1OXZA

Crystal structure of the human gga1 gat domain
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
132
structure length
132
Chain Sequence
DEEKSKMLARLLKSSHPEDLRAANKLIKEMVQEDQKRMEKISKRVNAIEEVNNNVKLLTEMVMSHSQGGAAAGSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEILQANDNLTQVINLYKQLVRGEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADP-ribosylation factor binding protein GGA1
publication title Crystal Structure of Human GGA1 GAT Domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 51
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03127 GAT GAT domain
A PF18308 GGA_N-GAT GGA N-GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1oxzA01
1.20.58.160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1oxzA02
2VRSA 2W6AA 3HE4A 1GD2E 5AVUB 2Z5IA 1G2CB 4JYCA 1T2KC 3KDPB 4GKGA 5APQA 3VTPC 1H8AA 1JNMA 1GU5A 3P8MC 5APWA 2JJLA 4LC1A 2WPRA 1WR6A 3NFQA 3HTKA 2P7JA 1HWTC 5AVVB 1GZLA 4M3LA 3IR9A 3M9BA 3LIDA 3HE5B 3VMYA 2WT7B 4AYCA 3A2AA 5AW3B 1A02F 1GK4A 1FOSE 2Q5UA 1CZQA 1GTWA 2ZFCA 5AVYB 2XV5A 3M9HA 5AW9B 4JYBA 5APSA 4I6MC 5APYA 3VMZA 2WTYA 3TYYA 1J2JB 3P7KA 3HE5A 2C9NY 2WT7A 3NMDA 1X8YA 3L36A 5AVRB 1IO4A 3L37A 2R32A 2QM7A 3VN0A 3B8EB 2E42A 5APTA 2XZRA 1CI6B 2YO2A 3L35A 3MGNA 5AVQB 4C46A 1MUUA 4AUWA 2W27A 2ZXEB 4XE5B 1A02J 3P32A 4AQRD 2R3CA 5AVWB 3OAKA 5APXA 2XU6A 3NXSA 5AW2B 1GK6A 1HBWA 1HUCA 3M0AA 5AW5B 4B86A 2WPQA 5AW1B 1GU4A 1CSBA 2R5DA 2Q7CA 3A5TA 1S9KE 5AVSB 1T2KD 1CI6A 2C9LY 1JUNA 2P2UA 1MFZA 1KQLA 4KHXA 1HJBA 1OWAA 1NWMX 1NAFA 5AW7B 1MV8A 5AVZB 5APUA 1X79A 3NTNA 4C7NB 3SWFA 3V4QA 2YO3A 4I2LC 5AW8B 3VYIA 4DZOA 1OXZA 1H89A 3VMXA 5AVXB 1NWQA 5AW6B 4EOTA 2E43A 3A3YB 2Q3IA 3LIEA 1SP4A 3V4WA 1DH3A 2Z5HA 3V5BA 5AW0B 1YYCA 1O3XA 3A7OA 2N9DA 5APVA 3TK1A 2R5BA 1H88A 5CMZA 1FAVA 3TNUB 1WRDA 3M91A 4C7NA 3M06A 4RESB 5AW4B 2H7HA 3KQGA 3M0DA 2IPPA 3HE4B 3T97A 1YD8G 1S9KD 3I5CA 3O8ZA 2N9BA 1SLQA 2QM8A 2WWWA 2YNYA 2WPSA 5AVTB 4HYTB 4GT1A 1FOSF 3UIAA 2P67A 3MD0A 3TNUA 2N2NA 2BASA 2KP8A
chains in the Genus database with same CATH superfamily
4DBQA 3WU2E 4DNDA 5BU5A 2V26A 3V2QA 3CIRA 2JR8A 4IHJE 1B7TA 5KLVE 2V7KA 5APWA 2KWIB 2UWJE 1HS7A 2H88C 2KS1B 2E76B 3CXHI 3AEFC 5HWXA 2B1EA 2D2CD 2Y0DA 3Q2YA 2PFXA 5AVVB 2XM2A 4EEBA 1NU1G 3CC2P 3GW6A 2CE7A 4DR5T 1QL2A 3PUVF 5H2FE 2A72A 4HWDA 3ZMUB 4DV0T 5AW9B 2B87B 1HG5A 4A56A 3PUYF 4DV5T 3K8PC 4B6XA 2H7OA 1PP9G 1SFCB 1Q86Q 5HCJA 2O3JA 4YTNA 4KMCA 5GTIE 1IFMA 1VF5B 2RKLA 1ZP0A 4I4TE 2MPKA 3O4XE 1UGOA 1YXRA 3Q5EA 2QM7A 2D2CB 2VWAA 5HXSA 2FFDA 5LXTE 5CBNA 5AVQB 4ADZA 3FXDB 3AECA 2QSIA 4ZOLE 3MZKB 1Y8AA 4YSZA 4CZZB 5CJ4A 2FYNC 3P32A 5J2TE 4BWNA 2LRKA 5FYMA 2FBWA 3FB2A 4PV1D 2BBHA 2H3RA 2R5DA 4O9BA 1DX7A 3BVHA 2JKVA 1G8XA 3IAOA 5FVLA 1MFZA 5L8RJ 5JDLA 1QGKB 3CX5D 4AKRB 3C8VA 4KT0J 1N73A 4X20E 3BCCJ 1HCIA 2YO3A 3P4RA 4IE4A 2KI7B 1RQVA 1JY2P 2ZM6T 1NU1J 3BASA 5CCGC 3L75E 1O3XA 1U7JA 4GODA 1XMQT 2R5BA 3ZMVB 1L4AB 4PV1B 1DIPA 4X1YE 4BAYB 2E5YA 4HWFA 4IE5A 5HYAA 4B3TT 1PP9J 1S5LX 1NTME 2W4XA 2MJZA 1T8ZA 4YTPA 2ITAA 2P67A 3RGUA 3TNUA 2PFVA 3H1JE 2DW3A 4OGQD 1RF1A 3QB5A 3NRYA 1W0BA 5JQGE 1UX5A 5KKZB 3CWBG 4EAHA 3Q5RA 2HPCA 3TKLB 4AQFC 4DR4T 2RP4A 3LK42 2JQHA 1EZVD 4WY4C 4M1PA 2ZVOB 3P4QA 1QSDA 1JTHB 3PU8A 3CCRP 2P7JA 2IBZG 1ZV4X 3IR9A 2WSSV 3LIDA 3CCQP 2K9AA 2WZ7A 2XQYA 1Y64B 4IDNA 3L71E 5C8YE 5CCHD 1NAYA 4OGQB 4ILCA 3PP5A 3ONXA 3C50A 5HEOA 2IFMA 1JNZA 2CXDA 2BG9C 4ILAA 1HH0A 1OW6A 5LA6E 3RYHE 2YKPA 5AQFB 2KSEA 3NMDA 3L36A 2BS3A 5AVRB 5KLVD 5CCHA 3L72G 4N3YB 3H1LG 4WZXA 4IOIH 4C46A 3RGLA 4JI8T 3FGAD 2W27A 2ZYGA 2X9WA 5CHXA 2A3DA 4EB6E 2CRBA 2WM9A 1ZKEA 3AEAC 3CL3D 2V7IA 3MA9A 3A5TA 2AXDS 2W61A 4U33A 3ABVA 2E2AA 1US7B 1NWMX 1MMDA 5KXJA 2XDJA 3RBXA 4PAGA 2V4HA 4ISTA 4KUMB 3C9IA 3FZFB 1NHLA 3P50A 4DV3T 3CCEP 1OW8A 1RH5B 3X1DA 2DCFA 4ILUA 1IFPA 1R8EA 4ASWA 1T3UA 3GMIA 3VKGA 1SFCC 2J5UA 3N5LA 2HODB 3AE5C 1VF5C 1IZNB 3AXJB 3JC6C 3T97A 2WAUA 2A45I 4QHOA 1ZMEC 2NOXA 2WSSH 3Q1MA 1YQ3A 4H13C 4TN7B 4IL6H 1QLBA 4YSXA 3HKEE 2ZT9B 3L72J 4KP3C 3CX7B 3ZCJA 1SQBE 2NTYA 2CPTA 1SQVE 2YKOA 3QH9A 2ZLYA 3N9PA 4X62T 1GU5A 3PHLA 4PW8A 3TSIA 1VQ6P 4TWFA 3BRTB 1K9MQ 5L4EA 4I0UA 3OJAB 2K1AA 2M3EA 2KSJA 5E79H 3RK2D 4UXNB 2FY8A 5LB7B 2X9YA 3K3OA 2K48A 4RKUJ 5JRCB 3B57A 4EYUA 1PIXA 3OVUA 1M1JA 4IL9A 3CCJP 3P4PA 1NTMD 1L2PA 3NBXX 4UVAB 1IC2A 1L0NE 5FXVA 5J1GA 4GDOA 3OA7A 3H1JD 4JYBA 2IBZI 3PUZF 4QXCB 3L73G 3AA6B 1ZRTE 3HA4A 2NPSA 3USSA 4IL6E 3TLUA 4TUYE 2N1TD 3HL6A 2XKMA 2WQYA 2KLUA 2FXOA 2YOEA 4N78E 1S35A 4A97A 3AEBC 5TJHA 1J5ET 2N1TA 1S1CX 4EDFA 2FYZA 4XFJA 4LMJA 2R44A 3TDKA 2W67A 5LHIB 2J58A 3L71D 4LF5T 2P10A 1IJ6A 4U72A 4W7YA 2L8KA 3IHRA 2UXDT 1CI6A 1BDCA 3ONJA 1PV3A 4W80A 3W68A 1NTZK 1NENA 1S94A 4YXWH 4K3AA 1UX4A 3AEEA 3J9X1 5EK2A 3OTOT 1GL2D 3VR9A 4Y99B 2YXRB 1WYCA 3RRWA 3RL0g 4C7RA 2NW8A 3F31A 1NO4A 3A0HH 3V2RA 3U1AA 4C7NA 4ZI7E 4TLFA 1GL2A 4PJ0E 3I55P 1T3JA 3RK3C 1AJYA 1SQPG 1MMNA 2LJLA 4PD4I 1OFCX 2KUBA 5KAFE 4HYTB 4GIFA 1QVGO 5LGUB 4X65T 4WVZA 3AEDA 2FKWB 2G8YA 5BVZA 1UUSA 3ZN0B 3E0ZA 3PUSA 2ODVA 2XM1A 5AQTB 5JDHA 1OMIA 3UFEA 3V5SA 2D2SA 1JEKA 3WUUA 5AQMB 2KNDA 1KNRA 1SQXK 4GOFA 3LK3B 2QG4A 2JQQA 4ASVA 1NTZJ 2N9YB 4HFBA 3A0HE 2VKOA 4EV6A 5EK3A 1DD4A 1PPJG 1GTWA 1PL5A 2XV5A 2HFED 3M9HA 4H63V 5AQPB 1SQBD 2Q6QA 2QA4P 3AA1B 1SQVD 4JBZA 1BR2A 5A1LA 4XAXB 4QX8B 3Q5XA 4AI6A 3GHGA 2PG8A 5AQLB 4AQGA 4X1IE 2ZT9C 1NJIQ 3L35A 3CQGB 1SQPJ 3ZEFB 4EZHA 5L2LA 3RBZA 4A7PA 3VU7H 2XQ8A 1R8IA 2W62A 4HE8A 1IFJA 2XAQB 1L0ND 2BG9E 1UIIA 3DP7A 1FZAA 2RN0A 4GOUA 1BCCE 5KAIH 3WI3A 1ZRTD 2C0SA 3CXHE 5E0OA 3FZLB 1KYOI 3VRAA 3N4XA 1VQPP 4PJMA 1V9DA 1JNRA 5GTHH 1M7LA 2X0LB 3RL0B 1LP1B 2IZ0A 3CWZB 5AQSB 4L5GA 5L3EB 3K1SA 2W66A 4N78D 1AVOA 5H6RB 1M8OB 2Q3IA 1FDOA 2XAFB 3D6YA 1BGYG 4O2BE 3D0TA 2H88A 3UU5A 5HEJA 2MAWA 4H9SE 4ZNCA 3AEFA 1MMGA 3UTKA 1BSHA 2YXQB 5AFUL 1URQC 4TWDA 2IPPA 3NZQA 3AE3C 3RQUA 2LM9A 3I1AA 4PK5A 3PRJA 1SQQK 1OEDC 3MXZA 2YNYA 2BS2A 4U3FG 5KAIE 1HX1B 2V7JA 2L3LA 2VRSA 2LKHA 2V6YB 1KTMA 4H63H 2D0UA 3L09A 3H1HG 3VTPC 2PGDA 5GTHE 4OYKA 3L4FA 1ZHCA 3ANWB 3VRBA 3G06A 3IN6A 2WZIA 4LMKA 3N7NA 5FL1A 2E9XA 2Q9IA 1HNWT 3O1JA 3N9NA 2BCCG 2AEFA 4NPEA 2KNCA 4AIUA 2YINA 3BRVB 4I50E 2V6XA 1S3JA 3FX0A 1MFTA 1H7CA 4FJOA 3L74G 3GA8A 2IIUA 2FYNB 2KNCB 1WR0A 2WTYA 2MYSA 1NTKG 2OTKE 5CCGD 1J2JB 4WBAA 3EDVA 1BGYJ 4Z1MH 1N7SB 1XTGB 4C90A 5M1BA 2WB5A 3KINB 2HLOA 1D0XA 2P58A 3EUHA 1RF0A 5CCGA 3E08A 1EXJA 1MIWA 5AVWB 2EHOC 4JEUB 2IFNA 3HD7B 4BRYB 1VQ9P 3AAEB 1GU4A 3CQCB 1XDOA 2P1JA 1NOHA 1PGQA 4IE7A 4K0UA 5C3JA 1OVRA 5AQOB 5JR9B 4DCKA 4Z91A 1S72P 5BMVE 5ABHA 3O6QA 3M3ZB 1L0LK 1I94T 1YJWP 1FMWA 4WY4D 3SFEC 2XQ3A 2QRXA 4I2LC 3BCCE 1VQOP 3FXEA 4IE0A 2E75C 4CPGA 3L74D 2V7QH 2A2FX 4AQFA 2LXBA 3T1YT 2OYIC 3RKOA 4WY4A 3TK1A 3PDYA 1QX8A 4R4LA 1XNQT 4U7JA 1D0ZA 1EDLA 2KMFA 4HFHA 2ZXXA 3F5HA 1YD8G 1NTKJ 3WU2H 4H9PC 3PTZA 1BCCD 2AXCA 4K35A 2RMZA 3CXHD 2FYUK 2OYHC 2RPAA 3H32B 1Q7YQ 2BG9A 2WITA 5CBOA 3SWHA 1T2KC 3WAKA 1P84I 1UCUA 5LG3A 3A0BH 2OA5A 4G63A 4B3ST 5LGNB 3HKCE 2FJEA 2YMYA 2WS3A 3N9OA 4MN4C 3RK3E 1KD1Q 2BG9B 1HGZA 3NFQA 4ZXLA 1HF9A 2PAJA 5L3DB 3RL0C 4NPFX 2XQ5A 4LFAT 3M0DC 1N2DC 3CC7P 4ZKUA 4OYJA 1R5SA 3ZC0A 1L0LJ 2NZ2A 4H44B 2IC9A 3AEAA 3JADA 3CCLP 4TT3H 5GTIH 1HGVA 2YDSA 5AVYB 2J59M 1Z8UA 2KS1A 3IEEA 3VMZA 4ZI2C 1ZR2A 2HPLA 3C51A 1SFCD 3ZJ2A 4A98A 4OH8B 2DNXA 1RE4C 2Q3EA 1AVYA 3ZC1A 1VF5D 4ZI3C 3JC6D 3A0BE 2E42A 2KT9A 2B87A 2BKNA 2YU2A 3RYIE 1W5CE 2VB6A 4AUWA 1SFCA 1NU1K 4ZZBA 1SUMB 2Q9QB 2B89A 4H13D 3BQKA 3II6A 4AXPA 2FYUJ 3UQ7A 1XWMA 2W2UA 1HUCA 1KFNA 1YTZT 4O4IE 1XNRT 2CPSA 5AW1B 2WU2A 4MLKA 1D0YA 4YSYA 4DIDB 1OW7A 1FU1A 3FXDA 2P2UA 1KQLA 4DV2T 2E5LT 4HTEA 3SWYA 1T8BA 1JY3O 2NP9A 3KPEA 4HN9A 2ZMAA 3Q2MA 1IFIA 3UUNA 4HFCA 1E7PA 2JDIH 3MHVA 3RH3A 2FJAA 2A06E 5JTGA 3GWHA 2I1JA 2W00A 1HR0T 4JF7A 4GYSA 4H13B 3A3YB 3JAFA 5CB4E 5KLIB 1DH3A 4U2ZA 1LTJB 2L91A 3C4XA 3E22E 5AW0B 2BKOA 5FY1A 3UULA 1FIOA 1FAVA 1L4AD 1N7SC 1VCTA 2XSBA 2XZEA 2ZM0A 3LFMA 5JDMA 3OYZA 4IFMA 2J4GA 1EZVG 2N9BA 2QM8A 3G9RA 3RLFF 1L4AA 2WDQA 3AE1A 4D6TE 3CPZA 3HD7C 4EIWA 3U78A 5DJUB 3BCCD 3CQXC 2LR2A 2V7MA 2JIWA 1U57A 5JR9C 1E2AA 1HNZT 2BVLA 1XMOT 3EFGA 5F5WA 3AE9C 1J1JA 4TNWA 4DR6T 2G0UA 3Q5DA 1GW4A 4B3RT 3P4SA 4TV9E 3CD6P 1YTZI 1VQ4P 1OEDE 4COFA 3AAIA 2XNXA 3AVRA 4LGDE 4M3LA 3DTOA 5KLVG 3FZHB 3UU3A 4AYCA 4X66T 3A2AA 1A02F 3RYCE 4W7ZA 3CMAP 2ZAEB 4H9QC 1FDIA 1JTHA 4I6MC 3EI0A 2LHNA 5HXHA 4JV5T 4YTMA 2H89C 3P7KA 4MBQA 3BQIA 4IDQA 1FZCB 4H0LB 1X8YA 3AE4C 1Q81Q 4JI0T 1Z56A 4PD4E 2QGSA 4QH1A 3RK3D 4XA4A 2BEZF 3NVOA 3R2PA 4A5XA 5BU8B 2C5KT 4TV8E 3ZYLA 4ANJA 1OZHA 4DVDA 2WDVA 4OVNF 1FMVA 1HBWA 3CX5I 5C39A 2PBIA 1HJ0A 2D0TA 2LT3A 3HI2A 4PJLA 2E74C 1LTBC 2HYNA 4H44C 3RK3B 3H1IE 4NIQA 3C98B 4DZOA 2X0HA 3NZPA 2GUSA 1KB9H 3CKDA 2J62A 1D1CA 2R6GF 4G2AA 3LIEA 2J1DG 2Z5HA 5ADXL 2X67A 1LTSC 4AQYT 4DUYT 1H88A 5CMZA 4IFFA 3KV9A 2WSCJ 2KIKA 3CWBJ 1YW0A 2Y9YA 3L75G 5DQVA 2M5AB 3S1KA 1FBMA 2HN1A 3P8CE 2Q9QC 5LP6E 2HODA 2ZT9D 3AXJA 5JDFA 3HR0A 1Q2NA 4PJJA 1HG2A 1NTMG 2A06D 2YKSA 1G2CB 4JYCA 1VQLP 5JVDE 2WBLA 5J0ZA 1KILB 1H8AA 3PJAA 3LW5H 3RYFE 4GYRA 2ODUA 3H1JG 3W67A 1KB9E 2WPRA 3MIWA 1FE6A 4H9RC 3F57A 4QKNA 3AE2C 1HTLC 1KFMA 5KLIC 1LTJC 1NTZE 4DR7T 2X9HA 5DJQC 2XAJB 3OJAA 1D1BA 4CN4A 3PTRB 3H1LJ 5L3FB 4HEAA 4D6TD 1WT6A 1N36T 5ETWA 3N9LA 3L71G 5JRCA 2FUPA 3FBLA 4CXXA 2W6BA 3L75D 1WMKA 3Q5SA 1N86A 2NR4A 3DJBA 4PFOA 3ZMZB 1DD3A 1WCRA 1URQD 2JO1A 4NXNT 4KBMB 4ZEYA 2O01H 3ZMSB 3PV0F 2KOGA 1RY3A 1ZOYA 4HH2A 1QVFO 2KZIA 3BQLA 4PJNA 4DV1T 4ZS3A 5CJ5A 1URQA 3M0AA 1YBKA 1VCSA 3CX8B 3AE3A 4GK5E 1J1DC 1JUNA 3HRNA 2F4VT 1OWAA 2VASA 5AVZB 1URQB 3VP9A 1U5PA 2FJBA 1XDPA 1KFYA 3AE8A 3SWFA 5AW8B 1OXZA 1PGJA 1OEDB 2FXMA 3GMAA 3VMXA 2CA5A 4PD4D 2WDRA 5AQUB 1HX8A 1SQXE 4K0KT 2HH7A 4PJ0H 1SP4A 2HG5D 2VL8A 5LHGB 3V5BA 4KX6A 4JPZB 1G1JA 3A7OA 3CLQA 5APVA 1WRDA 5KAFH 1FZCC 4H0LC 3M91A 4AKGA 4MFRA 4RESB 3VHLA 4DV7T 2C0XA 3TLWA 1AQTA 2WSFH 1M56D 2MOZA 3T1HT 1E79H 1E5WA 1FJPA 3L71J 5KDMC 1JY2O 2UUAT 3HUSB 2H43A 3W15B 3S4UA 3V5UA 2LLYA 2OV9A 5JDQA 1FZFA 4YTPC 3J7Yq 2BASA 3H1ID 3HTKB 2W6AA 5EFWB 5L4HA 2YDQA 3L70E 5APQA 2EHOD 4YHJA 1FDMA 5AQQB 4WW0A 5FKYA 5JH7E 1DEEG 1RF1C 3PUWF 2VVSA 4ZHQE 3RC8A 2YIUC 3RIUC 3D6ZA 3ZSSA 2AE9A 4H9NC 1W2BO 1SQBG 2OYOA 4QXBB 1SQVG 1LVFA 1J5WA 3L73J 3KV5A 1NKNA 5BR8T 1SQPK 1FS0E 5FNVE 2EHOA 3QK6A 2WT7B 5AW3B 5KMGP 2YMKA 4IDZA 4GK0E 2W6JH 1Q82Q 4IDOA 4Y28J 5CA1E 3P8CD 2QEXP 2DL1A 2E75D 3UUXB 2EHOB 1BDDA 5L47A 3JAEA 1T72A 4EOZB 1L0NG 5LG4A 3PUGA 5DJTB 3AEGA 3KDSE 4KI0F 5IWAT 2QJPC 2GM4A 1BGYE 2JWAA 1KB9D 4QH5A 4DBRA 2KYVA 2I1KA 4UF0B 3AE6A 4R4MA 2ZJSE 2NTXA 2OYIA 3AB3B 2VQET 1X79B 1SQQE 1KILC 3OAKA 1H0TB 2PJQA 3CXHH 2K9JB 2E75B 1NTZD 1P84E 1ZN5A 5FY7A 1ZW0A 2QYWA 1WRGA 3N2GE 2E8IA 1T2KD 2C9LY 2OYIB 4E7SA 3Q3DA 2BEQD 1YQ4A 5AW7B 1MV8A 5APUA 3ABVC 4QMAA 3I9YA 1KMIZ 1KZUB 2OYHA 5ABEA 1SQBJ 4EEDA 4E7ZA 1BE3E 3QUJA 3RL0D 4UB8E 1NEKA 4RJTA 3CC4P 3VKHA 1UURA 3LJCA 1K05A 5IYZE 2K9YA 4CN1A 4YXDC 2XQ9A 1RHZB 3CCVP 2KZJA 2OYHB 2QJKC 3I0OA 3E7KA 4YPCA 4DJGA 1M1KQ 2WZHA 5AW4B 3PE0A 1LP1A 4LLHA 1RE3C 5FVKA 3M0DA 4ZI2D 3HE4B 4I1LA 5LGTB 5HWYA 1VDFA 3I5CA 4HGAA 3LDQB 3H1KE 3O8ZA 3F89A 2WSEH 3TGUE 4P0BA 1L0NJ 4ZI3D 4GIWA 3MD0A 4YJ3E 3SOLA 1PZQA 2KXPB 1YQ3C 2BVMA 3VR8A 2XAHB 1YJ9P 3CCUP 2W63A 3ESLA 1RE4A 2ES0A 1W2EA 3KDPB 3ZN1B 1SQXD 2SPCA 3RX6A 1IK9A 3ZMTB 2O1JA 3KYQA 2KB7P 4GOEA 4IL6X 4X5TA 3ETVA 1EC5A 4YY3T 2IYOA 2V6YA 1KC8Q 4I55E 2WWVA 2WWUA 3PH0A 3V6IA 2W83C 2YKQA 2IMLA 3ANWA 3GG2A 1FOSE 5HXCA 4OFZA 1L0LE 2UXBT 2YEVC 1HTJF 2LHRA 2XSAA 4LF9T 2G3AA 4HWHA 1YKEB 3MTUE 3TYYA 3EVYA 4ASKA 1K73Q 2CEAA 2HHHT 3L70D 1X22A 2NPSC 1N7SD 4UR9A 3HUSC 2XTLA 3CVRA 5LNKA 3G3ZA 2CBIA 5FL0A 1VQKP 2POHA 1QUUA 5FMNA 3MGNA 1Q90D 1LKXA 4U31A 4XE5B 3F2EA 4QXHB 4I7ZB 4IGUA 1PFIA 3CI9A 2R3CA 1N7SA 2IX7C 2LKMA 3NXSA 3HD7D 2K3RA 5AQJB 2QE7H 1CSBA 2CMRA 1FC2C 2FYUE 2Q7CA 1AQ5A 2M67A 2LOSA 1NTKK 4HWIB 3CCSP 3V2NA 3S4RA 2M6BA 3EFFK 3HD7A 3L8RA 4BRYA 2ACXA 3B5MA 1LJ2A 2Y9ZA 4EYYR 1BCCG 4BJMA 2OGUA 3CCMP 5AVXB 2K88A 5JR9A 3LBXB 1S5LH 3AE9A 3GF3A 2NRGA 3CX6B 4WNKA 5F8PA 4U3FJ 3GN5B 1SQQD 1D7MA 4IFDK 1P84D 3H1HJ 2YDRA 1SA0E 2RH0A 2QJYB 2WPSA 4ERRA 3UIAA 3B5NB 1VRBA 3PUAA 3C4WA 2BCCJ 5B5EE 5CA0E 2XHEB 1BE3D 4TZ4C 2H89A 4ZMDA 5AVUB 1W09A 3L3PA 4Q25A 3EABA 4AKHA 4MALA 4UV8B 3AE4A 1NU1E 2LRLA 3O9XA 4QX7B 3RIAA 3P8MC 5AQGB 1N34T 5HEUA 2Y0CA 3L74J 4L73A 1Y47A 4UVCB 1S5LE 2OLTA 3UU4A 3H32A 2DLRA 3A5XA 3ZT6A 3HE5B 3MUDC 2E74D 2CBJA 1PP9E 2KK7A 3H1KD 4H44D 1YIJP 2X51A 4L9IA 1LRZA 3T8OA 3TGUD 3WUVA 2Y48B 2A45H 5AQKB 3E1IA 1CHUA 1BCCJ 1MIVA 5APSA 5APYA 4QH4A 5EK4A 5M4YA 5LOVE 3G6EP 1G73A 2XJ7A 1IO4A 2CXFA 3IF8B 3EAMA 3VN0A 3B8EB 2JPFA 2X0YA 4F8HA 1KQGB 3SFDC 4LF4T 5APTA 1S2EA 2WPVB 2E74B 5TISH 2HN2A 2ZXEB 2IDOB 3K3NA 2ZYDA 3KVBA 2Q9QD 4AQRD 4O2AE 2XU6A 5LYJE 1GK6A 4KHPT 1JCCA 5AW5B 1UK5A 3JCFA 1L0LD 3RHWA 4LFBT 2JMKA 3ITKA 2XY8B 4CXYA 1N7LA 5AQVB 5EZYE 1LT9B 3HKBE 2VKDA 1LGHB 3ONLC 3A8YC 2HPJA 2ZM2A 2Q9QA 3UU6A 2XQ7A 2JWDA 3C64A 1M57D 2UU9T 2AEMA 1KF6A 3VYIA 5ABFB 1JCDA 3AE7C 1H89A 1NWQA 5AW6B 2XPKA 3RIFA 3ZCIA 4EGWA 5KJ7C 1KILE 1K04A 2D5UA 3AE5A 2ACZA 3MZWB 2N9DA 3CMLA 1LWUB 3BCCG 2FJDA 5TISE 3GLMA 1SE7A 1FJGT 1MNEA 2PRRA 1LNQA 3FBZA 1CW5A 4AKLA 4CN6A 1VOMA 4DR3T 3PU3A 2FYUD 1FJKA 3AE2A 4IDPA 2JQ9A 1LTJA 4O4LE 1T98A 2Q1KA 2WWWA 3CWBE 4I7ZC 1JMMA 1FZBA 3SRZA 1U4QA 3N2OA 3QB5K 3RF1A 1NKZB 2R3SA 3PURA 5FXXA 3KXDA 4Z8XA 5LMUT 2C5JA 2IBZE 1USEA 3U1CA 3CMEP 1GDTA 2V5DA 4UVBB 2O1KA 5F3JA 4P09A 4IIJE 3V2PA 3KBUA 2LSKA 2CWOA 2E9XC 2CK3H 4IREA 2LSIA 2QIWA 3UFGA 1CZQA 1IBMT 1VQ8P 3L72E 2NW7A 2FFDB 3O1IA 4PD4H 4CI1B 2CHNA 3H1LE 4HKZH 1E1HB 5L3GB 2JRKA 4JQ0D 1J1DB 4H0LD 4WBNE 1NU1D 2IW5B 2LKGA 2IHR1 1LTIC 2QJYC 2R32A 3AEBA 4YHHT 2CLYB 3B5NC 2KINB 4O4JE 5AQRB 4WYVA 3MACA 2JJ9A 3LSVA 1MUUA 1A02J 5KLVK 3ZJ1A 1RF0C 2A45G 1YHQP 1N73B 1FZCA 3C1LA 1PP9D 2M8RA 2IAKA 2WPQA 2KSRA 2OTJP 1S9KE 3NWIA 3VMAA 2BDEA 3EHZA 2DHRA 2NW9A 5KTBA 1K8AQ 4YFSA 2ZM8A 4UV9B 2VL0A 3VOPA 3SWKA 5TAOA 4HFDA 1HFAA 4GKJT 4JI4T 4JI2T 4XBFB 5C2TA 2VK9A 5CGMA 4LF6T 4L76A 2UXXB 3PJSK 4PFPA 3RIUA 2V8SV 3KV4A 3N2KE 4YJ2E 2V7QJ 3UQ4A 2A06G 3TNUB 3AA7B 1KQSO 3MJXA 1RF1B 1KNPA 4NUVA 2K3WA 2YIUB 4UEMA 3Q5PA 2HPCB 5AVTB 2V1DB 2BKPA 3S9OA 5HXRA 1FZGA 1X9VA 2JMHA 5JREA 3QOFA 2Y6XA 5JDGA 4OHFA 1SHZC 4IL4A 3U59A 4H9OC 1Z0PA 3WMM0 5KLVJ 2KLQA 3D71A 4TWHA 3R6NA 1KYOH 3OW2O 1I6ZA 1AFOA 1LT9C 1MKMA 1KILD 3K3QC 2M5AA 4D6TG 1MZ9A 3N9MA 1S4XA 2LSGA 1KEYA 1TU3F 4HFVA 1KK7A 3ZLIA 1OX3A 1GZLA 3E1RA 1BR4A 1G2CA 3KV6A 3L73E 2QJPB 1KILA 2WU5A 3EWKA 2AXTH 2YN6A 2KLVA 3EDUA 3RI5A 3R4YA 2Q5UA 4ISSA 3CWBD 1LWUC 2O01N 1W0AA 2W90A 4NUUA 2IZ1A 1EZVI 3PJAJ 1ZR4A 2E5VA 2OTLP 1MMAA 1NTMK 4HFEA 4JI7T 1MNDA 1Y9BA 4WB4A 2LE8A 5HAXA 4NXMT 2E76C 1XTCC 1IK7A 3OPCA 4X64T 2IBZD 3TLTA 1LTGC 4CQIA 1KNZA 5FP3A 5B66H 4U3CA 1KYOE 1PGOA 5AQHB 1OIPA 2UXNB 4Z90A 4YXDA 2MTQA 2HR3A 5H6QB 3RKGA 1IAPA 1EDJA 1M62A 1LVKA 4UELA 5APXA 3I9WA 4B3MT 1RE3A 2VKHA 5FY0A 1EDKA 2ZYAA 4L75A 5AQIB 4I43B 5LHHB 1AA0A 3L72D 2QJKB 1KV4A 2AXTE 2D2CC 2IYPA 4P1NA 2K37A 3AAAB 3H1LD 4DMWA 3B4SA 4D6TJ 2M6IA 1ZP0C 2NWBA 5HEGA 2K24A 3ZSTA 1DEBA 3T97B 2PTFA 2LM2A 5DQWA 4P0AA 3L75J 3A7MA 4EOTA 2E43A 2FFDC 1FZEA 4EI2A 4HJGH 3AECC 1SQPE 5B66E 1ZXGA 4WBOA 2L9QA 4HB1A 4BJNA 3H1IG 1WFDA 1M90Q 4GKKT 1MIYA 5HXEA 5LJNA 3JCUH 3ZKRA 3MK7C 4JLEA 5JDNA 4JYAT 1NTMJ 1OEDA 2CLYC 2FBWC 1VL2A 1S9KD 3B13A 4UB6H 3AVSA 1PGPA 2C0WA 2NPSD 1WLXA 3H1JJ 2W8ZA 3FWLA 1N73C 5LBMA 3M9QA 2N2NA 2KP8A 3HKDE 4ILBA 1BSNA 1L4AC 3AE1C 4PV1C 1M7KA 2B9BA 1GD2E 1JOCA 1M1JB 1JNMA 2CPBA 1AV1A 3HUSA 4XZCA 1BR1A 3RK2B 2BS4A 4UIGA 1J1EB 1PPJE 3HTKA 2I6HA 1HWTC 2NPSB 2YU1A 3M9BA 2BZBA 3U3IA 1NYHA 4F6RC 2M3BA 2WY2A 3JCUE 4C91A 1OVVA 5KKZC 1VQMP 5E79E 4UB6E 3Q5WA 4NPDA 3NRXA 4TNVA 4OWFA 1JY3N 4YLHA 1JB0J 2FXPA 3Q9DA 2N1TB 1AJ3A 1NTZG 2X9XA 2WT7A 2XASB 1GQEA 4BXLA 3H1IJ 3I0QA 3L37A 1SQBK 2GK9A 1NVOA 1SQVK 2OARA 4AISA 1P84H 4NPPA 3D70A 2XZRA 2XQAA 1CI6B 2P9BA 4OGQC 2QA7A 3CK6A 3KVAA 3P4WA 4CI2B 3UU8A 4TX5A 3L73D 2K5BB 3BK9A 3UUBA 1XZYA 4IT4A 1R5LA 3RC3A 4UF0A 4UB8H 4JI3T 1JMBA 2GA1A 5CJ0A 3SFEA 2CCQA 4PK6A 4HFIA 1X79A 2DI4A 1L0NK 3AA0B 1IJ5A 4O4HE 1H0TA 2K9JA 4C7NB 4U7IA 4U7YA 5CCHC 1GL2B 3G71P 3TLVA 2XQ4A 1KYOD 3OBVE 5LMNT 4CXWA 3MP7B 1YYCA 1JO5A 2SPZA 1QLED 3KBTA 1X0TA 2V5CA 5CFBA 2LOPA 2XNDH 4HKAA 3ZDMA 1FEWA 3IA3A 3WAJA 1SQXG 4U3FE 1IBKT 4FI5A 3MUDA 3MKDA 3R84B 5DABA 3VP8A 3KZIH 3H1HE 4DUZT 1IFNA 2Z4EA 4PNIA 3N9QA 1SQVJ 4JI5T 1T6AA 3ETUA 2UUBT 3H6PA 4U74A 2WCAA 3HE4A 2VKJA 3ZYKA 2UXCT 2BCCE 3SS1A 1QL1A 2AEJA 5KX5E 2CM0A 4J2CA 2LSJA 2UUCT 1SQPD 4LC1A 3SFDA 1WR6A 5ABGA 3LW5J 1DU2A 3CPWO 2KZ7B 4QWNB 3IBPA 4BA9A 3L70G 3L74E 3L39A 2WP9A 2CWYA 3KFWX 3RPUA 3FZKB 1EZ3A 4YT0A 3ZYMA 1NTKE 2I0MA 1IFDA 3VMYA 1UIXA 3GHGB 1GK4A 2I59A 2XUEA 2J47A 2ZFCA 1SS1A 4CI3B 2ZVNB 4EZ4A 2PP6A 3H25A 2JQKA 3H37A 2MKVA 3KZIE 5KJ7D 4AKIA 1KQFB 1KB9I 2C9NY 4JBWF 3PLNA 3NKZA 2M0BA 3KHUA 2E5TA 3AE7A 5FXZA 5LJMA 3ZPOA 4O8SA 4WWIA 1SQXJ 5KJ7A 2YO2A 1PPJD 2B88A 2Y0EA 1HF8A 1U7MA 4X1KE 1JY3P 4L0RA 2VVNA 1M1JC 2O01J 2LXCB 1ZOYC 5AW2B 5LBQB 5HCMA 3FWNA 4B86A 3M65A 4PK4A 5AQNB 1W9RA 3RK2C 4DT0A 1J1EC 2A9UA 2WMMA 4LFCT 4KHXA 1HJBA 1SQQG 2RA1A 3H3AA 3PUXF 5IUXA 1EXIA 1LTAC 1YI2P 2QVAA 3NTNA 1BR0A 2WQYC 4V1Av 2Z6EA 3O1HA 4JUYA 4OX9T 4DOJA 2E9XD 3L70J 3AE8C 5GONE 3V4WA 4LF7T 1HNXT 2N1TC 1CUNA 4DR1T 4OK0A 1BE3G 4N6JA 2CHOA 1NH4A 2KWHA 4RO0A 2DWGA 2IUBA 3M06A 2N1GA 1N8RQ 2XQ6A 3KQGA 4EXTA 2L5GB 5B5EH 1YJNP 3LBXA 4U2YA 1SLQA 1KORA 4IE6A 5L3BB 2IC6A 5LCYA 2WSFJ 3CX5H 2VQFT 4Y99C 3JSVC 4MHCA 3QC9A 3GN5A 3B5ND 1BGYD 4ZKPA 2E9XB 3IF4A 2BBJA 1RQUA 3AEEC 1NGMB 4LMLA 4EIJA 3H1KG 5J2UE 1T7SA 4LF8T 4DMVA 2GUVA 2Z5IA 3TGUG 3TF5A 4GKGA 3GF7A 1ZEEA 3PUQA 3UUMA 3WUTA 2OQQA 2H7VC 1ZV8A 2JJLA 3B5NA 2D9DA 3EQ2A 3QNUA 4KJMA 3C4ZA 2H8PD 5HEHA 2MBGA 3ZT7A 1VQNP 4U3FD 3LG7A 1GL2C 3H3MA 1GW3A 1SQQJ 2XAGB 4DV4T 3OKQA 1YITP 1YKHB 2JP3A 4ZZCA 1HVVA 1EDIA 1N32T 3H1HD 4DR2T 1X9BA 1LTTC 5K5GB 1USDA 2X68A 3FHNA 3UT5E 1KN7A 2I8DA 3I56P 3CX5E 3AEDC 3HE5A 1D1AA 3OYXA 2BCCD 1L0LG 3G4SP 5L3CB 3K5BA 1BE3J 4EYYQ 4JI6T 1Y01A 3LK2B 1G1IA 1GMJA 3AEGC 2CXLA 1VQ7P 3O6QB 2X66A 5FXWA 3RRCA 2C5IT 3BATA 3AE6C 1NTKD 1QEXA 4DO0A 1VQ5P 3FXEB 1JY2N 4ZS2A 1N33T 5AVSB 3H1KJ 1IBLT 2Y8DA 3TGUJ 3QWOC 3ZT5A 1NAFA 1SVFA 2VURA 2WMOA 4DV6T 3P7IA 4WY4B 2LEHA 1LT1A 1YQ4C 4JI1T 2FYUG 3JC22 3GHGC 3V4QA 2YK0A 1VPCA 4L74A 1IJDB 1L0VA 2JEEA 1ZLLA 1LT9A 4HWCA 2WMNA 4JEHB 2B76A 1WYBA 2DWKA 2LSYA 1EZVE 1OVUA 2WSCH 2IDBA 3FZMB 4KHZF 2V7LA 1EQ7A 5H2FH 3RQWA 2H7HA 5ABFA 3TLSA 3SSUA 5IHYA 2W0GA 2E76D 3IFMA 3B71A 1JM0A 1FOSF 4GT1A 1LWUA 2WVRA 2WSEJ
chains in the Genus database with same CATH topology
4DBQA 4DNDA 5BU5A 2V26A 3V2QA 4IHJE 1B7TA 2V7KA 5APWA 2KWIB 1HS7A 5HWXA 2B1EA 5AVVB 2CE7A 1QL2A 2A72A 3ZMUB 5AW9B 1HG5A 4A56A 3K8PC 4B6XA 2H7OA 1SFCB 4KMCA 1IFMA 4I4TE 3O4XE 2QM7A 2VWAA 5HXSA 2FFDA 5LXTE 5AVQB 4ADZA 3FXDB 4ZOLE 3MZKB 4CZZB 5CJ4A 3P32A 5J2TE 5FYMA 3FB2A 2H3RA 2R5DA 4O9BA 1DX7A 3BVHA 1G8XA 1MFZA 5JDLA 4AKRB 1N73A 4X20E 1HCIA 2YO3A 4IE4A 1JY2P 3BASA 5CCGC 1O3XA 2R5BA 3ZMVB 1L4AB 4X1YE 4BAYB 4IE5A 5HYAA 2MJZA 1T8ZA 2P67A 3TNUA 2PFVA 1RF1A 3NRYA 5JQGE 1UX5A 4EAHA 2HPCA 3TKLB 4AQFC 2RP4A 3LK42 4WY4C 4M1PA 1QSDA 1JTHB 3PU8A 2P7JA 1ZV4X 3IR9A 2WSSV 3LIDA 2K9AA 2WZ7A 2XQYA 1Y64B 5C8YE 5CCHD 3PP5A 3ONXA 3C50A 2IFMA 2CXDA 1HH0A 5LA6E 3RYHE 2YKPA 3NMDA 3L36A 5AVRB 5CCHA 4N3YB 4C46A 2W27A 2X9WA 5CHXA 2A3DA 4EB6E 2WM9A 1ZKEA 3CL3D 2V7IA 3MA9A 3A5TA 2W61A 1US7B 1NWMX 1MMDA 2XDJA 4PAGA 4ISTA 4KUMB 3C9IA 1NHLA 2DCFA 4ILUA 3GMIA 1T3UA 3VKGA 1SFCC 3N5LA 2HODB 1IZNB 3JC6C 3T97A 2WAUA 2A45I 4QHOA 2NOXA 4TN7B 3HKEE 4KP3C 3CX7B 3ZCJA 2NTYA 2YKOA 2ZLYA 3N9PA 1GU5A 4PW8A 3TSIA 3BRTB 3OJAB 2KSJA 3RK2D 4UXNB 2X9YA 3K3OA 2K48A 5JRCB 3B57A 4EYUA 1M1JA 3NBXX 4UVAB 1IC2A 5FXVA 5J1GA 3OA7A 4JYBA 4QXCB 3AA6B 3HA4A 2NPSA 4TUYE 2N1TD 3HL6A 2XKMA 4N78E 1S35A 2N1TA 2FYZA 5LHIB 2J58A 1IJ6A 4U72A 4W7YA 2L8KA 3IHRA 1CI6A 4W80A 1NTZK 1S94A 1UX4A 3J9X1 5EK2A 1GL2D 4Y99B 1WYCA 3RRWA 4C7RA 2NW8A 3F31A 1NO4A 3V2RA 3U1AA 4C7NA 4ZI7E 1GL2A 1T3JA 3RK3C 1MMNA 2LJLA 4HYTB 4GIFA 5LGUB 2FKWB 5BVZA 3ZN0B 3E0ZA 3PUSA 2ODVA 5JDHA 3UFEA 3V5SA 2D2SA 2KNDA 3LK3B 1SQXK 2JQQA 2VKOA 5EK3A 1GTWA 2XV5A 2HFED 3M9HA 4H63V 3AA1B 1BR2A 5A1LA 4XAXB 4QX8B 3Q5XA 4AI6A 3GHGA 2PG8A 4AQGA 4X1IE 3L35A 3CQGB 3ZEFB 4EZHA 5L2LA 3VU7H 2W62A 4HE8A 1IFJA 2XAQB 3DP7A 1FZAA 4GOUA 3WI3A 2C0SA 5E0OA 3N4XA 4PJMA 1V9DA 1M7LA 2X0LB 3RL0B 5L3EB 3CWZB 4L5GA 4N78D 5H6RB 2Q3IA 2XAFB 4O2BE 3D0TA 4H9SE 1MMGA 3UTKA 5AFUL 1URQC 2IPPA 3NZQA 2LM9A 3I1AA 4PK5A 1SQQK 3MXZA 2YNYA 2V7JA 2L3LA 2VRSA 4H63H 2D0UA 3L09A 3VTPC 4OYKA 3L4FA 1ZHCA 3ANWB 3N7NA 2E9XA 2Q9IA 3O1JA 3N9NA 2YINA 3BRVB 4I50E 1H7CA 4FJOA 3GA8A 2MYSA 2WTYA 5CCGD 1J2JB 4WBAA 3EDVA 1N7SB 1XTGB 4C90A 3KINB 2HLOA 1D0XA 3EUHA 1RF0A 5CCGA 3E08A 1MIWA 5AVWB 2EHOC 4JEUB 2IFNA 3HD7B 3AAEB 1GU4A 3CQCB 2P1JA 1NOHA 4IE7A 4K0UA 5JR9B 5BMVE 1L0LK 1FMWA 4WY4D 4I2LC 4IE0A 2A2FX 4AQFA 2OYIC 3RKOA 4WY4A 3TK1A 3PDYA 1D0ZA 2KMFA 1YD8G 4H9PC 2FYUK 2OYHC 3H32B 2WITA 3SWHA 1T2KC 3WAKA 1UCUA 2OA5A 4G63A 5LGNB 3HKCE 2YMYA 3N9OA 1HGZA 3NFQA 2PAJA 5L3DB 3RL0C 3M0DC 1N2DC 4OYJA 4ZKUA 3ZC0A 2IC9A 1HGVA 5AVYB 2J59M 3IEEA 3VMZA 4ZI2C 1ZR2A 2HPLA 3C51A 1SFCD 3ZJ2A 4OH8B 2DNXA 1RE4C 3ZC1A 4ZI3C 3JC6D 2KT9A 2E42A 2YU2A 3RYIE 2VB6A 4AUWA 1SFCA 1NU1K 2Q9QB 3BQKA 3II6A 4AXPA 1HUCA 1KFNA 1YTZT 4O4IE 2CPSA 5AW1B 4MLKA 1D0YA 1FU1A 2P2UA 1KQLA 4HTEA 3SWYA 1JY3O 2NP9A 3KPEA 4HN9A 2ZMAA 3Q2MA 1IFIA 3UUNA 3RH3A 3GWHA 2I1JA 2W00A 4JF7A 4GYSA 5CB4E 3A3YB 1DH3A 1LTJB 3C4XA 3E22E 5AW0B 5FY1A 3UULA 1FIOA 1FAVA 1L4AD 1N7SC 2ZM0A 3LFMA 5JDMA 3OYZA 4IFMA 2N9BA 2QM8A 1L4AA 3CPZA 3HD7C 4EIWA 3U78A 3CQXC 2V7MA 5JR9C 2BVLA 3EFGA 2G0UA 1GW4A 4TV9E 1YTZI 3AAIA 2XNXA 3AVRA 4LGDE 4M3LA 3DTOA 4AYCA 3A2AA 1A02F 3RYCE 4W7ZA 4H9QC 1JTHA 4I6MC 2LHNA 5HXHA 3P7KA 4MBQA 3BQIA 1FZCB 1X8YA 1Z56A 2QGSA 3RK3D 4XA4A 3R2PA 5BU8B 2C5KT 4TV8E 3ZYLA 4ANJA 4DVDA 1FMVA 1HBWA 2PBIA 2D0TA 2LT3A 3HI2A 4PJLA 1LTBC 2HYNA 3RK3B 3C98B 4DZOA 3NZPA 2GUSA 3CKDA 1D1CA 4G2AA 3LIEA 2J1DG 2Z5HA 5ADXL 2X67A 1LTSC 1H88A 5CMZA 4IFFA 3KV9A 1YW0A 5DQVA 1FBMA 2Q9QC 3P8CE 5LP6E 2HODA 5JDFA 3HR0A 4PJJA 1HG2A 1G2CB 4JYCA 5JVDE 2WBLA 1KILB 1H8AA 3LW5H 3RYFE 4GYRA 2ODUA 2WPRA 3MIWA 4H9RC 3F57A 4QKNA 1HTLC 1KFMA 1LTJC 2X9HA 5DJQC 2XAJB 3OJAA 1D1BA 3PTRB 5L3FB 4HEAA 1WT6A 5ETWA 3N9LA 5JRCA 3FBLA 4CXXA 2W6BA 1N86A 3DJBA 4PFOA 3ZMZB 1URQD 4KBMB 2O01H 3ZMSB 2KOGA 1RY3A 4HH2A 3BQLA 4PJNA 4ZS3A 1URQA 3M0AA 3CX8B 4GK5E 1J1DC 1JUNA 3HRNA 1OWAA 2VASA 5AVZB 1URQB 3VP9A 1U5PA 3SWFA 5AW8B 1OXZA 2FXMA 3VMXA 2CA5A 1HX8A 2HH7A 1SP4A 2HG5D 2VL8A 5LHGB 3V5BA 1G1JA 3A7OA 3CLQA 5APVA 1WRDA 1FZCC 3M91A 4AKGA 4MFRA 4RESB 3VHLA 2C0XA 2WSFH 2MOZA 1E5WA 1FJPA 5KDMC 1JY2O 3HUSB 2H43A 3W15B 3S4UA 3V5UA 5JDQA 1FZFA 3J7Yq 2BASA 3HTKB 2W6AA 5APQA 2EHOD 4YHJA 1FDMA 5JH7E 4WW0A 3RC8A 1RF1C 4ZHQE 4H9NC 4QXBB 1LVFA 3KV5A 1NKNA 1SQPK 5FNVE 2EHOA 3QK6A 2WT7B 5AW3B 5KMGP 4IDZA 4GK0E 5CA1E 3P8CD 3UUXB 2EHOB 4EOZB 5LG4A 3PUGA 3KDSE 2GM4A 4DBRA 2KYVA 2I1KA 4UF0B 2NTXA 2OYIA 3AB3B 1X79B 1KILC 3OAKA 2PJQA 1ZN5A 5FY7A 1WRGA 3N2GE 2E8IA 1T2KD 2C9LY 2OYIB 4E7SA 5AW7B 1MV8A 5APUA 3I9YA 1KZUB 2OYHA 4E7ZA 3QUJA 3RL0D 3VKHA 3LJCA 5IYZE 2OYHB 3I0OA 5AW4B 3PE0A 4LLHA 1RE3C 4ZI2D 3M0DA 3HE4B 4I1LA 5LGTB 5HWYA 1VDFA 3I5CA 4HGAA 3O8ZA 2WSEH 4P0BA 4ZI3D 4GIWA 3MD0A 4YJ3E 3SOLA 2BVMA 2KXPB 2XAHB 2W63A 3ESLA 1RE4A 2ES0A 1W2EA 3KDPB 3ZN1B 2SPCA 3RX6A 1IK9A 3ZMTB 2O1JA 3KYQA 2KB7P 3ETVA 4I55E 2WWUA 2YKQA 3ANWA 1FOSE 5HXCA 4OFZA 2YEVC 1HTJF 2LHRA 1YKEB 3MTUE 3TYYA 3EVYA 4ASKA 2CEAA 2NPSC 1N7SD 3HUSC 2XTLA 3CVRA 5LNKA 3G3ZA 1QUUA 2POHA 5FMNA 3MGNA 1LKXA 4XE5B 3F2EA 4QXHB 4IGUA 1PFIA 3CI9A 2R3CA 1N7SA 2IX7C 2LKMA 3NXSA 3HD7D 1CSBA 2CMRA 2Q7CA 1AQ5A 2M67A 2LOSA 1NTKK 3V2NA 3HD7A 2ACXA 4EYYR 4BJMA 5AVXB 5JR9A 3LBXB 3CX6B 4WNKA 5F8PA 3GN5B 4IFDK 1SA0E 2WPSA 4ERRA 3UIAA 3B5NB 1VRBA 3PUAA 3C4WA 5CA0E 2XHEB 4TZ4C 5AVUB 3L3PA 4AKHA 4MALA 4UV8B 3O9XA 4QX7B 3P8MC 4UVCB 3H32A 2DLRA 3A5XA 3HE5B 2X51A 4L9IA 1LRZA 3T8OA 2Y48B 2A45H 3E1IA 1MIVA 5APSA 5APYA 5EK4A 5M4YA 5LOVE 1G73A 1IO4A 2CXFA 3IF8B 3VN0A 3B8EB 2JPFA 5APTA 2ZXEB 3K3NA 3KVBA 2Q9QD 4AQRD 4O2AE 2XU6A 5LYJE 1GK6A 1JCCA 5AW5B 2JMKA 4CXYA 1N7LA 5EZYE 1LT9B 3HKBE 2VKDA 1LGHB 2HPJA 2ZM2A 2Q9QA 3C64A 3VYIA 1JCDA 1H89A 1NWQA 5AW6B 3ZCIA 5KJ7C 2D5UA 2N9DA 3CMLA 1LWUB 1MNEA 3FBZA 1CW5A 4AKLA 1VOMA 3PU3A 1FJKA 1LTJA 4O4LE 1T98A 2WWWA 1JMMA 1FZBA 3SRZA 1U4QA 3N2OA 1NKZB 3PURA 5FXXA 4Z8XA 2C5JA 3U1CA 1GDTA 4UVBB 2O1KA 5F3JA 4P09A 4IIJE 3V2PA 3KBUA 2LSKA 2CWOA 2E9XC 2LSIA 1CZQA 2NW7A 2FFDB 3O1IA 4CI1B 1E1HB 5L3GB 2JRKA 1J1DB 4WBNE 2IW5B 1LTIC 2R32A 2CLYB 3B5NC 2KINB 4O4JE 3MACA 2JJ9A 1MUUA 1A02J 5KLVK 3ZJ1A 1RF0C 2A45G 1N73B 1FZCA 2M8RA 2IAKA 2WPQA 1S9KE 2BDEA 2DHRA 2NW9A 5KTBA 4YFSA 2ZM8A 4UV9B 3VOPA 5TAOA 1HFAA 4XBFB 2VK9A 2UXXB 4PFPA 3KV4A 3N2KE 4YJ2E 3TNUB 3AA7B 3MJXA 1RF1B 4NUVA 4UEMA 2HPCB 5AVTB 2V1DB 5HXRA 1FZGA 1X9VA 2JMHA 5JREA 2Y6XA 5JDGA 4OHFA 1SHZC 3U59A 4H9OC 1Z0PA 3WMM0 2KLQA 3R6NA 1AFOA 1LT9C 1KILD 3K3QC 1MZ9A 3N9MA 2LSGA 4HFVA 1KK7A 3ZLIA 1GZLA 1BR4A 1G2CA 3KV6A 1KILA 2KLVA 3EDUA 4ISSA 2Q5UA 1LWUC 4NUUA 1ZR4A 1MMAA 1NTMK 1MNDA 2LE8A 4WB4A 5HAXA 1XTCC 1LTGC 4CQIA 1KNZA 5FP3A 2UXNB 2MTQA 5H6QB 1IAPA 1LVKA 4UELA 5APXA 3I9WA 1RE3A 2VKHA 5FY0A 4I43B 5LHHB 3AAAB 4DMWA 2NWBA 2K24A 1DEBA 5DQWA 4P0AA 4EOTA 2E43A 2FFDC 1FZEA 4WBOA 2L9QA 4BJNA 1MIYA 5HXEA 5LJNA 3MK7C 4JLEA 5JDNA 2CLYC 1S9KD 3B13A 3AVSA 2C0WA 2NPSD 1WLXA 1N73C 5LBMA 3M9QA 2N2NA 2KP8A 3HKDE 1L4AC 1GD2E 1JOCA 1M1JB 1JNMA 2CPBA 3HUSA 4XZCA 1BR1A 3RK2B 4UIGA 1J1EB 3HTKA 1HWTC 2NPSB 2YU1A 3M9BA 2BZBA 3U3IA 4F6RC 2M3BA 4C91A 3Q5WA 3NRXA 1JY3N 4YLHA 3Q9DA 2N1TB 1AJ3A 2X9XA 2WT7A 2XASB 3I0QA 3L37A 1SQBK 2GK9A 1SQVK 2OARA 2XZRA 1CI6B 2P9BA 2QA7A 3KVAA 4CI2B 4TX5A 2K5BB 3BK9A 3RC3A 4UF0A 5CJ0A 2CCQA 4PK6A 1X79A 2DI4A 1L0NK 3AA0B 1IJ5A 4O4HE 4C7NB 5CCHC 1GL2B 3OBVE 4CXWA 1YYCA 1JO5A 3KBTA 2LOPA 4HKAA 1FEWA 3WAJA 4FI5A 3MUDA 3MKDA 3R84B 5DABA 3VP8A 1IFNA 2Z4EA 4PNIA 3N9QA 3ETUA 3H6PA 4U74A 3HE4A 2VKJA 3ZYKA 3SS1A 1QL1A 5KX5E 2CM0A 4J2CA 2LSJA 4LC1A 1WR6A 2KZ7B 4BA9A 4QWNB 3IBPA 2CWYA 3KFWX 3RPUA 1EZ3A 3ZYMA 1IFDA 3VMYA 3GHGB 1GK4A 2I59A 2XUEA 2ZFCA 4CI3B 4EZ4A 2PP6A 3H37A 5KJ7D 4AKIA 2C9NY 5FXZA 5LJMA 3ZPOA 4O8SA 5KJ7A 2YO2A 1HF8A 4X1KE 1JY3P 4L0RA 1M1JC 5AW2B 5LBQB 4B86A 3M65A 4PK4A 3RK2C 1J1EC 4KHXA 1HJBA 2RA1A 3H3AA 1LTAC 1BR0A 3NTNA 4V1Av 2Z6EA 3O1HA 4JUYA 4DOJA 2E9XD 5GONE 3V4WA 2N1TC 1CUNA 4OK0A 4N6JA 1NH4A 2KWHA 2DWGA 3M06A 2N1GA 3KQGA 4EXTA 2L5GB 3LBXA 1SLQA 4IE6A 5L3BB 2IC6A 5LCYA 4Y99C 4MHCA 3QC9A 3GN5A 3B5ND 4ZKPA 2E9XB 4EIJA 5J2UE 4DMVA 2GUVA 2Z5IA 4GKGA 1ZEEA 3PUQA 3UUMA 2H7VC 1ZV8A 2JJLA 3B5NA 3EQ2A 3C4ZA 2H8PD 2MBGA 3LG7A 1GL2C 1GW3A 2XAGB 3OKQA 1YKHB 1HVVA 1LTTC 2X68A 3FHNA 3UT5E 3HE5A 1D1AA 3OYXA 5L3CB 3LK2B 1G1IA 2CXLA 2X66A 5FXWA 3RRCA 2C5IT 3BATA 4DO0A 3FXEB 1JY2N 4ZS2A 5AVSB 2Y8DA 1NAFA 1SVFA 2WMOA 3P7IA 4WY4B 2LEHA 3GHGC 3V4QA 2YK0A 1VPCA 1IJDB 2JEEA 1ZLLA 1LT9A 2WMNA 4JEHB 1WYBA 2DWKA 2LSYA 2WSCH 2V7LA 1EQ7A 2H7HA 5IHYA 2W0GA 3IFMA 1FOSF 4GT1A 1LWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VRS A;  2W6A A;  3HE4 A;  1GD2 E;  5AVU B;  2Z5I A;  1G2C B;  4JYC A;  1T2K C;  3KDP B;  4GKG A;  5APQ A;  3VTP C;  1H8A A;  1JNM A;  1GU5 A;  3P8M C;  5APW A;  2JJL A;  4LC1 A;  2WPR A;  1WR6 A;  3NFQ A;  3HTK A;  2P7J A;  1HWT C;  5AVV B;  1GZL A;  4M3L A;  3IR9 A;  3M9B A;  3LID A;  3HE5 B;  3VMY A;  2WT7 B;  4AYC A;  3A2A A;  5AW3 B;  1A02 F;  1GK4 A;  1FOS E;  2Q5U A;  1CZQ A;  1GTW A;  2ZFC A;  5AVY B;  2XV5 A;  3M9H A;  5AW9 B;  4JYB A;  5APS A;  4I6M C;  5APY A;  3VMZ A;  2WTY A;  3TYY A;  1J2J B;  3P7K A;  3HE5 A;  2C9N Y;  2WT7 A;  3NMD A;  1X8Y A;  3L36 A;  5AVR B;  1IO4 A;  3L37 A;  2R32 A;  2QM7 A;  3VN0 A;  3B8E B;  2E42 A;  5APT A;  2XZR A;  1CI6 B;  2YO2 A;  3L35 A;  3MGN A;  5AVQ B;  4C46 A;  1MUU A;  4AUW A;  2W27 A;  2ZXE B;  4XE5 B;  1A02 J;  3P32 A;  4AQR D;  2R3C A;  5AVW B;  3OAK A;  5APX A;  2XU6 A;  3NXS A;  5AW2 B;  1GK6 A;  1HBW A;  1HUC A;  3M0A A;  5AW5 B;  4B86 A;  2WPQ A;  5AW1 B;  1GU4 A;  1CSB A;  2R5D A;  2Q7C A;  3A5T A;  1S9K E;  5AVS B;  1T2K D;  1CI6 A;  2C9L Y;  1JUN A;  2P2U A;  1MFZ A;  1KQL A;  4KHX A;  1HJB A;  1OWA A;  1NWM X;  1NAF A;  5AW7 B;  1MV8 A;  5AVZ B;  5APU A;  1X79 A;  3NTN A;  4C7N B;  3SWF A;  3V4Q A;  2YO3 A;  4I2L C;  5AW8 B;  3VYI A;  4DZO A;  1OXZ A;  1H89 A;  3VMX A;  5AVX B;  1NWQ A;  5AW6 B;  4EOT A;  2E43 A;  3A3Y B;  2Q3I A;  3LIE A;  1SP4 A;  3V4W A;  1DH3 A;  2Z5H A;  3V5B A;  5AW0 B;  1YYC A;  1O3X A;  3A7O A;  2N9D A;  5APV A;  3TK1 A;  2R5B A;  1H88 A;  5CMZ A;  1FAV A;  3TNU B;  1WRD A;  3M91 A;  4C7N A;  3M06 A;  4RES B;  5AW4 B;  2H7H A;  3KQG A;  3M0D A;  2IPP A;  3HE4 B;  3T97 A;  1YD8 G;  1S9K D;  3I5C A;  3O8Z A;  2N9B A;  1SLQ A;  2QM8 A;  2WWW A;  2YNY A;  2WPS A;  5AVT B;  4HYT B;  4GT1 A;  1FOS F;  3UIA A;  2P67 A;  3MD0 A;  3TNU A;  2N2N A;  2BAS A;  2KP8 A; 
#chains in the Genus database with same CATH topology
 4DBQ A;  3WU2 E;  4DND A;  5BU5 A;  2V26 A;  3V2Q A;  3CIR A;  2JR8 A;  4IHJ E;  1B7T A;  5KLV E;  2V7K A;  5APW A;  2KWI B;  2UWJ E;  1HS7 A;  2H88 C;  2KS1 B;  2E76 B;  3CXH I;  3AEF C;  5HWX A;  2B1E A;  2D2C D;  2Y0D A;  3Q2Y A;  2PFX A;  5AVV B;  2XM2 A;  4EEB A;  1NU1 G;  3CC2 P;  3GW6 A;  2CE7 A;  4DR5 T;  1QL2 A;  3PUV F;  5H2F E;  2A72 A;  4HWD A;  3ZMU B;  4DV0 T;  5AW9 B;  2B87 B;  1HG5 A;  4A56 A;  3PUY F;  4DV5 T;  3K8P C;  4B6X A;  2H7O A;  1PP9 G;  1SFC B;  1Q86 Q;  5HCJ A;  2O3J A;  4YTN A;  4KMC A;  5GTI E;  1IFM A;  1VF5 B;  2RKL A;  1ZP0 A;  4I4T E;  2MPK A;  3O4X E;  1UGO A;  1YXR A;  3Q5E A;  2QM7 A;  2D2C B;  2VWA A;  5HXS A;  2FFD A;  5LXT E;  5CBN A;  5AVQ B;  4ADZ A;  3FXD B;  3AEC A;  2QSI A;  4ZOL E;  3MZK B;  1Y8A A;  4YSZ A;  4CZZ B;  5CJ4 A;  2FYN C;  3P32 A;  5J2T E;  4BWN A;  2LRK A;  5FYM A;  2FBW A;  3FB2 A;  4PV1 D;  2BBH A;  2H3R A;  2R5D A;  4O9B A;  1DX7 A;  3BVH A;  2JKV A;  1G8X A;  3IAO A;  5FVL A;  1MFZ A;  5L8R J;  5JDL A;  1QGK B;  3CX5 D;  4AKR B;  3C8V A;  4KT0 J;  1N73 A;  4X20 E;  3BCC J;  1HCI A;  2YO3 A;  3P4R A;  4IE4 A;  2KI7 B;  1RQV A;  1JY2 P;  2ZM6 T;  1NU1 J;  3BAS A;  5CCG C;  3L75 E;  1O3X A;  1U7J A;  4GOD A;  1XMQ T;  2R5B A;  3ZMV B;  1L4A B;  4PV1 B;  1DIP A;  4X1Y E;  4BAY B;  2E5Y A;  4HWF A;  4IE5 A;  5HYA A;  4B3T T;  1PP9 J;  1S5L X;  1NTM E;  2W4X A;  2MJZ A;  1T8Z A;  4YTP A;  2ITA A;  2P67 A;  3RGU A;  3TNU A;  2PFV A;  3H1J E;  2DW3 A;  4OGQ D;  1RF1 A;  3QB5 A;  3NRY A;  1W0B A;  5JQG E;  1UX5 A;  5KKZ B;  3CWB G;  4EAH A;  3Q5R A;  2HPC A;  3TKL B;  4AQF C;  4DR4 T;  2RP4 A;  3LK4 2;  2JQH A;  1EZV D;  4WY4 C;  4M1P A;  2ZVO B;  3P4Q A;  1QSD A;  1JTH B;  3PU8 A;  3CCR P;  2P7J A;  2IBZ G;  1ZV4 X;  3IR9 A;  2WSS V;  3LID A;  3CCQ P;  2K9A A;  2WZ7 A;  2XQY A;  1Y64 B;  4IDN A;  3L71 E;  5C8Y E;  5CCH D;  1NAY A;  4OGQ B;  4ILC A;  3PP5 A;  3ONX A;  3C50 A;  5HEO A;  2IFM A;  1JNZ A;  2CXD A;  2BG9 C;  4ILA A;  1HH0 A;  1OW6 A;  5LA6 E;  3RYH E;  2YKP A;  5AQF B;  2KSE A;  3NMD A;  3L36 A;  2BS3 A;  5AVR B;  5KLV D;  5CCH A;  3L72 G;  4N3Y B;  3H1L G;  4WZX A;  4IOI H;  4C46 A;  3RGL A;  4JI8 T;  3FGA D;  2W27 A;  2ZYG A;  2X9W A;  5CHX A;  2A3D A;  4EB6 E;  2CRB A;  2WM9 A;  1ZKE A;  3AEA C;  3CL3 D;  2V7I A;  3MA9 A;  3A5T A;  2AXD S;  2W61 A;  4U33 A;  3ABV A;  2E2A A;  1US7 B;  1NWM X;  1MMD A;  5KXJ A;  2XDJ A;  3RBX A;  4PAG A;  2V4H A;  4IST A;  4KUM B;  3C9I A;  3FZF B;  1NHL A;  3P50 A;  4DV3 T;  3CCE P;  1OW8 A;  1RH5 B;  3X1D A;  2DCF A;  4ILU A;  1IFP A;  1R8E A;  4ASW A;  1T3U A;  3GMI A;  3VKG A;  1SFC C;  2J5U A;  3N5L A;  2HOD B;  3AE5 C;  1VF5 C;  1IZN B;  3AXJ B;  3JC6 C;  3T97 A;  2WAU A;  2A45 I;  4QHO A;  1ZME C;  2NOX A;  2WSS H;  3Q1M A;  1YQ3 A;  4H13 C;  4TN7 B;  4IL6 H;  1QLB A;  4YSX A;  3HKE E;  2ZT9 B;  3L72 J;  4KP3 C;  3CX7 B;  3ZCJ A;  1SQB E;  2NTY A;  2CPT A;  1SQV E;  2YKO A;  3QH9 A;  2ZLY A;  3N9P A;  4X62 T;  1GU5 A;  3PHL A;  4PW8 A;  3TSI A;  1VQ6 P;  4TWF A;  3BRT B;  1K9M Q;  5L4E A;  4I0U A;  3OJA B;  2K1A A;  2M3E A;  2KSJ A;  5E79 H;  3RK2 D;  4UXN B;  2FY8 A;  5LB7 B;  2X9Y A;  3K3O A;  2K48 A;  4RKU J;  5JRC B;  3B57 A;  4EYU A;  1PIX A;  3OVU A;  1M1J A;  4IL9 A;  3CCJ P;  3P4P A;  1NTM D;  1L2P A;  3NBX X;  4UVA B;  1IC2 A;  1L0N E;  5FXV A;  5J1G A;  4GDO A;  3OA7 A;  3H1J D;  4JYB A;  2IBZ I;  3PUZ F;  4QXC B;  3L73 G;  3AA6 B;  1ZRT E;  3HA4 A;  2NPS A;  3USS A;  4IL6 E;  3TLU A;  4TUY E;  2N1T D;  3HL6 A;  2XKM A;  2WQY A;  2KLU A;  2FXO A;  2YOE A;  4N78 E;  1S35 A;  4A97 A;  3AEB C;  5TJH A;  1J5E T;  2N1T A;  1S1C X;  4EDF A;  2FYZ A;  4XFJ A;  4LMJ A;  2R44 A;  3TDK A;  2W67 A;  5LHI B;  2J58 A;  3L71 D;  4LF5 T;  2P10 A;  1IJ6 A;  4U72 A;  4W7Y A;  2L8K A;  3IHR A;  2UXD T;  1CI6 A;  1BDC A;  3ONJ A;  1PV3 A;  4W80 A;  3W68 A;  1NTZ K;  1NEN A;  1S94 A;  4YXW H;  4K3A A;  1UX4 A;  3AEE A;  3J9X 1;  5EK2 A;  3OTO T;  1GL2 D;  3VR9 A;  4Y99 B;  2YXR B;  1WYC A;  3RRW A;  3RL0 g;  4C7R A;  2NW8 A;  3F31 A;  1NO4 A;  3A0H H;  3V2R A;  3U1A A;  4C7N A;  4ZI7 E;  4TLF A;  1GL2 A;  4PJ0 E;  3I55 P;  1T3J A;  3RK3 C;  1AJY A;  1SQP G;  1MMN A;  2LJL A;  4PD4 I;  1OFC X;  2KUB A;  5KAF E;  4HYT B;  4GIF A;  1QVG O;  5LGU B;  4X65 T;  4WVZ A;  3AED A;  2FKW B;  2G8Y A;  5BVZ A;  1UUS A;  3ZN0 B;  3E0Z A;  3PUS A;  2ODV A;  2XM1 A;  5AQT B;  5JDH A;  1OMI A;  3UFE A;  3V5S A;  2D2S A;  1JEK A;  3WUU A;  5AQM B;  2KND A;  1KNR A;  1SQX K;  4GOF A;  3LK3 B;  2QG4 A;  2JQQ A;  4ASV A;  1NTZ J;  2N9Y B;  4HFB A;  3A0H E;  2VKO A;  4EV6 A;  5EK3 A;  1DD4 A;  1PPJ G;  1GTW A;  1PL5 A;  2XV5 A;  2HFE D;  3M9H A;  4H63 V;  5AQP B;  1SQB D;  2Q6Q A;  2QA4 P;  3AA1 B;  1SQV D;  4JBZ A;  1BR2 A;  5A1L A;  4XAX B;  4QX8 B;  3Q5X A;  4AI6 A;  3GHG A;  2PG8 A;  5AQL B;  4AQG A;  4X1I E;  2ZT9 C;  1NJI Q;  3L35 A;  3CQG B;  1SQP J;  3ZEF B;  4EZH A;  5L2L A;  3RBZ A;  4A7P A;  3VU7 H;  2XQ8 A;  1R8I A;  2W62 A;  4HE8 A;  1IFJ A;  2XAQ B;  1L0N D;  2BG9 E;  1UII A;  3DP7 A;  1FZA A;  2RN0 A;  4GOU A;  1BCC E;  5KAI H;  3WI3 A;  1ZRT D;  2C0S A;  3CXH E;  5E0O A;  3FZL B;  1KYO I;  3VRA A;  3N4X A;  1VQP P;  4PJM A;  1V9D A;  1JNR A;  5GTH H;  1M7L A;  2X0L B;  3RL0 B;  1LP1 B;  2IZ0 A;  3CWZ B;  5AQS B;  4L5G A;  5L3E B;  3K1S A;  2W66 A;  4N78 D;  1AVO A;  5H6R B;  1M8O B;  2Q3I A;  1FDO A;  2XAF B;  3D6Y A;  1BGY G;  4O2B E;  3D0T A;  2H88 A;  3UU5 A;  5HEJ A;  2MAW A;  4H9S E;  4ZNC A;  3AEF A;  1MMG A;  3UTK A;  1BSH A;  2YXQ B;  5AFU L;  1URQ C;  4TWD A;  2IPP A;  3NZQ A;  3AE3 C;  3RQU A;  2LM9 A;  3I1A A;  4PK5 A;  3PRJ A;  1SQQ K;  1OED C;  3MXZ A;  2YNY A;  2BS2 A;  4U3F G;  5KAI E;  1HX1 B;  2V7J A;  2L3L A;  2VRS A;  2LKH A;  2V6Y B;  1KTM A;  4H63 H;  2D0U A;  3L09 A;  3H1H G;  3VTP C;  2PGD A;  5GTH E;  4OYK A;  3L4F A;  1ZHC A;  3ANW B;  3VRB A;  3G06 A;  3IN6 A;  2WZI A;  4LMK A;  3N7N A;  5FL1 A;  2E9X A;  2Q9I A;  1HNW T;  3O1J A;  3N9N A;  2BCC G;  2AEF A;  4NPE A;  2KNC A;  4AIU A;  2YIN A;  3BRV B;  4I50 E;  2V6X A;  1S3J A;  3FX0 A;  1MFT A;  1H7C A;  4FJO A;  3L74 G;  3GA8 A;  2IIU A;  2FYN B;  2KNC B;  1WR0 A;  2WTY A;  2MYS A;  1NTK G;  2OTK E;  5CCG D;  1J2J B;  4WBA A;  3EDV A;  1BGY J;  4Z1M H;  1N7S B;  1XTG B;  4C90 A;  5M1B A;  2WB5 A;  3KIN B;  2HLO A;  1D0X A;  2P58 A;  3EUH A;  1RF0 A;  5CCG A;  3E08 A;  1EXJ A;  1MIW A;  5AVW B;  2EHO C;  4JEU B;  2IFN A;  3HD7 B;  4BRY B;  1VQ9 P;  3AAE B;  1GU4 A;  3CQC B;  1XDO A;  2P1J A;  1NOH A;  1PGQ A;  4IE7 A;  4K0U A;  5C3J A;  1OVR A;  5AQO B;  5JR9 B;  4DCK A;  4Z91 A;  1S72 P;  5BMV E;  5ABH A;  3O6Q A;  3M3Z B;  1L0L K;  1I94 T;  1YJW P;  1FMW A;  4WY4 D;  3SFE C;  2XQ3 A;  2QRX A;  4I2L C;  3BCC E;  1VQO P;  3FXE A;  4IE0 A;  2E75 C;  4CPG A;  3L74 D;  2V7Q H;  2A2F X;  4AQF A;  2LXB A;  3T1Y T;  2OYI C;  3RKO A;  4WY4 A;  3TK1 A;  3PDY A;  1QX8 A;  4R4L A;  1XNQ T;  4U7J A;  1D0Z A;  1EDL A;  2KMF A;  4HFH A;  2ZXX A;  3F5H A;  1YD8 G;  1NTK J;  3WU2 H;  4H9P C;  3PTZ A;  1BCC D;  2AXC A;  4K35 A;  2RMZ A;  3CXH D;  2FYU K;  2OYH C;  2RPA A;  3H32 B;  1Q7Y Q;  2BG9 A;  2WIT A;  5CBO A;  3SWH A;  1T2K C;  3WAK A;  1P84 I;  1UCU A;  5LG3 A;  3A0B H;  2OA5 A;  4G63 A;  4B3S T;  5LGN B;  3HKC E;  2FJE A;  2YMY A;  2WS3 A;  3N9O A;  4MN4 C;  3RK3 E;  1KD1 Q;  2BG9 B;  1HGZ A;  3NFQ A;  4ZXL A;  1HF9 A;  2PAJ A;  5L3D B;  3RL0 C;  4NPF X;  2XQ5 A;  4LFA T;  3M0D C;  1N2D C;  3CC7 P;  4ZKU A;  4OYJ A;  1R5S A;  3ZC0 A;  1L0L J;  2NZ2 A;  4H44 B;  2IC9 A;  3AEA A;  3JAD A;  3CCL P;  4TT3 H;  5GTI H;  1HGV A;  2YDS A;  5AVY B;  2J59 M;  1Z8U A;  2KS1 A;  3IEE A;  3VMZ A;  4ZI2 C;  1ZR2 A;  2HPL A;  3C51 A;  1SFC D;  3ZJ2 A;  4A98 A;  4OH8 B;  2DNX A;  1RE4 C;  2Q3E A;  1AVY A;  3ZC1 A;  1VF5 D;  4ZI3 C;  3JC6 D;  3A0B E;  2E42 A;  2KT9 A;  2B87 A;  2BKN A;  2YU2 A;  3RYI E;  1W5C E;  2VB6 A;  4AUW A;  1SFC A;  1NU1 K;  4ZZB A;  1SUM B;  2Q9Q B;  2B89 A;  4H13 D;  3BQK A;  3II6 A;  4AXP A;  2FYU J;  3UQ7 A;  1XWM A;  2W2U A;  1HUC A;  1KFN A;  1YTZ T;  4O4I E;  1XNR T;  2CPS A;  5AW1 B;  2WU2 A;  4MLK A;  1D0Y A;  4YSY A;  4DID B;  1OW7 A;  1FU1 A;  3FXD A;  2P2U A;  1KQL A;  4DV2 T;  2E5L T;  4HTE A;  3SWY A;  1T8B A;  1JY3 O;  2NP9 A;  3KPE A;  4HN9 A;  2ZMA A;  3Q2M A;  1IFI A;  3UUN A;  4HFC A;  1E7P A;  2JDI H;  3MHV A;  3RH3 A;  2FJA A;  2A06 E;  5JTG A;  3GWH A;  2I1J A;  2W00 A;  1HR0 T;  4JF7 A;  4GYS A;  4H13 B;  3A3Y B;  3JAF A;  5CB4 E;  5KLI B;  1DH3 A;  4U2Z A;  1LTJ B;  2L91 A;  3C4X A;  3E22 E;  5AW0 B;  2BKO A;  5FY1 A;  3UUL A;  1FIO A;  1FAV A;  1L4A D;  1N7S C;  1VCT A;  2XSB A;  2XZE A;  2ZM0 A;  3LFM A;  5JDM A;  3OYZ A;  4IFM A;  2J4G A;  1EZV G;  2N9B A;  2QM8 A;  3G9R A;  3RLF F;  1L4A A;  2WDQ A;  3AE1 A;  4D6T E;  3CPZ A;  3HD7 C;  4EIW A;  3U78 A;  5DJU B;  3BCC D;  3CQX C;  2LR2 A;  2V7M A;  2JIW A;  1U57 A;  5JR9 C;  1E2A A;  1HNZ T;  2BVL A;  1XMO T;  3EFG A;  5F5W A;  3AE9 C;  1J1J A;  4TNW A;  4DR6 T;  2G0U A;  3Q5D A;  1GW4 A;  4B3R T;  3P4S A;  4TV9 E;  3CD6 P;  1YTZ I;  1VQ4 P;  1OED E;  4COF A;  3AAI A;  2XNX A;  3AVR A;  4LGD E;  4M3L A;  3DTO A;  5KLV G;  3FZH B;  3UU3 A;  4AYC A;  4X66 T;  3A2A A;  1A02 F;  3RYC E;  4W7Z A;  3CMA P;  2ZAE B;  4H9Q C;  1FDI A;  1JTH A;  4I6M C;  3EI0 A;  2LHN A;  5HXH A;  4JV5 T;  4YTM A;  2H89 C;  3P7K A;  4MBQ A;  3BQI A;  4IDQ A;  1FZC B;  4H0L B;  1X8Y A;  3AE4 C;  1Q81 Q;  4JI0 T;  1Z56 A;  4PD4 E;  2QGS A;  4QH1 A;  3RK3 D;  4XA4 A;  2BEZ F;  3NVO A;  3R2P A;  4A5X A;  5BU8 B;  2C5K T;  4TV8 E;  3ZYL A;  4ANJ A;  1OZH A;  4DVD A;  2WDV A;  4OVN F;  1FMV A;  1HBW A;  3CX5 I;  5C39 A;  2PBI A;  1HJ0 A;  2D0T A;  2LT3 A;  3HI2 A;  4PJL A;  2E74 C;  1LTB C;  2HYN A;  4H44 C;  3RK3 B;  3H1I E;  4NIQ A;  3C98 B;  4DZO A;  2X0H A;  3NZP A;  2GUS A;  1KB9 H;  3CKD A;  2J62 A;  1D1C A;  2R6G F;  4G2A A;  3LIE A;  2J1D G;  2Z5H A;  5ADX L;  2X67 A;  1LTS C;  4AQY T;  4DUY T;  1H88 A;  5CMZ A;  4IFF A;  3KV9 A;  2WSC J;  2KIK A;  3CWB J;  1YW0 A;  2Y9Y A;  3L75 G;  5DQV A;  2M5A B;  3S1K A;  1FBM A;  2HN1 A;  3P8C E;  2Q9Q C;  5LP6 E;  2HOD A;  2ZT9 D;  3AXJ A;  5JDF A;  3HR0 A;  1Q2N A;  4PJJ A;  1HG2 A;  1NTM G;  2A06 D;  2YKS A;  1G2C B;  4JYC A;  1VQL P;  5JVD E;  2WBL A;  5J0Z A;  1KIL B;  1H8A A;  3PJA A;  3LW5 H;  3RYF E;  4GYR A;  2ODU A;  3H1J G;  3W67 A;  1KB9 E;  2WPR A;  3MIW A;  1FE6 A;  4H9R C;  3F57 A;  4QKN A;  3AE2 C;  1HTL C;  1KFM A;  5KLI C;  1LTJ C;  1NTZ E;  4DR7 T;  2X9H A;  5DJQ C;  2XAJ B;  3OJA A;  1D1B A;  4CN4 A;  3PTR B;  3H1L J;  5L3F B;  4HEA A;  4D6T D;  1WT6 A;  1N36 T;  5ETW A;  3N9L A;  3L71 G;  5JRC A;  2FUP A;  3FBL A;  4CXX A;  2W6B A;  3L75 D;  1WMK A;  3Q5S A;  1N86 A;  2NR4 A;  3DJB A;  4PFO A;  3ZMZ B;  1DD3 A;  1WCR A;  1URQ D;  2JO1 A;  4NXN T;  4KBM B;  4ZEY A;  2O01 H;  3ZMS B;  3PV0 F;  2KOG A;  1RY3 A;  1ZOY A;  4HH2 A;  1QVF O;  2KZI A;  3BQL A;  4PJN A;  4DV1 T;  4ZS3 A;  5CJ5 A;  1URQ A;  3M0A A;  1YBK A;  1VCS A;  3CX8 B;  3AE3 A;  4GK5 E;  1J1D C;  1JUN A;  3HRN A;  2F4V T;  1OWA A;  2VAS A;  5AVZ B;  1URQ B;  3VP9 A;  1U5P A;  2FJB A;  1XDP A;  1KFY A;  3AE8 A;  3SWF A;  5AW8 B;  1OXZ A;  1PGJ A;  1OED B;  2FXM A;  3GMA A;  3VMX A;  2CA5 A;  4PD4 D;  2WDR A;  5AQU B;  1HX8 A;  1SQX E;  4K0K T;  2HH7 A;  4PJ0 H;  1SP4 A;  2HG5 D;  2VL8 A;  5LHG B;  3V5B A;  4KX6 A;  4JPZ B;  1G1J A;  3A7O A;  3CLQ A;  5APV A;  1WRD A;  5KAF H;  1FZC C;  4H0L C;  3M91 A;  4AKG A;  4MFR A;  4RES B;  3VHL A;  4DV7 T;  2C0X A;  3TLW A;  1AQT A;  2WSF H;  1M56 D;  2MOZ A;  3T1H T;  1E79 H;  1E5W A;  1FJP A;  3L71 J;  5KDM C;  1JY2 O;  2UUA T;  3HUS B;  2H43 A;  3W15 B;  3S4U A;  3V5U A;  2LLY A;  2OV9 A;  5JDQ A;  1FZF A;  4YTP C;  3J7Y q;  2BAS A;  3H1I D;  3HTK B;  2W6A A;  5EFW B;  5L4H A;  2YDQ A;  3L70 E;  5APQ A;  2EHO D;  4YHJ A;  1FDM A;  5AQQ B;  4WW0 A;  5FKY A;  5JH7 E;  1DEE G;  1RF1 C;  3PUW F;  2VVS A;  4ZHQ E;  3RC8 A;  2YIU C;  3RIU C;  3D6Z A;  3ZSS A;  2AE9 A;  4H9N C;  1W2B O;  1SQB G;  2OYO A;  4QXB B;  1SQV G;  1LVF A;  1J5W A;  3L73 J;  3KV5 A;  1NKN A;  5BR8 T;  1SQP K;  1FS0 E;  5FNV E;  2EHO A;  3QK6 A;  2WT7 B;  5AW3 B;  5KMG P;  2YMK A;  4IDZ A;  4GK0 E;  2W6J H;  1Q82 Q;  4IDO A;  4Y28 J;  5CA1 E;  3P8C D;  2QEX P;  2DL1 A;  2E75 D;  3UUX B;  2EHO B;  1BDD A;  5L47 A;  3JAE A;  1T72 A;  4EOZ B;  1L0N G;  5LG4 A;  3PUG A;  5DJT B;  3AEG A;  3KDS E;  4KI0 F;  5IWA T;  2QJP C;  2GM4 A;  1BGY E;  2JWA A;  1KB9 D;  4QH5 A;  4DBR A;  2KYV A;  2I1K A;  4UF0 B;  3AE6 A;  4R4M A;  2ZJS E;  2NTX A;  2OYI A;  3AB3 B;  2VQE T;  1X79 B;  1SQQ E;  1KIL C;  3OAK A;  1H0T B;  2PJQ A;  3CXH H;  2K9J B;  2E75 B;  1NTZ D;  1P84 E;  1ZN5 A;  5FY7 A;  1ZW0 A;  2QYW A;  1WRG A;  3N2G E;  2E8I A;  1T2K D;  2C9L Y;  2OYI B;  4E7S A;  3Q3D A;  2BEQ D;  1YQ4 A;  5AW7 B;  1MV8 A;  5APU A;  3ABV C;  4QMA A;  3I9Y A;  1KMI Z;  1KZU B;  2OYH A;  5ABE A;  1SQB J;  4EED A;  4E7Z A;  1BE3 E;  3QUJ A;  3RL0 D;  4UB8 E;  1NEK A;  4RJT A;  3CC4 P;  3VKH A;  1UUR A;  3LJC A;  1K05 A;  5IYZ E;  2K9Y A;  4CN1 A;  4YXD C;  2XQ9 A;  1RHZ B;  3CCV P;  2KZJ A;  2OYH B;  2QJK C;  3I0O A;  3E7K A;  4YPC A;  4DJG A;  1M1K Q;  2WZH A;  5AW4 B;  3PE0 A;  1LP1 A;  4LLH A;  1RE3 C;  5FVK A;  3M0D A;  4ZI2 D;  3HE4 B;  4I1L A;  5LGT B;  5HWY A;  1VDF A;  3I5C A;  4HGA A;  3LDQ B;  3H1K E;  3O8Z A;  3F89 A;  2WSE H;  3TGU E;  4P0B A;  1L0N J;  4ZI3 D;  4GIW A;  3MD0 A;  4YJ3 E;  3SOL A;  1PZQ A;  2KXP B;  1YQ3 C;  2BVM A;  3VR8 A;  2XAH B;  1YJ9 P;  3CCU P;  2W63 A;  3ESL A;  1RE4 A;  2ES0 A;  1W2E A;  3KDP B;  3ZN1 B;  1SQX D;  2SPC A;  3RX6 A;  1IK9 A;  3ZMT B;  2O1J A;  3KYQ A;  2KB7 P;  4GOE A;  4IL6 X;  4X5T A;  3ETV A;  1EC5 A;  4YY3 T;  2IYO A;  2V6Y A;  1KC8 Q;  4I55 E;  2WWV A;  2WWU A;  3PH0 A;  3V6I A;  2W83 C;  2YKQ A;  2IML A;  3ANW A;  3GG2 A;  1FOS E;  5HXC A;  4OFZ A;  1L0L E;  2UXB T;  2YEV C;  1HTJ F;  2LHR A;  2XSA A;  4LF9 T;  2G3A A;  4HWH A;  1YKE B;  3MTU E;  3TYY A;  3EVY A;  4ASK A;  1K73 Q;  2CEA A;  2HHH T;  3L70 D;  1X22 A;  2NPS C;  1N7S D;  4UR9 A;  3HUS C;  2XTL A;  3CVR A;  5LNK A;  3G3Z A;  2CBI A;  5FL0 A;  1VQK P;  2POH A;  1QUU A;  5FMN A;  3MGN A;  1Q90 D;  1LKX A;  4U31 A;  4XE5 B;  3F2E A;  4QXH B;  4I7Z B;  4IGU A;  1PFI A;  3CI9 A;  2R3C A;  1N7S A;  2IX7 C;  2LKM A;  3NXS A;  3HD7 D;  2K3R A;  5AQJ B;  2QE7 H;  1CSB A;  2CMR A;  1FC2 C;  2FYU E;  2Q7C A;  1AQ5 A;  2M67 A;  2LOS A;  1NTK K;  4HWI B;  3CCS P;  3V2N A;  3S4R A;  2M6B A;  3EFF K;  3HD7 A;  3L8R A;  4BRY A;  2ACX A;  3B5M A;  1LJ2 A;  2Y9Z A;  4EYY R;  1BCC G;  4BJM A;  2OGU A;  3CCM P;  5AVX B;  2K88 A;  5JR9 A;  3LBX B;  1S5L H;  3AE9 A;  3GF3 A;  2NRG A;  3CX6 B;  4WNK A;  5F8P A;  4U3F J;  3GN5 B;  1SQQ D;  1D7M A;  4IFD K;  1P84 D;  3H1H J;  2YDR A;  1SA0 E;  2RH0 A;  2QJY B;  2WPS A;  4ERR A;  3UIA A;  3B5N B;  1VRB A;  3PUA A;  3C4W A;  2BCC J;  5B5E E;  5CA0 E;  2XHE B;  1BE3 D;  4TZ4 C;  2H89 A;  4ZMD A;  5AVU B;  1W09 A;  3L3P A;  4Q25 A;  3EAB A;  4AKH A;  4MAL A;  4UV8 B;  3AE4 A;  1NU1 E;  2LRL A;  3O9X A;  4QX7 B;  3RIA A;  3P8M C;  5AQG B;  1N34 T;  5HEU A;  2Y0C A;  3L74 J;  4L73 A;  1Y47 A;  4UVC B;  1S5L E;  2OLT A;  3UU4 A;  3H32 A;  2DLR A;  3A5X A;  3ZT6 A;  3HE5 B;  3MUD C;  2E74 D;  2CBJ A;  1PP9 E;  2KK7 A;  3H1K D;  4H44 D;  1YIJ P;  2X51 A;  4L9I A;  1LRZ A;  3T8O A;  3TGU D;  3WUV A;  2Y48 B;  2A45 H;  5AQK B;  3E1I A;  1CHU A;  1BCC J;  1MIV A;  5APS A;  5APY A;  4QH4 A;  5EK4 A;  5M4Y A;  5LOV E;  3G6E P;  1G73 A;  2XJ7 A;  1IO4 A;  2CXF A;  3IF8 B;  3EAM A;  3VN0 A;  3B8E B;  2JPF A;  2X0Y A;  4F8H A;  1KQG B;  3SFD C;  4LF4 T;  5APT A;  1S2E A;  2WPV B;  2E74 B;  5TIS H;  2HN2 A;  2ZXE B;  2IDO B;  3K3N A;  2ZYD A;  3KVB A;  2Q9Q D;  4AQR D;  4O2A E;  2XU6 A;  5LYJ E;  1GK6 A;  4KHP T;  1JCC A;  5AW5 B;  1UK5 A;  3JCF A;  1L0L D;  3RHW A;  4LFB T;  2JMK A;  3ITK A;  2XY8 B;  4CXY A;  1N7L A;  5AQV B;  5EZY E;  1LT9 B;  3HKB E;  2VKD A;  1LGH B;  3ONL C;  3A8Y C;  2HPJ A;  2ZM2 A;  2Q9Q A;  3UU6 A;  2XQ7 A;  2JWD A;  3C64 A;  1M57 D;  2UU9 T;  2AEM A;  1KF6 A;  3VYI A;  5ABF B;  1JCD A;  3AE7 C;  1H89 A;  1NWQ A;  5AW6 B;  2XPK A;  3RIF A;  3ZCI A;  4EGW A;  5KJ7 C;  1KIL E;  1K04 A;  2D5U A;  3AE5 A;  2ACZ A;  3MZW B;  2N9D A;  3CML A;  1LWU B;  3BCC G;  2FJD A;  5TIS E;  3GLM A;  1SE7 A;  1FJG T;  1MNE A;  2PRR A;  1LNQ A;  3FBZ A;  1CW5 A;  4AKL A;  4CN6 A;  1VOM A;  4DR3 T;  3PU3 A;  2FYU D;  1FJK A;  3AE2 A;  4IDP A;  2JQ9 A;  1LTJ A;  4O4L E;  1T98 A;  2Q1K A;  2WWW A;  3CWB E;  4I7Z C;  1JMM A;  1FZB A;  3SRZ A;  1U4Q A;  3N2O A;  3QB5 K;  3RF1 A;  1NKZ B;  2R3S A;  3PUR A;  5FXX A;  3KXD A;  4Z8X A;  5LMU T;  2C5J A;  2IBZ E;  1USE A;  3U1C A;  3CME P;  1GDT A;  2V5D A;  4UVB B;  2O1K A;  5F3J A;  4P09 A;  4IIJ E;  3V2P A;  3KBU A;  2LSK A;  2CWO A;  2E9X C;  2CK3 H;  4IRE A;  2LSI A;  2QIW A;  3UFG A;  1CZQ A;  1IBM T;  1VQ8 P;  3L72 E;  2NW7 A;  2FFD B;  3O1I A;  4PD4 H;  4CI1 B;  2CHN A;  3H1L E;  4HKZ H;  1E1H B;  5L3G B;  2JRK A;  4JQ0 D;  1J1D B;  4H0L D;  4WBN E;  1NU1 D;  2IW5 B;  2LKG A;  2IHR 1;  1LTI C;  2QJY C;  2R32 A;  3AEB A;  4YHH T;  2CLY B;  3B5N C;  2KIN B;  4O4J E;  5AQR B;  4WYV A;  3MAC A;  2JJ9 A;  3LSV A;  1MUU A;  1A02 J;  5KLV K;  3ZJ1 A;  1RF0 C;  2A45 G;  1YHQ P;  1N73 B;  1FZC A;  3C1L A;  1PP9 D;  2M8R A;  2IAK A;  2WPQ A;  2KSR A;  2OTJ P;  1S9K E;  3NWI A;  3VMA A;  2BDE A;  3EHZ A;  2DHR A;  2NW9 A;  5KTB A;  1K8A Q;  4YFS A;  2ZM8 A;  4UV9 B;  2VL0 A;  3VOP A;  3SWK A;  5TAO A;  4HFD A;  1HFA A;  4GKJ T;  4JI4 T;  4JI2 T;  4XBF B;  5C2T A;  2VK9 A;  5CGM A;  4LF6 T;  4L76 A;  2UXX B;  3PJS K;  4PFP A;  3RIU A;  2V8S V;  3KV4 A;  3N2K E;  4YJ2 E;  2V7Q J;  3UQ4 A;  2A06 G;  3TNU B;  3AA7 B;  1KQS O;  3MJX A;  1RF1 B;  1KNP A;  4NUV A;  2K3W A;  2YIU B;  4UEM A;  3Q5P A;  2HPC B;  5AVT B;  2V1D B;  2BKP A;  3S9O A;  5HXR A;  1FZG A;  1X9V A;  2JMH A;  5JRE A;  3QOF A;  2Y6X A;  5JDG A;  4OHF A;  1SHZ C;  4IL4 A;  3U59 A;  4H9O C;  1Z0P A;  3WMM 0;  5KLV J;  2KLQ A;  3D71 A;  4TWH A;  3R6N A;  1KYO H;  3OW2 O;  1I6Z A;  1AFO A;  1LT9 C;  1MKM A;  1KIL D;  3K3Q C;  2M5A A;  4D6T G;  1MZ9 A;  3N9M A;  1S4X A;  2LSG A;  1KEY A;  1TU3 F;  4HFV A;  1KK7 A;  3ZLI A;  1OX3 A;  1GZL A;  3E1R A;  1BR4 A;  1G2C A;  3KV6 A;  3L73 E;  2QJP B;  1KIL A;  2WU5 A;  3EWK A;  2AXT H;  2YN6 A;  2KLV A;  3EDU A;  3RI5 A;  3R4Y A;  2Q5U A;  4ISS A;  3CWB D;  1LWU C;  2O01 N;  1W0A A;  2W90 A;  4NUU A;  2IZ1 A;  1EZV I;  3PJA J;  1ZR4 A;  2E5V A;  2OTL P;  1MMA A;  1NTM K;  4HFE A;  4JI7 T;  1MND A;  1Y9B A;  4WB4 A;  2LE8 A;  5HAX A;  4NXM T;  2E76 C;  1XTC C;  1IK7 A;  3OPC A;  4X64 T;  2IBZ D;  3TLT A;  1LTG C;  4CQI A;  1KNZ A;  5FP3 A;  5B66 H;  4U3C A;  1KYO E;  1PGO A;  5AQH B;  1OIP A;  2UXN B;  4Z90 A;  4YXD A;  2MTQ A;  2HR3 A;  5H6Q B;  3RKG A;  1IAP A;  1EDJ A;  1M62 A;  1LVK A;  4UEL A;  5APX A;  3I9W A;  4B3M T;  1RE3 A;  2VKH A;  5FY0 A;  1EDK A;  2ZYA A;  4L75 A;  5AQI B;  4I43 B;  5LHH B;  1AA0 A;  3L72 D;  2QJK B;  1KV4 A;  2AXT E;  2D2C C;  2IYP A;  4P1N A;  2K37 A;  3AAA B;  3H1L D;  4DMW A;  3B4S A;  4D6T J;  2M6I A;  1ZP0 C;  2NWB A;  5HEG A;  2K24 A;  3ZST A;  1DEB A;  3T97 B;  2PTF A;  2LM2 A;  5DQW A;  4P0A A;  3L75 J;  3A7M A;  4EOT A;  2E43 A;  2FFD C;  1FZE A;  4EI2 A;  4HJG H;  3AEC C;  1SQP E;  5B66 E;  1ZXG A;  4WBO A;  2L9Q A;  4HB1 A;  4BJN A;  3H1I G;  1WFD A;  1M90 Q;  4GKK T;  1MIY A;  5HXE A;  5LJN A;  3JCU H;  3ZKR A;  3MK7 C;  4JLE A;  5JDN A;  4JYA T;  1NTM J;  1OED A;  2CLY C;  2FBW C;  1VL2 A;  1S9K D;  3B13 A;  4UB6 H;  3AVS A;  1PGP A;  2C0W A;  2NPS D;  1WLX A;  3H1J J;  2W8Z A;  3FWL A;  1N73 C;  5LBM A;  3M9Q A;  2N2N A;  2KP8 A;  3HKD E;  4ILB A;  1BSN A;  1L4A C;  3AE1 C;  4PV1 C;  1M7K A;  2B9B A;  1GD2 E;  1JOC A;  1M1J B;  1JNM A;  2CPB A;  1AV1 A;  3HUS A;  4XZC A;  1BR1 A;  3RK2 B;  2BS4 A;  4UIG A;  1J1E B;  1PPJ E;  3HTK A;  2I6H A;  1HWT C;  2NPS B;  2YU1 A;  3M9B A;  2BZB A;  3U3I A;  1NYH A;  4F6R C;  2M3B A;  2WY2 A;  3JCU E;  4C91 A;  1OVV A;  5KKZ C;  1VQM P;  5E79 E;  4UB6 E;  3Q5W A;  4NPD A;  3NRX A;  4TNV A;  4OWF A;  1JY3 N;  4YLH A;  1JB0 J;  2FXP A;  3Q9D A;  2N1T B;  1AJ3 A;  1NTZ G;  2X9X A;  2WT7 A;  2XAS B;  1GQE A;  4BXL A;  3H1I J;  3I0Q A;  3L37 A;  1SQB K;  2GK9 A;  1NVO A;  1SQV K;  2OAR A;  4AIS A;  1P84 H;  4NPP A;  3D70 A;  2XZR A;  2XQA A;  1CI6 B;  2P9B A;  4OGQ C;  2QA7 A;  3CK6 A;  3KVA A;  3P4W A;  4CI2 B;  3UU8 A;  4TX5 A;  3L73 D;  2K5B B;  3BK9 A;  3UUB A;  1XZY A;  4IT4 A;  1R5L A;  3RC3 A;  4UF0 A;  4UB8 H;  4JI3 T;  1JMB A;  2GA1 A;  5CJ0 A;  3SFE A;  2CCQ A;  4PK6 A;  4HFI A;  1X79 A;  2DI4 A;  1L0N K;  3AA0 B;  1IJ5 A;  4O4H E;  1H0T A;  2K9J A;  4C7N B;  4U7I A;  4U7Y A;  5CCH C;  1GL2 B;  3G71 P;  3TLV A;  2XQ4 A;  1KYO D;  3OBV E;  5LMN T;  4CXW A;  3MP7 B;  1YYC A;  1JO5 A;  2SPZ A;  1QLE D;  3KBT A;  1X0T A;  2V5C A;  5CFB A;  2LOP A;  2XND H;  4HKA A;  3ZDM A;  1FEW A;  3IA3 A;  3WAJ A;  1SQX G;  4U3F E;  1IBK T;  4FI5 A;  3MUD A;  3MKD A;  3R84 B;  5DAB A;  3VP8 A;  3KZI H;  3H1H E;  4DUZ T;  1IFN A;  2Z4E A;  4PNI A;  3N9Q A;  1SQV J;  4JI5 T;  1T6A A;  3ETU A;  2UUB T;  3H6P A;  4U74 A;  2WCA A;  3HE4 A;  2VKJ A;  3ZYK A;  2UXC T;  2BCC E;  3SS1 A;  1QL1 A;  2AEJ A;  5KX5 E;  2CM0 A;  4J2C A;  2LSJ A;  2UUC T;  1SQP D;  4LC1 A;  3SFD A;  1WR6 A;  5ABG A;  3LW5 J;  1DU2 A;  3CPW O;  2KZ7 B;  4QWN B;  3IBP A;  4BA9 A;  3L70 G;  3L74 E;  3L39 A;  2WP9 A;  2CWY A;  3KFW X;  3RPU A;  3FZK B;  1EZ3 A;  4YT0 A;  3ZYM A;  1NTK E;  2I0M A;  1IFD A;  3VMY A;  1UIX A;  3GHG B;  1GK4 A;  2I59 A;  2XUE A;  2J47 A;  2ZFC A;  1SS1 A;  4CI3 B;  2ZVN B;  4EZ4 A;  2PP6 A;  3H25 A;  2JQK A;  3H37 A;  2MKV A;  3KZI E;  5KJ7 D;  4AKI A;  1KQF B;  1KB9 I;  2C9N Y;  4JBW F;  3PLN A;  3NKZ A;  2M0B A;  3KHU A;  2E5T A;  3AE7 A;  5FXZ A;  5LJM A;  3ZPO A;  4O8S A;  4WWI A;  1SQX J;  5KJ7 A;  2YO2 A;  1PPJ D;  2B88 A;  2Y0E A;  1HF8 A;  1U7M A;  4X1K E;  1JY3 P;  4L0R A;  2VVN A;  1M1J C;  2O01 J;  2LXC B;  1ZOY C;  5AW2 B;  5LBQ B;  5HCM A;  3FWN A;  4B86 A;  3M65 A;  4PK4 A;  5AQN B;  1W9R A;  3RK2 C;  4DT0 A;  1J1E C;  2A9U A;  2WMM A;  4LFC T;  4KHX A;  1HJB A;  1SQQ G;  2RA1 A;  3H3A A;  3PUX F;  5IUX A;  1EXI A;  1LTA C;  1YI2 P;  2QVA A;  3NTN A;  1BR0 A;  2WQY C;  4V1A v;  2Z6E A;  3O1H A;  4JUY A;  4OX9 T;  4DOJ A;  2E9X D;  3L70 J;  3AE8 C;  5GON E;  3V4W A;  4LF7 T;  1HNX T;  2N1T C;  1CUN A;  4DR1 T;  4OK0 A;  1BE3 G;  4N6J A;  2CHO A;  1NH4 A;  2KWH A;  4RO0 A;  2DWG A;  2IUB A;  3M06 A;  2N1G A;  1N8R Q;  2XQ6 A;  3KQG A;  4EXT A;  2L5G B;  5B5E H;  1YJN P;  3LBX A;  4U2Y A;  1SLQ A;  1KOR A;  4IE6 A;  5L3B B;  2IC6 A;  5LCY A;  2WSF J;  3CX5 H;  2VQF T;  4Y99 C;  3JSV C;  4MHC A;  3QC9 A;  3GN5 A;  3B5N D;  1BGY D;  4ZKP A;  2E9X B;  3IF4 A;  2BBJ A;  1RQU A;  3AEE C;  1NGM B;  4LML A;  4EIJ A;  3H1K G;  5J2U E;  1T7S A;  4LF8 T;  4DMV A;  2GUV A;  2Z5I A;  3TGU G;  3TF5 A;  4GKG A;  3GF7 A;  1ZEE A;  3PUQ A;  3UUM A;  3WUT A;  2OQQ A;  2H7V C;  1ZV8 A;  2JJL A;  3B5N A;  2D9D A;  3EQ2 A;  3QNU A;  4KJM A;  3C4Z A;  2H8P D;  5HEH A;  2MBG A;  3ZT7 A;  1VQN P;  4U3F D;  3LG7 A;  1GL2 C;  3H3M A;  1GW3 A;  1SQQ J;  2XAG B;  4DV4 T;  3OKQ A;  1YIT P;  1YKH B;  2JP3 A;  4ZZC A;  1HVV A;  1EDI A;  1N32 T;  3H1H D;  4DR2 T;  1X9B A;  1LTT C;  5K5G B;  1USD A;  2X68 A;  3FHN A;  3UT5 E;  1KN7 A;  2I8D A;  3I56 P;  3CX5 E;  3AED C;  3HE5 A;  1D1A A;  3OYX A;  2BCC D;  1L0L G;  3G4S P;  5L3C B;  3K5B A;  1BE3 J;  4EYY Q;  4JI6 T;  1Y01 A;  3LK2 B;  1G1I A;  1GMJ A;  3AEG C;  2CXL A;  1VQ7 P;  3O6Q B;  2X66 A;  5FXW A;  3RRC A;  2C5I T;  3BAT A;  3AE6 C;  1NTK D;  1QEX A;  4DO0 A;  1VQ5 P;  3FXE B;  1JY2 N;  4ZS2 A;  1N33 T;  5AVS B;  3H1K J;  1IBL T;  2Y8D A;  3TGU J;  3QWO C;  3ZT5 A;  1NAF A;  1SVF A;  2VUR A;  2WMO A;  4DV6 T;  3P7I A;  4WY4 B;  2LEH A;  1LT1 A;  1YQ4 C;  4JI1 T;  2FYU G;  3JC2 2;  3GHG C;  3V4Q A;  2YK0 A;  1VPC A;  4L74 A;  1IJD B;  1L0V A;  2JEE A;  1ZLL A;  1LT9 A;  4HWC A;  2WMN A;  4JEH B;  2B76 A;  1WYB A;  2DWK A;  2LSY A;  1EZV E;  1OVU A;  2WSC H;  2IDB A;  3FZM B;  4KHZ F;  2V7L A;  1EQ7 A;  5H2F H;  3RQW A;  2H7H A;  5ABF A;  3TLS A;  3SSU A;  5IHY A;  2W0G A;  2E76 D;  3IFM A;  3B71 A;  1JM0 A;  1FOS F;  4GT1 A;  1LWU A;  2WVR A;  2WSE J; 
#chains in the Genus database with same CATH homology
 4DBQ A;  4DND A;  5BU5 A;  2V26 A;  3V2Q A;  4IHJ E;  1B7T A;  2V7K A;  5APW A;  2KWI B;  1HS7 A;  5HWX A;  2B1E A;  5AVV B;  2CE7 A;  1QL2 A;  2A72 A;  3ZMU B;  5AW9 B;  1HG5 A;  4A56 A;  3K8P C;  4B6X A;  2H7O A;  1SFC B;  4KMC A;  1IFM A;  4I4T E;  3O4X E;  2QM7 A;  2VWA A;  5HXS A;  2FFD A;  5LXT E;  5AVQ B;  4ADZ A;  3FXD B;  4ZOL E;  3MZK B;  4CZZ B;  5CJ4 A;  3P32 A;  5J2T E;  5FYM A;  3FB2 A;  2H3R A;  2R5D A;  4O9B A;  1DX7 A;  3BVH A;  1G8X A;  1MFZ A;  5JDL A;  4AKR B;  1N73 A;  4X20 E;  1HCI A;  2YO3 A;  4IE4 A;  1JY2 P;  3BAS A;  5CCG C;  1O3X A;  2R5B A;  3ZMV B;  1L4A B;  4X1Y E;  4BAY B;  4IE5 A;  5HYA A;  2MJZ A;  1T8Z A;  2P67 A;  3TNU A;  2PFV A;  1RF1 A;  3NRY A;  5JQG E;  1UX5 A;  4EAH A;  2HPC A;  3TKL B;  4AQF C;  2RP4 A;  3LK4 2;  4WY4 C;  4M1P A;  1QSD A;  1JTH B;  3PU8 A;  2P7J A;  1ZV4 X;  3IR9 A;  2WSS V;  3LID A;  2K9A A;  2WZ7 A;  2XQY A;  1Y64 B;  5C8Y E;  5CCH D;  3PP5 A;  3ONX A;  3C50 A;  2IFM A;  2CXD A;  1HH0 A;  5LA6 E;  3RYH E;  2YKP A;  3NMD A;  3L36 A;  5AVR B;  5CCH A;  4N3Y B;  4C46 A;  2W27 A;  2X9W A;  5CHX A;  2A3D A;  4EB6 E;  2WM9 A;  1ZKE A;  3CL3 D;  2V7I A;  3MA9 A;  3A5T A;  2W61 A;  1US7 B;  1NWM X;  1MMD A;  2XDJ A;  4PAG A;  4IST A;  4KUM B;  3C9I A;  1NHL A;  2DCF A;  4ILU A;  3GMI A;  1T3U A;  3VKG A;  1SFC C;  3N5L A;  2HOD B;  1IZN B;  3JC6 C;  3T97 A;  2WAU A;  2A45 I;  4QHO A;  2NOX A;  4TN7 B;  3HKE E;  4KP3 C;  3CX7 B;  3ZCJ A;  2NTY A;  2YKO A;  2ZLY A;  3N9P A;  1GU5 A;  4PW8 A;  3TSI A;  3BRT B;  3OJA B;  2KSJ A;  3RK2 D;  4UXN B;  2X9Y A;  3K3O A;  2K48 A;  5JRC B;  3B57 A;  4EYU A;  1M1J A;  3NBX X;  4UVA B;  1IC2 A;  5FXV A;  5J1G A;  3OA7 A;  4JYB A;  4QXC B;  3AA6 B;  3HA4 A;  2NPS A;  4TUY E;  2N1T D;  3HL6 A;  2XKM A;  4N78 E;  1S35 A;  2N1T A;  2FYZ A;  5LHI B;  2J58 A;  1IJ6 A;  4U72 A;  4W7Y A;  2L8K A;  3IHR A;  1CI6 A;  4W80 A;  1NTZ K;  1S94 A;  1UX4 A;  3J9X 1;  5EK2 A;  1GL2 D;  4Y99 B;  1WYC A;  3RRW A;  4C7R A;  2NW8 A;  3F31 A;  1NO4 A;  3V2R A;  3U1A A;  4C7N A;  4ZI7 E;  1GL2 A;  1T3J A;  3RK3 C;  1MMN A;  2LJL A;  4HYT B;  4GIF A;  5LGU B;  2FKW B;  5BVZ A;  3ZN0 B;  3E0Z A;  3PUS A;  2ODV A;  5JDH A;  3UFE A;  3V5S A;  2D2S A;  2KND A;  3LK3 B;  1SQX K;  2JQQ A;  2VKO A;  5EK3 A;  1GTW A;  2XV5 A;  2HFE D;  3M9H A;  4H63 V;  3AA1 B;  1BR2 A;  5A1L A;  4XAX B;  4QX8 B;  3Q5X A;  4AI6 A;  3GHG A;  2PG8 A;  4AQG A;  4X1I E;  3L35 A;  3CQG B;  3ZEF B;  4EZH A;  5L2L A;  3VU7 H;  2W62 A;  4HE8 A;  1IFJ A;  2XAQ B;  3DP7 A;  1FZA A;  4GOU A;  3WI3 A;  2C0S A;  5E0O A;  3N4X A;  4PJM A;  1V9D A;  1M7L A;  2X0L B;  3RL0 B;  5L3E B;  3CWZ B;  4L5G A;  4N78 D;  5H6R B;  2Q3I A;  2XAF B;  4O2B E;  3D0T A;  4H9S E;  1MMG A;  3UTK A;  5AFU L;  1URQ C;  2IPP A;  3NZQ A;  2LM9 A;  3I1A A;  4PK5 A;  1SQQ K;  3MXZ A;  2YNY A;  2V7J A;  2L3L A;  2VRS A;  4H63 H;  2D0U A;  3L09 A;  3VTP C;  4OYK A;  3L4F A;  1ZHC A;  3ANW B;  3N7N A;  2E9X A;  2Q9I A;  3O1J A;  3N9N A;  2YIN A;  3BRV B;  4I50 E;  1H7C A;  4FJO A;  3GA8 A;  2MYS A;  2WTY A;  5CCG D;  1J2J B;  4WBA A;  3EDV A;  1N7S B;  1XTG B;  4C90 A;  3KIN B;  2HLO A;  1D0X A;  3EUH A;  1RF0 A;  5CCG A;  3E08 A;  1MIW A;  5AVW B;  2EHO C;  4JEU B;  2IFN A;  3HD7 B;  3AAE B;  1GU4 A;  3CQC B;  2P1J A;  1NOH A;  4IE7 A;  4K0U A;  5JR9 B;  5BMV E;  1L0L K;  1FMW A;  4WY4 D;  4I2L C;  4IE0 A;  2A2F X;  4AQF A;  2OYI C;  3RKO A;  4WY4 A;  3TK1 A;  3PDY A;  1D0Z A;  2KMF A;  1YD8 G;  4H9P C;  2FYU K;  2OYH C;  3H32 B;  2WIT A;  3SWH A;  1T2K C;  3WAK A;  1UCU A;  2OA5 A;  4G63 A;  5LGN B;  3HKC E;  2YMY A;  3N9O A;  1HGZ A;  3NFQ A;  2PAJ A;  5L3D B;  3RL0 C;  3M0D C;  1N2D C;  4OYJ A;  4ZKU A;  3ZC0 A;  2IC9 A;  1HGV A;  5AVY B;  2J59 M;  3IEE A;  3VMZ A;  4ZI2 C;  1ZR2 A;  2HPL A;  3C51 A;  1SFC D;  3ZJ2 A;  4OH8 B;  2DNX A;  1RE4 C;  3ZC1 A;  4ZI3 C;  3JC6 D;  2KT9 A;  2E42 A;  2YU2 A;  3RYI E;  2VB6 A;  4AUW A;  1SFC A;  1NU1 K;  2Q9Q B;  3BQK A;  3II6 A;  4AXP A;  1HUC A;  1KFN A;  1YTZ T;  4O4I E;  2CPS A;  5AW1 B;  4MLK A;  1D0Y A;  1FU1 A;  2P2U A;  1KQL A;  4HTE A;  3SWY A;  1JY3 O;  2NP9 A;  3KPE A;  4HN9 A;  2ZMA A;  3Q2M A;  1IFI A;  3UUN A;  3RH3 A;  3GWH A;  2I1J A;  2W00 A;  4JF7 A;  4GYS A;  5CB4 E;  3A3Y B;  1DH3 A;  1LTJ B;  3C4X A;  3E22 E;  5AW0 B;  5FY1 A;  3UUL A;  1FIO A;  1FAV A;  1L4A D;  1N7S C;  2ZM0 A;  3LFM A;  5JDM A;  3OYZ A;  4IFM A;  2N9B A;  2QM8 A;  1L4A A;  3CPZ A;  3HD7 C;  4EIW A;  3U78 A;  3CQX C;  2V7M A;  5JR9 C;  2BVL A;  3EFG A;  2G0U A;  1GW4 A;  4TV9 E;  1YTZ I;  3AAI A;  2XNX A;  3AVR A;  4LGD E;  4M3L A;  3DTO A;  4AYC A;  3A2A A;  1A02 F;  3RYC E;  4W7Z A;  4H9Q C;  1JTH A;  4I6M C;  2LHN A;  5HXH A;  3P7K A;  4MBQ A;  3BQI A;  1FZC B;  1X8Y A;  1Z56 A;  2QGS A;  3RK3 D;  4XA4 A;  3R2P A;  5BU8 B;  2C5K T;  4TV8 E;  3ZYL A;  4ANJ A;  4DVD A;  1FMV A;  1HBW A;  2PBI A;  2D0T A;  2LT3 A;  3HI2 A;  4PJL A;  1LTB C;  2HYN A;  3RK3 B;  3C98 B;  4DZO A;  3NZP A;  2GUS A;  3CKD A;  1D1C A;  4G2A A;  3LIE A;  2J1D G;  2Z5H A;  5ADX L;  2X67 A;  1LTS C;  1H88 A;  5CMZ A;  4IFF A;  3KV9 A;  1YW0 A;  5DQV A;  1FBM A;  2Q9Q C;  3P8C E;  5LP6 E;  2HOD A;  5JDF A;  3HR0 A;  4PJJ A;  1HG2 A;  1G2C B;  4JYC A;  5JVD E;  2WBL A;  1KIL B;  1H8A A;  3LW5 H;  3RYF E;  4GYR A;  2ODU A;  2WPR A;  3MIW A;  4H9R C;  3F57 A;  4QKN A;  1HTL C;  1KFM A;  1LTJ C;  2X9H A;  5DJQ C;  2XAJ B;  3OJA A;  1D1B A;  3PTR B;  5L3F B;  4HEA A;  1WT6 A;  5ETW A;  3N9L A;  5JRC A;  3FBL A;  4CXX A;  2W6B A;  1N86 A;  3DJB A;  4PFO A;  3ZMZ B;  1URQ D;  4KBM B;  2O01 H;  3ZMS B;  2KOG A;  1RY3 A;  4HH2 A;  3BQL A;  4PJN A;  4ZS3 A;  1URQ A;  3M0A A;  3CX8 B;  4GK5 E;  1J1D C;  1JUN A;  3HRN A;  1OWA A;  2VAS A;  5AVZ B;  1URQ B;  3VP9 A;  1U5P A;  3SWF A;  5AW8 B;  1OXZ A;  2FXM A;  3VMX A;  2CA5 A;  1HX8 A;  2HH7 A;  1SP4 A;  2HG5 D;  2VL8 A;  5LHG B;  3V5B A;  1G1J A;  3A7O A;  3CLQ A;  5APV A;  1WRD A;  1FZC C;  3M91 A;  4AKG A;  4MFR A;  4RES B;  3VHL A;  2C0X A;  2WSF H;  2MOZ A;  1E5W A;  1FJP A;  5KDM C;  1JY2 O;  3HUS B;  2H43 A;  3W15 B;  3S4U A;  3V5U A;  5JDQ A;  1FZF A;  3J7Y q;  2BAS A;  3HTK B;  2W6A A;  5APQ A;  2EHO D;  4YHJ A;  1FDM A;  5JH7 E;  4WW0 A;  3RC8 A;  1RF1 C;  4ZHQ E;  4H9N C;  4QXB B;  1LVF A;  3KV5 A;  1NKN A;  1SQP K;  5FNV E;  2EHO A;  3QK6 A;  2WT7 B;  5AW3 B;  5KMG P;  4IDZ A;  4GK0 E;  5CA1 E;  3P8C D;  3UUX B;  2EHO B;  4EOZ B;  5LG4 A;  3PUG A;  3KDS E;  2GM4 A;  4DBR A;  2KYV A;  2I1K A;  4UF0 B;  2NTX A;  2OYI A;  3AB3 B;  1X79 B;  1KIL C;  3OAK A;  2PJQ A;  1ZN5 A;  5FY7 A;  1WRG A;  3N2G E;  2E8I A;  1T2K D;  2C9L Y;  2OYI B;  4E7S A;  5AW7 B;  1MV8 A;  5APU A;  3I9Y A;  1KZU B;  2OYH A;  4E7Z A;  3QUJ A;  3RL0 D;  3VKH A;  3LJC A;  5IYZ E;  2OYH B;  3I0O A;  5AW4 B;  3PE0 A;  4LLH A;  1RE3 C;  4ZI2 D;  3M0D A;  3HE4 B;  4I1L A;  5LGT B;  5HWY A;  1VDF A;  3I5C A;  4HGA A;  3O8Z A;  2WSE H;  4P0B A;  4ZI3 D;  4GIW A;  3MD0 A;  4YJ3 E;  3SOL A;  2BVM A;  2KXP B;  2XAH B;  2W63 A;  3ESL A;  1RE4 A;  2ES0 A;  1W2E A;  3KDP B;  3ZN1 B;  2SPC A;  3RX6 A;  1IK9 A;  3ZMT B;  2O1J A;  3KYQ A;  2KB7 P;  3ETV A;  4I55 E;  2WWU A;  2YKQ A;  3ANW A;  1FOS E;  5HXC A;  4OFZ A;  2YEV C;  1HTJ F;  2LHR A;  1YKE B;  3MTU E;  3TYY A;  3EVY A;  4ASK A;  2CEA A;  2NPS C;  1N7S D;  3HUS C;  2XTL A;  3CVR A;  5LNK A;  3G3Z A;  1QUU A;  2POH A;  5FMN A;  3MGN A;  1LKX A;  4XE5 B;  3F2E A;  4QXH B;  4IGU A;  1PFI A;  3CI9 A;  2R3C A;  1N7S A;  2IX7 C;  2LKM A;  3NXS A;  3HD7 D;  1CSB A;  2CMR A;  2Q7C A;  1AQ5 A;  2M67 A;  2LOS A;  1NTK K;  3V2N A;  3HD7 A;  2ACX A;  4EYY R;  4BJM A;  5AVX B;  5JR9 A;  3LBX B;  3CX6 B;  4WNK A;  5F8P A;  3GN5 B;  4IFD K;  1SA0 E;  2WPS A;  4ERR A;  3UIA A;  3B5N B;  1VRB A;  3PUA A;  3C4W A;  5CA0 E;  2XHE B;  4TZ4 C;  5AVU B;  3L3P A;  4AKH A;  4MAL A;  4UV8 B;  3O9X A;  4QX7 B;  3P8M C;  4UVC B;  3H32 A;  2DLR A;  3A5X A;  3HE5 B;  2X51 A;  4L9I A;  1LRZ A;  3T8O A;  2Y48 B;  2A45 H;  3E1I A;  1MIV A;  5APS A;  5APY A;  5EK4 A;  5M4Y A;  5LOV E;  1G73 A;  1IO4 A;  2CXF A;  3IF8 B;  3VN0 A;  3B8E B;  2JPF A;  5APT A;  2ZXE B;  3K3N A;  3KVB A;  2Q9Q D;  4AQR D;  4O2A E;  2XU6 A;  5LYJ E;  1GK6 A;  1JCC A;  5AW5 B;  2JMK A;  4CXY A;  1N7L A;  5EZY E;  1LT9 B;  3HKB E;  2VKD A;  1LGH B;  2HPJ A;  2ZM2 A;  2Q9Q A;  3C64 A;  3VYI A;  1JCD A;  1H89 A;  1NWQ A;  5AW6 B;  3ZCI A;  5KJ7 C;  2D5U A;  2N9D A;  3CML A;  1LWU B;  1MNE A;  3FBZ A;  1CW5 A;  4AKL A;  1VOM A;  3PU3 A;  1FJK A;  1LTJ A;  4O4L E;  1T98 A;  2WWW A;  1JMM A;  1FZB A;  3SRZ A;  1U4Q A;  3N2O A;  1NKZ B;  3PUR A;  5FXX A;  4Z8X A;  2C5J A;  3U1C A;  1GDT A;  4UVB B;  2O1K A;  5F3J A;  4P09 A;  4IIJ E;  3V2P A;  3KBU A;  2LSK A;  2CWO A;  2E9X C;  2LSI A;  1CZQ A;  2NW7 A;  2FFD B;  3O1I A;  4CI1 B;  1E1H B;  5L3G B;  2JRK A;  1J1D B;  4WBN E;  2IW5 B;  1LTI C;  2R32 A;  2CLY B;  3B5N C;  2KIN B;  4O4J E;  3MAC A;  2JJ9 A;  1MUU A;  1A02 J;  5KLV K;  3ZJ1 A;  1RF0 C;  2A45 G;  1N73 B;  1FZC A;  2M8R A;  2IAK A;  2WPQ A;  1S9K E;  2BDE A;  2DHR A;  2NW9 A;  5KTB A;  4YFS A;  2ZM8 A;  4UV9 B;  3VOP A;  5TAO A;  1HFA A;  4XBF B;  2VK9 A;  2UXX B;  4PFP A;  3KV4 A;  3N2K E;  4YJ2 E;  3TNU B;  3AA7 B;  3MJX A;  1RF1 B;  4NUV A;  4UEM A;  2HPC B;  5AVT B;  2V1D B;  5HXR A;  1FZG A;  1X9V A;  2JMH A;  5JRE A;  2Y6X A;  5JDG A;  4OHF A;  1SHZ C;  3U59 A;  4H9O C;  1Z0P A;  3WMM 0;  2KLQ A;  3R6N A;  1AFO A;  1LT9 C;  1KIL D;  3K3Q C;  1MZ9 A;  3N9M A;  2LSG A;  4HFV A;  1KK7 A;  3ZLI A;  1GZL A;  1BR4 A;  1G2C A;  3KV6 A;  1KIL A;  2KLV A;  3EDU A;  4ISS A;  2Q5U A;  1LWU C;  4NUU A;  1ZR4 A;  1MMA A;  1NTM K;  1MND A;  2LE8 A;  4WB4 A;  5HAX A;  1XTC C;  1LTG C;  4CQI A;  1KNZ A;  5FP3 A;  2UXN B;  2MTQ A;  5H6Q B;  1IAP A;  1LVK A;  4UEL A;  5APX A;  3I9W A;  1RE3 A;  2VKH A;  5FY0 A;  4I43 B;  5LHH B;  3AAA B;  4DMW A;  2NWB A;  2K24 A;  1DEB A;  5DQW A;  4P0A A;  4EOT A;  2E43 A;  2FFD C;  1FZE A;  4WBO A;  2L9Q A;  4BJN A;  1MIY A;  5HXE A;  5LJN A;  3MK7 C;  4JLE A;  5JDN A;  2CLY C;  1S9K D;  3B13 A;  3AVS A;  2C0W A;  2NPS D;  1WLX A;  1N73 C;  5LBM A;  3M9Q A;  2N2N A;  2KP8 A;  3HKD E;  1L4A C;  1GD2 E;  1JOC A;  1M1J B;  1JNM A;  2CPB A;  3HUS A;  4XZC A;  1BR1 A;  3RK2 B;  4UIG A;  1J1E B;  3HTK A;  1HWT C;  2NPS B;  2YU1 A;  3M9B A;  2BZB A;  3U3I A;  4F6R C;  2M3B A;  4C91 A;  3Q5W A;  3NRX A;  1JY3 N;  4YLH A;  3Q9D A;  2N1T B;  1AJ3 A;  2X9X A;  2WT7 A;  2XAS B;  3I0Q A;  3L37 A;  1SQB K;  2GK9 A;  1SQV K;  2OAR A;  2XZR A;  1CI6 B;  2P9B A;  2QA7 A;  3KVA A;  4CI2 B;  4TX5 A;  2K5B B;  3BK9 A;  3RC3 A;  4UF0 A;  5CJ0 A;  2CCQ A;  4PK6 A;  1X79 A;  2DI4 A;  1L0N K;  3AA0 B;  1IJ5 A;  4O4H E;  4C7N B;  5CCH C;  1GL2 B;  3OBV E;  4CXW A;  1YYC A;  1JO5 A;  3KBT A;  2LOP A;  4HKA A;  1FEW A;  3WAJ A;  4FI5 A;  3MUD A;  3MKD A;  3R84 B;  5DAB A;  3VP8 A;  1IFN A;  2Z4E A;  4PNI A;  3N9Q A;  3ETU A;  3H6P A;  4U74 A;  3HE4 A;  2VKJ A;  3ZYK A;  3SS1 A;  1QL1 A;  5KX5 E;  2CM0 A;  4J2C A;  2LSJ A;  4LC1 A;  1WR6 A;  2KZ7 B;  4BA9 A;  4QWN B;  3IBP A;  2CWY A;  3KFW X;  3RPU A;  1EZ3 A;  3ZYM A;  1IFD A;  3VMY A;  3GHG B;  1GK4 A;  2I59 A;  2XUE A;  2ZFC A;  4CI3 B;  4EZ4 A;  2PP6 A;  3H37 A;  5KJ7 D;  4AKI A;  2C9N Y;  5FXZ A;  5LJM A;  3ZPO A;  4O8S A;  5KJ7 A;  2YO2 A;  1HF8 A;  4X1K E;  1JY3 P;  4L0R A;  1M1J C;  5AW2 B;  5LBQ B;  4B86 A;  3M65 A;  4PK4 A;  3RK2 C;  1J1E C;  4KHX A;  1HJB A;  2RA1 A;  3H3A A;  1LTA C;  1BR0 A;  3NTN A;  4V1A v;  2Z6E A;  3O1H A;  4JUY A;  4DOJ A;  2E9X D;  5GON E;  3V4W A;  2N1T C;  1CUN A;  4OK0 A;  4N6J A;  1NH4 A;  2KWH A;  2DWG A;  3M06 A;  2N1G A;  3KQG A;  4EXT A;  2L5G B;  3LBX A;  1SLQ A;  4IE6 A;  5L3B B;  2IC6 A;  5LCY A;  4Y99 C;  4MHC A;  3QC9 A;  3GN5 A;  3B5N D;  4ZKP A;  2E9X B;  4EIJ A;  5J2U E;  4DMV A;  2GUV A;  2Z5I A;  4GKG A;  1ZEE A;  3PUQ A;  3UUM A;  2H7V C;  1ZV8 A;  2JJL A;  3B5N A;  3EQ2 A;  3C4Z A;  2H8P D;  2MBG A;  3LG7 A;  1GL2 C;  1GW3 A;  2XAG B;  3OKQ A;  1YKH B;  1HVV A;  1LTT C;  2X68 A;  3FHN A;  3UT5 E;  3HE5 A;  1D1A A;  3OYX A;  5L3C B;  3LK2 B;  1G1I A;  2CXL A;  2X66 A;  5FXW A;  3RRC A;  2C5I T;  3BAT A;  4DO0 A;  3FXE B;  1JY2 N;  4ZS2 A;  5AVS B;  2Y8D A;  1NAF A;  1SVF A;  2WMO A;  3P7I A;  4WY4 B;  2LEH A;  3GHG C;  3V4Q A;  2YK0 A;  1VPC A;  1IJD B;  2JEE A;  1ZLL A;  1LT9 A;  2WMN A;  4JEH B;  1WYB A;  2DWK A;  2LSY A;  2WSC H;  2V7L A;  1EQ7 A;  2H7H A;  5IHY A;  2W0G A;  3IFM A;  1FOS F;  4GT1 A;  1LWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...