3UUXB

Crystal structure of yeast fis1 in complex with mdv1 fragment containing n-terminal extension and coiled coil domains
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
207
structure length
132
Chain Sequence
DNKTCFRMLTYISDDLLNEIPKETSLFQGFKSYLPIAELAIEGVETAAISSSYSPSALKSFSQTLVNSLEFLNIQKNSTLSEIRDIEVEVENLRQKKEKLLGKIANIEQNQLLLEDNLKQIDDRLDFLEEYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondria fission 1 protein
publication title Crystal structure of mitochondrial fission complex reveals scaffolding function for mitochondrial division 1 (mdv1) coiled coil.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Apoptosis
total genus 42
structure length 132
sequence length 207
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11542 Mdv1 Mitochondrial division protein 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3uuxB01
3UUXB
chains in the Genus database with same CATH superfamily
4DBQA 1HR0T 5J0ZA 4HWDA 4QH1A 2LJLA 3GN5A 3CQCB 3MA9A 3LDQB 4JI1T 3I9YA 2E9XC 3ETVA 1QSDA 5ABFB 4LFAT 3UU5A 4JBWF 3ZYLA 4ZI2C 2YDSA 1T72A 1D1CA 3FXEB 5LMUT 2D0UA 3P4QA 5HXHA 2QRXA 3RH3A 2E2AA 4GK0E 2YK0A 1Y64B 4O4LE 1HG5A 3C50A 2MTQA 5HAXA 2JMHA 4TUYE 1HS7A 2E5VA 4TX5A 5AQVB 2XAGB 5HXCA 4DMVA 2WQYA 3ZN1B 1CHUA 3N9LA 4U3CA 2HPLA 4YFSA 2X0LB 2XQ7A 2V6YB 4O4IE 1WYBA 3OBVE 3M3ZB 1UGOA 3O4XE 2VKOA 4H9SE 2X51A 4X5TA 4ZOLE 4HFDA 5ABFA 5FY1A 2F4VT 3RYIE 1WYCA 2UUBT 3RYCE 2C0SA 4EAHA 2V5DA 4DR3T 1M7KA 3I9WA 4MHCA 1XZYA 5JR9C 3I0QA 3AEBA 4ERRA 4NXNT 1B7TA 3P4WA 3QOFA 1MMDA 4E7ZA 2WS3A 1I6ZA 5L4HA 4PK5A 1UX5A 2MAWA 1SHZC 2HN2A 2V6YA 2W62A 4PK4A 4JI3T 4IDNA 3C4ZA 2M6BA 1QLBA 4OYJA 3PUWF 2UXDT 1W0BA 1WR0A 3OVUA 4KUMB 3L09A 3VR9A 4UEMA 4GKJT 1S35A 1N36T 3VKHA 3AVSA 3AEEA 4IIJE 3C4XA 4Z90A 4NUVA 5BMVE 2B1EA 4COFA 5HWXA 4V1Av 3AVRA 1N34T 4UF0B 2CLYC 2HH7A 5CA1E 2W66A 2LKGA 4O2AE 1FMVA 3ZMVB 2XAJB 4P0AA 5ADXL 4AKLA 4EGWA 1SUMB 1EZ3A 5E0OA 3FBLA 1GQEA 4HGAA 1XNRT 4HWFA 5HEUA 4FJOA 3ZYKA 1JNRA 3UTKA 3RRCA 3UUNA 4X64T 1W0AA 5L4EA 5JDNA 4NUUA 4F6RC 5LNKA 3N2GE 3UT5E 5LHGB 2Q9QD 3NRYA 4H9PC 2XY8B 4AKGA 5L47A 2PFVA 3I1AA 3BK9A 1OXZA 4UF0A 1WFDA 4X65T 4TN7B 4CN1A 1ZP0A 4TV9E 4L9IA 5LMNT 5FL1A 4I0UA 2QYWA 2D9DA 4YT0A 5AQRB 1I94T 3ONLC 3TKLB 3OYXA 3PUGA 4FI5A 2OA5A 2W63A 5JDFA 1D0XA 5LB7B 4ZZBA 3ZMTB 3SRZA 5ABGA 3ZLIA 2FBWA 4GK5E 2NR4A 2V1DB 5L3FB 2MPKA 1YQ3A 2XZEA 4OFZA 2V6XA 3JC6C 1HFAA 1UURA 1T7SA 2X9YA 3KV4A 1AJ3A 4Q25A 4DV1T 4O4HE 2OLTA 3H3MA 2FJDA 4AQYT 3N2KE 4P0BA 2W2UA 5BR8T 3Q5DA 1MNDA 4PK6A 5AQJB 2LOSA 4IHJE 2KNDA 3E08A 2BS4A 3GA8A 3IA3A 1HNZT 5L3EB 2JQKA 4UELA 5M4YA 4ANJA 2FJAA 2WB5A 2V7JA 2BBJA 3QC9A 3BQKA 1S94A 4JI2T 2ES0A 3RLFF 4G63A 4LF9T 3AE4A 4GKKT 2L3LA 5HEGA 4AXPA 3RC8A 3P4PA 3SWHA 1XMQT 5LHHB 5HXSA 2K48A 2HHHT 3EVYA 3AE9A 1M62A 2LLYA 3FZHB 2UU9T 5FXXA 4QX7B 4UVAB 4HFIA 1FIOA 2BS3A 2KLQA 4MALA 2J1DG 2KWHA 5LP6E 2BBHA 2E9XD 3ZT5A 2C5KT 2WZHA 4EYYR 4ZI2D 2BG9E 3ZN0B 4CI3B 3ANWB 3DJBA 4ADZA 5KMGP 2Q9QB 1OEDC 1SE7A 4UV8B 3K1SA 3LK2B 4UVCB 3ZCIA 1G73A 1IBMT 4JI6T 1ZEEA 2CBIA 2DWKA 4MBQA 3OPCA 2IC9A 4YHHT 2CE7A 2JQHA 4AQFA 4DV0T 2W61A 1UK5A 4L5GA 1KNZA 2EHOC 5J2UE 2YOEA 3ZEFB 1XDPA 3F2EA 3KINB 1IBLT 3AXJA 2A3DA 4ZZCA 3KV5A 3RIUC 4CXWA 4HTEA 4ASKA 5ETWA 4I55E 2H7OA 5TAOA 3T1YT 2AXDS 3ANWA 4KMCA 4ZI7E 2Q9QA 1FEWA 3N5LA 2CMRA 4AKHA 2R6GF 2LM2A 3LBXB 4GOUA 4YJ3E 1KNRA 3RGLA 4ZEYA 4U74A 5FVKA 3FHNA 4DV7T 1XMOT 2PG8A 3N9OA 1OWAA 4DR1T 4WW0A 2BKPA 2VQET 5L3DB 2QVAA 4O4JE 3KDSE 4YTMA 4EV6A 2W0GA 1J5ET 2BS2A 4HFEA 1YKHB 5H6QB 1NENA 5AQUB 3UU8A 1HCIA 3MZKB 3KFWX 2CA5A 5F3JA 3CPZA 3ZCJA 1OEDE 4EZHA 4DUZT 3AE8A 2HPJA 5EZYE 4IDQA 3LBXA 3AEAA 4IT4A 2V8SV 2ZMAA 4ZS2A 3RIAA 4NIQA 4EIWA 4P1NA 3O9XA 3N9PA 4JYAT 3TLTA 3PUZF 2BVMA 3PUVF 3UQ7A 5FY7A 2JJ9A 5ABEA 2JIWA 4WBNE 4OK0A 4JEHB 2WAUA 3U78A 2VL0A 3CQXC 5F8PA 3CK6A 4LF6T 4XZCA 3B57A 3UFEA 3NRXA 2E9XB 1IZNB 2BKOA 4P09A 4U2YA 3NKZA 5IYZE 3RX6A 4TZ4C 4AKIA 2UXXB 4HEAA 2M67A 2ZM2A 2ZLYA 2PBIA 3EUHA 2VKHA 3FBZA 2E8IA 4ZI3C 3ZPOA 2LRLA 4H9OC 4N78D 5AQOB 3X1DA 5HXEA 2XJ7A 4U31A 2CEAA 3ONJA 4OYKA 3LSVA 3RRWA 3FZLB 1BR1A 4DV5T 1NEKA 4DR7T 2CXLA 4NXMT 3VRAA 3W15B 3EDVA 1N32T 2A72A 4U7YA 2E9XA 5FKYA 2OV9A 3RF1A 1HF8A 3JC6D 1WLXA 3NZPA 4UV9B 1D1BA 2DNXA 2WDQA 3CX7B 1MIYA 4AIUA 2CRBA 1KNPA 2D2SA 5C8YE 4H63V 3DTOA 4C90A 2QGSA 2FJEA 4H63H 1IJ6A 2IW5B 3ZT6A 4PJJA 1HG2A 4WBOA 3SOLA 1IAPA 2V7MA 3RYHE 5DJQC 3AAAB 4U7IA 3P50A 2IUBA 5A1LA 2XHEB 3N9QA 5HEJA 5LGNB 3ZC1A 2UXBT 2LHNA 5KX5E 4WNKA 1KFYA 4TNWA 5HXRA 2X9HA 3PUSA 3PV0F 2W4XA 2VWAA 3ZSSA 2A2FX 2WZIA 5JR9A 3RKGA 5FNVE 2CLYB 2XQYA 4DIDB 4E7SA 5AQMB 3I0OA 3V5UA 4O2BE 4K0UA 4YTPA 4XBFB 4QWNB 5C3JA 1NWMX 4QHOA 1BR0A 5LYJE 1ZOYA 5CB4E 3NVOA 1HNWT 2LHRA 4HFCA 4UVBB 5LGTB 4BJNA 3NWIA 2YDRA 1MNEA 3N9MA 4EYUA 3ZJ2A 2DCFA 1X79A 2CXFA 2XQ6A 5AQIB 3O1JA 5FXWA 3RI5A 2VQFT 1L0VA 3AB3B 4EXTA 4PFPA 4UIGA 3TLUA 3VHLA 2V7IA 2VK9A 5J1GA 3IHRA 4H9NC 5L3BB 4QKNA 2WWVA 4TNVA 5GONE 1LRZA 2CWYA 4EB6E 5ABHA 2LKHA 5IHYA 2NWBA 4K0KT 3O1HA 5FY0A 3CX6B 3EDUA 1WR6A 2VURA 3K3QC 4DO0A 3UU4A 2BG9B 5LBQB 5HEHA 4XAXB 2I6HA 3J9X1 2LEHA 4CI2B 4YTNA 3AAIA 3Q5EA 4LFBT 4JI8T 2N9DA 3ZMSB 1MMAA 3B5MA 4AKRB 5IWAT 4DV2T 1SA0E 4KHZF 4DUYT 4DV3T 3V5SA 4AQGA 2XQ9A 4TWFA 4QXBB 2MYSA 2IIUA 2MOZA 1XWMA 5AQFB 4ZXLA 5L3CB 1XDOA 2H3RA 2QA7A 3NBXX 2NTXA 5C2TA 4U2ZA 3PU3A 3OTOT 1HX8A 2H7VC 2BG9A 2LSKA 2JQ9A 2K3WA 3AE1A 4KX6A 4JI7T 2HN1A 2YU1A 4F8HA 1YD8G 2ODUA 2FJBA 3UFGA 2DHRA 4YSYA 4JEUB 3ETUA 3AEGA 3PDYA 4UXNB 2AE9A 2H89A 4M1PA 1HTJF 2CWOA 4YSXA 4DV6T 3RC3A 2VVNA 2XQ4A 3AE2A 3RYFE 3AXJB 4WZXA 4QXHB 2YN6A 5FXVA 1WRDA 4A56A 4HFBA 4YXDA 2GK9A 5AQHB 4ZI3D 2W67A 1OEDB 2DI4A 4LF7T 1E2AA 3LK3B 3AAEB 3R84B 4CQIA 5JVDE 5J2TE 3WAJA 4BA9A 2X9XA 2IDOB 4U33A 4DBRA 1O3XA 2LSGA 2WU2A 5JTGA 3ZC0A 1E7PA 1BR4A 4IGUA 2V26A 5LG3A 2WM9A 3TLWA 3H3AA 4AI6A 4B3MT 2XQ8A 2X0YA 2KT9A 2L8KA 2YKSA 2CPTA 2Y48B 4HWHA 4ILAA 3HA4A 3TLSA 3Q2MA 1X9BA 2NW7A 4HWIB 2XSAA 1OEDA 4HN9A 3MACA 3K8PC 1T8BA 2WY2A 2JMKA 3EI0A 3HL6A 4IREA 5LOVE 1IBKT 2LSYA 2LM9A 3NZQA 5AQKB 2C5IT 2BDEA 2L9QA 4H9QC 2X67A 4KI0F 3QB5K 1VCSA 3CMLA 1Z0PA 3RIUA 5LGUB 3ZSTA 2M6IA 3Q5XA 1T98A 1LKXA 3VR8A 2KSRA 3JCFA 2MBGA 3J7Yq 4GYRA 2NOXA 2LSJA 2WDVA 3M65A 1MMGA 4DVDA 4PAGA 3KVBA 5HYAA 3VU7H 2NTYA 3PUXF 5JRCA 5LJMA 4YY3T 2WWUA 2XM2A 3LFMA 2ZM8A 5DABA 3PU8A 2B76A 2CHOA 2WMOA 4DNDA 4A98A 3WI3A 2H88A 5EK2A 5AQGB 1U5PA 3ZYMA 2XQ3A 1V9DA 4CI1B 4LMJA 1KF6A 2YU2A 1FMWA 1N33T 3AE7A 4LMKA 2XAQB 3LG7A 4ZHQE 4I50E 2VVSA 3LJCA 2IHR1 4ILBA 4NPPA 3AA6B 3QB5A 1FJGT 2I0MA 4O8SA 1IJ5A 4IL4A 3ESLA 3KV6A 4ISTA 1NAFA 4JI5T 3F31A 3ONXA 2ZM6T 2CXDA 2RP4A 4HE8A 3AA1B 5FVLA 4YJ2E 1WCRA 2JRKA 5KXJA 2XQ5A 2LRKA 3CIRA 4EOZB 4PJMA 5EK3A 4MFRA 1D0ZA 5LJNA 3IBPA 4HFHA 1Y01A 3HKCE 3FZMB 3SFDA 3BQIA 5JR9B 3FZKB 4IDPA 3PJAJ 2PTFA 5LXTE 1YW0A 3P8CD 2XAFB 3KVAA 4CXYA 2ZM0A 4ISSA 4DV4T 4QH5A 4L0RA 3UUBA 3CX8B 3BQLA 4IE5A 3WAKA 4DMWA 3ZMUB 3C64A 3FB2A 4CXXA 4IL9A 4JV5T 4IE6A 1QUUA 3ABVA 3HR0A 3T1HT 5JH7E 2P9BA 5AQPB 5HWYA 4OHFA 1MIWA 3EHZA 5FL0A 1ZKEA 2J47A 4PNIA 3PTRB 4TV8E 3OYZA 2KMFA 4B3TT 4I4TE 3UU6A 3UULA 3HKEE 3KV9A 2G0UA 3EABA 2KWIB 3QUJA 3QK6A 2WBLA 3PURA 2ODVA 2V5CA 2XQAA 1KEYA 1W09A 3PJAA 2XM1A 2YEVC 4YSZA 3UQ4A 4H9RC 2DLRA 1BR2A 3AEDA 4GIWA 3UUXB 3F57A 4EEDA 2VKJA 3JAEA 3A5XA 4MLKA 3RQWA 4I43B 1HX1B 4IDZA 3UUMA 2C5JA 5AQSB 3K3OA 3S4UA 3AEFA 3Q5WA 5LBMA 3OJAA 2NW9A 3PE0A 3A8YC 2E5LT 2CM0A 2DL1A 4TWDA 4EEBA 4AISA 1D0YA 4LMLA 1Z8UA 2CCQA 3GWHA 4CN6A 2EHOD 4YHJA 2X0HA 5LHIB 2IMLA 2XUEA 4IE7A 3MJXA 1H7CA 4A5XA 1VRBA 2V7LA 2WDRA 3AECA 4DR6T 3CQGB 1J5WA 4HWCA 2CHNA 2FUPA 5CA0E 1US7B 2SPCA 1UCUA 3PUYF 2Y8DA 3ZKRA 3CKDA 3ZJ1A 3UU3A 2Z6EA 4IE4A 5HCJA 2PJQA 2BG9C 2KXPB 4ILCA 2RPAA 4B3ST 3A7MA 4B3RT 5FP3A 5HEOA 3L39A 2LT3A 2V7KA 4X66T 4OX9T 3O1IA 2CBJA 3P4SA 4DR5T 5LG4A 4LFCT 3MXZA 5CFBA 3TLVA 3N9NA 5DQVA 5DQWA 4TWHA 3OKQA 1ZV4X 3CWZB 2XSBA 3N2OA 2WSSV 2IAKA 2X68A 1MIVA 3MKDA 4QX8B 4QH4A 3E22E 2YINA 4X1KE 2NP9A 1VCTA 5CJ5A 2N1GA 2UUAT 3P7IA 4ZS3A 2KINB 5FXZA 1D1AA 5FMNA 2ACZA 2DWGA 2J4GA 3JADA 3FXDB 5IUXA 4J2CA 3ZMZB 4HFVA 5AQNB 2W00A 5CGMA 1W9RA 4A97A 4JI0T 3AA7B 2WMNA 5EK4A 4DR2T 1LVFA 3C51A 1VOMA 4KHPT 4AQFC 2D0TA 4KP3C 1HNXT 3VKGA 1U4QA 2JPFA 3HKDE 2X9WA 3AE5A 4X1IE 5JDMA 4PFOA 2Y6XA 3MK7C 4X62T 1MMNA 3HKBE 1YXRA 3HI2A 5JDLA 5H6RB 1ZHCA 4WYVA 2XASB 4G2AA 3PUAA 2K9AA 1YQ4A 2Q9QC 3C4WA 2IC6A 2YDQA 3KBUA 2UXCT 4X1YE 1KK7A 3QNUA 3GMIA 2XAHB 4B6XA 2EHOB 4CZZB 5HCMA 1JNZA 4PJLA 2I59A 3FZFB 3ZT7A 2XPKA 4QXCB 3RPUA 2WCAA 5JQGE 2X66A 1R8IA 3CVRA 5KDMC 3IF8B 3H37A 2VB6A 2WP9A 2BVLA 2BZBA 4BAYB 2K24A 4IDOA 2WU5A 2UUCT 2KZ7B 4EZ4A 4U72A 4ILUA 3D0TA 5JRCB 2D5UA 3RIFA 3DP7A 2VL8A 2UXNB 1UUSA 3VRBA 2A9UA 4LF5T 4JLEA 1J1JA 1CUNA 2EHOA 3RKOA 3PUQA 4X20E 5L3GB 5JDHA 3P4RA 3Q9DA 4KBMB 5F5WA 4GYSA 3B13A 2N2NA 3AE6A 1YKEB 3L3PA 1G8XA 2LOPA 3R6NA 4JUYA 3SFEA 1UX4A 3RHWA 3U3IA 3G06A 3RQUA 5AQLB 2ACXA 4CN4A 1XNQT 4PJNA 4YLHA 4IE0A 5AQTB 1E1HB 3SS1A 2K5BB 2J62A 3K3NA 4LF8T 5JDQA 3GN5B 3EAMA 1LVKA 4PW8A 5FYMA 2RA1A 2VKDA 2LE8A 2LSIA 4UR9A 3AE3A 5LA6E 4JI4T 4HKAA 4C91A 5LCYA 3T8OA 3LK42 5AQQB 2VASA 2BKNA 5JDGA 3JAFA 3L8RA 4LF4T 4BJMA 5AFUL 4DR4T 4Z91A 3C98B 2NW8A 2JQQA 4Z8XA 1DU2A 3KBTA 3AA0B 5L2LA 3IEEA 2XTLA 5JREA 3E0ZA
chains in the Genus database with same CATH topology
4L5GA 4DBQA 2KWIB 4QXBB 1KNZA 2MYSA 2LJLA 2EHOC 3QUJA 2MOZA 3GN5A 3QK6A 5J2UE 2WBLA 3ZEFB 3PURA 3CQCB 3F2EA 3MA9A 3I9YA 2E9XC 3ETVA 3KINB 1QSDA 5L3CB 2A3DA 3KV5A 2H3RA 2ODVA 2QA7A 3NBXX 3ZYLA 4ZI2C 4CXWA 1D1CA 3FXEB 2D0UA 2NTXA 4HTEA 3PU3A 4ASKA 5ETWA 5HXHA 2YEVC 1HX8A 4I55E 2H7OA 3RH3A 5TAOA 4GK0E 2YK0A 2H7VC 1Y64B 3ANWA 2LSKA 4KMCA 1HG5A 4O4LE 4ZI7E 4H9RC 3C50A 2DLRA 2Q9QA 2MTQA 5HAXA 1BR2A 1FEWA 2JMHA 3N5LA 4TUYE 1HS7A 4GIWA 2CMRA 3UUXB 4AKHA 3F57A 4TX5A 2XAGB 5HXCA 2VKJA 2YU1A 4DMVA 3ZN1B 3A5XA 3N9LA 4MLKA 4I43B 2HPLA 3LBXB 4IDZA 1YD8G 3UUMA 2ODUA 2C5JA 4GOUA 4YFSA 2X0LB 3K3OA 3S4UA 4YJ3E 4O4IE 1WYBA 3OBVE 3Q5WA 5LBMA 3OJAA 2DHRA 4U74A 2NW9A 3FHNA 4JEUB 3ETUA 3PE0A 3O4XE 2PG8A 3N9OA 1OWAA 3PDYA 4UXNB 2VKOA 4H9SE 2X51A 2CM0A 4ZOLE 4WW0A 5FY1A 1D0YA 4M1PA 1HTJF 3RYIE 2CWOA 5L3DB 2CCQA 1WYCA 3GWHA 4O4JE 3RYCE 2C0SA 3KDSE 3RC3A 2EHOD 4YHJA 2W0GA 5LHIB 2XUEA 4EAHA 1YKHB 4IE7A 5H6QB 3RYFE 3I9WA 3MJXA 1H7CA 1HCIA 3MZKB 1VRBA 4QXHB 4MHCA 5FXVA 5JR9C 3I0QA 1WRDA 3KFWX 4A56A 4ERRA 2V7LA 2CA5A 1B7TA 5F3JA 1MMDA 3CQGB 4E7ZA 3CPZA 3ZCJA 4EZHA 2GK9A 2HPJA 5EZYE 3LBXA 4PK5A 1UX5A 5CA0E 4ZI3D 1SHZC 2DI4A 1US7B 2SPCA 2ZMAA 4ZS2A 1UCUA 2W62A 2Y8DA 3LK3B 3AAEB 3CKDA 4PK4A 3R84B 4EIWA 3O9XA 3ZJ1A 4CQIA 5JVDE 3C4ZA 3N9PA 4OYJA 2Z6EA 4IE4A 2BVMA 5J2TE 2PJQA 3WAJA 4BA9A 5FY7A 2X9XA 2JJ9A 4DBRA 4KUMB 3L09A 2KXPB 1O3XA 4WBNE 4OK0A 4UEMA 4JEHB 1S35A 2WAUA 5FP3A 2LSGA 3U78A 3ZC0A 3CQXC 5F8PA 3VKHA 4XZCA 3AVSA 3B57A 4IIJE 4XBFB 3C4XA 2LT3A 3UFEA 3NRXA 1BR4A 2V7KA 4IGUA 2E9XB 1IZNB 3O1IA 4NUVA 2V26A 2WM9A 4P09A 5BMVE 3H3AA 2B1EA 5IYZE 5LG4A 4AI6A 3RX6A 5HWXA 4V1Av 4TZ4C 3AVRA 4AKIA 2UXXB 2KT9A 2L8KA 2CLYC 2HH7A 2M67A 2ZLYA 2ZM2A 2Y48B 4HEAA 4UF0B 3MXZA 5CA1E 2PBIA 3HA4A 3EUHA 3Q2MA 4O2AE 1FMVA 2VKHA 3FBZA 3ZMVB 2XAJB 2E8IA 3N9NA 4P0AA 5ADXL 5DQVA 5DQWA 4AKLA 2NW7A 3OKQA 4ZI3C 1ZV4X 3ZPOA 4H9OC 1EZ3A 4N78D 3CWZB 4HN9A 5HXEA 3MACA 5E0OA 3K8PC 3N2OA 2CEAA 2JMKA 2WSSV 3FBLA 2IAKA 2X68A 1MIVA 4HGAA 3MKDA 4QX8B 3E22E 4OYKA 3HL6A 5LOVE 2YINA 2LSYA 3RRWA 2LM9A 3NZQA 4X1KE 2NP9A 1BR1A 2C5IT 2CXLA 4FJOA 3ZYKA 2N1GA 3UTKA 3P7IA 2BDEA 4ZS3A 2KINB 3W15B 3EDVA 3RRCA 3UUNA 2L9QA 4H9QC 5JDNA 5FXZA 1D1AA 4NUUA 4F6RC 2A72A 5FMNA 2DWGA 5LNKA 2X67A 3N2GE 3UT5E 5LHGB 2Q9QD 3NRYA 4H9PC 3CMLA 4AKGA 2E9XA 1Z0PA 3FXDB 4J2CA 3ZMZB 4HFVA 5LGUB 1HF8A 2PFVA 3I1AA 3JC6D 1WLXA 3NZPA 3BK9A 1OXZA 3Q5XA 2W00A 1T98A 1D1BA 4UF0A 4UV9B 4TN7B 3AA7B 2WMNA 1LKXA 5EK4A 2DNXA 1LVFA 3CX7B 1MIYA 3C51A 1VOMA 2MBGA 4AQFC 2D2SA 5C8YE 3J7Yq 2D0TA 4KP3C 4GYRA 4TV9E 4H63V 3VKGA 2NOXA 3DTOA 1U4QA 4L9IA 4C90A 2QGSA 2LSJA 2JPFA 3M65A 4H63H 3HKDE 2X9WA 1IJ6A 2IW5B 4X1IE 1MMGA 4PJJA 1HG2A 4DVDA 4PAGA 3KVBA 5HYAA 4WBOA 3SOLA 5JDMA 3VU7H 1IAPA 2NTYA 2V7MA 4PFOA 3OYXA 3PUGA 4FI5A 3TKLB 2Y6XA 3RYHE 2OA5A 3MK7C 5DJQC 5JRCA 5LJMA 3AAAB 2W63A 5JDFA 1D0XA 2WWUA 1MMNA 3LFMA 2ZM8A 3SRZA 5DABA 3ZMTB 3HKBE 5A1LA 2XHEB 3HI2A 3PU8A 3ZLIA 3N9QA 5JDLA 5H6RB 1ZHCA 2WMOA 2XASB 4DNDA 4G2AA 4GK5E 3PUAA 2K9AA 2V1DB 3WI3A 5L3FB 5EK2A 2Q9QC 3C4WA 2IC6A 5LGNB 3KBUA 3ZC1A 2LHNA 4X1YE 1U5PA 5KX5E 4OFZA 4WNKA 3ZYMA 1KK7A 3JC6C 1V9DA 3GMIA 2XAHB 5HXRA 1HFAA 2EHOB 2X9YA 2X9HA 4B6XA 3KV4A 3PUSA 4CZZB 4CI1B 1AJ3A 4PJLA 2I59A 2YU2A 4O4HE 1FMWA 2VWAA 2A2FX 3N2KE 4P0BA 4QXCB 3RPUA 5JR9A 5FNVE 2CLYB 2XQYA 2XAQB 5JQGE 3LG7A 1MNDA 4ZHQE 2X66A 4I50E 4PK6A 3LJCA 2LOSA 3CVRA 4IHJE 2KNDA 3E08A 3GA8A 5KDMC 4E7SA 3IF8B 3I0OA 3V5UA 4O2BE 3H37A 4K0UA 3AA6B 5L3EB 2VB6A 2BVLA 4UELA 4O8SA 5M4YA 2BZBA 4BAYB 4ANJA 1IJ5A 2K24A 3ESLA 3KV6A 4ISTA 4QWNB 1NWMX 1NAFA 4QHOA 1BR0A 2V7JA 5LYJE 3F31A 3ONXA 3QC9A 5CB4E 2CXDA 2LHRA 2KZ7B 4EZ4A 4U72A 3BQKA 4ILUA 2RP4A 3D0TA 4UVBB 5LGTB 5JRCB 1S94A 2D5UA 4HE8A 4BJNA 3DP7A 2VL8A 3AA1B 2UXNB 2ES0A 4G63A 1MNEA 3N9MA 4EYUA 4YJ2E 3ZJ2A 4JLEA 2DCFA 1CUNA 2EHOA 3RKOA 1X79A 3PUQA 2CXFA 2L3LA 4X20E 5L3GB 4AXPA 5JDHA 3RC8A 3SWHA 3Q9DA 2JRKA 4KBMB 5LHHB 5HXSA 4GYSA 3O1JA 5FXWA 3B13A 2N2NA 4EOZB 4PJMA 1YKEB 3L3PA 5EK3A 2K48A 4MFRA 1G8XA 3AB3B 1D0ZA 3EVYA 4EXTA 2LOPA 3R6NA 4JUYA 4PFPA 1UX4A 4UIGA 3U3IA 5LJNA 3IBPA 3HKCE 2ACXA 3BQIA 5FXXA 3VHLA 4PJNA 5JR9B 2V7IA 4YLHA 4QX7B 4IE0A 1E1HB 2VK9A 3SS1A 5J1GA 2K5BB 4UVAB 5LXTE 3IHRA 1FIOA 1YW0A 4H9NC 5L3BB 3K3NA 2KLQA 5JDQA 3GN5B 4MALA 1LVKA 2J1DG 3P8CD 2XAFB 4QKNA 4PW8A 2KWHA 5GONE 1LRZA 2CWYA 4EB6E 5LP6E 5FYMA 2RA1A 3KVAA 2VKDA 5IHYA 2NWBA 2E9XD 3O1HA 5FY0A 3CX6B 4CXYA 3EDUA 2ZM0A 4ISSA 2LE8A 2C5KT 2LSIA 1WR6A 4L0RA 4ZI2D 4EYYR 3CX8B 5LA6E 3K3QC 3BQLA 4IE5A 3WAKA 4DMWA 3ZMUB 3C64A 3ZN0B 4DO0A 4CI3B 4HKAA 3FB2A 5LCYA 3T8OA 4CXXA 3LK42 4C91A 3ANWB 5LBQB 4XAXB 3J9X1 3DJBA 2VASA 4IE6A 1QUUA 2LEHA 2Q9QB 4ADZA 5JDGA 5KMGP 4UV8B 4CI2B 3HR0A 3AAIA 3LK2B 5JH7E 4UVCB 2P9BA 5HWYA 2G0UA 3ZCIA 4OHFA 4BJMA 5AFUL 2N9DA 3ZMSB 1MIWA 3C98B 2NW8A 1G73A 2JQQA 1ZEEA 1ZKEA 1MMAA 4PNIA 4Z8XA 2DWKA 3PTRB 4TV8E 3OYZA 2KMFA 4AKRB 4MBQA 3KBTA 3AA0B 4I4TE 2IC9A 3UULA 5L2LA 1SA0E 3HKEE 3IEEA 2CE7A 2XTLA 4AQFA 5JREA 3E0ZA 3V5SA 3KV9A 2W61A 4AQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UUX B; 
#chains in the Genus database with same CATH topology
 4DBQ A;  1HR0 T;  5J0Z A;  4HWD A;  4QH1 A;  2LJL A;  3GN5 A;  3CQC B;  3MA9 A;  3LDQ B;  4JI1 T;  3I9Y A;  2E9X C;  3ETV A;  1QSD A;  5ABF B;  4LFA T;  3UU5 A;  4JBW F;  3ZYL A;  4ZI2 C;  2YDS A;  1T72 A;  1D1C A;  3FXE B;  5LMU T;  2D0U A;  3P4Q A;  5HXH A;  2QRX A;  3RH3 A;  2E2A A;  4GK0 E;  2YK0 A;  1Y64 B;  4O4L E;  1HG5 A;  3C50 A;  2MTQ A;  5HAX A;  2JMH A;  4TUY E;  1HS7 A;  2E5V A;  4TX5 A;  5AQV B;  2XAG B;  5HXC A;  4DMV A;  2WQY A;  3ZN1 B;  1CHU A;  3N9L A;  4U3C A;  2HPL A;  4YFS A;  2X0L B;  2XQ7 A;  2V6Y B;  4O4I E;  1WYB A;  3OBV E;  3M3Z B;  1UGO A;  3O4X E;  2VKO A;  4H9S E;  2X51 A;  4X5T A;  4ZOL E;  4HFD A;  5ABF A;  5FY1 A;  2F4V T;  3RYI E;  1WYC A;  2UUB T;  3RYC E;  2C0S A;  4EAH A;  2V5D A;  4DR3 T;  1M7K A;  3I9W A;  4MHC A;  1XZY A;  5JR9 C;  3I0Q A;  3AEB A;  4ERR A;  4NXN T;  1B7T A;  3P4W A;  3QOF A;  1MMD A;  4E7Z A;  2WS3 A;  1I6Z A;  5L4H A;  4PK5 A;  1UX5 A;  2MAW A;  1SHZ C;  2HN2 A;  2V6Y A;  2W62 A;  4PK4 A;  4JI3 T;  4IDN A;  3C4Z A;  2M6B A;  1QLB A;  4OYJ A;  3PUW F;  2UXD T;  1W0B A;  1WR0 A;  3OVU A;  4KUM B;  3L09 A;  3VR9 A;  4UEM A;  4GKJ T;  1S35 A;  1N36 T;  3VKH A;  3AVS A;  3AEE A;  4IIJ E;  3C4X A;  4Z90 A;  4NUV A;  5BMV E;  2B1E A;  4COF A;  5HWX A;  4V1A v;  3AVR A;  1N34 T;  4UF0 B;  2CLY C;  2HH7 A;  5CA1 E;  2W66 A;  2LKG A;  4O2A E;  1FMV A;  3ZMV B;  2XAJ B;  4P0A A;  5ADX L;  4AKL A;  4EGW A;  1SUM B;  1EZ3 A;  5E0O A;  3FBL A;  1GQE A;  4HGA A;  1XNR T;  4HWF A;  5HEU A;  4FJO A;  3ZYK A;  1JNR A;  3UTK A;  3RRC A;  3UUN A;  4X64 T;  1W0A A;  5L4E A;  5JDN A;  4NUU A;  4F6R C;  5LNK A;  3N2G E;  3UT5 E;  5LHG B;  2Q9Q D;  3NRY A;  4H9P C;  2XY8 B;  4AKG A;  5L47 A;  2PFV A;  3I1A A;  3BK9 A;  1OXZ A;  4UF0 A;  1WFD A;  4X65 T;  4TN7 B;  4CN1 A;  1ZP0 A;  4TV9 E;  4L9I A;  5LMN T;  5FL1 A;  4I0U A;  2QYW A;  2D9D A;  4YT0 A;  5AQR B;  1I94 T;  3ONL C;  3TKL B;  3OYX A;  3PUG A;  4FI5 A;  2OA5 A;  2W63 A;  5JDF A;  1D0X A;  5LB7 B;  4ZZB A;  3ZMT B;  3SRZ A;  5ABG A;  3ZLI A;  2FBW A;  4GK5 E;  2NR4 A;  2V1D B;  5L3F B;  2MPK A;  1YQ3 A;  2XZE A;  4OFZ A;  2V6X A;  3JC6 C;  1HFA A;  1UUR A;  1T7S A;  2X9Y A;  3KV4 A;  1AJ3 A;  4Q25 A;  4DV1 T;  4O4H E;  2OLT A;  3H3M A;  2FJD A;  4AQY T;  3N2K E;  4P0B A;  2W2U A;  5BR8 T;  3Q5D A;  1MND A;  4PK6 A;  5AQJ B;  2LOS A;  4IHJ E;  2KND A;  3E08 A;  2BS4 A;  3GA8 A;  3IA3 A;  1HNZ T;  5L3E B;  2JQK A;  4UEL A;  5M4Y A;  4ANJ A;  2FJA A;  2WB5 A;  2V7J A;  2BBJ A;  3QC9 A;  3BQK A;  1S94 A;  4JI2 T;  2ES0 A;  3RLF F;  4G63 A;  4LF9 T;  3AE4 A;  4GKK T;  2L3L A;  5HEG A;  4AXP A;  3RC8 A;  3P4P A;  3SWH A;  1XMQ T;  5LHH B;  5HXS A;  2K48 A;  2HHH T;  3EVY A;  3AE9 A;  1M62 A;  2LLY A;  3FZH B;  2UU9 T;  5FXX A;  4QX7 B;  4UVA B;  4HFI A;  1FIO A;  2BS3 A;  2KLQ A;  4MAL A;  2J1D G;  2KWH A;  5LP6 E;  2BBH A;  2E9X D;  3ZT5 A;  2C5K T;  2WZH A;  4EYY R;  4ZI2 D;  2BG9 E;  3ZN0 B;  4CI3 B;  3ANW B;  3DJB A;  4ADZ A;  5KMG P;  2Q9Q B;  1OED C;  1SE7 A;  4UV8 B;  3K1S A;  3LK2 B;  4UVC B;  3ZCI A;  1G73 A;  1IBM T;  4JI6 T;  1ZEE A;  2CBI A;  2DWK A;  4MBQ A;  3OPC A;  2IC9 A;  4YHH T;  2CE7 A;  2JQH A;  4AQF A;  4DV0 T;  2W61 A;  1UK5 A;  4L5G A;  1KNZ A;  2EHO C;  5J2U E;  2YOE A;  3ZEF B;  1XDP A;  3F2E A;  3KIN B;  1IBL T;  3AXJ A;  2A3D A;  4ZZC A;  3KV5 A;  3RIU C;  4CXW A;  4HTE A;  4ASK A;  5ETW A;  4I55 E;  2H7O A;  5TAO A;  3T1Y T;  2AXD S;  3ANW A;  4KMC A;  4ZI7 E;  2Q9Q A;  1FEW A;  3N5L A;  2CMR A;  4AKH A;  2R6G F;  2LM2 A;  3LBX B;  4GOU A;  4YJ3 E;  1KNR A;  3RGL A;  4ZEY A;  4U74 A;  5FVK A;  3FHN A;  4DV7 T;  1XMO T;  2PG8 A;  3N9O A;  1OWA A;  4DR1 T;  4WW0 A;  2BKP A;  2VQE T;  5L3D B;  2QVA A;  4O4J E;  3KDS E;  4YTM A;  4EV6 A;  2W0G A;  1J5E T;  2BS2 A;  4HFE A;  1YKH B;  5H6Q B;  1NEN A;  5AQU B;  3UU8 A;  1HCI A;  3MZK B;  3KFW X;  2CA5 A;  5F3J A;  3CPZ A;  3ZCJ A;  1OED E;  4EZH A;  4DUZ T;  3AE8 A;  2HPJ A;  5EZY E;  4IDQ A;  3LBX A;  3AEA A;  4IT4 A;  2V8S V;  2ZMA A;  4ZS2 A;  3RIA A;  4NIQ A;  4EIW A;  4P1N A;  3O9X A;  3N9P A;  4JYA T;  3TLT A;  3PUZ F;  2BVM A;  3PUV F;  3UQ7 A;  5FY7 A;  2JJ9 A;  5ABE A;  2JIW A;  4WBN E;  4OK0 A;  4JEH B;  2WAU A;  3U78 A;  2VL0 A;  3CQX C;  5F8P A;  3CK6 A;  4LF6 T;  4XZC A;  3B57 A;  3UFE A;  3NRX A;  2E9X B;  1IZN B;  2BKO A;  4P09 A;  4U2Y A;  3NKZ A;  5IYZ E;  3RX6 A;  4TZ4 C;  4AKI A;  2UXX B;  4HEA A;  2M67 A;  2ZM2 A;  2ZLY A;  2PBI A;  3EUH A;  2VKH A;  3FBZ A;  2E8I A;  4ZI3 C;  3ZPO A;  2LRL A;  4H9O C;  4N78 D;  5AQO B;  3X1D A;  5HXE A;  2XJ7 A;  4U31 A;  2CEA A;  3ONJ A;  4OYK A;  3LSV A;  3RRW A;  3FZL B;  1BR1 A;  4DV5 T;  1NEK A;  4DR7 T;  2CXL A;  4NXM T;  3VRA A;  3W15 B;  3EDV A;  1N32 T;  2A72 A;  4U7Y A;  2E9X A;  5FKY A;  2OV9 A;  3RF1 A;  1HF8 A;  3JC6 D;  1WLX A;  3NZP A;  4UV9 B;  1D1B A;  2DNX A;  2WDQ A;  3CX7 B;  1MIY A;  4AIU A;  2CRB A;  1KNP A;  2D2S A;  5C8Y E;  4H63 V;  3DTO A;  4C90 A;  2QGS A;  2FJE A;  4H63 H;  1IJ6 A;  2IW5 B;  3ZT6 A;  4PJJ A;  1HG2 A;  4WBO A;  3SOL A;  1IAP A;  2V7M A;  3RYH E;  5DJQ C;  3AAA B;  4U7I A;  3P50 A;  2IUB A;  5A1L A;  2XHE B;  3N9Q A;  5HEJ A;  5LGN B;  3ZC1 A;  2UXB T;  2LHN A;  5KX5 E;  4WNK A;  1KFY A;  4TNW A;  5HXR A;  2X9H A;  3PUS A;  3PV0 F;  2W4X A;  2VWA A;  3ZSS A;  2A2F X;  2WZI A;  5JR9 A;  3RKG A;  5FNV E;  2CLY B;  2XQY A;  4DID B;  4E7S A;  5AQM B;  3I0O A;  3V5U A;  4O2B E;  4K0U A;  4YTP A;  4XBF B;  4QWN B;  5C3J A;  1NWM X;  4QHO A;  1BR0 A;  5LYJ E;  1ZOY A;  5CB4 E;  3NVO A;  1HNW T;  2LHR A;  4HFC A;  4UVB B;  5LGT B;  4BJN A;  3NWI A;  2YDR A;  1MNE A;  3N9M A;  4EYU A;  3ZJ2 A;  2DCF A;  1X79 A;  2CXF A;  2XQ6 A;  5AQI B;  3O1J A;  5FXW A;  3RI5 A;  2VQF T;  1L0V A;  3AB3 B;  4EXT A;  4PFP A;  4UIG A;  3TLU A;  3VHL A;  2V7I A;  2VK9 A;  5J1G A;  3IHR A;  4H9N C;  5L3B B;  4QKN A;  2WWV A;  4TNV A;  5GON E;  1LRZ A;  2CWY A;  4EB6 E;  5ABH A;  2LKH A;  5IHY A;  2NWB A;  4K0K T;  3O1H A;  5FY0 A;  3CX6 B;  3EDU A;  1WR6 A;  2VUR A;  3K3Q C;  4DO0 A;  3UU4 A;  2BG9 B;  5LBQ B;  5HEH A;  4XAX B;  2I6H A;  3J9X 1;  2LEH A;  4CI2 B;  4YTN A;  3AAI A;  3Q5E A;  4LFB T;  4JI8 T;  2N9D A;  3ZMS B;  1MMA A;  3B5M A;  4AKR B;  5IWA T;  4DV2 T;  1SA0 E;  4KHZ F;  4DUY T;  4DV3 T;  3V5S A;  4AQG A;  2XQ9 A;  4TWF A;  4QXB B;  2MYS A;  2IIU A;  2MOZ A;  1XWM A;  5AQF B;  4ZXL A;  5L3C B;  1XDO A;  2H3R A;  2QA7 A;  3NBX X;  2NTX A;  5C2T A;  4U2Z A;  3PU3 A;  3OTO T;  1HX8 A;  2H7V C;  2BG9 A;  2LSK A;  2JQ9 A;  2K3W A;  3AE1 A;  4KX6 A;  4JI7 T;  2HN1 A;  2YU1 A;  4F8H A;  1YD8 G;  2ODU A;  2FJB A;  3UFG A;  2DHR A;  4YSY A;  4JEU B;  3ETU A;  3AEG A;  3PDY A;  4UXN B;  2AE9 A;  2H89 A;  4M1P A;  1HTJ F;  2CWO A;  4YSX A;  4DV6 T;  3RC3 A;  2VVN A;  2XQ4 A;  3AE2 A;  3RYF E;  3AXJ B;  4WZX A;  4QXH B;  2YN6 A;  5FXV A;  1WRD A;  4A56 A;  4HFB A;  4YXD A;  2GK9 A;  5AQH B;  4ZI3 D;  2W67 A;  1OED B;  2DI4 A;  4LF7 T;  1E2A A;  3LK3 B;  3AAE B;  3R84 B;  4CQI A;  5JVD E;  5J2T E;  3WAJ A;  4BA9 A;  2X9X A;  2IDO B;  4U33 A;  4DBR A;  1O3X A;  2LSG A;  2WU2 A;  5JTG A;  3ZC0 A;  1E7P A;  1BR4 A;  4IGU A;  2V26 A;  5LG3 A;  2WM9 A;  3TLW A;  3H3A A;  4AI6 A;  4B3M T;  2XQ8 A;  2X0Y A;  2KT9 A;  2L8K A;  2YKS A;  2CPT A;  2Y48 B;  4HWH A;  4ILA A;  3HA4 A;  3TLS A;  3Q2M A;  1X9B A;  2NW7 A;  4HWI B;  2XSA A;  1OED A;  4HN9 A;  3MAC A;  3K8P C;  1T8B A;  2WY2 A;  2JMK A;  3EI0 A;  3HL6 A;  4IRE A;  5LOV E;  1IBK T;  2LSY A;  2LM9 A;  3NZQ A;  5AQK B;  2C5I T;  2BDE A;  2L9Q A;  4H9Q C;  2X67 A;  4KI0 F;  3QB5 K;  1VCS A;  3CML A;  1Z0P A;  3RIU A;  5LGU B;  3ZST A;  2M6I A;  3Q5X A;  1T98 A;  1LKX A;  3VR8 A;  2KSR A;  3JCF A;  2MBG A;  3J7Y q;  4GYR A;  2NOX A;  2LSJ A;  2WDV A;  3M65 A;  1MMG A;  4DVD A;  4PAG A;  3KVB A;  5HYA A;  3VU7 H;  2NTY A;  3PUX F;  5JRC A;  5LJM A;  4YY3 T;  2WWU A;  2XM2 A;  3LFM A;  2ZM8 A;  5DAB A;  3PU8 A;  2B76 A;  2CHO A;  2WMO A;  4DND A;  4A98 A;  3WI3 A;  2H88 A;  5EK2 A;  5AQG B;  1U5P A;  3ZYM A;  2XQ3 A;  1V9D A;  4CI1 B;  4LMJ A;  1KF6 A;  2YU2 A;  1FMW A;  1N33 T;  3AE7 A;  4LMK A;  2XAQ B;  3LG7 A;  4ZHQ E;  4I50 E;  2VVS A;  3LJC A;  2IHR 1;  4ILB A;  4NPP A;  3AA6 B;  3QB5 A;  1FJG T;  2I0M A;  4O8S A;  1IJ5 A;  4IL4 A;  3ESL A;  3KV6 A;  4IST A;  1NAF A;  4JI5 T;  3F31 A;  3ONX A;  2ZM6 T;  2CXD A;  2RP4 A;  4HE8 A;  3AA1 B;  5FVL A;  4YJ2 E;  1WCR A;  2JRK A;  5KXJ A;  2XQ5 A;  2LRK A;  3CIR A;  4EOZ B;  4PJM A;  5EK3 A;  4MFR A;  1D0Z A;  5LJN A;  3IBP A;  4HFH A;  1Y01 A;  3HKC E;  3FZM B;  3SFD A;  3BQI A;  5JR9 B;  3FZK B;  4IDP A;  3PJA J;  2PTF A;  5LXT E;  1YW0 A;  3P8C D;  2XAF B;  3KVA A;  4CXY A;  2ZM0 A;  4ISS A;  4DV4 T;  4QH5 A;  4L0R A;  3UUB A;  3CX8 B;  3BQL A;  4IE5 A;  3WAK A;  4DMW A;  3ZMU B;  3C64 A;  3FB2 A;  4CXX A;  4IL9 A;  4JV5 T;  4IE6 A;  1QUU A;  3ABV A;  3HR0 A;  3T1H T;  5JH7 E;  2P9B A;  5AQP B;  5HWY A;  4OHF A;  1MIW A;  3EHZ A;  5FL0 A;  1ZKE A;  2J47 A;  4PNI A;  3PTR B;  4TV8 E;  3OYZ A;  2KMF A;  4B3T T;  4I4T E;  3UU6 A;  3UUL A;  3HKE E;  3KV9 A;  2G0U A;  3EAB A;  2KWI B;  3QUJ A;  3QK6 A;  2WBL A;  3PUR A;  2ODV A;  2V5C A;  2XQA A;  1KEY A;  1W09 A;  3PJA A;  2XM1 A;  2YEV C;  4YSZ A;  3UQ4 A;  4H9R C;  2DLR A;  1BR2 A;  3AED A;  4GIW A;  3UUX B;  3F57 A;  4EED A;  2VKJ A;  3JAE A;  3A5X A;  4MLK A;  3RQW A;  4I43 B;  1HX1 B;  4IDZ A;  3UUM A;  2C5J A;  5AQS B;  3K3O A;  3S4U A;  3AEF A;  3Q5W A;  5LBM A;  3OJA A;  2NW9 A;  3PE0 A;  3A8Y C;  2E5L T;  2CM0 A;  2DL1 A;  4TWD A;  4EEB A;  4AIS A;  1D0Y A;  4LML A;  1Z8U A;  2CCQ A;  3GWH A;  4CN6 A;  2EHO D;  4YHJ A;  2X0H A;  5LHI B;  2IML A;  2XUE A;  4IE7 A;  3MJX A;  1H7C A;  4A5X A;  1VRB A;  2V7L A;  2WDR A;  3AEC A;  4DR6 T;  3CQG B;  1J5W A;  4HWC A;  2CHN A;  2FUP A;  5CA0 E;  1US7 B;  2SPC A;  1UCU A;  3PUY F;  2Y8D A;  3ZKR A;  3CKD A;  3ZJ1 A;  3UU3 A;  2Z6E A;  4IE4 A;  5HCJ A;  2PJQ A;  2BG9 C;  2KXP B;  4ILC A;  2RPA A;  4B3S T;  3A7M A;  4B3R T;  5FP3 A;  5HEO A;  3L39 A;  2LT3 A;  2V7K A;  4X66 T;  4OX9 T;  3O1I A;  2CBJ A;  3P4S A;  4DR5 T;  5LG4 A;  4LFC T;  3MXZ A;  5CFB A;  3TLV A;  3N9N A;  5DQV A;  5DQW A;  4TWH A;  3OKQ A;  1ZV4 X;  3CWZ B;  2XSB A;  3N2O A;  2WSS V;  2IAK A;  2X68 A;  1MIV A;  3MKD A;  4QX8 B;  4QH4 A;  3E22 E;  2YIN A;  4X1K E;  2NP9 A;  1VCT A;  5CJ5 A;  2N1G A;  2UUA T;  3P7I A;  4ZS3 A;  2KIN B;  5FXZ A;  1D1A A;  5FMN A;  2ACZ A;  2DWG A;  2J4G A;  3JAD A;  3FXD B;  5IUX A;  4J2C A;  3ZMZ B;  4HFV A;  5AQN B;  2W00 A;  5CGM A;  1W9R A;  4A97 A;  4JI0 T;  3AA7 B;  2WMN A;  5EK4 A;  4DR2 T;  1LVF A;  3C51 A;  1VOM A;  4KHP T;  4AQF C;  2D0T A;  4KP3 C;  1HNX T;  3VKG A;  1U4Q A;  2JPF A;  3HKD E;  2X9W A;  3AE5 A;  4X1I E;  5JDM A;  4PFO A;  2Y6X A;  3MK7 C;  4X62 T;  1MMN A;  3HKB E;  1YXR A;  3HI2 A;  5JDL A;  5H6R B;  1ZHC A;  4WYV A;  2XAS B;  4G2A A;  3PUA A;  2K9A A;  1YQ4 A;  2Q9Q C;  3C4W A;  2IC6 A;  2YDQ A;  3KBU A;  2UXC T;  4X1Y E;  1KK7 A;  3QNU A;  3GMI A;  2XAH B;  4B6X A;  2EHO B;  4CZZ B;  5HCM A;  1JNZ A;  4PJL A;  2I59 A;  3FZF B;  3ZT7 A;  2XPK A;  4QXC B;  3RPU A;  2WCA A;  5JQG E;  2X66 A;  1R8I A;  3CVR A;  5KDM C;  3IF8 B;  3H37 A;  2VB6 A;  2WP9 A;  2BVL A;  2BZB A;  4BAY B;  2K24 A;  4IDO A;  2WU5 A;  2UUC T;  2KZ7 B;  4EZ4 A;  4U72 A;  4ILU A;  3D0T A;  5JRC B;  2D5U A;  3RIF A;  3DP7 A;  2VL8 A;  2UXN B;  1UUS A;  3VRB A;  2A9U A;  4LF5 T;  4JLE A;  1J1J A;  1CUN A;  2EHO A;  3RKO A;  3PUQ A;  4X20 E;  5L3G B;  5JDH A;  3P4R A;  3Q9D A;  4KBM B;  5F5W A;  4GYS A;  3B13 A;  2N2N A;  3AE6 A;  1YKE B;  3L3P A;  1G8X A;  2LOP A;  3R6N A;  4JUY A;  3SFE A;  1UX4 A;  3RHW A;  3U3I A;  3G06 A;  3RQU A;  5AQL B;  2ACX A;  4CN4 A;  1XNQ T;  4PJN A;  4YLH A;  4IE0 A;  5AQT B;  1E1H B;  3SS1 A;  2K5B B;  2J62 A;  3K3N A;  4LF8 T;  5JDQ A;  3GN5 B;  3EAM A;  1LVK A;  4PW8 A;  5FYM A;  2RA1 A;  2VKD A;  2LE8 A;  2LSI A;  4UR9 A;  3AE3 A;  5LA6 E;  4JI4 T;  4HKA A;  4C91 A;  5LCY A;  3T8O A;  3LK4 2;  5AQQ B;  2VAS A;  2BKN A;  5JDG A;  3JAF A;  3L8R A;  4LF4 T;  4BJM A;  5AFU L;  4DR4 T;  4Z91 A;  3C98 B;  2NW8 A;  2JQQ A;  4Z8X A;  1DU2 A;  3KBT A;  3AA0 B;  5L2L A;  3IEE A;  2XTL A;  5JRE A;  3E0Z A; 
#chains in the Genus database with same CATH homology
 4L5G A;  4DBQ A;  2KWI B;  4QXB B;  1KNZ A;  2MYS A;  2LJL A;  2EHO C;  3QUJ A;  2MOZ A;  3GN5 A;  3QK6 A;  5J2U E;  2WBL A;  3ZEF B;  3PUR A;  3CQC B;  3F2E A;  3MA9 A;  3I9Y A;  2E9X C;  3ETV A;  3KIN B;  1QSD A;  5L3C B;  2A3D A;  3KV5 A;  2H3R A;  2ODV A;  2QA7 A;  3NBX X;  3ZYL A;  4ZI2 C;  4CXW A;  1D1C A;  3FXE B;  2D0U A;  2NTX A;  4HTE A;  3PU3 A;  4ASK A;  5ETW A;  5HXH A;  2YEV C;  1HX8 A;  4I55 E;  2H7O A;  3RH3 A;  5TAO A;  4GK0 E;  2YK0 A;  2H7V C;  1Y64 B;  3ANW A;  2LSK A;  4KMC A;  1HG5 A;  4O4L E;  4ZI7 E;  4H9R C;  3C50 A;  2DLR A;  2Q9Q A;  2MTQ A;  5HAX A;  1BR2 A;  1FEW A;  2JMH A;  3N5L A;  4TUY E;  1HS7 A;  4GIW A;  2CMR A;  3UUX B;  4AKH A;  3F57 A;  4TX5 A;  2XAG B;  5HXC A;  2VKJ A;  2YU1 A;  4DMV A;  3ZN1 B;  3A5X A;  3N9L A;  4MLK A;  4I43 B;  2HPL A;  3LBX B;  4IDZ A;  1YD8 G;  3UUM A;  2ODU A;  2C5J A;  4GOU A;  4YFS A;  2X0L B;  3K3O A;  3S4U A;  4YJ3 E;  4O4I E;  1WYB A;  3OBV E;  3Q5W A;  5LBM A;  3OJA A;  2DHR A;  4U74 A;  2NW9 A;  3FHN A;  4JEU B;  3ETU A;  3PE0 A;  3O4X E;  2PG8 A;  3N9O A;  1OWA A;  3PDY A;  4UXN B;  2VKO A;  4H9S E;  2X51 A;  2CM0 A;  4ZOL E;  4WW0 A;  5FY1 A;  1D0Y A;  4M1P A;  1HTJ F;  3RYI E;  2CWO A;  5L3D B;  2CCQ A;  1WYC A;  3GWH A;  4O4J E;  3RYC E;  2C0S A;  3KDS E;  3RC3 A;  2EHO D;  4YHJ A;  2W0G A;  5LHI B;  2XUE A;  4EAH A;  1YKH B;  4IE7 A;  5H6Q B;  3RYF E;  3I9W A;  3MJX A;  1H7C A;  1HCI A;  3MZK B;  1VRB A;  4QXH B;  4MHC A;  5FXV A;  5JR9 C;  3I0Q A;  1WRD A;  3KFW X;  4A56 A;  4ERR A;  2V7L A;  2CA5 A;  1B7T A;  5F3J A;  1MMD A;  3CQG B;  4E7Z A;  3CPZ A;  3ZCJ A;  4EZH A;  2GK9 A;  2HPJ A;  5EZY E;  3LBX A;  4PK5 A;  1UX5 A;  5CA0 E;  4ZI3 D;  1SHZ C;  2DI4 A;  1US7 B;  2SPC A;  2ZMA A;  4ZS2 A;  1UCU A;  2W62 A;  2Y8D A;  3LK3 B;  3AAE B;  3CKD A;  4PK4 A;  3R84 B;  4EIW A;  3O9X A;  3ZJ1 A;  4CQI A;  5JVD E;  3C4Z A;  3N9P A;  4OYJ A;  2Z6E A;  4IE4 A;  2BVM A;  5J2T E;  2PJQ A;  3WAJ A;  4BA9 A;  5FY7 A;  2X9X A;  2JJ9 A;  4DBR A;  4KUM B;  3L09 A;  2KXP B;  1O3X A;  4WBN E;  4OK0 A;  4UEM A;  4JEH B;  1S35 A;  2WAU A;  5FP3 A;  2LSG A;  3U78 A;  3ZC0 A;  3CQX C;  5F8P A;  3VKH A;  4XZC A;  3AVS A;  3B57 A;  4IIJ E;  4XBF B;  3C4X A;  2LT3 A;  3UFE A;  3NRX A;  1BR4 A;  2V7K A;  4IGU A;  2E9X B;  1IZN B;  3O1I A;  4NUV A;  2V26 A;  2WM9 A;  4P09 A;  5BMV E;  3H3A A;  2B1E A;  5IYZ E;  5LG4 A;  4AI6 A;  3RX6 A;  5HWX A;  4V1A v;  4TZ4 C;  3AVR A;  4AKI A;  2UXX B;  2KT9 A;  2L8K A;  2CLY C;  2HH7 A;  2M67 A;  2ZLY A;  2ZM2 A;  2Y48 B;  4HEA A;  4UF0 B;  3MXZ A;  5CA1 E;  2PBI A;  3HA4 A;  3EUH A;  3Q2M A;  4O2A E;  1FMV A;  2VKH A;  3FBZ A;  3ZMV B;  2XAJ B;  2E8I A;  3N9N A;  4P0A A;  5ADX L;  5DQV A;  5DQW A;  4AKL A;  2NW7 A;  3OKQ A;  4ZI3 C;  1ZV4 X;  3ZPO A;  4H9O C;  1EZ3 A;  4N78 D;  3CWZ B;  4HN9 A;  5HXE A;  3MAC A;  5E0O A;  3K8P C;  3N2O A;  2CEA A;  2JMK A;  2WSS V;  3FBL A;  2IAK A;  2X68 A;  1MIV A;  4HGA A;  3MKD A;  4QX8 B;  3E22 E;  4OYK A;  3HL6 A;  5LOV E;  2YIN A;  2LSY A;  3RRW A;  2LM9 A;  3NZQ A;  4X1K E;  2NP9 A;  1BR1 A;  2C5I T;  2CXL A;  4FJO A;  3ZYK A;  2N1G A;  3UTK A;  3P7I A;  2BDE A;  4ZS3 A;  2KIN B;  3W15 B;  3EDV A;  3RRC A;  3UUN A;  2L9Q A;  4H9Q C;  5JDN A;  5FXZ A;  1D1A A;  4NUU A;  4F6R C;  2A72 A;  5FMN A;  2DWG A;  5LNK A;  2X67 A;  3N2G E;  3UT5 E;  5LHG B;  2Q9Q D;  3NRY A;  4H9P C;  3CML A;  4AKG A;  2E9X A;  1Z0P A;  3FXD B;  4J2C A;  3ZMZ B;  4HFV A;  5LGU B;  1HF8 A;  2PFV A;  3I1A A;  3JC6 D;  1WLX A;  3NZP A;  3BK9 A;  1OXZ A;  3Q5X A;  2W00 A;  1T98 A;  1D1B A;  4UF0 A;  4UV9 B;  4TN7 B;  3AA7 B;  2WMN A;  1LKX A;  5EK4 A;  2DNX A;  1LVF A;  3CX7 B;  1MIY A;  3C51 A;  1VOM A;  2MBG A;  4AQF C;  2D2S A;  5C8Y E;  3J7Y q;  2D0T A;  4KP3 C;  4GYR A;  4TV9 E;  4H63 V;  3VKG A;  2NOX A;  3DTO A;  1U4Q A;  4L9I A;  4C90 A;  2QGS A;  2LSJ A;  2JPF A;  3M65 A;  4H63 H;  3HKD E;  2X9W A;  1IJ6 A;  2IW5 B;  4X1I E;  1MMG A;  4PJJ A;  1HG2 A;  4DVD A;  4PAG A;  3KVB A;  5HYA A;  4WBO A;  3SOL A;  5JDM A;  3VU7 H;  1IAP A;  2NTY A;  2V7M A;  4PFO A;  3OYX A;  3PUG A;  4FI5 A;  3TKL B;  2Y6X A;  3RYH E;  2OA5 A;  3MK7 C;  5DJQ C;  5JRC A;  5LJM A;  3AAA B;  2W63 A;  5JDF A;  1D0X A;  2WWU A;  1MMN A;  3LFM A;  2ZM8 A;  3SRZ A;  5DAB A;  3ZMT B;  3HKB E;  5A1L A;  2XHE B;  3HI2 A;  3PU8 A;  3ZLI A;  3N9Q A;  5JDL A;  5H6R B;  1ZHC A;  2WMO A;  2XAS B;  4DND A;  4G2A A;  4GK5 E;  3PUA A;  2K9A A;  2V1D B;  3WI3 A;  5L3F B;  5EK2 A;  2Q9Q C;  3C4W A;  2IC6 A;  5LGN B;  3KBU A;  3ZC1 A;  2LHN A;  4X1Y E;  1U5P A;  5KX5 E;  4OFZ A;  4WNK A;  3ZYM A;  1KK7 A;  3JC6 C;  1V9D A;  3GMI A;  2XAH B;  5HXR A;  1HFA A;  2EHO B;  2X9Y A;  2X9H A;  4B6X A;  3KV4 A;  3PUS A;  4CZZ B;  4CI1 B;  1AJ3 A;  4PJL A;  2I59 A;  2YU2 A;  4O4H E;  1FMW A;  2VWA A;  2A2F X;  3N2K E;  4P0B A;  4QXC B;  3RPU A;  5JR9 A;  5FNV E;  2CLY B;  2XQY A;  2XAQ B;  5JQG E;  3LG7 A;  1MND A;  4ZHQ E;  2X66 A;  4I50 E;  4PK6 A;  3LJC A;  2LOS A;  3CVR A;  4IHJ E;  2KND A;  3E08 A;  3GA8 A;  5KDM C;  4E7S A;  3IF8 B;  3I0O A;  3V5U A;  4O2B E;  3H37 A;  4K0U A;  3AA6 B;  5L3E B;  2VB6 A;  2BVL A;  4UEL A;  4O8S A;  5M4Y A;  2BZB A;  4BAY B;  4ANJ A;  1IJ5 A;  2K24 A;  3ESL A;  3KV6 A;  4IST A;  4QWN B;  1NWM X;  1NAF A;  4QHO A;  1BR0 A;  2V7J A;  5LYJ E;  3F31 A;  3ONX A;  3QC9 A;  5CB4 E;  2CXD A;  2LHR A;  2KZ7 B;  4EZ4 A;  4U72 A;  3BQK A;  4ILU A;  2RP4 A;  3D0T A;  4UVB B;  5LGT B;  5JRC B;  1S94 A;  2D5U A;  4HE8 A;  4BJN A;  3DP7 A;  2VL8 A;  3AA1 B;  2UXN B;  2ES0 A;  4G63 A;  1MNE A;  3N9M A;  4EYU A;  4YJ2 E;  3ZJ2 A;  4JLE A;  2DCF A;  1CUN A;  2EHO A;  3RKO A;  1X79 A;  3PUQ A;  2CXF A;  2L3L A;  4X20 E;  5L3G B;  4AXP A;  5JDH A;  3RC8 A;  3SWH A;  3Q9D A;  2JRK A;  4KBM B;  5LHH B;  5HXS A;  4GYS A;  3O1J A;  5FXW A;  3B13 A;  2N2N A;  4EOZ B;  4PJM A;  1YKE B;  3L3P A;  5EK3 A;  2K48 A;  4MFR A;  1G8X A;  3AB3 B;  1D0Z A;  3EVY A;  4EXT A;  2LOP A;  3R6N A;  4JUY A;  4PFP A;  1UX4 A;  4UIG A;  3U3I A;  5LJN A;  3IBP A;  3HKC E;  2ACX A;  3BQI A;  5FXX A;  3VHL A;  4PJN A;  5JR9 B;  2V7I A;  4YLH A;  4QX7 B;  4IE0 A;  1E1H B;  2VK9 A;  3SS1 A;  5J1G A;  2K5B B;  4UVA B;  5LXT E;  3IHR A;  1FIO A;  1YW0 A;  4H9N C;  5L3B B;  3K3N A;  2KLQ A;  5JDQ A;  3GN5 B;  4MAL A;  1LVK A;  2J1D G;  3P8C D;  2XAF B;  4QKN A;  4PW8 A;  2KWH A;  5GON E;  1LRZ A;  2CWY A;  4EB6 E;  5LP6 E;  5FYM A;  2RA1 A;  3KVA A;  2VKD A;  5IHY A;  2NWB A;  2E9X D;  3O1H A;  5FY0 A;  3CX6 B;  4CXY A;  3EDU A;  2ZM0 A;  4ISS A;  2LE8 A;  2C5K T;  2LSI A;  1WR6 A;  4L0R A;  4ZI2 D;  4EYY R;  3CX8 B;  5LA6 E;  3K3Q C;  3BQL A;  4IE5 A;  3WAK A;  4DMW A;  3ZMU B;  3C64 A;  3ZN0 B;  4DO0 A;  4CI3 B;  4HKA A;  3FB2 A;  5LCY A;  3T8O A;  4CXX A;  3LK4 2;  4C91 A;  3ANW B;  5LBQ B;  4XAX B;  3J9X 1;  3DJB A;  2VAS A;  4IE6 A;  1QUU A;  2LEH A;  2Q9Q B;  4ADZ A;  5JDG A;  5KMG P;  4UV8 B;  4CI2 B;  3HR0 A;  3AAI A;  3LK2 B;  5JH7 E;  4UVC B;  2P9B A;  5HWY A;  2G0U A;  3ZCI A;  4OHF A;  4BJM A;  5AFU L;  2N9D A;  3ZMS B;  1MIW A;  3C98 B;  2NW8 A;  1G73 A;  2JQQ A;  1ZEE A;  1ZKE A;  1MMA A;  4PNI A;  4Z8X A;  2DWK A;  3PTR B;  4TV8 E;  3OYZ A;  2KMF A;  4AKR B;  4MBQ A;  3KBT A;  3AA0 B;  4I4T E;  2IC9 A;  3UUL A;  5L2L A;  1SA0 E;  3HKE E;  3IEE A;  2CE7 A;  2XTL A;  4AQF A;  5JRE A;  3E0Z A;  3V5S A;  3KV9 A;  2W61 A;  4AQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...