2Q9QC

The crystal structure of full length human gins complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
145
structure length
145
Chain Sequence
b'MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSILPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA replication complex GINS protein PSF2
publication title Crystal structure of the GINS complex and functional insights into its role in DNA replication.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
total genus 53
structure length 145
sequence length 145
chains with identical sequence G
ec nomenclature
pdb deposition date 2007-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1030 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2q9qC01
2Q9QB 2EHOA 2EHOB 3JC6D 2E9XA 3ANWA 2Q9QC 2E9XD
chains in the Genus database with same CATH superfamily
2NW9A 2DL1A 3HI2A 3NBXX 2WB5A 4UVBB 5ABFA 2LSIA 4AIUA 3RIUA 4GKJT 3AE9A 2CWOA 2BZBA 2K5BB 2J62A 3I0OA 4GK0E 4QXHB 5FXXA 3AE3A 2E9XC 2VK9A 4J2CA 5LBQB 2XPKA 5L4EA 4LF4T 5J0ZA 2HN1A 4B3ST 4P0AA 3B13A 4DV1T 4PFOA 2Y8DA 2VVSA 3VRAA 5CJ5A 2WZIA 2KSRA 4U33A 1J5ET 1LVKA 5TAOA 2HN2A 2W66A 3AEEA 2XJ7A 2EHOC 4BJNA 5HXEA 4ZI3C 1NAFA 1QSDA 2JQHA 5IYZE 2ZMAA 3KDSE 3RF1A 3M3ZB 3AE7A 4AXPA 4KHPT 2HHHT 4IT4A 3IBPA 4UF0B 3C4WA 4EAHA 4H9NC 1KNRA 4DUZT 4E7ZA 3CQXC 3GN5A 4HE8A 4LF9T 5JTGA 3QC9A 2XQ8A 1HG5A 3JCFA 2VWAA 1QUUA 3ABVA 5LGNB 4X1YE 3P4SA 3HKDE 2WMOA 2IMLA 5LG3A 4ASKA 4UELA 2C5JA 1XDOA 2W67A 2LM2A 4LMKA 5AQKB 3PDYA 3C50A 4MFRA 1XZYA 2KT9A 4QHOA 2P9BA 3NZPA 3ZN0B 4ADZA 2H88A 4LFAT 4A5XA 3MK7C 2KWIB 3UU4A 5LMUT 4DR5T 5AQVB 1JNRA 4CN1A 2Q9QD 2GK9A 3PUZF 3MACA 2CBIA 2LOPA 3ZMVB 4DV7T 5F3JA 1FJGT 4P1NA 4B3TT 2VL8A 3IHRA 5LG4A 1G8XA 3OKQA 2D0UA 5DQVA 4ZZBA 4QX8B 3LSVA 3UUBA 4QXCB 4HWIB 1UX5A 2PG8A 3RYIE 1ZP0A 2NR4A 1XNRT 4YLHA 4EEBA 5JR9A 2CM0A 2W62A 2IIUA 3ZJ1A 3ZPOA 4KP3C 3ZT6A 3O1HA 3HKBE 2K48A 4EZHA 4NUVA 4JEHB 3AEGA 5AQFB 5JDFA 4UV9B 4X1IE 4HGAA 1HX8A 5JVDE 3P4RA 4U3CA 2ZM2A 4EV6A 1HTJF 3ZKRA 4CQIA 3SWHA 4ILAA 2XQ5A 5JREA 4YJ3E 4ZI2D 5FVKA 2ZM8A 2WS3A 4PK5A 2E8IA 4NUUA 5AQGB 3LBXA 2DWKA 5GONE 3JAEA 2JQ9A 4YTNA 2RA1A 4XBFB 4JBWF 1HCIA 5LJNA 3EABA 2V1DB 1SHZC 2E9XA 5LGUB 2XTLA 3RQUA 4CXWA 1XNQT 3O1IA 3UUXB 3CX7B 3RRCA 3PURA 1YXRA 3K3QC 1N34T 4HWHA 1KFYA 4ERRA 4YFSA 3ANWB 2EHOA 1J5WA 3BQKA 2CHNA 4CN4A 3CKDA 2Q9QB 5FNVE 2LOSA 4CXYA 2JJ9A 3RC3A 4H63V 4AQFC 3MXZA 3CWZB 3NKZA 4YT0A 3P7IA 5L3DB 2XQ9A 1GQEA 2XAGB 1FMVA 3GA8A 3FXDB 2W2UA 5AQOB 2YDSA 3AAAB 2AXDS 4CN6A 4HTEA 4KMCA 4TWHA 4YSZA 5AQQB 4EGWA 4OK0A 2LSYA 1YKHB 3AEAA 5ABGA 2W0GA 4IIJE 4JI3T 2A72A 2H7VC 2LJLA 1UUSA 4MALA 4WBNE 3ETVA 2IUBA 2UXXB 4LFBT 4I4TE 5HEGA 2V26A 3ZJ2A 4ILUA 3RRWA 4X66T 3F31A 5CA1E 5KX5E 2H7OA 2Y6XA 3RX6A 1X9BA 2DI4A 1M7KA 3AE2A 3IA3A 1VCTA 3ZMSB 3C51A 2VURA 2VVNA 3UUMA 2BG9B 2BKNA 4IDPA 3R84B 2WM9A 3ZC0A 3ZMZB 4JI0T 3IEEA 2FJDA 2FJAA 1X79A 3KVAA 1VOMA 4ANJA 1FIOA 3OTOT 5HWYA 1SA0E 1UX4A 2ODUA 4MHCA 4H63H 2DNXA 1MIVA 3AEBA 5AQTB 4DMVA 4HFCA 2XAJB 3EHZA 2X51A 4IDZA 4ZS2A 4UEMA 4YSYA 5JDNA 4Q25A 5HXHA 4TX5A 3AA7B 3HA4A 1KNZA 4HFIA 3VR9A 3VR8A 2D2SA 2IAKA 2V8SV 5H6RB 5HAXA 2X0LB 5L47A 3RLFF 2CA5A 3CVRA 2YOEA 2YN6A 3MZKB 4O2BE 1UK5A 3N2GE 1UGOA 5IUXA 2MTQA 2XZEA 5DJQC 4JI2T 2V6YB 3AE1A 1ZHCA 3EDVA 2M6IA 2LT3A 1WCRA 4YTMA 2X9XA 4TV9E 4DBQA 2IDOB 3FZKB 2YINA 2VKDA 5CFBA 2UU9T 3PUWF 2WDVA 5FY0A 5HXCA 5ADXL 1NWMX 2C0SA 2UXCT 4O4HE 5AQJB 3A8YC 4U2ZA 3T1YT 4AKHA 3ZCJA 3EAMA 3MKDA 2ODVA 3AA6B 3UUNA 3FBZA 4WW0A 2MYSA 2X9WA 3N9LA 1U4QA 4G63A 3JAFA 4MLKA 4Z91A 3OPCA 1IJ6A 1U5PA 1JNZA 3HKCE 4YHHT 3KBTA 1WR6A 2MOZA 5AQLB 1DU2A 3CX8B 5A1LA 3WAJA 2XQ6A 3SS1A 3ONJA 3H3AA 2FJEA 5HEJA 4TNVA 4AQFA 3RPUA 2VQET 3J9X1 3WI3A 4PNIA 2Y48B 4TWDA 5L3BB 3NRXA 2LKHA 2UXNB 5L2LA 1MMGA 4JLEA 4CI3B 2X0HA 4UF0A 1IBLT 2ES0A 3UU8A 4HWCA 3SFEA 1E7PA 3ZYKA 3P8CD 5CB4E 1QLBA 5HXSA 1E2AA 4OHFA 4UR9A 5AQPB 1ZV4X 3Q5WA 2CCQA 2M67A 2WY2A 2BDEA 3RYHE 1WYCA 3RIAA 3AE5A 5F8PA 5ABFB 2WP9A 1SUMB 5FP3A 2K9AA 3SFDA 3X1DA 3L8RA 5AQIB 3UQ7A 2LSKA 3ZYLA 3PUGA 2JIWA 3O1JA 1BR1A 3ETUA 3AE6A 2CXDA 4ZOLE 4EEDA 2NWBA 2HH7A 3PUSA 2LRLA 2V5CA 2C5IT 1D0ZA 1US7B 3PUXF 3E22E 3OYXA 1MMAA 4PK6A 2WBLA 3EUHA 2BG9C 1H7CA 2K3WA 2I0MA 3RHWA 5ETWA 3FZFB 4CXXA 4HWFA 3C4ZA 1KF6A 2IC9A 3VHLA 2CLYB 4HFDA 2WWUA 2FBWA 1WR0A 4PK4A 4OYJA 4KI0F 2BBJA 3R6NA 2JPFA 2WMNA 4WBOA 2YDRA 1CHUA 4QX7B 2J4GA 2VQFT 3EI0A 4EYYR 1T8BA 4YHJA 4C91A 4JI4T 4O4LE 2RPAA 3RYFE 5LHHB 1OXZA 5LB7B 3GN5B 2F4VT 1YD8G 3AVRA 2X68A 4EXTA 5HCMA 3O4XE 4AKRB 5FY7A 3AA0B 3NWIA 2D0TA 2YEVC 4GYRA 5EK4A 3ZN1B 2WQYA 1YQ4A 4QKNA 2IC6A 5C8YE 2E9XD 2WSSV 3N9MA 5CA0E 4EYUA 4ZEYA 4H9PC 3AXJB 4CZZB 4WZXA 5FYMA 4L5GA 3TLVA 2MBGA 2MAWA 1R8IA 1LRZA 5FKYA 3N9NA 4LFCT 3OYZA 2XUEA 3GWHA 4DV5T 4PFPA 2CXLA 5DABA 4PAGA 2SPCA 3TLTA 2EHOD 1HR0T 2LLYA 4ZI3D 3AB3B 2YKSA 4X5TA 4UIGA 1O3XA 4UVAB 1IBKT 3G06A 1UCUA 2M6BA 2DLRA 4IE6A 2BS2A 1W09A 3ZT5A 3U3IA 2L3LA 3ZSTA 5AQMB 2QGSA 3T8OA 3AVSA 4ISTA 1D0XA 4HFBA 1W0AA 4M1PA 4Z8XA 3CPZA 3JADA 2MPKA 1MNEA 4DV0T 5HCJA 2LHRA 4IE0A 1D1AA 3QK6A 4LMJA 2V6XA 2X66A 1HX1B 3UFEA 2BVLA 4JYAT 1YKEB 4DV4T 4LF7T 5LHIB 3N2OA 3V5SA 1I6ZA 3KV4A 2H3RA 2N2NA 4BJMA 5JR9B 1NEKA 1XDPA 5LNKA 4H9SE 3KBUA 3Q2MA 3JC6C 5EK3A 1KEYA 5AQUB 4DR6T 5JDHA 5LHGB 1AJ3A 1MIWA 4ZI7E 4OX9T 2KNDA 4NPPA 5JRCB 3EDUA 2CBJA 2X9HA 3RIFA 4DV6T 3RYCE 5LXTE 4DR2T 3I9WA 3I1AA 4KUMB 5JDQA 3N2KE 2A2FX 3OJAA 2VL0A 5CGMA 3N5LA 2ZM0A 4PJNA 4JUYA 2HPJA 3RC8A 1OWAA 4CI2B 5HEHA 3C98B 1Z0PA 3P4QA 3QB5K 4HEAA 3FZMB 2BVMA 4H9QC 2UUAT 4EB6E 2BG9E 2BG9A 4IDNA 4A97A 5FL0A 5LMNT 2LRKA 3PJAJ 4ISSA 1HFAA 3DP7A 2PTFA 1Y64B 3FZHB 2CLYC 4TN7B 5E0OA 1ZKEA 4KBMB 4LMLA 2XY8B 4QXBB 4IDQA 3TLWA 4AQGA 4AKLA 4XAXB 2XASB 5EK2A 2BKOA 1HNXT 2DHRA 2QYWA 5JDGA 3UFGA 1OEDB 2CEAA 4YSXA 5LCYA 2N9DA 2KXPB 3K3OA 4HN9A 2PFVA 2NW7A 3O9XA 4QWNB 4GIWA 3V5UA 2B1EA 5FXWA 1HNZT 2V6YA 3Q5EA 2QVAA 1VRBA 3QUJA 3J7Yq 4JI5T 5HYAA 5FVLA 3P4PA 4OYKA 5C2TA 3N9PA 3PJAA 5DQWA 2LSGA 4ZZCA 4P0BA 1BR0A 3AAIA 4UXNB 2BS3A 3RKOA 4WYVA 4K0KT 4U7YA 4DR7T 4ZXLA 4WNKA 4E7SA 2NW8A 3QNUA 5KXJA 3RQWA 5L3EB 3C4XA 3VRBA 4IE7A 3BQLA 5J2TE 3U78A 3B5MA 3H37A 5ABEA 3L09A 3I9YA 4B3MT 3ESLA 4N78D 3CX6B 3ZEFB 3DTOA 3QB5A 4PJLA 4DMWA 1B7TA 3HKEE 4DO0A 2KLQA 3VKHA 5J1GA 3KV9A 4GYSA 4IL9A 2B76A 3QOFA 4A56A 4COFA 1E1HB 3F2EA 5LOVE 1XWMA 3KFWX 4GK5E 1HNWT 3C64A 2BKPA 3OBVE 1W0BA 5FMNA 3Q5DA 4V1Av 5AFUL 3L3PA 3LK2B 4JI6T 3CIRA 1T7SA 3VKGA 1IZNB 1MMNA 1I94T 1IBMT 5EZYE 1W9RA 3AE4A 1HG2A 1NENA 5HWXA 4I0UA 4HKAA 3PU3A 1UURA 2Q9QC 3TKLB 1WFDA 4P09A 2XQ3A 4UVCB 2XQYA 3EVYA 5L4HA 3LG7A 1IAPA 4ILCA 4NIQA 2L8KA 2V7IA 3E08A 2XAQB 3LDQB 1WRDA 1MNDA 3NZQA 5AQSB 2XSAA 2DCFA 2YU1A 4AISA 4YXDA 2LM9A 4F6RC 3T1HT 2CHOA 4DV2T 4I50E 2W00A 3FBLA 3UT5E 3UULA 4DNDA 4YY3T 1Z8UA 4I55E 2ACZA 4LF8T 4EOZB 4PW8A 1KNPA 4GOUA 2BBHA 5HEOA 5H6QB 1HS7A 3N9QA 3UU6A 2JQQA 4JI8T 3UU3A 2ZM6T 2A3DA 1MMDA 3AEFA 2C5KT 2XM2A 4ZI2C 4H9OC 1D0YA 2HPLA 1OEDC 3RI5A 5JQGE 3A7MA 2G0UA 2IW5B 4AKGA 3BQIA 2L9QA 5AQNB 1HF8A 3FHNA 3AECA 4XZCA 2WCAA 1L0VA 3CQGB 4TUYE 2W63A 3AXJA 3ZC1A 4U72A 2VASA 2XAHB 4DIDB 4HWDA 2VKHA 3D0TA 4QH4A 3ZCIA 4CI1B 4H9RC 4FI5A 3ZMUB 1ZOYA 1KK7A 3TLUA 3NRYA 4B6XA 1M62A 5FXVA 4AKIA 4FJOA 2KINB 1XMOT 4YTPA 2A9UA 5ABHA 5FL1A 2X9YA 4X65T 3CQCB 2CMRA 4G2AA 3IF8B 1CUNA 1WYBA 3FXEB 2K24A 2WU5A 3CK6A 2KMFA 4HFHA 4QH1A 2YU2A 3ZYMA 2V7KA 1N32T 2JMKA 1LVFA 3PU8A 3ZT7A 3AAEB 3M65A 3HL6A 3H3MA 1LKXA 2V7LA 4IHJE 4TNWA 3KVBA 3E0ZA 2VB6A 1MIYA 2LSJA 2QRXA 5LJMA 1BR4A 2IHR1 3RGLA 2XHEB 3I0QA 3ANWA 2NP9A 2NTYA 3P50A 5KMGP 2H89A 3UU5A 4HFEA 3OVUA 2Q9QA 3KV5A 5JRCA 2I6HA 4JEUB 4U2YA 4ZHQE 4L9IA 2DWGA 4IGUA 2NTXA 2JQKA 5JH7E 5LA6E 1YW0A 4DVDA 4O2AE 5KDMC 4EIWA 2OV9A 4HFVA 3ZSSA 2I59A 4IE4A 2PBIA 2LE8A 3MJXA 4C90A 2QA7A 2LEHA 5AQRB 1VCSA 2CE7A 4JV5T 4AQYT 2ZLYA 4U74A 4LF5T 2NOXA 3Q9DA 1S35A 2KZ7B 4KX6A 3AEDA 3CMLA 3ONLC 4A98A 3RIUC 2WZHA 3A5XA 3HR0A 3LBXB 3PUYF 3L39A 2XQ4A 4DUYT 3UTKA 3S4UA 1XMQT 3LK42 2AE9A 2E9XB 1N33T 5JDMA 1SE7A 4X20E 1V9DA 3WAKA 5LP6E 4B3RT 3BK9A 1D1CA 1G73A 2FUPA 3K3NA 4ILBA 2V7MA 4AI6A 1J1JA 1ZEEA 4O4IE 3FB2A 2XSBA 2EHOB 2WAUA 2WU2A 2KWHA 2UUCT 3DJBA 1OEDE 4DV3T 1T98A 1OEDA 2WDRA 5IHYA 3KINB 2N1GA 4DR4T 3ONXA 1WLXA 4K0UA 1Y01A 2CPTA 2YK0A 2XQAA 2Z6EA 4U31A 2X67A 5LGTB 1D1BA 3AA1B 4Z90A 2UUBT 5M4YA 4L0RA 5HEUA 4IREA 4TV8E 1T72A 3B57A 1N36T 2CWYA 2D5UA 2BS4A 3PUAA 2VKJA 5BMVE 2LKGA 4DR1T 2WWVA 3LFMA 4X64T 3Q5XA 4YJ2E 2LHNA 3GMIA 5LBMA 1S94A 3RH3A 4TZ4C 5L3GB 4F8HA 4IDOA 3AE8A 2UXDT 3SRZA 1FEWA 3LJCA 3PV0F 4JI7T 2XM1A 4OFZA 4MBQA 3RKGA 4O8SA 4X1KE 3NVOA 4I43B 5JDLA 2JRKA 5FXZA 1BR2A 3JC6D 1EZ3A 2OLTA 5FY1A 2VKOA 3ZLIA 4ZS3A 4QH5A 3N9OA 2WDQA 2X0YA 3KV6A 4EZ4A 3PUVF 2E5VA 2XAFB 4U7IA 3PUQA 2J1DG 2E5LT 1YQ3A 4UV8B 2RP4A 3P4WA 3ZMTB 2D9DA 1FMWA 4IL4A 3SOLA 2V7JA 3K8PC 4NXNT 3W15B 4PJMA 4JI1T 2W4XA 2R6GF 2XQ7A 2ACXA 4X62T 2CXFA 5HXRA 4BA9A 2J47A 5LYJE 4IE5A 3PE0A 3LK3B 4NXMT 2UXBT 3VU7H 4BAYB 5C3JA 3TLSA 2W61A 5JR9C 2FJBA 5L3CB 2V5DA 4KHZF 4TWFA 2YDQA 5BR8T 2CRBA 3UQ4A 4GKKT 2E2AA 5L3FB 4DBRA 4O4JE 3MA9A 5AQHB 1IJ5A 2OA5A 2PJQA 3FZLB 2JMHA 3PTRB 3F57A 5IWAT 4LF6T 3K1SA 5J2UE 4DR3T 5F5WA 4PJJA
chains in the Genus database with same CATH topology
2NW9A 2VASA 2XAHB 5JR9B 3HI2A 3NBXX 1X79A 4UVBB 2LSIA 3KVAA 5LNKA 1VOMA 4ANJA 1FIOA 2VKHA 3D0TA 4H9SE 2CWOA 3KBUA 1SA0E 5HWYA 1UX4A 2ODUA 4MHCA 3ZCIA 4CI1B 3Q2MA 3JC6C 2BZBA 2DNXA 4FI5A 4H63H 4H9RC 1MIVA 5EK3A 3ZMUB 2K5BB 4DMVA 2XAJB 1KK7A 2X51A 5JDHA 4IDZA 5LHGB 4ZS2A 3I0OA 4UEMA 3NRYA 4GK0E 1AJ3A 4B6XA 1MIWA 4ZI7E 4QXHB 5FXXA 2E9XC 5JDNA 5HXHA 2VK9A 4TX5A 3AA7B 2KNDA 3HA4A 1KNZA 5JRCB 4J2CA 2D2SA 2IAKA 5LBQB 5H6RB 3EDUA 5HAXA 2X0LB 2X9HA 5FXVA 4AKIA 4FJOA 2KINB 2CA5A 3CVRA 3B13A 3RYCE 4P0AA 4PFOA 5LXTE 2X9YA 2Y8DA 3I9WA 3I1AA 3MZKB 4KUMB 4O2BE 5JDQA 3N2GE 3CQCB 3N2KE 2CMRA 4G2AA 1LVKA 3IF8B 5TAOA 2MTQA 2A2FX 3OJAA 3N5LA 1CUNA 2ZM0A 2EHOC 4PJNA 4BJNA 4JUYA 2HPJA 5HXEA 1WYBA 3FXEB 2K24A 4ZI3C 1NAFA 5DJQC 3RC8A 1QSDA 2KMFA 1OWAA 5IYZE 4CI2B 1ZHCA 2ZMAA 2YU2A 3ZYMA 3C98B 1Z0PA 3EDVA 3KDSE 2V7KA 2JMKA 4HEAA 2BVMA 2LT3A 4AXPA 4H9QC 2X9XA 4TV9E 4DBQA 4EB6E 1LVFA 3PU8A 3IBPA 3AAEB 3M65A 4UF0B 2YINA 2VKDA 3C4WA 4EAHA 3HL6A 4H9NC 5FY0A 4E7ZA 3CQXC 1LKXA 5HXCA 2V7LA 3GN5A 4IHJE 5ADXL 1NWMX 2C0SA 4HE8A 4ISSA 3KVBA 1HFAA 3QC9A 3E0ZA 4O4HE 2VB6A 1MIYA 2LSJA 1HG5A 5LJMA 3DP7A 1Y64B 2VWAA 4TN7B 1BR4A 2CLYC 5E0OA 1QUUA 5LGNB 4X1YE 1ZKEA 3HKDE 4AKHA 3ZCJA 4KBMB 2XHEB 2WMOA 3I0QA 3ANWA 2NP9A 4QXBB 2NTYA 3MKDA 2ODVA 3AA6B 3UUNA 5KMGP 3FBZA 4ASKA 4UELA 4WW0A 4AQGA 2C5JA 2Q9QA 4AKLA 4XAXB 2XASB 2MYSA 2X9WA 3KV5A 5JRCA 5EK2A 3N9LA 4JEUB 4ZHQE 1U4QA 4G63A 2DHRA 3C50A 3PDYA 5JDGA 4MFRA 2KT9A 2DWGA 4L9IA 4IGUA 4MLKA 2NTXA 4QHOA 2CEAA 2P9BA 3NZPA 5LA6E 5LCYA 5JH7E 1IJ6A 1YW0A 3ZN0B 2N9DA 4DVDA 1U5PA 2KXPB 4O2AE 4ADZA 3HKCE 3K3OA 5KDMC 4EIWA 3KBTA 1WR6A 2MOZA 3MK7C 3CX8B 2PFVA 4HN9A 5A1LA 3WAJA 2NW7A 4HFVA 3SS1A 2I59A 2KWIB 3O9XA 4QWNB 4IE4A 2PBIA 2LE8A 3H3AA 4GIWA 3V5UA 3MJXA 4C90A 2B1EA 2QA7A 2LEHA 5FXWA 4AQFA 2CE7A 3RPUA 2Q9QD 3J9X1 3WI3A 1VRBA 2ZLYA 4U74A 2GK9A 3QUJA 2NOXA 3Q9DA 2Y48B 4PNIA 3J7Yq 1S35A 3MACA 5L3BB 2KZ7B 5HYAA 3NRXA 2UXNB 5L2LA 1MMGA 2LOPA 4OYKA 3ZMVB 3N9PA 4JLEA 5DQWA 2LSGA 3CMLA 4CI3B 5F3JA 4UF0A 4P0BA 1BR0A 2ES0A 3AAIA 4UXNB 3A5XA 3RKOA 3ZYKA 3HR0A 3LBXB 3P8CD 5CB4E 5HXSA 4OHFA 2VL8A 3IHRA 3UTKA 3S4UA 1ZV4X 3LK42 5LG4A 4WNKA 4E7SA 2NW8A 3Q5WA 2CCQA 1G8XA 2E9XB 2M67A 3OKQA 2BDEA 3RYHE 5JDMA 2D0UA 5DQVA 1WYCA 4X20E 4QX8B 1V9DA 5L3EB 5F8PA 3C4XA 3WAKA 5LP6E 4IE7A 3BQLA 5J2TE 3U78A 3BK9A 4QXCB 1D1CA 5FP3A 3H37A 1G73A 2K9AA 3K3NA 3L09A 1UX5A 2PG8A 2V7MA 3I9YA 3RYIE 4AI6A 3ESLA 4N78D 1ZEEA 4O4IE 3CX6B 3FB2A 3ZEFB 3DTOA 2LSKA 3ZYLA 2EHOB 2WAUA 3PUGA 2KWHA 4PJLA 3DJBA 3O1JA 4YLHA 1BR1A 3ETUA 5JR9A 2CM0A 4DMWA 1T98A 1B7TA 2W62A 2CXDA 4ZOLE 3HKEE 5IHYA 3ZJ1A 4DO0A 2NWBA 2HH7A 3ZPOA 2KLQA 4KP3C 3VKHA 3KINB 2N1GA 3PUSA 5J1GA 3KV9A 3O1HA 3HKBE 2K48A 2C5IT 1D0ZA 4GYSA 4NUVA 4EZHA 1US7B 4JEHB 3ONXA 5JDFA 4A56A 3E22E 1WLXA 1E1HB 4K0UA 4HGAA 3F2EA 4UV9B 3OYXA 1HX8A 4X1IE 5LOVE 2YK0A 5JVDE 1MMAA 2Z6EA 3KFWX 4GK5E 2X67A 5LGTB 1D1BA 4PK6A 2ZM2A 2WBLA 3AA1B 3C64A 3EUHA 1H7CA 5ETWA 4CXXA 1HTJF 5M4YA 4L0RA 4CQIA 3OBVE 3SWHA 5FMNA 3C4ZA 4V1Av 5AFUL 4TV8E 2IC9A 4YJ3E 3VHLA 3B57A 4ZI2D 2CLYB 5JREA 2WWUA 2ZM8A 3L3PA 2CWYA 4PK4A 4PK5A 2E8IA 2D5UA 4NUUA 4OYJA 3PUAA 2VKJA 3R6NA 3LK2B 2JPFA 3LBXA 5BMVE 3VKGA 2DWKA 5GONE 2WMNA 4WBOA 3LFMA 1IZNB 2RA1A 3Q5XA 4YJ2E 4XBFB 2LHNA 4QX7B 3GMIA 1HCIA 5LBMA 5LJNA 1MMNA 1S94A 3RH3A 2V1DB 4TZ4C 4EYYR 1SHZC 4YHJA 4C91A 5EZYE 2E9XA 5L3GB 1HG2A 5HWXA 4HKAA 4O4LE 3SRZA 1FEWA 4BJMA 5LGUB 3RYFE 5LHHB 2XTLA 1OXZA 3LJCA 3PU3A 2Q9QC 3TKLB 3GN5B 4CXWA 4P09A 4UVCB 2XQYA 1YD8G 3EVYA 4OFZA 3O1IA 4MBQA 3UUXB 3AVRA 2X68A 3CX7B 4EXTA 3RRCA 4O8SA 3LG7A 1IAPA 3PURA 4X1KE 3O4XE 3K3QC 2L8KA 4I43B 4AKRB 5JDLA 2V7IA 3E08A 2JRKA 5FY7A 4ERRA 5FXZA 2XAQB 1BR2A 3JC6D 4YFSA 3ANWB 3AA0B 1EZ3A 1WRDA 2D0TA 2YEVC 2EHOA 4GYRA 5EK4A 5FY1A 3BQKA 1MNDA 3ZN1B 2VKOA 3ZLIA 4ZS3A 3CKDA 2Q9QB 4QKNA 3NZQA 5FNVE 2IC6A 3N9OA 2LOSA 5C8YE 2E9XD 2WSSV 4CXYA 2JJ9A 3RC3A 3N9MA 2DCFA 4H63V 5CA0E 3KV6A 4EYUA 2YU1A 4H9PC 4EZ4A 4AQFC 3MXZA 2LM9A 2XAFB 4F6RC 4CZZB 3PUQA 2J1DG 3CWZB 4I50E 2W00A 5FYMA 4L5GA 2MBGA 3FBLA 3P7IA 3UT5E 1LRZA 3UULA 4DNDA 5L3DB 4UV8B 3N9NA 2RP4A 4I55E 3OYZA 4EOZB 4PW8A 2XUEA 3ZMTB 3GWHA 2XAGB 2CXLA 1FMWA 4PFPA 1FMVA 5DABA 4GOUA 3GA8A 3SOLA 3FXDB 2V7JA 4PAGA 2SPCA 5H6QB 3K8PC 2EHOD 3AAAB 4ZI3D 3AB3B 3W15B 1HS7A 3N9QA 4PJMA 4UIGA 1O3XA 4UVAB 4HTEA 1UCUA 4KMCA 4IE6A 2DLRA 2JQQA 2ACXA 4OK0A 3U3IA 2CXFA 2L3LA 5HXRA 2QGSA 2LSYA 3T8OA 4BA9A 1YKHB 2A3DA 3AVSA 5LYJE 4ISTA 1D0XA 4IE5A 3PE0A 1MMDA 2W0GA 3LK3B 4IIJE 2A72A 2H7VC 4M1PA 4Z8XA 2LJLA 3CPZA 3VU7H 4BAYB 4MALA 4WBNE 3ETVA 1MNEA 2UXXB 2C5KT 4ZI2C 4H9OC 1D0YA 2LHRA 2W61A 4IE0A 1D1AA 3QK6A 4I4TE 2V26A 3ZJ2A 5JR9C 2HPLA 5JQGE 4ILUA 5L3CB 3RRWA 2G0UA 3F31A 5CA1E 5KX5E 2H7OA 2X66A 2Y6XA 2IW5B 4AKGA 3RX6A 3UFEA 3BQIA 2DI4A 2BVLA 2L9QA 1HF8A 5L3FB 4DBRA 4O4JE 1YKEB 3ZMSB 3MA9A 3FHNA 1IJ5A 3C51A 2OA5A 2PJQA 5LHIB 3N2OA 3V5SA 3UUMA 2JMHA 3KV4A 4XZCA 3PTRB 2H3RA 2WM9A 3F57A 3R84B 5J2UE 3ZC0A 3CQGB 2N2NA 3ZMZB 4TUYE 2W63A 4PJJA 3ZC1A 3IEEA 4U72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q9Q B;  2EHO A;  2EHO B;  3JC6 D;  2E9X A;  3ANW A;  2Q9Q C;  2E9X D; 
#chains in the Genus database with same CATH topology
 2NW9 A;  2DL1 A;  3HI2 A;  3NBX X;  2WB5 A;  4UVB B;  5ABF A;  2LSI A;  4AIU A;  3RIU A;  4GKJ T;  3AE9 A;  2CWO A;  2BZB A;  2K5B B;  2J62 A;  3I0O A;  4GK0 E;  4QXH B;  5FXX A;  3AE3 A;  2E9X C;  2VK9 A;  4J2C A;  5LBQ B;  2XPK A;  5L4E A;  4LF4 T;  5J0Z A;  2HN1 A;  4B3S T;  4P0A A;  3B13 A;  4DV1 T;  4PFO A;  2Y8D A;  2VVS A;  3VRA A;  5CJ5 A;  2WZI A;  2KSR A;  4U33 A;  1J5E T;  1LVK A;  5TAO A;  2HN2 A;  2W66 A;  3AEE A;  2XJ7 A;  2EHO C;  4BJN A;  5HXE A;  4ZI3 C;  1NAF A;  1QSD A;  2JQH A;  5IYZ E;  2ZMA A;  3KDS E;  3RF1 A;  3M3Z B;  3AE7 A;  4AXP A;  4KHP T;  2HHH T;  4IT4 A;  3IBP A;  4UF0 B;  3C4W A;  4EAH A;  4H9N C;  1KNR A;  4DUZ T;  4E7Z A;  3CQX C;  3GN5 A;  4HE8 A;  4LF9 T;  5JTG A;  3QC9 A;  2XQ8 A;  1HG5 A;  3JCF A;  2VWA A;  1QUU A;  3ABV A;  5LGN B;  4X1Y E;  3P4S A;  3HKD E;  2WMO A;  2IML A;  5LG3 A;  4ASK A;  4UEL A;  2C5J A;  1XDO A;  2W67 A;  2LM2 A;  4LMK A;  5AQK B;  3PDY A;  3C50 A;  4MFR A;  1XZY A;  2KT9 A;  4QHO A;  2P9B A;  3NZP A;  3ZN0 B;  4ADZ A;  2H88 A;  4LFA T;  4A5X A;  3MK7 C;  2KWI B;  3UU4 A;  5LMU T;  4DR5 T;  5AQV B;  1JNR A;  4CN1 A;  2Q9Q D;  2GK9 A;  3PUZ F;  3MAC A;  2CBI A;  2LOP A;  3ZMV B;  4DV7 T;  5F3J A;  1FJG T;  4P1N A;  4B3T T;  2VL8 A;  3IHR A;  5LG4 A;  1G8X A;  3OKQ A;  2D0U A;  5DQV A;  4ZZB A;  4QX8 B;  3LSV A;  3UUB A;  4QXC B;  4HWI B;  1UX5 A;  2PG8 A;  3RYI E;  1ZP0 A;  2NR4 A;  1XNR T;  4YLH A;  4EEB A;  5JR9 A;  2CM0 A;  2W62 A;  2IIU A;  3ZJ1 A;  3ZPO A;  4KP3 C;  3ZT6 A;  3O1H A;  3HKB E;  2K48 A;  4EZH A;  4NUV A;  4JEH B;  3AEG A;  5AQF B;  5JDF A;  4UV9 B;  4X1I E;  4HGA A;  1HX8 A;  5JVD E;  3P4R A;  4U3C A;  2ZM2 A;  4EV6 A;  1HTJ F;  3ZKR A;  4CQI A;  3SWH A;  4ILA A;  2XQ5 A;  5JRE A;  4YJ3 E;  4ZI2 D;  5FVK A;  2ZM8 A;  2WS3 A;  4PK5 A;  2E8I A;  4NUU A;  5AQG B;  3LBX A;  2DWK A;  5GON E;  3JAE A;  2JQ9 A;  4YTN A;  2RA1 A;  4XBF B;  4JBW F;  1HCI A;  5LJN A;  3EAB A;  2V1D B;  1SHZ C;  2E9X A;  5LGU B;  2XTL A;  3RQU A;  4CXW A;  1XNQ T;  3O1I A;  3UUX B;  3CX7 B;  3RRC A;  3PUR A;  1YXR A;  3K3Q C;  1N34 T;  4HWH A;  1KFY A;  4ERR A;  4YFS A;  3ANW B;  2EHO A;  1J5W A;  3BQK A;  2CHN A;  4CN4 A;  3CKD A;  2Q9Q B;  5FNV E;  2LOS A;  4CXY A;  2JJ9 A;  3RC3 A;  4H63 V;  4AQF C;  3MXZ A;  3CWZ B;  3NKZ A;  4YT0 A;  3P7I A;  5L3D B;  2XQ9 A;  1GQE A;  2XAG B;  1FMV A;  3GA8 A;  3FXD B;  2W2U A;  5AQO B;  2YDS A;  3AAA B;  2AXD S;  4CN6 A;  4HTE A;  4KMC A;  4TWH A;  4YSZ A;  5AQQ B;  4EGW A;  4OK0 A;  2LSY A;  1YKH B;  3AEA A;  5ABG A;  2W0G A;  4IIJ E;  4JI3 T;  2A72 A;  2H7V C;  2LJL A;  1UUS A;  4MAL A;  4WBN E;  3ETV A;  2IUB A;  2UXX B;  4LFB T;  4I4T E;  5HEG A;  2V26 A;  3ZJ2 A;  4ILU A;  3RRW A;  4X66 T;  3F31 A;  5CA1 E;  5KX5 E;  2H7O A;  2Y6X A;  3RX6 A;  1X9B A;  2DI4 A;  1M7K A;  3AE2 A;  3IA3 A;  1VCT A;  3ZMS B;  3C51 A;  2VUR A;  2VVN A;  3UUM A;  2BG9 B;  2BKN A;  4IDP A;  3R84 B;  2WM9 A;  3ZC0 A;  3ZMZ B;  4JI0 T;  3IEE A;  2FJD A;  2FJA A;  1X79 A;  3KVA A;  1VOM A;  4ANJ A;  1FIO A;  3OTO T;  5HWY A;  1SA0 E;  1UX4 A;  2ODU A;  4MHC A;  4H63 H;  2DNX A;  1MIV A;  3AEB A;  5AQT B;  4DMV A;  4HFC A;  2XAJ B;  3EHZ A;  2X51 A;  4IDZ A;  4ZS2 A;  4UEM A;  4YSY A;  5JDN A;  4Q25 A;  5HXH A;  4TX5 A;  3AA7 B;  3HA4 A;  1KNZ A;  4HFI A;  3VR9 A;  3VR8 A;  2D2S A;  2IAK A;  2V8S V;  5H6R B;  5HAX A;  2X0L B;  5L47 A;  3RLF F;  2CA5 A;  3CVR A;  2YOE A;  2YN6 A;  3MZK B;  4O2B E;  1UK5 A;  3N2G E;  1UGO A;  5IUX A;  2MTQ A;  2XZE A;  5DJQ C;  4JI2 T;  2V6Y B;  3AE1 A;  1ZHC A;  3EDV A;  2M6I A;  2LT3 A;  1WCR A;  4YTM A;  2X9X A;  4TV9 E;  4DBQ A;  2IDO B;  3FZK B;  2YIN A;  2VKD A;  5CFB A;  2UU9 T;  3PUW F;  2WDV A;  5FY0 A;  5HXC A;  5ADX L;  1NWM X;  2C0S A;  2UXC T;  4O4H E;  5AQJ B;  3A8Y C;  4U2Z A;  3T1Y T;  4AKH A;  3ZCJ A;  3EAM A;  3MKD A;  2ODV A;  3AA6 B;  3UUN A;  3FBZ A;  4WW0 A;  2MYS A;  2X9W A;  3N9L A;  1U4Q A;  4G63 A;  3JAF A;  4MLK A;  4Z91 A;  3OPC A;  1IJ6 A;  1U5P A;  1JNZ A;  3HKC E;  4YHH T;  3KBT A;  1WR6 A;  2MOZ A;  5AQL B;  1DU2 A;  3CX8 B;  5A1L A;  3WAJ A;  2XQ6 A;  3SS1 A;  3ONJ A;  3H3A A;  2FJE A;  5HEJ A;  4TNV A;  4AQF A;  3RPU A;  2VQE T;  3J9X 1;  3WI3 A;  4PNI A;  2Y48 B;  4TWD A;  5L3B B;  3NRX A;  2LKH A;  2UXN B;  5L2L A;  1MMG A;  4JLE A;  4CI3 B;  2X0H A;  4UF0 A;  1IBL T;  2ES0 A;  3UU8 A;  4HWC A;  3SFE A;  1E7P A;  3ZYK A;  3P8C D;  5CB4 E;  1QLB A;  5HXS A;  1E2A A;  4OHF A;  4UR9 A;  5AQP B;  1ZV4 X;  3Q5W A;  2CCQ A;  2M67 A;  2WY2 A;  2BDE A;  3RYH E;  1WYC A;  3RIA A;  3AE5 A;  5F8P A;  5ABF B;  2WP9 A;  1SUM B;  5FP3 A;  2K9A A;  3SFD A;  3X1D A;  3L8R A;  5AQI B;  3UQ7 A;  2LSK A;  3ZYL A;  3PUG A;  2JIW A;  3O1J A;  1BR1 A;  3ETU A;  3AE6 A;  2CXD A;  4ZOL E;  4EED A;  2NWB A;  2HH7 A;  3PUS A;  2LRL A;  2V5C A;  2C5I T;  1D0Z A;  1US7 B;  3PUX F;  3E22 E;  3OYX A;  1MMA A;  4PK6 A;  2WBL A;  3EUH A;  2BG9 C;  1H7C A;  2K3W A;  2I0M A;  3RHW A;  5ETW A;  3FZF B;  4CXX A;  4HWF A;  3C4Z A;  1KF6 A;  2IC9 A;  3VHL A;  2CLY B;  4HFD A;  2WWU A;  2FBW A;  1WR0 A;  4PK4 A;  4OYJ A;  4KI0 F;  2BBJ A;  3R6N A;  2JPF A;  2WMN A;  4WBO A;  2YDR A;  1CHU A;  4QX7 B;  2J4G A;  2VQF T;  3EI0 A;  4EYY R;  1T8B A;  4YHJ A;  4C91 A;  4JI4 T;  4O4L E;  2RPA A;  3RYF E;  5LHH B;  1OXZ A;  5LB7 B;  3GN5 B;  2F4V T;  1YD8 G;  3AVR A;  2X68 A;  4EXT A;  5HCM A;  3O4X E;  4AKR B;  5FY7 A;  3AA0 B;  3NWI A;  2D0T A;  2YEV C;  4GYR A;  5EK4 A;  3ZN1 B;  2WQY A;  1YQ4 A;  4QKN A;  2IC6 A;  5C8Y E;  2E9X D;  2WSS V;  3N9M A;  5CA0 E;  4EYU A;  4ZEY A;  4H9P C;  3AXJ B;  4CZZ B;  4WZX A;  5FYM A;  4L5G A;  3TLV A;  2MBG A;  2MAW A;  1R8I A;  1LRZ A;  5FKY A;  3N9N A;  4LFC T;  3OYZ A;  2XUE A;  3GWH A;  4DV5 T;  4PFP A;  2CXL A;  5DAB A;  4PAG A;  2SPC A;  3TLT A;  2EHO D;  1HR0 T;  2LLY A;  4ZI3 D;  3AB3 B;  2YKS A;  4X5T A;  4UIG A;  1O3X A;  4UVA B;  1IBK T;  3G06 A;  1UCU A;  2M6B A;  2DLR A;  4IE6 A;  2BS2 A;  1W09 A;  3ZT5 A;  3U3I A;  2L3L A;  3ZST A;  5AQM B;  2QGS A;  3T8O A;  3AVS A;  4IST A;  1D0X A;  4HFB A;  1W0A A;  4M1P A;  4Z8X A;  3CPZ A;  3JAD A;  2MPK A;  1MNE A;  4DV0 T;  5HCJ A;  2LHR A;  4IE0 A;  1D1A A;  3QK6 A;  4LMJ A;  2V6X A;  2X66 A;  1HX1 B;  3UFE A;  2BVL A;  4JYA T;  1YKE B;  4DV4 T;  4LF7 T;  5LHI B;  3N2O A;  3V5S A;  1I6Z A;  3KV4 A;  2H3R A;  2N2N A;  4BJM A;  5JR9 B;  1NEK A;  1XDP A;  5LNK A;  4H9S E;  3KBU A;  3Q2M A;  3JC6 C;  5EK3 A;  1KEY A;  5AQU B;  4DR6 T;  5JDH A;  5LHG B;  1AJ3 A;  1MIW A;  4ZI7 E;  4OX9 T;  2KND A;  4NPP A;  5JRC B;  3EDU A;  2CBJ A;  2X9H A;  3RIF A;  4DV6 T;  3RYC E;  5LXT E;  4DR2 T;  3I9W A;  3I1A A;  4KUM B;  5JDQ A;  3N2K E;  2A2F X;  3OJA A;  2VL0 A;  5CGM A;  3N5L A;  2ZM0 A;  4PJN A;  4JUY A;  2HPJ A;  3RC8 A;  1OWA A;  4CI2 B;  5HEH A;  3C98 B;  1Z0P A;  3P4Q A;  3QB5 K;  4HEA A;  3FZM B;  2BVM A;  4H9Q C;  2UUA T;  4EB6 E;  2BG9 E;  2BG9 A;  4IDN A;  4A97 A;  5FL0 A;  5LMN T;  2LRK A;  3PJA J;  4ISS A;  1HFA A;  3DP7 A;  2PTF A;  1Y64 B;  3FZH B;  2CLY C;  4TN7 B;  5E0O A;  1ZKE A;  4KBM B;  4LML A;  2XY8 B;  4QXB B;  4IDQ A;  3TLW A;  4AQG A;  4AKL A;  4XAX B;  2XAS B;  5EK2 A;  2BKO A;  1HNX T;  2DHR A;  2QYW A;  5JDG A;  3UFG A;  1OED B;  2CEA A;  4YSX A;  5LCY A;  2N9D A;  2KXP B;  3K3O A;  4HN9 A;  2PFV A;  2NW7 A;  3O9X A;  4QWN B;  4GIW A;  3V5U A;  2B1E A;  5FXW A;  1HNZ T;  2V6Y A;  3Q5E A;  2QVA A;  1VRB A;  3QUJ A;  3J7Y q;  4JI5 T;  5HYA A;  5FVL A;  3P4P A;  4OYK A;  5C2T A;  3N9P A;  3PJA A;  5DQW A;  2LSG A;  4ZZC A;  4P0B A;  1BR0 A;  3AAI A;  4UXN B;  2BS3 A;  3RKO A;  4WYV A;  4K0K T;  4U7Y A;  4DR7 T;  4ZXL A;  4WNK A;  4E7S A;  2NW8 A;  3QNU A;  5KXJ A;  3RQW A;  5L3E B;  3C4X A;  3VRB A;  4IE7 A;  3BQL A;  5J2T E;  3U78 A;  3B5M A;  3H37 A;  5ABE A;  3L09 A;  3I9Y A;  4B3M T;  3ESL A;  4N78 D;  3CX6 B;  3ZEF B;  3DTO A;  3QB5 A;  4PJL A;  4DMW A;  1B7T A;  3HKE E;  4DO0 A;  2KLQ A;  3VKH A;  5J1G A;  3KV9 A;  4GYS A;  4IL9 A;  2B76 A;  3QOF A;  4A56 A;  4COF A;  1E1H B;  3F2E A;  5LOV E;  1XWM A;  3KFW X;  4GK5 E;  1HNW T;  3C64 A;  2BKP A;  3OBV E;  1W0B A;  5FMN A;  3Q5D A;  4V1A v;  5AFU L;  3L3P A;  3LK2 B;  4JI6 T;  3CIR A;  1T7S A;  3VKG A;  1IZN B;  1MMN A;  1I94 T;  1IBM T;  5EZY E;  1W9R A;  3AE4 A;  1HG2 A;  1NEN A;  5HWX A;  4I0U A;  4HKA A;  3PU3 A;  1UUR A;  2Q9Q C;  3TKL B;  1WFD A;  4P09 A;  2XQ3 A;  4UVC B;  2XQY A;  3EVY A;  5L4H A;  3LG7 A;  1IAP A;  4ILC A;  4NIQ A;  2L8K A;  2V7I A;  3E08 A;  2XAQ B;  3LDQ B;  1WRD A;  1MND A;  3NZQ A;  5AQS B;  2XSA A;  2DCF A;  2YU1 A;  4AIS A;  4YXD A;  2LM9 A;  4F6R C;  3T1H T;  2CHO A;  4DV2 T;  4I50 E;  2W00 A;  3FBL A;  3UT5 E;  3UUL A;  4DND A;  4YY3 T;  1Z8U A;  4I55 E;  2ACZ A;  4LF8 T;  4EOZ B;  4PW8 A;  1KNP A;  4GOU A;  2BBH A;  5HEO A;  5H6Q B;  1HS7 A;  3N9Q A;  3UU6 A;  2JQQ A;  4JI8 T;  3UU3 A;  2ZM6 T;  2A3D A;  1MMD A;  3AEF A;  2C5K T;  2XM2 A;  4ZI2 C;  4H9O C;  1D0Y A;  2HPL A;  1OED C;  3RI5 A;  5JQG E;  3A7M A;  2G0U A;  2IW5 B;  4AKG A;  3BQI A;  2L9Q A;  5AQN B;  1HF8 A;  3FHN A;  3AEC A;  4XZC A;  2WCA A;  1L0V A;  3CQG B;  4TUY E;  2W63 A;  3AXJ A;  3ZC1 A;  4U72 A;  2VAS A;  2XAH B;  4DID B;  4HWD A;  2VKH A;  3D0T A;  4QH4 A;  3ZCI A;  4CI1 B;  4H9R C;  4FI5 A;  3ZMU B;  1ZOY A;  1KK7 A;  3TLU A;  3NRY A;  4B6X A;  1M62 A;  5FXV A;  4AKI A;  4FJO A;  2KIN B;  1XMO T;  4YTP A;  2A9U A;  5ABH A;  5FL1 A;  2X9Y A;  4X65 T;  3CQC B;  2CMR A;  4G2A A;  3IF8 B;  1CUN A;  1WYB A;  3FXE B;  2K24 A;  2WU5 A;  3CK6 A;  2KMF A;  4HFH A;  4QH1 A;  2YU2 A;  3ZYM A;  2V7K A;  1N32 T;  2JMK A;  1LVF A;  3PU8 A;  3ZT7 A;  3AAE B;  3M65 A;  3HL6 A;  3H3M A;  1LKX A;  2V7L A;  4IHJ E;  4TNW A;  3KVB A;  3E0Z A;  2VB6 A;  1MIY A;  2LSJ A;  2QRX A;  5LJM A;  1BR4 A;  2IHR 1;  3RGL A;  2XHE B;  3I0Q A;  3ANW A;  2NP9 A;  2NTY A;  3P50 A;  5KMG P;  2H89 A;  3UU5 A;  4HFE A;  3OVU A;  2Q9Q A;  3KV5 A;  5JRC A;  2I6H A;  4JEU B;  4U2Y A;  4ZHQ E;  4L9I A;  2DWG A;  4IGU A;  2NTX A;  2JQK A;  5JH7 E;  5LA6 E;  1YW0 A;  4DVD A;  4O2A E;  5KDM C;  4EIW A;  2OV9 A;  4HFV A;  3ZSS A;  2I59 A;  4IE4 A;  2PBI A;  2LE8 A;  3MJX A;  4C90 A;  2QA7 A;  2LEH A;  5AQR B;  1VCS A;  2CE7 A;  4JV5 T;  4AQY T;  2ZLY A;  4U74 A;  4LF5 T;  2NOX A;  3Q9D A;  1S35 A;  2KZ7 B;  4KX6 A;  3AED A;  3CML A;  3ONL C;  4A98 A;  3RIU C;  2WZH A;  3A5X A;  3HR0 A;  3LBX B;  3PUY F;  3L39 A;  2XQ4 A;  4DUY T;  3UTK A;  3S4U A;  1XMQ T;  3LK4 2;  2AE9 A;  2E9X B;  1N33 T;  5JDM A;  1SE7 A;  4X20 E;  1V9D A;  3WAK A;  5LP6 E;  4B3R T;  3BK9 A;  1D1C A;  1G73 A;  2FUP A;  3K3N A;  4ILB A;  2V7M A;  4AI6 A;  1J1J A;  1ZEE A;  4O4I E;  3FB2 A;  2XSB A;  2EHO B;  2WAU A;  2WU2 A;  2KWH A;  2UUC T;  3DJB A;  1OED E;  4DV3 T;  1T98 A;  1OED A;  2WDR A;  5IHY A;  3KIN B;  2N1G A;  4DR4 T;  3ONX A;  1WLX A;  4K0U A;  1Y01 A;  2CPT A;  2YK0 A;  2XQA A;  2Z6E A;  4U31 A;  2X67 A;  5LGT B;  1D1B A;  3AA1 B;  4Z90 A;  2UUB T;  5M4Y A;  4L0R A;  5HEU A;  4IRE A;  4TV8 E;  1T72 A;  3B57 A;  1N36 T;  2CWY A;  2D5U A;  2BS4 A;  3PUA A;  2VKJ A;  5BMV E;  2LKG A;  4DR1 T;  2WWV A;  3LFM A;  4X64 T;  3Q5X A;  4YJ2 E;  2LHN A;  3GMI A;  5LBM A;  1S94 A;  3RH3 A;  4TZ4 C;  5L3G B;  4F8H A;  4IDO A;  3AE8 A;  2UXD T;  3SRZ A;  1FEW A;  3LJC A;  3PV0 F;  4JI7 T;  2XM1 A;  4OFZ A;  4MBQ A;  3RKG A;  4O8S A;  4X1K E;  3NVO A;  4I43 B;  5JDL A;  2JRK A;  5FXZ A;  1BR2 A;  3JC6 D;  1EZ3 A;  2OLT A;  5FY1 A;  2VKO A;  3ZLI A;  4ZS3 A;  4QH5 A;  3N9O A;  2WDQ A;  2X0Y A;  3KV6 A;  4EZ4 A;  3PUV F;  2E5V A;  2XAF B;  4U7I A;  3PUQ A;  2J1D G;  2E5L T;  1YQ3 A;  4UV8 B;  2RP4 A;  3P4W A;  3ZMT B;  2D9D A;  1FMW A;  4IL4 A;  3SOL A;  2V7J A;  3K8P C;  4NXN T;  3W15 B;  4PJM A;  4JI1 T;  2W4X A;  2R6G F;  2XQ7 A;  2ACX A;  4X62 T;  2CXF A;  5HXR A;  4BA9 A;  2J47 A;  5LYJ E;  4IE5 A;  3PE0 A;  3LK3 B;  4NXM T;  2UXB T;  3VU7 H;  4BAY B;  5C3J A;  3TLS A;  2W61 A;  5JR9 C;  2FJB A;  5L3C B;  2V5D A;  4KHZ F;  4TWF A;  2YDQ A;  5BR8 T;  2CRB A;  3UQ4 A;  4GKK T;  2E2A A;  5L3F B;  4DBR A;  4O4J E;  3MA9 A;  5AQH B;  1IJ5 A;  2OA5 A;  2PJQ A;  3FZL B;  2JMH A;  3PTR B;  3F57 A;  5IWA T;  4LF6 T;  3K1S A;  5J2U E;  4DR3 T;  5F5W A;  4PJJ A; 
#chains in the Genus database with same CATH homology
 2NW9 A;  2VAS A;  2XAH B;  5JR9 B;  3HI2 A;  3NBX X;  1X79 A;  4UVB B;  2LSI A;  3KVA A;  5LNK A;  1VOM A;  4ANJ A;  1FIO A;  2VKH A;  3D0T A;  4H9S E;  2CWO A;  3KBU A;  1SA0 E;  5HWY A;  1UX4 A;  2ODU A;  4MHC A;  3ZCI A;  4CI1 B;  3Q2M A;  3JC6 C;  2BZB A;  2DNX A;  4FI5 A;  4H63 H;  4H9R C;  1MIV A;  5EK3 A;  3ZMU B;  2K5B B;  4DMV A;  2XAJ B;  1KK7 A;  2X51 A;  5JDH A;  4IDZ A;  5LHG B;  4ZS2 A;  3I0O A;  4UEM A;  3NRY A;  4GK0 E;  1AJ3 A;  4B6X A;  1MIW A;  4ZI7 E;  4QXH B;  5FXX A;  2E9X C;  5JDN A;  5HXH A;  2VK9 A;  4TX5 A;  3AA7 B;  2KND A;  3HA4 A;  1KNZ A;  5JRC B;  4J2C A;  2D2S A;  2IAK A;  5LBQ B;  5H6R B;  3EDU A;  5HAX A;  2X0L B;  2X9H A;  5FXV A;  4AKI A;  4FJO A;  2KIN B;  2CA5 A;  3CVR A;  3B13 A;  3RYC E;  4P0A A;  4PFO A;  5LXT E;  2X9Y A;  2Y8D A;  3I9W A;  3I1A A;  3MZK B;  4KUM B;  4O2B E;  5JDQ A;  3N2G E;  3CQC B;  3N2K E;  2CMR A;  4G2A A;  1LVK A;  3IF8 B;  5TAO A;  2MTQ A;  2A2F X;  3OJA A;  3N5L A;  1CUN A;  2ZM0 A;  2EHO C;  4PJN A;  4BJN A;  4JUY A;  2HPJ A;  5HXE A;  1WYB A;  3FXE B;  2K24 A;  4ZI3 C;  1NAF A;  5DJQ C;  3RC8 A;  1QSD A;  2KMF A;  1OWA A;  5IYZ E;  4CI2 B;  1ZHC A;  2ZMA A;  2YU2 A;  3ZYM A;  3C98 B;  1Z0P A;  3EDV A;  3KDS E;  2V7K A;  2JMK A;  4HEA A;  2BVM A;  2LT3 A;  4AXP A;  4H9Q C;  2X9X A;  4TV9 E;  4DBQ A;  4EB6 E;  1LVF A;  3PU8 A;  3IBP A;  3AAE B;  3M65 A;  4UF0 B;  2YIN A;  2VKD A;  3C4W A;  4EAH A;  3HL6 A;  4H9N C;  5FY0 A;  4E7Z A;  3CQX C;  1LKX A;  5HXC A;  2V7L A;  3GN5 A;  4IHJ E;  5ADX L;  1NWM X;  2C0S A;  4HE8 A;  4ISS A;  3KVB A;  1HFA A;  3QC9 A;  3E0Z A;  4O4H E;  2VB6 A;  1MIY A;  2LSJ A;  1HG5 A;  5LJM A;  3DP7 A;  1Y64 B;  2VWA A;  4TN7 B;  1BR4 A;  2CLY C;  5E0O A;  1QUU A;  5LGN B;  4X1Y E;  1ZKE A;  3HKD E;  4AKH A;  3ZCJ A;  4KBM B;  2XHE B;  2WMO A;  3I0Q A;  3ANW A;  2NP9 A;  4QXB B;  2NTY A;  3MKD A;  2ODV A;  3AA6 B;  3UUN A;  5KMG P;  3FBZ A;  4ASK A;  4UEL A;  4WW0 A;  4AQG A;  2C5J A;  2Q9Q A;  4AKL A;  4XAX B;  2XAS B;  2MYS A;  2X9W A;  3KV5 A;  5JRC A;  5EK2 A;  3N9L A;  4JEU B;  4ZHQ E;  1U4Q A;  4G63 A;  2DHR A;  3C50 A;  3PDY A;  5JDG A;  4MFR A;  2KT9 A;  2DWG A;  4L9I A;  4IGU A;  4MLK A;  2NTX A;  4QHO A;  2CEA A;  2P9B A;  3NZP A;  5LA6 E;  5LCY A;  5JH7 E;  1IJ6 A;  1YW0 A;  3ZN0 B;  2N9D A;  4DVD A;  1U5P A;  2KXP B;  4O2A E;  4ADZ A;  3HKC E;  3K3O A;  5KDM C;  4EIW A;  3KBT A;  1WR6 A;  2MOZ A;  3MK7 C;  3CX8 B;  2PFV A;  4HN9 A;  5A1L A;  3WAJ A;  2NW7 A;  4HFV A;  3SS1 A;  2I59 A;  2KWI B;  3O9X A;  4QWN B;  4IE4 A;  2PBI A;  2LE8 A;  3H3A A;  4GIW A;  3V5U A;  3MJX A;  4C90 A;  2B1E A;  2QA7 A;  2LEH A;  5FXW A;  4AQF A;  2CE7 A;  3RPU A;  2Q9Q D;  3J9X 1;  3WI3 A;  1VRB A;  2ZLY A;  4U74 A;  2GK9 A;  3QUJ A;  2NOX A;  3Q9D A;  2Y48 B;  4PNI A;  3J7Y q;  1S35 A;  3MAC A;  5L3B B;  2KZ7 B;  5HYA A;  3NRX A;  2UXN B;  5L2L A;  1MMG A;  2LOP A;  4OYK A;  3ZMV B;  3N9P A;  4JLE A;  5DQW A;  2LSG A;  3CML A;  4CI3 B;  5F3J A;  4UF0 A;  4P0B A;  1BR0 A;  2ES0 A;  3AAI A;  4UXN B;  3A5X A;  3RKO A;  3ZYK A;  3HR0 A;  3LBX B;  3P8C D;  5CB4 E;  5HXS A;  4OHF A;  2VL8 A;  3IHR A;  3UTK A;  3S4U A;  1ZV4 X;  3LK4 2;  5LG4 A;  4WNK A;  4E7S A;  2NW8 A;  3Q5W A;  2CCQ A;  1G8X A;  2E9X B;  2M67 A;  3OKQ A;  2BDE A;  3RYH E;  5JDM A;  2D0U A;  5DQV A;  1WYC A;  4X20 E;  4QX8 B;  1V9D A;  5L3E B;  5F8P A;  3C4X A;  3WAK A;  5LP6 E;  4IE7 A;  3BQL A;  5J2T E;  3U78 A;  3BK9 A;  4QXC B;  1D1C A;  5FP3 A;  3H37 A;  1G73 A;  2K9A A;  3K3N A;  3L09 A;  1UX5 A;  2PG8 A;  2V7M A;  3I9Y A;  3RYI E;  4AI6 A;  3ESL A;  4N78 D;  1ZEE A;  4O4I E;  3CX6 B;  3FB2 A;  3ZEF B;  3DTO A;  2LSK A;  3ZYL A;  2EHO B;  2WAU A;  3PUG A;  2KWH A;  4PJL A;  3DJB A;  3O1J A;  4YLH A;  1BR1 A;  3ETU A;  5JR9 A;  2CM0 A;  4DMW A;  1T98 A;  1B7T A;  2W62 A;  2CXD A;  4ZOL E;  3HKE E;  5IHY A;  3ZJ1 A;  4DO0 A;  2NWB A;  2HH7 A;  3ZPO A;  2KLQ A;  4KP3 C;  3VKH A;  3KIN B;  2N1G A;  3PUS A;  5J1G A;  3KV9 A;  3O1H A;  3HKB E;  2K48 A;  2C5I T;  1D0Z A;  4GYS A;  4NUV A;  4EZH A;  1US7 B;  4JEH B;  3ONX A;  5JDF A;  4A56 A;  3E22 E;  1WLX A;  1E1H B;  4K0U A;  4HGA A;  3F2E A;  4UV9 B;  3OYX A;  1HX8 A;  4X1I E;  5LOV E;  2YK0 A;  5JVD E;  1MMA A;  2Z6E A;  3KFW X;  4GK5 E;  2X67 A;  5LGT B;  1D1B A;  4PK6 A;  2ZM2 A;  2WBL A;  3AA1 B;  3C64 A;  3EUH A;  1H7C A;  5ETW A;  4CXX A;  1HTJ F;  5M4Y A;  4L0R A;  4CQI A;  3OBV E;  3SWH A;  5FMN A;  3C4Z A;  4V1A v;  5AFU L;  4TV8 E;  2IC9 A;  4YJ3 E;  3VHL A;  3B57 A;  4ZI2 D;  2CLY B;  5JRE A;  2WWU A;  2ZM8 A;  3L3P A;  2CWY A;  4PK4 A;  4PK5 A;  2E8I A;  2D5U A;  4NUU A;  4OYJ A;  3PUA A;  2VKJ A;  3R6N A;  3LK2 B;  2JPF A;  3LBX A;  5BMV E;  3VKG A;  2DWK A;  5GON E;  2WMN A;  4WBO A;  3LFM A;  1IZN B;  2RA1 A;  3Q5X A;  4YJ2 E;  4XBF B;  2LHN A;  4QX7 B;  3GMI A;  1HCI A;  5LBM A;  5LJN A;  1MMN A;  1S94 A;  3RH3 A;  2V1D B;  4TZ4 C;  4EYY R;  1SHZ C;  4YHJ A;  4C91 A;  5EZY E;  2E9X A;  5L3G B;  1HG2 A;  5HWX A;  4HKA A;  4O4L E;  3SRZ A;  1FEW A;  4BJM A;  5LGU B;  3RYF E;  5LHH B;  2XTL A;  1OXZ A;  3LJC A;  3PU3 A;  2Q9Q C;  3TKL B;  3GN5 B;  4CXW A;  4P09 A;  4UVC B;  2XQY A;  1YD8 G;  3EVY A;  4OFZ A;  3O1I A;  4MBQ A;  3UUX B;  3AVR A;  2X68 A;  3CX7 B;  4EXT A;  3RRC A;  4O8S A;  3LG7 A;  1IAP A;  3PUR A;  4X1K E;  3O4X E;  3K3Q C;  2L8K A;  4I43 B;  4AKR B;  5JDL A;  2V7I A;  3E08 A;  2JRK A;  5FY7 A;  4ERR A;  5FXZ A;  2XAQ B;  1BR2 A;  3JC6 D;  4YFS A;  3ANW B;  3AA0 B;  1EZ3 A;  1WRD A;  2D0T A;  2YEV C;  2EHO A;  4GYR A;  5EK4 A;  5FY1 A;  3BQK A;  1MND A;  3ZN1 B;  2VKO A;  3ZLI A;  4ZS3 A;  3CKD A;  2Q9Q B;  4QKN A;  3NZQ A;  5FNV E;  2IC6 A;  3N9O A;  2LOS A;  5C8Y E;  2E9X D;  2WSS V;  4CXY A;  2JJ9 A;  3RC3 A;  3N9M A;  2DCF A;  4H63 V;  5CA0 E;  3KV6 A;  4EYU A;  2YU1 A;  4H9P C;  4EZ4 A;  4AQF C;  3MXZ A;  2LM9 A;  2XAF B;  4F6R C;  4CZZ B;  3PUQ A;  2J1D G;  3CWZ B;  4I50 E;  2W00 A;  5FYM A;  4L5G A;  2MBG A;  3FBL A;  3P7I A;  3UT5 E;  1LRZ A;  3UUL A;  4DND A;  5L3D B;  4UV8 B;  3N9N A;  2RP4 A;  4I55 E;  3OYZ A;  4EOZ B;  4PW8 A;  2XUE A;  3ZMT B;  3GWH A;  2XAG B;  2CXL A;  1FMW A;  4PFP A;  1FMV A;  5DAB A;  4GOU A;  3GA8 A;  3SOL A;  3FXD B;  2V7J A;  4PAG A;  2SPC A;  5H6Q B;  3K8P C;  2EHO D;  3AAA B;  4ZI3 D;  3AB3 B;  3W15 B;  1HS7 A;  3N9Q A;  4PJM A;  4UIG A;  1O3X A;  4UVA B;  4HTE A;  1UCU A;  4KMC A;  4IE6 A;  2DLR A;  2JQQ A;  2ACX A;  4OK0 A;  3U3I A;  2CXF A;  2L3L A;  5HXR A;  2QGS A;  2LSY A;  3T8O A;  4BA9 A;  1YKH B;  2A3D A;  3AVS A;  5LYJ E;  4IST A;  1D0X A;  4IE5 A;  3PE0 A;  1MMD A;  2W0G A;  3LK3 B;  4IIJ E;  2A72 A;  2H7V C;  4M1P A;  4Z8X A;  2LJL A;  3CPZ A;  3VU7 H;  4BAY B;  4MAL A;  4WBN E;  3ETV A;  1MNE A;  2UXX B;  2C5K T;  4ZI2 C;  4H9O C;  1D0Y A;  2LHR A;  2W61 A;  4IE0 A;  1D1A A;  3QK6 A;  4I4T E;  2V26 A;  3ZJ2 A;  5JR9 C;  2HPL A;  5JQG E;  4ILU A;  5L3C B;  3RRW A;  2G0U A;  3F31 A;  5CA1 E;  5KX5 E;  2H7O A;  2X66 A;  2Y6X A;  2IW5 B;  4AKG A;  3RX6 A;  3UFE A;  3BQI A;  2DI4 A;  2BVL A;  2L9Q A;  1HF8 A;  5L3F B;  4DBR A;  4O4J E;  1YKE B;  3ZMS B;  3MA9 A;  3FHN A;  1IJ5 A;  3C51 A;  2OA5 A;  2PJQ A;  5LHI B;  3N2O A;  3V5S A;  3UUM A;  2JMH A;  3KV4 A;  4XZC A;  3PTR B;  2H3R A;  2WM9 A;  3F57 A;  3R84 B;  5J2U E;  3ZC0 A;  3CQG B;  2N2N A;  3ZMZ B;  4TUY E;  2W63 A;  4PJJ A;  3ZC1 A;  3IEE A;  4U72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...