2Q9QC

The crystal structure of full length human gins complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
145
structure length
145
Chain Sequence
MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSILPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords DNA replication complex GINS protein PSF2
publication title Crystal structure of the GINS complex and functional insights into its role in DNA replication.
pubmed doi rcsb
source organism Homo sapiens
total genus 53
structure length 145
sequence length 145
chains with identical sequence G
ec nomenclature
pdb deposition date 2007-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1030 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2q9qC01
2EHOB 2Q9QC 3JC6D 2Q9QB 3ANWA 2E9XD 2EHOA 2E9XA
chains in the Genus database with same CATH superfamily
3O1JA 3VU7H 2Q9QB 4ADZA 3B5MA 2BKOA 4HWCA 5FY7A 2X51A 2XQ3A 2C5JA 3JAFA 4UEMA 3LBXA 2CHOA 2UXDT 4XZCA 2EHOA 2MAWA 2NTYA 1FIOA 1LKXA 2QGSA 3A8YC 3O4XE 1W9RA 5L4HA 5AQPB 1ZHCA 2A72A 4LMKA 4WBOA 3FXEB 2CWYA 4MALA 4JYAT 4OX9T 3PJAA 2V6XA 3I0QA 3ZC1A 4CI1B 2R6GF 3QB5A 4JI1T 2ZMAA 3AE5A 4IE4A 3AEBA 4JEHB 1O3XA 4OHFA 1J5WA 1W0BA 4BAYB 4ZHQE 4QX7B 4DV5T 4HWHA 2EHOC 1M7KA 3AE7A 5AFUL 5ABGA 4GKKT 1IAPA 2X9YA 2LT3A 3AA1B 3AE8A 2HH7A 4GYRA 5FY1A 4TWFA 2QA7A 3UU4A 5JH7E 2HN2A 5HWXA 2HPJA 3DTOA 1SUMB 5ABHA 4EZHA 3OBVE 2LSGA 1MMDA 5LG4A 4DVDA 3GA8A 5HCJA 3VRAA 4U3CA 2L3LA 3B57A 3QOFA 2KWIB 2XSBA 3AB3B 3T1YT 5FYMA 5FVLA 4U31A 4I55E 4IHJE 3OJAA 3EDUA 4EXTA 5HEGA 4ZEYA 2FUPA 2WWUA 2LOSA 2RPAA 4QX8B 2WB5A 2IC6A 5ABFB 4HFVA 1HNXT 2W00A 1I94T 4L9IA 2V1DB 5J1GA 2BKNA 3ZYMA 1UGOA 2H7VC 5JDLA 2WSSV 4ERRA 4ILCA 4KBMB 3A7MA 2NW7A 5A1LA 3Q5WA 2HHHT 2QYWA 1QUUA 1S35A 4ZI2D 4I50E 4U74A 4F8HA 1XDOA 2GK9A 4G2AA 4H9PC 3AXJB 4ISSA 3AE4A 1G73A 1KF6A 2B76A 1IJ6A 2NW9A 3RGLA 4X62T 1UUSA 3LDQB 1D1BA 4E7SA 2CLYC 5HXEA 2X0YA 4IGUA 2W0GA 5J0ZA 5JR9A 2K5BB 3CX6B 4CZZB 5F5WA 3TLWA 4K0UA 3NZQA 4AKRB 4LFCT 2B1EA 4IDNA 4TV9E 2CRBA 1V9DA 4EIWA 2WP9A 2BS3A 4JI6T 3H3MA 4H63V 4C90A 5LHIB 4PK6A 1KFYA 3ZT7A 5L3CB 4O4HE 5FXWA 2HPLA 3N9NA 2V5DA 1VCSA 4H9OC 3ZMUB 2FJEA 3PDYA 5HWYA 5JR9C 3AE9A 1IBKT 2XM1A 4ZZBA 3UTKA 3VR8A 5L3GB 3EVYA 2J47A 2V5CA 3ONLC 4UV8B 2Y48B 1T7SA 3RC8A 1Y64B 3P4WA 2I6HA 2PBIA 3ZLIA 2N2NA 4HKAA 2BG9A 2WU5A 1E1HB 2UUBT 3C64A 3O1IA 4IREA 3Q2MA 2VB6A 2BG9E 4OYKA 2D2SA 1E7PA 2XTLA 4UF0B 4JEUB 3K3QC 2YOEA 4DBQA 3E08A 1CHUA 3PUXF 4IE6A 4NPPA 4B3MT 3H37A 4EB6E 3N2GE 3RYCE 4WNKA 2BBJA 4YSYA 5IHYA 2VK9A 4IE7A 4QH5A 4IDOA 2BG9C 3VRBA 4AI6A 2DL1A 2CM0A 5LJMA 2JQHA 2XZEA 2LKGA 3I1AA 3TLUA 3PU3A 5JTGA 5AQUB 4HFEA 4TNWA 3P4QA 1WLXA 3UQ4A 5HAXA 3P4PA 4DNDA 2JQKA 2F4VT 3MJXA 1WYCA 5AQMB 3VR9A 3AVRA 1XNRT 2ZLYA 5LNKA 1X9BA 3SS1A 2XAGB 3NVOA 3D0TA 5M4YA 4HTEA 4QH4A 3GN5B 4X5TA 4DR2T 5AQVB 1D1CA 4Z91A 3Q5XA 2WU2A 2DWGA 3U78A 3TLVA 5BMVE 3ESLA 2OLTA 4H9QC 3AA7B 3IEEA 5KDMC 2PTFA 4GIWA 1X79A 3I0OA 2BS2A 3RYIE 2Q9QD 3KBUA 1N32T 4YJ3E 2KT9A 3HKDE 3RQWA 4B6XA 1KNZA 2UUAT 2XQ7A 1HR0T 1ZP0A 2CEAA 4TZ4C 2FBWA 5HYAA 3Q5DA 1J5ET 2X9WA 1UK5A 4WYVA 2YEVC 4YLHA 2ACZA 1HG5A 2BVMA 2SPCA 3HL6A 3AAAB 4L5GA 4EEBA 4UELA 1MIYA 4IE5A 1HX1B 2A2FX 3E22E 3A5XA 2DCFA 4ZI2C 4U33A 3EABA 4Z90A 3I9WA 3IF8B 1EZ3A 1N36T 4TN7B 2XAHB 2HN1A 1YXRA 4ZOLE 2L8KA 2LKHA 3W15B 4CQIA 1SA0E 3HR0A 1BR4A 3PUYF 1Z8UA 3AAEB 4UVCB 2XQ6A 5JRCA 1MNEA 2KLQA 2M6IA 2VQET 4QHOA 4U7YA 4UR9A 3UFEA 3FZMB 5EZYE 4FI5A 4JLEA 2FJBA 2MYSA 1WFDA 3ZC0A 2IC9A 3UU8A 3AE3A 1DU2A 5HXCA 1HNZT 2AE9A 3PUWF 3NZPA 3ZMTB 3OYXA 3C4WA 1XNQT 2L9QA 1MIVA 4IDPA 2LSYA 3SWHA 4KMCA 4H63H 3PUZF 3PUQA 3NWIA 4TNVA 4CN4A 1H7CA 1ZOYA 1E2AA 2N9DA 3CK6A 5L2LA 4JV5T 4KUMB 4E7ZA 2E9XD 1YKEB 3RYFE 3MXZA 3KINB 3KV9A 2WAUA 3AECA 3BQKA 1MMNA 1XMOT 3QC9A 2V6YA 3P50A 4DO0A 3QB5K 2J1DG 3O9XA 4PK4A 2OA5A 1IZNB 1SHZC 4JUYA 5H6RB 3CPZA 2ACXA 2NTXA 3MACA 3NKZA 3TLTA 2XASB 2JMKA 4DR4T 4ZXLA 4EZ4A 3GWHA 5H6QB 4X65T 3K3NA 1UX4A 1W0AA 4PFOA 3L39A 2XAJB 1ZV4X 4O2AE 5L3BB 5AQNB 2H3RA 5LYJE 2D0TA 3FBLA 1OEDB 1WCRA 2KSRA 5DQVA 2XQYA 2V7MA 1T72A 5C3JA 4UVAB 5AQIB 3UUBA 1XMQT 1US7B 2CHNA 4DR5T 4TWHA 3ZKRA 3QNUA 5LGTB 3CKDA 4IIJE 5L4EA 5AQOB 4AKIA 3MKDA 2DLRA 4HFIA 2W62A 4UVBB 3MZKB 3RH3A 4P1NA 2FJAA 5CB4E 2Y8DA 3UULA 2ZM2A 3EHZA 2A9UA 3LG7A 3OVUA 2JQQA 1BR0A 3HKBE 5HEJA 4CN6A 4YHJA 3CWZB 1HNWT 4ZS3A 4JBWF 4UXNB 2BDEA 5JR9B 3KV6A 2V8SV 5FL1A 1SE7A 4LF6T 4MBQA 3UUXB 2QVAA 4OK0A 4ZS2A 4MHCA 1ZKEA 3UT5E 1FMVA 3KVAA 4HN9A 1I6ZA 5LHHB 3ZPOA 2ES0A 2LOPA 4LMJA 4EV6A 2ZM8A 5C2TA 4OFZA 2CMRA 1OXZA 3HKEE 3N9PA 4O2BE 5LMNT 5EK3A 4YXDA 5LB7B 5C8YE 1Z0PA 3CQCB 4CI2B 4HWIB 4YSXA 4DR6T 1B7TA 4PJJA 2YDSA 4AKGA 1FJGT 3K8PC 2PG8A 4NUVA 2KMFA 4ASKA 3ZT6A 3SFDA 5AQJB 5CA0E 4L0RA 2J62A 3IA3A 5HXRA 5LGNB 2E9XA 3R6NA 3Q5EA 2X66A 1U5PA 4O4JE 3AEDA 4J2CA 4QXCB 3PJAJ 3ETVA 3P7IA 3AA0B 2PJQA 2WY2A 1T98A 2W66A 3SOLA 2WDQA 3ZSSA 3KVBA 1Y01A 3UU6A 5AQHB 1YKHB 3ZJ1A 2YKSA 4LF7T 5L3FB 1MNDA 4NUUA 3KBTA 3AE2A 2LSKA 4AKLA 4YSZA 2E9XC 5FXXA 3F57A 2KNDA 5HEOA 2LEHA 2UXCT 2YN6A 3IHRA 5F3JA 4O4IE 2LRKA 4KHZF 2ZM0A 5ETWA 3JC6D 3PUAA 2MTQA 2V7LA 4DR1T 4N78D 2V7KA 1XZYA 4I43B 2WS3A 3WAJA 3PE0A 4A56A 3F31A 3EAMA 2IDOB 4TX5A 1HFAA 3VKHA 1VCTA 4CXYA 3QUJA 3QK6A 2JRKA 2LHNA 2P9BA 3ZYKA 4WW0A 4BJMA 3UFGA 3N9MA 2J4GA 3C50A 5FMNA 3DP7A 2VL0A 3OYZA 2LM9A 3CX7B 1WR0A 2DWKA 5LG3A 2M6BA 4JI8T 1UURA 3J9X1 3RPUA 4WBNE 3ZT5A 1J1JA 2XQ4A 3ANWA 4MLKA 2X9XA 2K24A 4TUYE 1R8IA 2YK0A 3TLSA 1KNPA 2FJDA 4ZI7E 1GQEA 2XHEB 3FHNA 2BS4A 3UUMA 4CI3B 4AQFA 4ILBA 3LFMA 3ZSTA 5TAOA 4UF0A 3CVRA 4P09A 5HEUA 2DI4A 2WBLA 5LGUB 4QWNB 3TKLB 4XAXB 5AQTB 4IDQA 1ZEEA 4QXHB 2UXXB 3FZLB 1HG2A 2VVNA 3IBPA 3M3ZB 2WMNA 3AEEA 5JRCB 5EK4A 4Z8XA 5DABA 5DJQC 1NENA 1HF8A 1MMAA 3UU5A 2ZM6T 3X1DA 2YU2A 5FXVA 2DHRA 2XUEA 4H9NC 4EAHA 5FXZA 3V5SA 3BQIA 3OKQA 4EOZB 3BK9A 4AQFC 1XWMA 2UXBT 3VKGA 1VRBA 4KI0F 2LSIA 4U2ZA 5JDFA 2MPKA 1HCIA 5JDMA 4MFRA 2RA1A 2LSJA 4CN1A 3AEAA 3SRZA 2Z6EA 1VOMA 4B3RT 3N2KE 2IW5B 4DR3T 2W2UA 2QRXA 4JI4T 2OV9A 4I4TE 3RI5A 5HEHA 3LBXB 4LF9T 4OYJA 3M65A 2LLYA 3ZCJA 2ODVA 1FMWA 2WZIA 2EHOB 2CCQA 1NWMX 5HXHA 3K1SA 4X1YE 4CXWA 3FZFB 2V6YB 4DV3T 3LK2B 4GOUA 3ZMZB 3C4ZA 1LRZA 2JIWA 4X1IE 1U4QA 2XY8B 5AQKB 5GONE 4B3ST 3T8OA 4AISA 2I0MA 5LJNA 2C5IT 3ONJA 4ZI3D 4ISTA 1NEKA 1IBLT 4YHHT 1IBMT 4YY3T 2YDQA 3WI3A 1NAFA 2CBIA 3MA9A 2CBJA 2XPKA 3HKCE 2W61A 3ZJ2A 2VQFT 4PJLA 3PUGA 2VWAA 2LJLA 2MOZA 4X1KE 4YJ2E 2UUCT 2YU1A 3ZMSB 2V7JA 3P4SA 4DMVA 4AQYT 5CGMA 3HI2A 5IYZE 4YTPA 4HFCA 3PV0F 3RRCA 5J2TE 3P4RA 3AEGA 4KP3C 2BBHA 5LHGB 4JI3T 5LA6E 3SFEA 3N9QA 2XQ8A 3JC6C 2WZHA 3RLFF 4DIDB 2RP4A 4H9RC 5LOVE 2VKHA 4LMLA 3CMLA 4K0KT 5HCMA 1QSDA 3KFWX 2IHR1 4C91A 3RC3A 5LBMA 4Q25A 3AE6A 4P0AA 3N9LA 2C0SA 1L0VA 5DQWA 3AAIA 3FB2A 4COFA 4PK5A 4LF4T 4DV0T 4IDZA 2E5LT 4GKJT 2W67A 4ZZCA 5KMGP 1N33T 2Y6XA 5FKYA 3JADA 4HFHA 3R84B 3L8RA 1BR2A 2IMLA 3DJBA 2KWHA 4HWFA 2KINB 4FJOA 4QKNA 3MK7C 4P0BA 2H89A 5CFBA 2Q9QA 4I0UA 4X66T 1S94A 2CLYB 2CA5A 4A97A 4DMWA 2D5UA 2YDRA 2NP9A 4QH1A 3I9YA 3UUNA 2XM2A 2NW8A 1LVFA 5BR8T 1YQ3A 5FP3A 4XBFB 2NOXA 3GMIA 5L47A 2XSAA 1IJ5A 4BA9A 5JREA 2LE8A 3KDSE 2Q9QC 3PUSA 3G06A 3LSVA 3FZHB 2XQ9A 3RIFA 2VKJA 4EGWA 2WM9A 5LCYA 3U3IA 4M1PA 3EUHA 3LK3B 1WRDA 2E9XB 1FEWA 4DBRA 3UQ7A 4NXNT 3EI0A 2A3DA 4LFBT 1KEYA 2K9AA 1KK7A 2H7OA 2CWOA 3LJCA 4ILUA 2MBGA 3ZYLA 1OEDA 4IL4A 4PNIA 5LP6E 2WQYA 3L3PA 1UCUA 3CIRA 1OEDE 4PFPA 3WAKA 3NRYA 4AIUA 2X0LB 2K3WA 3ZN1B 5ADXL 2UXNB 1G8XA 4U2YA 2BG9B 5KXJA 2IAKA 5AQRB 2E2AA 4A5XA 2ODUA 3N2OA 4H9SE 3LK42 2BZBA 3ZN0B 4YTNA 4DR7T 1OEDC 4TV8E 2E8IA 2NWBA 5L3EB 5FL0A 5ABFA 2G0UA 4BJNA 3B13A 3KV5A 2VURA 4ZI3C 2AXDS 2D0UA 4PAGA 1D1AA 3OTOT 5LBQB 3RF1A 2CXLA 3RYHE 2VKOA 4O4LE 2WDRA 3PUVF 3N5LA 3KV4A 4G63A 2WDVA 3RIUA 2BVLA 3HA4A 4F6RC 3PTRB 3PURA 5HXSA 3C51A 2VL8A 2X0HA 2I59A 3RKGA 3ETUA 1QLBA 4DV1T 3RRWA 3PU8A 4EYUA 2V26A 4IL9A 3K3OA 2KXPB 2LM2A 5FNVE 1AJ3A 4HEAA 4PJMA 3AXJA 1YD8G 3ANWB 5IUXA 2XQAA 4V1Av 3OPCA 2NR4A 3RIUC 4DV6T 3VHLA 4HFBA 5FVKA 3FZKB 3ZMVB 2BKPA 1BR1A 3RIAA 2W63A 1HX8A 3C4XA 2YINA 1D0ZA 1JNRA 5AQSB 2XAFB 5E0OA 1HTJF 1LVKA 5CJ5A 4JI2T 4AKHA 4U7IA 3JCFA 4JI0T 2X9HA 4LFAT 5AQLB 2XJ7A 2CPTA 5F8PA 1CUNA 2CE7A 4YFSA 2DNXA 3N9OA 3FBZA 2IIUA 4PW8A 3L09A 2EHOD 4HFDA 2KZ7B 4X64T 4YTMA 3E0ZA 2VVSA 3JAEA 1M62A 4DV2T 3RQUA 1JNZA 2LHRA 4EYYR 4YT0A 4WZXA 3CQXC 4AQGA 5JDHA 2UU9T 4HE8A 3FXDB 3C98B 1KNRA 3Q9DA 3RX6A 4AXPA 5J2UE 4JI5T 1YW0A 2JJ9A 1W09A 3S4UA 2K48A 4KHPT 3H3AA 5AQFB 4EEDA 4UIGA 3CX8B 5IWAT 3ABVA 3J7Yq 2CXDA 2X67A 3AE1A 5KX5E 2E5VA 3RHWA 1YQ4A 2XAQB 5L3DB 1HS7A 2C5KT 3F2EA 3O1HA 4JI7T 3ZCIA 2WCAA 5EK2A 1MMGA 1WYBA 1WR6A 4DV7T 2WMOA 5LMUT 4LF5T 3ONXA 3CQGB 3T1HT 4LF8T 4KX6A 2LRLA 3BQLA 2WWVA 4X20E 4HGAA 4ILAA 2X68A 4NIQA 1D0XA 5JQGE 2W4XA 2M67A 1T8BA 3ZEFB 4GYSA 4CXXA 5AQQB 3AEFA 4TWDA 4IT4A 2VASA 2IUBA 4IE0A 2JQ9A 3GN5A 1D0YA 4NXMT 2JMHA 5JDGA 5CA1E 4HWDA 2VKDA 2PFVA 2XQ5A 4ANJA 4DUZT 4DUYT 5JDNA 3NBXX 4GK5E 2D9DA 3UU3A 4O8SA 4U72A 1N34T 1UX5A 2CXFA 5LXTE 1MIWA 5AQGB 1OWAA 1XDPA 5ABEA 3AVSA 4B3TT 2V7IA 2N1GA 5JDQA 5FY0A 4GK0E 3AA6B 4A98A 3NRXA 3RKOA 3V5UA 4DV4T 3EDVA 4QXBB 3P8CD 2JPFA 5JVDE 4UV9B 2H88A 4PJNA
chains in the Genus database with same CATH topology
1YKHB 3IEEA 3O1JA 3VU7H 3ZJ1A 5KDMC 2Q9QB 4GIWA 1X79A 3I0OA 5L3FB 3RYIE 4ADZA 1MNDA 2Q9QD 2VKJA 4NUUA 3KBTA 3KBUA 2LSKA 5FY7A 2X51A 2WM9A 4YJ3E 5LCYA 4AKLA 2KT9A 2E9XC 3HKDE 3U3IA 4M1PA 5FXXA 3EUHA 3F57A 3LK3B 2C5JA 4B6XA 1WRDA 2KNDA 4UEMA 1KNZA 3LBXA 2E9XB 1FEWA 2LEHA 4DBRA 4XZCA 2CEAA 2EHOA 3IHRA 5F3JA 4O4IE 4TZ4C 2NTYA 5HYAA 2A3DA 2ZM0A 3JC6D 3PUAA 5ETWA 1FIOA 1LKXA 2X9WA 2QGSA 2MTQA 3O4XE 2K9AA 2YEVC 1KK7A 2V7LA 1ZHCA 4N78D 2H7OA 2A72A 2CWOA 4YLHA 1HG5A 3LJCA 2BVMA 2SPCA 2V7KA 3HL6A 4ILUA 3AAAB 4L5GA 4WBOA 2MBGA 3ZYLA 4UELA 4PNIA 1MIYA 4IE5A 3FXEB 2A2FX 2CWYA 4MALA 5LP6E 3E22E 4I43B 3A5XA 3I0QA 3L3PA 3ZC1A 3WAJA 2DCFA 4ZI2C 4CI1B 3PE0A 1UCUA 4A56A 3F31A 2ZMAA 4PFPA 4TX5A 3WAKA 3NRYA 2X0LB 3I9WA 4IE4A 3ZN1B 1HFAA 3IF8B 4JEHB 5ADXL 1EZ3A 1O3XA 2UXNB 4TN7B 2XAHB 3VKHA 4OHFA 1G8XA 4BAYB 4CXYA 3QUJA 4ZHQE 3QK6A 4QX7B 2JRKA 2LHNA 2P9BA 2EHOC 3ZYKA 2IAKA 4WW0A 5AFUL 4BJMA 4ZOLE 3N9MA 1IAPA 2L8KA 2ODUA 3N2OA 2X9YA 2LT3A 3C50A 4H9SE 3AA1B 5FMNA 3LK42 2BZBA 3ZN0B 2HH7A 3W15B 4GYRA 5FY1A 3DP7A 2QA7A 4TV8E 2E8IA 5JH7E 4CQIA 1SA0E 3HR0A 2NWBA 5HWXA 2HPJA 3DTOA 5L3EB 1BR4A 3OYZA 4EZHA 2LM9A 2G0UA 3CX7B 2DWKA 3AAEB 3OBVE 3J9X1 2LSGA 4PJNA 3RPUA 4UVCB 1MMDA 4WBNE 5LG4A 4DVDA 4BJNA 3B13A 3GA8A 3KV5A 5JRCA 4ZI3C 2D0UA 4PAGA 1MNEA 2KLQA 1D1AA 2L3LA 3ANWA 3B57A 5LBQB 2CXLA 4QHOA 2KWIB 4MLKA 3RYHE 2VKOA 4O4LE 3AB3B 3UFEA 3N5LA 2X9XA 5EZYE 4FI5A 3KV4A 2K24A 4G63A 4JLEA 4TUYE 2MYSA 2YK0A 3ZC0A 5FYMA 2BVLA 2IC9A 3HA4A 4ZI7E 4F6RC 3PTRB 3PURA 5HXSA 2XHEB 4I55E 5HXCA 3C51A 3FHNA 2VL8A 4IHJE 3UUMA 3OJAA 3EDUA 3NZPA 3ZMTB 2I59A 4CI3B 4EXTA 3OYXA 3ETUA 3C4WA 4AQFA 2L9QA 2WWUA 3LFMA 2LOSA 3RRWA 5TAOA 1MIVA 3PU8A 2LSYA 4QX8B 3CVRA 4UF0A 4P09A 3SWHA 4KMCA 2DI4A 4H63H 2WBLA 4EYUA 5LGUB 3PUQA 2V26A 2IC6A 4QWNB 3TKLB 4XAXB 4HFVA 1ZEEA 4QXHB 2UXXB 1H7CA 2W00A 3K3OA 1HG2A 3IBPA 2KXPB 4L9IA 5FNVE 2WMNA 2N9DA 1AJ3A 2V1DB 5JRCB 4HEAA 4PJMA 5L2LA 4KUMB 4E7ZA 1YD8G 1YKEB 2E9XD 3ANWB 5EK4A 5J1GA 3RYFE 4Z8XA 5DABA 3MXZA 5DJQC 3ZYMA 4V1Av 3KINB 1HF8A 2H7VC 1MMAA 3KV9A 2WAUA 5JDLA 2WSSV 3VHLA 2YU2A 5FXVA 3BQKA 2DHRA 4ERRA 1MMNA 2XUEA 4H9NC 3QC9A 4KBMB 4EAHA 5FXZA 3V5SA 3ZMVB 3BQIA 4DO0A 3OKQA 4EOZB 1BR1A 3BK9A 2J1DG 4AQFC 3O9XA 2NW7A 2OA5A 4PK4A 2W63A 1HX8A 3C4XA 2YINA 3VKGA 1D0ZA 5A1LA 2XAFB 1VRBA 3Q5WA 2LSIA 5E0OA 1IZNB 1SHZC 4JUYA 5H6RB 3CPZA 1HTJF 2ACXA 2NTXA 3MACA 1HCIA 5JDFA 5JDMA 4MFRA 2RA1A 2XASB 1LVKA 2JMKA 2LSJA 4AKHA 1QUUA 1S35A 4EZ4A 2X9HA 3SRZA 2Z6EA 1VOMA 4ZI2D 3GWHA 4I50E 5H6QB 4U74A 3N2KE 2IW5B 3K3NA 1UX4A 5F8PA 4PFOA 2GK9A 1CUNA 2CE7A 4I4TE 4YFSA 2DNXA 3LBXB 4G2AA 4OYJA 2XAJB 1ZV4X 3M65A 3N9OA 3FBZA 3ZCJA 4H9PC 4O2AE 5L3BB 2ODVA 1FMWA 2EHOB 4PW8A 4ISSA 3L09A 2CCQA 1G73A 1NWMX 2EHOD 5HXHA 2KZ7B 2H3RA 4X1YE 3E0ZA 4CXWA 1IJ6A 5LYJE 2D0TA 2NW9A 2LHRA 3FBLA 4EYYR 3LK2B 3CQXC 4GOUA 4AQGA 5JDHA 4HE8A 3ZMZB 3C4ZA 1LRZA 3FXDB 3C98B 1D1BA 4X1IE 1U4QA 4E7SA 5DQVA 3Q9DA 3RX6A 2XQYA 2CLYC 4AXPA 2V7MA 5GONE 5HXEA 5J2UE 4IGUA 1YW0A 2W0GA 3T8OA 2JJ9A 5JR9A 5LJNA 2C5IT 2K5BB 4UVAB 3CX6B 3S4UA 4CZZB 2K48A 1US7B 4K0UA 3NZQA 3H3AA 4AKRB 4ZI3D 4UIGA 4ISTA 3CX8B 5LGTB 2B1EA 4TV9E 3CKDA 4IIJE 1V9DA 3WI3A 1NAFA 4EIWA 4AKIA 3MKDA 3MA9A 3J7Yq 2DLRA 3HKCE 2CXDA 2W61A 2X67A 3ZJ2A 5KX5E 4H63V 2W62A 4PJLA 4UVBB 4C90A 5LHIB 3MZKB 4PK6A 3RH3A 3PUGA 2VWAA 4O4HE 5CB4E 5L3CB 5FXWA 2Y8DA 2HPLA 3N9NA 2LJLA 2MOZA 2XAQB 4X1KE 4YJ2E 2YU1A 5L3DB 1HS7A 4H9OC 2V7JA 3UULA 3ZMSB 4DMVA 2ZM2A 2C5KT 1BR0A 3LG7A 2JQQA 3F2EA 3HI2A 3HKBE 3ZMUB 3O1HA 3PDYA 4YHJA 5HWYA 5IYZE 5JR9C 3CWZB 4ZS3A 3UTKA 3RRCA 5L3GB 3EVYA 3ZCIA 4UXNB 2BDEA 5JR9B 3KV6A 5J2TE 5EK2A 1MMGA 4MBQA 3UUXB 1WYBA 1WR6A 4UV8B 4OK0A 2Y48B 4KP3C 4ZS2A 1Y64B 2WMOA 5LHGB 3RC8A 5LA6E 4MHCA 2PBIA 3ONXA 3ZLIA 2N2NA 4HKAA 3N9QA 3CQGB 3JC6C 1ZKEA 3UT5E 1E1HB 1FMVA 3KVAA 2RP4A 4HN9A 3BQLA 4H9RC 5LHHB 4X20E 3ZPOA 5LOVE 2VKHA 4HGAA 2X68A 3C64A 2ES0A 1D0XA 2LOPA 3CMLA 3O1IA 3Q2MA 2ZM8A 5JQGE 1QSDA 2VB6A 4OYKA 3KFWX 2D2SA 2XTLA 4UF0B 4JEUB 3K3QC 4OFZA 4C91A 3RC3A 4DBQA 5LBMA 3E08A 2M67A 4P0AA 4IE6A 2CMRA 1OXZA 2C0SA 3N9LA 3HKEE 3H37A 5DQWA 3AAIA 4GYSA 3ZEFB 3FB2A 4EB6E 4CXXA 3N9PA 3N2GE 3RYCE 2VASA 4PK5A 4WNKA 4IE0A 4O2BE 4IDZA 3GN5A 5IHYA 2VK9A 1D0YA 4IE7A 2JMHA 5KMGP 2Y6XA 5JDGA 5CA1E 4AI6A 5EK3A 2CM0A 3R84B 5LJMA 5C8YE 1Z0PA 1BR2A 3CQCB 4CI2B 2VKDA 2PFVA 3DJBA 2KWHA 4ANJA 2KINB 3I1AA 4FJOA 3PU3A 4QKNA 5JDNA 3NBXX 4GK5E 1B7TA 4PJJA 4AKGA 3MK7C 4P0BA 3K8PC 1WLXA 2PG8A 2Q9QA 4NUVA 1S94A 2CLYB 5HAXA 2KMFA 4O8SA 4U72A 4ASKA 2CA5A 1UX5A 4DNDA 2CXFA 5LXTE 5CA0E 3MJXA 1WYCA 4L0RA 1MIWA 3AVRA 2ZLYA 1OWAA 4DMWA 2D5UA 5LNKA 5HXRA 5LGNB 2E9XA 3AVSA 3R6NA 3SS1A 2NP9A 2X66A 2XAGB 2V7IA 3D0TA 3I9YA 1U5PA 5M4YA 3UUNA 4O4JE 2N1GA 5JDQA 5FY0A 4HTEA 4GK0E 3AA6B 4J2CA 4QXCB 3GN5B 2NW8A 3NRXA 3RKOA 3V5UA 1LVFA 1D1CA 3ETVA 3EDVA 3P7IA 3Q5XA 3AA0B 4QXBB 2PJQA 5FP3A 4XBFB 3P8CD 2NOXA 2JPFA 1T98A 2DWGA 3U78A 3GMIA 3SOLA 5JVDE 4UV9B 5BMVE 1IJ5A 3ESLA 4BA9A 5JREA 2LE8A 3KDSE 2Q9QC 4H9QC 3PUSA 3AA7B 3KVBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EHO B;  2Q9Q C;  3JC6 D;  2Q9Q B;  3ANW A;  2E9X D;  2EHO A;  2E9X A; 
#chains in the Genus database with same CATH topology
 3O1J A;  3VU7 H;  2Q9Q B;  4ADZ A;  3B5M A;  2BKO A;  4HWC A;  5FY7 A;  2X51 A;  2XQ3 A;  2C5J A;  3JAF A;  4UEM A;  3LBX A;  2CHO A;  2UXD T;  4XZC A;  2EHO A;  2MAW A;  2NTY A;  1FIO A;  1LKX A;  2QGS A;  3A8Y C;  3O4X E;  1W9R A;  5L4H A;  5AQP B;  1ZHC A;  2A72 A;  4LMK A;  4WBO A;  3FXE B;  2CWY A;  4MAL A;  4JYA T;  4OX9 T;  3PJA A;  2V6X A;  3I0Q A;  3ZC1 A;  4CI1 B;  2R6G F;  3QB5 A;  4JI1 T;  2ZMA A;  3AE5 A;  4IE4 A;  3AEB A;  4JEH B;  1O3X A;  4OHF A;  1J5W A;  1W0B A;  4BAY B;  4ZHQ E;  4QX7 B;  4DV5 T;  4HWH A;  2EHO C;  1M7K A;  3AE7 A;  5AFU L;  5ABG A;  4GKK T;  1IAP A;  2X9Y A;  2LT3 A;  3AA1 B;  3AE8 A;  2HH7 A;  4GYR A;  5FY1 A;  4TWF A;  2QA7 A;  3UU4 A;  5JH7 E;  2HN2 A;  5HWX A;  2HPJ A;  3DTO A;  1SUM B;  5ABH A;  4EZH A;  3OBV E;  2LSG A;  1MMD A;  5LG4 A;  4DVD A;  3GA8 A;  5HCJ A;  3VRA A;  4U3C A;  2L3L A;  3B57 A;  3QOF A;  2KWI B;  2XSB A;  3AB3 B;  3T1Y T;  5FYM A;  5FVL A;  4U31 A;  4I55 E;  4IHJ E;  3OJA A;  3EDU A;  4EXT A;  5HEG A;  4ZEY A;  2FUP A;  2WWU A;  2LOS A;  2RPA A;  4QX8 B;  2WB5 A;  2IC6 A;  5ABF B;  4HFV A;  1HNX T;  2W00 A;  1I94 T;  4L9I A;  2V1D B;  5J1G A;  2BKN A;  3ZYM A;  1UGO A;  2H7V C;  5JDL A;  2WSS V;  4ERR A;  4ILC A;  4KBM B;  3A7M A;  2NW7 A;  5A1L A;  3Q5W A;  2HHH T;  2QYW A;  1QUU A;  1S35 A;  4ZI2 D;  4I50 E;  4U74 A;  4F8H A;  1XDO A;  2GK9 A;  4G2A A;  4H9P C;  3AXJ B;  4ISS A;  3AE4 A;  1G73 A;  1KF6 A;  2B76 A;  1IJ6 A;  2NW9 A;  3RGL A;  4X62 T;  1UUS A;  3LDQ B;  1D1B A;  4E7S A;  2CLY C;  5HXE A;  2X0Y A;  4IGU A;  2W0G A;  5J0Z A;  5JR9 A;  2K5B B;  3CX6 B;  4CZZ B;  5F5W A;  3TLW A;  4K0U A;  3NZQ A;  4AKR B;  4LFC T;  2B1E A;  4IDN A;  4TV9 E;  2CRB A;  1V9D A;  4EIW A;  2WP9 A;  2BS3 A;  4JI6 T;  3H3M A;  4H63 V;  4C90 A;  5LHI B;  4PK6 A;  1KFY A;  3ZT7 A;  5L3C B;  4O4H E;  5FXW A;  2HPL A;  3N9N A;  2V5D A;  1VCS A;  4H9O C;  3ZMU B;  2FJE A;  3PDY A;  5HWY A;  5JR9 C;  3AE9 A;  1IBK T;  2XM1 A;  4ZZB A;  3UTK A;  3VR8 A;  5L3G B;  3EVY A;  2J47 A;  2V5C A;  3ONL C;  4UV8 B;  2Y48 B;  1T7S A;  3RC8 A;  1Y64 B;  3P4W A;  2I6H A;  2PBI A;  3ZLI A;  2N2N A;  4HKA A;  2BG9 A;  2WU5 A;  1E1H B;  2UUB T;  3C64 A;  3O1I A;  4IRE A;  3Q2M A;  2VB6 A;  2BG9 E;  4OYK A;  2D2S A;  1E7P A;  2XTL A;  4UF0 B;  4JEU B;  3K3Q C;  2YOE A;  4DBQ A;  3E08 A;  1CHU A;  3PUX F;  4IE6 A;  4NPP A;  4B3M T;  3H37 A;  4EB6 E;  3N2G E;  3RYC E;  4WNK A;  2BBJ A;  4YSY A;  5IHY A;  2VK9 A;  4IE7 A;  4QH5 A;  4IDO A;  2BG9 C;  3VRB A;  4AI6 A;  2DL1 A;  2CM0 A;  5LJM A;  2JQH A;  2XZE A;  2LKG A;  3I1A A;  3TLU A;  3PU3 A;  5JTG A;  5AQU B;  4HFE A;  4TNW A;  3P4Q A;  1WLX A;  3UQ4 A;  5HAX A;  3P4P A;  4DND A;  2JQK A;  2F4V T;  3MJX A;  1WYC A;  5AQM B;  3VR9 A;  3AVR A;  1XNR T;  2ZLY A;  5LNK A;  1X9B A;  3SS1 A;  2XAG B;  3NVO A;  3D0T A;  5M4Y A;  4HTE A;  4QH4 A;  3GN5 B;  4X5T A;  4DR2 T;  5AQV B;  1D1C A;  4Z91 A;  3Q5X A;  2WU2 A;  2DWG A;  3U78 A;  3TLV A;  5BMV E;  3ESL A;  2OLT A;  4H9Q C;  3AA7 B;  3IEE A;  5KDM C;  2PTF A;  4GIW A;  1X79 A;  3I0O A;  2BS2 A;  3RYI E;  2Q9Q D;  3KBU A;  1N32 T;  4YJ3 E;  2KT9 A;  3HKD E;  3RQW A;  4B6X A;  1KNZ A;  2UUA T;  2XQ7 A;  1HR0 T;  1ZP0 A;  2CEA A;  4TZ4 C;  2FBW A;  5HYA A;  3Q5D A;  1J5E T;  2X9W A;  1UK5 A;  4WYV A;  2YEV C;  4YLH A;  2ACZ A;  1HG5 A;  2BVM A;  2SPC A;  3HL6 A;  3AAA B;  4L5G A;  4EEB A;  4UEL A;  1MIY A;  4IE5 A;  1HX1 B;  2A2F X;  3E22 E;  3A5X A;  2DCF A;  4ZI2 C;  4U33 A;  3EAB A;  4Z90 A;  3I9W A;  3IF8 B;  1EZ3 A;  1N36 T;  4TN7 B;  2XAH B;  2HN1 A;  1YXR A;  4ZOL E;  2L8K A;  2LKH A;  3W15 B;  4CQI A;  1SA0 E;  3HR0 A;  1BR4 A;  3PUY F;  1Z8U A;  3AAE B;  4UVC B;  2XQ6 A;  5JRC A;  1MNE A;  2KLQ A;  2M6I A;  2VQE T;  4QHO A;  4U7Y A;  4UR9 A;  3UFE A;  3FZM B;  5EZY E;  4FI5 A;  4JLE A;  2FJB A;  2MYS A;  1WFD A;  3ZC0 A;  2IC9 A;  3UU8 A;  3AE3 A;  1DU2 A;  5HXC A;  1HNZ T;  2AE9 A;  3PUW F;  3NZP A;  3ZMT B;  3OYX A;  3C4W A;  1XNQ T;  2L9Q A;  1MIV A;  4IDP A;  2LSY A;  3SWH A;  4KMC A;  4H63 H;  3PUZ F;  3PUQ A;  3NWI A;  4TNV A;  4CN4 A;  1H7C A;  1ZOY A;  1E2A A;  2N9D A;  3CK6 A;  5L2L A;  4JV5 T;  4KUM B;  4E7Z A;  2E9X D;  1YKE B;  3RYF E;  3MXZ A;  3KIN B;  3KV9 A;  2WAU A;  3AEC A;  3BQK A;  1MMN A;  1XMO T;  3QC9 A;  2V6Y A;  3P50 A;  4DO0 A;  3QB5 K;  2J1D G;  3O9X A;  4PK4 A;  2OA5 A;  1IZN B;  1SHZ C;  4JUY A;  5H6R B;  3CPZ A;  2ACX A;  2NTX A;  3MAC A;  3NKZ A;  3TLT A;  2XAS B;  2JMK A;  4DR4 T;  4ZXL A;  4EZ4 A;  3GWH A;  5H6Q B;  4X65 T;  3K3N A;  1UX4 A;  1W0A A;  4PFO A;  3L39 A;  2XAJ B;  1ZV4 X;  4O2A E;  5L3B B;  5AQN B;  2H3R A;  5LYJ E;  2D0T A;  3FBL A;  1OED B;  1WCR A;  2KSR A;  5DQV A;  2XQY A;  2V7M A;  1T72 A;  5C3J A;  4UVA B;  5AQI B;  3UUB A;  1XMQ T;  1US7 B;  2CHN A;  4DR5 T;  4TWH A;  3ZKR A;  3QNU A;  5LGT B;  3CKD A;  4IIJ E;  5L4E A;  5AQO B;  4AKI A;  3MKD A;  2DLR A;  4HFI A;  2W62 A;  4UVB B;  3MZK B;  3RH3 A;  4P1N A;  2FJA A;  5CB4 E;  2Y8D A;  3UUL A;  2ZM2 A;  3EHZ A;  2A9U A;  3LG7 A;  3OVU A;  2JQQ A;  1BR0 A;  3HKB E;  5HEJ A;  4CN6 A;  4YHJ A;  3CWZ B;  1HNW T;  4ZS3 A;  4JBW F;  4UXN B;  2BDE A;  5JR9 B;  3KV6 A;  2V8S V;  5FL1 A;  1SE7 A;  4LF6 T;  4MBQ A;  3UUX B;  2QVA A;  4OK0 A;  4ZS2 A;  4MHC A;  1ZKE A;  3UT5 E;  1FMV A;  3KVA A;  4HN9 A;  1I6Z A;  5LHH B;  3ZPO A;  2ES0 A;  2LOP A;  4LMJ A;  4EV6 A;  2ZM8 A;  5C2T A;  4OFZ A;  2CMR A;  1OXZ A;  3HKE E;  3N9P A;  4O2B E;  5LMN T;  5EK3 A;  4YXD A;  5LB7 B;  5C8Y E;  1Z0P A;  3CQC B;  4CI2 B;  4HWI B;  4YSX A;  4DR6 T;  1B7T A;  4PJJ A;  2YDS A;  4AKG A;  1FJG T;  3K8P C;  2PG8 A;  4NUV A;  2KMF A;  4ASK A;  3ZT6 A;  3SFD A;  5AQJ B;  5CA0 E;  4L0R A;  2J62 A;  3IA3 A;  5HXR A;  5LGN B;  2E9X A;  3R6N A;  3Q5E A;  2X66 A;  1U5P A;  4O4J E;  3AED A;  4J2C A;  4QXC B;  3PJA J;  3ETV A;  3P7I A;  3AA0 B;  2PJQ A;  2WY2 A;  1T98 A;  2W66 A;  3SOL A;  2WDQ A;  3ZSS A;  3KVB A;  1Y01 A;  3UU6 A;  5AQH B;  1YKH B;  3ZJ1 A;  2YKS A;  4LF7 T;  5L3F B;  1MND A;  4NUU A;  3KBT A;  3AE2 A;  2LSK A;  4AKL A;  4YSZ A;  2E9X C;  5FXX A;  3F57 A;  2KND A;  5HEO A;  2LEH A;  2UXC T;  2YN6 A;  3IHR A;  5F3J A;  4O4I E;  2LRK A;  4KHZ F;  2ZM0 A;  5ETW A;  3JC6 D;  3PUA A;  2MTQ A;  2V7L A;  4DR1 T;  4N78 D;  2V7K A;  1XZY A;  4I43 B;  2WS3 A;  3WAJ A;  3PE0 A;  4A56 A;  3F31 A;  3EAM A;  2IDO B;  4TX5 A;  1HFA A;  3VKH A;  1VCT A;  4CXY A;  3QUJ A;  3QK6 A;  2JRK A;  2LHN A;  2P9B A;  3ZYK A;  4WW0 A;  4BJM A;  3UFG A;  3N9M A;  2J4G A;  3C50 A;  5FMN A;  3DP7 A;  2VL0 A;  3OYZ A;  2LM9 A;  3CX7 B;  1WR0 A;  2DWK A;  5LG3 A;  2M6B A;  4JI8 T;  1UUR A;  3J9X 1;  3RPU A;  4WBN E;  3ZT5 A;  1J1J A;  2XQ4 A;  3ANW A;  4MLK A;  2X9X A;  2K24 A;  4TUY E;  1R8I A;  2YK0 A;  3TLS A;  1KNP A;  2FJD A;  4ZI7 E;  1GQE A;  2XHE B;  3FHN A;  2BS4 A;  3UUM A;  4CI3 B;  4AQF A;  4ILB A;  3LFM A;  3ZST A;  5TAO A;  4UF0 A;  3CVR A;  4P09 A;  5HEU A;  2DI4 A;  2WBL A;  5LGU B;  4QWN B;  3TKL B;  4XAX B;  5AQT B;  4IDQ A;  1ZEE A;  4QXH B;  2UXX B;  3FZL B;  1HG2 A;  2VVN A;  3IBP A;  3M3Z B;  2WMN A;  3AEE A;  5JRC B;  5EK4 A;  4Z8X A;  5DAB A;  5DJQ C;  1NEN A;  1HF8 A;  1MMA A;  3UU5 A;  2ZM6 T;  3X1D A;  2YU2 A;  5FXV A;  2DHR A;  2XUE A;  4H9N C;  4EAH A;  5FXZ A;  3V5S A;  3BQI A;  3OKQ A;  4EOZ B;  3BK9 A;  4AQF C;  1XWM A;  2UXB T;  3VKG A;  1VRB A;  4KI0 F;  2LSI A;  4U2Z A;  5JDF A;  2MPK A;  1HCI A;  5JDM A;  4MFR A;  2RA1 A;  2LSJ A;  4CN1 A;  3AEA A;  3SRZ A;  2Z6E A;  1VOM A;  4B3R T;  3N2K E;  2IW5 B;  4DR3 T;  2W2U A;  2QRX A;  4JI4 T;  2OV9 A;  4I4T E;  3RI5 A;  5HEH A;  3LBX B;  4LF9 T;  4OYJ A;  3M65 A;  2LLY A;  3ZCJ A;  2ODV A;  1FMW A;  2WZI A;  2EHO B;  2CCQ A;  1NWM X;  5HXH A;  3K1S A;  4X1Y E;  4CXW A;  3FZF B;  2V6Y B;  4DV3 T;  3LK2 B;  4GOU A;  3ZMZ B;  3C4Z A;  1LRZ A;  2JIW A;  4X1I E;  1U4Q A;  2XY8 B;  5AQK B;  5GON E;  4B3S T;  3T8O A;  4AIS A;  2I0M A;  5LJN A;  2C5I T;  3ONJ A;  4ZI3 D;  4IST A;  1NEK A;  1IBL T;  4YHH T;  1IBM T;  4YY3 T;  2YDQ A;  3WI3 A;  1NAF A;  2CBI A;  3MA9 A;  2CBJ A;  2XPK A;  3HKC E;  2W61 A;  3ZJ2 A;  2VQF T;  4PJL A;  3PUG A;  2VWA A;  2LJL A;  2MOZ A;  4X1K E;  4YJ2 E;  2UUC T;  2YU1 A;  3ZMS B;  2V7J A;  3P4S A;  4DMV A;  4AQY T;  5CGM A;  3HI2 A;  5IYZ E;  4YTP A;  4HFC A;  3PV0 F;  3RRC A;  5J2T E;  3P4R A;  3AEG A;  4KP3 C;  2BBH A;  5LHG B;  4JI3 T;  5LA6 E;  3SFE A;  3N9Q A;  2XQ8 A;  3JC6 C;  2WZH A;  3RLF F;  4DID B;  2RP4 A;  4H9R C;  5LOV E;  2VKH A;  4LML A;  3CML A;  4K0K T;  5HCM A;  1QSD A;  3KFW X;  2IHR 1;  4C91 A;  3RC3 A;  5LBM A;  4Q25 A;  3AE6 A;  4P0A A;  3N9L A;  2C0S A;  1L0V A;  5DQW A;  3AAI A;  3FB2 A;  4COF A;  4PK5 A;  4LF4 T;  4DV0 T;  4IDZ A;  2E5L T;  4GKJ T;  2W67 A;  4ZZC A;  5KMG P;  1N33 T;  2Y6X A;  5FKY A;  3JAD A;  4HFH A;  3R84 B;  3L8R A;  1BR2 A;  2IML A;  3DJB A;  2KWH A;  4HWF A;  2KIN B;  4FJO A;  4QKN A;  3MK7 C;  4P0B A;  2H89 A;  5CFB A;  2Q9Q A;  4I0U A;  4X66 T;  1S94 A;  2CLY B;  2CA5 A;  4A97 A;  4DMW A;  2D5U A;  2YDR A;  2NP9 A;  4QH1 A;  3I9Y A;  3UUN A;  2XM2 A;  2NW8 A;  1LVF A;  5BR8 T;  1YQ3 A;  5FP3 A;  4XBF B;  2NOX A;  3GMI A;  5L47 A;  2XSA A;  1IJ5 A;  4BA9 A;  5JRE A;  2LE8 A;  3KDS E;  2Q9Q C;  3PUS A;  3G06 A;  3LSV A;  3FZH B;  2XQ9 A;  3RIF A;  2VKJ A;  4EGW A;  2WM9 A;  5LCY A;  3U3I A;  4M1P A;  3EUH A;  3LK3 B;  1WRD A;  2E9X B;  1FEW A;  4DBR A;  3UQ7 A;  4NXN T;  3EI0 A;  2A3D A;  4LFB T;  1KEY A;  2K9A A;  1KK7 A;  2H7O A;  2CWO A;  3LJC A;  4ILU A;  2MBG A;  3ZYL A;  1OED A;  4IL4 A;  4PNI A;  5LP6 E;  2WQY A;  3L3P A;  1UCU A;  3CIR A;  1OED E;  4PFP A;  3WAK A;  3NRY A;  4AIU A;  2X0L B;  2K3W A;  3ZN1 B;  5ADX L;  2UXN B;  1G8X A;  4U2Y A;  2BG9 B;  5KXJ A;  2IAK A;  5AQR B;  2E2A A;  4A5X A;  2ODU A;  3N2O A;  4H9S E;  3LK4 2;  2BZB A;  3ZN0 B;  4YTN A;  4DR7 T;  1OED C;  4TV8 E;  2E8I A;  2NWB A;  5L3E B;  5FL0 A;  5ABF A;  2G0U A;  4BJN A;  3B13 A;  3KV5 A;  2VUR A;  4ZI3 C;  2AXD S;  2D0U A;  4PAG A;  1D1A A;  3OTO T;  5LBQ B;  3RF1 A;  2CXL A;  3RYH E;  2VKO A;  4O4L E;  2WDR A;  3PUV F;  3N5L A;  3KV4 A;  4G63 A;  2WDV A;  3RIU A;  2BVL A;  3HA4 A;  4F6R C;  3PTR B;  3PUR A;  5HXS A;  3C51 A;  2VL8 A;  2X0H A;  2I59 A;  3RKG A;  3ETU A;  1QLB A;  4DV1 T;  3RRW A;  3PU8 A;  4EYU A;  2V26 A;  4IL9 A;  3K3O A;  2KXP B;  2LM2 A;  5FNV E;  1AJ3 A;  4HEA A;  4PJM A;  3AXJ A;  1YD8 G;  3ANW B;  5IUX A;  2XQA A;  4V1A v;  3OPC A;  2NR4 A;  3RIU C;  4DV6 T;  3VHL A;  4HFB A;  5FVK A;  3FZK B;  3ZMV B;  2BKP A;  1BR1 A;  3RIA A;  2W63 A;  1HX8 A;  3C4X A;  2YIN A;  1D0Z A;  1JNR A;  5AQS B;  2XAF B;  5E0O A;  1HTJ F;  1LVK A;  5CJ5 A;  4JI2 T;  4AKH A;  4U7I A;  3JCF A;  4JI0 T;  2X9H A;  4LFA T;  5AQL B;  2XJ7 A;  2CPT A;  5F8P A;  1CUN A;  2CE7 A;  4YFS A;  2DNX A;  3N9O A;  3FBZ A;  2IIU A;  4PW8 A;  3L09 A;  2EHO D;  4HFD A;  2KZ7 B;  4X64 T;  4YTM A;  3E0Z A;  2VVS A;  3JAE A;  1M62 A;  4DV2 T;  3RQU A;  1JNZ A;  2LHR A;  4EYY R;  4YT0 A;  4WZX A;  3CQX C;  4AQG A;  5JDH A;  2UU9 T;  4HE8 A;  3FXD B;  3C98 B;  1KNR A;  3Q9D A;  3RX6 A;  4AXP A;  5J2U E;  4JI5 T;  1YW0 A;  2JJ9 A;  1W09 A;  3S4U A;  2K48 A;  4KHP T;  3H3A A;  5AQF B;  4EED A;  4UIG A;  3CX8 B;  5IWA T;  3ABV A;  3J7Y q;  2CXD A;  2X67 A;  3AE1 A;  5KX5 E;  2E5V A;  3RHW A;  1YQ4 A;  2XAQ B;  5L3D B;  1HS7 A;  2C5K T;  3F2E A;  3O1H A;  4JI7 T;  3ZCI A;  2WCA A;  5EK2 A;  1MMG A;  1WYB A;  1WR6 A;  4DV7 T;  2WMO A;  5LMU T;  4LF5 T;  3ONX A;  3CQG B;  3T1H T;  4LF8 T;  4KX6 A;  2LRL A;  3BQL A;  2WWV A;  4X20 E;  4HGA A;  4ILA A;  2X68 A;  4NIQ A;  1D0X A;  5JQG E;  2W4X A;  2M67 A;  1T8B A;  3ZEF B;  4GYS A;  4CXX A;  5AQQ B;  3AEF A;  4TWD A;  4IT4 A;  2VAS A;  2IUB A;  4IE0 A;  2JQ9 A;  3GN5 A;  1D0Y A;  4NXM T;  2JMH A;  5JDG A;  5CA1 E;  4HWD A;  2VKD A;  2PFV A;  2XQ5 A;  4ANJ A;  4DUZ T;  4DUY T;  5JDN A;  3NBX X;  4GK5 E;  2D9D A;  3UU3 A;  4O8S A;  4U72 A;  1N34 T;  1UX5 A;  2CXF A;  5LXT E;  1MIW A;  5AQG B;  1OWA A;  1XDP A;  5ABE A;  3AVS A;  4B3T T;  2V7I A;  2N1G A;  5JDQ A;  5FY0 A;  4GK0 E;  3AA6 B;  4A98 A;  3NRX A;  3RKO A;  3V5U A;  4DV4 T;  3EDV A;  4QXB B;  3P8C D;  2JPF A;  5JVD E;  4UV9 B;  2H88 A;  4PJN A; 
#chains in the Genus database with same CATH homology
 1YKH B;  3IEE A;  3O1J A;  3VU7 H;  3ZJ1 A;  5KDM C;  2Q9Q B;  4GIW A;  1X79 A;  3I0O A;  5L3F B;  3RYI E;  4ADZ A;  1MND A;  2Q9Q D;  2VKJ A;  4NUU A;  3KBT A;  3KBU A;  2LSK A;  5FY7 A;  2X51 A;  2WM9 A;  4YJ3 E;  5LCY A;  4AKL A;  2KT9 A;  2E9X C;  3HKD E;  3U3I A;  4M1P A;  5FXX A;  3EUH A;  3F57 A;  3LK3 B;  2C5J A;  4B6X A;  1WRD A;  2KND A;  4UEM A;  1KNZ A;  3LBX A;  2E9X B;  1FEW A;  2LEH A;  4DBR A;  4XZC A;  2CEA A;  2EHO A;  3IHR A;  5F3J A;  4O4I E;  4TZ4 C;  2NTY A;  5HYA A;  2A3D A;  2ZM0 A;  3JC6 D;  3PUA A;  5ETW A;  1FIO A;  1LKX A;  2X9W A;  2QGS A;  2MTQ A;  3O4X E;  2K9A A;  2YEV C;  1KK7 A;  2V7L A;  1ZHC A;  4N78 D;  2H7O A;  2A72 A;  2CWO A;  4YLH A;  1HG5 A;  3LJC A;  2BVM A;  2SPC A;  2V7K A;  3HL6 A;  4ILU A;  3AAA B;  4L5G A;  4WBO A;  2MBG A;  3ZYL A;  4UEL A;  4PNI A;  1MIY A;  4IE5 A;  3FXE B;  2A2F X;  2CWY A;  4MAL A;  5LP6 E;  3E22 E;  4I43 B;  3A5X A;  3I0Q A;  3L3P A;  3ZC1 A;  3WAJ A;  2DCF A;  4ZI2 C;  4CI1 B;  3PE0 A;  1UCU A;  4A56 A;  3F31 A;  2ZMA A;  4PFP A;  4TX5 A;  3WAK A;  3NRY A;  2X0L B;  3I9W A;  4IE4 A;  3ZN1 B;  1HFA A;  3IF8 B;  4JEH B;  5ADX L;  1EZ3 A;  1O3X A;  2UXN B;  4TN7 B;  2XAH B;  3VKH A;  4OHF A;  1G8X A;  4BAY B;  4CXY A;  3QUJ A;  4ZHQ E;  3QK6 A;  4QX7 B;  2JRK A;  2LHN A;  2P9B A;  2EHO C;  3ZYK A;  2IAK A;  4WW0 A;  5AFU L;  4BJM A;  4ZOL E;  3N9M A;  1IAP A;  2L8K A;  2ODU A;  3N2O A;  2X9Y A;  2LT3 A;  3C50 A;  4H9S E;  3AA1 B;  5FMN A;  3LK4 2;  2BZB A;  3ZN0 B;  2HH7 A;  3W15 B;  4GYR A;  5FY1 A;  3DP7 A;  2QA7 A;  4TV8 E;  2E8I A;  5JH7 E;  4CQI A;  1SA0 E;  3HR0 A;  2NWB A;  5HWX A;  2HPJ A;  3DTO A;  5L3E B;  1BR4 A;  3OYZ A;  4EZH A;  2LM9 A;  2G0U A;  3CX7 B;  2DWK A;  3AAE B;  3OBV E;  3J9X 1;  2LSG A;  4PJN A;  3RPU A;  4UVC B;  1MMD A;  4WBN E;  5LG4 A;  4DVD A;  4BJN A;  3B13 A;  3GA8 A;  3KV5 A;  5JRC A;  4ZI3 C;  2D0U A;  4PAG A;  1MNE A;  2KLQ A;  1D1A A;  2L3L A;  3ANW A;  3B57 A;  5LBQ B;  2CXL A;  4QHO A;  2KWI B;  4MLK A;  3RYH E;  2VKO A;  4O4L E;  3AB3 B;  3UFE A;  3N5L A;  2X9X A;  5EZY E;  4FI5 A;  3KV4 A;  2K24 A;  4G63 A;  4JLE A;  4TUY E;  2MYS A;  2YK0 A;  3ZC0 A;  5FYM A;  2BVL A;  2IC9 A;  3HA4 A;  4ZI7 E;  4F6R C;  3PTR B;  3PUR A;  5HXS A;  2XHE B;  4I55 E;  5HXC A;  3C51 A;  3FHN A;  2VL8 A;  4IHJ E;  3UUM A;  3OJA A;  3EDU A;  3NZP A;  3ZMT B;  2I59 A;  4CI3 B;  4EXT A;  3OYX A;  3ETU A;  3C4W A;  4AQF A;  2L9Q A;  2WWU A;  3LFM A;  2LOS A;  3RRW A;  5TAO A;  1MIV A;  3PU8 A;  2LSY A;  4QX8 B;  3CVR A;  4UF0 A;  4P09 A;  3SWH A;  4KMC A;  2DI4 A;  4H63 H;  2WBL A;  4EYU A;  5LGU B;  3PUQ A;  2V26 A;  2IC6 A;  4QWN B;  3TKL B;  4XAX B;  4HFV A;  1ZEE A;  4QXH B;  2UXX B;  1H7C A;  2W00 A;  3K3O A;  1HG2 A;  3IBP A;  2KXP B;  4L9I A;  5FNV E;  2WMN A;  2N9D A;  1AJ3 A;  2V1D B;  5JRC B;  4HEA A;  4PJM A;  5L2L A;  4KUM B;  4E7Z A;  1YD8 G;  1YKE B;  2E9X D;  3ANW B;  5EK4 A;  5J1G A;  3RYF E;  4Z8X A;  5DAB A;  3MXZ A;  5DJQ C;  3ZYM A;  4V1A v;  3KIN B;  1HF8 A;  2H7V C;  1MMA A;  3KV9 A;  2WAU A;  5JDL A;  2WSS V;  3VHL A;  2YU2 A;  5FXV A;  3BQK A;  2DHR A;  4ERR A;  1MMN A;  2XUE A;  4H9N C;  3QC9 A;  4KBM B;  4EAH A;  5FXZ A;  3V5S A;  3ZMV B;  3BQI A;  4DO0 A;  3OKQ A;  4EOZ B;  1BR1 A;  3BK9 A;  2J1D G;  4AQF C;  3O9X A;  2NW7 A;  2OA5 A;  4PK4 A;  2W63 A;  1HX8 A;  3C4X A;  2YIN A;  3VKG A;  1D0Z A;  5A1L A;  2XAF B;  1VRB A;  3Q5W A;  2LSI A;  5E0O A;  1IZN B;  1SHZ C;  4JUY A;  5H6R B;  3CPZ A;  1HTJ F;  2ACX A;  2NTX A;  3MAC A;  1HCI A;  5JDF A;  5JDM A;  4MFR A;  2RA1 A;  2XAS B;  1LVK A;  2JMK A;  2LSJ A;  4AKH A;  1QUU A;  1S35 A;  4EZ4 A;  2X9H A;  3SRZ A;  2Z6E A;  1VOM A;  4ZI2 D;  3GWH A;  4I50 E;  5H6Q B;  4U74 A;  3N2K E;  2IW5 B;  3K3N A;  1UX4 A;  5F8P A;  4PFO A;  2GK9 A;  1CUN A;  2CE7 A;  4I4T E;  4YFS A;  2DNX A;  3LBX B;  4G2A A;  4OYJ A;  2XAJ B;  1ZV4 X;  3M65 A;  3N9O A;  3FBZ A;  3ZCJ A;  4H9P C;  4O2A E;  5L3B B;  2ODV A;  1FMW A;  2EHO B;  4PW8 A;  4ISS A;  3L09 A;  2CCQ A;  1G73 A;  1NWM X;  2EHO D;  5HXH A;  2KZ7 B;  2H3R A;  4X1Y E;  3E0Z A;  4CXW A;  1IJ6 A;  5LYJ E;  2D0T A;  2NW9 A;  2LHR A;  3FBL A;  4EYY R;  3LK2 B;  3CQX C;  4GOU A;  4AQG A;  5JDH A;  4HE8 A;  3ZMZ B;  3C4Z A;  1LRZ A;  3FXD B;  3C98 B;  1D1B A;  4X1I E;  1U4Q A;  4E7S A;  5DQV A;  3Q9D A;  3RX6 A;  2XQY A;  2CLY C;  4AXP A;  2V7M A;  5GON E;  5HXE A;  5J2U E;  4IGU A;  1YW0 A;  2W0G A;  3T8O A;  2JJ9 A;  5JR9 A;  5LJN A;  2C5I T;  2K5B B;  4UVA B;  3CX6 B;  3S4U A;  4CZZ B;  2K48 A;  1US7 B;  4K0U A;  3NZQ A;  3H3A A;  4AKR B;  4ZI3 D;  4UIG A;  4IST A;  3CX8 B;  5LGT B;  2B1E A;  4TV9 E;  3CKD A;  4IIJ E;  1V9D A;  3WI3 A;  1NAF A;  4EIW A;  4AKI A;  3MKD A;  3MA9 A;  3J7Y q;  2DLR A;  3HKC E;  2CXD A;  2W61 A;  2X67 A;  3ZJ2 A;  5KX5 E;  4H63 V;  2W62 A;  4PJL A;  4UVB B;  4C90 A;  5LHI B;  3MZK B;  4PK6 A;  3RH3 A;  3PUG A;  2VWA A;  4O4H E;  5CB4 E;  5L3C B;  5FXW A;  2Y8D A;  2HPL A;  3N9N A;  2LJL A;  2MOZ A;  2XAQ B;  4X1K E;  4YJ2 E;  2YU1 A;  5L3D B;  1HS7 A;  4H9O C;  2V7J A;  3UUL A;  3ZMS B;  4DMV A;  2ZM2 A;  2C5K T;  1BR0 A;  3LG7 A;  2JQQ A;  3F2E A;  3HI2 A;  3HKB E;  3ZMU B;  3O1H A;  3PDY A;  4YHJ A;  5HWY A;  5IYZ E;  5JR9 C;  3CWZ B;  4ZS3 A;  3UTK A;  3RRC A;  5L3G B;  3EVY A;  3ZCI A;  4UXN B;  2BDE A;  5JR9 B;  3KV6 A;  5J2T E;  5EK2 A;  1MMG A;  4MBQ A;  3UUX B;  1WYB A;  1WR6 A;  4UV8 B;  4OK0 A;  2Y48 B;  4KP3 C;  4ZS2 A;  1Y64 B;  2WMO A;  5LHG B;  3RC8 A;  5LA6 E;  4MHC A;  2PBI A;  3ONX A;  3ZLI A;  2N2N A;  4HKA A;  3N9Q A;  3CQG B;  3JC6 C;  1ZKE A;  3UT5 E;  1E1H B;  1FMV A;  3KVA A;  2RP4 A;  4HN9 A;  3BQL A;  4H9R C;  5LHH B;  4X20 E;  3ZPO A;  5LOV E;  2VKH A;  4HGA A;  2X68 A;  3C64 A;  2ES0 A;  1D0X A;  2LOP A;  3CML A;  3O1I A;  3Q2M A;  2ZM8 A;  5JQG E;  1QSD A;  2VB6 A;  4OYK A;  3KFW X;  2D2S A;  2XTL A;  4UF0 B;  4JEU B;  3K3Q C;  4OFZ A;  4C91 A;  3RC3 A;  4DBQ A;  5LBM A;  3E08 A;  2M67 A;  4P0A A;  4IE6 A;  2CMR A;  1OXZ A;  2C0S A;  3N9L A;  3HKE E;  3H37 A;  5DQW A;  3AAI A;  4GYS A;  3ZEF B;  3FB2 A;  4EB6 E;  4CXX A;  3N9P A;  3N2G E;  3RYC E;  2VAS A;  4PK5 A;  4WNK A;  4IE0 A;  4O2B E;  4IDZ A;  3GN5 A;  5IHY A;  2VK9 A;  1D0Y A;  4IE7 A;  2JMH A;  5KMG P;  2Y6X A;  5JDG A;  5CA1 E;  4AI6 A;  5EK3 A;  2CM0 A;  3R84 B;  5LJM A;  5C8Y E;  1Z0P A;  1BR2 A;  3CQC B;  4CI2 B;  2VKD A;  2PFV A;  3DJB A;  2KWH A;  4ANJ A;  2KIN B;  3I1A A;  4FJO A;  3PU3 A;  4QKN A;  5JDN A;  3NBX X;  4GK5 E;  1B7T A;  4PJJ A;  4AKG A;  3MK7 C;  4P0B A;  3K8P C;  1WLX A;  2PG8 A;  2Q9Q A;  4NUV A;  1S94 A;  2CLY B;  5HAX A;  2KMF A;  4O8S A;  4U72 A;  4ASK A;  2CA5 A;  1UX5 A;  4DND A;  2CXF A;  5LXT E;  5CA0 E;  3MJX A;  1WYC A;  4L0R A;  1MIW A;  3AVR A;  2ZLY A;  1OWA A;  4DMW A;  2D5U A;  5LNK A;  5HXR A;  5LGN B;  2E9X A;  3AVS A;  3R6N A;  3SS1 A;  2NP9 A;  2X66 A;  2XAG B;  2V7I A;  3D0T A;  3I9Y A;  1U5P A;  5M4Y A;  3UUN A;  4O4J E;  2N1G A;  5JDQ A;  5FY0 A;  4HTE A;  4GK0 E;  3AA6 B;  4J2C A;  4QXC B;  3GN5 B;  2NW8 A;  3NRX A;  3RKO A;  3V5U A;  1LVF A;  1D1C A;  3ETV A;  3EDV A;  3P7I A;  3Q5X A;  3AA0 B;  4QXB B;  2PJQ A;  5FP3 A;  4XBF B;  3P8C D;  2NOX A;  2JPF A;  1T98 A;  2DWG A;  3U78 A;  3GMI A;  3SOL A;  5JVD E;  4UV9 B;  5BMV E;  1IJ5 A;  3ESL A;  4BA9 A;  5JRE A;  2LE8 A;  3KDS E;  2Q9Q C;  4H9Q C;  3PUS A;  3AA7 B;  3KVB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...