1OEDE

Structure of acetylcholine receptor pore from electron images
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
260
structure length
128
Chain Sequence
PLFYIINIIAPCVLISSLVVLVYFLPAQAGGQKCTLSISVLLAQTIFLFLIAQKVPETSLNVPLIGKYLIFVMFVSMLIVMNCVIVLNVSLRTGKVIDKACFWIALLLFSIGTLAIFLTGHFNQVPEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ion channel/receptor
molecule keywords ACETYLCHOLINE RECEPTOR PROTEIN, ALPHA CHAIN
publication title Structure and Gating Mechanism of the Acetylcholine Receptor Pore.
pubmed doi rcsb
total genus 52
structure length 128
sequence length 260
ec nomenclature
pdb deposition date 2003-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02932 Neur_chan_memb Neurotransmitter-gated ion-channel transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 1oedE00
1OEDE 4HFBA 4TNVA 2BG9A 3UU3A 2BG9B 4Z91A 4IL4A 3UU6A 4COFA 4ILAA 4F8HA 3JAFA 4ZZBA 3TLSA 4NPPA 3UQ4A 2YKSA 3RI5A 4HFEA 4QH4A 3P4WA 4A98A 2XQ5A 3UU4A 2BG9E 2LKHA 2YN6A 4HFDA 2LLYA 2M6IA 2MAWA 4ZZCA 2XQ9A 4LMJA 3UU5A 3LSVA 4TWHA 2XQ3A 5L47A 5IUXA 3UU8A 5CFBA 4IREA 2KSRA 3EHZA 3ZKRA 4ILCA 2XQ7A 3RQUA 3RQWA 1OEDC 2XQAA 4QH1A 4X5TA 3EI0A 4TNWA 3TLUA 3TLVA 2LM2A 3TLTA 3EAMA 5J0ZA 4QH5A 5HEUA 2XQ6A 1OEDB 3TLWA 5HEJA 5L4EA 4HFIA 3UQ7A 2BG9C 4A97A 4ILBA 3RIAA 4Z90A 3JADA 5HEOA 5L4HA 3RIFA 4HFCA 3P50A 4LMKA 3JAEA 2XQ8A 3UUBA 5LG3A 4HFHA 3RHWA 4LMLA 1OEDA 4TWFA 2LKGA 2M6BA 5HEHA 5HCJA 5HEGA 2YOEA 4IL9A 2VL0A 4TWDA 2XQ4A 5HCMA
chains in the Genus database with same CATH superfamily
3AB3B 5J1GA 4IL4A 2KNDA 4H9PC 4NPPA 2YDSA 2J4GA 2WZIA 2CHNA 1E7PA 3PUZF 3N2GE 4UXNB 4ZS3A 4E7ZA 4ZI2C 1D1AA 5F8PA 4HEAA 2BDEA 2R6GF 2XAFB 2XM1A 2UXXB 3RQUA 3JC6D 1OEDC 3VRAA 3RRWA 4YY3T 3ETVA 4AXPA 5TAOA 1HX1B 3CPZA 4AISA 4PK5A 3GMIA 3UQ7A 2VQET 4Z90A 2BBHA 5FKYA 1BR4A 2EHOD 1IBLT 4I55E 5AQFB 2CHOA 3FZHB 3PJAA 1XNRT 4NUUA 4UEMA 3OVUA 3H3MA 3RHWA 5ABGA 5J2UE 4DMWA 2CLYB 3IF8B 2XJ7A 4IGUA 4B3TT 4N78D 5LJNA 2BG9A 2H7VC 2KWHA 2XZEA 2WWUA 3O1HA 3E08A 4F8HA 2EHOB 3C4WA 1HTJF 3VR9A 5FXWA 4DMVA 1X79A 3Q9DA 4EOZB 4YLHA 4QH4A 3OKQA 2PFVA 1N36T 2D9DA 3AEEA 2A72A 3HR0A 5KXJA 4EB6E 4EXTA 2VVSA 4UVAB 1UCUA 2IUBA 2EHOA 3UU8A 1V9DA 4ISSA 3ANWA 1NWMX 1VOMA 2KSRA 2X0YA 3IHRA 3RQWA 2VKDA 3M3ZB 4P0AA 3RGLA 5L3BB 2NOXA 4NXMT 5AQGB 4DBRA 3LK42 3NKZA 5JDFA 3ETUA 3TKLB 5LGTB 4KBMB 3AE8A 5C3JA 2BG9C 4EYYR 4O2AE 5FXZA 3JC6C 2HH7A 2F4VT 3MXZA 5L2LA 4Q25A 2X51A 2CLYC 4FI5A 3I9WA 2CMRA 2MTQA 3AA6B 2XHEB 2E5LT 1VRBA 5HCJA 3N9LA 1D1CA 3B13A 2NP9A 4YSXA 4TV9E 4HFBA 4B3MT 5HXCA 1Z0PA 4Z91A 5FXVA 2JIWA 2V6XA 3CKDA 2W67A 4DR5T 2QA7A 3NWIA 4M1PA 3UU4A 3F2EA 4IDQA 1OWAA 3PJAJ 3ZMVB 2CXLA 2W63A 4U2YA 4EZ4A 4PJNA 4E7SA 4QHOA 5F5WA 4X65T 2K3WA 3AA0B 4X64T 1DU2A 1G8XA 2C5IT 3NRXA 1Y01A 5AQNB 3DTOA 3N5LA 2E9XD 1NAFA 2CBJA 2VKJA 2ACZA 2IIUA 5DQWA 5ABFB 4A5XA 3EAMA 1H7CA 4QH5A 4ZI3D 3CQXC 5H6QB 4ZXLA 3CQGB 5L4EA 5LMUT 2DHRA 4IT4A 5AQHB 3ZC0A 2L8KA 3OYZA 3E0ZA 4DR4T 5LG3A 3AE5A 4HFHA 4JV5T 4HE8A 2E9XB 4IHJE 2H88A 5AQMB 2LEHA 1J1JA 5LA6E 2P9BA 3QC9A 2LJLA 2GK9A 4YTMA 4QWNB 1SHZC 5FNVE 3H3AA 5LHGB 4NIQA 2LM9A 1ZHCA 4MALA 1T8BA 3PU3A 2V1DB 3ZMUB 3ZYLA 3AE3A 4P1NA 1QSDA 5KX5E 2LKHA 5LGNB 3S4UA 2MPKA 4I43B 2OA5A 3FZLB 4LMJA 5AQKB 4WZXA 3LSVA 3RKGA 3WI3A 4O4HE 4YJ3E 5CFBA 5LMNT 2D5UA 4OX9T 2XQAA 1T98A 3A7MA 4EZHA 2XQYA 3BQLA 1SA0E 1XNQT 2PBIA 2YDQA 1HF8A 2WU2A 2XSBA 3N9OA 4C90A 1W0BA 3FZFB 3ZCIA 4MFRA 3ONJA 4EYUA 2VB6A 1MIWA 3DJBA 2PG8A 5LYJE 4DV3T 3OJAA 2CWYA 1HS7A 4H9NC 4PNIA 3PUGA 3V5UA 2X66A 2I6HA 3T1HT 4IE0A 3ZYKA 3ZJ1A 4MLKA 2WAUA 3PUYF 4DV2T 2OLTA 3L39A 3BQIA 4DV4T 5F3JA 3RLFF 3CX6B 4X1KE 4H63H 4J2CA 4ZEYA 3KVBA 1ZP0A 4ZZBA 3RPUA 2X68A 4LF8T 3AE9A 1U4QA 2KINB 2XAJB 3I9YA 1BR0A 3K3OA 2XQ9A 4LF4T 4UVBB 5DABA 4ZI2D 2NW7A 4LFBT 4HWDA 4CI2B 2DI4A 4DR7T 4PK6A 4ZS2A 3AA7B 2DL1A 2I59A 1KFYA 4G63A 4WBOA 4V1Av 1WYBA 5LBMA 4JYAT 4UV9B 3IEEA 4DR2T 1ZOYA 4YHJA 4PJMA 3RH3A 4H9OC 2MOZA 1MNEA 5L3CB 2XQ6A 3N9MA 4IDZA 2CCQA 2V8SV 3AEBA 1T72A 3J9X1 2WSSV 2LSGA 1LVKA 4TZ4C 2Q9QC 3BQKA 1WCRA 2X9WA 4NXNT 3FHNA 4U2ZA 2L3LA 3PDYA 4ADZA 2DNXA 2AXDS 1UX5A 4X1YE 4GKJT 2VK9A 4DVDA 2M67A 2ZM0A 2DWKA 2XQ4A 1HNXT 4JLEA 3CVRA 2LSYA 4P09A 1YQ3A 2W0GA 2BZBA 1VCSA 3M65A 4AKRB 2D0UA 3GWHA 4QX7B 3ZSTA 2XQ5A 3IBPA 2D0TA 2LSIA 4IDPA 3ZT6A 4OYJA 2LLYA 2CPTA 1NEKA 1WRDA 3C4ZA 2WS3A 2ZM2A 4KHPT 1ZKEA 3P4SA 3PUSA 2B76A 4H9QC 1IBMT 2UUBT 4PFOA 4DV6T 4UV8B 2KLQA 3U78A 4JI7T 4CN1A 3VKGA 2JMHA 2JRKA 2CBIA 2JPFA 3F31A 3OYXA 5JRCB 4CXWA 5L4HA 1UURA 3FZKB 2IC9A 4ZI7E 5JDHA 3NBXX 4O4JE 4L0RA 1BR2A 2FBWA 3CIRA 2QGSA 5AQLB 3P4PA 1HG5A 4BAYB 4B3ST 2WWVA 5LG4A 2M6BA 3I0OA 2HPJA 1WR6A 4PW8A 3CK6A 2FJAA 5JRCA 4IL9A 3SWHA 3KBUA 3HKDE 3Q5EA 3LG7A 2J47A 4PFPA 4EAHA 2BG9B 2DWGA 2IAKA 3EABA 5LOVE 4MHCA 4DIDB 4QKNA 2V6YA 3EDVA 2XAGB 2RP4A 3PU8A 4AKHA 1FMWA 2BVLA 5LBQB 2BKPA 1M7KA 5HWYA 2XAQB 4YHHT 2M6IA 3NZQA 5FVKA 2YU1A 2WDQA 2LSKA 2WU5A 2ZLYA 3AAEB 3R84B 1X9BA 3AAIA 3ANWB 4WNKA 4AKIA 5AQPB 4OK0A 4JBWF 2KXPB 4GOUA 1BR1A 2XASB 2K48A 1D1BA 2VURA 4DR6T 2FJDA 2JQ9A 2WB5A 5LB7B 3FZMB 3AE1A 2VWAA 4HFIA 4EEBA 4ILBA 2ZM6T 2W2UA 2CXFA 1OXZA 2XY8B 1CHUA 2H89A 3CWZB 2UU9T 3RC8A 5H6RB 2XQ8A 4ASKA 4EEDA 2PTFA 5IHYA 5JDQA 2VQFT 3K3QC 4UF0B 4PK4A 2LKGA 2D2SA 2VL8A 2WQYA 3K3NA 5AQSB 3K8PC 1JNZA 3NVOA 3PE0A 4AQFA 5CB4E 3AEAA 1LVFA 4YT0A 3BK9A 4UF0A 2V7KA 3RI5A 5CJ5A 2KMFA 3L3PA 5HXSA 2JJ9A 3UTKA 1W09A 4JI8T 4HWCA 3C98B 3ZMZB 4DUZT 5JR9A 4EGWA 5AQQB 4TN7B 3P7IA 3GN5A 2H7OA 4ISTA 1SE7A 3LDQB 1S94A 4QH1A 3TLUA 5IWAT 4XZCA 3UULA 4HTEA 1HG2A 1XDPA 2N1GA 3AE7A 3QB5K 3UUXB 2C5JA 4AQFC 2Y48B 2XM2A 1IJ6A 4HFCA 2IW5B 3P50A 5LCYA 3SFEA 3FB2A 5DQVA 3FXDB 4HN9A 4EIWA 1MIVA 4YJ2E 2E2AA 4LMLA 4ZHQE 5LXTE 4CN4A 5AQTB 1R8IA 3N9NA 2LOPA 3PUWF 4LF5T 5HEGA 2LRLA 5JR9C 4QX8B 4AIUA 4DO0A 3O1JA 1W9RA 3QK6A 2K24A 5EZYE 2NTXA 3UU6A 3ZN0B 3JAFA 3TLSA 5C8YE 3HKEE 3T8OA 4K0UA 3UFGA 5DJQC 4A98A 2Y6XA 1QLBA 3QUJA 2KWIB 2X67A 1J5ET 4K0KT 1KNRA 3ZSSA 5GONE 5FY7A 4DV0T 3HKBE 1KEYA 4O8SA 2MYSA 3EVYA 2A9UA 3EI0A 5AQVB 3TLVA 4LFAT 2LM2A 1D0ZA 5J0ZA 4ANJA 1FEWA 2DLRA 3RC3A 1B7TA 2WMOA 1N33T 2LRKA 2CXDA 5JREA 3VKHA 2SPCA 5JH7E 2Q9QD 4AKLA 3LK3B 3UUBA 1HNZT 3PUVF 3Q2MA 3SFDA 2WDVA 4OYKA 5LGUB 4JEUB 5IYZE 3A5XA 2DCFA 4QXHB 4DR3T 3U3IA 4LF9T 4IE6A 3ONXA 2NW9A 5EK2A 4COFA 2ACXA 4ILAA 1U5PA 2Q9QB 2ES0A 3ZT5A 2UUCT 4DV7T 4HFEA 3Q5WA 1US7B 1O3XA 2YN6A 2CM0A 3AEDA 5JDLA 2UXNB 2WM9A 1KNPA 1KNZA 5HXRA 3ABVA 3PUXF 4TWHA 3AVSA 3I0QA 2XQ3A 5IUXA 2W61A 2Q9QA 4GKKT 2BS4A 4NUVA 4TV8E 4ERRA 3ZEFB 5LJMA 1S35A 2YU2A 2WCAA 3H37A 4X1IE 3LJCA 3KV9A 2JMKA 4X5TA 4Z8XA 4CXYA 2YDRA 3I1AA 3A8YC 4MBQA 2ODUA 3LFMA 4A97A 2NW8A 5AQOB 5C2TA 5HEOA 2B1EA 5ABEA 4CZZB 4KMCA 4B3RT 4GIWA 4JUYA 3EUHA 3UUMA 2UXCT 3VR8A 4CI1B 4HWIB 5KMGP 2IMLA 2V26A 3PV0F 3UU3A 2YINA 1IBKT 2L9QA 4WW0A 3GA8A 3WAJA 3SOLA 3L09A 2E8IA 3RRCA 4JI0T 2XTLA 3C50A 3MKDA 1I94T 3PURA 4O4IE 4YTNA 3MK7C 2N9DA 3LBXA 1YW0A 3ZYMA 4H9SE 5ADXL 5HYAA 3P8CD 4P0BA 2V7LA 3QB5A 2BS2A 5LNKA 4KI0F 1L0VA 2KT9A 1YD8G 3NRYA 3ZKRA 5JDGA 1MMGA 2BBJA 1YKHB 1KK7A 2WZHA 1FIOA 5HEUA 2V7MA 3KBTA 1GQEA 4GYRA 5FY1A 2HN2A 4GYSA 1MMNA 4UELA 3G06A 2H3RA 4HFVA 3N2KE 5AFUL 1IAPA 1G73A 1FJGT 5HEHA 3N9PA 4YFSA 1Y64B 5CA0E 2QRXA 1OEDE 2E5VA 4TNVA 4AQGA 3AE6A 2YK0A 2CEAA 4L9IA 2V5CA 3KV5A 2BVMA 1CUNA 1AJ3A 3UQ4A 2YKSA 2V6YB 2C5KT 5HXEA 4BJNA 1SUMB 3Q5XA 5E0OA 3AA1B 2IHR1 2X9XA 1HX8A 4WYVA 2FUPA 4KUMB 3RYHE 4JI3T 5M4YA 4JI4T 2ODVA 2K5BB 3W15B 4BA9A 3VU7H 4XBFB 4JI6T 2X9HA 2XQ7A 4U72A 1XZYA 5JDNA 3O1IA 3CMLA 2XPKA 1W0AA 2W66A 3HKCE 4TNWA 2HN1A 3KVAA 2LE8A 3JCFA 3TLWA 3DP7A 2Z6EA 1ZEEA 4QXBB 3JADA 4HGAA 2NTYA 4U7IA 2NWBA 3RIFA 1UUSA 1J5WA 1UK5A 4HWFA 2VKHA 3KINB 2JQKA 3ZPOA 4OFZA 4GK5E 1M62A 3AVRA 1I6ZA 1HFAA 2FJBA 2LHRA 2Y8DA 5FMNA 4CQIA 2CWOA 4JI2T 5HCMA 5L3FB 5AQRB 1Z8UA 3FBLA 4IE5A 1IZNB 2WDRA 4XAXB 3RF1A 2BG9E 2CRBA 1LKXA 3B5MA 4H63V 2CE7A 4EV6A 3OTOT 3UU5A 1JNRA 2BKOA 5JR9B 1D0YA 3D0TA 5FL0A 1YQ4A 2I0MA 4JI5T 3GN5B 2AE9A 3FXEB 4ILCA 2N2NA 2X0HA 3PUQA 4HKAA 1HNWT 2MBGA 4LF7T 3EDUA 4UIGA 2ZMAA 5AQJB 4O2BE 4DUYT 3B57A 3ZJ2A 2X0LB 1LRZA 3ZCJA 3RYIE 4ILUA 4PJLA 3ONLC 2EHOC 5BMVE 3AAAB 5L3GB 4CXXA 3JAEA 3OPCA 3UFEA 3C4XA 2G0UA 1YXRA 4JEHB 5FP3A 1HCIA 5HAXA 3O4XE 3AEGA 3P4RA 4ZOLE 3VHLA 4U74A 2YOEA 2W62A 4U31A 4TWDA 3QOFA 5LHHB 5FXXA 2FJEA 2W4XA 3HA4A 5AQUB 2QVAA 1UGOA 2LSJA 3C51A 3P4WA 2LOSA 5J2TE 4UVCB 4IE7A 4U3CA 4HFDA 1T7SA 1MIYA 5CGMA 5JDMA 1XMQT 4KP3C 5FL1A 4IREA 3AECA 2X9YA 5FYMA 4U33A 1WLXA 3O9XA 2HHHT 2RPAA 3RIUA 5ABFA 4I0UA 3ZMTB 2IC6A 3RYFE 1XDOA 4UR9A 5AQIB 3TLTA 4PJJA 4G2AA 1D0XA 2VVNA 1E2AA 3RIAA 5BR8T 2W00A 2UXBT 4A56A 5ETWA 3MJXA 2BKNA 3CQCB 3PUAA 3UUNA 3CX8B 2KZ7B 5JTGA 2E9XA 3P4QA 5JVDE 5KDMC 2V5DA 3UT5E 4TWFA 3AEFA 3RX6A 4QXCB 4LFCT 2WY2A 3R6NA 2LHNA 5EK4A 3T1YT 2A2FX 2NR4A 4H9RC 3RIUC 2J1DG 2RA1A 4O4LE 2HPLA 4C91A 3ZMSB 3PTRB 3ESLA 1NENA 3ZT7A 4LF6T 3VRBA 3X1DA 1KF6A 4B6XA 2JQHA 4X66T 1QUUA 4IIJE 5HXHA 1N34T 3HL6A 5JQGE 2C0SA 4X62T 3KFWX 1EZ3A 3N2OA 3SRZA 3C64A 2QYWA 1N32T 3E22E 4DV1T 5CA1E 3LK2B 2E9XC 2V7IA 3KV6A 4IE4A 4AQYT 1FMVA 4DV5T 5L3EB 3N9QA 4X20E 2XSAA 4AKGA 2OV9A 3MZKB 4JI1T 3WAKA 4PAGA 3AXJB 4FJOA 4ZI3C 4WBNE 3L8RA 3HI2A 4U7YA 1E1HB 3MA9A 4I4TE 1XWMA 2K9AA 2WMNA 1XMOT 5EK3A 5ABHA 1MNDA 5FY0A 3AXJA 2YEVC 1WYCA 5LHIB 3ZN1B 3QNUA 4IDOA 3F57A 1WFDA 4AI6A 2BS3A 3RKOA 1MMAA 2XAHB 4I50E 1VCTA 5HWXA 1ZV4X 4KX6A 4YTPA 1YKEB 3RYCE 3NZPA 2JQQA 2V7JA 4F6RC 1UX4A 4DR1T 5L3DB 4HWHA 5A1LA 3AE4A 3KV4A 4CI3B 4YSZA 2UXDT 2VASA 2MAWA 4L5GA 4GK0E 4IDNA 4ZZCA 3J7Yq 3LBXB 4OHFA 2WP9A 4YXDA 5L47A 4BJMA 3AE2A 3EHZA 5LP6E 2LT3A 1IJ5A 3IA3A 4CN6A 2VKOA 2WBLA 3ZLIA 4TUYE 3CX7B 1OEDB 1HR0T 5HEJA 3V5SA 2XUEA 2UUAT 3MACA 4DNDA 4DBQA 4LMKA 3K1SA 4KHZF 3Q5DA 2IDOB 2A3DA 2ZM8A 5FVLA 2CA5A 1OEDA 3ZC1A 1WR0A 2PJQA 3FBZA 3OBVE 4YSYA 1MMDA 4TX5A 3KDSE 2VL0A 3SS1A 2J62A
chains in the Genus database with same CATH topology
1OEDE 4HFBA 4TNVA 2BG9A 3UU3A 2BG9B 4Z91A 4IL4A 3UU6A 4COFA 4ILAA 4F8HA 3JAFA 4ZZBA 3TLSA 4NPPA 3UQ4A 2YKSA 3RI5A 4HFEA 4QH4A 3P4WA 4A98A 2XQ5A 3UU4A 2BG9E 2LKHA 2YN6A 4HFDA 2LLYA 2M6IA 2MAWA 4ZZCA 2XQ9A 4LMJA 3UU5A 3LSVA 4TWHA 2XQ3A 5L47A 5IUXA 3UU8A 5CFBA 4IREA 2KSRA 3EHZA 3ZKRA 4ILCA 2XQ7A 3RQUA 3RQWA 1OEDC 2XQAA 4QH1A 4X5TA 3EI0A 4TNWA 3TLUA 3TLVA 2LM2A 3TLTA 3EAMA 5J0ZA 4QH5A 5HEUA 2XQ6A 1OEDB 3TLWA 5HEJA 5L4EA 4HFIA 3UQ7A 2BG9C 4A97A 4ILBA 3RIAA 4Z90A 3JADA 5HEOA 5L4HA 3RIFA 4HFCA 3P50A 4LMKA 3JAEA 2XQ8A 3UUBA 5LG3A 4HFHA 3RHWA 4LMLA 1OEDA 4TWFA 2LKGA 2M6BA 5HEHA 5HCJA 5HEGA 2YOEA 4IL9A 2VL0A 4TWDA 2XQ4A 5HCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OED E;  4HFB A;  4TNV A;  2BG9 A;  3UU3 A;  2BG9 B;  4Z91 A;  4IL4 A;  3UU6 A;  4COF A;  4ILA A;  4F8H A;  3JAF A;  4ZZB A;  3TLS A;  4NPP A;  3UQ4 A;  2YKS A;  3RI5 A;  4HFE A;  4QH4 A;  3P4W A;  4A98 A;  2XQ5 A;  3UU4 A;  2BG9 E;  2LKH A;  2YN6 A;  4HFD A;  2LLY A;  2M6I A;  2MAW A;  4ZZC A;  2XQ9 A;  4LMJ A;  3UU5 A;  3LSV A;  4TWH A;  2XQ3 A;  5L47 A;  5IUX A;  3UU8 A;  5CFB A;  4IRE A;  2KSR A;  3EHZ A;  3ZKR A;  4ILC A;  2XQ7 A;  3RQU A;  3RQW A;  1OED C;  2XQA A;  4QH1 A;  4X5T A;  3EI0 A;  4TNW A;  3TLU A;  3TLV A;  2LM2 A;  3TLT A;  3EAM A;  5J0Z A;  4QH5 A;  5HEU A;  2XQ6 A;  1OED B;  3TLW A;  5HEJ A;  5L4E A;  4HFI A;  3UQ7 A;  2BG9 C;  4A97 A;  4ILB A;  3RIA A;  4Z90 A;  3JAD A;  5HEO A;  5L4H A;  3RIF A;  4HFC A;  3P50 A;  4LMK A;  3JAE A;  2XQ8 A;  3UUB A;  5LG3 A;  4HFH A;  3RHW A;  4LML A;  1OED A;  4TWF A;  2LKG A;  2M6B A;  5HEH A;  5HCJ A;  5HEG A;  2YOE A;  4IL9 A;  2VL0 A;  4TWD A;  2XQ4 A;  5HCM A; 
#chains in the Genus database with same CATH topology
 3AB3 B;  5J1G A;  4IL4 A;  2KND A;  4H9P C;  4NPP A;  2YDS A;  2J4G A;  2WZI A;  2CHN A;  1E7P A;  3PUZ F;  3N2G E;  4UXN B;  4ZS3 A;  4E7Z A;  4ZI2 C;  1D1A A;  5F8P A;  4HEA A;  2BDE A;  2R6G F;  2XAF B;  2XM1 A;  2UXX B;  3RQU A;  3JC6 D;  1OED C;  3VRA A;  3RRW A;  4YY3 T;  3ETV A;  4AXP A;  5TAO A;  1HX1 B;  3CPZ A;  4AIS A;  4PK5 A;  3GMI A;  3UQ7 A;  2VQE T;  4Z90 A;  2BBH A;  5FKY A;  1BR4 A;  2EHO D;  1IBL T;  4I55 E;  5AQF B;  2CHO A;  3FZH B;  3PJA A;  1XNR T;  4NUU A;  4UEM A;  3OVU A;  3H3M A;  3RHW A;  5ABG A;  5J2U E;  4DMW A;  2CLY B;  3IF8 B;  2XJ7 A;  4IGU A;  4B3T T;  4N78 D;  5LJN A;  2BG9 A;  2H7V C;  2KWH A;  2XZE A;  2WWU A;  3O1H A;  3E08 A;  4F8H A;  2EHO B;  3C4W A;  1HTJ F;  3VR9 A;  5FXW A;  4DMV A;  1X79 A;  3Q9D A;  4EOZ B;  4YLH A;  4QH4 A;  3OKQ A;  2PFV A;  1N36 T;  2D9D A;  3AEE A;  2A72 A;  3HR0 A;  5KXJ A;  4EB6 E;  4EXT A;  2VVS A;  4UVA B;  1UCU A;  2IUB A;  2EHO A;  3UU8 A;  1V9D A;  4ISS A;  3ANW A;  1NWM X;  1VOM A;  2KSR A;  2X0Y A;  3IHR A;  3RQW A;  2VKD A;  3M3Z B;  4P0A A;  3RGL A;  5L3B B;  2NOX A;  4NXM T;  5AQG B;  4DBR A;  3LK4 2;  3NKZ A;  5JDF A;  3ETU A;  3TKL B;  5LGT B;  4KBM B;  3AE8 A;  5C3J A;  2BG9 C;  4EYY R;  4O2A E;  5FXZ A;  3JC6 C;  2HH7 A;  2F4V T;  3MXZ A;  5L2L A;  4Q25 A;  2X51 A;  2CLY C;  4FI5 A;  3I9W A;  2CMR A;  2MTQ A;  3AA6 B;  2XHE B;  2E5L T;  1VRB A;  5HCJ A;  3N9L A;  1D1C A;  3B13 A;  2NP9 A;  4YSX A;  4TV9 E;  4HFB A;  4B3M T;  5HXC A;  1Z0P A;  4Z91 A;  5FXV A;  2JIW A;  2V6X A;  3CKD A;  2W67 A;  4DR5 T;  2QA7 A;  3NWI A;  4M1P A;  3UU4 A;  3F2E A;  4IDQ A;  1OWA A;  3PJA J;  3ZMV B;  2CXL A;  2W63 A;  4U2Y A;  4EZ4 A;  4PJN A;  4E7S A;  4QHO A;  5F5W A;  4X65 T;  2K3W A;  3AA0 B;  4X64 T;  1DU2 A;  1G8X A;  2C5I T;  3NRX A;  1Y01 A;  5AQN B;  3DTO A;  3N5L A;  2E9X D;  1NAF A;  2CBJ A;  2VKJ A;  2ACZ A;  2IIU A;  5DQW A;  5ABF B;  4A5X A;  3EAM A;  1H7C A;  4QH5 A;  4ZI3 D;  3CQX C;  5H6Q B;  4ZXL A;  3CQG B;  5L4E A;  5LMU T;  2DHR A;  4IT4 A;  5AQH B;  3ZC0 A;  2L8K A;  3OYZ A;  3E0Z A;  4DR4 T;  5LG3 A;  3AE5 A;  4HFH A;  4JV5 T;  4HE8 A;  2E9X B;  4IHJ E;  2H88 A;  5AQM B;  2LEH A;  1J1J A;  5LA6 E;  2P9B A;  3QC9 A;  2LJL A;  2GK9 A;  4YTM A;  4QWN B;  1SHZ C;  5FNV E;  3H3A A;  5LHG B;  4NIQ A;  2LM9 A;  1ZHC A;  4MAL A;  1T8B A;  3PU3 A;  2V1D B;  3ZMU B;  3ZYL A;  3AE3 A;  4P1N A;  1QSD A;  5KX5 E;  2LKH A;  5LGN B;  3S4U A;  2MPK A;  4I43 B;  2OA5 A;  3FZL B;  4LMJ A;  5AQK B;  4WZX A;  3LSV A;  3RKG A;  3WI3 A;  4O4H E;  4YJ3 E;  5CFB A;  5LMN T;  2D5U A;  4OX9 T;  2XQA A;  1T98 A;  3A7M A;  4EZH A;  2XQY A;  3BQL A;  1SA0 E;  1XNQ T;  2PBI A;  2YDQ A;  1HF8 A;  2WU2 A;  2XSB A;  3N9O A;  4C90 A;  1W0B A;  3FZF B;  3ZCI A;  4MFR A;  3ONJ A;  4EYU A;  2VB6 A;  1MIW A;  3DJB A;  2PG8 A;  5LYJ E;  4DV3 T;  3OJA A;  2CWY A;  1HS7 A;  4H9N C;  4PNI A;  3PUG A;  3V5U A;  2X66 A;  2I6H A;  3T1H T;  4IE0 A;  3ZYK A;  3ZJ1 A;  4MLK A;  2WAU A;  3PUY F;  4DV2 T;  2OLT A;  3L39 A;  3BQI A;  4DV4 T;  5F3J A;  3RLF F;  3CX6 B;  4X1K E;  4H63 H;  4J2C A;  4ZEY A;  3KVB A;  1ZP0 A;  4ZZB A;  3RPU A;  2X68 A;  4LF8 T;  3AE9 A;  1U4Q A;  2KIN B;  2XAJ B;  3I9Y A;  1BR0 A;  3K3O A;  2XQ9 A;  4LF4 T;  4UVB B;  5DAB A;  4ZI2 D;  2NW7 A;  4LFB T;  4HWD A;  4CI2 B;  2DI4 A;  4DR7 T;  4PK6 A;  4ZS2 A;  3AA7 B;  2DL1 A;  2I59 A;  1KFY A;  4G63 A;  4WBO A;  4V1A v;  1WYB A;  5LBM A;  4JYA T;  4UV9 B;  3IEE A;  4DR2 T;  1ZOY A;  4YHJ A;  4PJM A;  3RH3 A;  4H9O C;  2MOZ A;  1MNE A;  5L3C B;  2XQ6 A;  3N9M A;  4IDZ A;  2CCQ A;  2V8S V;  3AEB A;  1T72 A;  3J9X 1;  2WSS V;  2LSG A;  1LVK A;  4TZ4 C;  2Q9Q C;  3BQK A;  1WCR A;  2X9W A;  4NXN T;  3FHN A;  4U2Z A;  2L3L A;  3PDY A;  4ADZ A;  2DNX A;  2AXD S;  1UX5 A;  4X1Y E;  4GKJ T;  2VK9 A;  4DVD A;  2M67 A;  2ZM0 A;  2DWK A;  2XQ4 A;  1HNX T;  4JLE A;  3CVR A;  2LSY A;  4P09 A;  1YQ3 A;  2W0G A;  2BZB A;  1VCS A;  3M65 A;  4AKR B;  2D0U A;  3GWH A;  4QX7 B;  3ZST A;  2XQ5 A;  3IBP A;  2D0T A;  2LSI A;  4IDP A;  3ZT6 A;  4OYJ A;  2LLY A;  2CPT A;  1NEK A;  1WRD A;  3C4Z A;  2WS3 A;  2ZM2 A;  4KHP T;  1ZKE A;  3P4S A;  3PUS A;  2B76 A;  4H9Q C;  1IBM T;  2UUB T;  4PFO A;  4DV6 T;  4UV8 B;  2KLQ A;  3U78 A;  4JI7 T;  4CN1 A;  3VKG A;  2JMH A;  2JRK A;  2CBI A;  2JPF A;  3F31 A;  3OYX A;  5JRC B;  4CXW A;  5L4H A;  1UUR A;  3FZK B;  2IC9 A;  4ZI7 E;  5JDH A;  3NBX X;  4O4J E;  4L0R A;  1BR2 A;  2FBW A;  3CIR A;  2QGS A;  5AQL B;  3P4P A;  1HG5 A;  4BAY B;  4B3S T;  2WWV A;  5LG4 A;  2M6B A;  3I0O A;  2HPJ A;  1WR6 A;  4PW8 A;  3CK6 A;  2FJA A;  5JRC A;  4IL9 A;  3SWH A;  3KBU A;  3HKD E;  3Q5E A;  3LG7 A;  2J47 A;  4PFP A;  4EAH A;  2BG9 B;  2DWG A;  2IAK A;  3EAB A;  5LOV E;  4MHC A;  4DID B;  4QKN A;  2V6Y A;  3EDV A;  2XAG B;  2RP4 A;  3PU8 A;  4AKH A;  1FMW A;  2BVL A;  5LBQ B;  2BKP A;  1M7K A;  5HWY A;  2XAQ B;  4YHH T;  2M6I A;  3NZQ A;  5FVK A;  2YU1 A;  2WDQ A;  2LSK A;  2WU5 A;  2ZLY A;  3AAE B;  3R84 B;  1X9B A;  3AAI A;  3ANW B;  4WNK A;  4AKI A;  5AQP B;  4OK0 A;  4JBW F;  2KXP B;  4GOU A;  1BR1 A;  2XAS B;  2K48 A;  1D1B A;  2VUR A;  4DR6 T;  2FJD A;  2JQ9 A;  2WB5 A;  5LB7 B;  3FZM B;  3AE1 A;  2VWA A;  4HFI A;  4EEB A;  4ILB A;  2ZM6 T;  2W2U A;  2CXF A;  1OXZ A;  2XY8 B;  1CHU A;  2H89 A;  3CWZ B;  2UU9 T;  3RC8 A;  5H6R B;  2XQ8 A;  4ASK A;  4EED A;  2PTF A;  5IHY A;  5JDQ A;  2VQF T;  3K3Q C;  4UF0 B;  4PK4 A;  2LKG A;  2D2S A;  2VL8 A;  2WQY A;  3K3N A;  5AQS B;  3K8P C;  1JNZ A;  3NVO A;  3PE0 A;  4AQF A;  5CB4 E;  3AEA A;  1LVF A;  4YT0 A;  3BK9 A;  4UF0 A;  2V7K A;  3RI5 A;  5CJ5 A;  2KMF A;  3L3P A;  5HXS A;  2JJ9 A;  3UTK A;  1W09 A;  4JI8 T;  4HWC A;  3C98 B;  3ZMZ B;  4DUZ T;  5JR9 A;  4EGW A;  5AQQ B;  4TN7 B;  3P7I A;  3GN5 A;  2H7O A;  4IST A;  1SE7 A;  3LDQ B;  1S94 A;  4QH1 A;  3TLU A;  5IWA T;  4XZC A;  3UUL A;  4HTE A;  1HG2 A;  1XDP A;  2N1G A;  3AE7 A;  3QB5 K;  3UUX B;  2C5J A;  4AQF C;  2Y48 B;  2XM2 A;  1IJ6 A;  4HFC A;  2IW5 B;  3P50 A;  5LCY A;  3SFE A;  3FB2 A;  5DQV A;  3FXD B;  4HN9 A;  4EIW A;  1MIV A;  4YJ2 E;  2E2A A;  4LML A;  4ZHQ E;  5LXT E;  4CN4 A;  5AQT B;  1R8I A;  3N9N A;  2LOP A;  3PUW F;  4LF5 T;  5HEG A;  2LRL A;  5JR9 C;  4QX8 B;  4AIU A;  4DO0 A;  3O1J A;  1W9R A;  3QK6 A;  2K24 A;  5EZY E;  2NTX A;  3UU6 A;  3ZN0 B;  3JAF A;  3TLS A;  5C8Y E;  3HKE E;  3T8O A;  4K0U A;  3UFG A;  5DJQ C;  4A98 A;  2Y6X A;  1QLB A;  3QUJ A;  2KWI B;  2X67 A;  1J5E T;  4K0K T;  1KNR A;  3ZSS A;  5GON E;  5FY7 A;  4DV0 T;  3HKB E;  1KEY A;  4O8S A;  2MYS A;  3EVY A;  2A9U A;  3EI0 A;  5AQV B;  3TLV A;  4LFA T;  2LM2 A;  1D0Z A;  5J0Z A;  4ANJ A;  1FEW A;  2DLR A;  3RC3 A;  1B7T A;  2WMO A;  1N33 T;  2LRK A;  2CXD A;  5JRE A;  3VKH A;  2SPC A;  5JH7 E;  2Q9Q D;  4AKL A;  3LK3 B;  3UUB A;  1HNZ T;  3PUV F;  3Q2M A;  3SFD A;  2WDV A;  4OYK A;  5LGU B;  4JEU B;  5IYZ E;  3A5X A;  2DCF A;  4QXH B;  4DR3 T;  3U3I A;  4LF9 T;  4IE6 A;  3ONX A;  2NW9 A;  5EK2 A;  4COF A;  2ACX A;  4ILA A;  1U5P A;  2Q9Q B;  2ES0 A;  3ZT5 A;  2UUC T;  4DV7 T;  4HFE A;  3Q5W A;  1US7 B;  1O3X A;  2YN6 A;  2CM0 A;  3AED A;  5JDL A;  2UXN B;  2WM9 A;  1KNP A;  1KNZ A;  5HXR A;  3ABV A;  3PUX F;  4TWH A;  3AVS A;  3I0Q A;  2XQ3 A;  5IUX A;  2W61 A;  2Q9Q A;  4GKK T;  2BS4 A;  4NUV A;  4TV8 E;  4ERR A;  3ZEF B;  5LJM A;  1S35 A;  2YU2 A;  2WCA A;  3H37 A;  4X1I E;  3LJC A;  3KV9 A;  2JMK A;  4X5T A;  4Z8X A;  4CXY A;  2YDR A;  3I1A A;  3A8Y C;  4MBQ A;  2ODU A;  3LFM A;  4A97 A;  2NW8 A;  5AQO B;  5C2T A;  5HEO A;  2B1E A;  5ABE A;  4CZZ B;  4KMC A;  4B3R T;  4GIW A;  4JUY A;  3EUH A;  3UUM A;  2UXC T;  3VR8 A;  4CI1 B;  4HWI B;  5KMG P;  2IML A;  2V26 A;  3PV0 F;  3UU3 A;  2YIN A;  1IBK T;  2L9Q A;  4WW0 A;  3GA8 A;  3WAJ A;  3SOL A;  3L09 A;  2E8I A;  3RRC A;  4JI0 T;  2XTL A;  3C50 A;  3MKD A;  1I94 T;  3PUR A;  4O4I E;  4YTN A;  3MK7 C;  2N9D A;  3LBX A;  1YW0 A;  3ZYM A;  4H9S E;  5ADX L;  5HYA A;  3P8C D;  4P0B A;  2V7L A;  3QB5 A;  2BS2 A;  5LNK A;  4KI0 F;  1L0V A;  2KT9 A;  1YD8 G;  3NRY A;  3ZKR A;  5JDG A;  1MMG A;  2BBJ A;  1YKH B;  1KK7 A;  2WZH A;  1FIO A;  5HEU A;  2V7M A;  3KBT A;  1GQE A;  4GYR A;  5FY1 A;  2HN2 A;  4GYS A;  1MMN A;  4UEL A;  3G06 A;  2H3R A;  4HFV A;  3N2K E;  5AFU L;  1IAP A;  1G73 A;  1FJG T;  5HEH A;  3N9P A;  4YFS A;  1Y64 B;  5CA0 E;  2QRX A;  1OED E;  2E5V A;  4TNV A;  4AQG A;  3AE6 A;  2YK0 A;  2CEA A;  4L9I A;  2V5C A;  3KV5 A;  2BVM A;  1CUN A;  1AJ3 A;  3UQ4 A;  2YKS A;  2V6Y B;  2C5K T;  5HXE A;  4BJN A;  1SUM B;  3Q5X A;  5E0O A;  3AA1 B;  2IHR 1;  2X9X A;  1HX8 A;  4WYV A;  2FUP A;  4KUM B;  3RYH E;  4JI3 T;  5M4Y A;  4JI4 T;  2ODV A;  2K5B B;  3W15 B;  4BA9 A;  3VU7 H;  4XBF B;  4JI6 T;  2X9H A;  2XQ7 A;  4U72 A;  1XZY A;  5JDN A;  3O1I A;  3CML A;  2XPK A;  1W0A A;  2W66 A;  3HKC E;  4TNW A;  2HN1 A;  3KVA A;  2LE8 A;  3JCF A;  3TLW A;  3DP7 A;  2Z6E A;  1ZEE A;  4QXB B;  3JAD A;  4HGA A;  2NTY A;  4U7I A;  2NWB A;  3RIF A;  1UUS A;  1J5W A;  1UK5 A;  4HWF A;  2VKH A;  3KIN B;  2JQK A;  3ZPO A;  4OFZ A;  4GK5 E;  1M62 A;  3AVR A;  1I6Z A;  1HFA A;  2FJB A;  2LHR A;  2Y8D A;  5FMN A;  4CQI A;  2CWO A;  4JI2 T;  5HCM A;  5L3F B;  5AQR B;  1Z8U A;  3FBL A;  4IE5 A;  1IZN B;  2WDR A;  4XAX B;  3RF1 A;  2BG9 E;  2CRB A;  1LKX A;  3B5M A;  4H63 V;  2CE7 A;  4EV6 A;  3OTO T;  3UU5 A;  1JNR A;  2BKO A;  5JR9 B;  1D0Y A;  3D0T A;  5FL0 A;  1YQ4 A;  2I0M A;  4JI5 T;  3GN5 B;  2AE9 A;  3FXE B;  4ILC A;  2N2N A;  2X0H A;  3PUQ A;  4HKA A;  1HNW T;  2MBG A;  4LF7 T;  3EDU A;  4UIG A;  2ZMA A;  5AQJ B;  4O2B E;  4DUY T;  3B57 A;  3ZJ2 A;  2X0L B;  1LRZ A;  3ZCJ A;  3RYI E;  4ILU A;  4PJL A;  3ONL C;  2EHO C;  5BMV E;  3AAA B;  5L3G B;  4CXX A;  3JAE A;  3OPC A;  3UFE A;  3C4X A;  2G0U A;  1YXR A;  4JEH B;  5FP3 A;  1HCI A;  5HAX A;  3O4X E;  3AEG A;  3P4R A;  4ZOL E;  3VHL A;  4U74 A;  2YOE A;  2W62 A;  4U31 A;  4TWD A;  3QOF A;  5LHH B;  5FXX A;  2FJE A;  2W4X A;  3HA4 A;  5AQU B;  2QVA A;  1UGO A;  2LSJ A;  3C51 A;  3P4W A;  2LOS A;  5J2T E;  4UVC B;  4IE7 A;  4U3C A;  4HFD A;  1T7S A;  1MIY A;  5CGM A;  5JDM A;  1XMQ T;  4KP3 C;  5FL1 A;  4IRE A;  3AEC A;  2X9Y A;  5FYM A;  4U33 A;  1WLX A;  3O9X A;  2HHH T;  2RPA A;  3RIU A;  5ABF A;  4I0U A;  3ZMT B;  2IC6 A;  3RYF E;  1XDO A;  4UR9 A;  5AQI B;  3TLT A;  4PJJ A;  4G2A A;  1D0X A;  2VVN A;  1E2A A;  3RIA A;  5BR8 T;  2W00 A;  2UXB T;  4A56 A;  5ETW A;  3MJX A;  2BKN A;  3CQC B;  3PUA A;  3UUN A;  3CX8 B;  2KZ7 B;  5JTG A;  2E9X A;  3P4Q A;  5JVD E;  5KDM C;  2V5D A;  3UT5 E;  4TWF A;  3AEF A;  3RX6 A;  4QXC B;  4LFC T;  2WY2 A;  3R6N A;  2LHN A;  5EK4 A;  3T1Y T;  2A2F X;  2NR4 A;  4H9R C;  3RIU C;  2J1D G;  2RA1 A;  4O4L E;  2HPL A;  4C91 A;  3ZMS B;  3PTR B;  3ESL A;  1NEN A;  3ZT7 A;  4LF6 T;  3VRB A;  3X1D A;  1KF6 A;  4B6X A;  2JQH A;  4X66 T;  1QUU A;  4IIJ E;  5HXH A;  1N34 T;  3HL6 A;  5JQG E;  2C0S A;  4X62 T;  3KFW X;  1EZ3 A;  3N2O A;  3SRZ A;  3C64 A;  2QYW A;  1N32 T;  3E22 E;  4DV1 T;  5CA1 E;  3LK2 B;  2E9X C;  2V7I A;  3KV6 A;  4IE4 A;  4AQY T;  1FMV A;  4DV5 T;  5L3E B;  3N9Q A;  4X20 E;  2XSA A;  4AKG A;  2OV9 A;  3MZK B;  4JI1 T;  3WAK A;  4PAG A;  3AXJ B;  4FJO A;  4ZI3 C;  4WBN E;  3L8R A;  3HI2 A;  4U7Y A;  1E1H B;  3MA9 A;  4I4T E;  1XWM A;  2K9A A;  2WMN A;  1XMO T;  5EK3 A;  5ABH A;  1MND A;  5FY0 A;  3AXJ A;  2YEV C;  1WYC A;  5LHI B;  3ZN1 B;  3QNU A;  4IDO A;  3F57 A;  1WFD A;  4AI6 A;  2BS3 A;  3RKO A;  1MMA A;  2XAH B;  4I50 E;  1VCT A;  5HWX A;  1ZV4 X;  4KX6 A;  4YTP A;  1YKE B;  3RYC E;  3NZP A;  2JQQ A;  2V7J A;  4F6R C;  1UX4 A;  4DR1 T;  5L3D B;  4HWH A;  5A1L A;  3AE4 A;  3KV4 A;  4CI3 B;  4YSZ A;  2UXD T;  2VAS A;  2MAW A;  4L5G A;  4GK0 E;  4IDN A;  4ZZC A;  3J7Y q;  3LBX B;  4OHF A;  2WP9 A;  4YXD A;  5L47 A;  4BJM A;  3AE2 A;  3EHZ A;  5LP6 E;  2LT3 A;  1IJ5 A;  3IA3 A;  4CN6 A;  2VKO A;  2WBL A;  3ZLI A;  4TUY E;  3CX7 B;  1OED B;  1HR0 T;  5HEJ A;  3V5S A;  2XUE A;  2UUA T;  3MAC A;  4DND A;  4DBQ A;  4LMK A;  3K1S A;  4KHZ F;  3Q5D A;  2IDO B;  2A3D A;  2ZM8 A;  5FVL A;  2CA5 A;  1OED A;  3ZC1 A;  1WR0 A;  2PJQ A;  3FBZ A;  3OBV E;  4YSY A;  1MMD A;  4TX5 A;  3KDS E;  2VL0 A;  3SS1 A;  2J62 A; 
#chains in the Genus database with same CATH homology
 1OED E;  4HFB A;  4TNV A;  2BG9 A;  3UU3 A;  2BG9 B;  4Z91 A;  4IL4 A;  3UU6 A;  4COF A;  4ILA A;  4F8H A;  3JAF A;  4ZZB A;  3TLS A;  4NPP A;  3UQ4 A;  2YKS A;  3RI5 A;  4HFE A;  4QH4 A;  3P4W A;  4A98 A;  2XQ5 A;  3UU4 A;  2BG9 E;  2LKH A;  2YN6 A;  4HFD A;  2LLY A;  2M6I A;  2MAW A;  4ZZC A;  2XQ9 A;  4LMJ A;  3UU5 A;  3LSV A;  4TWH A;  2XQ3 A;  5L47 A;  5IUX A;  3UU8 A;  5CFB A;  4IRE A;  2KSR A;  3EHZ A;  3ZKR A;  4ILC A;  2XQ7 A;  3RQU A;  3RQW A;  1OED C;  2XQA A;  4QH1 A;  4X5T A;  3EI0 A;  4TNW A;  3TLU A;  3TLV A;  2LM2 A;  3TLT A;  3EAM A;  5J0Z A;  4QH5 A;  5HEU A;  2XQ6 A;  1OED B;  3TLW A;  5HEJ A;  5L4E A;  4HFI A;  3UQ7 A;  2BG9 C;  4A97 A;  4ILB A;  3RIA A;  4Z90 A;  3JAD A;  5HEO A;  5L4H A;  3RIF A;  4HFC A;  3P50 A;  4LMK A;  3JAE A;  2XQ8 A;  3UUB A;  5LG3 A;  4HFH A;  3RHW A;  4LML A;  1OED A;  4TWF A;  2LKG A;  2M6B A;  5HEH A;  5HCJ A;  5HEG A;  2YOE A;  4IL9 A;  2VL0 A;  4TWD A;  2XQ4 A;  5HCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...