2Q9QC

The crystal structure of full length human gins complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
145
structure length
145
Chain Sequence
MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSILPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA replication complex GINS protein PSF2
publication title Crystal structure of the GINS complex and functional insights into its role in DNA replication.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
total genus 53
structure length 145
sequence length 145
chains with identical sequence G
ec nomenclature
pdb deposition date 2007-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1030 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2q9qC01
2Q9QC 3ANWA 2Q9QB 2E9XD 3JC6D 2E9XA 2EHOA 2EHOB
chains in the Genus database with same CATH superfamily
4HWDA 2CPTA 3HA4A 4ZZBA 3VKHA 2X9WA 4L9IA 1QUUA 4IL9A 2V5CA 5FVKA 2Q9QD 3Q5WA 4HFCA 5HXSA 1V9DA 2XTLA 3A7MA 4NXMT 4H9NC 2VVNA 4ZI3C 5L47A 1XMOT 1UGOA 2BS2A 4BAYB 1LRZA 5BMVE 2XAGB 3I0OA 3PU8A 3WAJA 1T98A 2QA7A 2VL0A 1KNPA 2OV9A 4O8SA 2ZLYA 3UQ4A 4GK0E 4KHPT 2IHR1 2JQ9A 2ZM8A 3L39A 4WZXA 2CM0A 3KBUA 2XY8B 5AQLB 4H9RC 5ADXL 2V7LA 5JDFA 4LF4T 2ZMAA 2WQYA 4YHHT 1LVKA 2WDRA 4UV8B 4PFOA 2BVMA 2MBGA 5J2TE 2L3LA 3F31A 3OVUA 1Z8UA 2J62A 2OA5A 1D0ZA 4CXYA 3J7Yq 3PJAA 1W0BA 2KINB 1HX1B 4EEBA 4P1NA 4ZI2C 3PU3A 4JUYA 2UUAT 5JTGA 4HE8A 4DV2T 1UK5A 2BKOA 4TZ4C 1WLXA 4TN7B 2E9XB 3RGLA 4I50E 4MLKA 4X65T 4AI6A 1KK7A 4IIJE 1IJ5A 1IZNB 1Z0PA 2XJ7A 3NRXA 4UF0B 1J5WA 3IBPA 3ZMSB 3IA3A 4HN9A 4YHJA 5AQVB 4DR5T 1OXZA 4X62T 1N36T 3AEEA 3ZYKA 3FZKB 2VQFT 1R8IA 2H88A 4E7SA 4PJJA 2YKSA 2P9BA 3V5UA 3HI2A 3ABVA 5LGNB 4U3CA 4H9OC 3BQLA 4WYVA 5DQWA 2DL1A 4AISA 4Z90A 4KI0F 3HKDE 2ODUA 3ZMUB 4U33A 3C4ZA 4UXNB 5F5WA 2W00A 4YSXA 5AQPB 4LMLA 4XZCA 3F57A 2A72A 5AQHB 2CCQA 3NRYA 3GN5A 1ZEEA 5LG3A 5HXHA 2PTFA 4JYAT 4LMJA 3AXJB 2IC9A 5LG4A 3FZFB 3K8PC 2IIUA 3P8CD 3UU3A 1HS7A 4DUZT 2DCFA 2C0SA 3NVOA 2LSKA 4NIQA 3RQWA 1UCUA 5HEJA 3LK2B 4EB6E 4GKKT 4EZ4A 5CFBA 4H63H 3BK9A 2RA1A 3RLFF 4E7ZA 3KVAA 4CQIA 5JDNA 5J0ZA 3T8OA 4DUYT 4QHOA 1WR0A 5EK4A 2LSYA 4MHCA 4GOUA 2MPKA 4CZZB 3Q9DA 4NPPA 2H89A 3P7IA 5HCJA 4L5GA 5IYZE 1NAFA 2EHOD 3UUBA 3BQKA 3N9QA 1JNRA 4AQGA 3LJCA 2FBWA 3ZT7A 3PUQA 2LRKA 2L9QA 1FMVA 3LK42 4X1IE 3RIUC 5FY1A 3B57A 3AE6A 3HR0A 2WB5A 4DR4T 3RH3A 5KXJA 3C50A 3ANWB 4LF6T 5C8YE 4DBRA 2WWUA 3RKOA 4EXTA 3P4WA 2LOSA 4JEHB 4DR2T 1CHUA 3I0QA 2V7IA 2V7KA 5EK2A 3MA9A 1MIVA 3JCFA 4IT4A 3ZC1A 3CQCB 4TWDA 2V6YB 3QUJA 4ZZCA 3O1HA 3P4SA 4ZI7E 2RP4A 4QX8B 4O4IE 2MYSA 2XZEA 3LBXB 3MJXA 2HPLA 3QC9A 2WU5A 2FJBA 5CJ5A 4X1KE 2BS4A 2E9XA 2UXXB 4PAGA 4QKNA 2XSBA 4QXCB 5DABA 1MMGA 2W66A 2CHOA 4DV4T 2W0GA 3QK6A 5L3FB 3PUYF 5L2LA 2DHRA 3NZQA 2WSSV 4UF0A 3AAAB 4PJLA 1YQ4A 2IC6A 3QB5K 3KINB 2X67A 4DV0T 4PK6A 3VR8A 3ZMZB 1Y01A 1LVFA 1SA0E 4ZXLA 2K3WA 4IE4A 4Z91A 3FHNA 4HTEA 3ZSTA 3MXZA 3RQUA 3RIAA 5F8PA 3PV0F 3EABA 4PJMA 2ODVA 2WU2A 3AE8A 3AAIA 5LJNA 4JBWF 2XASB 1MMAA 4DR6T 4QX7B 2NW8A 5FXWA 3RKGA 3AEDA 2X0HA 4QXBB 4ILBA 1I94T 3P50A 5AQOB 3NZPA 3WAKA 2N1GA 3LDQB 4HWHA 4KP3C 4YXDA 4TWFA 5LMNT 5FP3A 2VQET 1UURA 3KV5A 4B3TT 2WP9A 3MK7C 4P0BA 4ISSA 4IDPA 2BKNA 4M1PA 2I59A 4QH4A 2YU2A 5L3EB 1WCRA 3IHRA 2E2AA 3SFDA 2DWKA 5LCYA 2PFVA 4U74A 1ZHCA 1VRBA 5J1GA 3EAMA 3CWZB 2JQHA 2W61A 4PJNA 5LB7B 2YN6A 3UT5E 4X5TA 1MIWA 3K1SA 2LHNA 2LM9A 5KX5E 5L3CB 3ZYLA 1HNZT 5C3JA 3UQ7A 3I9WA 1YW0A 3ONLC 3BQIA 1KNZA 3AE3A 3PUAA 5AQNB 3OTOT 4QWNB 3I1AA 2WBLA 1CUNA 4B3MT 1QLBA 2KNDA 4BJMA 4IDZA 3E22E 3Q5DA 5LBMA 4IDNA 1IBMT 4KHZF 5CGMA 1HX8A 2C5KT 3ANWA 1U5PA 4X64T 3RX6A 2UXBT 1LKXA 5KDMC 2UUCT 4YLHA 1OEDC 3FB2A 3NBXX 4B3RT 3N9PA 4IDOA 1JNZA 3HL6A 4N78D 4JI5T 1KF6A 4V1Av 4LMKA 4G2AA 1XMQT 2V6YA 3ZJ1A 1BR1A 2E9XC 4ZEYA 1E1HB 3RRCA 2XQYA 4KMCA 3HKBE 5E0OA 1NENA 5DQVA 3LBXA 3TLVA 4YJ3E 2XHEB 5HEGA 2JPFA 4K0UA 4UEMA 5H6RB 3VKGA 4OYJA 4C90A 4YSZA 4DV1T 2VKDA 3DP7A 1D1CA 3K3OA 4EIWA 2LHRA 3JC6D 1YQ3A 3CIRA 3AE7A 3AA7B 2IW5B 2DLRA 4HWIB 2V1DB 2VURA 2FJDA 2H7OA 2VWAA 1WYBA 3A5XA 3AA1B 3RIUA 3PTRB 4ZI3D 2D5UA 3FBZA 2VVSA 4O2AE 2H7VC 3PUVF 2F4VT 3C4WA 3EDUA 4H9SE 2Q9QB 1Y64B 4HFVA 1OEDB 1XWMA 1VCTA 2ACXA 5LBQB 2B76A 1AJ3A 2CXFA 1E2AA 5AQSB 1D0YA 3QNUA 4YTPA 5C2TA 1NEKA 2VK9A 2LJLA 3PUWF 5AQMB 3C64A 3AE4A 4EV6A 1NWMX 4IHJE 2N2NA 4CXWA 3PUXF 3I9YA 4TX5A 3SOLA 5M4YA 1KEYA 2DNXA 1D1AA 4QH5A 2WY2A 3LK3B 5IHYA 3J9X1 5LXTE 2C5IT 5LA6E 3N2OA 5JDGA 5A1LA 2KWHA 1SUMB 5JDLA 4LFAT 3ETVA 2AXDS 3LFMA 3UULA 2NTYA 3O4XE 2J4GA 3RHWA 2QGSA 2R6GF 4EAHA 1OWAA 2HHHT 1ZP0A 3AVSA 2E5VA 2M67A 3KBTA 4WBOA 2X9XA 3RI5A 4UVBB 4Z8XA 4ZOLE 4CI1B 3RF1A 2NWBA 2V8SV 4GYRA 4YT0A 1VCSA 4LF9T 3OJAA 4PNIA 3QB5A 4UELA 2YU1A 4DV6T 5CA0E 3ZT6A 3TKLB 2J1DG 1HF8A 3FXEB 4EZHA 2XQ9A 3ETUA 3ESLA 1BR2A 4U31A 2M6IA 4X66T 2KSRA 2NW9A 1IJ6A 2UUBT 4YSYA 3TLWA 3PE0A 3AEFA 3MACA 2WDVA 3D0TA 2CLYC 1US7B 1G73A 3C98B 1HFAA 1HNWT 2WS3A 3OYXA 4YTNA 4OX9T 4JEUB 4BA9A 3QOFA 5HAXA 5ABHA 2BBHA 4AKGA 4HFHA 2NP9A 2WMNA 5HYAA 1HCIA 1SHZC 2VKHA 3LSVA 2VKOA 2XAQB 2YOEA 2SPCA 4JI3T 5H6QB 3ZT5A 4DBQA 5JRCB 4U7IA 1O3XA 1B7TA 4EGWA 5AQKB 4OK0A 5LJMA 3CPZA 4JI7T 3M65A 4BJNA 1ZKEA 1FJGT 2HPJA 4JI8T 4GK5E 3OPCA 2NR4A 1MIYA 5AQTB 2JMKA 2CMRA 4J2CA 2Q9QA 2DI4A 3ZMTB 4QXHB 2H3RA 2I0MA 5FXZA 1OEDA 1T8BA 3HKCE 4AXPA 3JAEA 2K24A 4OYKA 4ZHQE 4AQFA 4EOZB 2JQKA 4TUYE 1QSDA 2N9DA 3CQXC 4H9PC 4NXNT 5HWXA 5L4EA 4JI4T 5FY0A 4IREA 4A56A 4CI2B 4O2BE 3UTKA 1MMDA 1U4QA 5JR9B 2CLYB 2IDOB 5FKYA 5L3DB 3VR9A 3EUHA 1N33T 3P4QA 2Y8DA 4P09A 2BG9C 5LHGB 3FZHB 3RYCE 1WYCA 4HFBA 3JAFA 4EEDA 1MNEA 1HTJF 2MTQA 2MOZA 4X20E 3P4PA 5FL1A 3ZYMA 5ABFA 2CHNA 3H37A 3ZMVB 1FMWA 2CE7A 2LKGA 3AE2A 1D1BA 1BR0A 2YDQA 3AAEB 4JI6T 3L8RA 1FEWA 3C4XA 4ISTA 5CA1E 4DNDA 5HXEA 2IUBA 1YD8G 3PDYA 5AFUL 1SE7A 4DR1T 4ADZA 5F3JA 3UFEA 2CA5A 4OHFA 3N9LA 4WNKA 2ZM2A 4A97A 4LFBT 4ZS3A 4DMWA 5JDMA 3V5SA 2XAJB 4TWHA 2L8KA 3ZKRA 3ZSSA 4TNVA 4XBFB 2A3DA 4YTMA 3LG7A 4H63V 2BG9E 5JQGE 2W4XA 3O9XA 5HWYA 2FJAA 1KNRA 4G63A 5AQGB 3Q2MA 5AQUB 3K3NA 5HEOA 1EZ3A 3ZPOA 5AQFB 1W09A 4WBNE 2M6BA 2BG9B 4WW0A 4UVCB 3AVRA 3H3MA 1VOMA 3O1IA 4JI2T 3ZJ2A 4I0UA 2K48A 4NUUA 2B1EA 1WFDA 3CK6A 2A9UA 5L3BB 3RIFA 3U78A 3WI3A 2XSAA 3CQGB 5LP6E 5LOVE 4GIWA 4PW8A 1KFYA 2IMLA 3IF8B 2W63A 3RC3A 4DR7T 5JVDE 2Q9QC 1YXRA 5JRCA 3TLSA 3DTOA 2HN2A 3TLUA 5JDHA 2BZBA 2YINA 5HXRA 5FYMA 2C5JA 2JMHA 3G06A 4AQFC 4U7YA 4U2ZA 2BBJA 2XAFB 2YK0A 4I4TE 2LOPA 4FI5A 5EK3A 3JC6C 3T1YT 3KVBA 2X9YA 2XQAA 3O1JA 3GA8A 2X68A 2LT3A 3SFEA 2UXCT 1HG2A 5LGTB 2LE8A 1N32T 1IBLT 2BKPA 4HGAA 3ZLIA 5AQQB 3DJBA 5AQRB 1FIOA 2WZIA 4CN4A 4IE0A 2XM1A 5AQJB 2LLYA 5LNKA 5JR9A 4O4JE 4TV9E 3VU7H 2WM9A 1MNDA 5LGUB 2LSIA 4DV5T 4L0RA 2VKJA 4PFPA 3KFWX 3AE9A 4MBQA 2A2FX 1XZYA 2J47A 2E9XD 1OEDE 3B5MA 2ZM6T 3GWHA 2I6HA 2WMOA 5BR8T 4UIGA 1H7CA 5LHIB 2UU9T 4ZS2A 3AE1A 4AKRB 3N5LA 2XQ4A 2V7JA 4UV9B 3N9OA 2ZM0A 1XDOA 3IEEA 2CBJA 4C91A 4UR9A 2G0UA 2KWIB 3EDVA 2CXDA 3S4UA 1WRDA 2XPKA 4HEAA 2D0TA 2WWVA 1M7KA 2XQ5A 2YDSA 3CX8B 4LF5T 2VASA 3KDSE 2VB6A 3L09A 2CXLA 3RPUA 3AEGA 1XDPA 2V5DA 3VRBA 4DR3T 4DV3T 3MKDA 2BVLA 4OFZA 3TLTA 4CI3B 4EYUA 3ZN1B 5ABGA 4DIDB 4O4LE 2HH7A 5IWAT 4IE5A 1W9RA 3P4RA 5ABFB 3ZCIA 1ZV4X 3Q5XA 4DV7T 2W2UA 4ZI2D 3M3ZB 2BG9A 4HWCA 3UUXB 2X51A 3AA0B 2LEHA 3W15B 3SWHA 4CN6A 4DVDA 2KLQA 4TNWA 5EZYE 3KV9A 4U2YA 1D0XA 2CWOA 3E0ZA 1WR6A 2Y48B 4ILUA 3T1HT 2W62A 4HFDA 3UU6A 3K3QC 1IBKT 4LF7T 3AE5A 3GMIA 4IE6A 4XAXB 4JI0T 5ABEA 4Q25A 5LMUT 4GYSA 2XQ7A 2D9DA 3CVRA 2HN1A 1UX5A 3VHLA 4AKIA 3UUMA 5GONE 4AKHA 2XQ3A 2PG8A 3N9NA 4JLEA 3FZMB 2CBIA 2IAKA 3RRWA 2ES0A 2D0UA 2EHOC 3OYZA 3AECA 4HFEA 2VL8A 2UXNB 2QRXA 3F2EA 1T72A 3OKQA 3C51A 4NUVA 4LF8T 2YDRA 5L3GB 2CEAA 4KBMB 5J2UE 5JR9C 1IAPA 2FUPA 2NTXA 2KZ7B 4MFRA 3UFGA 1J5ET 4B3ST 2V6XA 3ONXA 3MZKB 3L3PA 2LSJA 4X1YE 4K0KT 3U3IA 4JI1T 3FXDB 3PUGA 2W67A 2KMFA 5KMGP 4ERRA 5AQIB 3AEAA 1HNXT 1M62A 4MALA 1N34T 3UU5A 4HWFA 5LHHB 1UX4A 3KV6A 2WCAA 4TV8E 4CXXA 2X66A 4KUMB 2V26A 2XQ6A 1GQEA 4F6RC 5IUXA 3UUNA 4O4HE 4ANJA 3HKEE 3B13A 2WZHA 3SS1A 1W0AA 2XQ8A 5FXVA 2Y6XA 4A98A 2X0LB 2K9AA 3PJAJ 5TAOA 5JREA 2EHOB 3ONJA 1MMNA 3SRZA 5FMNA 2X9HA 5CB4E 3FZLB 4AKLA 4YY3T 3R84B 2OLTA 1HG5A 3E08A 4YJ2E 3RYIE 3A8YC 4F8HA 3NWIA 2K5BB 3ZEFB 2JJ9A 2QYWA 3Q5EA 5LYJE 3VRAA 3H3AA 2YEVC 3JADA 3AEBA 3N9MA 1S94A 1HR0T 4ASKA 5HEHA 2LM2A 2E8IA 4LFCT 4AIUA 1UUSA 3R6NA 4I55E 4ILCA 5HXCA 4IL4A 3UU8A 3EI0A 4YFSA 3AA6B 5FXXA 5FY7A 5ETWA 4P0AA 3X1DA 1T7SA 4ILAA 2V7MA 3PUZF 1G8XA 5JDQA 5HEUA 3PUSA 1YKEB 2QVAA 3PURA 2AE9A 2XUEA 2DWGA 1X79A 4PK5A 4HKAA 3NKZA 5DJQC 2GK9A 2Z6EA 3CMLA 4FJOA 1L0VA 4I43B 1X9BA 3ZN0B 4IGUA 4DO0A 2KT9A 4CN1A 4QH1A 2RPAA 4U72A 3RYFE 2FJEA 3RYHE 2JRKA 3AXJA 2CWYA 5FVLA 3AB3B 2PBIA 3N2KE 2UXDT 3ZC0A 3FBLA 5L4HA 2CRBA 4DMVA 5JH7E 4A5XA 4KX6A 5FL0A 2LSGA 3KV4A 2D2SA 2WAUA 2LKHA 5FNVE 1J1JA 4AQYT 2MAWA 2ACZA 1XNQT 1XNRT 4JV5T 4COFA 3OBVE 2BDEA 4IDQA 3EHZA 2KXPB 2E5LT 4GKJT 3N2GE 2WDQA 2BS3A 1ZOYA 3RC8A 1YKHB 4UVAB 2JQQA 3GN5B 3ZCJA 4EYYR 2NOXA 2LRLA 4H9QC 1E7PA 4HFIA 4PK4A 3CKDA 2NW7A 2XM2A 3CX6B 3UU4A 3EVYA 5HCMA 1S35A 2XAHB 1DU2A 1I6ZA 2X0YA 4IE7A 3CX7B 4B6XA 2JIWA 2PJQA 1BR4A 2EHOA
chains in the Genus database with same CATH topology
2XAQB 4QXBB 3ZCIA 3HA4A 1ZV4X 3VKHA 3NZPA 3Q5XA 2SPCA 3WAKA 2N1GA 2X9WA 4L9IA 5H6QB 4ZI2D 1QUUA 4KP3C 4DBQA 5JRCB 1O3XA 2Q9QD 1B7TA 3Q5WA 3UUXB 4OK0A 5FP3A 5HXSA 2X51A 5LJMA 1V9DA 3AA0B 3CPZA 2XTLA 3M65A 2LEHA 4BJNA 3W15B 3KV5A 3SWHA 4H9NC 4ZI3C 4DVDA 1ZKEA 2KLQA 3MK7C 5EZYE 4P0BA 2HPJA 4GK5E 1MIYA 4BAYB 3KV9A 4ISSA 2JMKA 2CMRA 1D0XA 2CWOA 1LRZA 3E0ZA 1WR6A 4J2CA 5BMVE 2XAGB 3I0OA 2Q9QA 2Y48B 4ILUA 2DI4A 3ZMTB 4M1PA 2I59A 4QXHB 3PU8A 2W62A 2H3RA 2YU2A 3WAJA 1T98A 2QA7A 5FXZA 3HKCE 3K3QC 3GMIA 4AXPA 5L3EB 4O8SA 2ZLYA 4IE6A 4XAXB 4GK0E 2K24A 4OYKA 3IHRA 4ZHQE 4GYSA 4AQFA 4EOZB 3CVRA 1QSDA 4TUYE 2N9DA 2ZM8A 3CQXC 2DWKA 5LCYA 1UX5A 2PFVA 4H9PC 5HWXA 2CM0A 3KBUA 4U74A 3VHLA 1ZHCA 4H9RC 5FY0A 1VRBA 5J1GA 3UUMA 4AKIA 5GONE 5ADXL 2V7LA 5JDFA 4A56A 4AKHA 4CI2B 4O2BE 2ZMAA 3UTKA 1MMDA 3CWZB 2W61A 2PG8A 4PJNA 1U4QA 3N9NA 2CLYB 5JR9B 1LVKA 4JLEA 3UT5E 4UV8B 3RRWA 2IAKA 5L3DB 2ES0A 2D0UA 1MIWA 2EHOC 4PFOA 2LHNA 2BVMA 3OYZA 3EUHA 2MBGA 2VL8A 2UXNB 5J2TE 2LM9A 3F2EA 5KX5E 5L3CB 3OKQA 3ZYLA 3C51A 4NUVA 2Y8DA 4P09A 2L3LA 3F31A 5LHGB 3RYCE 5L3GB 2OA5A 1D0ZA 4CXYA 1WYCA 3I9WA 1YW0A 3J7Yq 2CEAA 4KBMB 5J2UE 3BQIA 5JR9C 1KNZA 1IAPA 3PUAA 1MNEA 2NTXA 4QWNB 2KZ7B 1HTJF 2KINB 2MTQA 4MFRA 3I1AA 2MOZA 4X20E 2WBLA 3ZYMA 1CUNA 4ZI2C 2KNDA 4BJMA 3PU3A 4IDZA 3E22E 3H37A 4JUYA 3ZMVB 3ONXA 5LBMA 3MZKB 3L3PA 2LSJA 1HX8A 1FMWA 2C5KT 3ANWA 1U5PA 4HE8A 4X1YE 2CE7A 3RX6A 1LKXA 4TZ4C 1WLXA 4TN7B 5KDMC 4YLHA 2E9XB 1D1BA 1BR0A 3U3IA 3AAEB 3FB2A 3NBXX 4I50E 4MLKA 1FEWA 3N9PA 3FXDB 3C4XA 4AI6A 4ISTA 1KK7A 4IIJE 5CA1E 3PUGA 4DNDA 3HL6A 5HXEA 1YD8G 3PDYA 1IJ5A 5AFUL 1IZNB 2KMFA 4N78D 1Z0PA 3UFEA 4ADZA 5F3JA 5KMGP 3NRXA 4UF0B 4V1Av 3IBPA 2CA5A 4G2AA 3ZMSB 4ERRA 4HN9A 4OHFA 3N9LA 3ZJ1A 4YHJA 1BR1A 2E9XC 4WNKA 1E1HB 4MALA 3RRCA 2ZM2A 2XQYA 4KMCA 4ZS3A 4DMWA 5LHHB 1OXZA 3HKBE 5E0OA 3ZYKA 5DQVA 3LBXA 1UX4A 5JDMA 3V5SA 4YJ3E 3KV6A 2XAJB 2XHEB 2JPFA 4TV8E 2L8KA 4K0UA 4CXXA 2X66A 4E7SA 4KUMB 4UEMA 2V26A 5H6RB 3VKGA 4OYJA 4PJJA 4C90A 4XBFB 4F6RC 2P9BA 3UUNA 2A3DA 3V5UA 3HI2A 3LG7A 5LGNB 4H9OC 2VKDA 4H63V 3BQLA 3DP7A 5JQGE 1D1CA 4O4HE 4ANJA 3O9XA 3K3OA 5DQWA 3HKEE 3B13A 4EIWA 2LHRA 5HWYA 3SS1A 3JC6D 5FXVA 2Y6XA 3HKDE 2ODUA 4G63A 3ZMUB 3Q2MA 2X0LB 3C4ZA 2K9AA 3K3NA 5TAOA 4UXNB 5JREA 2EHOB 1MMNA 1EZ3A 3SRZA 5FMNA 3AA7B 2IW5B 2DLRA 2W00A 3ZPOA 2X9HA 2V1DB 5CB4E 4WBNE 4XZCA 3F57A 2A72A 4AKLA 2CCQA 3NRYA 3GN5A 3R84B 4WW0A 2H7OA 1HG5A 1ZEEA 3E08A 4YJ2E 4UVCB 3AVRA 2VWAA 3RYIE 1WYBA 5HXHA 2K5BB 3A5XA 3AA1B 3ZEFB 1VOMA 2JJ9A 3O1IA 5LYJE 3ZJ2A 3PTRB 4ZI3D 2D5UA 2K48A 3FBZA 4NUUA 2B1EA 2IC9A 2H7VC 4O2AE 5LG4A 3K8PC 3C4WA 3EDUA 4H9SE 2Q9QB 3P8CD 1Y64B 5L3BB 1HS7A 3U78A 3WI3A 2DCFA 4HFVA 2C0SA 3H3AA 2YEVC 2LSKA 2ACXA 3CQGB 5LP6E 5LOVE 1UCUA 3LK2B 4EB6E 5LBQB 4GIWA 4EZ4A 1AJ3A 2CXFA 3N9MA 4H63H 4PW8A 3BK9A 2W63A 3IF8B 3RC3A 2RA1A 4E7ZA 3KVAA 4CQIA 5JDNA 1D0YA 1S94A 5JVDE 2Q9QC 4ASKA 3T8OA 2E8IA 5JRCA 4QHOA 2VK9A 2LJLA 5EK4A 3DTOA 5JDHA 3R6NA 2BZBA 2LSYA 4I55E 3C64A 2YINA 5HXCA 5HXRA 4MHCA 4GOUA 1NWMX 4IHJE 2C5JA 5FYMA 4CZZB 3Q9DA 2N2NA 2JMHA 3AA6B 4YFSA 5FXXA 4AQFC 5FY7A 3P7IA 4L5GA 5ETWA 4CXWA 5IYZE 4P0AA 1NAFA 2XAFB 2EHOD 2YK0A 3I9YA 4TX5A 3SOLA 4I4TE 2V7MA 2LOPA 3BQKA 3N9QA 1G8XA 4AQGA 5JDQA 5M4YA 3LJCA 3PUSA 4FI5A 5EK3A 1YKEB 3JC6C 2DNXA 3PURA 3KVBA 1D1AA 2X9YA 3PUQA 3O1JA 3GA8A 2X68A 3LK3B 2XUEA 2DWGA 1X79A 2L9QA 1FMVA 2LT3A 5IHYA 3J9X1 1HG2A 5LXTE 2C5IT 3LK42 5LA6E 5LGTB 3N2OA 4X1IE 2LE8A 5FY1A 4PK5A 5JDGA 3B57A 4HGAA 3ZLIA 3HR0A 5A1LA 2KWHA 3DJBA 4HKAA 5DJQC 2GK9A 2Z6EA 3RH3A 5JDLA 3CMLA 4FJOA 1FIOA 3C50A 3ANWB 3ETVA 4IE0A 5C8YE 4I43B 4DBRA 3ZN0B 2WWUA 3RKOA 4EXTA 5LNKA 3LFMA 5JR9A 4O4JE 4TV9E 3UULA 2LOSA 2NTYA 3O4XE 3VU7H 4IGUA 4DO0A 4JEHB 2KT9A 4U72A 2QGSA 3RYFE 4EAHA 3I0QA 2V7IA 2V7KA 5EK2A 3MA9A 1MIVA 3RYHE 2WM9A 1MNDA 1OWAA 5LGUB 2LSIA 2JRKA 2CWYA 4L0RA 3AB3B 3ZC1A 2VKJA 2PBIA 3CQCB 3N2KE 4PFPA 3KFWX 3QUJA 3ZC0A 3AVSA 4MBQA 3O1HA 3FBLA 2A2FX 2M67A 3KBTA 4WBOA 4ZI7E 2RP4A 2E9XD 2X9XA 4QX8B 4O4IE 4UVBB 4Z8XA 4ZOLE 3GWHA 2MYSA 4DMVA 5JH7E 4CI1B 2WMOA 3LBXB 3MJXA 2NWBA 2HPLA 4GYRA 4UIGA 1H7CA 3QC9A 5LHIB 2LSGA 3OJAA 4ZS2A 3KV4A 4PNIA 4UELA 4AKRB 2YU1A 2D2SA 2WAUA 5CA0E 3TKLB 2J1DG 5FNVE 3N5LA 4X1KE 1HF8A 2V7JA 2E9XA 3FXEB 2UXXB 4PAGA 4QKNA 4EZHA 3ETUA 3N9OA 3OBVE 2BDEA 4QXCB 2ZM0A 4UV9B 5DABA 1MMGA 3ESLA 1BR2A 3IEEA 2KXPB 4C91A 2W0GA 3QK6A 5L3FB 2G0UA 5L2LA 2DHRA 2NW9A 2KWIB 3EDVA 3NZQA 2CXDA 2WSSV 3N2GE 1IJ6A 4UF0A 3S4UA 3AAAB 4PJLA 1WRDA 2IC6A 3KINB 3RC8A 2X67A 4HEAA 4PK6A 3PE0A 2D0TA 3ZMZB 3MACA 3D0TA 1YKHB 4UVAB 2JQQA 3GN5B 2CLYC 3ZCJA 1LVFA 1US7B 4EYYR 1SA0E 1G73A 2NOXA 3C98B 3CX8B 4IE4A 1HFAA 2VASA 3KDSE 4H9QC 3FHNA 2VB6A 3L09A 4HTEA 2CXLA 3RPUA 3MXZA 4PK4A 5F8PA 3OYXA 3CKDA 2NW7A 4PJMA 2ODVA 4JEUB 3MKDA 4BA9A 2BVLA 3CX6B 4OFZA 3AAIA 4CI3B 4EYUA 3ZN1B 5LJNA 3EVYA 5HAXA 2XASB 1MMAA 1S35A 2XAHB 4AKGA 2NP9A 4O4LE 2WMNA 5HYAA 1HCIA 4IE7A 4QX7B 1SHZC 2VKHA 2HH7A 2NW8A 3CX7B 4B6XA 5FXWA 2VKOA 2PJQA 1BR4A 4IE5A 2EHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q9Q C;  3ANW A;  2Q9Q B;  2E9X D;  3JC6 D;  2E9X A;  2EHO A;  2EHO B; 
#chains in the Genus database with same CATH topology
 4HWD A;  2CPT A;  3HA4 A;  4ZZB A;  3VKH A;  2X9W A;  4L9I A;  1QUU A;  4IL9 A;  2V5C A;  5FVK A;  2Q9Q D;  3Q5W A;  4HFC A;  5HXS A;  1V9D A;  2XTL A;  3A7M A;  4NXM T;  4H9N C;  2VVN A;  4ZI3 C;  5L47 A;  1XMO T;  1UGO A;  2BS2 A;  4BAY B;  1LRZ A;  5BMV E;  2XAG B;  3I0O A;  3PU8 A;  3WAJ A;  1T98 A;  2QA7 A;  2VL0 A;  1KNP A;  2OV9 A;  4O8S A;  2ZLY A;  3UQ4 A;  4GK0 E;  4KHP T;  2IHR 1;  2JQ9 A;  2ZM8 A;  3L39 A;  4WZX A;  2CM0 A;  3KBU A;  2XY8 B;  5AQL B;  4H9R C;  5ADX L;  2V7L A;  5JDF A;  4LF4 T;  2ZMA A;  2WQY A;  4YHH T;  1LVK A;  2WDR A;  4UV8 B;  4PFO A;  2BVM A;  2MBG A;  5J2T E;  2L3L A;  3F31 A;  3OVU A;  1Z8U A;  2J62 A;  2OA5 A;  1D0Z A;  4CXY A;  3J7Y q;  3PJA A;  1W0B A;  2KIN B;  1HX1 B;  4EEB A;  4P1N A;  4ZI2 C;  3PU3 A;  4JUY A;  2UUA T;  5JTG A;  4HE8 A;  4DV2 T;  1UK5 A;  2BKO A;  4TZ4 C;  1WLX A;  4TN7 B;  2E9X B;  3RGL A;  4I50 E;  4MLK A;  4X65 T;  4AI6 A;  1KK7 A;  4IIJ E;  1IJ5 A;  1IZN B;  1Z0P A;  2XJ7 A;  3NRX A;  4UF0 B;  1J5W A;  3IBP A;  3ZMS B;  3IA3 A;  4HN9 A;  4YHJ A;  5AQV B;  4DR5 T;  1OXZ A;  4X62 T;  1N36 T;  3AEE A;  3ZYK A;  3FZK B;  2VQF T;  1R8I A;  2H88 A;  4E7S A;  4PJJ A;  2YKS A;  2P9B A;  3V5U A;  3HI2 A;  3ABV A;  5LGN B;  4U3C A;  4H9O C;  3BQL A;  4WYV A;  5DQW A;  2DL1 A;  4AIS A;  4Z90 A;  4KI0 F;  3HKD E;  2ODU A;  3ZMU B;  4U33 A;  3C4Z A;  4UXN B;  5F5W A;  2W00 A;  4YSX A;  5AQP B;  4LML A;  4XZC A;  3F57 A;  2A72 A;  5AQH B;  2CCQ A;  3NRY A;  3GN5 A;  1ZEE A;  5LG3 A;  5HXH A;  2PTF A;  4JYA T;  4LMJ A;  3AXJ B;  2IC9 A;  5LG4 A;  3FZF B;  3K8P C;  2IIU A;  3P8C D;  3UU3 A;  1HS7 A;  4DUZ T;  2DCF A;  2C0S A;  3NVO A;  2LSK A;  4NIQ A;  3RQW A;  1UCU A;  5HEJ A;  3LK2 B;  4EB6 E;  4GKK T;  4EZ4 A;  5CFB A;  4H63 H;  3BK9 A;  2RA1 A;  3RLF F;  4E7Z A;  3KVA A;  4CQI A;  5JDN A;  5J0Z A;  3T8O A;  4DUY T;  4QHO A;  1WR0 A;  5EK4 A;  2LSY A;  4MHC A;  4GOU A;  2MPK A;  4CZZ B;  3Q9D A;  4NPP A;  2H89 A;  3P7I A;  5HCJ A;  4L5G A;  5IYZ E;  1NAF A;  2EHO D;  3UUB A;  3BQK A;  3N9Q A;  1JNR A;  4AQG A;  3LJC A;  2FBW A;  3ZT7 A;  3PUQ A;  2LRK A;  2L9Q A;  1FMV A;  3LK4 2;  4X1I E;  3RIU C;  5FY1 A;  3B57 A;  3AE6 A;  3HR0 A;  2WB5 A;  4DR4 T;  3RH3 A;  5KXJ A;  3C50 A;  3ANW B;  4LF6 T;  5C8Y E;  4DBR A;  2WWU A;  3RKO A;  4EXT A;  3P4W A;  2LOS A;  4JEH B;  4DR2 T;  1CHU A;  3I0Q A;  2V7I A;  2V7K A;  5EK2 A;  3MA9 A;  1MIV A;  3JCF A;  4IT4 A;  3ZC1 A;  3CQC B;  4TWD A;  2V6Y B;  3QUJ A;  4ZZC A;  3O1H A;  3P4S A;  4ZI7 E;  2RP4 A;  4QX8 B;  4O4I E;  2MYS A;  2XZE A;  3LBX B;  3MJX A;  2HPL A;  3QC9 A;  2WU5 A;  2FJB A;  5CJ5 A;  4X1K E;  2BS4 A;  2E9X A;  2UXX B;  4PAG A;  4QKN A;  2XSB A;  4QXC B;  5DAB A;  1MMG A;  2W66 A;  2CHO A;  4DV4 T;  2W0G A;  3QK6 A;  5L3F B;  3PUY F;  5L2L A;  2DHR A;  3NZQ A;  2WSS V;  4UF0 A;  3AAA B;  4PJL A;  1YQ4 A;  2IC6 A;  3QB5 K;  3KIN B;  2X67 A;  4DV0 T;  4PK6 A;  3VR8 A;  3ZMZ B;  1Y01 A;  1LVF A;  1SA0 E;  4ZXL A;  2K3W A;  4IE4 A;  4Z91 A;  3FHN A;  4HTE A;  3ZST A;  3MXZ A;  3RQU A;  3RIA A;  5F8P A;  3PV0 F;  3EAB A;  4PJM A;  2ODV A;  2WU2 A;  3AE8 A;  3AAI A;  5LJN A;  4JBW F;  2XAS B;  1MMA A;  4DR6 T;  4QX7 B;  2NW8 A;  5FXW A;  3RKG A;  3AED A;  2X0H A;  4QXB B;  4ILB A;  1I94 T;  3P50 A;  5AQO B;  3NZP A;  3WAK A;  2N1G A;  3LDQ B;  4HWH A;  4KP3 C;  4YXD A;  4TWF A;  5LMN T;  5FP3 A;  2VQE T;  1UUR A;  3KV5 A;  4B3T T;  2WP9 A;  3MK7 C;  4P0B A;  4ISS A;  4IDP A;  2BKN A;  4M1P A;  2I59 A;  4QH4 A;  2YU2 A;  5L3E B;  1WCR A;  3IHR A;  2E2A A;  3SFD A;  2DWK A;  5LCY A;  2PFV A;  4U74 A;  1ZHC A;  1VRB A;  5J1G A;  3EAM A;  3CWZ B;  2JQH A;  2W61 A;  4PJN A;  5LB7 B;  2YN6 A;  3UT5 E;  4X5T A;  1MIW A;  3K1S A;  2LHN A;  2LM9 A;  5KX5 E;  5L3C B;  3ZYL A;  1HNZ T;  5C3J A;  3UQ7 A;  3I9W A;  1YW0 A;  3ONL C;  3BQI A;  1KNZ A;  3AE3 A;  3PUA A;  5AQN B;  3OTO T;  4QWN B;  3I1A A;  2WBL A;  1CUN A;  4B3M T;  1QLB A;  2KND A;  4BJM A;  4IDZ A;  3E22 E;  3Q5D A;  5LBM A;  4IDN A;  1IBM T;  4KHZ F;  5CGM A;  1HX8 A;  2C5K T;  3ANW A;  1U5P A;  4X64 T;  3RX6 A;  2UXB T;  1LKX A;  5KDM C;  2UUC T;  4YLH A;  1OED C;  3FB2 A;  3NBX X;  4B3R T;  3N9P A;  4IDO A;  1JNZ A;  3HL6 A;  4N78 D;  4JI5 T;  1KF6 A;  4V1A v;  4LMK A;  4G2A A;  1XMQ T;  2V6Y A;  3ZJ1 A;  1BR1 A;  2E9X C;  4ZEY A;  1E1H B;  3RRC A;  2XQY A;  4KMC A;  3HKB E;  5E0O A;  1NEN A;  5DQV A;  3LBX A;  3TLV A;  4YJ3 E;  2XHE B;  5HEG A;  2JPF A;  4K0U A;  4UEM A;  5H6R B;  3VKG A;  4OYJ A;  4C90 A;  4YSZ A;  4DV1 T;  2VKD A;  3DP7 A;  1D1C A;  3K3O A;  4EIW A;  2LHR A;  3JC6 D;  1YQ3 A;  3CIR A;  3AE7 A;  3AA7 B;  2IW5 B;  2DLR A;  4HWI B;  2V1D B;  2VUR A;  2FJD A;  2H7O A;  2VWA A;  1WYB A;  3A5X A;  3AA1 B;  3RIU A;  3PTR B;  4ZI3 D;  2D5U A;  3FBZ A;  2VVS A;  4O2A E;  2H7V C;  3PUV F;  2F4V T;  3C4W A;  3EDU A;  4H9S E;  2Q9Q B;  1Y64 B;  4HFV A;  1OED B;  1XWM A;  1VCT A;  2ACX A;  5LBQ B;  2B76 A;  1AJ3 A;  2CXF A;  1E2A A;  5AQS B;  1D0Y A;  3QNU A;  4YTP A;  5C2T A;  1NEK A;  2VK9 A;  2LJL A;  3PUW F;  5AQM B;  3C64 A;  3AE4 A;  4EV6 A;  1NWM X;  4IHJ E;  2N2N A;  4CXW A;  3PUX F;  3I9Y A;  4TX5 A;  3SOL A;  5M4Y A;  1KEY A;  2DNX A;  1D1A A;  4QH5 A;  2WY2 A;  3LK3 B;  5IHY A;  3J9X 1;  5LXT E;  2C5I T;  5LA6 E;  3N2O A;  5JDG A;  5A1L A;  2KWH A;  1SUM B;  5JDL A;  4LFA T;  3ETV A;  2AXD S;  3LFM A;  3UUL A;  2NTY A;  3O4X E;  2J4G A;  3RHW A;  2QGS A;  2R6G F;  4EAH A;  1OWA A;  2HHH T;  1ZP0 A;  3AVS A;  2E5V A;  2M67 A;  3KBT A;  4WBO A;  2X9X A;  3RI5 A;  4UVB B;  4Z8X A;  4ZOL E;  4CI1 B;  3RF1 A;  2NWB A;  2V8S V;  4GYR A;  4YT0 A;  1VCS A;  4LF9 T;  3OJA A;  4PNI A;  3QB5 A;  4UEL A;  2YU1 A;  4DV6 T;  5CA0 E;  3ZT6 A;  3TKL B;  2J1D G;  1HF8 A;  3FXE B;  4EZH A;  2XQ9 A;  3ETU A;  3ESL A;  1BR2 A;  4U31 A;  2M6I A;  4X66 T;  2KSR A;  2NW9 A;  1IJ6 A;  2UUB T;  4YSY A;  3TLW A;  3PE0 A;  3AEF A;  3MAC A;  2WDV A;  3D0T A;  2CLY C;  1US7 B;  1G73 A;  3C98 B;  1HFA A;  1HNW T;  2WS3 A;  3OYX A;  4YTN A;  4OX9 T;  4JEU B;  4BA9 A;  3QOF A;  5HAX A;  5ABH A;  2BBH A;  4AKG A;  4HFH A;  2NP9 A;  2WMN A;  5HYA A;  1HCI A;  1SHZ C;  2VKH A;  3LSV A;  2VKO A;  2XAQ B;  2YOE A;  2SPC A;  4JI3 T;  5H6Q B;  3ZT5 A;  4DBQ A;  5JRC B;  4U7I A;  1O3X A;  1B7T A;  4EGW A;  5AQK B;  4OK0 A;  5LJM A;  3CPZ A;  4JI7 T;  3M65 A;  4BJN A;  1ZKE A;  1FJG T;  2HPJ A;  4JI8 T;  4GK5 E;  3OPC A;  2NR4 A;  1MIY A;  5AQT B;  2JMK A;  2CMR A;  4J2C A;  2Q9Q A;  2DI4 A;  3ZMT B;  4QXH B;  2H3R A;  2I0M A;  5FXZ A;  1OED A;  1T8B A;  3HKC E;  4AXP A;  3JAE A;  2K24 A;  4OYK A;  4ZHQ E;  4AQF A;  4EOZ B;  2JQK A;  4TUY E;  1QSD A;  2N9D A;  3CQX C;  4H9P C;  4NXN T;  5HWX A;  5L4E A;  4JI4 T;  5FY0 A;  4IRE A;  4A56 A;  4CI2 B;  4O2B E;  3UTK A;  1MMD A;  1U4Q A;  5JR9 B;  2CLY B;  2IDO B;  5FKY A;  5L3D B;  3VR9 A;  3EUH A;  1N33 T;  3P4Q A;  2Y8D A;  4P09 A;  2BG9 C;  5LHG B;  3FZH B;  3RYC E;  1WYC A;  4HFB A;  3JAF A;  4EED A;  1MNE A;  1HTJ F;  2MTQ A;  2MOZ A;  4X20 E;  3P4P A;  5FL1 A;  3ZYM A;  5ABF A;  2CHN A;  3H37 A;  3ZMV B;  1FMW A;  2CE7 A;  2LKG A;  3AE2 A;  1D1B A;  1BR0 A;  2YDQ A;  3AAE B;  4JI6 T;  3L8R A;  1FEW A;  3C4X A;  4IST A;  5CA1 E;  4DND A;  5HXE A;  2IUB A;  1YD8 G;  3PDY A;  5AFU L;  1SE7 A;  4DR1 T;  4ADZ A;  5F3J A;  3UFE A;  2CA5 A;  4OHF A;  3N9L A;  4WNK A;  2ZM2 A;  4A97 A;  4LFB T;  4ZS3 A;  4DMW A;  5JDM A;  3V5S A;  2XAJ B;  4TWH A;  2L8K A;  3ZKR A;  3ZSS A;  4TNV A;  4XBF B;  2A3D A;  4YTM A;  3LG7 A;  4H63 V;  2BG9 E;  5JQG E;  2W4X A;  3O9X A;  5HWY A;  2FJA A;  1KNR A;  4G63 A;  5AQG B;  3Q2M A;  5AQU B;  3K3N A;  5HEO A;  1EZ3 A;  3ZPO A;  5AQF B;  1W09 A;  4WBN E;  2M6B A;  2BG9 B;  4WW0 A;  4UVC B;  3AVR A;  3H3M A;  1VOM A;  3O1I A;  4JI2 T;  3ZJ2 A;  4I0U A;  2K48 A;  4NUU A;  2B1E A;  1WFD A;  3CK6 A;  2A9U A;  5L3B B;  3RIF A;  3U78 A;  3WI3 A;  2XSA A;  3CQG B;  5LP6 E;  5LOV E;  4GIW A;  4PW8 A;  1KFY A;  2IML A;  3IF8 B;  2W63 A;  3RC3 A;  4DR7 T;  5JVD E;  2Q9Q C;  1YXR A;  5JRC A;  3TLS A;  3DTO A;  2HN2 A;  3TLU A;  5JDH A;  2BZB A;  2YIN A;  5HXR A;  5FYM A;  2C5J A;  2JMH A;  3G06 A;  4AQF C;  4U7Y A;  4U2Z A;  2BBJ A;  2XAF B;  2YK0 A;  4I4T E;  2LOP A;  4FI5 A;  5EK3 A;  3JC6 C;  3T1Y T;  3KVB A;  2X9Y A;  2XQA A;  3O1J A;  3GA8 A;  2X68 A;  2LT3 A;  3SFE A;  2UXC T;  1HG2 A;  5LGT B;  2LE8 A;  1N32 T;  1IBL T;  2BKP A;  4HGA A;  3ZLI A;  5AQQ B;  3DJB A;  5AQR B;  1FIO A;  2WZI A;  4CN4 A;  4IE0 A;  2XM1 A;  5AQJ B;  2LLY A;  5LNK A;  5JR9 A;  4O4J E;  4TV9 E;  3VU7 H;  2WM9 A;  1MND A;  5LGU B;  2LSI A;  4DV5 T;  4L0R A;  2VKJ A;  4PFP A;  3KFW X;  3AE9 A;  4MBQ A;  2A2F X;  1XZY A;  2J47 A;  2E9X D;  1OED E;  3B5M A;  2ZM6 T;  3GWH A;  2I6H A;  2WMO A;  5BR8 T;  4UIG A;  1H7C A;  5LHI B;  2UU9 T;  4ZS2 A;  3AE1 A;  4AKR B;  3N5L A;  2XQ4 A;  2V7J A;  4UV9 B;  3N9O A;  2ZM0 A;  1XDO A;  3IEE A;  2CBJ A;  4C91 A;  4UR9 A;  2G0U A;  2KWI B;  3EDV A;  2CXD A;  3S4U A;  1WRD A;  2XPK A;  4HEA A;  2D0T A;  2WWV A;  1M7K A;  2XQ5 A;  2YDS A;  3CX8 B;  4LF5 T;  2VAS A;  3KDS E;  2VB6 A;  3L09 A;  2CXL A;  3RPU A;  3AEG A;  1XDP A;  2V5D A;  3VRB A;  4DR3 T;  4DV3 T;  3MKD A;  2BVL A;  4OFZ A;  3TLT A;  4CI3 B;  4EYU A;  3ZN1 B;  5ABG A;  4DID B;  4O4L E;  2HH7 A;  5IWA T;  4IE5 A;  1W9R A;  3P4R A;  5ABF B;  3ZCI A;  1ZV4 X;  3Q5X A;  4DV7 T;  2W2U A;  4ZI2 D;  3M3Z B;  2BG9 A;  4HWC A;  3UUX B;  2X51 A;  3AA0 B;  2LEH A;  3W15 B;  3SWH A;  4CN6 A;  4DVD A;  2KLQ A;  4TNW A;  5EZY E;  3KV9 A;  4U2Y A;  1D0X A;  2CWO A;  3E0Z A;  1WR6 A;  2Y48 B;  4ILU A;  3T1H T;  2W62 A;  4HFD A;  3UU6 A;  3K3Q C;  1IBK T;  4LF7 T;  3AE5 A;  3GMI A;  4IE6 A;  4XAX B;  4JI0 T;  5ABE A;  4Q25 A;  5LMU T;  4GYS A;  2XQ7 A;  2D9D A;  3CVR A;  2HN1 A;  1UX5 A;  3VHL A;  4AKI A;  3UUM A;  5GON E;  4AKH A;  2XQ3 A;  2PG8 A;  3N9N A;  4JLE A;  3FZM B;  2CBI A;  2IAK A;  3RRW A;  2ES0 A;  2D0U A;  2EHO C;  3OYZ A;  3AEC A;  4HFE A;  2VL8 A;  2UXN B;  2QRX A;  3F2E A;  1T72 A;  3OKQ A;  3C51 A;  4NUV A;  4LF8 T;  2YDR A;  5L3G B;  2CEA A;  4KBM B;  5J2U E;  5JR9 C;  1IAP A;  2FUP A;  2NTX A;  2KZ7 B;  4MFR A;  3UFG A;  1J5E T;  4B3S T;  2V6X A;  3ONX A;  3MZK B;  3L3P A;  2LSJ A;  4X1Y E;  4K0K T;  3U3I A;  4JI1 T;  3FXD B;  3PUG A;  2W67 A;  2KMF A;  5KMG P;  4ERR A;  5AQI B;  3AEA A;  1HNX T;  1M62 A;  4MAL A;  1N34 T;  3UU5 A;  4HWF A;  5LHH B;  1UX4 A;  3KV6 A;  2WCA A;  4TV8 E;  4CXX A;  2X66 A;  4KUM B;  2V26 A;  2XQ6 A;  1GQE A;  4F6R C;  5IUX A;  3UUN A;  4O4H E;  4ANJ A;  3HKE E;  3B13 A;  2WZH A;  3SS1 A;  1W0A A;  2XQ8 A;  5FXV A;  2Y6X A;  4A98 A;  2X0L B;  2K9A A;  3PJA J;  5TAO A;  5JRE A;  2EHO B;  3ONJ A;  1MMN A;  3SRZ A;  5FMN A;  2X9H A;  5CB4 E;  3FZL B;  4AKL A;  4YY3 T;  3R84 B;  2OLT A;  1HG5 A;  3E08 A;  4YJ2 E;  3RYI E;  3A8Y C;  4F8H A;  3NWI A;  2K5B B;  3ZEF B;  2JJ9 A;  2QYW A;  3Q5E A;  5LYJ E;  3VRA A;  3H3A A;  2YEV C;  3JAD A;  3AEB A;  3N9M A;  1S94 A;  1HR0 T;  4ASK A;  5HEH A;  2LM2 A;  2E8I A;  4LFC T;  4AIU A;  1UUS A;  3R6N A;  4I55 E;  4ILC A;  5HXC A;  4IL4 A;  3UU8 A;  3EI0 A;  4YFS A;  3AA6 B;  5FXX A;  5FY7 A;  5ETW A;  4P0A A;  3X1D A;  1T7S A;  4ILA A;  2V7M A;  3PUZ F;  1G8X A;  5JDQ A;  5HEU A;  3PUS A;  1YKE B;  2QVA A;  3PUR A;  2AE9 A;  2XUE A;  2DWG A;  1X79 A;  4PK5 A;  4HKA A;  3NKZ A;  5DJQ C;  2GK9 A;  2Z6E A;  3CML A;  4FJO A;  1L0V A;  4I43 B;  1X9B A;  3ZN0 B;  4IGU A;  4DO0 A;  2KT9 A;  4CN1 A;  4QH1 A;  2RPA A;  4U72 A;  3RYF E;  2FJE A;  3RYH E;  2JRK A;  3AXJ A;  2CWY A;  5FVL A;  3AB3 B;  2PBI A;  3N2K E;  2UXD T;  3ZC0 A;  3FBL A;  5L4H A;  2CRB A;  4DMV A;  5JH7 E;  4A5X A;  4KX6 A;  5FL0 A;  2LSG A;  3KV4 A;  2D2S A;  2WAU A;  2LKH A;  5FNV E;  1J1J A;  4AQY T;  2MAW A;  2ACZ A;  1XNQ T;  1XNR T;  4JV5 T;  4COF A;  3OBV E;  2BDE A;  4IDQ A;  3EHZ A;  2KXP B;  2E5L T;  4GKJ T;  3N2G E;  2WDQ A;  2BS3 A;  1ZOY A;  3RC8 A;  1YKH B;  4UVA B;  2JQQ A;  3GN5 B;  3ZCJ A;  4EYY R;  2NOX A;  2LRL A;  4H9Q C;  1E7P A;  4HFI A;  4PK4 A;  3CKD A;  2NW7 A;  2XM2 A;  3CX6 B;  3UU4 A;  3EVY A;  5HCM A;  1S35 A;  2XAH B;  1DU2 A;  1I6Z A;  2X0Y A;  4IE7 A;  3CX7 B;  4B6X A;  2JIW A;  2PJQ A;  1BR4 A;  2EHO A; 
#chains in the Genus database with same CATH homology
 2XAQ B;  4QXB B;  3ZCI A;  3HA4 A;  1ZV4 X;  3VKH A;  3NZP A;  3Q5X A;  2SPC A;  3WAK A;  2N1G A;  2X9W A;  4L9I A;  5H6Q B;  4ZI2 D;  1QUU A;  4KP3 C;  4DBQ A;  5JRC B;  1O3X A;  2Q9Q D;  1B7T A;  3Q5W A;  3UUX B;  4OK0 A;  5FP3 A;  5HXS A;  2X51 A;  5LJM A;  1V9D A;  3AA0 B;  3CPZ A;  2XTL A;  3M65 A;  2LEH A;  4BJN A;  3W15 B;  3KV5 A;  3SWH A;  4H9N C;  4ZI3 C;  4DVD A;  1ZKE A;  2KLQ A;  3MK7 C;  5EZY E;  4P0B A;  2HPJ A;  4GK5 E;  1MIY A;  4BAY B;  3KV9 A;  4ISS A;  2JMK A;  2CMR A;  1D0X A;  2CWO A;  1LRZ A;  3E0Z A;  1WR6 A;  4J2C A;  5BMV E;  2XAG B;  3I0O A;  2Q9Q A;  2Y48 B;  4ILU A;  2DI4 A;  3ZMT B;  4M1P A;  2I59 A;  4QXH B;  3PU8 A;  2W62 A;  2H3R A;  2YU2 A;  3WAJ A;  1T98 A;  2QA7 A;  5FXZ A;  3HKC E;  3K3Q C;  3GMI A;  4AXP A;  5L3E B;  4O8S A;  2ZLY A;  4IE6 A;  4XAX B;  4GK0 E;  2K24 A;  4OYK A;  3IHR A;  4ZHQ E;  4GYS A;  4AQF A;  4EOZ B;  3CVR A;  1QSD A;  4TUY E;  2N9D A;  2ZM8 A;  3CQX C;  2DWK A;  5LCY A;  1UX5 A;  2PFV A;  4H9P C;  5HWX A;  2CM0 A;  3KBU A;  4U74 A;  3VHL A;  1ZHC A;  4H9R C;  5FY0 A;  1VRB A;  5J1G A;  3UUM A;  4AKI A;  5GON E;  5ADX L;  2V7L A;  5JDF A;  4A56 A;  4AKH A;  4CI2 B;  4O2B E;  2ZMA A;  3UTK A;  1MMD A;  3CWZ B;  2W61 A;  2PG8 A;  4PJN A;  1U4Q A;  3N9N A;  2CLY B;  5JR9 B;  1LVK A;  4JLE A;  3UT5 E;  4UV8 B;  3RRW A;  2IAK A;  5L3D B;  2ES0 A;  2D0U A;  1MIW A;  2EHO C;  4PFO A;  2LHN A;  2BVM A;  3OYZ A;  3EUH A;  2MBG A;  2VL8 A;  2UXN B;  5J2T E;  2LM9 A;  3F2E A;  5KX5 E;  5L3C B;  3OKQ A;  3ZYL A;  3C51 A;  4NUV A;  2Y8D A;  4P09 A;  2L3L A;  3F31 A;  5LHG B;  3RYC E;  5L3G B;  2OA5 A;  1D0Z A;  4CXY A;  1WYC A;  3I9W A;  1YW0 A;  3J7Y q;  2CEA A;  4KBM B;  5J2U E;  3BQI A;  5JR9 C;  1KNZ A;  1IAP A;  3PUA A;  1MNE A;  2NTX A;  4QWN B;  2KZ7 B;  1HTJ F;  2KIN B;  2MTQ A;  4MFR A;  3I1A A;  2MOZ A;  4X20 E;  2WBL A;  3ZYM A;  1CUN A;  4ZI2 C;  2KND A;  4BJM A;  3PU3 A;  4IDZ A;  3E22 E;  3H37 A;  4JUY A;  3ZMV B;  3ONX A;  5LBM A;  3MZK B;  3L3P A;  2LSJ A;  1HX8 A;  1FMW A;  2C5K T;  3ANW A;  1U5P A;  4HE8 A;  4X1Y E;  2CE7 A;  3RX6 A;  1LKX A;  4TZ4 C;  1WLX A;  4TN7 B;  5KDM C;  4YLH A;  2E9X B;  1D1B A;  1BR0 A;  3U3I A;  3AAE B;  3FB2 A;  3NBX X;  4I50 E;  4MLK A;  1FEW A;  3N9P A;  3FXD B;  3C4X A;  4AI6 A;  4IST A;  1KK7 A;  4IIJ E;  5CA1 E;  3PUG A;  4DND A;  3HL6 A;  5HXE A;  1YD8 G;  3PDY A;  1IJ5 A;  5AFU L;  1IZN B;  2KMF A;  4N78 D;  1Z0P A;  3UFE A;  4ADZ A;  5F3J A;  5KMG P;  3NRX A;  4UF0 B;  4V1A v;  3IBP A;  2CA5 A;  4G2A A;  3ZMS B;  4ERR A;  4HN9 A;  4OHF A;  3N9L A;  3ZJ1 A;  4YHJ A;  1BR1 A;  2E9X C;  4WNK A;  1E1H B;  4MAL A;  3RRC A;  2ZM2 A;  2XQY A;  4KMC A;  4ZS3 A;  4DMW A;  5LHH B;  1OXZ A;  3HKB E;  5E0O A;  3ZYK A;  5DQV A;  3LBX A;  1UX4 A;  5JDM A;  3V5S A;  4YJ3 E;  3KV6 A;  2XAJ B;  2XHE B;  2JPF A;  4TV8 E;  2L8K A;  4K0U A;  4CXX A;  2X66 A;  4E7S A;  4KUM B;  4UEM A;  2V26 A;  5H6R B;  3VKG A;  4OYJ A;  4PJJ A;  4C90 A;  4XBF B;  4F6R C;  2P9B A;  3UUN A;  2A3D A;  3V5U A;  3HI2 A;  3LG7 A;  5LGN B;  4H9O C;  2VKD A;  4H63 V;  3BQL A;  3DP7 A;  5JQG E;  1D1C A;  4O4H E;  4ANJ A;  3O9X A;  3K3O A;  5DQW A;  3HKE E;  3B13 A;  4EIW A;  2LHR A;  5HWY A;  3SS1 A;  3JC6 D;  5FXV A;  2Y6X A;  3HKD E;  2ODU A;  4G63 A;  3ZMU B;  3Q2M A;  2X0L B;  3C4Z A;  2K9A A;  3K3N A;  5TAO A;  4UXN B;  5JRE A;  2EHO B;  1MMN A;  1EZ3 A;  3SRZ A;  5FMN A;  3AA7 B;  2IW5 B;  2DLR A;  2W00 A;  3ZPO A;  2X9H A;  2V1D B;  5CB4 E;  4WBN E;  4XZC A;  3F57 A;  2A72 A;  4AKL A;  2CCQ A;  3NRY A;  3GN5 A;  3R84 B;  4WW0 A;  2H7O A;  1HG5 A;  1ZEE A;  3E08 A;  4YJ2 E;  4UVC B;  3AVR A;  2VWA A;  3RYI E;  1WYB A;  5HXH A;  2K5B B;  3A5X A;  3AA1 B;  3ZEF B;  1VOM A;  2JJ9 A;  3O1I A;  5LYJ E;  3ZJ2 A;  3PTR B;  4ZI3 D;  2D5U A;  2K48 A;  3FBZ A;  4NUU A;  2B1E A;  2IC9 A;  2H7V C;  4O2A E;  5LG4 A;  3K8P C;  3C4W A;  3EDU A;  4H9S E;  2Q9Q B;  3P8C D;  1Y64 B;  5L3B B;  1HS7 A;  3U78 A;  3WI3 A;  2DCF A;  4HFV A;  2C0S A;  3H3A A;  2YEV C;  2LSK A;  2ACX A;  3CQG B;  5LP6 E;  5LOV E;  1UCU A;  3LK2 B;  4EB6 E;  5LBQ B;  4GIW A;  4EZ4 A;  1AJ3 A;  2CXF A;  3N9M A;  4H63 H;  4PW8 A;  3BK9 A;  2W63 A;  3IF8 B;  3RC3 A;  2RA1 A;  4E7Z A;  3KVA A;  4CQI A;  5JDN A;  1D0Y A;  1S94 A;  5JVD E;  2Q9Q C;  4ASK A;  3T8O A;  2E8I A;  5JRC A;  4QHO A;  2VK9 A;  2LJL A;  5EK4 A;  3DTO A;  5JDH A;  3R6N A;  2BZB A;  2LSY A;  4I55 E;  3C64 A;  2YIN A;  5HXC A;  5HXR A;  4MHC A;  4GOU A;  1NWM X;  4IHJ E;  2C5J A;  5FYM A;  4CZZ B;  3Q9D A;  2N2N A;  2JMH A;  3AA6 B;  4YFS A;  5FXX A;  4AQF C;  5FY7 A;  3P7I A;  4L5G A;  5ETW A;  4CXW A;  5IYZ E;  4P0A A;  1NAF A;  2XAF B;  2EHO D;  2YK0 A;  3I9Y A;  4TX5 A;  3SOL A;  4I4T E;  2V7M A;  2LOP A;  3BQK A;  3N9Q A;  1G8X A;  4AQG A;  5JDQ A;  5M4Y A;  3LJC A;  3PUS A;  4FI5 A;  5EK3 A;  1YKE B;  3JC6 C;  2DNX A;  3PUR A;  3KVB A;  1D1A A;  2X9Y A;  3PUQ A;  3O1J A;  3GA8 A;  2X68 A;  3LK3 B;  2XUE A;  2DWG A;  1X79 A;  2L9Q A;  1FMV A;  2LT3 A;  5IHY A;  3J9X 1;  1HG2 A;  5LXT E;  2C5I T;  3LK4 2;  5LA6 E;  5LGT B;  3N2O A;  4X1I E;  2LE8 A;  5FY1 A;  4PK5 A;  5JDG A;  3B57 A;  4HGA A;  3ZLI A;  3HR0 A;  5A1L A;  2KWH A;  3DJB A;  4HKA A;  5DJQ C;  2GK9 A;  2Z6E A;  3RH3 A;  5JDL A;  3CML A;  4FJO A;  1FIO A;  3C50 A;  3ANW B;  3ETV A;  4IE0 A;  5C8Y E;  4I43 B;  4DBR A;  3ZN0 B;  2WWU A;  3RKO A;  4EXT A;  5LNK A;  3LFM A;  5JR9 A;  4O4J E;  4TV9 E;  3UUL A;  2LOS A;  2NTY A;  3O4X E;  3VU7 H;  4IGU A;  4DO0 A;  4JEH B;  2KT9 A;  4U72 A;  2QGS A;  3RYF E;  4EAH A;  3I0Q A;  2V7I A;  2V7K A;  5EK2 A;  3MA9 A;  1MIV A;  3RYH E;  2WM9 A;  1MND A;  1OWA A;  5LGU B;  2LSI A;  2JRK A;  2CWY A;  4L0R A;  3AB3 B;  3ZC1 A;  2VKJ A;  2PBI A;  3CQC B;  3N2K E;  4PFP A;  3KFW X;  3QUJ A;  3ZC0 A;  3AVS A;  4MBQ A;  3O1H A;  3FBL A;  2A2F X;  2M67 A;  3KBT A;  4WBO A;  4ZI7 E;  2RP4 A;  2E9X D;  2X9X A;  4QX8 B;  4O4I E;  4UVB B;  4Z8X A;  4ZOL E;  3GWH A;  2MYS A;  4DMV A;  5JH7 E;  4CI1 B;  2WMO A;  3LBX B;  3MJX A;  2NWB A;  2HPL A;  4GYR A;  4UIG A;  1H7C A;  3QC9 A;  5LHI B;  2LSG A;  3OJA A;  4ZS2 A;  3KV4 A;  4PNI A;  4UEL A;  4AKR B;  2YU1 A;  2D2S A;  2WAU A;  5CA0 E;  3TKL B;  2J1D G;  5FNV E;  3N5L A;  4X1K E;  1HF8 A;  2V7J A;  2E9X A;  3FXE B;  2UXX B;  4PAG A;  4QKN A;  4EZH A;  3ETU A;  3N9O A;  3OBV E;  2BDE A;  4QXC B;  2ZM0 A;  4UV9 B;  5DAB A;  1MMG A;  3ESL A;  1BR2 A;  3IEE A;  2KXP B;  4C91 A;  2W0G A;  3QK6 A;  5L3F B;  2G0U A;  5L2L A;  2DHR A;  2NW9 A;  2KWI B;  3EDV A;  3NZQ A;  2CXD A;  2WSS V;  3N2G E;  1IJ6 A;  4UF0 A;  3S4U A;  3AAA B;  4PJL A;  1WRD A;  2IC6 A;  3KIN B;  3RC8 A;  2X67 A;  4HEA A;  4PK6 A;  3PE0 A;  2D0T A;  3ZMZ B;  3MAC A;  3D0T A;  1YKH B;  4UVA B;  2JQQ A;  3GN5 B;  2CLY C;  3ZCJ A;  1LVF A;  1US7 B;  4EYY R;  1SA0 E;  1G73 A;  2NOX A;  3C98 B;  3CX8 B;  4IE4 A;  1HFA A;  2VAS A;  3KDS E;  4H9Q C;  3FHN A;  2VB6 A;  3L09 A;  4HTE A;  2CXL A;  3RPU A;  3MXZ A;  4PK4 A;  5F8P A;  3OYX A;  3CKD A;  2NW7 A;  4PJM A;  2ODV A;  4JEU B;  3MKD A;  4BA9 A;  2BVL A;  3CX6 B;  4OFZ A;  3AAI A;  4CI3 B;  4EYU A;  3ZN1 B;  5LJN A;  3EVY A;  5HAX A;  2XAS B;  1MMA A;  1S35 A;  2XAH B;  4AKG A;  2NP9 A;  4O4L E;  2WMN A;  5HYA A;  1HCI A;  4IE7 A;  4QX7 B;  1SHZ C;  2VKH A;  2HH7 A;  2NW8 A;  3CX7 B;  4B6X A;  5FXW A;  2VKO A;  2PJQ A;  1BR4 A;  4IE5 A;  2EHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...