9 C;  4ILC A;  5HEJ A;  5L4H A;  4IL4 A;  2YKS A;  4HFE A;  4Z90 A;  3UU3 A;  5L4E A;  5HEU A;  3TLW A;  3RI5 A;  1OED E;  4TNV A;  4HFH A;  2MAW A;  4LMJ A;  4ZZC A;  2LKG A;  2XQ6 A;  4TNW A;  2BG9 B;  4F8H A;  3TLT A;  3UU5 A;  4HFI A;  4A98 A;  4ZZB A;  5HEG A;  3EAM A;  4HFB A;  3UQ7 A;  2VL0 A;  1OED C;  4LMK A;  4X5T A;  3TLU A;  4QH5 A;  3TLV A;  5CFB A;  3RQU A;  5HEO A; 
#chains in the Genus database with same CATH topology
 2DNX A;  2XQY A;  3P4P A;  3LBX A;  4KX6 A;  3H3M A;  2E9X B;  4HFD A;  2LHR A;  1FIO A;  2NTX A;  3AAE B;  3LDQ B;  1ZP0 A;  3C4Z A;  2XQA A;  2YU1 A;  4IHJ E;  4ZOL E;  1U5P A;  2W67 A;  2Q9Q A;  2E9X A;  4ILA A;  5FP3 A;  3RC3 A;  1KK7 A;  1YW0 A;  2V8S V;  2V7I A;  4O4L E;  3TLS A;  5AQK B;  3EVY A;  3ZYK A;  2XAG B;  2M6I A;  5JDQ A;  5LHH B;  4GYR A;  4WBO A;  5LMN T;  2CCQ A;  2VWA A;  3VHL A;  4L9I A;  3RIU C;  2DWK A;  1OED A;  2LJL A;  2FJA A;  4DMV A;  3ETV A;  3TKL B;  4YJ3 E;  3VRA A;  1IZN B;  4DMW A;  5IUX A;  4TN7 B;  1XZY A;  2KWI B;  1ZOY A;  4IRE A;  2I0M A;  3UQ4 A;  3N9L A;  4DR1 T;  4YHJ A;  2ODU A;  4IDP A;  4UVA B;  5LBM A;  2LLY A;  2KSR A;  3HR0 A;  2XAS B;  5LGU B;  4QXB B;  3ZJ1 A;  3RIF A;  4MLK A;  1S94 A;  4NUU A;  4ILU A;  3ZCJ A;  3JC6 D;  1J1J A;  2BBH A;  5J2U E;  3ZPO A;  4JYA T;  4XZC A;  5HEJ A;  5HCJ A;  1UGO A;  1SA0 E;  5JDN A;  4DR6 T;  4L0R A;  1FMW A;  4DV7 T;  2W4X A;  4NPP A;  4X20 E;  2UXB T;  4COF A;  2W00 A;  2XTL A;  4JEH B;  5KDM C;  2WWV A;  4O8S A;  2CXL A;  5JR9 B;  4I0U A;  5JRC A;  1W09 A;  2B76 A;  3M3Z B;  4H9P C;  4AKI A;  1E1H B;  3UUM A;  2NR4 A;  5HXC A;  1V9D A;  3PUA A;  2ODV A;  5ABG A;  4UF0 A;  2WQY A;  3NWI A;  2LT3 A;  1M7K A;  3PU3 A;  5LJN A;  1XMQ T;  3AE9 A;  4ASK A;  2BG9 E;  1OWA A;  3PU8 A;  4P0B A;  4UF0 B;  2MBG A;  3UU6 A;  5LNK A;  3O4X E;  3I0Q A;  3S4U A;  1XNR T;  3ZT7 A;  5JDM A;  3W15 B;  4CN6 A;  3ZST A;  1W9R A;  2WZI A;  1GQE A;  3QK6 A;  1Z8U A;  3AEG A;  3FZF B;  2XSA A;  3AE5 A;  4H9N C;  2YDQ A;  5L3D B;  3K8P C;  3KDS E;  1N34 T;  2MYS A;  4IIJ E;  3ZT5 A;  4X62 T;  2LSI A;  2WZH A;  3L8R A;  3GWH A;  2NW8 A;  2D9D A;  3MK7 C;  3MJX A;  3L09 A;  2BKO A;  2EHO B;  3CVR A;  4H9S E;  2XQ3 A;  2BG9 A;  4MAL A;  4P1N A;  4EEB A;  5CJ5 A;  5KXJ A;  4EXT A;  2FUP A;  2E2A A;  4O4J E;  2ES0 A;  1KNR A;  2I59 A;  4U72 A;  3SRZ A;  3RPU A;  2NW7 A;  3Q5W A;  3EUH A;  4JI0 T;  2CWO A;  3RRW A;  4U7I A;  2RP4 A;  5ETW A;  5F8P A;  3QC9 A;  3PE0 A;  4IL4 A;  5HWX A;  3BQK A;  2X67 A;  4HFE A;  5LB7 B;  3DTO A;  2WSS V;  4YSX A;  4DUZ T;  5FXX A;  1HNW T;  3RGL A;  5JVD E;  4JI1 T;  3IBP A;  3EAB A;  4B3T T;  3RKG A;  2E5V A;  2WMN A;  4O2A E;  3P4Q A;  2MAW A;  4YT0 A;  2CWY A;  3Q5D A;  4ZZC A;  5C3J A;  1MMA A;  1ZHC A;  3HA4 A;  3CQX C;  2AXD S;  2VK9 A;  1XNQ T;  2EHO D;  2XAH B;  4TX5 A;  5HXH A;  4ZI2 D;  1N36 T;  2V6Y B;  2CMR A;  2XQ6 A;  3ESL A;  3X1D A;  1DU2 A;  2JPF A;  4HFV A;  1MNE A;  2Q9Q B;  5CA1 E;  1HS7 A;  1WYB A;  2ZM2 A;  5FXV A;  3KV4 A;  4JUY A;  4EIW A;  4I55 E;  4BAY B;  4DR5 T;  3ONX A;  2XZE A;  2CA5 A;  2VKO A;  2YDR A;  3AAA B;  3HKB E;  4IE0 A;  4Z8X A;  2G0U A;  2KLQ A;  5FNV E;  5GON E;  5HEG A;  3JC6 C;  2V26 A;  5LHG B;  3Q5X A;  3OJA A;  2WDV A;  3N9P A;  5EK4 A;  4LF9 T;  4GKJ T;  1QLB A;  3B57 A;  4YTM A;  2GK9 A;  4OX9 T;  1WLX A;  2UXX B;  3ZYL A;  4F6R C;  3WAK A;  4KI0 F;  2ZLY A;  3RYC E;  2R6G F;  4YSY A;  2C5J A;  2JQK A;  3QB5 A;  3QUJ A;  4LMK A;  2DCF A;  2IHR 1;  2LSK A;  3ONJ A;  1WR6 A;  4H9R C;  1NEN A;  3H37 A;  4YXD A;  5FXZ A;  5L3B B;  3RC8 A;  3MKD A;  4PJL A;  4EOZ B;  1HNZ T;  1ZKE A;  5CFB A;  3FZK B;  5HEO A;  4WZX A;  5L3E B;  4DBR A;  1LVK A;  3LJC A;  2VB6 A;  4X66 T;  4YTN A;  4AQY T;  1XWM A;  2C0S A;  3GN5 A;  3QNU A;  5LXT E;  4JI7 T;  5DAB A;  3PTR B;  3HKE E;  4KMC A;  1MND A;  2LRL A;  4CN1 A;  5JDL A;  4PK6 A;  4TWF A;  2XM2 A;  5HEH A;  4AQG A;  2VQE T;  1VCT A;  3FBL A;  3ZLI A;  4ZI2 C;  5FXW A;  5HAX A;  2LE8 A;  4ZI3 D;  2CHO A;  3T8O A;  3UTK A;  4DO0 A;  4GK5 E;  4JV5 T;  3FXD B;  4WW0 A;  3ZKR A;  4TUY E;  4DR2 T;  3L39 A;  2C5K T;  2CRB A;  2UUB T;  5JRC B;  1UX5 A;  3UFE A;  4EYU A;  1G8X A;  4BJN A;  1UUR A;  2WS3 A;  3AE1 A;  3C98 B;  4XBF B;  2MOZ A;  1SHZ C;  3P50 A;  4UV9 B;  2HPL A;  2J1D G;  4U7Y A;  2D5U A;  2L8K A;  3E08 A;  3ETU A;  4TWH A;  5LYJ E;  2Q9Q D;  5AQQ B;  4ADZ A;  2UXD T;  2QVA A;  1L0V A;  2CLY B;  3PUZ F;  1CUN A;  2NWB A;  2XAQ B;  3J9X 1;  5AQR B;  3OYZ A;  4IST A;  2XSB A;  2XQ8 A;  1YD8 G;  3P7I A;  3JAD A;  5JDH A;  3RYI E;  3RIA A;  4OFZ A;  5L2L A;  5AQF B;  3AEB A;  3AA1 B;  5AQU B;  4YHH T;  2K9A A;  4PNI A;  2VAS A;  3ZMT B;  3CKD A;  4H63 H;  3GN5 B;  2LM9 A;  5IYZ E;  2CM0 A;  3PUR A;  4NXM T;  3O1H A;  3V5S A;  1E7P A;  4V1A v;  4LFA T;  2LKH A;  3ANW A;  4DR7 T;  4QKN A;  1T72 A;  2XAF B;  3N9Q A;  3C50 A;  3PUS A;  3OVU A;  4IT4 A;  2KWH A;  3FBZ A;  5LG3 A;  3JAE A;  4LF4 T;  4I43 B;  4DV3 T;  5M4Y A;  2QYW A;  2XQ7 A;  4B3S T;  4HWF A;  4JLE A;  2A72 A;  5LCY A;  2JRK A;  1FMV A;  1BR0 A;  1QUU A;  4I4T E;  3SS1 A;  5AQL B;  4LFB T;  2MTQ A;  4UVC B;  2A2F X;  5JDG A;  4GOU A;  1U4Q A;  4A5X A;  3MXZ A;  1MIV A;  2D0T A;  2H7O A;  2X66 A;  4IE4 A;  5HWY A;  2LHN A;  3MA9 A;  3UUB A;  4EED A;  1KF6 A;  5LOV E;  1UCU A;  2WM9 A;  3KIN B;  1CHU A;  4K0U A;  5FY0 A;  3AE7 A;  4JI6 T;  4IE5 A;  3ZEF B;  4U33 A;  2W0G A;  4B3R T;  4MBQ A;  4B6X A;  3K3N A;  2E9X C;  3N9M A;  4OYJ A;  5L3G B;  1UUS A;  3A8Y C;  1LKX A;  4ERR A;  3SFE A;  1UX4 A;  2M6B A;  3AEA A;  1D0X A;  1Y64 B;  4U3C A;  3ZT6 A;  2N2N A;  5EZY E;  3ZMZ B;  1N32 T;  5AFU L;  5L4E A;  4IE7 A;  3OTO T;  2BS4 A;  4H9O C;  3Q2M A;  5HXR A;  2JMH A;  4WBN E;  3TLW A;  3ZMS B;  3KVB A;  2IIU A;  2K5B B;  2WMO A;  2JJ9 A;  3OKQ A;  2C5I T;  3LFM A;  2OV9 A;  3B5M A;  3PDY A;  3AAI A;  1X79 A;  3SOL A;  5EK3 A;  1D1A A;  3ZCI A;  3AE8 A;  3NRY A;  2VVN A;  2PJQ A;  4CI2 B;  3ZSS A;  3I9W A;  2VVS A;  4AIU A;  4X1Y E;  4TV8 E;  3ZC0 A;  2V5C A;  3BQI A;  3EDV A;  1LRZ A;  1BR1 A;  2JQQ A;  4MHC A;  4UIG A;  4WNK A;  3K3O A;  1BR4 A;  2XPK A;  3NZP A;  3RRC A;  4HE8 A;  3NZQ A;  2B1E A;  1YQ4 A;  2NTY A;  2X9Y A;  4I50 E;  3UU5 A;  3U3I A;  1SE7 A;  3P8C D;  4CXY A;  2YU2 A;  3FHN A;  4GK0 E;  1HNX T;  2QA7 A;  2CLY C;  1LVF A;  1WCR A;  2E9X D;  2J4G A;  5LGN B;  3C64 A;  3Q9D A;  4KP3 C;  5HYA A;  3CX6 B;  3Q5E A;  2NP9 A;  4YTP A;  5HXS A;  5JH7 E;  5ABF A;  4AQF A;  4J2C A;  2KT9 A;  4BA9 A;  2CBI A;  2N9D A;  4QX7 B;  4ZEY A;  4IDZ A;  4PJJ A;  3UFG A;  4CQI A;  5JQG E;  4O4H E;  2LSJ A;  5LP6 E;  1G73 A;  5H6Q B;  4JI2 T;  1IBL T;  1JNZ A;  2PG8 A;  2ZM0 A;  5BMV E;  5IHY A;  1MIY A;  2X51 A;  3BQL A;  3KFW X;  3O1J A;  5FL0 A;  4QH5 A;  5FY7 A;  1E2A A;  3LK3 B;  5ABE A;  4ZI3 C;  3VKH A;  3RQW A;  5JR9 C;  4FI5 A;  4X64 T;  3P4R A;  3HKD E;  2H88 A;  2DLR A;  4PAG A;  4PFP A;  4TV9 E;  3RYF E;  4HGA A;  1T7S A;  3F57 A;  4QH4 A;  3ZMU B;  4DND A;  5LJM A;  3PJA J;  5C8Y E;  5FVL A;  2KZ7 B;  4GIW A;  2KIN B;  2X68 A;  4A97 A;  5TAO A;  3AVS A;  3EHZ A;  4QH1 A;  2JMK A;  2XQ4 A;  4GYS A;  3R6N A;  4ZS2 A;  3RHW A;  1UK5 A;  1VOM A;  2LEH A;  3HI2 A;  3LSV A;  3MAC A;  4NIQ A;  4UV8 B;  4ZS3 A;  2W61 A;  2YOE A;  1I6Z A;  3DJB A;  3AA0 B;  1H7C A;  3LK4 2;  2XHE B;  4E7Z A;  4EYY R;  1KFY A;  3T1Y T;  4AQF C;  4DBQ A;  2V7K A;  2FJB A;  2JIW A;  3DP7 A;  2VKH A;  5J0Z A;  1XMO T;  3VKG A;  4OK0 A;  2NOX A;  5DQV A;  2QGS A;  3UUN A;  3NVO A;  4IDQ A;  3RX6 A;  4DVD A;  3N5L A;  4JI3 T;  2X0H A;  4IGU A;  5AQG B;  4G2A A;  1O3X A;  4TZ4 C;  2VKD A;  2LM2 A;  2XM1 A;  2YN6 A;  3JCF A;  4O4I E;  4OYK A;  3C4W A;  4TWD A;  3VU7 H;  2V7M A;  3P4S A;  4HKA A;  4EGW A;  2A3D A;  4YSZ A;  4CXW A;  4DUY T;  1T8B A;  3CIR A;  5F3J A;  1W0A A;  2L9Q A;  4LF6 T;  2D0U A;  3AVR A;  3CX7 B;  5LBQ B;  3CPZ A;  3KV6 A;  2BS2 A;  2IDO B;  3CQC B;  4E7S A;  4UEL A;  1S35 A;  2IUB A;  2VUR A;  3AEE A;  2A9U A;  2IC6 A;  2MPK A;  2YIN A;  4HTE A;  5AQJ B;  1HG2 A;  5AQI B;  1HX8 A;  1XDO A;  2BBJ A;  5L47 A;  4CI1 B;  1ZV4 X;  3WI3 A;  2BS3 A;  2CHN A;  1B7T A;  2CPT A;  2WB5 A;  2WY2 A;  1HX1 B;  3JAF A;  1WR0 A;  4IDN A;  5HCM A;  5ADX L;  1WRD A;  1NAF A;  3C51 A;  4IE6 A;  4UXN B;  5JDF A;  4PK5 A;  3D0T A;  2XQ5 A;  5JRE A;  2CBJ A;  4YY3 T;  2H7V C;  2BG9 C;  4ILC A;  3SWH A;  5ABF B;  2H89 A;  2LOP A;  5L4H A;  2QRX A;  3AEC A;  4UR9 A;  1HCI A;  3N9O A;  3ZN1 B;  2VKJ A;  4Z90 A;  3U78 A;  1HFA A;  4PFO A;  5HEU A;  4ZHQ E;  3F31 A;  3N2O A;  3AEF A;  4N78 D;  3OPC A;  4OHF A;  5DQW A;  3FZL B;  5AQN B;  3F2E A;  3VR8 A;  3RI5 A;  2VL8 A;  3AA7 B;  3RYH E;  2JQH A;  2YK0 A;  4M1P A;  1MMD A;  1X9B A;  5AQP B;  3RH3 A;  5FMN A;  5FY1 A;  2J62 A;  4A56 A;  5CA0 E;  2UXC T;  4KHP T;  4NUV A;  2LOS A;  4H9Q C;  2X0L B;  5AQM B;  5L3C B;  3ABV A;  5FL1 A;  2EHO A;  4L5G A;  3RF1 A;  5EK2 A;  4YFS A;  2RA1 A;  4ISS A;  2W66 A;  2PBI A;  2Z6E A;  2DWG A;  2K3W A;  2PFV A;  4TNW A;  4U74 A;  3V5U A;  2UU9 T;  2FJE A;  4XAX B;  2WWU A;  2M67 A;  3TLT A;  4AKL A;  2UUA T;  2HPJ A;  4DV0 T;  4FJO A;  1FJG T;  4HFI A;  2L3L A;  4A98 A;  1M62 A;  2DHR A;  2YEV C;  5DJQ C;  2WDR A;  4K0K T;  4DID B;  3VRB A;  2ACX A;  2K48 A;  2YDS A;  3IEE A;  1HR0 T;  4ZZB A;  4HFB A;  1KNZ A;  4DV5 T;  2XY8 B;  3UQ7 A;  4AIS A;  2BKN A;  3OBV E;  4KUM B;  2W2U A;  3KBU A;  1NEK A;  3MZK B;  3ZYM A;  4AKH A;  1YQ3 A;  3N9N A;  3FZH B;  1R8I A;  5CGM A;  3NKZ A;  2Y6X A;  3AE4 A;  3N2K E;  4X5T A;  3L3P A;  3AED A;  4AKG A;  4EAH A;  1KEY A;  3A7M A;  4EZ4 A;  1WYC A;  1IBK T;  3CWZ B;  3RIU A;  4HWC A;  3RQU A;  3UUL A;  2BG9 B;  1Z0P A;  3CQG B;  3H3A A;  2E8I A;  3AA6 B;  5E0O A;  3ZN0 B;  4CI3 B;  4KHZ F;  2KND A;  2X9X A;  1N33 T;  4GKK T;  3NRX A;  2N1G A;  2LRK A;  3PUX F;  2HHH T;  2CEA A;  5LG4 A;  3I9Y A;  3E0Z A;  4HN9 A;  3IA3 A;  4UEM A;  5FKY A;  5C2T A;  3RKO A;  2J47 A;  5KMG P;  3I1A A;  5AQV B;  4X1I E;  4WYV A;  4U2Y A;  3UUX B;  3UU4 A;  1OED B;  4Z91 A;  3C4X A;  3QB5 K;  4ZXL A;  3ANW B;  4QX8 B;  4LF7 T;  2V5D A;  1EZ3 A;  2RPA A;  4IL9 A;  5AQT B;  3PV0 F;  2PTF A;  3LK2 B;  4HEA A;  4JBW F;  5HXE A;  4C91 A;  3PJA A;  5ABH A;  4EB6 E;  2UXN B;  5LA6 E;  3UU8 A;  1IJ6 A;  2E5L T;  5JTG A;  3EI0 A;  3K3Q C;  4C90 A;  1HF8 A;  3PUQ A;  4LML A;  2V6X A;  4DR4 T;  2BVM A;  3NBX X;  3KV5 A;  4EV6 A;  2IML A;  2XAJ B;  3UT5 E;  4DV2 T;  4HFC A;  4NXN T;  4BJM A;  1YXR A;  2XUE A;  4LFC T;  1AJ3 A;  5LGT B;  2Y8D A;  2CXF A;  5JR9 A;  3FZM B;  3PUG A;  2I6H A;  4YJ2 E;  3GA8 A;  5BR8 T;  5CB4 E;  4DV4 T;  3ZMV B;  4UVB B;  4KBM B;  4QWN B;  4DV6 T;  2WP9 A;  2X9W A;  1WFD A;  4ILB A;  3O9X A;  3M65 A;  2CE7 A;  3ZJ2 A;  1YKE B;  2JQ9 A;  1J5W A;  4ANJ A;  3AE3 A;  2IC9 A;  1FEW A;  1OXZ A;  2WU2 A;  2XQ9 A;  3CK6 A;  4IDO A;  4PW8 A;  5AQH B;  1IBM T;  3KBT A;  1JNR A;  5AQO B;  5L3F B;  2W62 A;  4JI4 T;  1VRB A;  3B13 A;  1D0Y A;  5J2T E;  1KNP A;  3AE2 A;  4DR3 T;  3AXJ B;  3KVA A;  2ZMA A;  5AQS B;  3GMI A;  4U31 A;  2DL1 A;  3I0O A;  3O1I A;  3AXJ A;  5H6R B;  5A1L A;  3PUW F;  4HWD A;  4JEU B;  4AKR B;  1IJ5 A;  3P4W A;  4PJN A;  2EHO C;  3FB2 A;  4QXH B;  3CX8 B;  4B3M T;  3FXE B;  2X0Y A;  4LF8 T;  1VCS A;  3HL6 A;  2H3R A;  2HN2 A;  1MMG A;  2BDE A;  2V1D B;  2UUC T;  4JI8 T;  3AE6 A;  3CML A;  1IAP A;  2WDQ A;  4DV1 T;  3T1H T;  4X1K E;  5KX5 E;  2WAU A;  4O2B E;  4PJM A;  2P9B A;  1HTJ F;  1I94 T;  3R84 B;  2YKS A;  2IW5 B;  1XDP A;  3UU3 A;  4JI5 T;  2K24 A;  3A5X A;  4QHO A;  4AI6 A;  4X65 T;  5FYM A;  1T98 A;  2BVL A;  1SUM B;  1MMN A;  2AE9 A;  2OLT A;  1OED E;  4HWI B;  4Q25 A;  1D0Z A;  4TNV A;  4CZZ B;  2V7J A;  2LSG A;  3ONL C;  2HH7 A;  2HN1 A;  2SPC A;  3IF8 B;  4HFH A;  4P09 A;  3EDU A;  2KXP B;  1W0B A;  3N2G E;  2ACZ A;  2D2S A;  2DI4 A;  2WBL A;  2V6Y A;  3PUY F;  4HWH A;  4LMJ A;  2NW9 A;  3VR9 A;  3LG7 A;  2LKG A;  1MIW A;  1US7 B;  4U2Z A;  3PUV F;  5LHI B;  1Y01 A;  3RLF F;  3E22 E;  4F8H A;  3QOF A;  4LF5 T;  4G63 A;  2Y48 B;  5FVK A;  5J1G A;  2F4V T;  3ZC1 A;  3J7Y q;  2ZM6 T;  4MFR A;  2KMF A;  2WCA A;  1NWM X;  3G06 A;  5F5W A;  2FBW A;  2VQF T;  2IAK A;  4QXC B;  2CXD A;  2OA5 A;  2V7L A;  3SFD A;  1BR2 A;  3WAJ A;  3EAM A;  1QSD A;  4P0A A;  4YLH A;  2BKP A;  2WU5 A;  4H63 V;  3IHR A;  3K1S A;  1D1B A;  2VL0 A;  3BK9 A;  1J5E T;  1ZEE A;  2XJ7 A;  2LSY A;  2W63 A;  2X9H A;  2ZM8 A;  3KV9 A;  4CN4 A;  4EZH A;  5IWA T;  1OED C;  3HKC E;  3OYX A;  5LMU T;  1YKH B;  4PK4 A;  3TLU A;  4CXX A;  2FJD A;  3AB3 B;  1D1C A;  3TLV A;  4AXP A;  4ZI7 E;  1HG5 A;  2Q9Q C;  3LBX B;  2BZB A; 
#chains in the Genus database with same CATH homology
 4QH4 A;  4HFD A;  2XQA A;  4TWF A;  5HEH A;  4A97 A;  4ILA A;  3RHW A;  3EHZ A;  3TLS A;  4QH1 A;  2XQ4 A;  3UU4 A;  2M6I A;  1OED B;  4Z91 A;  3LSV A;  3RQW A;  3ZKR A;  1OED A;  2YOE A;  4IL9 A;  5IUX A;  4IRE A;  3UQ4 A;  3P50 A;  3UU8 A;  4TWH A;  2LLY A;  2KSR A;  3EI0 A;  5J0Z A;  4LML A;  2XQ8 A;  4HFC A;  3JAD A;  3RIA A;  5HCJ A;  2YN6 A;  2LM2 A;  4NPP A;  4TWD A;  4COF A;  2LKH A;  4ILB A;  5LG3 A;  3JAE A;  2XQ7 A;  2BG9 E;  2XQ9 A;  3UU6 A;  3UUB A;  5L47 A;  3RIF A;  3P4W A;  2XQ3 A;  2BG9 A;  3JAF A;  5HCM A;  2M6B A;  2XQ5 A;  2BG9 C;  4ILC A;  5HEJ A;  5L4H A;  4IL4 A;  2YKS A;  4HFE A;  4Z90 A;  3UU3 A;  5L4E A;  5HEU A;  3TLW A;  3RI5 A;  1OED E;  4TNV A;  4HFH A;  2MAW A;  4LMJ A;  4ZZC A;  2LKG A;  2XQ6 A;  4TNW A;  2BG9 B;  4F8H A;  3TLT A;  3UU5 A;  4HFI A;  4A98 A;  4ZZB A;  5HEG A;  3EAM A;  4HFB A;  3UQ7 A;  2VL0 A;  1OED C;  4LMK A;  4X5T A;  3TLU A;  4QH5 A;  3TLV A;  5CFB A;  3RQU A;  5HEO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...