3UUXB

Crystal structure of yeast fis1 in complex with mdv1 fragment containing n-terminal extension and coiled coil domains
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
207
structure length
132
Chain Sequence
DNKTCFRMLTYISDDLLNEIPKETSLFQGFKSYLPIAELAIEGVETAAISSSYSPSALKSFSQTLVNSLEFLNIQKNSTLSEIRDIEVEVENLRQKKEKLLGKIANIEQNQLLLEDNLKQIDDRLDFLEEYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords Mitochondria fission 1 protein
publication title Crystal structure of mitochondrial fission complex reveals scaffolding function for mitochondrial division 1 (mdv1) coiled coil.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
total genus 42
structure length 132
sequence length 207
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11542 Mdv1 Mitochondrial division protein 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3uuxB01
3UUXB
chains in the Genus database with same CATH superfamily
2OA5A 2MPKA 2XPKA 5LMNT 4X5TA 4V1Av 4X62T 1XDPA 3UUBA 2EHOD 3EDVA 5DABA 2CEAA 4DR1T 3P7IA 3EHZA 1MMNA 2NTYA 5LB7B 3LBXB 3AEGA 4UF0B 4IE0A 3RQWA 2R6GF 2JPFA 4HFIA 2NTXA 2DLRA 4AKRB 3AA1B 5ADXL 2VVSA 2JQQA 3SS1A 4DV6T 2X9WA 2VKJA 4CN6A 4EGWA 3LK2B 4LFCT 3UT5E 4EEDA 2VK9A 1HTJF 1W9RA 3UQ7A 1KNPA 4EB6E 2W66A 1NEKA 4Z90A 2H88A 5J2UE 3Q2MA 3JCFA 5JR9A 4LF9T 5KDMC 1I94T 2XAQB 4EYYR 5L47A 3RIUC 2ZM2A 3C4XA 2UU9T 2IIUA 3ZSSA 5LP6E 2XQ9A 4DR6T 4EZHA 2ZM6T 5AQJB 2K5BB 4CXYA 4OHFA 3O9XA 3EAMA 2IHR1 2KWIB 3ABVA 5JR9C 3UFGA 1G8XA 5AQGB 2E5LT 3WI3A 4O4JE 1J5ET 4O2BE 2D2SA 4CZZB 2V6YB 1KNRA 4NPPA 3AEAA 3VHLA 4TWHA 4IE7A 1E2AA 5LHGB 4TNWA 2WQYA 5AQOB 2WCAA 3ZYKA 1UURA 4U31A 4ASKA 4CN4A 3E08A 2WMNA 3K3QC 3HKEE 2XQ5A 2XQ6A 3NRYA 2A9UA 1HG2A 2XSAA 5L3CB 3F2EA 1WFDA 4NUVA 3RYFE 2D5UA 3CIRA 4C91A 2BG9E 4QX7B 4K0KT 5KMGP 3R6NA 1IBLT 4JV5T 1UGOA 4KUMB 3JC6C 2HHHT 3DP7A 4AQFA 2LEHA 3AE8A 3AE7A 3SFEA 1HCIA 2H7VC 4JI8T 3CKDA 4AQYT 2UUBT 1N36T 2VL8A 3RYCE 5FXVA 3RGLA 2V8SV 2YK0A 1U4QA 2J1DG 2PJQA 1MNDA 3AA6B 4EOZB 2C0SA 3AA0B 2VASA 4KP3C 3C4ZA 3UTKA 1XMQT 2ODVA 3RKOA 2M6IA 2BBJA 2X0HA 3AVSA 2H89A 3KFWX 3MJXA 4LFAT 2E9XD 1FJGT 3LSVA 4H9NC 4A5XA 3L39A 4YSXA 5LBMA 3QNUA 3CX6B 3HR0A 2LKHA 3RYIE 2CXLA 2KLQA 3FXEB 3NZPA 2HN1A 4IDZA 4CI3B 4FJOA 5JDHA 1HG5A 4A98A 3QUJA 5H6QB 3O1JA 3H37A 4P0BA 3T1HT 4ILCA 4KHZF 3LG7A 1LKXA 3MK7C 1IJ5A 2XZEA 3C4WA 4HFBA 3Q5WA 4B6XA 4O2AE 1Z0PA 2BS2A 3FZKB 5DJQC 3WAKA 3ZYLA 2FUPA 2Q9QA 2VURA 4MBQA 3RH3A 1T8BA 2V1DB 4DVDA 3FB2A 5HEGA 5FMNA 5KX5E 3P8CD 3ZJ2A 3KINB 2BZBA 3LK42 1WYCA 4JYAT 2LKGA 2NP9A 5HXCA 1XDOA 1NWMX 1YKHB 3NVOA 4ZOLE 4H9SE 1XNQT 3RQUA 2XQ4A 1OEDA 4B3MT 5BMVE 1XZYA 4X1KE 4EV6A 2PBIA 1MNEA 4ZI2D 3RIFA 2ZMAA 1LVKA 3KBTA 5FXWA 1JNZA 2JIWA 1T7SA 5HWXA 3ZT7A 2IW5B 3CQCB 2BKPA 3TLUA 4YTMA 2W67A 2V7MA 1OEDC 3O1HA 3UUMA 2YDRA 2CA5A 4IHJE 4XZCA 3O1IA 3QB5A 2C5IT 3TLTA 1KK7A 4PFOA 4LF4T 3ONJA 2CM0A 3O4XE 1Z8UA 3AEBA 2CXDA 5E0OA 3UU8A 4UV9B 5HCJA 4CQIA 1UX4A 1SE7A 4AISA 5ABHA 2F4VT 3NRXA 2WMOA 5LMUT 2WP9A 2XY8B 4DR4T 4ZXLA 4DV2T 2PG8A 5FY7A 3OTOT 3AXJB 1Y64B 2YOEA 3HKCE 3N9MA 4CXXA 3JC6D 2FJBA 3NWIA 1QLBA 3UUXB 5FXZA 4QXHB 3N9OA 2BKOA 2X51A 2YDSA 3RYHE 2DL1A 3EABA 2W4XA 4CI1B 2WB5A 4HEAA 3UUNA 2X66A 2VKDA 4K0UA 4OYJA 3G06A 3U78A 5AQTB 1IAPA 2V26A 5IWAT 3CX8B 2V5DA 5AQLB 4IE5A 4H9PC 4DUZT 3KVAA 1VCSA 3A7MA 4WBOA 4C90A 3PV0F 3A5XA 2JJ9A 3OKQA 1FMVA 3MACA 4LMLA 2UXBT 2VKOA 3PUSA 5C2TA 2SPCA 3SFDA 4UF0A 3P4WA 3ZMVB 5LHHB 4GKJT 5HEHA 1R8IA 4Q25A 2QRXA 3UU6A 5AQKB 2CWOA 2BS4A 3N5LA 1IJ6A 4B3ST 4EIWA 3EDUA 3AE1A 2VQET 4B3TT 2KINB 3PUZF 5AQIB 4AIUA 1O3XA 2A72A 2LLYA 1ZOYA 4QH4A 1S35A 2LSIA 4JI7T 4WZXA 4UR9A 3I1AA 3IHRA 3N9QA 3VRAA 5IHYA 3N9NA 2JRKA 2NW8A 3PUGA 3RIUA 4DMWA 2LSJA 3P50A 4H9QC 4YHHT 3AE2A 5AQNB 2ACZA 2W0GA 1HNWT 3OVUA 5LA6E 4U7IA 4AKLA 1X79A 2IC6A 2Q9QD 1YKEB 3PUXF 3P4QA 4HFDA 4XAXB 2V6YA 4YJ3E 1BR1A 5JRCB 3MXZA 2WAUA 4GK5E 1M7KA 2LE8A 2WY2A 1HF8A 4QX8B 4PJLA 1YXRA 4DBQA 2YKSA 5AQFB 4HFHA 1UCUA 4H63H 3ZEFB 5FP3A 5J2TE 4ZI3D 2I6HA 3RLFF 4TV9E 4AKGA 1GQEA 5FVKA 3AE4A 4QH5A 3EVYA 1G73A 5CJ5A 2X0YA 3PDYA 4BA9A 1JNRA 3F31A 3ZJ1A 5LCYA 3PUWF 3CPZA 4MHCA 3HI2A 4I43B 5DQVA 4X65T 3I0OA 2WWUA 2VB6A 2FJDA 2IMLA 2L3LA 3AEDA 4U72A 4ZI7E 5FL1A 4GYRA 3CX7B 5AQUB 2XQ3A 3K3OA 5J0ZA 2LM2A 2NW7A 3RRWA 2A2FX 1NENA 2LM9A 2UXNB 4QXCB 3DTOA 4EAHA 4AI6A 1UX5A 3AAAB 3NBXX 1OWAA 3QOFA 3PU8A 1D0YA 3HKBE 2OLTA 3ESLA 3OPCA 1MIVA 3RRCA 4DV4T 2HN2A 1FEWA 2JQ9A 4EEBA 2XHEB 3PE0A 3GMIA 1ZEEA 4NXNT 4UEMA 2WBLA 1XNRT 1HX8A 4DUYT 2IUBA 3UU3A 4JI2T 2Y48B 2H7OA 2E8IA 4BJNA 5L3EB 5M4YA 3SOLA 2NOXA 2V6XA 2XM1A 4JLEA 3SRZA 2W62A 2DWGA 5HYAA 3I9WA 2WU5A 4CN1A 1KFYA 1J5WA 4KI0F 1YD8G 4YTNA 3X1DA 4O8SA 5JREA 2X67A 5EZYE 1D1CA 3ZC0A 4IDOA 5AFUL 3H3AA 2BG9B 4KHPT 1N34T 4YXDA 3OYXA 3ZLIA 3Q9DA 3PUQA 3AE3A 3BQLA 3EUHA 2DNXA 4ILUA 3Q5DA 2WWVA 4G63A 1L0VA 2HPLA 4I55E 5JDFA 4WBNE 2UXXB 5L3BB 2HH7A 4I0UA 2ZM8A 2XQAA 5CA1E 3BQIA 4Z8XA 3KVBA 5AQMB 3N2KE 3BK9A 1H7CA 3CVRA 3ZKRA 4I50E 2IDOB 3AVRA 2ACXA 3L09A 4IE6A 2KMFA 4DV0T 2JQHA 2YDQA 3I9YA 3JADA 3RC8A 4OX9T 1S94A 2MOZA 3C51A 1YQ3A 3HKDE 4IL4A 4P0AA 3B57A 4WYVA 1XWMA 2IAKA 2H3RA 4ZZBA 4DBRA 2DHRA 4CI2B 5BR8T 2CHOA 2MTQA 2UUAT 4X1YE 1HS7A 5JQGE 2I59A 2V7JA 5HEOA 3Q5EA 3P4PA 2KT9A 3ZMSB 3R84B 2CLYB 2IC9A 1ZKEA 4LF8T 1MMAA 3J9X1 3KDSE 3ONXA 2CCQA 2EHOB 4DR5T 3IF8B 4JEUB 3JAEA 4OFZA 3L8RA 1WCRA 1W0BA 3A8YC 3UFEA 4OYKA 3VRBA 5L3DB 3H3MA 2VVNA 4PJNA 2XAFB 2I0MA 3TLSA 3VKHA 3UQ4A 4UIGA 4JI1T 4IT4A 4COFA 5IYZE 5AQPB 5AQSB 5LG3A 5LOVE 1BR2A 2C5KT 2VQFT 3NKZA 3VR8A 2CHNA 1KNZA 1OEDE 5JDGA 4F8HA 4FI5A 5L2LA 4TN7B 4AXPA 5CGMA 2Q9QB 3ETVA 2QGSA 5IUXA 5AQHB 3AXJA 4GIWA 4X66T 2DWKA 3C50A 2WDVA 5F8PA 2FJEA 5JDQA 2FJAA 4GOUA 2N2NA 1N32T 2XUEA 4PNIA 5J1GA 4HWCA 4UV8B 2G0UA 3C64A 4LF7T 2XASB 5JDLA 1B7TA 3K3NA 3K1SA 4ILAA 3GN5A 4U2YA 5FNVE 3RPUA 4YY3T 3OBVE 2LRLA 4UVCB 2UXDT 4PK6A 4UXNB 4TX5A 5ABEA 5EK3A 2XQYA 4X64T 2VKHA 5HXRA 1MIYA 3TLWA 5C8YE 4EYUA 2LSKA 2W61A 4DMVA 2KXPB 5ABFB 2CXFA 4P09A 3RI5A 3AAEB 2WSSV 4ISSA 3PUYF 2WZHA 4LFBT 3IBPA 3FZFB 2BKNA 5HAXA 4P1NA 4DR2T 2RA1A 3KV6A 4HN9A 5LGNB 2LHNA 2V7LA 1MMDA 3ANWA 5LJNA 3CQGB 5GONE 4YSYA 3AE6A 3HA4A 4L0RA 4DV5T 5CA0E 4O4IE 4KX6A 5FVLA 1NAFA 5L4EA 3TLVA 5ETWA 3T1YT 4ADZA 4ERRA 5FKYA 2W2UA 4HWIB 3PUAA 1BR4A 2MAWA 1X9BA 4H9OC 1IZNB 2WM9A 2PFVA 2L8KA 1ZP0A 2D9DA 3P4RA 1HX1B 4IGUA 3CQXC 3PJAJ 4BJMA 3LBXA 2UXCT 3K8PC 2NR4A 4QKNA 1HNXT 1SUMB 4A56A 3MKDA 2YEVC 3B5MA 4IDPA 5LNKA 4PFPA 5H6RB 3E22E 2KNDA 2AE9A 1D0XA 3EI0A 4DR3T 2X9XA 2XAHB 2RPAA 4JEHB 4HGAA 2XAJB 4TZ4C 4JI4T 5EK2A 2NWBA 2KZ7B 5LXTE 1I6ZA 2XM2A 2AXDS 4GKKT 4IREA 1HNZT 2JMHA 2E9XC 3ZCIA 1T72A 3F57A 2MBGA 1U5PA 4ILBA 2VL0A 2E9XB 5JH7E 4IL9A 2YU1A 5JRCA 1SA0E 4YFSA 5HWYA 4JUYA 5HXHA 3N2GE 4LF5T 2WDQA 5HEJA 4DV3T 5L3GB 1AJ3A 3AECA 2V7IA 4BAYB 1E7PA 5FYMA 3BQKA 4PK4A 3ZPOA 3RF1A 2BBHA 3ZT6A 3PUVF 1WRDA 2ODUA 5EK4A 5C3JA 3RHWA 1FMWA 2Z6EA 4ZHQE 4O4HE 3QC9A 2FBWA 2LRKA 3ZCJA 4YLHA 2BVMA 3PU3A 1MIWA 2LOPA 1KF6A 1YQ4A 2B1EA 3ZYMA 2X0LB 3M3ZB 2Y6XA 3SWHA 4ZZCA 5LGUB 4UVAB 1N33T 4LMJA 4AQGA 4QWNB 2LHRA 4HFEA 5JTGA 2PTFA 2WS3A 3IA3A 4LF6T 4ISTA 5FY1A 5CB4E 5F3JA 5LGTB 5JVDE 1IBMT 4U2ZA 4E7ZA 3LJCA 2CE7A 4CXWA 2CRBA 4JI5T 1WYBA 3ZMUB 4HFCA 3AA7B 5JR9B 3GWHA 2CWYA 4NIQA 2BS3A 3UU4A 4TWDA 5DQWA 4PK5A 4ZI2C 3QB5K 4NUUA 2UUCT 3N9PA 1FIOA 4AKHA 2WZIA 2N1GA 3MZKB 2W00A 3V5UA 2XTLA 3KV4A 2YU2A 4HWFA 3OYZA 3MA9A 4U33A 2J47A 3W15B 1D1BA 3FXDB 4YJ2E 5AQRB 4WW0A 3GA8A 2LT3A 4TWFA 2L9QA 1W09A 2E2AA 4JI6T 4EZ4A 1WR0A 2Y8DA 3AEFA 2BVLA 3ONLC 3OJAA 2BG9A 4MFRA 3CK6A 4H9RC 3UU5A 2QA7A 4PJMA 5HXSA 2C5JA 3AB3B 3NZQA 4TNVA 4B3RT 3FZLB 2XAGB 3QK6A 4YSZA 4XBFB 4ZS3A 5HXEA 2JQKA 3ZC1A 4U7YA 1ZHCA 2BG9C 3LFMA 1QSDA 1WR6A 5HEUA 1M62A 5AQQB 3B13A 5L4HA 2J62A 1DU2A 2X9HA 5LJMA 3FZHB 3VKGA 1UK5A 2M67A 3PTRB 3T8OA 3V5SA 2HPJA 4AQFC 4ANJA 5JDMA 4PJJA 3RX6A 1EZ3A 2WU2A 3FZMB 1YW0A 1Y01A 3L3PA 2W63A 3AE5A 5A1LA 3I0QA 1E1HB 4AKIA 4ZEYA 2E5VA 2EHOA 4O4LE 4EXTA 3AAIA 4PAGA 4X20E 4QHOA 4IIJE 2QYWA 4H63V 2X68A 3S4UA 4J2CA 4UVBB 4DNDA 4DV1T 1BR0A 2GK9A 1MMGA 5HCMA 2XQ8A 1V9DA 2BDEA 2XJ7A 2D0TA 3FBZA 2CLYC 2JMKA 5FL0A 2EHOC 5L3FB 4GYSA 3KV5A 2A3DA 3AEEA 2D0UA 2X9YA 1VRBA 2WDRA 2XSBA 4IE4A 2B76A 3TKLB 2K48A 3UULA 3ETUA 2QVAA 4U74A 2XQ7A 3RKGA 4QH1A 3E0ZA 2CBJA 4YTPA 3C98B 2K3WA 3CMLA 4ZS2A 1D1AA 2MYSA 4TUYE 5JDNA 4DO0A 2Q9QC 1VOMA 3IEEA 4Z91A 2N9DA 4M1PA 3N9LA 5F5WA 2NW9A 3DJBA 4UELA 5ABFA 1LVFA 1W0AA 4MLKA 3D0TA 4GK0E 2RP4A 1T98A 2VWAA 4JI0T 4HWHA 3N2OA 5LBQB 4ZI3C 5LHIB 4L5GA 3VU7H 4A97A 3ZT5A 4HWDA 5CFBA 2K9AA 5FY0A 1HFAA 3ZN1B 4KBMB 1OEDB 3KV9A 4I4TE 2V5CA 3JAFA 3FBLA 1CHUA 2LSYA 5TAOA 2LJLA 4U3CA 1UUSA 2M6BA 1SHZC 3Q5XA 4MALA 4HFVA 2KSRA 4QXBB 4JI3T 2ES0A 4TV8E 1D0ZA 4DIDB 4WNKA 3AE9A 3ZSTA 4LMKA 4OK0A 1J1JA 1ZV4X 4DR7T 3CWZB 3ZN0B 4YT0A 2KWHA 3PJAA 2ZM0A 3PURA 3HL6A 1QUUA 3P4SA 2P9BA 3KBUA 2LOSA 1XMOT 2OV9A 3GN5B 1CUNA 4N78D 1IBKT 5ABGA 2DCFA 2ZLYA 4HKAA 4X1IE 2LSGA 2K24A 1LRZA 1OXZA 5LYJE 4JBWF 3ZMTB 4G2AA 5FXXA 3RIAA 4IDNA 5LG4A 4HE8A 3LK3B 4L9IA 4F6RC 4IDQA 2CBIA 1VCTA 2YN6A 2YINA 3LDQB 3RC3A 4DV7T 2DI4A 2CMRA 4NXMT 2E9XA 3FHNA 1US7B 3VR9A 1KEYA 1HR0T 5AQVB 3ZMZB 4YHJA 3WAJA 2J4GA 4KMCA 1WLXA 3ANWB 2V7KA 3J7Yq 4HTEA 4PW8A 2CPTA 4E7SA 3U3IA 3M65A 5KXJA
chains in the Genus database with same CATH topology
2OA5A 1KK7A 4IE6A 2KMFA 1FIOA 4AKHA 4PFOA 2N1GA 3MZKB 2CM0A 3I9YA 4V1Av 3O4XE 3RC8A 2W00A 2CXDA 5E0OA 1S94A 2MOZA 3C51A 4UV9B 4CQIA 2EHOD 3V5UA 3HKDE 1UX4A 2XTLA 3EDVA 5DABA 4P0AA 3B57A 3KV4A 2CEAA 2YU2A 3P7IA 1MMNA 2IAKA 2NTYA 3NRXA 2H3RA 3MA9A 3OYZA 3LBXB 2WMOA 4UF0B 4DBRA 2DHRA 4CI2B 4IE0A 2PG8A 5FY7A 3W15B 1D1BA 2MTQA 1Y64B 3FXDB 4YJ2E 2JPFA 3GA8A 4WW0A 2LT3A 2NTXA 2DLRA 2L9QA 4X1YE 1HS7A 3HKCE 4AKRB 3AA1B 3N9MA 5ADXL 4CXXA 3JC6D 4EZ4A 2Y8DA 2BVLA 3OJAA 5JQGE 2I59A 2JQQA 2V7JA 4MFRA 3SS1A 4H9RC 2X9WA 2VKJA 5FXZA 3UUXB 2QA7A 4QXHB 3N9OA 4PJMA 5HXSA 2KT9A 2C5JA 3LK2B 3ZMSB 2X51A 2CLYB 3AB3B 3R84B 2IC9A 3NZQA 3RYHE 3UT5E 1ZKEA 2VK9A 1MMAA 1HTJF 3J9X1 3KDSE 3ONXA 2CCQA 2EHOB 4CI1B 3IF8B 4HEAA 3UUNA 2X66A 4EB6E 4JEUB 2VKDA 4K0UA 2XAGB 4OFZA 3QK6A 4OYJA 4XBFB 4ZS3A 3UFEA 3U78A 5HXEA 3Q2MA 5J2UE 5JR9A 4OYKA 3ZC1A 1ZHCA 1IAPA 5L3DB 2V26A 5KDMC 3CX8B 3LFMA 4IE5A 2XAQB 4EYYR 4PJNA 2XAFB 4H9PC 2ZM2A 1QSDA 3VKHA 1WR6A 3C4XA 5LP6E 4EZHA 4UIGA 3KVAA 5IYZE 3B13A 4WBOA 4C90A 2K5BB 2X9HA 3A5XA 5LOVE 4CXYA 1BR2A 4OHFA 5LJMA 2JJ9A 2C5KT 3OKQA 1FMVA 3O9XA 3MACA 2KWIB 2VKOA 1KNZA 3PUSA 5JDGA 3VKGA 2M67A 3PTRB 3T8OA 2SPCA 5JR9C 4FI5A 5L2LA 3V5SA 2HPJA 4TN7B 4UF0A 4AXPA 4AQFC 1G8XA 2Q9QB 3WI3A 4O4JE 3ETVA 2QGSA 3ZMVB 4GIWA 5LHHB 4O2BE 4ANJA 2DWKA 2D2SA 5JDMA 4CZZB 3C50A 4PJJA 3RX6A 1EZ3A 5F8PA 5JDQA 1YW0A 4GOUA 3VHLA 2N2NA 2XUEA 3L3PA 4IE7A 4PNIA 2W63A 5J1GA 4UV8B 2G0UA 3C64A 5LHGB 2CWOA 5A1LA 3I0QA 3N5LA 1IJ6A 2XASB 4EIWA 3EDUA 1E1HB 5JDLA 1B7TA 3K3NA 2KINB 4AKIA 3GN5A 5FNVE 3RPUA 2EHOA 3OBVE 1O3XA 4O4LE 3ZYKA 4EXTA 4UVCB 3AAIA 4PAGA 4X20E 4PK6A 4QHOA 4ASKA 4UXNB 4TX5A 4IIJE 4H63V 5EK3A 3E08A 2A72A 2X68A 3S4UA 2XQYA 2VKHA 5HXRA 1MIYA 2WMNA 1S35A 5C8YE 3K3QC 4J2CA 3HKEE 2LSIA 4UVBB 4DNDA 4EYUA 1BR0A 2GK9A 3NRYA 2LSKA 2W61A 3I1AA 2KXPB 1MMGA 4DMVA 2CXFA 3IHRA 3N9QA 4P09A 5IHYA 1HG2A 3N9NA 5L3CB 3AAEB 2JRKA 1V9DA 2WSSV 2BDEA 4ISSA 2D0TA 3FBZA 2NW8A 3F2EA 2CLYC 3PUGA 4DMWA 2JMKA 2LSJA 3IBPA 4H9QC 4NUVA 2EHOC 5L3FB 5HAXA 4GYSA 2W0GA 3KV5A 3RYFE 2A3DA 2D5UA 4C91A 2RA1A 3KV6A 2D0UA 4QX7B 2X9YA 4HN9A 5LA6E 1VRBA 5LGNB 4AKLA 5KMGP 2LHNA 3R6NA 2V7LA 1MMDA 3ANWA 5LJNA 3CQGB 1X79A 2IC6A 5GONE 4IE4A 2Q9QD 1YKEB 3TKLB 3HA4A 4L0RA 2K48A 4KUMB 3JC6C 3UULA 3ETUA 4XAXB 3DP7A 5CA0E 4U74A 4AQFA 2LEHA 4O4IE 4YJ3E 1HCIA 1BR1A 3E0ZA 2H7VC 3CKDA 1NAFA 2WAUA 3MXZA 4GK5E 5JRCB 2LE8A 5ETWA 2VL8A 1HF8A 3C98B 4PJLA 4QX8B 4DBQA 3CMLA 4ADZA 4ZS2A 3RYCE 4ERRA 3PUAA 5FXVA 1BR4A 1D1AA 1UCUA 4H63H 2MYSA 2YK0A 1U4QA 5FP3A 3ZEFB 4H9OC 5J2TE 2J1DG 2PJQA 1IZNB 2WM9A 2PFVA 2L8KA 4ZI3D 4TUYE 1MNDA 4TV9E 3AA6B 5JDNA 4EOZB 4DO0A 4AKGA 2Q9QC 2C0SA 3AA0B 2VASA 1VOMA 3C4ZA 4KP3C 3UTKA 4IGUA 3EVYA 1G73A 3CQXC 4BJMA 3LBXA 2ODVA 3IEEA 3RKOA 3K8PC 3PDYA 4BA9A 2N9DA 4M1PA 4QKNA 3AVSA 3N9LA 3KFWX 2NW9A 3DJBA 3F31A 3MJXA 4UELA 3ZJ1A 5LCYA 2E9XD 1LVFA 3CPZA 4MHCA 3HI2A 4I43B 4MLKA 3D0TA 4A56A 3MKDA 5DQVA 4GK0E 2RP4A 1T98A 2VWAA 2YEVC 4H9NC 3I0OA 3N2OA 2WWUA 5LBMA 2VB6A 5LNKA 5LBQB 4PFPA 5H6RB 4ZI3C 2L3LA 4U72A 5LHIB 4ZI7E 3E22E 2KNDA 4L5GA 4GYRA 1D0XA 3CX6B 3CX7B 3HR0A 3VU7H 2X9XA 2XAHB 3K3OA 2NW7A 3RYIE 3RRWA 4JEHB 4HGAA 2A2FX 2K9AA 2LM9A 2XAJB 4TZ4C 2UXNB 5FY0A 2CXLA 5EK2A 4QXCB 2NWBA 2KLQA 3DTOA 4EAHA 4AI6A 3FXEB 1UX5A 1HFAA 2KZ7B 5LXTE 3AAAB 3NZPA 3ZN1B 4KBMB 3NBXX 3KV9A 4IDZA 1OWAA 4I4TE 4CI3B 2JMHA 3FBLA 2E9XC 2LSYA 3ZCIA 5TAOA 3F57A 4FJOA 2LJLA 5JDHA 1HG5A 3PU8A 2MBGA 1D0YA 3HKBE 1U5PA 1SHZC 3ESLA 3Q5XA 2E9XB 5JH7E 4MALA 4HFVA 2YU1A 5JRCA 3QUJA 1SA0E 1MIVA 4QXBB 4YFSA 5H6QB 5HWYA 3O1JA 2ES0A 3H37A 4TV8E 1D0ZA 4JUYA 3RRCA 4P0BA 4WNKA 1FEWA 5HXHA 3N2GE 3LG7A 1LKXA 3MK7C 4OK0A 1IJ5A 3C4WA 1ZV4X 2XHEB 3CWZB 3PE0A 3ZN0B 3GMIA 3Q5WA 4B6XA 1ZEEA 5L3GB 1AJ3A 4O2AE 2KWHA 1Z0PA 2V7IA 4BAYB 4UEMA 2WBLA 1HX8A 5FYMA 3BQKA 2ZM0A 3PURA 4PK4A 5DJQC 3HL6A 1QUUA 3ZPOA 2P9BA 3WAKA 3ZYLA 2Q9QA 2Y48B 3KBUA 2H7OA 2LOSA 4MBQA 3RH3A 1WRDA 2ODUA 5EK4A 2E8IA 4BJNA 5L3EB 1FMWA 2Z6EA 3GN5B 4ZHQE 4O4HE 3QC9A 2V1DB 3SOLA 4DVDA 1CUNA 5M4YA 2NOXA 3FB2A 4N78D 4JLEA 3ZCJA 3SRZA 5FMNA 5KX5E 2DCFA 3P8CD 2BVMA 4YLHA 2ZLYA 3PU3A 3ZJ2A 2W62A 3KINB 4HKAA 2BZBA 2DWGA 1MIWA 4X1IE 5HYAA 3LK42 2LOPA 2LSGA 3I9WA 2K24A 1LRZA 1OXZA 2B1EA 3ZYMA 2X0LB 5LYJE 1WYCA 3ZMTB 4G2AA 5FXXA 2Y6XA 3SWHA 1YD8G 2NP9A 4O8SA 5HXCA 5JREA 5LGUB 5LG4A 2X67A 5EZYE 1D1CA 3ZC0A 4HE8A 3LK3B 4L9IA 4UVAB 4F6RC 5AFUL 1NWMX 1YKHB 3H3AA 4ZOLE 4H9SE 3OYXA 5BMVE 4X1KE 4AQGA 4QWNB 2YINA 3ZLIA 2PBIA 1MNEA 3Q9DA 2LHRA 3RC3A 4ZI2D 3PUQA 2DI4A 2ZMAA 1LVKA 2CMRA 3BQLA 3EUHA 3KBTA 5FXWA 2DNXA 2E9XA 3FHNA 1US7B 4ISTA 4ILUA 5FY1A 3ZMZB 5CB4E 5F3JA 4YHJA 3WAJA 4G63A 4KMCA 1WLXA 5HWXA 5LGTB 5JVDE 2HPLA 4I55E 5JDFA 4E7ZA 4WBNE 3ANWB 2V7KA 3J7Yq 2UXXB 2CE7A 3LJCA 4HTEA 4PW8A 4CXWA 5L3BB 2IW5B 2HH7A 1WYBA 3CQCB 3ZMUB 2ZM8A 5CA1E 3AA7B 3BQIA 3GWHA 4Z8XA 2CWYA 3KVBA 4E7SA 3N2KE 5JR9B 2V7MA 3BK9A 1H7CA 3CVRA 3U3IA 4I50E 3M65A 3O1HA 5DQWA 4PK5A 3UUMA 3AVRA 2CA5A 4IHJE 2ACXA 4ZI2C 4XZCA 4NUUA 3L09A 3O1IA 2C5IT 3N9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UUX B; 
#chains in the Genus database with same CATH topology
 2OA5 A;  2MPK A;  2XPK A;  5LMN T;  4X5T A;  4V1A v;  4X62 T;  1XDP A;  3UUB A;  2EHO D;  3EDV A;  5DAB A;  2CEA A;  4DR1 T;  3P7I A;  3EHZ A;  1MMN A;  2NTY A;  5LB7 B;  3LBX B;  3AEG A;  4UF0 B;  4IE0 A;  3RQW A;  2R6G F;  2JPF A;  4HFI A;  2NTX A;  2DLR A;  4AKR B;  3AA1 B;  5ADX L;  2VVS A;  2JQQ A;  3SS1 A;  4DV6 T;  2X9W A;  2VKJ A;  4CN6 A;  4EGW A;  3LK2 B;  4LFC T;  3UT5 E;  4EED A;  2VK9 A;  1HTJ F;  1W9R A;  3UQ7 A;  1KNP A;  4EB6 E;  2W66 A;  1NEK A;  4Z90 A;  2H88 A;  5J2U E;  3Q2M A;  3JCF A;  5JR9 A;  4LF9 T;  5KDM C;  1I94 T;  2XAQ B;  4EYY R;  5L47 A;  3RIU C;  2ZM2 A;  3C4X A;  2UU9 T;  2IIU A;  3ZSS A;  5LP6 E;  2XQ9 A;  4DR6 T;  4EZH A;  2ZM6 T;  5AQJ B;  2K5B B;  4CXY A;  4OHF A;  3O9X A;  3EAM A;  2IHR 1;  2KWI B;  3ABV A;  5JR9 C;  3UFG A;  1G8X A;  5AQG B;  2E5L T;  3WI3 A;  4O4J E;  1J5E T;  4O2B E;  2D2S A;  4CZZ B;  2V6Y B;  1KNR A;  4NPP A;  3AEA A;  3VHL A;  4TWH A;  4IE7 A;  1E2A A;  5LHG B;  4TNW A;  2WQY A;  5AQO B;  2WCA A;  3ZYK A;  1UUR A;  4U31 A;  4ASK A;  4CN4 A;  3E08 A;  2WMN A;  3K3Q C;  3HKE E;  2XQ5 A;  2XQ6 A;  3NRY A;  2A9U A;  1HG2 A;  2XSA A;  5L3C B;  3F2E A;  1WFD A;  4NUV A;  3RYF E;  2D5U A;  3CIR A;  4C91 A;  2BG9 E;  4QX7 B;  4K0K T;  5KMG P;  3R6N A;  1IBL T;  4JV5 T;  1UGO A;  4KUM B;  3JC6 C;  2HHH T;  3DP7 A;  4AQF A;  2LEH A;  3AE8 A;  3AE7 A;  3SFE A;  1HCI A;  2H7V C;  4JI8 T;  3CKD A;  4AQY T;  2UUB T;  1N36 T;  2VL8 A;  3RYC E;  5FXV A;  3RGL A;  2V8S V;  2YK0 A;  1U4Q A;  2J1D G;  2PJQ A;  1MND A;  3AA6 B;  4EOZ B;  2C0S A;  3AA0 B;  2VAS A;  4KP3 C;  3C4Z A;  3UTK A;  1XMQ T;  2ODV A;  3RKO A;  2M6I A;  2BBJ A;  2X0H A;  3AVS A;  2H89 A;  3KFW X;  3MJX A;  4LFA T;  2E9X D;  1FJG T;  3LSV A;  4H9N C;  4A5X A;  3L39 A;  4YSX A;  5LBM A;  3QNU A;  3CX6 B;  3HR0 A;  2LKH A;  3RYI E;  2CXL A;  2KLQ A;  3FXE B;  3NZP A;  2HN1 A;  4IDZ A;  4CI3 B;  4FJO A;  5JDH A;  1HG5 A;  4A98 A;  3QUJ A;  5H6Q B;  3O1J A;  3H37 A;  4P0B A;  3T1H T;  4ILC A;  4KHZ F;  3LG7 A;  1LKX A;  3MK7 C;  1IJ5 A;  2XZE A;  3C4W A;  4HFB A;  3Q5W A;  4B6X A;  4O2A E;  1Z0P A;  2BS2 A;  3FZK B;  5DJQ C;  3WAK A;  3ZYL A;  2FUP A;  2Q9Q A;  2VUR A;  4MBQ A;  3RH3 A;  1T8B A;  2V1D B;  4DVD A;  3FB2 A;  5HEG A;  5FMN A;  5KX5 E;  3P8C D;  3ZJ2 A;  3KIN B;  2BZB A;  3LK4 2;  1WYC A;  4JYA T;  2LKG A;  2NP9 A;  5HXC A;  1XDO A;  1NWM X;  1YKH B;  3NVO A;  4ZOL E;  4H9S E;  1XNQ T;  3RQU A;  2XQ4 A;  1OED A;  4B3M T;  5BMV E;  1XZY A;  4X1K E;  4EV6 A;  2PBI A;  1MNE A;  4ZI2 D;  3RIF A;  2ZMA A;  1LVK A;  3KBT A;  5FXW A;  1JNZ A;  2JIW A;  1T7S A;  5HWX A;  3ZT7 A;  2IW5 B;  3CQC B;  2BKP A;  3TLU A;  4YTM A;  2W67 A;  2V7M A;  1OED C;  3O1H A;  3UUM A;  2YDR A;  2CA5 A;  4IHJ E;  4XZC A;  3O1I A;  3QB5 A;  2C5I T;  3TLT A;  1KK7 A;  4PFO A;  4LF4 T;  3ONJ A;  2CM0 A;  3O4X E;  1Z8U A;  3AEB A;  2CXD A;  5E0O A;  3UU8 A;  4UV9 B;  5HCJ A;  4CQI A;  1UX4 A;  1SE7 A;  4AIS A;  5ABH A;  2F4V T;  3NRX A;  2WMO A;  5LMU T;  2WP9 A;  2XY8 B;  4DR4 T;  4ZXL A;  4DV2 T;  2PG8 A;  5FY7 A;  3OTO T;  3AXJ B;  1Y64 B;  2YOE A;  3HKC E;  3N9M A;  4CXX A;  3JC6 D;  2FJB A;  3NWI A;  1QLB A;  3UUX B;  5FXZ A;  4QXH B;  3N9O A;  2BKO A;  2X51 A;  2YDS A;  3RYH E;  2DL1 A;  3EAB A;  2W4X A;  4CI1 B;  2WB5 A;  4HEA A;  3UUN A;  2X66 A;  2VKD A;  4K0U A;  4OYJ A;  3G06 A;  3U78 A;  5AQT B;  1IAP A;  2V26 A;  5IWA T;  3CX8 B;  2V5D A;  5AQL B;  4IE5 A;  4H9P C;  4DUZ T;  3KVA A;  1VCS A;  3A7M A;  4WBO A;  4C90 A;  3PV0 F;  3A5X A;  2JJ9 A;  3OKQ A;  1FMV A;  3MAC A;  4LML A;  2UXB T;  2VKO A;  3PUS A;  5C2T A;  2SPC A;  3SFD A;  4UF0 A;  3P4W A;  3ZMV B;  5LHH B;  4GKJ T;  5HEH A;  1R8I A;  4Q25 A;  2QRX A;  3UU6 A;  5AQK B;  2CWO A;  2BS4 A;  3N5L A;  1IJ6 A;  4B3S T;  4EIW A;  3EDU A;  3AE1 A;  2VQE T;  4B3T T;  2KIN B;  3PUZ F;  5AQI B;  4AIU A;  1O3X A;  2A72 A;  2LLY A;  1ZOY A;  4QH4 A;  1S35 A;  2LSI A;  4JI7 T;  4WZX A;  4UR9 A;  3I1A A;  3IHR A;  3N9Q A;  3VRA A;  5IHY A;  3N9N A;  2JRK A;  2NW8 A;  3PUG A;  3RIU A;  4DMW A;  2LSJ A;  3P50 A;  4H9Q C;  4YHH T;  3AE2 A;  5AQN B;  2ACZ A;  2W0G A;  1HNW T;  3OVU A;  5LA6 E;  4U7I A;  4AKL A;  1X79 A;  2IC6 A;  2Q9Q D;  1YKE B;  3PUX F;  3P4Q A;  4HFD A;  4XAX B;  2V6Y A;  4YJ3 E;  1BR1 A;  5JRC B;  3MXZ A;  2WAU A;  4GK5 E;  1M7K A;  2LE8 A;  2WY2 A;  1HF8 A;  4QX8 B;  4PJL A;  1YXR A;  4DBQ A;  2YKS A;  5AQF B;  4HFH A;  1UCU A;  4H63 H;  3ZEF B;  5FP3 A;  5J2T E;  4ZI3 D;  2I6H A;  3RLF F;  4TV9 E;  4AKG A;  1GQE A;  5FVK A;  3AE4 A;  4QH5 A;  3EVY A;  1G73 A;  5CJ5 A;  2X0Y A;  3PDY A;  4BA9 A;  1JNR A;  3F31 A;  3ZJ1 A;  5LCY A;  3PUW F;  3CPZ A;  4MHC A;  3HI2 A;  4I43 B;  5DQV A;  4X65 T;  3I0O A;  2WWU A;  2VB6 A;  2FJD A;  2IML A;  2L3L A;  3AED A;  4U72 A;  4ZI7 E;  5FL1 A;  4GYR A;  3CX7 B;  5AQU B;  2XQ3 A;  3K3O A;  5J0Z A;  2LM2 A;  2NW7 A;  3RRW A;  2A2F X;  1NEN A;  2LM9 A;  2UXN B;  4QXC B;  3DTO A;  4EAH A;  4AI6 A;  1UX5 A;  3AAA B;  3NBX X;  1OWA A;  3QOF A;  3PU8 A;  1D0Y A;  3HKB E;  2OLT A;  3ESL A;  3OPC A;  1MIV A;  3RRC A;  4DV4 T;  2HN2 A;  1FEW A;  2JQ9 A;  4EEB A;  2XHE B;  3PE0 A;  3GMI A;  1ZEE A;  4NXN T;  4UEM A;  2WBL A;  1XNR T;  1HX8 A;  4DUY T;  2IUB A;  3UU3 A;  4JI2 T;  2Y48 B;  2H7O A;  2E8I A;  4BJN A;  5L3E B;  5M4Y A;  3SOL A;  2NOX A;  2V6X A;  2XM1 A;  4JLE A;  3SRZ A;  2W62 A;  2DWG A;  5HYA A;  3I9W A;  2WU5 A;  4CN1 A;  1KFY A;  1J5W A;  4KI0 F;  1YD8 G;  4YTN A;  3X1D A;  4O8S A;  5JRE A;  2X67 A;  5EZY E;  1D1C A;  3ZC0 A;  4IDO A;  5AFU L;  3H3A A;  2BG9 B;  4KHP T;  1N34 T;  4YXD A;  3OYX A;  3ZLI A;  3Q9D A;  3PUQ A;  3AE3 A;  3BQL A;  3EUH A;  2DNX A;  4ILU A;  3Q5D A;  2WWV A;  4G63 A;  1L0V A;  2HPL A;  4I55 E;  5JDF A;  4WBN E;  2UXX B;  5L3B B;  2HH7 A;  4I0U A;  2ZM8 A;  2XQA A;  5CA1 E;  3BQI A;  4Z8X A;  3KVB A;  5AQM B;  3N2K E;  3BK9 A;  1H7C A;  3CVR A;  3ZKR A;  4I50 E;  2IDO B;  3AVR A;  2ACX A;  3L09 A;  4IE6 A;  2KMF A;  4DV0 T;  2JQH A;  2YDQ A;  3I9Y A;  3JAD A;  3RC8 A;  4OX9 T;  1S94 A;  2MOZ A;  3C51 A;  1YQ3 A;  3HKD E;  4IL4 A;  4P0A A;  3B57 A;  4WYV A;  1XWM A;  2IAK A;  2H3R A;  4ZZB A;  4DBR A;  2DHR A;  4CI2 B;  5BR8 T;  2CHO A;  2MTQ A;  2UUA T;  4X1Y E;  1HS7 A;  5JQG E;  2I59 A;  2V7J A;  5HEO A;  3Q5E A;  3P4P A;  2KT9 A;  3ZMS B;  3R84 B;  2CLY B;  2IC9 A;  1ZKE A;  4LF8 T;  1MMA A;  3J9X 1;  3KDS E;  3ONX A;  2CCQ A;  2EHO B;  4DR5 T;  3IF8 B;  4JEU B;  3JAE A;  4OFZ A;  3L8R A;  1WCR A;  1W0B A;  3A8Y C;  3UFE A;  4OYK A;  3VRB A;  5L3D B;  3H3M A;  2VVN A;  4PJN A;  2XAF B;  2I0M A;  3TLS A;  3VKH A;  3UQ4 A;  4UIG A;  4JI1 T;  4IT4 A;  4COF A;  5IYZ E;  5AQP B;  5AQS B;  5LG3 A;  5LOV E;  1BR2 A;  2C5K T;  2VQF T;  3NKZ A;  3VR8 A;  2CHN A;  1KNZ A;  1OED E;  5JDG A;  4F8H A;  4FI5 A;  5L2L A;  4TN7 B;  4AXP A;  5CGM A;  2Q9Q B;  3ETV A;  2QGS A;  5IUX A;  5AQH B;  3AXJ A;  4GIW A;  4X66 T;  2DWK A;  3C50 A;  2WDV A;  5F8P A;  2FJE A;  5JDQ A;  2FJA A;  4GOU A;  2N2N A;  1N32 T;  2XUE A;  4PNI A;  5J1G A;  4HWC A;  4UV8 B;  2G0U A;  3C64 A;  4LF7 T;  2XAS B;  5JDL A;  1B7T A;  3K3N A;  3K1S A;  4ILA A;  3GN5 A;  4U2Y A;  5FNV E;  3RPU A;  4YY3 T;  3OBV E;  2LRL A;  4UVC B;  2UXD T;  4PK6 A;  4UXN B;  4TX5 A;  5ABE A;  5EK3 A;  2XQY A;  4X64 T;  2VKH A;  5HXR A;  1MIY A;  3TLW A;  5C8Y E;  4EYU A;  2LSK A;  2W61 A;  4DMV A;  2KXP B;  5ABF B;  2CXF A;  4P09 A;  3RI5 A;  3AAE B;  2WSS V;  4ISS A;  3PUY F;  2WZH A;  4LFB T;  3IBP A;  3FZF B;  2BKN A;  5HAX A;  4P1N A;  4DR2 T;  2RA1 A;  3KV6 A;  4HN9 A;  5LGN B;  2LHN A;  2V7L A;  1MMD A;  3ANW A;  5LJN A;  3CQG B;  5GON E;  4YSY A;  3AE6 A;  3HA4 A;  4L0R A;  4DV5 T;  5CA0 E;  4O4I E;  4KX6 A;  5FVL A;  1NAF A;  5L4E A;  3TLV A;  5ETW A;  3T1Y T;  4ADZ A;  4ERR A;  5FKY A;  2W2U A;  4HWI B;  3PUA A;  1BR4 A;  2MAW A;  1X9B A;  4H9O C;  1IZN B;  2WM9 A;  2PFV A;  2L8K A;  1ZP0 A;  2D9D A;  3P4R A;  1HX1 B;  4IGU A;  3CQX C;  3PJA J;  4BJM A;  3LBX A;  2UXC T;  3K8P C;  2NR4 A;  4QKN A;  1HNX T;  1SUM B;  4A56 A;  3MKD A;  2YEV C;  3B5M A;  4IDP A;  5LNK A;  4PFP A;  5H6R B;  3E22 E;  2KND A;  2AE9 A;  1D0X A;  3EI0 A;  4DR3 T;  2X9X A;  2XAH B;  2RPA A;  4JEH B;  4HGA A;  2XAJ B;  4TZ4 C;  4JI4 T;  5EK2 A;  2NWB A;  2KZ7 B;  5LXT E;  1I6Z A;  2XM2 A;  2AXD S;  4GKK T;  4IRE A;  1HNZ T;  2JMH A;  2E9X C;  3ZCI A;  1T72 A;  3F57 A;  2MBG A;  1U5P A;  4ILB A;  2VL0 A;  2E9X B;  5JH7 E;  4IL9 A;  2YU1 A;  5JRC A;  1SA0 E;  4YFS A;  5HWY A;  4JUY A;  5HXH A;  3N2G E;  4LF5 T;  2WDQ A;  5HEJ A;  4DV3 T;  5L3G B;  1AJ3 A;  3AEC A;  2V7I A;  4BAY B;  1E7P A;  5FYM A;  3BQK A;  4PK4 A;  3ZPO A;  3RF1 A;  2BBH A;  3ZT6 A;  3PUV F;  1WRD A;  2ODU A;  5EK4 A;  5C3J A;  3RHW A;  1FMW A;  2Z6E A;  4ZHQ E;  4O4H E;  3QC9 A;  2FBW A;  2LRK A;  3ZCJ A;  4YLH A;  2BVM A;  3PU3 A;  1MIW A;  2LOP A;  1KF6 A;  1YQ4 A;  2B1E A;  3ZYM A;  2X0L B;  3M3Z B;  2Y6X A;  3SWH A;  4ZZC A;  5LGU B;  4UVA B;  1N33 T;  4LMJ A;  4AQG A;  4QWN B;  2LHR A;  4HFE A;  5JTG A;  2PTF A;  2WS3 A;  3IA3 A;  4LF6 T;  4IST A;  5FY1 A;  5CB4 E;  5F3J A;  5LGT B;  5JVD E;  1IBM T;  4U2Z A;  4E7Z A;  3LJC A;  2CE7 A;  4CXW A;  2CRB A;  4JI5 T;  1WYB A;  3ZMU B;  4HFC A;  3AA7 B;  5JR9 B;  3GWH A;  2CWY A;  4NIQ A;  2BS3 A;  3UU4 A;  4TWD A;  5DQW A;  4PK5 A;  4ZI2 C;  3QB5 K;  4NUU A;  2UUC T;  3N9P A;  1FIO A;  4AKH A;  2WZI A;  2N1G A;  3MZK B;  2W00 A;  3V5U A;  2XTL A;  3KV4 A;  2YU2 A;  4HWF A;  3OYZ A;  3MA9 A;  4U33 A;  2J47 A;  3W15 B;  1D1B A;  3FXD B;  4YJ2 E;  5AQR B;  4WW0 A;  3GA8 A;  2LT3 A;  4TWF A;  2L9Q A;  1W09 A;  2E2A A;  4JI6 T;  4EZ4 A;  1WR0 A;  2Y8D A;  3AEF A;  2BVL A;  3ONL C;  3OJA A;  2BG9 A;  4MFR A;  3CK6 A;  4H9R C;  3UU5 A;  2QA7 A;  4PJM A;  5HXS A;  2C5J A;  3AB3 B;  3NZQ A;  4TNV A;  4B3R T;  3FZL B;  2XAG B;  3QK6 A;  4YSZ A;  4XBF B;  4ZS3 A;  5HXE A;  2JQK A;  3ZC1 A;  4U7Y A;  1ZHC A;  2BG9 C;  3LFM A;  1QSD A;  1WR6 A;  5HEU A;  1M62 A;  5AQQ B;  3B13 A;  5L4H A;  2J62 A;  1DU2 A;  2X9H A;  5LJM A;  3FZH B;  3VKG A;  1UK5 A;  2M67 A;  3PTR B;  3T8O A;  3V5S A;  2HPJ A;  4AQF C;  4ANJ A;  5JDM A;  4PJJ A;  3RX6 A;  1EZ3 A;  2WU2 A;  3FZM B;  1YW0 A;  1Y01 A;  3L3P A;  2W63 A;  3AE5 A;  5A1L A;  3I0Q A;  1E1H B;  4AKI A;  4ZEY A;  2E5V A;  2EHO A;  4O4L E;  4EXT A;  3AAI A;  4PAG A;  4X20 E;  4QHO A;  4IIJ E;  2QYW A;  4H63 V;  2X68 A;  3S4U A;  4J2C A;  4UVB B;  4DND A;  4DV1 T;  1BR0 A;  2GK9 A;  1MMG A;  5HCM A;  2XQ8 A;  1V9D A;  2BDE A;  2XJ7 A;  2D0T A;  3FBZ A;  2CLY C;  2JMK A;  5FL0 A;  2EHO C;  5L3F B;  4GYS A;  3KV5 A;  2A3D A;  3AEE A;  2D0U A;  2X9Y A;  1VRB A;  2WDR A;  2XSB A;  4IE4 A;  2B76 A;  3TKL B;  2K48 A;  3UUL A;  3ETU A;  2QVA A;  4U74 A;  2XQ7 A;  3RKG A;  4QH1 A;  3E0Z A;  2CBJ A;  4YTP A;  3C98 B;  2K3W A;  3CML A;  4ZS2 A;  1D1A A;  2MYS A;  4TUY E;  5JDN A;  4DO0 A;  2Q9Q C;  1VOM A;  3IEE A;  4Z91 A;  2N9D A;  4M1P A;  3N9L A;  5F5W A;  2NW9 A;  3DJB A;  4UEL A;  5ABF A;  1LVF A;  1W0A A;  4MLK A;  3D0T A;  4GK0 E;  2RP4 A;  1T98 A;  2VWA A;  4JI0 T;  4HWH A;  3N2O A;  5LBQ B;  4ZI3 C;  5LHI B;  4L5G A;  3VU7 H;  4A97 A;  3ZT5 A;  4HWD A;  5CFB A;  2K9A A;  5FY0 A;  1HFA A;  3ZN1 B;  4KBM B;  1OED B;  3KV9 A;  4I4T E;  2V5C A;  3JAF A;  3FBL A;  1CHU A;  2LSY A;  5TAO A;  2LJL A;  4U3C A;  1UUS A;  2M6B A;  1SHZ C;  3Q5X A;  4MAL A;  4HFV A;  2KSR A;  4QXB B;  4JI3 T;  2ES0 A;  4TV8 E;  1D0Z A;  4DID B;  4WNK A;  3AE9 A;  3ZST A;  4LMK A;  4OK0 A;  1J1J A;  1ZV4 X;  4DR7 T;  3CWZ B;  3ZN0 B;  4YT0 A;  2KWH A;  3PJA A;  2ZM0 A;  3PUR A;  3HL6 A;  1QUU A;  3P4S A;  2P9B A;  3KBU A;  2LOS A;  1XMO T;  2OV9 A;  3GN5 B;  1CUN A;  4N78 D;  1IBK T;  5ABG A;  2DCF A;  2ZLY A;  4HKA A;  4X1I E;  2LSG A;  2K24 A;  1LRZ A;  1OXZ A;  5LYJ E;  4JBW F;  3ZMT B;  4G2A A;  5FXX A;  3RIA A;  4IDN A;  5LG4 A;  4HE8 A;  3LK3 B;  4L9I A;  4F6R C;  4IDQ A;  2CBI A;  1VCT A;  2YN6 A;  2YIN A;  3LDQ B;  3RC3 A;  4DV7 T;  2DI4 A;  2CMR A;  4NXM T;  2E9X A;  3FHN A;  1US7 B;  3VR9 A;  1KEY A;  1HR0 T;  5AQV B;  3ZMZ B;  4YHJ A;  3WAJ A;  2J4G A;  4KMC A;  1WLX A;  3ANW B;  2V7K A;  3J7Y q;  4HTE A;  4PW8 A;  2CPT A;  4E7S A;  3U3I A;  3M65 A;  5KXJ A; 
#chains in the Genus database with same CATH homology
 2OA5 A;  1KK7 A;  4IE6 A;  2KMF A;  1FIO A;  4AKH A;  4PFO A;  2N1G A;  3MZK B;  2CM0 A;  3I9Y A;  4V1A v;  3O4X E;  3RC8 A;  2W00 A;  2CXD A;  5E0O A;  1S94 A;  2MOZ A;  3C51 A;  4UV9 B;  4CQI A;  2EHO D;  3V5U A;  3HKD E;  1UX4 A;  2XTL A;  3EDV A;  5DAB A;  4P0A A;  3B57 A;  3KV4 A;  2CEA A;  2YU2 A;  3P7I A;  1MMN A;  2IAK A;  2NTY A;  3NRX A;  2H3R A;  3MA9 A;  3OYZ A;  3LBX B;  2WMO A;  4UF0 B;  4DBR A;  2DHR A;  4CI2 B;  4IE0 A;  2PG8 A;  5FY7 A;  3W15 B;  1D1B A;  2MTQ A;  1Y64 B;  3FXD B;  4YJ2 E;  2JPF A;  3GA8 A;  4WW0 A;  2LT3 A;  2NTX A;  2DLR A;  2L9Q A;  4X1Y E;  1HS7 A;  3HKC E;  4AKR B;  3AA1 B;  3N9M A;  5ADX L;  4CXX A;  3JC6 D;  4EZ4 A;  2Y8D A;  2BVL A;  3OJA A;  5JQG E;  2I59 A;  2JQQ A;  2V7J A;  4MFR A;  3SS1 A;  4H9R C;  2X9W A;  2VKJ A;  5FXZ A;  3UUX B;  2QA7 A;  4QXH B;  3N9O A;  4PJM A;  5HXS A;  2KT9 A;  2C5J A;  3LK2 B;  3ZMS B;  2X51 A;  2CLY B;  3AB3 B;  3R84 B;  2IC9 A;  3NZQ A;  3RYH E;  3UT5 E;  1ZKE A;  2VK9 A;  1MMA A;  1HTJ F;  3J9X 1;  3KDS E;  3ONX A;  2CCQ A;  2EHO B;  4CI1 B;  3IF8 B;  4HEA A;  3UUN A;  2X66 A;  4EB6 E;  4JEU B;  2VKD A;  4K0U A;  2XAG B;  4OFZ A;  3QK6 A;  4OYJ A;  4XBF B;  4ZS3 A;  3UFE A;  3U78 A;  5HXE A;  3Q2M A;  5J2U E;  5JR9 A;  4OYK A;  3ZC1 A;  1ZHC A;  1IAP A;  5L3D B;  2V26 A;  5KDM C;  3CX8 B;  3LFM A;  4IE5 A;  2XAQ B;  4EYY R;  4PJN A;  2XAF B;  4H9P C;  2ZM2 A;  1QSD A;  3VKH A;  1WR6 A;  3C4X A;  5LP6 E;  4EZH A;  4UIG A;  3KVA A;  5IYZ E;  3B13 A;  4WBO A;  4C90 A;  2K5B B;  2X9H A;  3A5X A;  5LOV E;  4CXY A;  1BR2 A;  4OHF A;  5LJM A;  2JJ9 A;  2C5K T;  3OKQ A;  1FMV A;  3O9X A;  3MAC A;  2KWI B;  2VKO A;  1KNZ A;  3PUS A;  5JDG A;  3VKG A;  2M67 A;  3PTR B;  3T8O A;  2SPC A;  5JR9 C;  4FI5 A;  5L2L A;  3V5S A;  2HPJ A;  4TN7 B;  4UF0 A;  4AXP A;  4AQF C;  1G8X A;  2Q9Q B;  3WI3 A;  4O4J E;  3ETV A;  2QGS A;  3ZMV B;  4GIW A;  5LHH B;  4O2B E;  4ANJ A;  2DWK A;  2D2S A;  5JDM A;  4CZZ B;  3C50 A;  4PJJ A;  3RX6 A;  1EZ3 A;  5F8P A;  5JDQ A;  1YW0 A;  4GOU A;  3VHL A;  2N2N A;  2XUE A;  3L3P A;  4IE7 A;  4PNI A;  2W63 A;  5J1G A;  4UV8 B;  2G0U A;  3C64 A;  5LHG B;  2CWO A;  5A1L A;  3I0Q A;  3N5L A;  1IJ6 A;  2XAS B;  4EIW A;  3EDU A;  1E1H B;  5JDL A;  1B7T A;  3K3N A;  2KIN B;  4AKI A;  3GN5 A;  5FNV E;  3RPU A;  2EHO A;  3OBV E;  1O3X A;  4O4L E;  3ZYK A;  4EXT A;  4UVC B;  3AAI A;  4PAG A;  4X20 E;  4PK6 A;  4QHO A;  4ASK A;  4UXN B;  4TX5 A;  4IIJ E;  4H63 V;  5EK3 A;  3E08 A;  2A72 A;  2X68 A;  3S4U A;  2XQY A;  2VKH A;  5HXR A;  1MIY A;  2WMN A;  1S35 A;  5C8Y E;  3K3Q C;  4J2C A;  3HKE E;  2LSI A;  4UVB B;  4DND A;  4EYU A;  1BR0 A;  2GK9 A;  3NRY A;  2LSK A;  2W61 A;  3I1A A;  2KXP B;  1MMG A;  4DMV A;  2CXF A;  3IHR A;  3N9Q A;  4P09 A;  5IHY A;  1HG2 A;  3N9N A;  5L3C B;  3AAE B;  2JRK A;  1V9D A;  2WSS V;  2BDE A;  4ISS A;  2D0T A;  3FBZ A;  2NW8 A;  3F2E A;  2CLY C;  3PUG A;  4DMW A;  2JMK A;  2LSJ A;  3IBP A;  4H9Q C;  4NUV A;  2EHO C;  5L3F B;  5HAX A;  4GYS A;  2W0G A;  3KV5 A;  3RYF E;  2A3D A;  2D5U A;  4C91 A;  2RA1 A;  3KV6 A;  2D0U A;  4QX7 B;  2X9Y A;  4HN9 A;  5LA6 E;  1VRB A;  5LGN B;  4AKL A;  5KMG P;  2LHN A;  3R6N A;  2V7L A;  1MMD A;  3ANW A;  5LJN A;  3CQG B;  1X79 A;  2IC6 A;  5GON E;  4IE4 A;  2Q9Q D;  1YKE B;  3TKL B;  3HA4 A;  4L0R A;  2K48 A;  4KUM B;  3JC6 C;  3UUL A;  3ETU A;  4XAX B;  3DP7 A;  5CA0 E;  4U74 A;  4AQF A;  2LEH A;  4O4I E;  4YJ3 E;  1HCI A;  1BR1 A;  3E0Z A;  2H7V C;  3CKD A;  1NAF A;  2WAU A;  3MXZ A;  4GK5 E;  5JRC B;  2LE8 A;  5ETW A;  2VL8 A;  1HF8 A;  3C98 B;  4PJL A;  4QX8 B;  4DBQ A;  3CML A;  4ADZ A;  4ZS2 A;  3RYC E;  4ERR A;  3PUA A;  5FXV A;  1BR4 A;  1D1A A;  1UCU A;  4H63 H;  2MYS A;  2YK0 A;  1U4Q A;  5FP3 A;  3ZEF B;  4H9O C;  5J2T E;  2J1D G;  2PJQ A;  1IZN B;  2WM9 A;  2PFV A;  2L8K A;  4ZI3 D;  4TUY E;  1MND A;  4TV9 E;  3AA6 B;  5JDN A;  4EOZ B;  4DO0 A;  4AKG A;  2Q9Q C;  2C0S A;  3AA0 B;  2VAS A;  1VOM A;  3C4Z A;  4KP3 C;  3UTK A;  4IGU A;  3EVY A;  1G73 A;  3CQX C;  4BJM A;  3LBX A;  2ODV A;  3IEE A;  3RKO A;  3K8P C;  3PDY A;  4BA9 A;  2N9D A;  4M1P A;  4QKN A;  3AVS A;  3N9L A;  3KFW X;  2NW9 A;  3DJB A;  3F31 A;  3MJX A;  4UEL A;  3ZJ1 A;  5LCY A;  2E9X D;  1LVF A;  3CPZ A;  4MHC A;  3HI2 A;  4I43 B;  4MLK A;  3D0T A;  4A56 A;  3MKD A;  5DQV A;  4GK0 E;  2RP4 A;  1T98 A;  2VWA A;  2YEV C;  4H9N C;  3I0O A;  3N2O A;  2WWU A;  5LBM A;  2VB6 A;  5LNK A;  5LBQ B;  4PFP A;  5H6R B;  4ZI3 C;  2L3L A;  4U72 A;  5LHI B;  4ZI7 E;  3E22 E;  2KND A;  4L5G A;  4GYR A;  1D0X A;  3CX6 B;  3CX7 B;  3HR0 A;  3VU7 H;  2X9X A;  2XAH B;  3K3O A;  2NW7 A;  3RYI E;  3RRW A;  4JEH B;  4HGA A;  2A2F X;  2K9A A;  2LM9 A;  2XAJ B;  4TZ4 C;  2UXN B;  5FY0 A;  2CXL A;  5EK2 A;  4QXC B;  2NWB A;  2KLQ A;  3DTO A;  4EAH A;  4AI6 A;  3FXE B;  1UX5 A;  1HFA A;  2KZ7 B;  5LXT E;  3AAA B;  3NZP A;  3ZN1 B;  4KBM B;  3NBX X;  3KV9 A;  4IDZ A;  1OWA A;  4I4T E;  4CI3 B;  2JMH A;  3FBL A;  2E9X C;  2LSY A;  3ZCI A;  5TAO A;  3F57 A;  4FJO A;  2LJL A;  5JDH A;  1HG5 A;  3PU8 A;  2MBG A;  1D0Y A;  3HKB E;  1U5P A;  1SHZ C;  3ESL A;  3Q5X A;  2E9X B;  5JH7 E;  4MAL A;  4HFV A;  2YU1 A;  5JRC A;  3QUJ A;  1SA0 E;  1MIV A;  4QXB B;  4YFS A;  5H6Q B;  5HWY A;  3O1J A;  2ES0 A;  3H37 A;  4TV8 E;  1D0Z A;  4JUY A;  3RRC A;  4P0B A;  4WNK A;  1FEW A;  5HXH A;  3N2G E;  3LG7 A;  1LKX A;  3MK7 C;  4OK0 A;  1IJ5 A;  3C4W A;  1ZV4 X;  2XHE B;  3CWZ B;  3PE0 A;  3ZN0 B;  3GMI A;  3Q5W A;  4B6X A;  1ZEE A;  5L3G B;  1AJ3 A;  4O2A E;  2KWH A;  1Z0P A;  2V7I A;  4BAY B;  4UEM A;  2WBL A;  1HX8 A;  5FYM A;  3BQK A;  2ZM0 A;  3PUR A;  4PK4 A;  5DJQ C;  3HL6 A;  1QUU A;  3ZPO A;  2P9B A;  3WAK A;  3ZYL A;  2Q9Q A;  2Y48 B;  3KBU A;  2H7O A;  2LOS A;  4MBQ A;  3RH3 A;  1WRD A;  2ODU A;  5EK4 A;  2E8I A;  4BJN A;  5L3E B;  1FMW A;  2Z6E A;  3GN5 B;  4ZHQ E;  4O4H E;  3QC9 A;  2V1D B;  3SOL A;  4DVD A;  1CUN A;  5M4Y A;  2NOX A;  3FB2 A;  4N78 D;  4JLE A;  3ZCJ A;  3SRZ A;  5FMN A;  5KX5 E;  2DCF A;  3P8C D;  2BVM A;  4YLH A;  2ZLY A;  3PU3 A;  3ZJ2 A;  2W62 A;  3KIN B;  4HKA A;  2BZB A;  2DWG A;  1MIW A;  4X1I E;  5HYA A;  3LK4 2;  2LOP A;  2LSG A;  3I9W A;  2K24 A;  1LRZ A;  1OXZ A;  2B1E A;  3ZYM A;  2X0L B;  5LYJ E;  1WYC A;  3ZMT B;  4G2A A;  5FXX A;  2Y6X A;  3SWH A;  1YD8 G;  2NP9 A;  4O8S A;  5HXC A;  5JRE A;  5LGU B;  5LG4 A;  2X67 A;  5EZY E;  1D1C A;  3ZC0 A;  4HE8 A;  3LK3 B;  4L9I A;  4UVA B;  4F6R C;  5AFU L;  1NWM X;  1YKH B;  3H3A A;  4ZOL E;  4H9S E;  3OYX A;  5BMV E;  4X1K E;  4AQG A;  4QWN B;  2YIN A;  3ZLI A;  2PBI A;  1MNE A;  3Q9D A;  2LHR A;  3RC3 A;  4ZI2 D;  3PUQ A;  2DI4 A;  2ZMA A;  1LVK A;  2CMR A;  3BQL A;  3EUH A;  3KBT A;  5FXW A;  2DNX A;  2E9X A;  3FHN A;  1US7 B;  4IST A;  4ILU A;  5FY1 A;  3ZMZ B;  5CB4 E;  5F3J A;  4YHJ A;  3WAJ A;  4G63 A;  4KMC A;  1WLX A;  5HWX A;  5LGT B;  5JVD E;  2HPL A;  4I55 E;  5JDF A;  4E7Z A;  4WBN E;  3ANW B;  2V7K A;  3J7Y q;  2UXX B;  2CE7 A;  3LJC A;  4HTE A;  4PW8 A;  4CXW A;  5L3B B;  2IW5 B;  2HH7 A;  1WYB A;  3CQC B;  3ZMU B;  2ZM8 A;  5CA1 E;  3AA7 B;  3BQI A;  3GWH A;  4Z8X A;  2CWY A;  3KVB A;  4E7S A;  3N2K E;  5JR9 B;  2V7M A;  3BK9 A;  1H7C A;  3CVR A;  3U3I A;  4I50 E;  3M65 A;  3O1H A;  5DQW A;  4PK5 A;  3UUM A;  3AVR A;  2CA5 A;  4IHJ E;  2ACX A;  4ZI2 C;  4XZC A;  4NUU A;  3L09 A;  3O1I A;  2C5I T;  3N9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...