4JI4T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 33
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4ji4T00
4JI1T 4DUYT 4B3TT 5IWAT 2UXCT 1N36T 2F4VT 3T1YT 4LF5T 4JV5T 5LMUT 4LFCT 1HNZT 2UU9T 4DR5T 4B3RT 1XMOT 4DR6T 3OTOT 4NXNT 4DV0T 4OX9T 4DR2T 1N33T 2VQFT 4JI5T 4X62T 4LF7T 1N32T 4DV3T 4DR4T 2UXDT 4JI8T 4LF4T 2VQET 4X65T 2E5LT 4JI2T 1HR0T 4DR1T 1FJGT 4X64T 4DV4T 4X66T 4NXMT 1HNXT 4DUZT 4DR7T 1J5ET 1XNQT 4KHPT 4AQYT 4LFAT 1I94T 1N34T 4GKKT 4JYAT 2UXBT 4JI4T 5LMNT 4LF8T 2ZM6T 2HHHT 1HNWT 4JI3T 4JI6T 5BR8T 2UUCT 4YHHT 4DV6T 1XMQT 4YY3T 1IBLT 4LF6T 4LF9T 3T1HT 4JI7T 4B3ST 1IBKT 4K0KT 4DR3T 4GKJT 1IBMT 1XNRT 4DV1T 4JI0T 4DV5T 4LFBT 4DV7T 2UUBT 4B3MT 4DV2T 2UUAT
chains in the Genus database with same CATH superfamily
4JI1T 4ZXLA 2VB6A 2LT3A 1T7SA 3O4XE 2X51A 3BQIA 4EEBA 3CX7B 4AQFC 4MLKA 2IUBA 3L8RA 5LBQB 2UU9T 3FBLA 4HFHA 3KDSE 5FVLA 4DV0T 4YFSA 3RH3A 1XDPA 1X9BA 3H3MA 2FBWA 2NR4A 2XAHB 2SPCA 4F6RC 3I9YA 3NVOA 4IDZA 4AKRB 2I0MA 4YJ2E 3RIUA 4DR7T 2OA5A 3ZT7A 3ZYKA 4ISSA 3GWHA 2D9DA 4O4HE 4CXYA 2KWHA 1D0YA 3WAKA 2IW5B 5LMNT 1FMWA 2X68A 3I1AA 2K5BB 3OYZA 2EHOB 1YQ4A 2MOZA 3ZYLA 2G0UA 2AXDS 5L3GB 4LF6T 3FXEB 3K3NA 2MYSA 1BR4A 5AQSB 4QWNB 1OEDE 3ZSSA 2ZM0A 3PJAJ 3GMIA 1IBMT 3EVYA 4UR9A 2KSRA 4KMCA 5JDFA 3FHNA 3BK9A 4H9RC 4UXNB 3K3QC 4EZHA 1WYCA 4QHOA 2XUEA 3H3AA 3KBUA 4AKLA 3VR8A 3O1HA 1E2AA 3RQWA 2BZBA 3OYXA 5ABEA 5HXSA 1QSDA 4LMJA 3CVRA 4P0BA 2V7IA 2BS3A 5FY0A 5AQNB 3AA6B 4OX9T 1OWAA 2M6BA 2VQFT 3HL6A 2BS4A 5LBMA 3ZMSB 3CQXC 1KFYA 3LK2B 2D5UA 4TNVA 3ZSTA 4L5GA 2LKGA 3N9MA 2LKHA 3KVBA 4PK5A 4X20E 2NW8A 4UVAB 1HX1B 4YLHA 4A97A 1V9DA 3W15B 2L8KA 2LSJA 3L39A 1JNRA 4DBRA 2RA1A 4O2AE 2BG9C 2RPAA 4ZS2A 2XQ3A 5FVKA 1SE7A 2IDOB 3MACA 2MBGA 1HCIA 2PJQA 1W9RA 2LHNA 1IBKT 1KEYA 4X1YE 2X0LB 2NW9A 4PW8A 5LGTB 3A7MA 3FB2A 2LRLA 4DV7T 2FUPA 1S35A 3P4WA 2UXCT 3P8CD 5ETWA 3K8PC 4E7ZA 4J2CA 2J47A 2MTQA 4ZI2C 2WAUA 2CEAA 3PUWF 2LRKA 4O4IE 1OXZA 2DI4A 4O8SA 3RIFA 3C4ZA 2E2AA 3Q5WA 1MIWA 4PJNA 5CGMA 2ZLYA 4QH1A 4QH5A 3WAJA 2XJ7A 5ADXL 1XZYA 5FL0A 3EABA 4DUZT 4KX6A 5ABHA 3UUXB 2L3LA 3ZJ1A 2BVMA 4M1PA 2CXDA 2KNDA 1IJ6A 3HR0A 2V6XA 4UV8B 1D1CA 2WZHA 3RIAA 2BG9B 2LOPA 2DWGA 3RGLA 5HWXA 3IHRA 1T98A 1CUNA 3JADA 4EXTA 3FZLB 4TN7B 2LLYA 2UXNB 2ZM8A 4KI0F 4K0KT 5LHGB 5AQVB 4UELA 4MBQA 3JAEA 2Y8DA 1ZEEA 4P09A 3UT5E 3UU5A 3UQ4A 4X1IE 4U74A 1D0XA 2LOSA 3IBPA 2MPKA 2QRXA 4IE4A 3AA1B 4IE0A 3TLSA 2WWUA 3RQUA 5JR9C 2VKOA 5LB7B 2BG9E 4IE6A 2UXDT 3LFMA 4AKHA 3N2GE 2VQET 2E5LT 4G63A 5AQMB 1M7KA 4CN6A 2VKHA 1L0VA 3RYFE 4DVDA 3MZKB 5CB4E 1YKHB 2KXPB 4ZI3D 1UX4A 5LG3A 1I94T 1UCUA 2CA5A 1UGOA 4PJMA 4GKKT 2YN6A 5H6RB 4WBNE 3J9X1 4HWFA 3LBXB 2WBLA 4EIWA 4O4JE 3ZMUB 4PFPA 5IYZE 2XQ6A 3ZN0B 4BJMA 4YHHT 5L3CB 4TWHA 4G2AA 1SUMB 2K3WA 2V26A 4PFOA 3L09A 4NIQA 3C51A 2LSGA 1KNRA 2OV9A 3T1YT 4GIWA 4ILCA 3KVAA 3GA8A 3HKCE 4TNWA 3QNUA 2LJLA 2V6YA 3ESLA 4C90A 2E9XC 3EDVA 3E22E 3TLUA 2YKSA 5JR9B 3HI2A 3VRAA 3I0QA 2X67A 1H7CA 1WFDA 3AE7A 4LMLA 3Q9DA 2XQYA 4QX7B 3ZLIA 4EYYR 4F8HA 3IF8B 3NWIA 2HH7A 2K9AA 1OEDC 3KV9A 3N9OA 3N5LA 1LVFA 4YTMA 5J2UE 3O9XA 2WDQA 3PUVF 3TKLB 4CI1B 5FMNA 3CPZA 4I55E 2CCQA 3ZT5A 3PDYA 4H9OC 4EOZB 1WR0A 2CRBA 4MFRA 5HEOA 3N9LA 4ISTA 4PJJA 2Q9QD 4TWFA 3RYCE 4IT4A 1WRDA 1IZNB 4O4LE 4CXXA 4TWDA 4ZHQE 2WMOA 2WDRA 4PJLA 1MIVA 3UFGA 4LF5T 1O3XA 2YINA 4HFBA 4ADZA 2C0SA 1HF8A 3P4SA 4GK5E 2AE9A 3AECA 1HS7A 4GYSA 2E9XB 5KMGP 3CIRA 4K0UA 4JI5T 3KBTA 5LGNB 5E0OA 2B1EA 5JH7E 2X0HA 1LRZA 4EGWA 2H89A 3P4RA 5EK2A 3ZT6A 3CQCB 5DQWA 3NRYA 3QK6A 3GN5B 5FXVA 3RRWA 2YDSA 4X5TA 3AAIA 1J5ET 2IMLA 3ABVA 5LGUB 4XBFB 1OEDB 2XASB 3PU8A 4KP3C 3AEEA 3C4WA 3N2OA 1NWMX 4LF8T 3RF1A 1D1BA 4GYRA 3QB5K 3AA0B 1IAPA 3JC6C 2W62A 4DNDA 2DNXA 5EZYE 4YY3T 1Z8UA 5C3JA 4BAYB 2CBIA 3N2KE 3AE3A 3PV0F 2J62A 2VK9A 3PUAA 5DABA 4ZOLE 4DV5T 2XHEB 1VOMA 5IHYA 4A98A 1LKXA 1HG2A 5LMUT 3H37A 2XQ4A 2CLYC 1B7TA 5M4YA 4DR5T 4B3RT 3OTOT 4QXHB 3RI5A 4Z90A 4DR2T 1G8XA 1WR6A 5JDGA 3K3OA 2BS2A 3EAMA 3KV5A 4HWIB 5JRCB 1FMVA 2DL1A 2NWBA 3UU8A 4DR1T 1Y01A 4CN1A 4FI5A 3SOLA 3QB5A 5FKYA 2WQYA 5HXEA 4L9IA 1YD8G 1XNQT 2LSKA 4AXPA 4FJOA 1HG5A 3PUGA 4XAXB 5KXJA 5HEHA 2E9XD 2RP4A 4CXWA 2ZM6T 2C5KT 1HNWT 2CWOA 1R8IA 4U72A 4YHJA 4P0AA 2K48A 4IE5A 4P1NA 1HX8A 2YDRA 2PG8A 5TAOA 4DMWA 2HPLA 1MMDA 5AQFB 3AE4A 4GK0E 2XY8B 1YKEB 5HAXA 1UURA 3SFEA 4PAGA 4HEAA 3B13A 2F4VT 3NKZA 3PE0A 4V1Av 4CQIA 3N9NA 2CLYB 4QXCB 2J4GA 2V5DA 2V8SV 3PUQA 3UU4A 2H7OA 2WWVA 2WZIA 5JDMA 3KV6A 2CHNA 1BR0A 1ZHCA 2W67A 4KUMB 2XQ9A 5AQRB 3AE5A 2EHOD 4MALA 4U7YA 2H3RA 2BBHA 4NXMT 2A3DA 3DP7A 2D0TA 3IA3A 3CX6B 1QUUA 4LFAT 5JREA 4H9NC 2CHOA 5LHHB 2R6GF 3A5XA 2EHOA 1ZOYA 3P7IA 3UUBA 2YU2A 3K1SA 3NBXX 2ODUA 2VKDA 2MAWA 3PUZF 4DV6T 5HCMA 3IEEA 2ZM2A 3AEDA 1NENA 3ANWB 2CXFA 5FNVE 4UV9B 4DR3T 2YEVC 3DTOA 2KZ7B 3CKDA 3B57A 1E1HB 3UULA 2Z6EA 1US7B 3UFEA 2VL8A 4AQFA 2XAJB 2BKPA 1XDOA 3ONLC 4Q25A 5L3BB 1FEWA 4UVBB 3A8YC 1G73A 3JC6D 1D0ZA 2IHR1 3MKDA 5LOVE 5LCYA 4I50E 4YTNA 3SRZA 5ABFB 2PTFA 5BMVE 4LF4T 1MMAA 4BJNA 4X65T 3AA7B 3RIUC 3V5SA 5DQVA 1VCTA 2X66A 5FXXA 2KINB 1ZV4X 1KK7A 2NTXA 2WU5A 4QKNA 3RHWA 5J2TE 5L3EB 3LDQB 5L3FB 1SHZC 4KHZF 3G06A 3ZPOA 4UF0B 3RPUA 2BBJA 1NAFA 4IIJE 2BKNA 1YW0A 2HHHT 4ERRA 4EEDA 2JPFA 2KWIB 5BR8T 2DLRA 2UUCT 1ZKEA 2IC9A 2XAGB 1BR2A 4ZZCA 5LJMA 3Q5XA 5HWYA 5FXWA 3NZPA 3KINB 4PK6A 3F2EA 3AB3B 3AXJA 1T8BA 3HKBE 1VRBA 4NUVA 3EI0A 2L9QA 3DJBA 4JEUB 4WW0A 5LHIB 1W09A 3PTRB 3AEBA 4U33A 5FL1A 4U2YA 4ILBA 2HPJA 3RKOA 4NXNT 5LA6E 3P4QA 4AIUA 3ZJ2A 5H6QB 3PJAA 3ONXA 3KFWX 3CQGB 5JDHA 4JI8T 1HR0T 4UIGA 2CMRA 4X66T 3RKGA 5CFBA 2W00A 1MMGA 5F3JA 4O2BE 3JCFA 4NUUA 2M6IA 2WDVA 2BVLA 4JI4T 4EB6E 3ZC0A 2LHRA 2BG9A 5GONE 4H9QC 2HN1A 4JI6T 3SWHA 3AE8A 5J1GA 3OPCA 3RLFF 4ILUA 1EZ3A 3T1HT 2NW7A 3OKQA 2FJDA 2K24A 4ZI2D 2CBJA 3R84B 3LJCA 3U78A 1U4QA 4TZ4C 2LE8A 2NOXA 4B3MT 5L4EA 2VVSA 5CA1E 2WY2A 4AI6A 5DJQC 3Q5DA 5IWAT 1N36T 1X79A 1W0BA 3RC3A 4JV5T 3Q2MA 1Z0PA 3T8OA 4N78D 3LK42 1KNZA 3AEAA 1XMOT 4YSXA 1UX5A 5FYMA 5AQTB 2J1DG 3MXZA 3EUHA 3J7Yq 3L3PA 2Q9QA 1IJ5A 5ABGA 3ZMZB 5HEJA 2LM2A 4OK0A 2CXLA 2YK0A 3SFDA 4KHPT 2VURA 2DHRA 4YXDA 3LBXA 2IC6A 2UXBT 2YU1A 2CPTA 3UU6A 5HEGA 3P4PA 2IIUA 5C2TA 4KBMB 3ZCJA 5EK4A 1MNEA 2QA7A 3HKDE 3ZN1B 4MHCA 3AE6A 1Y64B 1J5WA 3ZC1A 5AQQB 3TLWA 5A1LA 3WI3A 4HFDA 4GKJT 5F8PA 1XNRT 3ZMVB 2H88A 4JI0T 4LFBT 4UVCB 4YT0A 4HWCA 4DV2T 3LSVA 4NPPA 3VKHA 2W61A 4U7IA 3AVRA 2XM1A 3I0OA 3ONJA 4A56A 3CMLA 2FJAA 2WU2A 2XSBA 2JQ9A 1MMNA 3EDUA 4TV9E 4EYUA 5FXZA 1VCSA 4YSYA 2WSSV 5JR9A 3RYIE 3M3ZB 5LJNA 1S94A 4LF7T 1D1AA 3ZKRA 4ASKA 4ZI7E 2W0GA 2XPKA 1CHUA 4JI2T 4HWDA 1U5PA 5LNKA 1FJGT 2OLTA 2N2NA 2KMFA 3PU3A 2JQQA 4HKAA 2WB5A 3NRXA 3U3IA 5LYJE 5LG4A 4ZEYA 1NEKA 2YDQA 3EHZA 3N9PA 4JI3T 5L47A 2I6HA 3OJAA 4QH4A 3B5MA 2ODVA 2NP9A 4LF9T 4ZI3C 4H9SE 3FZKB 5KX5E 3AE2A 2FJEA 4TUYE 4OYKA 3AEFA 4QXBB 2FJBA 2HN2A 4BA9A 5AQOB 3ZCIA 4ZZBA 2UUBT 4JBWF 3R6NA 4DUYT 3HA4A 2W63A 4AKIA 3RRCA 4EAHA 5AQHB 3E0ZA 3SS1A 3QC9A 2C5IT 2JJ9A 5CJ5A 4HN9A 4HFCA 5LXTE 4U3CA 5HCJA 2D0UA 2E9XA 2GK9A 3ETVA 2CM0A 3PUXF 1N33T 3C98B 1YXRA 2BKOA 4B6XA 3VKGA 3NZQA 2I59A 4WYVA 1KF6A 2ES0A 4H63V 1W0AA 3GN5A 2XAFB 3CX8B 4L0RA 4ZS3A 5AQGB 4OFZA 5J0ZA 1OEDA 3F57A 4COFA 3V5UA 4DMVA 4JYAT 2CE7A 4A5XA 5AFUL 3FZMB 1BR1A 4HFVA 2JQHA 5JDNA 1T72A 4ANJA 5L4HA 5L2LA 2LM9A 4ILAA 3AXJB 4OHFA 4H9PC 2V7KA 3X1DA 3FZFB 4WBOA 2XQAA 3VHLA 2WM9A 5CA0E 4X1KE 2C5JA 4DO0A 2UUAT 3C64A 4B3TT 1KNPA 3VU7H 2Q9QC 4YJ3E 4QX8B 3VRBA 1HNZT 1MIYA 5F5WA 1WLXA 5AQJB 1E7PA 2V6YB 5AQUB 1WYBA 5FY7A 4JUYA 5L3DB 4HFIA 4IE7A 1N32T 3F31A 1YQ3A 4GOUA 5JRCA 1FIOA 3UTKA 2V7JA 3D0TA 2X9WA 2M67A 3MJXA 2UXXB 1QLBA 3AAEB 2XTLA 5IUXA 2Y6XA 4DIDB 4AQYT 4LMKA 4I43B 3OVUA 2A9UA 5HXHA 2XQ5A 3O1JA 2CWYA 4WZXA 4UEMA 4IHJE 3PUSA 3UUNA 2X0YA 4YSZA 1MNDA 2XZEA 3C50A 2XSAA 2JMHA 2WP9A 4JEHB 4E7SA 1GQEA 4IREA 3E08A 4IDNA 2V1DB 4IDPA 4YTPA 2WCAA 2VASA 2VKJA 4HWHA 2V5CA 3S4UA 4IDQA 2V7MA 2WMNA 3TLVA 5FY1A 2Q9QB 1AJ3A 3AEGA 2VL0A 2E5VA 5KDMC 2A2FX 3JAFA 1J1JA 3ZEFB 2PBIA 2KLQA 4IL9A 3UQ7A 3FBZA 3RYHE 3AE1A 4X62T 3I9WA 3AE9A 3ZMTB 3FXDB 5JQGE 5EK3A 3AVSA 2KT9A 4Z8XA 2W66A 2NTYA 4X64T 2D2SA 4DV4T 4HFEA 2QGSA 2LSYA 3BQLA 1HNXT 3RX6A 3ZYMA 4EZ4A 2JRKA 2VVNA 5C8YE 4I4TE 4C91A 2H7VC 4U31A 3O1IA 4IGUA 4CI2B 3HKEE 5HYAA 2QYWA 5AQLB 2X9YA 2V7LA 5JVDE 3ANWA 1XMQT 1UUSA 2XQ7A 2WS3A 4PK4A 2IAKA 4B3ST 4U2ZA 3MK7C 3N9QA 4IDOA 3RC8A 5HXCA 2DCFA 2Y48B 5JDLA 4Z91A 2VWAA 4H63H 3C4XA 4HTEA 5JTGA 2ACZA 3VR9A 2X9XA 4CI3B 1I6ZA 1ZP0A 3M65A 4LFCT 3QOFA 4AISA 5JDQA 3PUYF 4DR6T 3ETUA 2ACXA 4I0UA 4PNIA 5HEUA 3TLTA 4AQGA 5ABFA 4IL4A 4DV3T 3P50A 4DR4T 2B76A 2N1GA 3QUJA 5LP6E 3MA9A 1XWMA 2QVAA 3BQKA 2YOEA 2XAQB 4EV6A 2PFVA 4HE8A 4TX5A 1JNZA 2LSIA 5FP3A 1LVKA 2P9BA 2JMKA 5AQPB 2W2UA 2XQ8A 1DU2A 2A72A 2LEHA 4AKGA 3PURA 3LG7A 1UK5A 3UU3A 2ZMAA 4OYJA 1N34T 1HTJF 3AAAB 4CN4A 2DWKA 4UF0A 2EHOC 4TV8E 2X9HA 2N9DA 3OBVE 1HFAA 2E8IA 4HGAA 5HXRA 2JIWA 3FZHB 4JLEA 5AQKB 2BDEA 1IBLT 3UUMA 4XZCA 2XM2A 4JI7T 2W4XA 2JQKA 3Q5EA 1M62A 3KV4A 1SA0E 4CZZB 4DBQA 4DV1T 3CK6A 5AQIB 3LK3B 4WNKA 3CWZB 1WCRA
chains in the Genus database with same CATH topology
4JI1T 4DUYT 4B3TT 5IWAT 2UXCT 1N36T 2F4VT 3T1YT 4LF5T 4JV5T 5LMUT 4LFCT 1HNZT 2UU9T 4DR5T 4B3RT 1XMOT 4DR6T 3OTOT 4NXNT 4DV0T 4OX9T 4DR2T 1N33T 2VQFT 4JI5T 4X62T 4LF7T 1N32T 4DV3T 4DR4T 2UXDT 4JI8T 4LF4T 2VQET 4X65T 2E5LT 4JI2T 1HR0T 4DR1T 1FJGT 4X64T 4DV4T 4X66T 4NXMT 1HNXT 4DUZT 4DR7T 1J5ET 1XNQT 4KHPT 4AQYT 4LFAT 1I94T 1N34T 4GKKT 4JYAT 2UXBT 4JI4T 5LMNT 4LF8T 2ZM6T 2HHHT 1HNWT 4JI3T 4JI6T 5BR8T 2UUCT 4YHHT 4DV6T 1XMQT 4YY3T 1IBLT 4LF6T 4LF9T 3T1HT 4JI7T 4B3ST 1IBKT 4K0KT 4DR3T 4GKJT 1IBMT 1XNRT 4DV1T 4JI0T 4DV5T 4LFBT 4DV7T 2UUBT 4B3MT 4DV2T 2UUAT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI1 T;  4DUY T;  4B3T T;  5IWA T;  2UXC T;  1N36 T;  2F4V T;  3T1Y T;  4LF5 T;  4JV5 T;  5LMU T;  4LFC T;  1HNZ T;  2UU9 T;  4DR5 T;  4B3R T;  1XMO T;  4DR6 T;  3OTO T;  4NXN T;  4DV0 T;  4OX9 T;  4DR2 T;  1N33 T;  2VQF T;  4JI5 T;  4X62 T;  4LF7 T;  1N32 T;  4DV3 T;  4DR4 T;  2UXD T;  4JI8 T;  4LF4 T;  2VQE T;  4X65 T;  2E5L T;  4JI2 T;  1HR0 T;  4DR1 T;  1FJG T;  4X64 T;  4DV4 T;  4X66 T;  4NXM T;  1HNX T;  4DUZ T;  4DR7 T;  1J5E T;  1XNQ T;  4KHP T;  4AQY T;  4LFA T;  1I94 T;  1N34 T;  4GKK T;  4JYA T;  2UXB T;  4JI4 T;  5LMN T;  4LF8 T;  2ZM6 T;  2HHH T;  1HNW T;  4JI3 T;  4JI6 T;  5BR8 T;  2UUC T;  4YHH T;  4DV6 T;  1XMQ T;  4YY3 T;  1IBL T;  4LF6 T;  4LF9 T;  3T1H T;  4JI7 T;  4B3S T;  1IBK T;  4K0K T;  4DR3 T;  4GKJ T;  1IBM T;  1XNR T;  4DV1 T;  4JI0 T;  4DV5 T;  4LFB T;  4DV7 T;  2UUB T;  4B3M T;  4DV2 T;  2UUA T; 
#chains in the Genus database with same CATH topology
 4JI1 T;  4ZXL A;  2VB6 A;  2LT3 A;  1T7S A;  3O4X E;  2X51 A;  3BQI A;  4EEB A;  3CX7 B;  4AQF C;  4MLK A;  2IUB A;  3L8R A;  5LBQ B;  2UU9 T;  3FBL A;  4HFH A;  3KDS E;  5FVL A;  4DV0 T;  4YFS A;  3RH3 A;  1XDP A;  1X9B A;  3H3M A;  2FBW A;  2NR4 A;  2XAH B;  2SPC A;  4F6R C;  3I9Y A;  3NVO A;  4IDZ A;  4AKR B;  2I0M A;  4YJ2 E;  3RIU A;  4DR7 T;  2OA5 A;  3ZT7 A;  3ZYK A;  4ISS A;  3GWH A;  2D9D A;  4O4H E;  4CXY A;  2KWH A;  1D0Y A;  3WAK A;  2IW5 B;  5LMN T;  1FMW A;  2X68 A;  3I1A A;  2K5B B;  3OYZ A;  2EHO B;  1YQ4 A;  2MOZ A;  3ZYL A;  2G0U A;  2AXD S;  5L3G B;  4LF6 T;  3FXE B;  3K3N A;  2MYS A;  1BR4 A;  5AQS B;  4QWN B;  1OED E;  3ZSS A;  2ZM0 A;  3PJA J;  3GMI A;  1IBM T;  3EVY A;  4UR9 A;  2KSR A;  4KMC A;  5JDF A;  3FHN A;  3BK9 A;  4H9R C;  4UXN B;  3K3Q C;  4EZH A;  1WYC A;  4QHO A;  2XUE A;  3H3A A;  3KBU A;  4AKL A;  3VR8 A;  3O1H A;  1E2A A;  3RQW A;  2BZB A;  3OYX A;  5ABE A;  5HXS A;  1QSD A;  4LMJ A;  3CVR A;  4P0B A;  2V7I A;  2BS3 A;  5FY0 A;  5AQN B;  3AA6 B;  4OX9 T;  1OWA A;  2M6B A;  2VQF T;  3HL6 A;  2BS4 A;  5LBM A;  3ZMS B;  3CQX C;  1KFY A;  3LK2 B;  2D5U A;  4TNV A;  3ZST A;  4L5G A;  2LKG A;  3N9M A;  2LKH A;  3KVB A;  4PK5 A;  4X20 E;  2NW8 A;  4UVA B;  1HX1 B;  4YLH A;  4A97 A;  1V9D A;  3W15 B;  2L8K A;  2LSJ A;  3L39 A;  1JNR A;  4DBR A;  2RA1 A;  4O2A E;  2BG9 C;  2RPA A;  4ZS2 A;  2XQ3 A;  5FVK A;  1SE7 A;  2IDO B;  3MAC A;  2MBG A;  1HCI A;  2PJQ A;  1W9R A;  2LHN A;  1IBK T;  1KEY A;  4X1Y E;  2X0L B;  2NW9 A;  4PW8 A;  5LGT B;  3A7M A;  3FB2 A;  2LRL A;  4DV7 T;  2FUP A;  1S35 A;  3P4W A;  2UXC T;  3P8C D;  5ETW A;  3K8P C;  4E7Z A;  4J2C A;  2J47 A;  2MTQ A;  4ZI2 C;  2WAU A;  2CEA A;  3PUW F;  2LRK A;  4O4I E;  1OXZ A;  2DI4 A;  4O8S A;  3RIF A;  3C4Z A;  2E2A A;  3Q5W A;  1MIW A;  4PJN A;  5CGM A;  2ZLY A;  4QH1 A;  4QH5 A;  3WAJ A;  2XJ7 A;  5ADX L;  1XZY A;  5FL0 A;  3EAB A;  4DUZ T;  4KX6 A;  5ABH A;  3UUX B;  2L3L A;  3ZJ1 A;  2BVM A;  4M1P A;  2CXD A;  2KND A;  1IJ6 A;  3HR0 A;  2V6X A;  4UV8 B;  1D1C A;  2WZH A;  3RIA A;  2BG9 B;  2LOP A;  2DWG A;  3RGL A;  5HWX A;  3IHR A;  1T98 A;  1CUN A;  3JAD A;  4EXT A;  3FZL B;  4TN7 B;  2LLY A;  2UXN B;  2ZM8 A;  4KI0 F;  4K0K T;  5LHG B;  5AQV B;  4UEL A;  4MBQ A;  3JAE A;  2Y8D A;  1ZEE A;  4P09 A;  3UT5 E;  3UU5 A;  3UQ4 A;  4X1I E;  4U74 A;  1D0X A;  2LOS A;  3IBP A;  2MPK A;  2QRX A;  4IE4 A;  3AA1 B;  4IE0 A;  3TLS A;  2WWU A;  3RQU A;  5JR9 C;  2VKO A;  5LB7 B;  2BG9 E;  4IE6 A;  2UXD T;  3LFM A;  4AKH A;  3N2G E;  2VQE T;  2E5L T;  4G63 A;  5AQM B;  1M7K A;  4CN6 A;  2VKH A;  1L0V A;  3RYF E;  4DVD A;  3MZK B;  5CB4 E;  1YKH B;  2KXP B;  4ZI3 D;  1UX4 A;  5LG3 A;  1I94 T;  1UCU A;  2CA5 A;  1UGO A;  4PJM A;  4GKK T;  2YN6 A;  5H6R B;  4WBN E;  3J9X 1;  4HWF A;  3LBX B;  2WBL A;  4EIW A;  4O4J E;  3ZMU B;  4PFP A;  5IYZ E;  2XQ6 A;  3ZN0 B;  4BJM A;  4YHH T;  5L3C B;  4TWH A;  4G2A A;  1SUM B;  2K3W A;  2V26 A;  4PFO A;  3L09 A;  4NIQ A;  3C51 A;  2LSG A;  1KNR A;  2OV9 A;  3T1Y T;  4GIW A;  4ILC A;  3KVA A;  3GA8 A;  3HKC E;  4TNW A;  3QNU A;  2LJL A;  2V6Y A;  3ESL A;  4C90 A;  2E9X C;  3EDV A;  3E22 E;  3TLU A;  2YKS A;  5JR9 B;  3HI2 A;  3VRA A;  3I0Q A;  2X67 A;  1H7C A;  1WFD A;  3AE7 A;  4LML A;  3Q9D A;  2XQY A;  4QX7 B;  3ZLI A;  4EYY R;  4F8H A;  3IF8 B;  3NWI A;  2HH7 A;  2K9A A;  1OED C;  3KV9 A;  3N9O A;  3N5L A;  1LVF A;  4YTM A;  5J2U E;  3O9X A;  2WDQ A;  3PUV F;  3TKL B;  4CI1 B;  5FMN A;  3CPZ A;  4I55 E;  2CCQ A;  3ZT5 A;  3PDY A;  4H9O C;  4EOZ B;  1WR0 A;  2CRB A;  4MFR A;  5HEO A;  3N9L A;  4IST A;  4PJJ A;  2Q9Q D;  4TWF A;  3RYC E;  4IT4 A;  1WRD A;  1IZN B;  4O4L E;  4CXX A;  4TWD A;  4ZHQ E;  2WMO A;  2WDR A;  4PJL A;  1MIV A;  3UFG A;  4LF5 T;  1O3X A;  2YIN A;  4HFB A;  4ADZ A;  2C0S A;  1HF8 A;  3P4S A;  4GK5 E;  2AE9 A;  3AEC A;  1HS7 A;  4GYS A;  2E9X B;  5KMG P;  3CIR A;  4K0U A;  4JI5 T;  3KBT A;  5LGN B;  5E0O A;  2B1E A;  5JH7 E;  2X0H A;  1LRZ A;  4EGW A;  2H89 A;  3P4R A;  5EK2 A;  3ZT6 A;  3CQC B;  5DQW A;  3NRY A;  3QK6 A;  3GN5 B;  5FXV A;  3RRW A;  2YDS A;  4X5T A;  3AAI A;  1J5E T;  2IML A;  3ABV A;  5LGU B;  4XBF B;  1OED B;  2XAS B;  3PU8 A;  4KP3 C;  3AEE A;  3C4W A;  3N2O A;  1NWM X;  4LF8 T;  3RF1 A;  1D1B A;  4GYR A;  3QB5 K;  3AA0 B;  1IAP A;  3JC6 C;  2W62 A;  4DND A;  2DNX A;  5EZY E;  4YY3 T;  1Z8U A;  5C3J A;  4BAY B;  2CBI A;  3N2K E;  3AE3 A;  3PV0 F;  2J62 A;  2VK9 A;  3PUA A;  5DAB A;  4ZOL E;  4DV5 T;  2XHE B;  1VOM A;  5IHY A;  4A98 A;  1LKX A;  1HG2 A;  5LMU T;  3H37 A;  2XQ4 A;  2CLY C;  1B7T A;  5M4Y A;  4DR5 T;  4B3R T;  3OTO T;  4QXH B;  3RI5 A;  4Z90 A;  4DR2 T;  1G8X A;  1WR6 A;  5JDG A;  3K3O A;  2BS2 A;  3EAM A;  3KV5 A;  4HWI B;  5JRC B;  1FMV A;  2DL1 A;  2NWB A;  3UU8 A;  4DR1 T;  1Y01 A;  4CN1 A;  4FI5 A;  3SOL A;  3QB5 A;  5FKY A;  2WQY A;  5HXE A;  4L9I A;  1YD8 G;  1XNQ T;  2LSK A;  4AXP A;  4FJO A;  1HG5 A;  3PUG A;  4XAX B;  5KXJ A;  5HEH A;  2E9X D;  2RP4 A;  4CXW A;  2ZM6 T;  2C5K T;  1HNW T;  2CWO A;  1R8I A;  4U72 A;  4YHJ A;  4P0A A;  2K48 A;  4IE5 A;  4P1N A;  1HX8 A;  2YDR A;  2PG8 A;  5TAO A;  4DMW A;  2HPL A;  1MMD A;  5AQF B;  3AE4 A;  4GK0 E;  2XY8 B;  1YKE B;  5HAX A;  1UUR A;  3SFE A;  4PAG A;  4HEA A;  3B13 A;  2F4V T;  3NKZ A;  3PE0 A;  4V1A v;  4CQI A;  3N9N A;  2CLY B;  4QXC B;  2J4G A;  2V5D A;  2V8S V;  3PUQ A;  3UU4 A;  2H7O A;  2WWV A;  2WZI A;  5JDM A;  3KV6 A;  2CHN A;  1BR0 A;  1ZHC A;  2W67 A;  4KUM B;  2XQ9 A;  5AQR B;  3AE5 A;  2EHO D;  4MAL A;  4U7Y A;  2H3R A;  2BBH A;  4NXM T;  2A3D A;  3DP7 A;  2D0T A;  3IA3 A;  3CX6 B;  1QUU A;  4LFA T;  5JRE A;  4H9N C;  2CHO A;  5LHH B;  2R6G F;  3A5X A;  2EHO A;  1ZOY A;  3P7I A;  3UUB A;  2YU2 A;  3K1S A;  3NBX X;  2ODU A;  2VKD A;  2MAW A;  3PUZ F;  4DV6 T;  5HCM A;  3IEE A;  2ZM2 A;  3AED A;  1NEN A;  3ANW B;  2CXF A;  5FNV E;  4UV9 B;  4DR3 T;  2YEV C;  3DTO A;  2KZ7 B;  3CKD A;  3B57 A;  1E1H B;  3UUL A;  2Z6E A;  1US7 B;  3UFE A;  2VL8 A;  4AQF A;  2XAJ B;  2BKP A;  1XDO A;  3ONL C;  4Q25 A;  5L3B B;  1FEW A;  4UVB B;  3A8Y C;  1G73 A;  3JC6 D;  1D0Z A;  2IHR 1;  3MKD A;  5LOV E;  5LCY A;  4I50 E;  4YTN A;  3SRZ A;  5ABF B;  2PTF A;  5BMV E;  4LF4 T;  1MMA A;  4BJN A;  4X65 T;  3AA7 B;  3RIU C;  3V5S A;  5DQV A;  1VCT A;  2X66 A;  5FXX A;  2KIN B;  1ZV4 X;  1KK7 A;  2NTX A;  2WU5 A;  4QKN A;  3RHW A;  5J2T E;  5L3E B;  3LDQ B;  5L3F B;  1SHZ C;  4KHZ F;  3G06 A;  3ZPO A;  4UF0 B;  3RPU A;  2BBJ A;  1NAF A;  4IIJ E;  2BKN A;  1YW0 A;  2HHH T;  4ERR A;  4EED A;  2JPF A;  2KWI B;  5BR8 T;  2DLR A;  2UUC T;  1ZKE A;  2IC9 A;  2XAG B;  1BR2 A;  4ZZC A;  5LJM A;  3Q5X A;  5HWY A;  5FXW A;  3NZP A;  3KIN B;  4PK6 A;  3F2E A;  3AB3 B;  3AXJ A;  1T8B A;  3HKB E;  1VRB A;  4NUV A;  3EI0 A;  2L9Q A;  3DJB A;  4JEU B;  4WW0 A;  5LHI B;  1W09 A;  3PTR B;  3AEB A;  4U33 A;  5FL1 A;  4U2Y A;  4ILB A;  2HPJ A;  3RKO A;  4NXN T;  5LA6 E;  3P4Q A;  4AIU A;  3ZJ2 A;  5H6Q B;  3PJA A;  3ONX A;  3KFW X;  3CQG B;  5JDH A;  4JI8 T;  1HR0 T;  4UIG A;  2CMR A;  4X66 T;  3RKG A;  5CFB A;  2W00 A;  1MMG A;  5F3J A;  4O2B E;  3JCF A;  4NUU A;  2M6I A;  2WDV A;  2BVL A;  4JI4 T;  4EB6 E;  3ZC0 A;  2LHR A;  2BG9 A;  5GON E;  4H9Q C;  2HN1 A;  4JI6 T;  3SWH A;  3AE8 A;  5J1G A;  3OPC A;  3RLF F;  4ILU A;  1EZ3 A;  3T1H T;  2NW7 A;  3OKQ A;  2FJD A;  2K24 A;  4ZI2 D;  2CBJ A;  3R84 B;  3LJC A;  3U78 A;  1U4Q A;  4TZ4 C;  2LE8 A;  2NOX A;  4B3M T;  5L4E A;  2VVS A;  5CA1 E;  2WY2 A;  4AI6 A;  5DJQ C;  3Q5D A;  5IWA T;  1N36 T;  1X79 A;  1W0B A;  3RC3 A;  4JV5 T;  3Q2M A;  1Z0P A;  3T8O A;  4N78 D;  3LK4 2;  1KNZ A;  3AEA A;  1XMO T;  4YSX A;  1UX5 A;  5FYM A;  5AQT B;  2J1D G;  3MXZ A;  3EUH A;  3J7Y q;  3L3P A;  2Q9Q A;  1IJ5 A;  5ABG A;  3ZMZ B;  5HEJ A;  2LM2 A;  4OK0 A;  2CXL A;  2YK0 A;  3SFD A;  4KHP T;  2VUR A;  2DHR A;  4YXD A;  3LBX A;  2IC6 A;  2UXB T;  2YU1 A;  2CPT A;  3UU6 A;  5HEG A;  3P4P A;  2IIU A;  5C2T A;  4KBM B;  3ZCJ A;  5EK4 A;  1MNE A;  2QA7 A;  3HKD E;  3ZN1 B;  4MHC A;  3AE6 A;  1Y64 B;  1J5W A;  3ZC1 A;  5AQQ B;  3TLW A;  5A1L A;  3WI3 A;  4HFD A;  4GKJ T;  5F8P A;  1XNR T;  3ZMV B;  2H88 A;  4JI0 T;  4LFB T;  4UVC B;  4YT0 A;  4HWC A;  4DV2 T;  3LSV A;  4NPP A;  3VKH A;  2W61 A;  4U7I A;  3AVR A;  2XM1 A;  3I0O A;  3ONJ A;  4A56 A;  3CML A;  2FJA A;  2WU2 A;  2XSB A;  2JQ9 A;  1MMN A;  3EDU A;  4TV9 E;  4EYU A;  5FXZ A;  1VCS A;  4YSY A;  2WSS V;  5JR9 A;  3RYI E;  3M3Z B;  5LJN A;  1S94 A;  4LF7 T;  1D1A A;  3ZKR A;  4ASK A;  4ZI7 E;  2W0G A;  2XPK A;  1CHU A;  4JI2 T;  4HWD A;  1U5P A;  5LNK A;  1FJG T;  2OLT A;  2N2N A;  2KMF A;  3PU3 A;  2JQQ A;  4HKA A;  2WB5 A;  3NRX A;  3U3I A;  5LYJ E;  5LG4 A;  4ZEY A;  1NEK A;  2YDQ A;  3EHZ A;  3N9P A;  4JI3 T;  5L47 A;  2I6H A;  3OJA A;  4QH4 A;  3B5M A;  2ODV A;  2NP9 A;  4LF9 T;  4ZI3 C;  4H9S E;  3FZK B;  5KX5 E;  3AE2 A;  2FJE A;  4TUY E;  4OYK A;  3AEF A;  4QXB B;  2FJB A;  2HN2 A;  4BA9 A;  5AQO B;  3ZCI A;  4ZZB A;  2UUB T;  4JBW F;  3R6N A;  4DUY T;  3HA4 A;  2W63 A;  4AKI A;  3RRC A;  4EAH A;  5AQH B;  3E0Z A;  3SS1 A;  3QC9 A;  2C5I T;  2JJ9 A;  5CJ5 A;  4HN9 A;  4HFC A;  5LXT E;  4U3C A;  5HCJ A;  2D0U A;  2E9X A;  2GK9 A;  3ETV A;  2CM0 A;  3PUX F;  1N33 T;  3C98 B;  1YXR A;  2BKO A;  4B6X A;  3VKG A;  3NZQ A;  2I59 A;  4WYV A;  1KF6 A;  2ES0 A;  4H63 V;  1W0A A;  3GN5 A;  2XAF B;  3CX8 B;  4L0R A;  4ZS3 A;  5AQG B;  4OFZ A;  5J0Z A;  1OED A;  3F57 A;  4COF A;  3V5U A;  4DMV A;  4JYA T;  2CE7 A;  4A5X A;  5AFU L;  3FZM B;  1BR1 A;  4HFV A;  2JQH A;  5JDN A;  1T72 A;  4ANJ A;  5L4H A;  5L2L A;  2LM9 A;  4ILA A;  3AXJ B;  4OHF A;  4H9P C;  2V7K A;  3X1D A;  3FZF B;  4WBO A;  2XQA A;  3VHL A;  2WM9 A;  5CA0 E;  4X1K E;  2C5J A;  4DO0 A;  2UUA T;  3C64 A;  4B3T T;  1KNP A;  3VU7 H;  2Q9Q C;  4YJ3 E;  4QX8 B;  3VRB A;  1HNZ T;  1MIY A;  5F5W A;  1WLX A;  5AQJ B;  1E7P A;  2V6Y B;  5AQU B;  1WYB A;  5FY7 A;  4JUY A;  5L3D B;  4HFI A;  4IE7 A;  1N32 T;  3F31 A;  1YQ3 A;  4GOU A;  5JRC A;  1FIO A;  3UTK A;  2V7J A;  3D0T A;  2X9W A;  2M67 A;  3MJX A;  2UXX B;  1QLB A;  3AAE B;  2XTL A;  5IUX A;  2Y6X A;  4DID B;  4AQY T;  4LMK A;  4I43 B;  3OVU A;  2A9U A;  5HXH A;  2XQ5 A;  3O1J A;  2CWY A;  4WZX A;  4UEM A;  4IHJ E;  3PUS A;  3UUN A;  2X0Y A;  4YSZ A;  1MND A;  2XZE A;  3C50 A;  2XSA A;  2JMH A;  2WP9 A;  4JEH B;  4E7S A;  1GQE A;  4IRE A;  3E08 A;  4IDN A;  2V1D B;  4IDP A;  4YTP A;  2WCA A;  2VAS A;  2VKJ A;  4HWH A;  2V5C A;  3S4U A;  4IDQ A;  2V7M A;  2WMN A;  3TLV A;  5FY1 A;  2Q9Q B;  1AJ3 A;  3AEG A;  2VL0 A;  2E5V A;  5KDM C;  2A2F X;  3JAF A;  1J1J A;  3ZEF B;  2PBI A;  2KLQ A;  4IL9 A;  3UQ7 A;  3FBZ A;  3RYH E;  3AE1 A;  4X62 T;  3I9W A;  3AE9 A;  3ZMT B;  3FXD B;  5JQG E;  5EK3 A;  3AVS A;  2KT9 A;  4Z8X A;  2W66 A;  2NTY A;  4X64 T;  2D2S A;  4DV4 T;  4HFE A;  2QGS A;  2LSY A;  3BQL A;  1HNX T;  3RX6 A;  3ZYM A;  4EZ4 A;  2JRK A;  2VVN A;  5C8Y E;  4I4T E;  4C91 A;  2H7V C;  4U31 A;  3O1I A;  4IGU A;  4CI2 B;  3HKE E;  5HYA A;  2QYW A;  5AQL B;  2X9Y A;  2V7L A;  5JVD E;  3ANW A;  1XMQ T;  1UUS A;  2XQ7 A;  2WS3 A;  4PK4 A;  2IAK A;  4B3S T;  4U2Z A;  3MK7 C;  3N9Q A;  4IDO A;  3RC8 A;  5HXC A;  2DCF A;  2Y48 B;  5JDL A;  4Z91 A;  2VWA A;  4H63 H;  3C4X A;  4HTE A;  5JTG A;  2ACZ A;  3VR9 A;  2X9X A;  4CI3 B;  1I6Z A;  1ZP0 A;  3M65 A;  4LFC T;  3QOF A;  4AIS A;  5JDQ A;  3PUY F;  4DR6 T;  3ETU A;  2ACX A;  4I0U A;  4PNI A;  5HEU A;  3TLT A;  4AQG A;  5ABF A;  4IL4 A;  4DV3 T;  3P50 A;  4DR4 T;  2B76 A;  2N1G A;  3QUJ A;  5LP6 E;  3MA9 A;  1XWM A;  2QVA A;  3BQK A;  2YOE A;  2XAQ B;  4EV6 A;  2PFV A;  4HE8 A;  4TX5 A;  1JNZ A;  2LSI A;  5FP3 A;  1LVK A;  2P9B A;  2JMK A;  5AQP B;  2W2U A;  2XQ8 A;  1DU2 A;  2A72 A;  2LEH A;  4AKG A;  3PUR A;  3LG7 A;  1UK5 A;  3UU3 A;  2ZMA A;  4OYJ A;  1N34 T;  1HTJ F;  3AAA B;  4CN4 A;  2DWK A;  4UF0 A;  2EHO C;  4TV8 E;  2X9H A;  2N9D A;  3OBV E;  1HFA A;  2E8I A;  4HGA A;  5HXR A;  2JIW A;  3FZH B;  4JLE A;  5AQK B;  2BDE A;  1IBL T;  3UUM A;  4XZC A;  2XM2 A;  4JI7 T;  2W4X A;  2JQK A;  3Q5E A;  1M62 A;  3KV4 A;  1SA0 E;  4CZZ B;  4DBQ A;  4DV1 T;  3CK6 A;  5AQI B;  3LK3 B;  4WNK A;  3CWZ B;  1WCR A; 
#chains in the Genus database with same CATH homology
 4JI1 T;  4DUY T;  4B3T T;  5IWA T;  2UXC T;  1N36 T;  2F4V T;  3T1Y T;  4LF5 T;  4JV5 T;  5LMU T;  4LFC T;  1HNZ T;  2UU9 T;  4DR5 T;  4B3R T;  1XMO T;  4DR6 T;  3OTO T;  4NXN T;  4DV0 T;  4OX9 T;  4DR2 T;  1N33 T;  2VQF T;  4JI5 T;  4X62 T;  4LF7 T;  1N32 T;  4DV3 T;  4DR4 T;  2UXD T;  4JI8 T;  4LF4 T;  2VQE T;  4X65 T;  2E5L T;  4JI2 T;  1HR0 T;  4DR1 T;  1FJG T;  4X64 T;  4DV4 T;  4X66 T;  4NXM T;  1HNX T;  4DUZ T;  4DR7 T;  1J5E T;  1XNQ T;  4KHP T;  4AQY T;  4LFA T;  1I94 T;  1N34 T;  4GKK T;  4JYA T;  2UXB T;  4JI4 T;  5LMN T;  4LF8 T;  2ZM6 T;  2HHH T;  1HNW T;  4JI3 T;  4JI6 T;  5BR8 T;  2UUC T;  4YHH T;  4DV6 T;  1XMQ T;  4YY3 T;  1IBL T;  4LF6 T;  4LF9 T;  3T1H T;  4JI7 T;  4B3S T;  1IBK T;  4K0K T;  4DR3 T;  4GKJ T;  1IBM T;  1XNR T;  4DV1 T;  4JI0 T;  4DV5 T;  4LFB T;  4DV7 T;  2UUB T;  4B3M T;  4DV2 T;  2UUA T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...