4JI4T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 33
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4ji4T00
4B3RT 1XMOT 4AQYT 4JI4T 2UUAT 2E5LT 4DR3T 4OX9T 1N32T 4JI5T 4DV4T 4JI2T 1XNQT 1HNXT 1XMQT 4DV0T 3T1HT 4DR6T 3T1YT 4DUYT 4DR1T 1N33T 1HNZT 2F4VT 4LFCT 5IWAT 3OTOT 4GKJT 4JI3T 4LF8T 4JV5T 4DR7T 2UXDT 4DUZT 4GKKT 4X64T 4JI0T 2ZM6T 1XNRT 4LF5T 5LMUT 4DR4T 4NXNT 4LF7T 4B3ST 4B3MT 2UUCT 4DR2T 2VQET 4KHPT 2UU9T 1FJGT 2UXBT 1I94T 1IBMT 4JI1T 4JI6T 2UUBT 4LF4T 4JYAT 1N34T 4JI8T 4X66T 1J5ET 5BR8T 1HR0T 4LF9T 4X62T 2HHHT 4X65T 4K0KT 4DV5T 4LF6T 1HNWT 4DV6T 1IBLT 4DV3T 4NXMT 4YHHT 4DV7T 4LFBT 4DV2T 2VQFT 2UXCT 1N36T 4LFAT 4DR5T 4JI7T 4B3TT 4YY3T 5LMNT 4DV1T 1IBKT
chains in the Genus database with same CATH superfamily
3HKDE 3LK3B 4K0UA 2WP9A 3AEEA 3KINB 1ZKEA 2BBJA 1B7TA 2LE8A 2ZLYA 4JUYA 1UURA 3UU3A 1W0AA 5JREA 4P0BA 5AQQB 3H3MA 4COFA 5KXJA 1XMQT 4AQGA 2VVSA 2CXLA 3K8PC 5AQMB 4H9SE 3ZCIA 2QYWA 4CXXA 2XHEB 3TKLB 2I6HA 4NUUA 4HFIA 4ASKA 5HXHA 5L3EB 3VU7H 2X9YA 4TN7B 1HCIA 4HFHA 2SPCA 4YTPA 4JI0T 2MAWA 1XNRT 4N78D 4DR4T 5AQOB 2PTFA 3AXJA 3F57A 4TX5A 2VWAA 3UUNA 2I59A 4U31A 3I1AA 4MFRA 3RH3A 2EHOA 3C4ZA 1X9BA 2XSBA 2LSJA 5LBMA 5FY7A 2P9BA 4ZHQE 3ANWB 5FY0A 2JJ9A 4PJJA 3UFEA 3JC6C 2JMKA 2KT9A 3Q5WA 2XASB 2VVNA 4O4IE 1YKEB 4HFVA 4PW8A 1BR1A 2XQYA 1U4QA 4I0UA 2FJBA 1WCRA 3ETVA 4IT4A 5CA0E 1WR6A 2K24A 4HFEA 1NEKA 1D1AA 4GIWA 2BVMA 3L39A 3PV0F 3UU8A 3CPZA 4ZZCA 5L3GB 2VL8A 5HXSA 3ZC0A 2E9XC 4PJMA 4CXYA 3KV4A 3FZFB 3NWIA 4ZEYA 3N9NA 1MIWA 2D2SA 3WI3A 1XWMA 4EIWA 5FVKA 2WAUA 3C50A 3V5SA 3OJAA 5DQVA 3K1SA 3LK42 1OXZA 4KUMB 2L8KA 5JDHA 3ESLA 4EYUA 2V6XA 2XAJB 2K9AA 2ACZA 2NTXA 1V9DA 4GK5E 2I0MA 3C4WA 3ZC1A 5JDQA 4DV5T 3VRBA 2BBHA 5LCYA 4YHHT 4LFBT 1W09A 3KFWX 5LNKA 2YU1A 3ONJA 3EHZA 4DV1T 5FXXA 2XQ7A 3MA9A 3CWZB 4HEAA 1US7B 5HXEA 4GK0E 3RIUC 4Q25A 4JI4T 2ES0A 3RGLA 2Z6EA 2W2UA 3NZPA 2XM1A 4BA9A 2L3LA 2WB5A 3IBPA 2BZBA 3Q5DA 4DBQA 1VCTA 4JV5T 2DI4A 2XAQB 3N9OA 3KVBA 5LBQB 2BG9E 3MK7C 5LG3A 5BMVE 2XQAA 5AFUL 2IC9A 3RIUA 5IUXA 2WQYA 5L4HA 5KDMC 3H3AA 2QGSA 2MOZA 2X9WA 3ETUA 2VQET 5FXVA 3RF1A 3PUSA 5EK2A 3AEBA 4JI6T 3TLUA 3J9X1 2H89A 4AKLA 2V26A 2RA1A 5LB7B 5FKYA 1WFDA 4AISA 4QWNB 3ZEFB 2LRKA 2J47A 2BKPA 5FNVE 3FZMB 1VRBA 1M7KA 3PUQA 3AE9A 3R6NA 2Q9QC 4DO0A 5EK3A 2J1DG 1MIYA 4YTNA 4LMLA 1OWAA 5JDFA 4PK5A 3GN5B 4ERRA 5LJMA 1D1BA 1R8IA 4WBOA 2LSGA 3KBUA 2LM9A 2WU5A 3MKDA 2E8IA 3OPCA 2CHNA 3P4QA 2BS2A 2V5CA 3QNUA 1SHZC 3EI0A 3MJXA 2W4XA 3OTOT 4ISSA 4LF8T 4CQIA 2BVLA 5J0ZA 2UXDT 4AKGA 4CN4A 2NWBA 1ZP0A 2B76A 3VKGA 4TV9E 3TLSA 3ZLIA 2H7VC 1ZHCA 2JRKA 2WZIA 3DJBA 5FL0A 4LF7T 1OEDB 5AQRB 4DR2T 2V1DB 2HH7A 4Z90A 3RHWA 3RRCA 2LLYA 2DCFA 3O1IA 4UR9A 4ZOLE 4YSYA 5L3BB 2YDQA 2CEAA 3ZYKA 4DV6T 3P4PA 1E2AA 3CVRA 5CJ5A 1KNPA 4DV2T 2VQFT 1N36T 2V8SV 1UX5A 3K3OA 2ACXA 1E1HB 5L2LA 4MHCA 3ZJ2A 5CB4E 4WBNE 4YSXA 4AKHA 5LYJE 4TNWA 3F2EA 3P50A 4ZI7E 5J2UE 1KNZA 4DR3T 2CCQA 2BS3A 3ABVA 1ZOYA 4JI2T 3P4WA 2JMHA 1IZNB 4YJ3E 3QC9A 3RRWA 1HNZT 5JVDE 1OEDC 3GN5A 3HKEE 3C51A 4CN1A 2LM2A 3N2GE 4GKKT 1J5WA 2WMOA 4YLHA 2ZM6T 3PUAA 2CWOA 3BQIA 4OHFA 4HWCA 5AQGB 3RKOA 1VCSA 2VURA 3AEAA 4EXTA 3LBXB 5CA1E 2XPKA 3E22E 4B3ST 1LRZA 3AXJB 4KX6A 5FMNA 2WY2A 2KINB 4GYRA 4NIQA 3J7Yq 1S94A 1ZEEA 2IUBA 2IMLA 4AIUA 1OEDA 2C5IT 2D0TA 5LHGB 3FB2A 4ILCA 2W66A 3L8RA 2UXXB 4LMKA 4YXDA 5HEJA 5AQUB 2X68A 1VOMA 3EAMA 3PUWF 5LG4A 2Y8DA 2OLTA 3RC8A 2CXDA 2JQQA 3CX8B 1DU2A 2XQ6A 4DMVA 4JBWF 1U5PA 3F31A 3MZKB 2UUAT 4AQFC 5CGMA 4H9RC 4JI5T 3AE4A 2VKJA 4H9QC 4QX8B 4A5XA 2XQ3A 4ZS3A 3T8OA 4F8HA 4TV8E 4IE6A 1MMNA 2ODVA 2WDRA 2KXPB 3N2KE 1AJ3A 5AQPB 4A97A 3PU3A 4UF0A 2XAGB 5HXRA 2WU2A 4PJNA 2EHOC 4DVDA 3AE1A 3V5UA 4LF5T 5F8PA 1S35A 5LXTE 3IA3A 4AQFA 5JQGE 5LGUB 4A98A 3I9WA 2XSAA 3VR9A 2BKOA 5C3JA 2DNXA 4H9NC 3A8YC 4I55E 4HE8A 4H9OC 2WMNA 3VKHA 3LBXA 1UX4A 2HHHT 4ISTA 2LJLA 3LFMA 1IBLT 4O2AE 5TAOA 3S4UA 2D0UA 4HFBA 4JLEA 3Q5XA 2LOPA 2BKNA 5M4YA 3P4SA 4IE7A 3N9QA 3QB5K 1Z8UA 2M67A 3D0TA 3RLFF 2R6GF 1WRDA 2KMFA 3CQGB 1FMWA 2WCAA 5LGNB 2N9DA 3FBZA 1EZ3A 4DV4T 1XNQT 1SE7A 1YQ4A 3U78A 4YSZA 4U2YA 5F3JA 3LSVA 2W62A 4UVBB 4HWFA 1CHUA 2YKSA 3C64A 2VKOA 4IDNA 4AKIA 3ZJ1A 2CM0A 2W0GA 4A56A 5E0OA 1D0XA 4P0AA 2A3DA 2KLQA 1Y64B 1E7PA 2Y48B 5LJNA 4G63A 2YU2A 4KBMB 4ZI2D 4P09A 4UVCB 5FXWA 4O8SA 2IW5B 4PAGA 4IDPA 3LDQB 2FJDA 2FUPA 4PK6A 4UXNB 3EUHA 1X79A 4DV7T 4CZZB 3N5LA 4GYSA 3B5MA 4WW0A 3PU8A 3AA1B 4IDQA 1T8BA 1IAPA 2X51A 1WYBA 5ETWA 3R84B 3BQKA 2V6YB 2W63A 3FZHB 3EABA 2PFVA 2IDOB 4IIJE 4X20E 4OX9T 2C0SA 2HN2A 2WWVA 2X9XA 3C4XA 5A1LA 1JNRA 3T1YT 2B1EA 2V7IA 2WSSV 2J62A 2JQ9A 3ZT7A 3FXEB 3PUZF 2NOXA 3EVYA 3OVUA 4EOZB 5H6RB 2KWHA 4QX7B 4HGAA 1HX8A 1G73A 4IREA 2C5KT 1WYCA 5IHYA 3WAJA 1IBMT 4JI1T 2UUBT 4TWDA 3H37A 4EAHA 4X65T 1KFYA 1SUMB 1Y01A 1LVKA 4UELA 3PJAA 3JADA 3AE7A 1QSDA 5FVLA 1KF6A 2H3RA 3ZMZB 4L5GA 3E0ZA 3O1HA 2XTLA 3GA8A 3PTRB 4JI7T 4YY3T 2K5BB 2WZHA 3M65A 2OV9A 1FMVA 5L3CB 4UV9B 2NP9A 3VHLA 4YHJA 2X9HA 4KI0F 5HEGA 4F6RC 2WS3A 5JTGA 3AA6B 4EEDA 1MMDA 2VK9A 4IDZA 5IYZE 2V6YA 4BJMA 2AE9A 3OBVE 1H7CA 4OK0A 4C91A 3IEEA 4HWDA 3HA4A 3PUYF 1NENA 2W67A 4J2CA 4ADZA 4GKJT 1JNZA 2YINA 2L9QA 1YQ3A 4X64T 3AE3A 5FP3A 3AECA 2KZ7B 3P8CD 4YT0A 3A7MA 3LG7A 3VRAA 4U74A 3L3PA 3G06A 2ZM8A 4PFPA 3RX6A 2XY8B 1T7SA 2DHRA 2E2AA 5L47A 4UV8B 5AQNB 2E5VA 1IJ6A 1OEDE 2CPTA 5JR9B 1HS7A 2UXNB 3NRYA 4DV3T 4BAYB 4NXMT 5HXCA 4KP3C 4Z8XA 1MNDA 4PFOA 2FBWA 1W0BA 2DWKA 4IE4A 3FXDB 4O4HE 3KBTA 3UUMA 4DBRA 4IGUA 4XZCA 2CMRA 2NTYA 4PNIA 3SRZA 3AVSA 4KHZF 2YK0A 2IC6A 4PJLA 3ZKRA 3ZN1B 2WDVA 2QA7A 5CFBA 4QH1A 2PJQA 3RQWA 2N2NA 2CBJA 3RYCE 4U2ZA 2V7KA 3FZKB 4X1YE 4DR6T 2M6BA 3DTOA 4X5TA 5HEOA 5HYAA 4I43B 4DMWA 3EDVA 5JDGA 2M6IA 2D5UA 2E9XD 3ZMUB 3AE6A 4M1PA 4UF0B 3CMLA 5JR9C 5AQKB 2CA5A 3N2OA 2V7MA 5JDLA 3JAEA 1HTJF 3KV9A 3PUXF 4ILUA 5AQFB 4JYAT 3OYZA 3TLVA 2G0UA 2RP4A 3HR0A 2QVAA 3KVAA 3BQLA 3NBXX 4LF6T 4O2BE 4EB6E 2KSRA 3K3QC 4TNVA 3O4XE 3ZT5A 2WBLA 1G8XA 4DR5T 2XAFB 5JR9A 4OFZA 5ADXL 4TZ4C 5AQHB 2ZMAA 3B13A 5FYMA 2FJAA 4HFCA 4EGWA 2C5JA 4U33A 3ZMTB 2PBIA 4CI1B 3MXZA 2E5LT 2YOEA 2VKHA 1D0ZA 3LK2B 3QUJA 3ZSTA 2LKGA 4U7YA 2BDEA 3T1HT 2LSYA 4DR1T 4JEUB 5LP6E 3L09A 3CK6A 4UIGA 5IWAT 1KNRA 5DQWA 4DR7T 2JQKA 4ZZBA 2X0LB 3PDYA 1UGOA 1XDOA 3PE0A 4ANJA 3GMIA 4B3MT 2HPJA 3KDSE 2K48A 2H7OA 4ILAA 4KHPT 3RIAA 4QHOA 1I94T 2YDSA 2A72A 3ZT6A 3JAFA 5EZYE 3I0QA 3CQXC 2CBIA 3RPUA 1J5ET 4IE5A 3AEGA 1QLBA 4QXCB 3I9YA 3OKQA 3CX7B 3CQCB 2WDQA 2ZM0A 3PURA 4HFDA 2W00A 4XAXB 2HN1A 4OYJA 4I4TE 5LGTB 2IAKA 2MTQA 4TWHA 3IF8B 2MYSA 2H88A 4G2AA 1KK7A 3AE2A 2OA5A 2Q9QD 4B6XA 1KEYA 2J4GA 2LSKA 2X0YA 1MNEA 5LHIB 4WNKA 2XQ8A 1HNXT 1L0VA 4XBFB 5HCMA 2X0HA 4DV0T 2E9XB 1YXRA 5JRCB 3ZSSA 3UULA 2CLYB 2VL0A 4QH5A 3N9PA 4EYYR 3KV6A 1I6ZA 5LMUT 5J1GA 2ZM2A 4CI3B 4AKRB 2GK9A 2LRLA 1CUNA 3ONLC 3RYFE 1HX1B 2V5DA 2IHR1 4X62T 2JQHA 1HF8A 4NUVA 3NRXA 3UUXB 2KNDA 4GOUA 2UXCT 4LFAT 3HL6A 3ZMSB 3W15B 4AI6A 5LMNT 4IE0A 1IBKT 5LHHB 1NAFA 3RC3A 4AQYT 4QXHB 2NW8A 4DIDB 4EV6A 2DWGA 3RYIE 5ABHA 2XM2A 4QH4A 3HKCE 2CLYC 4CN6A 4V1Av 3UU5A 4YFSA 2DLRA 3SFEA 3O1JA 2NW9A 1N33T 2CHOA 3ZMVB 2XQ4A 3UFGA 1MMGA 3NVOA 1J1JA 3OYXA 2LHRA 1UCUA 5L4EA 4O4JE 2BS4A 2VB6A 4L9IA 4ZI3D 2E9XA 5JRCA 1MMAA 3RIFA 4WYVA 5J2TE 4EZHA 3P4RA 2QRXA 1QUUA 1FIOA 2UUCT 4TUYE 1UK5A 1WR0A 4H63V 3UT5E 1D0YA 1YKHB 3AE5A 3ANWA 2WM9A 4IHJE 2ODUA 2LSIA 5H6QB 4X66T 5LA6E 3HKBE 3N9MA 4ZS2A 3IHRA 5C8YE 3O9XA 4K0KT 2MPKA 4EZ4A 2CE7A 3AAIA 1BR2A 2AXDS 1FEWA 5JH7E 4DNDA 5C2TA 5LOVE 2Q9QB 2RPAA 4B3TT 2XJ7A 3AB3B 3Q5EA 5HWXA 2YEVC 3RQUA 2LHNA 2VASA 4QXBB 4B3RT 2YN6A 4X1IE 1D1CA 1T98A 4E7ZA 4CI2B 4HN9A 1IJ5A 2XQ9A 4WZXA 3AVRA 4I50E 3WAKA 3I0OA 2Y6XA 4QKNA 2BG9B 3UQ4A 3QK6A 4P1NA 3PJAJ 2F4VT 4H63H 4H9PC 4CXWA 2NW7A 4X1KE 2JPFA 5AQSB 4IL4A 4U72A 4IL9A 5HCJA 4Z91A 3ZYMA 4MLKA 2V7JA 3AEDA 3M3ZB 5AQTB 2EHOD 4U3CA 3KV5A 5KX5E 4ZXLA 1YD8G 1FJGT 3PUGA 5L3FB 1Z0PA 5L3DB 3BK9A 1N34T 3HI2A 1W9RA 3A5XA 4TWFA 1BR4A 3NZQA 5GONE 3UUBA 2V7LA 2X67A 5ABFB 2LOSA 3RI5A 4BJNA 4LMJA 5FY1A 4HTEA 2NR4A 2BG9C 3C98B 3EDUA 2LT3A 3AAAB 2XZEA 3DP7A 3FBLA 1T72A 2Q9QA 2D9DA 3JC6D 4PK4A 3QOFA 4HKAA 4KMCA 5JDNA 5AQJB 3QB5A 4FI5A 1HG2A 3SOLA 1ZV4X 2LEHA 4DUYT 3AA7B 4LFCT 1LVFA 1M62A 5KMGP 2DL1A 3SS1A 4MBQA 5AQIB 5FXZA 2PG8A 1HFAA 2BG9A 3Q9DA 3ZN0B 2IIUA 3UU6A 5HAXA 1GQEA 1NWMX 2MBGA 5EK4A 3RKGA 4ZI2C 3ZYLA 5DABA 1LKXA 3TLTA 2UU9T 4OYKA 3ONXA 2A2FX 4LF4T 4YTMA 4JI8T 2K3WA 5BR8T 4E7SA 4NPPA 4JEHB 3CX6B 1XZYA 2KWIB 3AA0B 5FL1A 3LJCA 1SA0E 3NKZA 4FJOA 1BR0A 4U7IA 5F5WA 1MIVA 3K3NA 5ABFA 3UTKA 3UQ7A 4UEMA 5ABEA 1XMOT 4AXPA 5HEHA 4C90A 2CRBA 2WWUA 3E08A 4ZI3C 5AQVB 1N32T 2X66A 3Q2MA 4MALA 2LKHA 3ZCJA 5HEUA 2XQ5A 4UVAB 4ILBA 5DJQC 4EEBA 3TLWA 3N9LA 3B57A 3AEFA 4JI3T 5ABGA 4O4LE 4DUZT 3ZPOA 3X1DA 2EHOB 3SWHA 5JDMA 4HWIB 3CIRA 3P7IA 3CKDA 3JCFA 2VKDA 1WLXA 4NXNT 2JIWA 1HG5A 1O3XA 3FZLB 3PUVF 2XUEA 5HWYA 1YW0A 3SFDA 1UUSA 2UXBT 4L0RA 2W61A 2CWYA 3AAEB 4LF9T 1HR0T 4IDOA 2XAHB 3RYHE 1HNWT 2FJEA 3GWHA 2HPLA 5AQLB 3UU4A 3FHNA 2A9UA 3AE8A 3MACA 3VR8A 4YJ2E 2CXFA 2YDRA 2N1GA 3U3IA 4HWHA 1XDPA
chains in the Genus database with same CATH topology
4B3RT 1XMOT 4AQYT 4JI4T 2UUAT 2E5LT 4DR3T 4OX9T 1N32T 4JI5T 4DV4T 4JI2T 1XNQT 1HNXT 1XMQT 4DV0T 3T1HT 4DR6T 3T1YT 4DUYT 4DR1T 1N33T 1HNZT 2F4VT 4LFCT 5IWAT 3OTOT 4GKJT 4JI3T 4LF8T 4JV5T 4DR7T 2UXDT 4DUZT 4GKKT 4X64T 4JI0T 2ZM6T 1XNRT 4LF5T 5LMUT 4DR4T 4NXNT 4LF7T 4B3ST 4B3MT 2UUCT 4DR2T 2VQET 4KHPT 2UU9T 1FJGT 2UXBT 1I94T 1IBMT 4JI1T 4JI6T 2UUBT 4LF4T 4JYAT 1N34T 4JI8T 4X66T 1J5ET 5BR8T 1HR0T 4LF9T 4X62T 2HHHT 4X65T 4K0KT 4DV5T 4LF6T 1HNWT 4DV6T 1IBLT 4DV3T 4NXMT 4YHHT 4DV7T 4LFBT 4DV2T 2VQFT 2UXCT 1N36T 4LFAT 4DR5T 4JI7T 4B3TT 4YY3T 5LMNT 4DV1T 1IBKT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3R T;  1XMO T;  4AQY T;  4JI4 T;  2UUA T;  2E5L T;  4DR3 T;  4OX9 T;  1N32 T;  4JI5 T;  4DV4 T;  4JI2 T;  1XNQ T;  1HNX T;  1XMQ T;  4DV0 T;  3T1H T;  4DR6 T;  3T1Y T;  4DUY T;  4DR1 T;  1N33 T;  1HNZ T;  2F4V T;  4LFC T;  5IWA T;  3OTO T;  4GKJ T;  4JI3 T;  4LF8 T;  4JV5 T;  4DR7 T;  2UXD T;  4DUZ T;  4GKK T;  4X64 T;  4JI0 T;  2ZM6 T;  1XNR T;  4LF5 T;  5LMU T;  4DR4 T;  4NXN T;  4LF7 T;  4B3S T;  4B3M T;  2UUC T;  4DR2 T;  2VQE T;  4KHP T;  2UU9 T;  1FJG T;  2UXB T;  1I94 T;  1IBM T;  4JI1 T;  4JI6 T;  2UUB T;  4LF4 T;  4JYA T;  1N34 T;  4JI8 T;  4X66 T;  1J5E T;  5BR8 T;  1HR0 T;  4LF9 T;  4X62 T;  2HHH T;  4X65 T;  4K0K T;  4DV5 T;  4LF6 T;  1HNW T;  4DV6 T;  1IBL T;  4DV3 T;  4NXM T;  4YHH T;  4DV7 T;  4LFB T;  4DV2 T;  2VQF T;  2UXC T;  1N36 T;  4LFA T;  4DR5 T;  4JI7 T;  4B3T T;  4YY3 T;  5LMN T;  4DV1 T;  1IBK T; 
#chains in the Genus database with same CATH topology
 3HKD E;  3LK3 B;  4K0U A;  2WP9 A;  3AEE A;  3KIN B;  1ZKE A;  2BBJ A;  1B7T A;  2LE8 A;  2ZLY A;  4JUY A;  1UUR A;  3UU3 A;  1W0A A;  5JRE A;  4P0B A;  5AQQ B;  3H3M A;  4COF A;  5KXJ A;  1XMQ T;  4AQG A;  2VVS A;  2CXL A;  3K8P C;  5AQM B;  4H9S E;  3ZCI A;  2QYW A;  4CXX A;  2XHE B;  3TKL B;  2I6H A;  4NUU A;  4HFI A;  4ASK A;  5HXH A;  5L3E B;  3VU7 H;  2X9Y A;  4TN7 B;  1HCI A;  4HFH A;  2SPC A;  4YTP A;  4JI0 T;  2MAW A;  1XNR T;  4N78 D;  4DR4 T;  5AQO B;  2PTF A;  3AXJ A;  3F57 A;  4TX5 A;  2VWA A;  3UUN A;  2I59 A;  4U31 A;  3I1A A;  4MFR A;  3RH3 A;  2EHO A;  3C4Z A;  1X9B A;  2XSB A;  2LSJ A;  5LBM A;  5FY7 A;  2P9B A;  4ZHQ E;  3ANW B;  5FY0 A;  2JJ9 A;  4PJJ A;  3UFE A;  3JC6 C;  2JMK A;  2KT9 A;  3Q5W A;  2XAS B;  2VVN A;  4O4I E;  1YKE B;  4HFV A;  4PW8 A;  1BR1 A;  2XQY A;  1U4Q A;  4I0U A;  2FJB A;  1WCR A;  3ETV A;  4IT4 A;  5CA0 E;  1WR6 A;  2K24 A;  4HFE A;  1NEK A;  1D1A A;  4GIW A;  2BVM A;  3L39 A;  3PV0 F;  3UU8 A;  3CPZ A;  4ZZC A;  5L3G B;  2VL8 A;  5HXS A;  3ZC0 A;  2E9X C;  4PJM A;  4CXY A;  3KV4 A;  3FZF B;  3NWI A;  4ZEY A;  3N9N A;  1MIW A;  2D2S A;  3WI3 A;  1XWM A;  4EIW A;  5FVK A;  2WAU A;  3C50 A;  3V5S A;  3OJA A;  5DQV A;  3K1S A;  3LK4 2;  1OXZ A;  4KUM B;  2L8K A;  5JDH A;  3ESL A;  4EYU A;  2V6X A;  2XAJ B;  2K9A A;  2ACZ A;  2NTX A;  1V9D A;  4GK5 E;  2I0M A;  3C4W A;  3ZC1 A;  5JDQ A;  4DV5 T;  3VRB A;  2BBH A;  5LCY A;  4YHH T;  4LFB T;  1W09 A;  3KFW X;  5LNK A;  2YU1 A;  3ONJ A;  3EHZ A;  4DV1 T;  5FXX A;  2XQ7 A;  3MA9 A;  3CWZ B;  4HEA A;  1US7 B;  5HXE A;  4GK0 E;  3RIU C;  4Q25 A;  4JI4 T;  2ES0 A;  3RGL A;  2Z6E A;  2W2U A;  3NZP A;  2XM1 A;  4BA9 A;  2L3L A;  2WB5 A;  3IBP A;  2BZB A;  3Q5D A;  4DBQ A;  1VCT A;  4JV5 T;  2DI4 A;  2XAQ B;  3N9O A;  3KVB A;  5LBQ B;  2BG9 E;  3MK7 C;  5LG3 A;  5BMV E;  2XQA A;  5AFU L;  2IC9 A;  3RIU A;  5IUX A;  2WQY A;  5L4H A;  5KDM C;  3H3A A;  2QGS A;  2MOZ A;  2X9W A;  3ETU A;  2VQE T;  5FXV A;  3RF1 A;  3PUS A;  5EK2 A;  3AEB A;  4JI6 T;  3TLU A;  3J9X 1;  2H89 A;  4AKL A;  2V26 A;  2RA1 A;  5LB7 B;  5FKY A;  1WFD A;  4AIS A;  4QWN B;  3ZEF B;  2LRK A;  2J47 A;  2BKP A;  5FNV E;  3FZM B;  1VRB A;  1M7K A;  3PUQ A;  3AE9 A;  3R6N A;  2Q9Q C;  4DO0 A;  5EK3 A;  2J1D G;  1MIY A;  4YTN A;  4LML A;  1OWA A;  5JDF A;  4PK5 A;  3GN5 B;  4ERR A;  5LJM A;  1D1B A;  1R8I A;  4WBO A;  2LSG A;  3KBU A;  2LM9 A;  2WU5 A;  3MKD A;  2E8I A;  3OPC A;  2CHN A;  3P4Q A;  2BS2 A;  2V5C A;  3QNU A;  1SHZ C;  3EI0 A;  3MJX A;  2W4X A;  3OTO T;  4ISS A;  4LF8 T;  4CQI A;  2BVL A;  5J0Z A;  2UXD T;  4AKG A;  4CN4 A;  2NWB A;  1ZP0 A;  2B76 A;  3VKG A;  4TV9 E;  3TLS A;  3ZLI A;  2H7V C;  1ZHC A;  2JRK A;  2WZI A;  3DJB A;  5FL0 A;  4LF7 T;  1OED B;  5AQR B;  4DR2 T;  2V1D B;  2HH7 A;  4Z90 A;  3RHW A;  3RRC A;  2LLY A;  2DCF A;  3O1I A;  4UR9 A;  4ZOL E;  4YSY A;  5L3B B;  2YDQ A;  2CEA A;  3ZYK A;  4DV6 T;  3P4P A;  1E2A A;  3CVR A;  5CJ5 A;  1KNP A;  4DV2 T;  2VQF T;  1N36 T;  2V8S V;  1UX5 A;  3K3O A;  2ACX A;  1E1H B;  5L2L A;  4MHC A;  3ZJ2 A;  5CB4 E;  4WBN E;  4YSX A;  4AKH A;  5LYJ E;  4TNW A;  3F2E A;  3P50 A;  4ZI7 E;  5J2U E;  1KNZ A;  4DR3 T;  2CCQ A;  2BS3 A;  3ABV A;  1ZOY A;  4JI2 T;  3P4W A;  2JMH A;  1IZN B;  4YJ3 E;  3QC9 A;  3RRW A;  1HNZ T;  5JVD E;  1OED C;  3GN5 A;  3HKE E;  3C51 A;  4CN1 A;  2LM2 A;  3N2G E;  4GKK T;  1J5W A;  2WMO A;  4YLH A;  2ZM6 T;  3PUA A;  2CWO A;  3BQI A;  4OHF A;  4HWC A;  5AQG B;  3RKO A;  1VCS A;  2VUR A;  3AEA A;  4EXT A;  3LBX B;  5CA1 E;  2XPK A;  3E22 E;  4B3S T;  1LRZ A;  3AXJ B;  4KX6 A;  5FMN A;  2WY2 A;  2KIN B;  4GYR A;  4NIQ A;  3J7Y q;  1S94 A;  1ZEE A;  2IUB A;  2IML A;  4AIU A;  1OED A;  2C5I T;  2D0T A;  5LHG B;  3FB2 A;  4ILC A;  2W66 A;  3L8R A;  2UXX B;  4LMK A;  4YXD A;  5HEJ A;  5AQU B;  2X68 A;  1VOM A;  3EAM A;  3PUW F;  5LG4 A;  2Y8D A;  2OLT A;  3RC8 A;  2CXD A;  2JQQ A;  3CX8 B;  1DU2 A;  2XQ6 A;  4DMV A;  4JBW F;  1U5P A;  3F31 A;  3MZK B;  2UUA T;  4AQF C;  5CGM A;  4H9R C;  4JI5 T;  3AE4 A;  2VKJ A;  4H9Q C;  4QX8 B;  4A5X A;  2XQ3 A;  4ZS3 A;  3T8O A;  4F8H A;  4TV8 E;  4IE6 A;  1MMN A;  2ODV A;  2WDR A;  2KXP B;  3N2K E;  1AJ3 A;  5AQP B;  4A97 A;  3PU3 A;  4UF0 A;  2XAG B;  5HXR A;  2WU2 A;  4PJN A;  2EHO C;  4DVD A;  3AE1 A;  3V5U A;  4LF5 T;  5F8P A;  1S35 A;  5LXT E;  3IA3 A;  4AQF A;  5JQG E;  5LGU B;  4A98 A;  3I9W A;  2XSA A;  3VR9 A;  2BKO A;  5C3J A;  2DNX A;  4H9N C;  3A8Y C;  4I55 E;  4HE8 A;  4H9O C;  2WMN A;  3VKH A;  3LBX A;  1UX4 A;  2HHH T;  4IST A;  2LJL A;  3LFM A;  1IBL T;  4O2A E;  5TAO A;  3S4U A;  2D0U A;  4HFB A;  4JLE A;  3Q5X A;  2LOP A;  2BKN A;  5M4Y A;  3P4S A;  4IE7 A;  3N9Q A;  3QB5 K;  1Z8U A;  2M67 A;  3D0T A;  3RLF F;  2R6G F;  1WRD A;  2KMF A;  3CQG B;  1FMW A;  2WCA A;  5LGN B;  2N9D A;  3FBZ A;  1EZ3 A;  4DV4 T;  1XNQ T;  1SE7 A;  1YQ4 A;  3U78 A;  4YSZ A;  4U2Y A;  5F3J A;  3LSV A;  2W62 A;  4UVB B;  4HWF A;  1CHU A;  2YKS A;  3C64 A;  2VKO A;  4IDN A;  4AKI A;  3ZJ1 A;  2CM0 A;  2W0G A;  4A56 A;  5E0O A;  1D0X A;  4P0A A;  2A3D A;  2KLQ A;  1Y64 B;  1E7P A;  2Y48 B;  5LJN A;  4G63 A;  2YU2 A;  4KBM B;  4ZI2 D;  4P09 A;  4UVC B;  5FXW A;  4O8S A;  2IW5 B;  4PAG A;  4IDP A;  3LDQ B;  2FJD A;  2FUP A;  4PK6 A;  4UXN B;  3EUH A;  1X79 A;  4DV7 T;  4CZZ B;  3N5L A;  4GYS A;  3B5M A;  4WW0 A;  3PU8 A;  3AA1 B;  4IDQ A;  1T8B A;  1IAP A;  2X51 A;  1WYB A;  5ETW A;  3R84 B;  3BQK A;  2V6Y B;  2W63 A;  3FZH B;  3EAB A;  2PFV A;  2IDO B;  4IIJ E;  4X20 E;  4OX9 T;  2C0S A;  2HN2 A;  2WWV A;  2X9X A;  3C4X A;  5A1L A;  1JNR A;  3T1Y T;  2B1E A;  2V7I A;  2WSS V;  2J62 A;  2JQ9 A;  3ZT7 A;  3FXE B;  3PUZ F;  2NOX A;  3EVY A;  3OVU A;  4EOZ B;  5H6R B;  2KWH A;  4QX7 B;  4HGA A;  1HX8 A;  1G73 A;  4IRE A;  2C5K T;  1WYC A;  5IHY A;  3WAJ A;  1IBM T;  4JI1 T;  2UUB T;  4TWD A;  3H37 A;  4EAH A;  4X65 T;  1KFY A;  1SUM B;  1Y01 A;  1LVK A;  4UEL A;  3PJA A;  3JAD A;  3AE7 A;  1QSD A;  5FVL A;  1KF6 A;  2H3R A;  3ZMZ B;  4L5G A;  3E0Z A;  3O1H A;  2XTL A;  3GA8 A;  3PTR B;  4JI7 T;  4YY3 T;  2K5B B;  2WZH A;  3M65 A;  2OV9 A;  1FMV A;  5L3C B;  4UV9 B;  2NP9 A;  3VHL A;  4YHJ A;  2X9H A;  4KI0 F;  5HEG A;  4F6R C;  2WS3 A;  5JTG A;  3AA6 B;  4EED A;  1MMD A;  2VK9 A;  4IDZ A;  5IYZ E;  2V6Y A;  4BJM A;  2AE9 A;  3OBV E;  1H7C A;  4OK0 A;  4C91 A;  3IEE A;  4HWD A;  3HA4 A;  3PUY F;  1NEN A;  2W67 A;  4J2C A;  4ADZ A;  4GKJ T;  1JNZ A;  2YIN A;  2L9Q A;  1YQ3 A;  4X64 T;  3AE3 A;  5FP3 A;  3AEC A;  2KZ7 B;  3P8C D;  4YT0 A;  3A7M A;  3LG7 A;  3VRA A;  4U74 A;  3L3P A;  3G06 A;  2ZM8 A;  4PFP A;  3RX6 A;  2XY8 B;  1T7S A;  2DHR A;  2E2A A;  5L47 A;  4UV8 B;  5AQN B;  2E5V A;  1IJ6 A;  1OED E;  2CPT A;  5JR9 B;  1HS7 A;  2UXN B;  3NRY A;  4DV3 T;  4BAY B;  4NXM T;  5HXC A;  4KP3 C;  4Z8X A;  1MND A;  4PFO A;  2FBW A;  1W0B A;  2DWK A;  4IE4 A;  3FXD B;  4O4H E;  3KBT A;  3UUM A;  4DBR A;  4IGU A;  4XZC A;  2CMR A;  2NTY A;  4PNI A;  3SRZ A;  3AVS A;  4KHZ F;  2YK0 A;  2IC6 A;  4PJL A;  3ZKR A;  3ZN1 B;  2WDV A;  2QA7 A;  5CFB A;  4QH1 A;  2PJQ A;  3RQW A;  2N2N A;  2CBJ A;  3RYC E;  4U2Z A;  2V7K A;  3FZK B;  4X1Y E;  4DR6 T;  2M6B A;  3DTO A;  4X5T A;  5HEO A;  5HYA A;  4I43 B;  4DMW A;  3EDV A;  5JDG A;  2M6I A;  2D5U A;  2E9X D;  3ZMU B;  3AE6 A;  4M1P A;  4UF0 B;  3CML A;  5JR9 C;  5AQK B;  2CA5 A;  3N2O A;  2V7M A;  5JDL A;  3JAE A;  1HTJ F;  3KV9 A;  3PUX F;  4ILU A;  5AQF B;  4JYA T;  3OYZ A;  3TLV A;  2G0U A;  2RP4 A;  3HR0 A;  2QVA A;  3KVA A;  3BQL A;  3NBX X;  4LF6 T;  4O2B E;  4EB6 E;  2KSR A;  3K3Q C;  4TNV A;  3O4X E;  3ZT5 A;  2WBL A;  1G8X A;  4DR5 T;  2XAF B;  5JR9 A;  4OFZ A;  5ADX L;  4TZ4 C;  5AQH B;  2ZMA A;  3B13 A;  5FYM A;  2FJA A;  4HFC A;  4EGW A;  2C5J A;  4U33 A;  3ZMT B;  2PBI A;  4CI1 B;  3MXZ A;  2E5L T;  2YOE A;  2VKH A;  1D0Z A;  3LK2 B;  3QUJ A;  3ZST A;  2LKG A;  4U7Y A;  2BDE A;  3T1H T;  2LSY A;  4DR1 T;  4JEU B;  5LP6 E;  3L09 A;  3CK6 A;  4UIG A;  5IWA T;  1KNR A;  5DQW A;  4DR7 T;  2JQK A;  4ZZB A;  2X0L B;  3PDY A;  1UGO A;  1XDO A;  3PE0 A;  4ANJ A;  3GMI A;  4B3M T;  2HPJ A;  3KDS E;  2K48 A;  2H7O A;  4ILA A;  4KHP T;  3RIA A;  4QHO A;  1I94 T;  2YDS A;  2A72 A;  3ZT6 A;  3JAF A;  5EZY E;  3I0Q A;  3CQX C;  2CBI A;  3RPU A;  1J5E T;  4IE5 A;  3AEG A;  1QLB A;  4QXC B;  3I9Y A;  3OKQ A;  3CX7 B;  3CQC B;  2WDQ A;  2ZM0 A;  3PUR A;  4HFD A;  2W00 A;  4XAX B;  2HN1 A;  4OYJ A;  4I4T E;  5LGT B;  2IAK A;  2MTQ A;  4TWH A;  3IF8 B;  2MYS A;  2H88 A;  4G2A A;  1KK7 A;  3AE2 A;  2OA5 A;  2Q9Q D;  4B6X A;  1KEY A;  2J4G A;  2LSK A;  2X0Y A;  1MNE A;  5LHI B;  4WNK A;  2XQ8 A;  1HNX T;  1L0V A;  4XBF B;  5HCM A;  2X0H A;  4DV0 T;  2E9X B;  1YXR A;  5JRC B;  3ZSS A;  3UUL A;  2CLY B;  2VL0 A;  4QH5 A;  3N9P A;  4EYY R;  3KV6 A;  1I6Z A;  5LMU T;  5J1G A;  2ZM2 A;  4CI3 B;  4AKR B;  2GK9 A;  2LRL A;  1CUN A;  3ONL C;  3RYF E;  1HX1 B;  2V5D A;  2IHR 1;  4X62 T;  2JQH A;  1HF8 A;  4NUV A;  3NRX A;  3UUX B;  2KND A;  4GOU A;  2UXC T;  4LFA T;  3HL6 A;  3ZMS B;  3W15 B;  4AI6 A;  5LMN T;  4IE0 A;  1IBK T;  5LHH B;  1NAF A;  3RC3 A;  4AQY T;  4QXH B;  2NW8 A;  4DID B;  4EV6 A;  2DWG A;  3RYI E;  5ABH A;  2XM2 A;  4QH4 A;  3HKC E;  2CLY C;  4CN6 A;  4V1A v;  3UU5 A;  4YFS A;  2DLR A;  3SFE A;  3O1J A;  2NW9 A;  1N33 T;  2CHO A;  3ZMV B;  2XQ4 A;  3UFG A;  1MMG A;  3NVO A;  1J1J A;  3OYX A;  2LHR A;  1UCU A;  5L4E A;  4O4J E;  2BS4 A;  2VB6 A;  4L9I A;  4ZI3 D;  2E9X A;  5JRC A;  1MMA A;  3RIF A;  4WYV A;  5J2T E;  4EZH A;  3P4R A;  2QRX A;  1QUU A;  1FIO A;  2UUC T;  4TUY E;  1UK5 A;  1WR0 A;  4H63 V;  3UT5 E;  1D0Y A;  1YKH B;  3AE5 A;  3ANW A;  2WM9 A;  4IHJ E;  2ODU A;  2LSI A;  5H6Q B;  4X66 T;  5LA6 E;  3HKB E;  3N9M A;  4ZS2 A;  3IHR A;  5C8Y E;  3O9X A;  4K0K T;  2MPK A;  4EZ4 A;  2CE7 A;  3AAI A;  1BR2 A;  2AXD S;  1FEW A;  5JH7 E;  4DND A;  5C2T A;  5LOV E;  2Q9Q B;  2RPA A;  4B3T T;  2XJ7 A;  3AB3 B;  3Q5E A;  5HWX A;  2YEV C;  3RQU A;  2LHN A;  2VAS A;  4QXB B;  4B3R T;  2YN6 A;  4X1I E;  1D1C A;  1T98 A;  4E7Z A;  4CI2 B;  4HN9 A;  1IJ5 A;  2XQ9 A;  4WZX A;  3AVR A;  4I50 E;  3WAK A;  3I0O A;  2Y6X A;  4QKN A;  2BG9 B;  3UQ4 A;  3QK6 A;  4P1N A;  3PJA J;  2F4V T;  4H63 H;  4H9P C;  4CXW A;  2NW7 A;  4X1K E;  2JPF A;  5AQS B;  4IL4 A;  4U72 A;  4IL9 A;  5HCJ A;  4Z91 A;  3ZYM A;  4MLK A;  2V7J A;  3AED A;  3M3Z B;  5AQT B;  2EHO D;  4U3C A;  3KV5 A;  5KX5 E;  4ZXL A;  1YD8 G;  1FJG T;  3PUG A;  5L3F B;  1Z0P A;  5L3D B;  3BK9 A;  1N34 T;  3HI2 A;  1W9R A;  3A5X A;  4TWF A;  1BR4 A;  3NZQ A;  5GON E;  3UUB A;  2V7L A;  2X67 A;  5ABF B;  2LOS A;  3RI5 A;  4BJN A;  4LMJ A;  5FY1 A;  4HTE A;  2NR4 A;  2BG9 C;  3C98 B;  3EDU A;  2LT3 A;  3AAA B;  2XZE A;  3DP7 A;  3FBL A;  1T72 A;  2Q9Q A;  2D9D A;  3JC6 D;  4PK4 A;  3QOF A;  4HKA A;  4KMC A;  5JDN A;  5AQJ B;  3QB5 A;  4FI5 A;  1HG2 A;  3SOL A;  1ZV4 X;  2LEH A;  4DUY T;  3AA7 B;  4LFC T;  1LVF A;  1M62 A;  5KMG P;  2DL1 A;  3SS1 A;  4MBQ A;  5AQI B;  5FXZ A;  2PG8 A;  1HFA A;  2BG9 A;  3Q9D A;  3ZN0 B;  2IIU A;  3UU6 A;  5HAX A;  1GQE A;  1NWM X;  2MBG A;  5EK4 A;  3RKG A;  4ZI2 C;  3ZYL A;  5DAB A;  1LKX A;  3TLT A;  2UU9 T;  4OYK A;  3ONX A;  2A2F X;  4LF4 T;  4YTM A;  4JI8 T;  2K3W A;  5BR8 T;  4E7S A;  4NPP A;  4JEH B;  3CX6 B;  1XZY A;  2KWI B;  3AA0 B;  5FL1 A;  3LJC A;  1SA0 E;  3NKZ A;  4FJO A;  1BR0 A;  4U7I A;  5F5W A;  1MIV A;  3K3N A;  5ABF A;  3UTK A;  3UQ7 A;  4UEM A;  5ABE A;  1XMO T;  4AXP A;  5HEH A;  4C90 A;  2CRB A;  2WWU A;  3E08 A;  4ZI3 C;  5AQV B;  1N32 T;  2X66 A;  3Q2M A;  4MAL A;  2LKH A;  3ZCJ A;  5HEU A;  2XQ5 A;  4UVA B;  4ILB A;  5DJQ C;  4EEB A;  3TLW A;  3N9L A;  3B57 A;  3AEF A;  4JI3 T;  5ABG A;  4O4L E;  4DUZ T;  3ZPO A;  3X1D A;  2EHO B;  3SWH A;  5JDM A;  4HWI B;  3CIR A;  3P7I A;  3CKD A;  3JCF A;  2VKD A;  1WLX A;  4NXN T;  2JIW A;  1HG5 A;  1O3X A;  3FZL B;  3PUV F;  2XUE A;  5HWY A;  1YW0 A;  3SFD A;  1UUS A;  2UXB T;  4L0R A;  2W61 A;  2CWY A;  3AAE B;  4LF9 T;  1HR0 T;  4IDO A;  2XAH B;  3RYH E;  1HNW T;  2FJE A;  3GWH A;  2HPL A;  5AQL B;  3UU4 A;  3FHN A;  2A9U A;  3AE8 A;  3MAC A;  3VR8 A;  4YJ2 E;  2CXF A;  2YDR A;  2N1G A;  3U3I A;  4HWH A;  1XDP A; 
#chains in the Genus database with same CATH homology
 4B3R T;  1XMO T;  4AQY T;  4JI4 T;  2UUA T;  2E5L T;  4DR3 T;  4OX9 T;  1N32 T;  4JI5 T;  4DV4 T;  4JI2 T;  1XNQ T;  1HNX T;  1XMQ T;  4DV0 T;  3T1H T;  4DR6 T;  3T1Y T;  4DUY T;  4DR1 T;  1N33 T;  1HNZ T;  2F4V T;  4LFC T;  5IWA T;  3OTO T;  4GKJ T;  4JI3 T;  4LF8 T;  4JV5 T;  4DR7 T;  2UXD T;  4DUZ T;  4GKK T;  4X64 T;  4JI0 T;  2ZM6 T;  1XNR T;  4LF5 T;  5LMU T;  4DR4 T;  4NXN T;  4LF7 T;  4B3S T;  4B3M T;  2UUC T;  4DR2 T;  2VQE T;  4KHP T;  2UU9 T;  1FJG T;  2UXB T;  1I94 T;  1IBM T;  4JI1 T;  4JI6 T;  2UUB T;  4LF4 T;  4JYA T;  1N34 T;  4JI8 T;  4X66 T;  1J5E T;  5BR8 T;  1HR0 T;  4LF9 T;  4X62 T;  2HHH T;  4X65 T;  4K0K T;  4DV5 T;  4LF6 T;  1HNW T;  4DV6 T;  1IBL T;  4DV3 T;  4NXM T;  4YHH T;  4DV7 T;  4LFB T;  4DV2 T;  2VQF T;  2UXC T;  1N36 T;  4LFA T;  4DR5 T;  4JI7 T;  4B3T T;  4YY3 T;  5LMN T;  4DV1 T;  1IBK T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...