4JI4T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 33
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4ji4T00
4LFCT 4B3MT 4DUYT 1XMQT 1XMOT 1N32T 4B3ST 4X64T 4K0KT 4X62T 1I94T 4NXMT 4JI5T 1N33T 1HNWT 4JI7T 1HNZT 5BR8T 4LF8T 3T1YT 1N36T 2F4VT 4GKKT 2UUAT 1XNRT 1J5ET 1N34T 4DR4T 4DV4T 4LF9T 4DR7T 3OTOT 2HHHT 4DV6T 3T1HT 4X65T 1IBLT 4JI2T 2UXCT 4JYAT 5IWAT 4JI8T 4YHHT 4DV0T 4DV7T 2E5LT 4JI1T 4DR2T 4DV2T 4B3TT 2VQET 4YY3T 2UXBT 1FJGT 4JI6T 4LF5T 4NXNT 4LF6T 4DR6T 4JV5T 4JI4T 4LFBT 1IBMT 4GKJT 5LMUT 5LMNT 4X66T 4DR3T 4DR5T 4KHPT 4DV5T 2ZM6T 2UUBT 4DV1T 2UU9T 4LF7T 1HR0T 4LF4T 2VQFT 2UXDT 1XNQT 4DUZT 4JI0T 4B3RT 4DR1T 4AQYT 2UUCT 4LFAT 1IBKT 4JI3T 4DV3T 1HNXT 4OX9T
chains in the Genus database with same CATH superfamily
2WQYA 2QRXA 1YQ4A 4DUYT 5HEGA 2XQ4A 2W2UA 4UEMA 4Q25A 4JUYA 3ZYMA 4JI7T 1Z8UA 4EEBA 3Q5EA 4HFEA 3J7Yq 4UVAB 2XQ9A 3C98B 3RH3A 3N5LA 1MMGA 4YSYA 3ABVA 2WU2A 3F2EA 4ZXLA 2V6XA 5AQPB 1YW0A 1M7KA 5JDHA 4CXYA 4AI6A 2UXBT 5AQKB 3KV4A 4KI0F 4PJLA 4NXNT 2I6HA 2JIWA 3N2OA 5LHIB 4EV6A 1IBMT 1SE7A 2IHR1 2LT3A 4E7ZA 1UCUA 4ZS2A 4DR5T 4DV5T 5L3EB 2L9QA 2XAFB 4O4JE 3CMLA 3AE7A 4HFVA 3PUWF 3O1IA 3F31A 5HWXA 4H63H 5AQRB 4EOZB 2BKPA 3PUGA 2UXNB 2UUCT 2FJEA 2JMHA 4DVDA 2BDEA 2WWVA 1IJ5A 1MNDA 3D0TA 3RPUA 4ZZBA 3ZN0B 3PTRB 3GWHA 3O1JA 2JRKA 1SUMB 3C51A 4X62T 4JI5T 4I50E 3LFMA 2C0SA 2E9XC 2LOSA 1XDPA 2W62A 3ZYLA 2IC9A 2WWUA 3RRWA 4DMWA 2LJLA 3AA1B 2X9HA 3A7MA 3AAIA 3ZT7A 3EDUA 4AKHA 3AE3A 1Y64B 3KINB 4X5TA 2D0TA 4IDOA 3ZJ1A 4P1NA 2XHEB 2C5KT 4O2BE 4QXBB 3O9XA 4CN1A 1HX8A 2SPCA 2WMNA 4JV5T 3FXDB 2XQ7A 5ABHA 1HG5A 3I0QA 4IE5A 4U3CA 3CQCB 4KHPT 3OKQA 4LF4T 2NOXA 3AA6B 3J9X1 3AB3B 3PUZF 2VQFT 1WYCA 1MNEA 4DUZT 4WW0A 3AVRA 2X0YA 4AKGA 2LRLA 4Z90A 3VHLA 3RQUA 2WB5A 5FY0A 5AQUB 3N9QA 3QB5K 2BVLA 2G0UA 3N2KE 3RYIE 4Z91A 2AXDS 5BR8T 4AXPA 3LJCA 5LA6E 4HWIB 3UU3A 3O4XE 5GONE 2LKHA 2VL8A 3HKBE 5M4YA 1D0YA 2V8SV 3HI2A 5IWAT 5FY7A 1HG2A 3QB5A 3P4SA 4HEAA 2VASA 2K24A 5F8PA 4DV2T 5CJ5A 1U4QA 3WAKA 3EDVA 4JEUB 3UFGA 5L3FB 3EI0A 4JI4T 4DMVA 2ZLYA 2BKOA 4CI2B 2XY8B 2NW8A 1BR2A 4ZI2D 2EHOB 3I0OA 3MZKB 4HFDA 3AXJA 4UVCB 2W4XA 5KXJA 4IDZA 3P4PA 4HFBA 5AFUL 3NVOA 2Z6EA 4EAHA 3RKGA 4EGWA 2W61A 1XNQT 3UFEA 2D2SA 3FZMB 1WR0A 5JR9C 5H6QB 4PFOA 2A72A 4QKNA 4ANJA 4YTNA 4MALA 4G2AA 3NZQA 3GMIA 5HAXA 2XZEA 4KBMB 1SHZC 1WRDA 4TUYE 2AE9A 4YTMA 4LMJA 4YJ3E 2UUAT 2HH7A 2W63A 3ZSSA 4NUUA 2FJDA 3ETUA 5AQSB 4CXXA 3NRYA 3OYZA 2PG8A 4ZI7E 2JJ9A 2UXCT 4YXDA 2CHOA 5AQGB 5CA1E 4TN7B 4ERRA 5AQHB 3RIFA 4KX6A 2K5BB 2XM1A 4LF5T 1EZ3A 5EK2A 4U33A 2X0LB 1NENA 1OEDB 5JH7E 2WZIA 4GKJT 3ZT5A 4UF0A 3LK3B 2QA7A 5HWYA 4PW8A 1S35A 4HFCA 1ZEEA 3RYFE 1OWAA 1MMAA 4K0UA 1HR0T 3PUYF 3ZC0A 2KLQA 3DP7A 2M6BA 5DJQC 3MXZA 2XM2A 2XQ6A 1AJ3A 2WSSV 5HEHA 2D9DA 4KUMB 4HFIA 3LSVA 1HX1B 1IZNB 2V7JA 3ZLIA 4X64T 3K8PC 1IJ6A 1GQEA 4IL4A 4COFA 2VVSA 3CPZA 4KHZF 5JVDE 1LVFA 4LF8T 2IMLA 3LBXB 1N36T 4TX5A 3TLWA 2BKNA 2LE8A 1N34T 5IHYA 5ABFB 2ES0A 1V9DA 5HYAA 3RF1A 5EZYE 4UELA 3A8YC 4TWHA 5LHGB 2VWAA 3FZKB 4YSXA 2IIUA 3JC6C 4OYKA 1VCTA 4LF6T 5C8YE 3NRXA 4O4LE 2VKOA 2NTXA 4O2AE 1US7B 3E22E 3BK9A 5LJMA 3CVRA 5EK4A 1KFYA 2KMFA 2BZBA 2XSAA 3N9MA 2LSJA 4X1YE 5LHHB 4IL9A 3PU3A 4DO0A 4JBWF 4PJMA 3PURA 4BJMA 1MMNA 5LG4A 3ZCIA 1E7PA 2CRBA 1G73A 4DIDB 2CMRA 2I59A 2NW7A 4UV9B 5JDQA 4JI3T 3BQKA 3IBPA 3ZJ2A 3EHZA 1XMOT 3P50A 1WR6A 4QXHB 5DQVA 1W0BA 2BG9B 1HNWT 2YDQA 1X9BA 2OV9A 4ILUA 5LG3A 4N78D 2W0GA 3Q9DA 4O8SA 4TV8E 5HEUA 2VK9A 5FKYA 4DR4T 2B76A 5FYMA 3JAEA 2BBHA 4TWFA 4PK6A 4YLHA 4TWDA 1UURA 3AECA 4QHOA 4QXCB 5IYZE 3PUAA 2LRKA 2WMOA 5AQVB 2CBJA 2KXPB 4TZ4C 2UXXB 1YKEB 5LGUB 1WYBA 4IIJE 1XZYA 2EHOC 2E8IA 5A1LA 5HXEA 2IUBA 4U2YA 3MA9A 3RLFF 3CX6B 2UU9T 3SFEA 3AA0B 3X1DA 4L0RA 2K9AA 2WDVA 5AQLB 4CXWA 4A5XA 2LLYA 2V5CA 5HCMA 5F3JA 1KNPA 4H63V 2MYSA 1HNXT 1VRBA 4ILAA 2CHNA 5L4HA 4P09A 3ANWA 4GYSA 2RP4A 3RGLA 1G8XA 5LGTB 4AQGA 3T1YT 3K3OA 3RRCA 2V1DB 4IDQA 2X51A 4AQFA 2WM9A 4H9NC 3PJAA 2QGSA 3CX7B 1T72A 3C64A 2OLTA 2VKDA 2VKJA 4DNDA 4H9OC 2JQ9A 4ILCA 4JI2T 2N2NA 3AEGA 2L8KA 2V6YA 4M1PA 4IE0A 4GOUA 2IAKA 2E9XD 4EZHA 5ABEA 4AKRB 5JREA 3C50A 2W00A 2B1EA 2WDQA 3ZPOA 3PU8A 4JI6T 2KNDA 2V26A 4I0UA 2J1DG 2L3LA 2X68A 2YDSA 3M3ZB 4HWCA 4TNVA 3TLUA 3K1SA 2Y8DA 1W0AA 2CA5A 3UT5E 4DV1T 3QC9A 2DLRA 3UU6A 2LHRA 3KV6A 5L4EA 2XPKA 2UXDT 4XAXB 2MBGA 4CI3B 2ZMAA 2D5UA 5LYJE 2DCFA 3RIUC 3QK6A 4IE6A 3L3PA 2PFVA 3H3AA 3UUNA 2NR4A 2FJBA 2J4GA 4PJNA 4OX9T 2MPKA 3FXEB 5BMVE 2IC6A 4AIUA 2XTLA 1XMQT 3TLTA 1YD8G 3ZEFB 3EABA 2VURA 3RC8A 4DBRA 4GKKT 3P7IA 3RI5A 1OXZA 1SA0E 4LF9T 5FVLA 2Q9QC 3L8RA 4DV6T 4X65T 2MTQA 1KEYA 4JYAT 2Q9QD 4QWNB 4DV0T 4DV7T 1HS7A 1MIYA 4PJJA 5LJNA 4H9RC 5L2LA 4OK0A 2NP9A 3QOFA 1ZKEA 2K3WA 1FEWA 5FP3A 4F8HA 5J2TE 2C5IT 3BQIA 1BR4A 2RPAA 5LP6E 3E08A 4L5GA 2YK0A 3Q2MA 3KV5A 4DR3T 2LHNA 3HR0A 3ZMZB 2OA5A 4TV9E 3AAAB 3RKOA 1BR0A 3PV0F 2PTFA 4YHJA 1ZHCA 3AXJB 2YDRA 3U78A 4ADZA 2YU1A 2FBWA 5FXWA 3LK42 4MFRA 2BG9C 4IE4A 2HN2A 3RYCE 4V1Av 3HKCE 4NXMT 1FMVA 5LBQB 3AEFA 3KVAA 3ZYKA 2LSGA 2X66A 2HHHT 5LBMA 1UX5A 2KWIB 5AQIB 3SRZA 3V5SA 1J5WA 4PFPA 2QYWA 3FB2A 2Y6XA 1E1HB 4JLEA 4DR6T 4U31A 4LFBT 1NWMX 3AEDA 3Q5XA 2CE7A 3ZMVB 3N9PA 2LKGA 3K3QC 2V7KA 2UUBT 4U72A 1WCRA 4UF0B 2BS2A 4GYRA 4QX8B 4U7YA 3CQXC 4A56A 2I0MA 4H9QC 4DR1T 3AE9A 5LNKA 3BQLA 3KVBA 4ZEYA 1D1AA 3C4XA 3OBVE 4U7IA 4EYUA 5FY1A 4MHCA 5LOVE 2H3RA 5FVKA 1B7TA 1N32T 1LVKA 5KDMC 4IDPA 2E9XA 1R8IA 5FMNA 4HGAA 1N33T 1HNZT 2PJQA 5AQJB 3PUXF 3TLSA 2F4VT 3ONJA 4OHFA 2HPJA 3Q5WA 5CGMA 2ODVA 5ADXL 3KBUA 2XAGB 3QNUA 1W09A 4JEHB 2C5JA 4JI8T 3PE0A 4YHHT 2E5LT 5LB7B 3GN5A 1NAFA 3ZCJA 4YT0A 4BJNA 5AQQB 5TAOA 5LCYA 2V7IA 5JTGA 5AQOB 4EB6E 2CPTA 3VRBA 3RIAA 2NW9A 1CHUA 3CX8B 2JQKA 5L3BB 4PK5A 3JADA 4PAGA 1DU2A 4HKAA 1HCIA 3FBLA 4ZS3A 4CZZB 2CEAA 4I55E 3JC6D 2CWYA 3N9OA 2LEHA 5LXTE 5HEJA 2WZHA 4LFAT 1HTJF 1IBKT 2J47A 1VCSA 1Z0PA 2CXDA 2Q9QA 3FBZA 4B3MT 4O4IE 3I9WA 1T7SA 3N9LA 3CQGB 5E0OA 4NPPA 4IE7A 4P0BA 2BS4A 2BBJA 1QLBA 3R6NA 1J5ET 3UULA 1E2AA 5L3DB 3AE5A 1IBLT 4EEDA 4GK0E 3AEBA 3G06A 2BVMA 4J2CA 3ETVA 3SOLA 4YSZA 1L0VA 3VKGA 4MLKA 4I43B 3VKHA 3HA4A 4PNIA 4U74A 4MBQA 2LSKA 4GK5E 4XZCA 1UGOA 2V7LA 2WAUA 2VVNA 4YFSA 4NIQA 2PBIA 4EIWA 2XSBA 5DABA 2CLYB 3CWZB 3E0ZA 2H89A 3MJXA 5H6RB 1QSDA 5JR9B 3AE6A 1T98A 2EHOD 2WU5A 2ACZA 4FI5A 3ZC1A 5JR9A 3SS1A 5HXSA 2XJ7A 5C2TA 2W66A 2HN1A 3QUJA 2IDOB 4L9IA 1YKHB 4K0KT 2MOZA 3JCFA 2DHRA 4UV8B 3NWIA 3M65A 3UUBA 3C4ZA 4E7SA 3IF8B 1ZV4X 1XNRT 2WDRA 3ANWB 3LDQB 4GIWA 2XAHB 4DR7T 1T8BA 5AQFB 3OTOT 4HN9A 5L47A 4ISSA 3W15B 2YU2A 3UU5A 3UU4A 2NWBA 2CXLA 3HL6A 3NBXX 3AE1A 3LK2B 1YXRA 1WLXA 4DR2T 4WZXA 5JDFA 3U3IA 2XQ8A 5CFBA 4B3TT 5J1GA 2VQET 4ZZCA 4H9PC 2V6YB 2V5DA 2ZM2A 1NEKA 4ISTA 3VR8A 3IEEA 5FXXA 2JMKA 2BS3A 3OJAA 4QH4A 3RX6A 1UX4A 5J0ZA 3HKDE 2YKSA 4IGUA 5L3CB 1OEDC 4IREA 4PK4A 3UQ7A 1QUUA 1W9RA 4HE8A 3GA8A 3OVUA 5JDNA 2XQAA 2DL1A 5FL0A 5EK3A 5HEOA 3HKEE 2DNXA 1LKXA 3DTOA 5KMGP 5FXVA 2KINB 3IA3A 5F5WA 1H7CA 2LM9A 2VB6A 4AISA 2JQHA 2E2AA 4CQIA 4HWHA 4F6RC 1OEDE 2LOPA 4HWFA 2E5VA 3AEAA 4HWDA 4O4HE 4HTEA 4AKIA 3ONXA 4WBOA 2A3DA 3P8CD 2XUEA 2CBIA 3CIRA 4TNWA 4C91A 2VKHA 2H7VC 4JI1T 4YTPA 4H9SE 4WNKA 3B13A 2YOEA 3C4WA 3ZMUB 1O3XA 3TKLB 3EUHA 4EZ4A 2X67A 5AQMB 4LMLA 2X0HA 3SFDA 3I1AA 3VR9A 5JRCB 2N9DA 3PJAJ 5LMNT 3KDSE 1ZOYA 3SWHA 3IHRA 2JQQA 2FUPA 1MIWA 5JRCA 4DBQA 4Z8XA 1XWMA 3K3NA 4X1KE 3VU7H 2Y48B 4OYJA 5ETWA 1KNRA 2XASB 4B3RT 3WAJA 4CI1B 4IDNA 3PDYA 5L3GB 2DI4A 4DV3T 3FHNA 2HPLA 3UUXB 4ZI3C 3AEEA 4ZHQE 4ZI3D 4WBNE 2KT9A 3RC3A 2WP9A 5FXZA 2FJAA 3LG7A 3AA7B 4EXTA 1LRZA 4CN4A 3P4QA 4ILBA 4WYVA 4EYYR 1KF6A 2MAWA 1D1CA 2ACXA 2LSYA 4ZI2C 3EVYA 4XBFB 4QH1A 2NTYA 2WCAA 1HF8A 3ESLA 2CM0A 4YY3T 2WY2A 3DJBA 4G63A 4UIGA 5HXRA 2R6GF 5FL1A 1MIVA 4A98A 2EHOA 3T8OA 3S4UA 3AAEB 5IUXA 4X20E 2ODUA 2W67A 2ZM0A 4I4TE 2CLYC 2BG9E 1X79A 3F57A 3B57A 3AE4A 3ONLC 5ABGA 4LF7T 4A97A 2A9UA 1WFDA 3AVSA 4YJ2E 3PUVF 2LM2A 1D1BA 2K48A 1UUSA 1U5PA 3UQ4A 1UK5A 4JI0T 4U2ZA 3KV9A 1VOMA 3L39A 1XDOA 5AQTB 3N9NA 1JNRA 3P4RA 4OFZA 2LSIA 5DQWA 3O1HA 5J2UE 2A2FX 1D0ZA 4CN6A 4B3ST 3MACA 3UU8A 2GK9A 3B5MA 3OPCA 2YN6A 4X1IE 3RQWA 4IHJE 5LGNB 2E9XB 4AQFC 3FZHB 4BAYB 2J62A 3I9YA 3WI3A 4LMKA 3T1HT 3NZPA 3H3MA 2M67A 3FZFB 2KWHA 4HFHA 1FMWA 1IAPA 4AKLA 1OEDA 3PUQA 5JDMA 5HXHA 2XQ3A 3AE2A 2CXFA 2QVAA 3VRAA 3ZSTA 4ASKA 5HCJA 3ZT6A 2CWOA 3GN5B 3N2GE 1D0XA 1I6ZA 2CCQA 1Y01A 2X9YA 3MK7C 1FIOA 4X66T 2IW5B 2XAJB 2RA1A 3ZMSB 2KZ7B 3NKZA 4UR9A 5FNVE 3RYHE 4QX7B 4KMCA 3RIUA 1ZP0A 2V7MA 5KX5E 3UUMA 1YQ3A 1MMDA 3RHWA 2YEVC 1KNZA 3V5UA 2ZM8A 4BA9A 3PUSA 4LFCT 3JAFA 3LBXA 4UVBB 3KFWX 5C3JA 4P0AA 1I94T 3P4WA 2P9BA 5ABFA 2Q9QB 2N1GA 2D0UA 3ZMTB 1JNZA 4DV4T 3ZN1B 3A5XA 3L09A 2X9WA 2H88A 4UXNB 5JQGE 2YINA 2WS3A 3CKDA 3FZLB 1BR1A 2DWKA 1M62A 4FJOA 3OYXA 2VL0A 3KBTA 1FJGT 5JDLA 3EAMA 4IT4A 1J1JA 4B6XA 5CA0E 2M6IA 4KP3C 5HXCA 5JDGA 3UTKA 5LMUT 2DWGA 1S94A 2XAQB 3Q5DA 2JPFA 1CUNA 4NUVA 2XQYA 1KK7A 5CB4E 4ZOLE 5AQNB 2ZM6T 3MKDA 2H7OA 3ZKRA 4C90A 3TLVA 1HFAA 3R84B 2XQ5A 2WBLA 4QH5A 3H37A 2KSRA 4AQYT 2BG9A 2X9XA 3AE8A 3CK6A
chains in the Genus database with same CATH topology
4LFCT 4B3MT 4DUYT 1XMQT 1XMOT 1N32T 4B3ST 4X64T 4K0KT 4X62T 1I94T 4NXMT 4JI5T 1N33T 1HNWT 4JI7T 1HNZT 5BR8T 4LF8T 3T1YT 1N36T 2F4VT 4GKKT 2UUAT 1XNRT 1J5ET 1N34T 4DR4T 4DV4T 4LF9T 4DR7T 3OTOT 2HHHT 4DV6T 3T1HT 4X65T 1IBLT 4JI2T 2UXCT 4JYAT 5IWAT 4JI8T 4YHHT 4DV0T 4DV7T 2E5LT 4JI1T 4DR2T 4DV2T 4B3TT 2VQET 4YY3T 2UXBT 1FJGT 4JI6T 4LF5T 4NXNT 4LF6T 4DR6T 4JV5T 4JI4T 4LFBT 1IBMT 4GKJT 5LMUT 5LMNT 4X66T 4DR3T 4DR5T 4KHPT 4DV5T 2ZM6T 2UUBT 4DV1T 2UU9T 4LF7T 1HR0T 4LF4T 2VQFT 2UXDT 1XNQT 4DUZT 4JI0T 4B3RT 4DR1T 4AQYT 2UUCT 4LFAT 1IBKT 4JI3T 4DV3T 1HNXT 4OX9T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFC T;  4B3M T;  4DUY T;  1XMQ T;  1XMO T;  1N32 T;  4B3S T;  4X64 T;  4K0K T;  4X62 T;  1I94 T;  4NXM T;  4JI5 T;  1N33 T;  1HNW T;  4JI7 T;  1HNZ T;  5BR8 T;  4LF8 T;  3T1Y T;  1N36 T;  2F4V T;  4GKK T;  2UUA T;  1XNR T;  1J5E T;  1N34 T;  4DR4 T;  4DV4 T;  4LF9 T;  4DR7 T;  3OTO T;  2HHH T;  4DV6 T;  3T1H T;  4X65 T;  1IBL T;  4JI2 T;  2UXC T;  4JYA T;  5IWA T;  4JI8 T;  4YHH T;  4DV0 T;  4DV7 T;  2E5L T;  4JI1 T;  4DR2 T;  4DV2 T;  4B3T T;  2VQE T;  4YY3 T;  2UXB T;  1FJG T;  4JI6 T;  4LF5 T;  4NXN T;  4LF6 T;  4DR6 T;  4JV5 T;  4JI4 T;  4LFB T;  1IBM T;  4GKJ T;  5LMU T;  5LMN T;  4X66 T;  4DR3 T;  4DR5 T;  4KHP T;  4DV5 T;  2ZM6 T;  2UUB T;  4DV1 T;  2UU9 T;  4LF7 T;  1HR0 T;  4LF4 T;  2VQF T;  2UXD T;  1XNQ T;  4DUZ T;  4JI0 T;  4B3R T;  4DR1 T;  4AQY T;  2UUC T;  4LFA T;  1IBK T;  4JI3 T;  4DV3 T;  1HNX T;  4OX9 T; 
#chains in the Genus database with same CATH topology
 2WQY A;  2QRX A;  1YQ4 A;  4DUY T;  5HEG A;  2XQ4 A;  2W2U A;  4UEM A;  4Q25 A;  4JUY A;  3ZYM A;  4JI7 T;  1Z8U A;  4EEB A;  3Q5E A;  4HFE A;  3J7Y q;  4UVA B;  2XQ9 A;  3C98 B;  3RH3 A;  3N5L A;  1MMG A;  4YSY A;  3ABV A;  2WU2 A;  3F2E A;  4ZXL A;  2V6X A;  5AQP B;  1YW0 A;  1M7K A;  5JDH A;  4CXY A;  4AI6 A;  2UXB T;  5AQK B;  3KV4 A;  4KI0 F;  4PJL A;  4NXN T;  2I6H A;  2JIW A;  3N2O A;  5LHI B;  4EV6 A;  1IBM T;  1SE7 A;  2IHR 1;  2LT3 A;  4E7Z A;  1UCU A;  4ZS2 A;  4DR5 T;  4DV5 T;  5L3E B;  2L9Q A;  2XAF B;  4O4J E;  3CML A;  3AE7 A;  4HFV A;  3PUW F;  3O1I A;  3F31 A;  5HWX A;  4H63 H;  5AQR B;  4EOZ B;  2BKP A;  3PUG A;  2UXN B;  2UUC T;  2FJE A;  2JMH A;  4DVD A;  2BDE A;  2WWV A;  1IJ5 A;  1MND A;  3D0T A;  3RPU A;  4ZZB A;  3ZN0 B;  3PTR B;  3GWH A;  3O1J A;  2JRK A;  1SUM B;  3C51 A;  4X62 T;  4JI5 T;  4I50 E;  3LFM A;  2C0S A;  2E9X C;  2LOS A;  1XDP A;  2W62 A;  3ZYL A;  2IC9 A;  2WWU A;  3RRW A;  4DMW A;  2LJL A;  3AA1 B;  2X9H A;  3A7M A;  3AAI A;  3ZT7 A;  3EDU A;  4AKH A;  3AE3 A;  1Y64 B;  3KIN B;  4X5T A;  2D0T A;  4IDO A;  3ZJ1 A;  4P1N A;  2XHE B;  2C5K T;  4O2B E;  4QXB B;  3O9X A;  4CN1 A;  1HX8 A;  2SPC A;  2WMN A;  4JV5 T;  3FXD B;  2XQ7 A;  5ABH A;  1HG5 A;  3I0Q A;  4IE5 A;  4U3C A;  3CQC B;  4KHP T;  3OKQ A;  4LF4 T;  2NOX A;  3AA6 B;  3J9X 1;  3AB3 B;  3PUZ F;  2VQF T;  1WYC A;  1MNE A;  4DUZ T;  4WW0 A;  3AVR A;  2X0Y A;  4AKG A;  2LRL A;  4Z90 A;  3VHL A;  3RQU A;  2WB5 A;  5FY0 A;  5AQU B;  3N9Q A;  3QB5 K;  2BVL A;  2G0U A;  3N2K E;  3RYI E;  4Z91 A;  2AXD S;  5BR8 T;  4AXP A;  3LJC A;  5LA6 E;  4HWI B;  3UU3 A;  3O4X E;  5GON E;  2LKH A;  2VL8 A;  3HKB E;  5M4Y A;  1D0Y A;  2V8S V;  3HI2 A;  5IWA T;  5FY7 A;  1HG2 A;  3QB5 A;  3P4S A;  4HEA A;  2VAS A;  2K24 A;  5F8P A;  4DV2 T;  5CJ5 A;  1U4Q A;  3WAK A;  3EDV A;  4JEU B;  3UFG A;  5L3F B;  3EI0 A;  4JI4 T;  4DMV A;  2ZLY A;  2BKO A;  4CI2 B;  2XY8 B;  2NW8 A;  1BR2 A;  4ZI2 D;  2EHO B;  3I0O A;  3MZK B;  4HFD A;  3AXJ A;  4UVC B;  2W4X A;  5KXJ A;  4IDZ A;  3P4P A;  4HFB A;  5AFU L;  3NVO A;  2Z6E A;  4EAH A;  3RKG A;  4EGW A;  2W61 A;  1XNQ T;  3UFE A;  2D2S A;  3FZM B;  1WR0 A;  5JR9 C;  5H6Q B;  4PFO A;  2A72 A;  4QKN A;  4ANJ A;  4YTN A;  4MAL A;  4G2A A;  3NZQ A;  3GMI A;  5HAX A;  2XZE A;  4KBM B;  1SHZ C;  1WRD A;  4TUY E;  2AE9 A;  4YTM A;  4LMJ A;  4YJ3 E;  2UUA T;  2HH7 A;  2W63 A;  3ZSS A;  4NUU A;  2FJD A;  3ETU A;  5AQS B;  4CXX A;  3NRY A;  3OYZ A;  2PG8 A;  4ZI7 E;  2JJ9 A;  2UXC T;  4YXD A;  2CHO A;  5AQG B;  5CA1 E;  4TN7 B;  4ERR A;  5AQH B;  3RIF A;  4KX6 A;  2K5B B;  2XM1 A;  4LF5 T;  1EZ3 A;  5EK2 A;  4U33 A;  2X0L B;  1NEN A;  1OED B;  5JH7 E;  2WZI A;  4GKJ T;  3ZT5 A;  4UF0 A;  3LK3 B;  2QA7 A;  5HWY A;  4PW8 A;  1S35 A;  4HFC A;  1ZEE A;  3RYF E;  1OWA A;  1MMA A;  4K0U A;  1HR0 T;  3PUY F;  3ZC0 A;  2KLQ A;  3DP7 A;  2M6B A;  5DJQ C;  3MXZ A;  2XM2 A;  2XQ6 A;  1AJ3 A;  2WSS V;  5HEH A;  2D9D A;  4KUM B;  4HFI A;  3LSV A;  1HX1 B;  1IZN B;  2V7J A;  3ZLI A;  4X64 T;  3K8P C;  1IJ6 A;  1GQE A;  4IL4 A;  4COF A;  2VVS A;  3CPZ A;  4KHZ F;  5JVD E;  1LVF A;  4LF8 T;  2IML A;  3LBX B;  1N36 T;  4TX5 A;  3TLW A;  2BKN A;  2LE8 A;  1N34 T;  5IHY A;  5ABF B;  2ES0 A;  1V9D A;  5HYA A;  3RF1 A;  5EZY E;  4UEL A;  3A8Y C;  4TWH A;  5LHG B;  2VWA A;  3FZK B;  4YSX A;  2IIU A;  3JC6 C;  4OYK A;  1VCT A;  4LF6 T;  5C8Y E;  3NRX A;  4O4L E;  2VKO A;  2NTX A;  4O2A E;  1US7 B;  3E22 E;  3BK9 A;  5LJM A;  3CVR A;  5EK4 A;  1KFY A;  2KMF A;  2BZB A;  2XSA A;  3N9M A;  2LSJ A;  4X1Y E;  5LHH B;  4IL9 A;  3PU3 A;  4DO0 A;  4JBW F;  4PJM A;  3PUR A;  4BJM A;  1MMN A;  5LG4 A;  3ZCI A;  1E7P A;  2CRB A;  1G73 A;  4DID B;  2CMR A;  2I59 A;  2NW7 A;  4UV9 B;  5JDQ A;  4JI3 T;  3BQK A;  3IBP A;  3ZJ2 A;  3EHZ A;  1XMO T;  3P50 A;  1WR6 A;  4QXH B;  5DQV A;  1W0B A;  2BG9 B;  1HNW T;  2YDQ A;  1X9B A;  2OV9 A;  4ILU A;  5LG3 A;  4N78 D;  2W0G A;  3Q9D A;  4O8S A;  4TV8 E;  5HEU A;  2VK9 A;  5FKY A;  4DR4 T;  2B76 A;  5FYM A;  3JAE A;  2BBH A;  4TWF A;  4PK6 A;  4YLH A;  4TWD A;  1UUR A;  3AEC A;  4QHO A;  4QXC B;  5IYZ E;  3PUA A;  2LRK A;  2WMO A;  5AQV B;  2CBJ A;  2KXP B;  4TZ4 C;  2UXX B;  1YKE B;  5LGU B;  1WYB A;  4IIJ E;  1XZY A;  2EHO C;  2E8I A;  5A1L A;  5HXE A;  2IUB A;  4U2Y A;  3MA9 A;  3RLF F;  3CX6 B;  2UU9 T;  3SFE A;  3AA0 B;  3X1D A;  4L0R A;  2K9A A;  2WDV A;  5AQL B;  4CXW A;  4A5X A;  2LLY A;  2V5C A;  5HCM A;  5F3J A;  1KNP A;  4H63 V;  2MYS A;  1HNX T;  1VRB A;  4ILA A;  2CHN A;  5L4H A;  4P09 A;  3ANW A;  4GYS A;  2RP4 A;  3RGL A;  1G8X A;  5LGT B;  4AQG A;  3T1Y T;  3K3O A;  3RRC A;  2V1D B;  4IDQ A;  2X51 A;  4AQF A;  2WM9 A;  4H9N C;  3PJA A;  2QGS A;  3CX7 B;  1T72 A;  3C64 A;  2OLT A;  2VKD A;  2VKJ A;  4DND A;  4H9O C;  2JQ9 A;  4ILC A;  4JI2 T;  2N2N A;  3AEG A;  2L8K A;  2V6Y A;  4M1P A;  4IE0 A;  4GOU A;  2IAK A;  2E9X D;  4EZH A;  5ABE A;  4AKR B;  5JRE A;  3C50 A;  2W00 A;  2B1E A;  2WDQ A;  3ZPO A;  3PU8 A;  4JI6 T;  2KND A;  2V26 A;  4I0U A;  2J1D G;  2L3L A;  2X68 A;  2YDS A;  3M3Z B;  4HWC A;  4TNV A;  3TLU A;  3K1S A;  2Y8D A;  1W0A A;  2CA5 A;  3UT5 E;  4DV1 T;  3QC9 A;  2DLR A;  3UU6 A;  2LHR A;  3KV6 A;  5L4E A;  2XPK A;  2UXD T;  4XAX B;  2MBG A;  4CI3 B;  2ZMA A;  2D5U A;  5LYJ E;  2DCF A;  3RIU C;  3QK6 A;  4IE6 A;  3L3P A;  2PFV A;  3H3A A;  3UUN A;  2NR4 A;  2FJB A;  2J4G A;  4PJN A;  4OX9 T;  2MPK A;  3FXE B;  5BMV E;  2IC6 A;  4AIU A;  2XTL A;  1XMQ T;  3TLT A;  1YD8 G;  3ZEF B;  3EAB A;  2VUR A;  3RC8 A;  4DBR A;  4GKK T;  3P7I A;  3RI5 A;  1OXZ A;  1SA0 E;  4LF9 T;  5FVL A;  2Q9Q C;  3L8R A;  4DV6 T;  4X65 T;  2MTQ A;  1KEY A;  4JYA T;  2Q9Q D;  4QWN B;  4DV0 T;  4DV7 T;  1HS7 A;  1MIY A;  4PJJ A;  5LJN A;  4H9R C;  5L2L A;  4OK0 A;  2NP9 A;  3QOF A;  1ZKE A;  2K3W A;  1FEW A;  5FP3 A;  4F8H A;  5J2T E;  2C5I T;  3BQI A;  1BR4 A;  2RPA A;  5LP6 E;  3E08 A;  4L5G A;  2YK0 A;  3Q2M A;  3KV5 A;  4DR3 T;  2LHN A;  3HR0 A;  3ZMZ B;  2OA5 A;  4TV9 E;  3AAA B;  3RKO A;  1BR0 A;  3PV0 F;  2PTF A;  4YHJ A;  1ZHC A;  3AXJ B;  2YDR A;  3U78 A;  4ADZ A;  2YU1 A;  2FBW A;  5FXW A;  3LK4 2;  4MFR A;  2BG9 C;  4IE4 A;  2HN2 A;  3RYC E;  4V1A v;  3HKC E;  4NXM T;  1FMV A;  5LBQ B;  3AEF A;  3KVA A;  3ZYK A;  2LSG A;  2X66 A;  2HHH T;  5LBM A;  1UX5 A;  2KWI B;  5AQI B;  3SRZ A;  3V5S A;  1J5W A;  4PFP A;  2QYW A;  3FB2 A;  2Y6X A;  1E1H B;  4JLE A;  4DR6 T;  4U31 A;  4LFB T;  1NWM X;  3AED A;  3Q5X A;  2CE7 A;  3ZMV B;  3N9P A;  2LKG A;  3K3Q C;  2V7K A;  2UUB T;  4U72 A;  1WCR A;  4UF0 B;  2BS2 A;  4GYR A;  4QX8 B;  4U7Y A;  3CQX C;  4A56 A;  2I0M A;  4H9Q C;  4DR1 T;  3AE9 A;  5LNK A;  3BQL A;  3KVB A;  4ZEY A;  1D1A A;  3C4X A;  3OBV E;  4U7I A;  4EYU A;  5FY1 A;  4MHC A;  5LOV E;  2H3R A;  5FVK A;  1B7T A;  1N32 T;  1LVK A;  5KDM C;  4IDP A;  2E9X A;  1R8I A;  5FMN A;  4HGA A;  1N33 T;  1HNZ T;  2PJQ A;  5AQJ B;  3PUX F;  3TLS A;  2F4V T;  3ONJ A;  4OHF A;  2HPJ A;  3Q5W A;  5CGM A;  2ODV A;  5ADX L;  3KBU A;  2XAG B;  3QNU A;  1W09 A;  4JEH B;  2C5J A;  4JI8 T;  3PE0 A;  4YHH T;  2E5L T;  5LB7 B;  3GN5 A;  1NAF A;  3ZCJ A;  4YT0 A;  4BJN A;  5AQQ B;  5TAO A;  5LCY A;  2V7I A;  5JTG A;  5AQO B;  4EB6 E;  2CPT A;  3VRB A;  3RIA A;  2NW9 A;  1CHU A;  3CX8 B;  2JQK A;  5L3B B;  4PK5 A;  3JAD A;  4PAG A;  1DU2 A;  4HKA A;  1HCI A;  3FBL A;  4ZS3 A;  4CZZ B;  2CEA A;  4I55 E;  3JC6 D;  2CWY A;  3N9O A;  2LEH A;  5LXT E;  5HEJ A;  2WZH A;  4LFA T;  1HTJ F;  1IBK T;  2J47 A;  1VCS A;  1Z0P A;  2CXD A;  2Q9Q A;  3FBZ A;  4B3M T;  4O4I E;  3I9W A;  1T7S A;  3N9L A;  3CQG B;  5E0O A;  4NPP A;  4IE7 A;  4P0B A;  2BS4 A;  2BBJ A;  1QLB A;  3R6N A;  1J5E T;  3UUL A;  1E2A A;  5L3D B;  3AE5 A;  1IBL T;  4EED A;  4GK0 E;  3AEB A;  3G06 A;  2BVM A;  4J2C A;  3ETV A;  3SOL A;  4YSZ A;  1L0V A;  3VKG A;  4MLK A;  4I43 B;  3VKH A;  3HA4 A;  4PNI A;  4U74 A;  4MBQ A;  2LSK A;  4GK5 E;  4XZC A;  1UGO A;  2V7L A;  2WAU A;  2VVN A;  4YFS A;  4NIQ A;  2PBI A;  4EIW A;  2XSB A;  5DAB A;  2CLY B;  3CWZ B;  3E0Z A;  2H89 A;  3MJX A;  5H6R B;  1QSD A;  5JR9 B;  3AE6 A;  1T98 A;  2EHO D;  2WU5 A;  2ACZ A;  4FI5 A;  3ZC1 A;  5JR9 A;  3SS1 A;  5HXS A;  2XJ7 A;  5C2T A;  2W66 A;  2HN1 A;  3QUJ A;  2IDO B;  4L9I A;  1YKH B;  4K0K T;  2MOZ A;  3JCF A;  2DHR A;  4UV8 B;  3NWI A;  3M65 A;  3UUB A;  3C4Z A;  4E7S A;  3IF8 B;  1ZV4 X;  1XNR T;  2WDR A;  3ANW B;  3LDQ B;  4GIW A;  2XAH B;  4DR7 T;  1T8B A;  5AQF B;  3OTO T;  4HN9 A;  5L47 A;  4ISS A;  3W15 B;  2YU2 A;  3UU5 A;  3UU4 A;  2NWB A;  2CXL A;  3HL6 A;  3NBX X;  3AE1 A;  3LK2 B;  1YXR A;  1WLX A;  4DR2 T;  4WZX A;  5JDF A;  3U3I A;  2XQ8 A;  5CFB A;  4B3T T;  5J1G A;  2VQE T;  4ZZC A;  4H9P C;  2V6Y B;  2V5D A;  2ZM2 A;  1NEK A;  4IST A;  3VR8 A;  3IEE A;  5FXX A;  2JMK A;  2BS3 A;  3OJA A;  4QH4 A;  3RX6 A;  1UX4 A;  5J0Z A;  3HKD E;  2YKS A;  4IGU A;  5L3C B;  1OED C;  4IRE A;  4PK4 A;  3UQ7 A;  1QUU A;  1W9R A;  4HE8 A;  3GA8 A;  3OVU A;  5JDN A;  2XQA A;  2DL1 A;  5FL0 A;  5EK3 A;  5HEO A;  3HKE E;  2DNX A;  1LKX A;  3DTO A;  5KMG P;  5FXV A;  2KIN B;  3IA3 A;  5F5W A;  1H7C A;  2LM9 A;  2VB6 A;  4AIS A;  2JQH A;  2E2A A;  4CQI A;  4HWH A;  4F6R C;  1OED E;  2LOP A;  4HWF A;  2E5V A;  3AEA A;  4HWD A;  4O4H E;  4HTE A;  4AKI A;  3ONX A;  4WBO A;  2A3D A;  3P8C D;  2XUE A;  2CBI A;  3CIR A;  4TNW A;  4C91 A;  2VKH A;  2H7V C;  4JI1 T;  4YTP A;  4H9S E;  4WNK A;  3B13 A;  2YOE A;  3C4W A;  3ZMU B;  1O3X A;  3TKL B;  3EUH A;  4EZ4 A;  2X67 A;  5AQM B;  4LML A;  2X0H A;  3SFD A;  3I1A A;  3VR9 A;  5JRC B;  2N9D A;  3PJA J;  5LMN T;  3KDS E;  1ZOY A;  3SWH A;  3IHR A;  2JQQ A;  2FUP A;  1MIW A;  5JRC A;  4DBQ A;  4Z8X A;  1XWM A;  3K3N A;  4X1K E;  3VU7 H;  2Y48 B;  4OYJ A;  5ETW A;  1KNR A;  2XAS B;  4B3R T;  3WAJ A;  4CI1 B;  4IDN A;  3PDY A;  5L3G B;  2DI4 A;  4DV3 T;  3FHN A;  2HPL A;  3UUX B;  4ZI3 C;  3AEE A;  4ZHQ E;  4ZI3 D;  4WBN E;  2KT9 A;  3RC3 A;  2WP9 A;  5FXZ A;  2FJA A;  3LG7 A;  3AA7 B;  4EXT A;  1LRZ A;  4CN4 A;  3P4Q A;  4ILB A;  4WYV A;  4EYY R;  1KF6 A;  2MAW A;  1D1C A;  2ACX A;  2LSY A;  4ZI2 C;  3EVY A;  4XBF B;  4QH1 A;  2NTY A;  2WCA A;  1HF8 A;  3ESL A;  2CM0 A;  4YY3 T;  2WY2 A;  3DJB A;  4G63 A;  4UIG A;  5HXR A;  2R6G F;  5FL1 A;  1MIV A;  4A98 A;  2EHO A;  3T8O A;  3S4U A;  3AAE B;  5IUX A;  4X20 E;  2ODU A;  2W67 A;  2ZM0 A;  4I4T E;  2CLY C;  2BG9 E;  1X79 A;  3F57 A;  3B57 A;  3AE4 A;  3ONL C;  5ABG A;  4LF7 T;  4A97 A;  2A9U A;  1WFD A;  3AVS A;  4YJ2 E;  3PUV F;  2LM2 A;  1D1B A;  2K48 A;  1UUS A;  1U5P A;  3UQ4 A;  1UK5 A;  4JI0 T;  4U2Z A;  3KV9 A;  1VOM A;  3L39 A;  1XDO A;  5AQT B;  3N9N A;  1JNR A;  3P4R A;  4OFZ A;  2LSI A;  5DQW A;  3O1H A;  5J2U E;  2A2F X;  1D0Z A;  4CN6 A;  4B3S T;  3MAC A;  3UU8 A;  2GK9 A;  3B5M A;  3OPC A;  2YN6 A;  4X1I E;  3RQW A;  4IHJ E;  5LGN B;  2E9X B;  4AQF C;  3FZH B;  4BAY B;  2J62 A;  3I9Y A;  3WI3 A;  4LMK A;  3T1H T;  3NZP A;  3H3M A;  2M67 A;  3FZF B;  2KWH A;  4HFH A;  1FMW A;  1IAP A;  4AKL A;  1OED A;  3PUQ A;  5JDM A;  5HXH A;  2XQ3 A;  3AE2 A;  2CXF A;  2QVA A;  3VRA A;  3ZST A;  4ASK A;  5HCJ A;  3ZT6 A;  2CWO A;  3GN5 B;  3N2G E;  1D0X A;  1I6Z A;  2CCQ A;  1Y01 A;  2X9Y A;  3MK7 C;  1FIO A;  4X66 T;  2IW5 B;  2XAJ B;  2RA1 A;  3ZMS B;  2KZ7 B;  3NKZ A;  4UR9 A;  5FNV E;  3RYH E;  4QX7 B;  4KMC A;  3RIU A;  1ZP0 A;  2V7M A;  5KX5 E;  3UUM A;  1YQ3 A;  1MMD A;  3RHW A;  2YEV C;  1KNZ A;  3V5U A;  2ZM8 A;  4BA9 A;  3PUS A;  4LFC T;  3JAF A;  3LBX A;  4UVB B;  3KFW X;  5C3J A;  4P0A A;  1I94 T;  3P4W A;  2P9B A;  5ABF A;  2Q9Q B;  2N1G A;  2D0U A;  3ZMT B;  1JNZ A;  4DV4 T;  3ZN1 B;  3A5X A;  3L09 A;  2X9W A;  2H88 A;  4UXN B;  5JQG E;  2YIN A;  2WS3 A;  3CKD A;  3FZL B;  1BR1 A;  2DWK A;  1M62 A;  4FJO A;  3OYX A;  2VL0 A;  3KBT A;  1FJG T;  5JDL A;  3EAM A;  4IT4 A;  1J1J A;  4B6X A;  5CA0 E;  2M6I A;  4KP3 C;  5HXC A;  5JDG A;  3UTK A;  5LMU T;  2DWG A;  1S94 A;  2XAQ B;  3Q5D A;  2JPF A;  1CUN A;  4NUV A;  2XQY A;  1KK7 A;  5CB4 E;  4ZOL E;  5AQN B;  2ZM6 T;  3MKD A;  2H7O A;  3ZKR A;  4C90 A;  3TLV A;  1HFA A;  3R84 B;  2XQ5 A;  2WBL A;  4QH5 A;  3H37 A;  2KSR A;  4AQY T;  2BG9 A;  2X9X A;  3AE8 A;  3CK6 A; 
#chains in the Genus database with same CATH homology
 4LFC T;  4B3M T;  4DUY T;  1XMQ T;  1XMO T;  1N32 T;  4B3S T;  4X64 T;  4K0K T;  4X62 T;  1I94 T;  4NXM T;  4JI5 T;  1N33 T;  1HNW T;  4JI7 T;  1HNZ T;  5BR8 T;  4LF8 T;  3T1Y T;  1N36 T;  2F4V T;  4GKK T;  2UUA T;  1XNR T;  1J5E T;  1N34 T;  4DR4 T;  4DV4 T;  4LF9 T;  4DR7 T;  3OTO T;  2HHH T;  4DV6 T;  3T1H T;  4X65 T;  1IBL T;  4JI2 T;  2UXC T;  4JYA T;  5IWA T;  4JI8 T;  4YHH T;  4DV0 T;  4DV7 T;  2E5L T;  4JI1 T;  4DR2 T;  4DV2 T;  4B3T T;  2VQE T;  4YY3 T;  2UXB T;  1FJG T;  4JI6 T;  4LF5 T;  4NXN T;  4LF6 T;  4DR6 T;  4JV5 T;  4JI4 T;  4LFB T;  1IBM T;  4GKJ T;  5LMU T;  5LMN T;  4X66 T;  4DR3 T;  4DR5 T;  4KHP T;  4DV5 T;  2ZM6 T;  2UUB T;  4DV1 T;  2UU9 T;  4LF7 T;  1HR0 T;  4LF4 T;  2VQF T;  2UXD T;  1XNQ T;  4DUZ T;  4JI0 T;  4B3R T;  4DR1 T;  4AQY T;  2UUC T;  4LFA T;  1IBK T;  4JI3 T;  4DV3 T;  1HNX T;  4OX9 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...