1OXZA

Crystal structure of the human gga1 gat domain
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
132
structure length
132
Chain Sequence
DEEKSKMLARLLKSSHPEDLRAANKLIKEMVQEDQKRMEKISKRVNAIEEVNNNVKLLTEMVMSHSQGGAAAGSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEILQANDNLTQVINLYKQLVRGEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of Human GGA1 GAT Domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords ADP-ribosylation factor binding protein GGA1
total genus 51
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03127 GAT GAT domain
A PF18308 GGA_N-GAT GGA N-GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1oxzA01
1.20.58.160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1oxzA02
3TYYA 2XU6A 1FAVA 5AVZB 4AYCA 5AW6B 3VMXA 3L37A 1OWAA 5APXA 3M06A 3A3YB 3VMYA 3L36A 3IR9A 5AW5B 5AW8B 3VMZA 4I6MC 5AW2B 3A5TA 1X8YA 1CI6B 2Z5IA 2WPQA 2Q5UA 3HTKA 5APYA 5AVRB 4C7NB 4JYCA 1H89A 2YO3A 3KQGA 3LIDA 3P7KA 4GT1A 5AW9B 3VTPC 1GU4A 2E43A 5AVWB 2YNYA 3V4QA 3HE4B 4M3LA 1CZQA 1G2CB 4JYBA 1FOSE 2WTYA 1GD2E 1O3XA 2N9DA 2H7HA 3HE4A 3TNUA 3SWFA 5APVA 5AVYB 5AW4B 2Q7CA 2XV5A 1SP4A 2QM8A 2WPRA 3TNUB 4C7NA 1GTWA 2N9BA 1T2KD 3NTNA 1H8AA 4GKGA 2Z5HA 1MV8A 2QM7A 2WPSA 3V4WA 2YO2A 2P67A 2R3CA 1YD8G 5APSA 1WR6A 5APQA 1NWMX 2Q3IA 4DZOA 1J2JB 1T2KC 1HWTC 2XZRA 2JJLA 3NFQA 2E42A 4RESB 1A02J 5AW7B 4I2LC 1GK4A 2C9NY 4HYTB 4C46A 2BASA 3M0AA 5AVUB 5AW1B 1MUUA 3HE5B 1H88A 2IPPA 5APUA 3TK1A 5AW3B 3HE5A 1X79A 5AVVB 2N2NA 1YYCA 1KQLA 3MGNA 3M91A 2W27A 3B8EB 3O8ZA 3L35A 3V5BA 3KDPB 3T97A 1SLQA 1GU5A 2R5BA 3MD0A 2R5DA 2R32A 4KHXA 1JNMA 1MFZA 5AVXB 3NMDA 1DH3A 2P7JA 2VRSA 5AVTB 4EOTA 1S9KD 1GZLA 1IO4A 3I5CA 3M9HA 1NAFA 2WT7A 1GK6A 1CSBA 4LC1A 4AQRD 3VN0A 2KP8A 3P32A 2ZFCA 5AW0B 1CI6A 5CMZA 1JUNA 4AUWA 3M9BA 4B86A 2WWWA 3P8MC 5AVQB 1HJBA 1OXZA 2WT7B 3A2AA 3A7OA 2C9LY 5APWA 3OAKA 3VYIA 1S9KE 4XE5B 5AVSB 5APTA 1A02F 1WRDA 1HUCA 3NXSA 3UIAA 2W6AA 1FOSF 2ZXEB 3M0DA 1HBWA 3LIEA 2P2UA 1NWQA
chains in the Genus database with same CATH superfamily
2WSSV 1VQ9P 4NPEA 4IDOA 2JWAA 4ZS2A 1GQEA 3AXJA 2G8YA 2KMFA 2V7LA 1NGMB 2NOXA 3VMYA 3HR0A 4Z90A 2JIWA 2WZHA 1X8YA 2ZM0A 4OFZA 3LK3B 3GHGC 1SQPK 3LIDA 3MJXA 3AEEA 4U74A 1FZCA 2A2FX 1HNZT 1BGYE 4QKNA 1LTJC 1L2PA 1NENA 3U1AA 2D2CB 4XBFB 5KLIC 4HWIB 4L5GA 2HFED 2WU5A 1ZOYA 5L3DB 2Y48B 3TNUB 3ZJ2A 2LRKA 1OMIA 1X22A 3L70J 1HF8A 2R3CA 4DR1T 1VF5C 1FZGA 2ES0A 1KNRA 3WU2E 4IL6H 3CQGB 2A06D 4U3FJ 2YK0A 2JKVA 1VQ8P 1QUUA 1RF1C 3N9PA 5GTHE 3IF4A 2CK3H 3Q5PA 2XQ5A 4OX9T 3BCCG 5DJUB 1JY3O 2W6JH 4U3FG 3ABVA 2X0LB 4ASVA 2KS1A 1J1JA 1GL2B 4MN4C 2WDVA 2CCQA 4UELA 5L3BB 2B1EA 1KZUB 4GODA 3M0DC 5AQMB 1N73C 4ERRA 5FL1A 2WY2A 3N7NA 1SQXG 2W2UA 4ZI2D 2IFMA 1QGKB 2OGUA 4NUVA 1PPJD 4H9PC 5AQSB 1ZV8A 3CCVP 3P8CD 4PJNA 3H1HG 4EOTA 2KWIB 3ZC1A 4X65T 3AE5C 3S4RA 1K9MQ 2XQ3A 3B5NB 5ABFB 1JY2O 1J1EB 4JI1T 3M9HA 3I0OA 2VURA 2BS2A 3BRVB 1LTAC 4JEUB 2YMKA 5CBOA 1IZNB 2WSFJ 5A1LA 2VK9A 3H1HD 1QSDA 4E7ZA 1DEBA 5HEHA 3AE2A 2QEXP 1HG5A 3VU7H 1OXZA 2WT7B 1YXRA 2EHOB 2FFDA 3OAKA 1NTZD 2O01N 4L73A 4XE5B 3RC8A 3NXSA 1KFYA 4N78D 1T6AA 3M3ZB 3HKCE 3VOPA 2V26A 4ZI2C 4BAYB 3OKQA 5KLVJ 3MZWB 1OVVA 2LE8A 5LHGB 4ILBA 1HNXT 1M7KA 4JI2T 2Z5IA 2WPQA 4B3MT 3VTPC 3LK42 4HKZH 2WITA 1UIIA 2LM9A 1IJ6A 4DR3T 5CCGA 3CC7P 2V6YA 1SP4A 2QM8A 1DD3A 1GTWA 3I55P 1DX7A 3JC6D 3R4YA 2ZT9D 4H9RC 1CW5A 4ZKPA 1NU1K 3PE0A 1OX3A 1WR6A 2KNCA 1VQ6P 3RRCA 4H13C 1KNPA 3WAKA 3CX5H 1L0LG 3OBVE 4DZOA 1KYOH 4GDOA 4YTPA 1XMQT 4LLHA 3Q5XA 1PPJE 5JQGE 2W4XA 1X0TA 2C9NY 3SOLA 5AVUB 5AW1B 5C39A 1LNQA 3PRJA 4F6RC 5APUA 3TKLB 1UCUA 1MNEA 2J1DG 2BKOA 5AVVB 4HFBA 4EIJA 2DLRA 3MA9A 5KXJA 2Q1KA 2O1JA 1VQLP 1NTKJ 3P4QA 1NTMK 4B6XA 5LG4A 1OW8A 3AEDA 4W7YA 2OTJP 3L70E 5KAFE 3HUSA 2O3JA 4DR5T 2OYIC 2E9XA 1FJGT 3K5BA 1SFCC 3I56P 2JPFA 1URQC 1BGYJ 3KBTA 3L72E 4L74A 1D0XA 1T72A 3E22E 2WMNA 2GM4A 4B86A 5KAIH 1ZRTD 4YHJA 3AE4C 1FZAA 4PAGA 1EC5A 5KDMC 2H88A 2IX7C 4O2AE 5IHYA 2QJKC 3V6IA 2J4GA 2E5VA 2XAHB 4UB6H 3P4SA 4PFOA 1HBWA 3ABVC 1S4XA 4WY4D 3QH9A 1YBKA 4HFEA 1AFOA 1PP9J 2BCCG 5LBQB 1ZEEA 5AQTB 3VMXA 3IF8B 1N73A 3TGUG 3CCQP 3MACA 3LSVA 2WQYA 2YDQA 1KQGB 4AQFC 5AVRB 5TISE 2WPVB 2LSGA 3KV6A 2Q9IA 2Q3EA 3CWBJ 5AVWB 2OYHA 1Z8UA 2UUBT 2XY8B 5JRCB 4JYBA 4IE7A 1N34T 1YITP 3CXHH 2KT9A 1SQXK 4GK0E 1YIJP 1MV8A 1Y47A 2XNDH 3UFEA 2L8KA 3AEAA 2CBIA 3FXDA 1S35A 3K1SA 1HS7A 3C4XA 1GW4A 3C8VA 2LSIA 2L9QA 1YTZT 4ANJA 2Q3IA 4NPDA 3GF3A 2VKOA 1IK7A 3P4PA 2FJDA 1G73A 2LKHA 2QYWA 2UXNB 2JJLA 4EYYQ 1JEKA 1L0NK 4X64T 3D71A 3GA8A 3GHGA 1GK4A 3JCUH 2LHRA 2UXDT 2JQKA 1FZBA 4PK4A 5H6QB 2YKPA 1H88A 1N7LA 3FX0A 3SSUA 3L70G 5CB4E 3HE5A 4JI7T 2IDBA 1KQLA 3MGNA 4TWDA 1JTHB 3AECA 1SQBJ 2BDEA 5EZYE 1T7SA 3FWNA 3PHLA 2I6HA 1NTMD 2GK9A 4E7SA 1HR0T 3QWOC 4BXLA 4IFFA 1KILB 3IN6A 4H9SE 1PPJG 3AEFC 2KP8A 2MJZA 5L4EA 2ZYGA 3AE3C 4JBWF 1U7MA 1VQKP 2E74D 3H1IJ 4PK5A 1PFIA 1Z0PA 4PD4D 1IJDB 5ABEA 3A2AA 2A06E 3L74D 3Q5WA 4W80A 2LXBA 3CCJP 4ASWA 1A02F 3SWHA 1UUSA 3H1IE 1OFCX 3M0DA 4IT4A 1YQ3A 1BR2A 3L74G 1LWUB 2LKGA 4O4HE 2CWOA 4DO0A 2KNCB 3OW2O 4HN9A 1G2CA 2KYVA 1PGPA 5AW8B 4EB6E 2GUVA 2H43A 3L71E 4EI2A 1KN7A 3HKDE 4GIWA 5AW9B 2E43A 1FIOA 1HFAA 1R8IA 1W0BA 3V4QA 3L72J 5KJ7D 1KYOI 1KD1Q 4CQIA 1O3XA 3PU3A 3AE2C 2A45G 4AIUA 5JR9B 5APVA 1WR0A 2R3SA 1SQPJ 2WPRA 4IL9A 4ZZCA 3NTNA 3A7MA 3WU2H 1MZ9A 2RH0A 1Q90D 1USDA 3ZT6A 3V4WA 3RHWA 1HGVA 4U3FE 3ZCJA 2P67A 3BCCE 3FBZA 2YU2A 1M1JA 2NPSA 4GOEA 2NPSD 2IBZE 3HRNA 3F57A 1LWUA 1LT9B 3S9OA 5K5GB 2K9YA 1VF5D 3SWYA 4IFMA 1HWTC 2FXPA 4HB1A 3AE1A 2ACXA 1IAPA 4GK5E 1J5WA 4JI3T 3EAMA 2FFDB 1ZLLA 2K5BB 2K88A 2LHNA 5KKZC 4CN1A 5EK4A 3E0ZA 1OW6A 3CK6A 4UV9B 3P7IA 2XTLA 1QLED 3M91A 1KC8Q 2PGDA 2MOZA 3RIUA 4TX5A 1UURA 2XHEB 4V1Av 3RL0C 2B89A 4WY4B 4KHXA 1D1BA 5TAOA 2XQAA 1XTCC 2YN6A 4GOFA 2KNDA 1ZOYC 5CJ5A 3O1JA 2BVMA 2XPKA 1J5ET 4LF5T 2A45H 1NAFA 1KMIZ 1CSBA 3FWLA 4XA4A 4O9BA 1D1CA 1N86A 3P32A 5AW0B 3ZYMA 3AEEC 1JUNA 4TUYE 2XZEA 4ZXLA 3V5UA 2E8IA 2M0BA 1B7TA 5CBNA 5AQRB 2LKMA 3KHUA 3TDKA 3GN5A 2IYPA 3ZT5A 4YXDA 3KV5A 3EUHA 3RYFE 2K9JA 1XDOA 4PD4I 2C9LY 4KX6A 1VQ7P 2D9DA 3VYIA 4DUYT 5B5EH 2RKLA 4I0UA 1LTTC 3C51A 2JJ9A 2BS3A 4WW0A 3O6QB 3L75D 2XQ6A 4ILCA 3H32A 2PFXA 1BGYG 1SQVK 2P58A 4LF6T 2Y9YA 4MBQA 4TT3H 4DV3T 3NBXX 1NH4A 3V2NA 3S1KA 4I6MC 5C8YE 3FZLB 3OJAB 2N1TB 4D6TD 1K04A 2NW9A 4AI6A 2YO3A 2IFNA 3I1AA 2M5AB 5KLIB 2CRBA 1CZQA 1FDMA 1ZW0A 3V2RA 1W2BO 2H89A 2A06G 3PP5A 3CI9A 1S5LX 1LVFA 5GTIH 3CCEP 2JQ9A 5AQVB 3DTOA 2PAJA 1UK5A 3IA3A 4DVDA 4EAHA 1M90Q 3C50A 5L8RJ 5HAXA 2DCFA 2XQ4A 3AAAB 4H44C 2IC6A 4YPCA 1BDCA 1FJKA 4QX7B 4A7PA 4WVZA 3ZMZB 2HH7A 3ONJA 4WZXA 2CXLA 1KB9D 4YSXA 1N8RQ 3LBXA 2R44A 3ZYKA 2QRXA 2HN1A 2SPCA 2V5CA 5ABGA 3Q9DA 3EDVA 3K3QC 1ZHCA 3ZLIA 4H13D 5JDFA 4L9IA 2L91A 1HG2A 3SRZA 1YYCA 3JAEA 4H63V 1H0TA 2K3WA 3AEGC 3MTUE 4D6TG 1WCRA 4X1YE 3Q5RA 1FBMA 4KJMA 2O01J 1EXIA 2JMHA 2P9BA 1R5SA 2RMZA 1N7SB 4XZCA 2IBZI 5AQNB 1W2EA 2IDOB 3P4WA 5H2FE 1NTMJ 2KSRA 3ESLA 4QXHB 3UU8A 1NU1J 4X1KE 4Q25A 3BK9A 2WWWA 1SQQE 3B71A 4TN7B 3GLMA 3UQ7A 5LJNA 5HEUA 1NTMG 2KSEA 2FY8A 5CCGC 4MFRA 1LVKA 3RBZA 1CUNA 5APWA 4UV8B 1S9KE 5CGMA 4ISSA 1LJ2A 3NVOA 1P84D 5APTA 1NTKE 1EZVI 3JC6C 2RA1A 2Q9QB 2J47A 1YQ4C 3PUSA 1MMGA 3W15B 3CCSP 3EQ2A 2WM9A 1M7LA 1T8ZA 2JQHA 1FAVA 1VCTA 2BG9A 3A3YB 1Q81Q 3UULA 3VMZA 4EV6A 3HI2A 3VR9A 1U7JA 2YIUB 5LG3A 2D0UA 1CI6B 2VB6A 2DWGA 2HHHT 4L76A 5EK3A 2W67A 1SQXJ 3JCFA 3LDQB 3OJAA 1SQPD 5B66E 1VOMA 1NU1G 4N3YB 2CWYA 4M3LA 1PZQA 2V7MA 5E0OA 2X9WA 3N5LA 1EZ3A 4DR4T 1SFCA 1OEDC 3K3NA 3N2GE 5CFBA 3PV0F 1L4AD 1PIXA 3LFMA 1NTKD 1LP1B 2FYNC 1L0LE 2WSFH 3BASA 1KK7A 4KT0J 1JY3N 4UR9A 2H88C 3EABA 1KFMA 4Z8XA 2LOSA 4UVCB 1D0ZA 1HX8A 1LGHB 2BG9E 1ZXGA 2NTYA 4OGQD 5DQWA 2K37A 2PRRA 1URQA 2OYOA 4IGUA 1ZR4A 2POHA 2XZRA 2BEZF 3HD7B 5J0ZA 3TGUD 1Y64B 2E76B 3PUGA 3RK2B 2E5TA 3II6A 5AW7B 1D1AA 4ADZA 3L75G 2V7IA 3M0AA 3UFGA 2QGSA 2JEEA 4IREA 1Q7YQ 3LW5J 1YKHB 3H1HE 2M8RA 3QB5K 3V5BA 5AQJB 3RRWA 1LT1A 3CVRA 3ZMSB 2R32A 5KTBA 4G63A 3H1HJ 2VRSA 2J62A 4EYUA 3MK7C 1XZYA 5CJ4A 4U33A 5LMUT 1VQMP 2LT3A 3H1JD 4PV1C 1KYOE 2K24A 3BCCD 5CMZA 3HKBE 2OYHC 2A45I 2BG9B 2QJKB 5CCGD 3MXZA 4QH5A 4JBZA 2E74C 3L75J 3PUQA 1NKNA 5AVSB 3NWIA 1KFNA 2HPLA 3GG2A 4MHCA 1HH0A 2JO1A 2WSSH 4IDZA 3CXHI 4I4TE 4ILAA 3BRTB 1BR0A 4BA9A 2IW5B 2XSBA 3L36A 3AECC 4JI6T 5KAFH 4ZNCA 2QJPC 3NRYA 3HTKA 1DU2A 4L75A 5BU5A 2WMMA 3KQGA 1EDLA 5L3FB 1EZVE 2N1TC 3CXHD 1NTKG 3AAIA 4CZZB 1NAYA 2A9UA 5F3JA 2X9XA 3RK3E 1HTLC 2E76D 4GIFA 1LTBC 4PJLA 3HD7D 5KJ7C 1FZCB 2H7HA 5M1BA 2IAKA 2DL1A 2BCCJ 3ETUA 1AQ5A 4BJNA 5LHHB 2N9BA 3O9XA 2V4HA 2HPCA 1N7SC 3WAJA 1R5LA 1VF5B 4U7JA 4O4JE 1OIPA 3PUXF 4WBNE 3U59A 2VQFT 4Z1MH 4IE4A 2CHNA 4YXDC 1T2KC 1N2DC 3FZKB 2FXOA 4KHPT 1A02J 4DOJA 4ZMDA 3KXDA 3ETVA 4DUZT 4I50E 2D2SA 2K48A 1LTJA 4K3AA 2AXCA 3ITKA 4MALA 1LTSC 1IFNA 1X79A 1LRZA 2N2NA 3N9NA 4A97A 3CXHE 2J5UA 2FXMA 1BGYD 3G3ZA 1SLQA 4PK6A 3Q5DA 1M56D 3CWBG 1JNMA 1KORA 3ZN1B 5AQUB 4ZI7E 2D5UA 2XDJA 4GOUA 5DABA 5L47A 4HE8A 4CPGA 4K0UA 2KWHA 2XNXA 1XNQT 1UGOA 1FDOA 1CI6A 3A0BE 3M9BA 3ZCIA 2KLUA 5B5EE 2V6XA 3FZMB 4YSYA 4QMAA 5AVQB 3ZPOA 2HLOA 2RN0A 1IFDA 2PTFA 3R6NA 5L3EB 2K3RA 4H44D 2Q9QA 1URQD 1WRGA 1WRDA 1EZVD 1HUCA 1FOSF 1RE3A 1OEDE 2BBJA 4A5XA 1SQBD 2WZ7A 1RHZB 2ZYAA 2NR4A 1AVOA 1L0ND 3TYYA 1S72P 3B5NA 3KPEA 3M65A 2X67A 5AQQB 3S4UA 1NEKA 1X9BA 3KZIE 2ITAA 4GT1A 3L73G 1VQ5P 1I6ZA 3CMLA 2YNYA 2MPKA 4AKHA 4QXCB 1RH5B 1FZEA 2FYUG 2Y9ZA 5AVYB 5AW4B 2BZBA 1G1JA 3T1HT 1MFTA 4DJGA 1SQQD 2WPSA 3IHRA 2EHOC 5IWAT 4U31A 1JB0J 3H1JE 1PP9D 1TU3F 3RQWA 3H25A 2C5JA 3D6ZA 1QVGO 4H0LD 2V1DB 1Q2NA 4OWFA 2Z4EA 4UXNB 2BG9C 1KF6A 1SQBE 5GONE 3VP8A 3CMEP 1IFJA 3V2PA 1IC2A 2XQYA 1FJPA 1KILE 3QK6A 3AVSA 3Q5EA 1VQPP 1SQQK 1HX1B 1J1DB 1Z56A 3PJSK 3AA6B 3NRXA 2Y0DA 3X1DA 4IL4A 1SE7A 2IPPA 5FXVA 4K0KT 3O1IA 3BATA 2AXTE 1E5WA 2ZYDA 5LXTE 3O8ZA 2E5LT 4K35A 2JP3A 4UF0A 5H2FH 2MAWA 1DH3A 1BE3D 4QWNB 2A72A 5J2UE 1BCCE 3LG7A 3ONLC 1URQB 2WWUA 4YJ3E 3RYHE 2B76A 3HUSB 3RGUA 4AKIA 3CC4P 5HEJA 1U5PA 4YTMA 1NTZG 4OK0A 2EHOD 2IZ0A 2YXQB 4A56A 1Q86Q 2N9YB 1S94A 3I9WA 2LEHA 4CN4A 2AEJA 1L0NJ 1LTIC 5KLVG 2I59A 1HCIA 1JCDA 2W6AA 3L73D 1EXJA 4UVAB 5HXEA 3RYIE 3LIEA 1VDFA 4XAXB 2OV9A 4PJJA 1FDIA 2B9BA 5HEOA 1SQXE 4AYCA 5AW6B 3F2EA 1OWAA 3Q3DA 3WMM0 5EK2A 2OYIA 4BWNA 2XM1A 4YY3T 2Q5UA 1RF0C 1SQQJ 2OARA 4JYCA 1H89A 2JR8A 2QJPB 3GMIA 5L3GB 3RL0D 2WTYA 4DMVA 2WSCJ 2WS3A 2QSIA 2CHOA 1DIPA 3F31A 1S2EA 3A0HH 3GMAA 1IFPA 1YJNP 4KMCA 2AEFA 4YLHA 4QH4A 3MZKB 2YDSA 4OH8B 3H1LJ 5APSA 3C9IA 3KVBA 4O2BE 3ZN0B 1YI2P 5M4YA 1IBKT 1MMAA 2LSJA 3RIAA 4NXMT 2HR3A 1L4AB 3CWBE 2WQYC 2CEAA 4DBRA 3UU5A 3L4FA 3SFEC 2V6YB 2NP9A 1BE3E 3O6QA 5JDGA 1W5CE 3A8YC 4N78E 2KI7B 5LA6E 4COFA 1NO4A 3BQLA 2UXXB 4HWCA 5CCHC 1L0LJ 3AE7A 5AW3B 1NVOA 4ZKUA 1LTJB 4H9NC 1S1CX 1ZRTE 3GWHA 3RK3D 5AQLB 3T97A 2R5BA 3AVRA 3IEEA 1IBLT 3SWKA 2E75D 2VL8A 4YHHT 3CX6B 4U72A 4WYVA 1YKEB 4PFPA 4ZOLE 4KUMB 3SS1A 1XDPA 1UIXA 1GK6A 4LC1A 3CX7B 4Z91A 3L75E 1EDIA 4HWHA 4A98A 3T8OA 4LGDE 1FZFA 4YFSA 3SFDA 2V7JA 2P1JA 4YTPC 2LSKA 4OYKA 2YOEA 2C5KT 2DHRA 1JMBA 1X79B 1KB9I 2W66A 4DBQA 5JREA 2LLYA 2WCAA 4H13B 3RK3C 4LF4T 1VQNP 2XSAA 4JF7A 5C2TA 2UXBT 2YEVC 4HKAA 5LYJE 1EDKA 3CIRA 1T3UA 2IMLA 3BVHA 4IHJE 1P84I 4LF9T 1ZMEC 4QH1A 2M3EA 5HXRA 3J7Yq 1OVUA 1BR4A 4H9QC 4TWFA 5LJMA 4M1PA 3MHVA 1N7SD 4PJMA 2JMKA 3Q2MA 5FY1A 2X0YA 2QA7A 2VVNA 1E2AA 4X1IE 4OHFA 1NKZB 4DR2T 4I43B 5HCJA 4HFHA 3HD7A 1H7CA 3C4WA 5JTGA 3JC22 3TLUA 3UUXB 2W61A 1NHLA 5APQA 3H1KG 3G9RA 1E79H 2CLYB 3ZJ1A 3UU4A 1FC2C 3C4ZA 3KV4A 3KYQA 2R6GF 3OYZA 3QC9A 3L73E 1YW0A 3N2OA 5B66H 4JYAT 1MUUA 2BCCE 3HE5B 5FVLA 5H6RB 1J1DC 3PTZA 4DMWA 1NU1E 1T8BA 3MIWA 5CCHD 3I0QA 5EFWB 3UQ4A 4EGWA 3BCCJ 2K1AA 2CXFA 4HEAA 1N33T 2H7VC 4JLEA 2M3BA 3VRBA 3AAEB 3W68A 1KILA 1AJ3A 2J58A 1MFZA 1OW7A 2NRGA 3EFFK 2A3DA 3E1RA 2E9XD 4KI0F 4L0RA 4TWHA 2N1GA 2W63A 1LP1A 1JM0A 2D2CC 1AV1A 1BE3G 5AQIB 5IYZE 4BJMA 3D70A 1LT9C 1PP9E 3ZMTB 1PV3A 1L4AA 2E74B 4PV1B 4JPZB 2OTLP 4UB8E 2DNXA 4X62T 2XAGB 3O1HA 1BR1A 5HXSA 4FI5A 2L5GB 4DNDA 3TLSA 2V7QJ 3MUDC 3F89A 1XWMA 1LKXA 1JY2P 3UIAA 2LJLA 5LP6E 5BR8T 3A5XA 4CI2B 2K9AA 4J2CA 3H37A 5CA0E 3KZIH 1V9DA 1FS0E 3AEDC 2I0MA 1VCSA 4EEBA 3L09A 4YJ2E 3F5HA 3M06A 3DJBA 3L71G 1FMWA 5AW2B 1SFCD 2LXCB 4HWDA 4I7ZB 5AQHB 2I8DA 2GA1A 5F5WA 3PUYF 2OYIB 3JAFA 5AQKB 5JR9A 2G0UA 3EHZA 2BKNA 4IL6X 3T1YT 4XFJA 1JOCA 1AQTA 5CJ0A 2XUEA 3PURA 2XQ9A 3OVUA 4IFDK 3AEBA 1YTZI 2O1KA 2BEQD 4CXWA 1RE4C 2D0TA 4CI3B 1NU1D 2L3LA 3AE9A 4H0LB 1FEWA 3PUVF 5FKYA 4QXBB 4DR7T 2CE7A 1QLBA 2VKDA 2AXTH 4JV5T 4HFVA 1QL1A 2E42A 4OYJA 4AKGA 4JI0T 4C46A 3RK2D 4QX8B 2IIUA 4B3TT 1HVVA 3IBPA 1VL2A 1GL2C 1OZHA 3VP9A 3PTRB 3H1LG 2FYUE 3AE6C 3BQIA 4EZHA 1WYBA 3H1JJ 4IE6A 1GU5A 1XMOT 3MD0A 3ZMVB 4AQFA 1NTZK 2ZLYA 1JO5A 2LRLA 2QIWA 2FKWB 3UTKA 3I5CA 2KLVA 5FMNA 1SQBK 5KLVE 1IFIA 2ZVOB 4LF7T 4DCKA 4HJGH 3VKHA 2Y0EA 2DW3A 2JWDA 2ZVNB 3SFEA 1VQOP 3TSIA 3CC2P 1SQVG 4UF0B 2C0SA 1HJBA 1PGOA 2KZJA 1G1IA 1QVFO 3AE1C 3LW5H 3U1CA 5E79H 1IBMT 2AEMA 5JRCA 2CLYC 3PJAA 5BMVE 5KLVK 4ZS3A 2E75B 4WBOA 1S5LH 3P8CE 1USEA 2XU6A 4LMLA 2KSJA 4X5TA 4P0AA 2WSEH 4WB4A 1EZVG 2KK7A 3WI3A 4AISA 5CA1E 3ZT7A 5AFUL 2MYSA 3RIUC 1K73Q 1VQ4P 5CCHA 2BCCD 1MIYA 4TV8E 1GL2D 1KILC 3E7KA 4TNVA 5LGUB 4PJ0E 3A0HE 3A0BH 3HE4B 3CQXC 2NZ2A 5J2TE 1KEYA 4TLFA 2VVSA 2FYNB 3SFDC 3H1LE 3MP7B 5DJTB 4WNKA 4HFIA 1LT9A 2VWAA 4C7NA 3H1KD 4PW8A 4LFAT 4JQ0D 2Z5HA 2YMYA 4PD4E 3CKDA 4R4LA 4KBMB 2IYOA 3TF5A 3QB5A 1QL2A 3AE3A 3BQKA 4LFBT 2AXDS 5ADXL 4CXYA 1RQUA 3MUDA 1JTHA 2HYNA 1HJ0A 3KFWX 1JMMA 2G3AA 4ZI3C 1WLXA 4Y99C 2D2CD 3Q5SA 2XAFB 2MTQA 2WSEJ 1SQPE 4O4IE 1K8AQ 4UIGA 3AE4A 1AVYA 5JDQA 4I2LC 5L4HA 4LFCT 2YKSA 4DV1T 2BASA 3G71P 2CM0A 2Q9QD 5F8PA 5FY7A 2UXCT 3AB3B 5JH7E 1RF0A 5BVZA 2BKPA 5HXCA 1N32T 2B88A 1SS1A 2W27A 2XAQB 3H1KJ 3MKDA 5JR9C 3H3AA 1GMJA 1IK9A 3VHLA 1T98A 5BU8B 5AVXB 2LOPA 3H1LD 4I7ZC 1S9KD 2HPCB 3UT5E 1RQVA 3H1KE 1SQBG 3CX5I 4JI5T 1RE4A 2ZFCA 1SFCB 1W09A 2UUCT 4NUUA 3L8RA 4UEMA 3RL0g 2QJYB 1EDJA 3JSVC 1U4QA 1BSNA 2HN2A 3RC3A 3HD7C 5DJQC 4HFCA 3CCMP 4B3RT 2XJ7A 1ZP0C 5LGTB 1KQFB 3RQUA 4OVNF 4OGQC 5KKZB 5FXXA 1SA0E 3G6EP 2HPJA 4H44B 3CPZA 4YTNA 3KINB 1E7PA 4U7IA 3EWKA 4U7YA 2SPZA 3C1LA 3O4XE 3AE7C 1ZN5A 2W8ZA 3RIFA 5L3CB 4KP3C 1NTZJ 3CD6P 2QG4A 3IR9A 2BS4A 1E1HB 2NW7A 1QX8A 5GTHH 4HFDA 2CPBA 3CCUP 4IDQA 4ZZBA 4DV7T 4DIDB 3T97B 2YU1A 1R8EA 3P7KA 1GU4A 2CMRA 2H7OA 2YKQA 3CPWO 3GHGB 2RP4A 5KX5E 3WUUA 2UWJE 2LSYA 1FOSE 3EI0A 5JDNA 2FYUJ 3HE4A 2KZ7B 5JDHA 2NW8A 5LHIB 1SQVD 5FNVE 3KVAA 2X51A 2KZIA 3WUVA 4NXNT 4GKKT 1G8XA 2Q6QA 1MNDA 1YJ9P 2YO2A 2JRKA 3LJCA 4EXTA 4OGQB 2ZM2A 3AA1B 2O01H 1L4AC 5AQGB 4TZ4C 3AEFA 4H9OC 4HH2A 1XNRT 4H0LC 1L0NG 2VKHA 3ZKRA 1MMDA 1YQ4A 3NFQA 2PFVA 2LM2A 4TNWA 2ZAEB 2XQ7A 3UU6A 4GYRA 1RF1B 4G2AA 4RJTA 3KBUA 4AXPA 2N1TA 2GUSA 3HL6A 2V5DA 4CI1B 4AQGA 2HODB 2W62A 2H89C 3C98B 2M6IA 2ODVA 2UU9T 1KV4A 1YQ3C 3KDPB 3AEBC 3GN5B 3C64A 1OEDA 5JVDE 5ETWA 5HXHA 3E08A 3NMDA 4WBAA 1VPCA 1L0NE 2MKVA 1FU1A 5AVTB 4NPFX 4WWIA 2WSCH 1NTKK 1IO4A 1UX5A 2C5IT 3PU8A 3RKGA 3RF1A 3ZSTA 4I1LA 2WT7A 2ZM8A 3CWBD 2FUPA 5KMGP 3UUNA 2P10A 2F4VT 3FGAD 3IAOA 2QA4P 3WUTA 1WYCA 5IUXA 3I9YA 3RYCE 1YHQP 4RKUJ 1AJYA 3IFMA 4PV1D 1GDTA 3P8MC 1P84H 3RX6A 3N9MA 1T3JA 4DV0T 3B57A 2IBZD 1K05A 2XM2A 1KB9E 1WMKA 3TLTA 2CA5A 5HYAA 5DQVA 2OA5A 2V8SV 3AE6A 1NTME 3AEGA 3UUBA 1RF1A 4KHZF 4JUYA 3AE8A 3RK3B 2J59M 3CMAP 2E75C 2IHR1 1LWUC 2OTKE 5FVKA 2E76C 3FHNA 3RK2C 3GF7A 2MBGA 3TGUJ 4WY4A 3B13A 3ZC0A 4EIWA 1SQVJ 3D0TA 4EZ4A 4UVBB 2OLTA 2VASA 1JCCA 1KNZA 2AE9A 3B4SA 1JNZA 3L39A 5KLVD 3SWFA 1Y8AA 2X66A 2XV5A 1SHZC 2QVAA 3AE5A 1DD4A 3CCLP 3LK2B 3U3IA 5TJHA 2XQ8A 4P0BA 2BVLA 4NIQA 3AA0B 1SUMB 4DV4T 4H63H 2Y0CA 3EDUA 3ONXA 3GW6A 5J1GA 2CPSA 3L3PA 3PUAA 2ZT9B 4CXXA 3R2PA 5KAIE 4IOIH 4RO0A 2XASB 1FMVA 1M62A 3FB2A 2WVRA 1IJ5A 1L0LK 3LBXB 4IL6E 2KUBA 4DT0A 3UUMA 1W9RA 4FJOA 4TV9E 5C3JA 4JEHB 2HODA 2YDRA 3FZFB 3HTKB 3KV9A 4U3CA 2C0XA 2WDRA 4YXWH 4D6TE 1NOHA 2FYZA 3N9QA 1YJWP 5HWXA 2P7JA 3ANWA 1L0LD 3NZPA 1GZLA 4GKJT 2WB5A 1SQXD 1NJIQ 3FBLA 5TISH 2X0HA 4D6TJ 1N7SA 2XAJB 2IZ1A 2FBWA 2NTXA 5E79E 1M57D 2W0GA 1NYHA 1FZCC 5AQFB 5LGNB 3AE9C 2IBZG 4AKRB 3M9QA 2ZT9C 4O8SA 5JDLA 3ZSSA 1KTMA 4F8HA 1W0AA 4NPPA 1D0YA 3CQCB 3V5SA 4N6JA 2W6BA 2WMOA 5LB7B 3FXDB 3G4SP 2X9HA 4YSZA 3RBXA 2ZXEB 2YXRB 1Y9BA 3VMAA 4ZI3D 4QHOA 4DV2T 3CLQA 3OA7A 2P2UA 4EDFA 2E2AA 4DV6T 2FJBA 2W83C 1NWQA 2H8PD 2RPAA 2WP9A 1Q82Q 1BCCD 5AVZB 4ILUA 3TLWA 2Y6XA 4LMKA 5APXA 1D7MA 3PDYA 5AW5B 1PGJA 2KXPB 3A5TA 2LR2A 2JQQA 5APYA 3QUJA 3ZEFB 3CCRP 3P4RA 1HTJF 1MKMA 2X68A 4PD4H 3L70D 4C91A 3FXEB 1GD2E 3ANWB 3TLVA 2CXDA 5FL0A 4UB8H 1GL2A 2Q7CA 4ZHQE 3EVYA 2X9YA 2H3RA 1KILD 2W00A 4GKGA 4IE5A 3CWZB 1M1JB 2NPSB 3L71J 3FXEA 3L73J 1HF9A 5FXZA 1YD8G 2KINB 1HNWT 4YT0A 1NWMX 3HKEE 2CPTA 5ABFA 2V7QH 3QOFA 1J2JB 3ZMUB 2WWVA 1N36T 3VKGA 1LTGC 4U2ZA 1BDDA 3K8PC 1RY3A 3VR8A 4EEDA 3AE8C 3L74J 1IFMA 3E1IA 4ISTA 2KS1B 3H1ID 3K3OA 1UX4A 3CX5E 3Q2YA 1H0TB 2I1KA 2IUBA 2Q9QC 2V7KA 1N73B 3V2QA 1M1KQ 1XTGB 5KJ7A 3L74E 2WAUA 5JDMA 3N2KE 4AKLA 1RE3C 2I1JA 1GW3A 3DP7A 3B5MA 3H1IG 1AA0A 3AXJB 4JI8T 1ZV4X 1BSHA 4ZEYA 2R5DA 3L71D 2YIUC 3TGUE 3RLFF 4ASKA 3B5NC 1S3JA 2B87A 3PH0A 1SQVE 2ODUA 4JI4T 3PLNA 1SQPG 2M5AA 4HGAA 4AQRD 3VN0A 2WU2A 1MIWA 2E9XB 3RI5A 4W7ZA 1BE3J 4EOZB 4B3ST 2B87B 2OQQA 1JY2N 2PP6A 4Y28J 3H1JG 1FE6A 2HG5D 5LCYA 3D6YA 1WFDA 1ZR2A 1I94T 1KQSO 4PNIA 3RH3A 2W90A 3L72G 3FZHB 1M8OB 3EFGA 2KIKA 3CX5D 4IDNA 1SQQG 5LBMA 4U3FD 4P1NA 1PL5A 2Z6EA 3Q1MA 4O4LE 1PGQA 3B5ND 4UB6E 3L37A 1US7B 2PG8A 5AQPB 5LOVE 4C7RA 3P50A 5CHXA 2FJAA 4X20E 3J9X1 4C7NB 1J1EC 1MMNA 3U78A 5FXWA 2WBLA 4R4MA 4P09A 1G2CB 2E9XC 2ZM6T 3PUZF 3OPCA 2N9DA 3TNUA 4LMJA 2FBWC 1OEDB 3H32B 5LMNT 3PUWF 4IDPA 5FYMA 3H3MA 2M67A 1T2KD 1H8AA 2IC9A 4MLKA 2FYUK 2QM7A 1JY3P 2WDQA 1U57A 2WZIA 1KYOD 2UUAT 3KDSE 3L72D 1OVRA 1NTZE 1DEEG 2XKMA 3HUSC 4BRYA 1VRBA 2QE7H 2Y8DA 1S5LE 3G06A 3RGLA 2K9JB 1SVFA 4DR6T 4I55E 4Y99B 1X9VA 4HWFA 3CL3D 2ACZA 5FP3A 4GYSA 2FFDC 1QEXA 4RESB 3RKOA 2KLQA 5HCMA 1WT6A 1EQ7A 4HYTB 1MIVA 3OYXA 3R84B 4PJ0H 3NKZA 5L2LA 1Y01A 1ZP0A 3TK1A 3PJAJ 4IE0A 4DV5T 3USSA 5AQOB 3UU3A 4CN6A 3N9OA 2JDIH 3B8EB 3JCUE 2N1TD 5ABHA 2YINA 2ZMAA 3L35A 4WY4C 3RPUA 2NWBA 1CHUA 1L0VA 4EYYR 2M6BA 3N4XA 5LNKA 3RL0B 2ZXXA 1JNRA 1P84E 2PBIA 3H6PA 2BBHA 4HTEA 2C0WA 1PP9G 4C90A 4BRYB 5HEGA 3AEAC 4LF8T 1KB9H 2QJYC 2VQET 3NZQA 4AUWA 2DI4A 2DWKA 3N9LA 4X66T 2FYUD 2ZJSE 2PJQA 3OTOT 2KOGA 1BCCG 2VL0A 2OYHB 2EHOA 4AQYT 2FJEA 3ZDMA 5GTIE 1M1JC 2NPSC 3A7OA 3ZYLA 2KB7P 1BCCJ 1ZKEA 2VKJA 3JADA 3W67A 3AA7B 2YKOA 3VRAA 4U2YA 2CBJA 3QNUA 5FY0A 3CX8B 5HWYA 3HA4A 4IIJE 1HGZA 2E5YA
chains in the Genus database with same CATH topology
2WSSV 3O4XE 3H32A 4PJJA 1ZN5A 4ZS2A 1SQVK 4AYCA 5AW6B 3F2EA 5L3CB 2KMFA 4KP3C 1OWAA 2V7LA 2NOXA 4MBQA 3VMYA 3IR9A 3HR0A 1NH4A 3V2NA 3WMM0 1E1HB 2NW7A 3NBXX 4I6MC 5EK2A 2OYIA 5C8YE 2ZM0A 1X8YA 2CPBA 4OFZA 3OJAB 2N1TB 4CI2B 2Q5UA 3GHGC 3LK3B 1RF0C 2OARA 2YU1A 4JYCA 2NW9A 1H89A 2YO3A 1SQPK 2IFNA 3LIDA 3P7KA 1GU4A 2CMRA 2H7OA 3I1AA 2YKQA 1FZCA 2A2FX 3GHGB 2RP4A 4U74A 4QKNA 3GMIA 5KX5E 1LTJC 1CZQA 1FDMA 2LSYA 3RL0D 5L3GB 3U1AA 1FOSE 2WTYA 4XBFB 3V2RA 4L5GA 5JDNA 2HFED 3HE4A 2KZ7B 4DMVA 2NW8A 5JDHA 5LHIB 3PP5A 3CI9A 1LVFA 5FNVE 3KVAA 2X51A 5L3DB 2Y48B 3F31A 3TNUB 3ZJ2A 3DTOA 2PAJA 4KMCA 1G8XA 1MNDA 2JRKA 3LJCA 2YO2A 4YLHA 4DVDA 1HF8A 3MZKB 2R3CA 4EAHA 4OH8B 4EXTA 5APSA 3C9IA 3C50A 3KVBA 2ZM2A 4O2BE 3ZN0B 3AA1B 2O01H 5HAXA 5M4YA 1L4AC 2DCFA 3AAAB 4TZ4C 1FZGA 1MMAA 2ES0A 2LSJA 2IC6A 4H9OC 4HH2A 1FJKA 1L4AB 2VKHA 4QX7B 3CQGB 1MMDA 2YK0A 3ZMZB 1QUUA 3NFQA 1RF1C 2HH7A 2PFVA 2CEAA 2CXLA 3N9PA 3L4FA 4DBRA 2NP9A 3LBXA 1RF1B 4GYRA 3ZYKA 2SPCA 4G2AA 5JDGA 4N78E 3KBUA 2N1TA 1JY3O 2GUSA 3EDVA 3HL6A 2X0LB 3K3QC 1NO4A 1ZHCA 3Q9DA 3BQLA 5LA6E 3ZLIA 4CI1B 4AQGA 1GL2B 2UXXB 5JDFA 4L9IA 5CCHC 2HODB 2CCQA 4UELA 5L3BB 1HG2A 2B1EA 1KZUB 5AW3B 4ZKUA 2W62A 3SRZA 3C98B 1LTJB 1YYCA 2ODVA 4H9NC 4H63V 3M0DC 4ERRA 1N73C 3MTUE 3N7NA 3GWHA 3RK3D 4ZI2D 3KDPB 2IFMA 3T97A 3GN5B 3C64A 4NUVA 2R5BA 5JVDE 3AVRA 3IEEA 5ETWA 2VL8A 4H9PC 4X1YE 5HXHA 3E08A 3NMDA 1VPCA 1FBMA 1ZV8A 3P8CD 4WBAA 2KWIB 1FU1A 5AVTB 4EOTA 3CX6B 4PJNA 4U72A 3ZC1A 2WSCH 2JMHA 1NTKK 1IO4A 1UX5A 3B5NB 1YKEB 1N7SB 1JY2O 1J1EB 2C5IT 2P9BA 4KUMB 3M9HA 1W2EA 3I0OA 3SS1A 4I1LA 2WT7A 1GK6A 4LC1A 2ZM8A 5KMGP 3CX7B 3BRVB 3UUNA 1LTAC 3ESLA 4JEUB 4QXHB 1IZNB 1WYCA 4X1KE 5A1LA 2VK9A 1QSDA 3I9YA 3RYCE 3T8OA 4E7ZA 3IFMA 3BK9A 2WWWA 1DEBA 4LGDE 4PFPA 1GDTA 3P8MC 4TN7B 1FZFA 4AKLA 3RX6A 4YFSA 5LJNA 3N9MA 1T3JA 3VU7H 1HG5A 2V7JA 2P1JA 5CCGC 1OXZA 2WT7B 2LSKA 1LVKA 4MFRA 2EHOB 4OYKA 2C5KT 2DHRA 3B57A 1CUNA 1X79B 2FFDA 5APWA 4UV8B 3OAKA 1S9KE 4DBQA 4XE5B 4ISSA 2CA5A 5HYAA 5LGNB 5JREA 5APTA 3RC8A 5DQVA 3NXSA 2OA5A 3JC6C 4N78D 3HKCE 3VOPA 2V26A 2RA1A 3RK3C 4ZI2C 2Q9QB 4JF7A 3PUSA 1RF1A 1MMGA 3W15B 4JUYA 4BAYB 3EQ2A 2WM9A 3RK3B 2J59M 2YEVC 1M7LA 1T8ZA 3OKQA 4HKAA 1FAVA 1LWUC 5LYJE 3FHNA 3RK2C 2MBGA 3A3YB 1T3UA 3BVHA 2LE8A 4WY4A 3VMZA 3HI2A 4IHJE 3B13A 3UULA 5LHGB 3ZC0A 2D0UA 3D0TA 4EIWA 5HXRA 1CI6B 2Z5IA 2WPQA 1BR4A 2VB6A 2DWGA 4H9QC 4EZ4A 5LJMA 5EK3A 3J7Yq 4UVBB 4ZHQE 4M1PA 2VASA 1JCCA 3VTPC 3LK42 3OJAA 1VOMA 1KNZA 1N7SD 4N3YB 2WITA 2CWYA 4PJMA 2JMKA 2LM9A 4M3LA 3Q2MA 2V7MA 4GYSA 5E0OA 5FY1A 2X9WA 1IJ6A 1EZ3A 3N5LA 1SFCA 3K3NA 2QA7A 3N2GE 4XZCA 1L4AD 4ZI3D 3LFMA 3SWFA 5CCGA 2X66A 2XV5A 1SHZC 1SP4A 2QM8A 2WSFH 1GTWA 3BASA 4X1IE 1KK7A 1NKZB 1DX7A 4OHFA 4AI6A 1JY3N 3JC6D 3LK2B 4H9RC 4I43B 3U3IA 3HD7A 1H7CA 1KFMA 3C4WA 4P0BA 4Z8XA 2LOSA 1CW5A 2BVLA 4UVCB 4ZKPA 1NU1K 2W61A 1D0ZA 1HX8A 1WR6A 3AA0B 3PE0A 3UUXB 1NHLA 5APQA 1LGHB 4H63H 3RRCA 2CLYB 2NTYA 3ZJ1A 3EDUA 3WAKA 3ONXA 3OBVE 5DQWA 5J1GA 4DZOA 3C4ZA 1URQA 2CPSA 3L3PA 3PUAA 4LLHA 3KV4A 3PU8A 1ZR4A 3KYQA 4IGUA 2POHA 2XZRA 4CXXA 3HD7B 3R2PA 3Q5XA 5JQGE 1Y64B 2XASB 3OYZA 3RK2B 1FMVA 3PUGA 3FB2A 3QC9A 3II6A 1D1AA 5AW7B 1L0LK 1IJ5A 2C9NY 4ADZA 2V7IA 1YW0A 3M0AA 4MALA 3N2OA 3LBXB 3SOLA 5AVUB 5AW1B 1MUUA 3HE5B 2QGSA 5H6RB 2JEEA 4F6RC 5APUA 1J1DC 3TKLB 3UUMA 4FJOA 1UCUA 4TV9E 1MNEA 4DMWA 2J1DG 1YKHB 3MIWA 2M8RA 5AVVB 5CCHD 3I0QA 2HODA 4JEHB 4EIJA 2DLRA 3MA9A 3HTKB 2O1JA 3KV9A 3V5BA 2C0XA 3RRWA 3CVRA 2CXFA 3ZMSB 4HEAA 4B6XA 1NTMK 2H7VC 4JLEA 2M3BA 3AAEB 1NOHA 1KILA 2FYZA 2R32A 5LG4A 2J58A 1MFZA 1AJ3A 3N9QA 2A3DA 5KTBA 4G63A 5HWXA 4W7YA 2P7JA 2VRSA 3ANWA 3NZPA 1GZLA 4EYUA 3HUSA 3MK7C 2E9XD 5CJ4A 2OYIC 4L0RA 2E9XA 3FBLA 1SFCC 2N1GA 2W63A 1N7SA 2JPFA 1URQC 2LT3A 2XAJB 3KBTA 2NTXA 2K24A 3HKBE 2W0GA 5CMZA 1FZCC 1D0XA 1LT9C 2OYHC 2A45I 3E22E 5IYZE 2WMNA 3ZMTB 5JDMA 4B86A 2GM4A 3M9QA 1L4AA 2DNXA 4YHJA 1FZAA 4PAGA 4AKRB 5CCGD 3MXZA 4O8SA 5KDMC 5JDLA 2IX7C 4O2AE 2XAGB 5IHYA 3O1HA 1BR1A 1D0YA 3CQCB 3V5SA 2XAHB 2L5GB 4N6JA 2W6BA 3PUQA 4FI5A 4DNDA 2WMOA 1NKNA 5AVSB 3FXDB 2X9HA 1LKXA 1JY2P 1KFNA 3UIAA 2HPLA 2LJLA 4PFOA 5LP6E 4MHCA 1HH0A 2ZXEB 1HBWA 3A5XA 4IDZA 2K9AA 4WY4D 4J2CA 3CLQA 3OA7A 2P2UA 3H37A 4QHOA 1AFOA 4I4TE 5CA0E 3BRTB 2H8PD 1NWQA 4BA9A 1V9DA 1BR0A 5LBQB 1ZEEA 2IW5B 5AVZB 4ILUA 2Y6XA 3VMXA 3IF8B 3L09A 5APXA 4YJ2E 3M06A 1N73A 3DJBA 3L36A 3PDYA 5AW5B 2KXPB 3MACA 1FMWA 5AW2B 3A5TA 1SFCD 2JQQA 3NRYA 4AQFC 3HTKA 5APYA 5AVRB 2LSGA 3QUJA 3ZEFB 5BU5A 3KV6A 3KQGA 2Q9IA 1HTJF 2OYIB 5L3FB 2N1TC 2X68A 5AVWB 2OYHA 3AAIA 4CZZB 4C91A 3FXEB 2X9XA 5JR9A 2G0UA 5F3JA 1HTLC 5JRCB 4JYBA 4GIFA 1LTBC 1GD2E 3ANWB 2CXDA 4PJLA 3HD7D 5KJ7C 1FZCB 2H7HA 1GL2A 2IAKA 1JOCA 3PTRB 4IE7A 2Q7CA 5CJ0A 2XUEA 3EVYA 2KT9A 2X9YA 3ETUA 3PURA 4BJMA 1SQXK 4IFDK 1AQ5A 2H3RA 4BJNA 5LHHB 1KILD 2N9BA 2W00A 4GK0E 4GKGA 3O9XA 1MV8A 1YTZI 2HPCA 4IE5A 2O1KA 1M1JB 2NPSB 3CWZB 1N7SC 2L8KA 5FXZA 3UFEA 4CXWA 1RE4C 3WAJA 2D0TA 1YD8G 4CI3B 1S35A 2KINB 1HS7A 2L3LA 3C4XA 1GW4A 4O4JE 2LSIA 2L9QA 1NWMX 1FEWA 1YTZT 3HKEE 2Q3IA 3U59A 4ANJA 4WBNE 4IE4A 4QXBB 2CE7A 2VKOA 1G73A 1J2JB 1T2KC 1N2DC 3ZMUB 3VKGA 2VKDA 2UXNB 1LTGC 2JJLA 4HFVA 1QL1A 1RY3A 3K8PC 2E42A 1L0NK 1IFMA 4OYJA 3E1IA 3GA8A 4ISTA 4AKGA 1A02J 3GHGA 1GK4A 4DOJA 2LHRA 4C46A 3ETVA 3K3OA 1FZBA 3RK2D 4PK4A 1UX4A 4I50E 4QX8B 2D2SA 5H6QB 2K48A 1LTJA 2YKPA 1H88A 2I1KA 1HVVA 1N7LA 2Q9QC 2V7KA 1N73B 3V2QA 2WAUA 1XTGB 5KJ7A 3IBPA 1LTSC 1GL2C 1IFNA 3HE5A 3VP9A 1LRZA 1RE3C 2I1JA 1KQLA 3MGNA 1X79A 1GW3A 2N2NA 3DP7A 3N9NA 1JTHB 3BQIA 4EZHA 1WYBA 2FXMA 2BDEA 5EZYE 4IE6A 3G3ZA 1ZV4X 1SLQA 4PK6A 1GU5A 4E7SA 3MD0A 2R5DA 2GK9A 1JNMA 3ZMVB 4AQFA 1NTZK 4ASKA 3B5NC 3ZN1B 4ZI7E 2D5UA 2XDJA 2ZLYA 4GOUA 5DABA 4IFFA 1KILB 1JO5A 2ODUA 2FKWB 4HE8A 3I5CA 4H9SE 3UTKA 5HXSA 2KLVA 4K0UA 5FMNA 1SQBK 4HGAA 1IFIA 4AQRD 2KWHA 3VN0A 2KP8A 2MJZA 2XNXA 1MIWA 2E9XB 4W7ZA 1CI6A 4EOZB 3VKHA 3M9BA 3ZCIA 5AVQB 4PK5A 3TSIA 1PFIA 1JY2N 2PP6A 1Z0PA 2HLOA 4UF0B 3ZPOA 1IFDA 1IJDB 2HG5D 1HJBA 2C0SA 5LCYA 3A2AA 3Q5WA 1G1IA 4W80A 3LW5H 3R6NA 3U1CA 1ZR2A 5L3EB 2Q9QA 1URQD 1WRGA 4PNIA 1WRDA 3RH3A 1A02F 1HUCA 3SWHA 1RE3A 1FOSF 3EFGA 2WZ7A 3M0DA 5JRCA 2CLYC 5BMVE 5KLVK 1BR2A 4ZS3A 4WBOA 1LWUB 4O4HE 5LBMA 3P8CE 2CWOA 4DO0A 3TYYA 2XU6A 2Z6EA 4O4LE 2KSJA 4P0AA 2WSEH 3B5ND 4WB4A 3B5NA 3L37A 4HN9A 1G2CA 1US7B 2PG8A 3KPEA 3WI3A 2KYVA 3M65A 5CA1E 5AW8B 4EB6E 5AFUL 2GUVA 2MYSA 5LOVE 4C7RA 5CCHA 2H43A 1MIYA 2X67A 5CHXA 4TV8E 3S4UA 1GL2D 1KILC 4X20E 3J9X1 4C7NB 3HKDE 5LGUB 4GT1A 1J1EC 5AW9B 2E43A 1FIOA 1HFAA 1MMNA 4GIWA 5FXWA 3U78A 2WBLA 3CMLA 2YNYA 3V4QA 4P09A 5KJ7D 3HE4B 3CQXC 1G2CB 2E9XC 5J2TE 4AKHA 4QXCB 4CQIA 1O3XA 3PU3A 3MJXA 2N9DA 1FZEA 2A45G 5JR9B 3TNUA 5APVA 5AVYB 5AW4B 3H32B 4WNKA 2BZBA 1LT9A 5FYMA 2WPRA 2VWAA 4C7NA 1G1JA 2M67A 1T2KD 1H8AA 3NTNA 2IC9A 4PW8A 4MLKA 1MZ9A 2FYUK 2YMYA 2Z5HA 2QM7A 1JY3P 3CKDA 2WPSA 3V4WA 2EHOC 1HGVA 3IHRA 4KBMB 1QL2A 3ZCJA 2P67A 3BQKA 3FBZA 2YU2A 3KDSE 1M1JA 2NPSA 5ADXL 2NPSD 2XKMA 3HUSC 2C5JA 1VRBA 3HRNA 2Y8DA 4CXYA 3MUDA 1SVFA 1JTHA 2HYNA 2V1DB 1LWUA 3F57A 1LT9B 3KFWX 4Y99B 4I55E 5CB4E 2Z4EA 4AXPA 4UXNB 1X9VA 1JMMA 3SWYA 3CL3D 4ZI3C 1WLXA 4IFMA 4Y99C 1HWTC 3OYXA 5GONE 5FP3A 2XAFB 3VP8A 2MTQA 1IFJA 2FFDC 3V2PA 1IC2A 1IAPA 2ACXA 1FJPA 2XQYA 4O4IE 4RESB 4GK5E 4UIGA 3RKOA 5JDQA 4I2LC 2KLQA 3QK6A 2FFDB 3AVSA 1WT6A 1EQ7A 1ZLLA 4HYTB 1MIVA 2K5BB 2BASA 1SQQK 2CM0A 2LHNA 3R84B 1J1DB 1Z56A 2Q9QD 3AA6B 5F8PA 3NRXA 5L2LA 5FY7A 2IPPA 5FXVA 5EK4A 3O1IA 3BATA 3TK1A 3E0ZA 1E5WA 4IE0A 5LXTE 3AB3B 4UV9B 1RF0A 5BVZA 2XTLA 3P7IA 5HXCA 5JH7E 3N9OA 3M91A 2W27A 3B8EB 2N1TD 2MOZA 2YINA 3O8ZA 3L35A 4WY4C 2XAQB 2ZMAA 3MKDA 4UF0A 3RPUA 2NWBA 4TX5A 2XHEB 3H3AA 5JR9C 4V1Av 1IK9A 3RL0C 4EYYR 3VHLA 4WY4B 4KHXA 3N4XA 1D1BA 1T98A 5BU8B 5TAOA 5AVXB 2LOPA 1XTCC 1DH3A 5LNKA 3RL0B 2KNDA 1S9KD 3O1JA 2BVMA 4QWNB 4ZOLE 2HPCB 3UT5E 2A72A 2PBIA 5J2UE 3LG7A 3H6PA 2A45H 1URQB 2WWUA 4HTEA 1NAFA 2C0WA 1CSBA 4C90A 4XA4A 4O9BA 4YJ3E 3RYHE 1D1CA 3HUSB 4AKIA 1RE4A 1N86A 2ZFCA 1SFCB 3P32A 5AW0B 3ZYMA 3NZQA 1JUNA 4AUWA 1U5PA 2DI4A 2DWKA 4TUYE 3N9LA 4NUUA 4UEMA 3V5UA 2PJQA 2KOGA 2E8IA 4OK0A 3N2KE 1U4QA 2EHOD 2OYHB 1B7TA 2EHOA 3RC3A 4A56A 2LKMA 3HD7C 1S94A 3GN5A 5DJQC 3KV5A 3EUHA 3RYFE 3I9WA 2LEHA 1M1JC 2NPSC 1LTIC 3A7OA 2C9LY 3ZYLA 3VYIA 5LGTB 2I59A 1HCIA 2KB7P 1ZKEA 1JCDA 2VKJA 3AA7B 2W6AA 2YKOA 1SA0E 4UVAB 1LTTC 3C51A 5FXXA 2JJ9A 2HPJA 5FY0A 3CPZA 3CX8B 5HWYA 3RYIE 3KINB 5HXEA 3LIEA 1VDFA 4WW0A 3HA4A 4IIJE 4XAXB 1HGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TYY A;  2XU6 A;  1FAV A;  5AVZ B;  4AYC A;  5AW6 B;  3VMX A;  3L37 A;  1OWA A;  5APX A;  3M06 A;  3A3Y B;  3VMY A;  3L36 A;  3IR9 A;  5AW5 B;  5AW8 B;  3VMZ A;  4I6M C;  5AW2 B;  3A5T A;  1X8Y A;  1CI6 B;  2Z5I A;  2WPQ A;  2Q5U A;  3HTK A;  5APY A;  5AVR B;  4C7N B;  4JYC A;  1H89 A;  2YO3 A;  3KQG A;  3LID A;  3P7K A;  4GT1 A;  5AW9 B;  3VTP C;  1GU4 A;  2E43 A;  5AVW B;  2YNY A;  3V4Q A;  3HE4 B;  4M3L A;  1CZQ A;  1G2C B;  4JYB A;  1FOS E;  2WTY A;  1GD2 E;  1O3X A;  2N9D A;  2H7H A;  3HE4 A;  3TNU A;  3SWF A;  5APV A;  5AVY B;  5AW4 B;  2Q7C A;  2XV5 A;  1SP4 A;  2QM8 A;  2WPR A;  3TNU B;  4C7N A;  1GTW A;  2N9B A;  1T2K D;  3NTN A;  1H8A A;  4GKG A;  2Z5H A;  1MV8 A;  2QM7 A;  2WPS A;  3V4W A;  2YO2 A;  2P67 A;  2R3C A;  1YD8 G;  5APS A;  1WR6 A;  5APQ A;  1NWM X;  2Q3I A;  4DZO A;  1J2J B;  1T2K C;  1HWT C;  2XZR A;  2JJL A;  3NFQ A;  2E42 A;  4RES B;  1A02 J;  5AW7 B;  4I2L C;  1GK4 A;  2C9N Y;  4HYT B;  4C46 A;  2BAS A;  3M0A A;  5AVU B;  5AW1 B;  1MUU A;  3HE5 B;  1H88 A;  2IPP A;  5APU A;  3TK1 A;  5AW3 B;  3HE5 A;  1X79 A;  5AVV B;  2N2N A;  1YYC A;  1KQL A;  3MGN A;  3M91 A;  2W27 A;  3B8E B;  3O8Z A;  3L35 A;  3V5B A;  3KDP B;  3T97 A;  1SLQ A;  1GU5 A;  2R5B A;  3MD0 A;  2R5D A;  2R32 A;  4KHX A;  1JNM A;  1MFZ A;  5AVX B;  3NMD A;  1DH3 A;  2P7J A;  2VRS A;  5AVT B;  4EOT A;  1S9K D;  1GZL A;  1IO4 A;  3I5C A;  3M9H A;  1NAF A;  2WT7 A;  1GK6 A;  1CSB A;  4LC1 A;  4AQR D;  3VN0 A;  2KP8 A;  3P32 A;  2ZFC A;  5AW0 B;  1CI6 A;  5CMZ A;  1JUN A;  4AUW A;  3M9B A;  4B86 A;  2WWW A;  3P8M C;  5AVQ B;  1HJB A;  1OXZ A;  2WT7 B;  3A2A A;  3A7O A;  2C9L Y;  5APW A;  3OAK A;  3VYI A;  1S9K E;  4XE5 B;  5AVS B;  5APT A;  1A02 F;  1WRD A;  1HUC A;  3NXS A;  3UIA A;  2W6A A;  1FOS F;  2ZXE B;  3M0D A;  1HBW A;  3LIE A;  2P2U A;  1NWQ A; 
#chains in the Genus database with same CATH topology
 2WSS V;  1VQ9 P;  4NPE A;  4IDO A;  2JWA A;  4ZS2 A;  1GQE A;  3AXJ A;  2G8Y A;  2KMF A;  2V7L A;  1NGM B;  2NOX A;  3VMY A;  3HR0 A;  4Z90 A;  2JIW A;  2WZH A;  1X8Y A;  2ZM0 A;  4OFZ A;  3LK3 B;  3GHG C;  1SQP K;  3LID A;  3MJX A;  3AEE A;  4U74 A;  1FZC A;  2A2F X;  1HNZ T;  1BGY E;  4QKN A;  1LTJ C;  1L2P A;  1NEN A;  3U1A A;  2D2C B;  4XBF B;  5KLI C;  4HWI B;  4L5G A;  2HFE D;  2WU5 A;  1ZOY A;  5L3D B;  2Y48 B;  3TNU B;  3ZJ2 A;  2LRK A;  1OMI A;  1X22 A;  3L70 J;  1HF8 A;  2R3C A;  4DR1 T;  1VF5 C;  1FZG A;  2ES0 A;  1KNR A;  3WU2 E;  4IL6 H;  3CQG B;  2A06 D;  4U3F J;  2YK0 A;  2JKV A;  1VQ8 P;  1QUU A;  1RF1 C;  3N9P A;  5GTH E;  3IF4 A;  2CK3 H;  3Q5P A;  2XQ5 A;  4OX9 T;  3BCC G;  5DJU B;  1JY3 O;  2W6J H;  4U3F G;  3ABV A;  2X0L B;  4ASV A;  2KS1 A;  1J1J A;  1GL2 B;  4MN4 C;  2WDV A;  2CCQ A;  4UEL A;  5L3B B;  2B1E A;  1KZU B;  4GOD A;  3M0D C;  5AQM B;  1N73 C;  4ERR A;  5FL1 A;  2WY2 A;  3N7N A;  1SQX G;  2W2U A;  4ZI2 D;  2IFM A;  1QGK B;  2OGU A;  4NUV A;  1PPJ D;  4H9P C;  5AQS B;  1ZV8 A;  3CCV P;  3P8C D;  4PJN A;  3H1H G;  4EOT A;  2KWI B;  3ZC1 A;  4X65 T;  3AE5 C;  3S4R A;  1K9M Q;  2XQ3 A;  3B5N B;  5ABF B;  1JY2 O;  1J1E B;  4JI1 T;  3M9H A;  3I0O A;  2VUR A;  2BS2 A;  3BRV B;  1LTA C;  4JEU B;  2YMK A;  5CBO A;  1IZN B;  2WSF J;  5A1L A;  2VK9 A;  3H1H D;  1QSD A;  4E7Z A;  1DEB A;  5HEH A;  3AE2 A;  2QEX P;  1HG5 A;  3VU7 H;  1OXZ A;  2WT7 B;  1YXR A;  2EHO B;  2FFD A;  3OAK A;  1NTZ D;  2O01 N;  4L73 A;  4XE5 B;  3RC8 A;  3NXS A;  1KFY A;  4N78 D;  1T6A A;  3M3Z B;  3HKC E;  3VOP A;  2V26 A;  4ZI2 C;  4BAY B;  3OKQ A;  5KLV J;  3MZW B;  1OVV A;  2LE8 A;  5LHG B;  4ILB A;  1HNX T;  1M7K A;  4JI2 T;  2Z5I A;  2WPQ A;  4B3M T;  3VTP C;  3LK4 2;  4HKZ H;  2WIT A;  1UII A;  2LM9 A;  1IJ6 A;  4DR3 T;  5CCG A;  3CC7 P;  2V6Y A;  1SP4 A;  2QM8 A;  1DD3 A;  1GTW A;  3I55 P;  1DX7 A;  3JC6 D;  3R4Y A;  2ZT9 D;  4H9R C;  1CW5 A;  4ZKP A;  1NU1 K;  3PE0 A;  1OX3 A;  1WR6 A;  2KNC A;  1VQ6 P;  3RRC A;  4H13 C;  1KNP A;  3WAK A;  3CX5 H;  1L0L G;  3OBV E;  4DZO A;  1KYO H;  4GDO A;  4YTP A;  1XMQ T;  4LLH A;  3Q5X A;  1PPJ E;  5JQG E;  2W4X A;  1X0T A;  2C9N Y;  3SOL A;  5AVU B;  5AW1 B;  5C39 A;  1LNQ A;  3PRJ A;  4F6R C;  5APU A;  3TKL B;  1UCU A;  1MNE A;  2J1D G;  2BKO A;  5AVV B;  4HFB A;  4EIJ A;  2DLR A;  3MA9 A;  5KXJ A;  2Q1K A;  2O1J A;  1VQL P;  1NTK J;  3P4Q A;  1NTM K;  4B6X A;  5LG4 A;  1OW8 A;  3AED A;  4W7Y A;  2OTJ P;  3L70 E;  5KAF E;  3HUS A;  2O3J A;  4DR5 T;  2OYI C;  2E9X A;  1FJG T;  3K5B A;  1SFC C;  3I56 P;  2JPF A;  1URQ C;  1BGY J;  3KBT A;  3L72 E;  4L74 A;  1D0X A;  1T72 A;  3E22 E;  2WMN A;  2GM4 A;  4B86 A;  5KAI H;  1ZRT D;  4YHJ A;  3AE4 C;  1FZA A;  4PAG A;  1EC5 A;  5KDM C;  2H88 A;  2IX7 C;  4O2A E;  5IHY A;  2QJK C;  3V6I A;  2J4G A;  2E5V A;  2XAH B;  4UB6 H;  3P4S A;  4PFO A;  1HBW A;  3ABV C;  1S4X A;  4WY4 D;  3QH9 A;  1YBK A;  4HFE A;  1AFO A;  1PP9 J;  2BCC G;  5LBQ B;  1ZEE A;  5AQT B;  3VMX A;  3IF8 B;  1N73 A;  3TGU G;  3CCQ P;  3MAC A;  3LSV A;  2WQY A;  2YDQ A;  1KQG B;  4AQF C;  5AVR B;  5TIS E;  2WPV B;  2LSG A;  3KV6 A;  2Q9I A;  2Q3E A;  3CWB J;  5AVW B;  2OYH A;  1Z8U A;  2UUB T;  2XY8 B;  5JRC B;  4JYB A;  4IE7 A;  1N34 T;  1YIT P;  3CXH H;  2KT9 A;  1SQX K;  4GK0 E;  1YIJ P;  1MV8 A;  1Y47 A;  2XND H;  3UFE A;  2L8K A;  3AEA A;  2CBI A;  3FXD A;  1S35 A;  3K1S A;  1HS7 A;  3C4X A;  1GW4 A;  3C8V A;  2LSI A;  2L9Q A;  1YTZ T;  4ANJ A;  2Q3I A;  4NPD A;  3GF3 A;  2VKO A;  1IK7 A;  3P4P A;  2FJD A;  1G73 A;  2LKH A;  2QYW A;  2UXN B;  2JJL A;  4EYY Q;  1JEK A;  1L0N K;  4X64 T;  3D71 A;  3GA8 A;  3GHG A;  1GK4 A;  3JCU H;  2LHR A;  2UXD T;  2JQK A;  1FZB A;  4PK4 A;  5H6Q B;  2YKP A;  1H88 A;  1N7L A;  3FX0 A;  3SSU A;  3L70 G;  5CB4 E;  3HE5 A;  4JI7 T;  2IDB A;  1KQL A;  3MGN A;  4TWD A;  1JTH B;  3AEC A;  1SQB J;  2BDE A;  5EZY E;  1T7S A;  3FWN A;  3PHL A;  2I6H A;  1NTM D;  2GK9 A;  4E7S A;  1HR0 T;  3QWO C;  4BXL A;  4IFF A;  1KIL B;  3IN6 A;  4H9S E;  1PPJ G;  3AEF C;  2KP8 A;  2MJZ A;  5L4E A;  2ZYG A;  3AE3 C;  4JBW F;  1U7M A;  1VQK P;  2E74 D;  3H1I J;  4PK5 A;  1PFI A;  1Z0P A;  4PD4 D;  1IJD B;  5ABE A;  3A2A A;  2A06 E;  3L74 D;  3Q5W A;  4W80 A;  2LXB A;  3CCJ P;  4ASW A;  1A02 F;  3SWH A;  1UUS A;  3H1I E;  1OFC X;  3M0D A;  4IT4 A;  1YQ3 A;  1BR2 A;  3L74 G;  1LWU B;  2LKG A;  4O4H E;  2CWO A;  4DO0 A;  2KNC B;  3OW2 O;  4HN9 A;  1G2C A;  2KYV A;  1PGP A;  5AW8 B;  4EB6 E;  2GUV A;  2H43 A;  3L71 E;  4EI2 A;  1KN7 A;  3HKD E;  4GIW A;  5AW9 B;  2E43 A;  1FIO A;  1HFA A;  1R8I A;  1W0B A;  3V4Q A;  3L72 J;  5KJ7 D;  1KYO I;  1KD1 Q;  4CQI A;  1O3X A;  3PU3 A;  3AE2 C;  2A45 G;  4AIU A;  5JR9 B;  5APV A;  1WR0 A;  2R3S A;  1SQP J;  2WPR A;  4IL9 A;  4ZZC A;  3NTN A;  3A7M A;  3WU2 H;  1MZ9 A;  2RH0 A;  1Q90 D;  1USD A;  3ZT6 A;  3V4W A;  3RHW A;  1HGV A;  4U3F E;  3ZCJ A;  2P67 A;  3BCC E;  3FBZ A;  2YU2 A;  1M1J A;  2NPS A;  4GOE A;  2NPS D;  2IBZ E;  3HRN A;  3F57 A;  1LWU A;  1LT9 B;  3S9O A;  5K5G B;  2K9Y A;  1VF5 D;  3SWY A;  4IFM A;  1HWT C;  2FXP A;  4HB1 A;  3AE1 A;  2ACX A;  1IAP A;  4GK5 E;  1J5W A;  4JI3 T;  3EAM A;  2FFD B;  1ZLL A;  2K5B B;  2K88 A;  2LHN A;  5KKZ C;  4CN1 A;  5EK4 A;  3E0Z A;  1OW6 A;  3CK6 A;  4UV9 B;  3P7I A;  2XTL A;  1QLE D;  3M91 A;  1KC8 Q;  2PGD A;  2MOZ A;  3RIU A;  4TX5 A;  1UUR A;  2XHE B;  4V1A v;  3RL0 C;  2B89 A;  4WY4 B;  4KHX A;  1D1B A;  5TAO A;  2XQA A;  1XTC C;  2YN6 A;  4GOF A;  2KND A;  1ZOY C;  5CJ5 A;  3O1J A;  2BVM A;  2XPK A;  1J5E T;  4LF5 T;  2A45 H;  1NAF A;  1KMI Z;  1CSB A;  3FWL A;  4XA4 A;  4O9B A;  1D1C A;  1N86 A;  3P32 A;  5AW0 B;  3ZYM A;  3AEE C;  1JUN A;  4TUY E;  2XZE A;  4ZXL A;  3V5U A;  2E8I A;  2M0B A;  1B7T A;  5CBN A;  5AQR B;  2LKM A;  3KHU A;  3TDK A;  3GN5 A;  2IYP A;  3ZT5 A;  4YXD A;  3KV5 A;  3EUH A;  3RYF E;  2K9J A;  1XDO A;  4PD4 I;  2C9L Y;  4KX6 A;  1VQ7 P;  2D9D A;  3VYI A;  4DUY T;  5B5E H;  2RKL A;  4I0U A;  1LTT C;  3C51 A;  2JJ9 A;  2BS3 A;  4WW0 A;  3O6Q B;  3L75 D;  2XQ6 A;  4ILC A;  3H32 A;  2PFX A;  1BGY G;  1SQV K;  2P58 A;  4LF6 T;  2Y9Y A;  4MBQ A;  4TT3 H;  4DV3 T;  3NBX X;  1NH4 A;  3V2N A;  3S1K A;  4I6M C;  5C8Y E;  3FZL B;  3OJA B;  2N1T B;  4D6T D;  1K04 A;  2NW9 A;  4AI6 A;  2YO3 A;  2IFN A;  3I1A A;  2M5A B;  5KLI B;  2CRB A;  1CZQ A;  1FDM A;  1ZW0 A;  3V2R A;  1W2B O;  2H89 A;  2A06 G;  3PP5 A;  3CI9 A;  1S5L X;  1LVF A;  5GTI H;  3CCE P;  2JQ9 A;  5AQV B;  3DTO A;  2PAJ A;  1UK5 A;  3IA3 A;  4DVD A;  4EAH A;  1M90 Q;  3C50 A;  5L8R J;  5HAX A;  2DCF A;  2XQ4 A;  3AAA B;  4H44 C;  2IC6 A;  4YPC A;  1BDC A;  1FJK A;  4QX7 B;  4A7P A;  4WVZ A;  3ZMZ B;  2HH7 A;  3ONJ A;  4WZX A;  2CXL A;  1KB9 D;  4YSX A;  1N8R Q;  3LBX A;  2R44 A;  3ZYK A;  2QRX A;  2HN1 A;  2SPC A;  2V5C A;  5ABG A;  3Q9D A;  3EDV A;  3K3Q C;  1ZHC A;  3ZLI A;  4H13 D;  5JDF A;  4L9I A;  2L91 A;  1HG2 A;  3SRZ A;  1YYC A;  3JAE A;  4H63 V;  1H0T A;  2K3W A;  3AEG C;  3MTU E;  4D6T G;  1WCR A;  4X1Y E;  3Q5R A;  1FBM A;  4KJM A;  2O01 J;  1EXI A;  2JMH A;  2P9B A;  1R5S A;  2RMZ A;  1N7S B;  4XZC A;  2IBZ I;  5AQN B;  1W2E A;  2IDO B;  3P4W A;  5H2F E;  1NTM J;  2KSR A;  3ESL A;  4QXH B;  3UU8 A;  1NU1 J;  4X1K E;  4Q25 A;  3BK9 A;  2WWW A;  1SQQ E;  3B71 A;  4TN7 B;  3GLM A;  3UQ7 A;  5LJN A;  5HEU A;  1NTM G;  2KSE A;  2FY8 A;  5CCG C;  4MFR A;  1LVK A;  3RBZ A;  1CUN A;  5APW A;  4UV8 B;  1S9K E;  5CGM A;  4ISS A;  1LJ2 A;  3NVO A;  1P84 D;  5APT A;  1NTK E;  1EZV I;  3JC6 C;  2RA1 A;  2Q9Q B;  2J47 A;  1YQ4 C;  3PUS A;  1MMG A;  3W15 B;  3CCS P;  3EQ2 A;  2WM9 A;  1M7L A;  1T8Z A;  2JQH A;  1FAV A;  1VCT A;  2BG9 A;  3A3Y B;  1Q81 Q;  3UUL A;  3VMZ A;  4EV6 A;  3HI2 A;  3VR9 A;  1U7J A;  2YIU B;  5LG3 A;  2D0U A;  1CI6 B;  2VB6 A;  2DWG A;  2HHH T;  4L76 A;  5EK3 A;  2W67 A;  1SQX J;  3JCF A;  3LDQ B;  3OJA A;  1SQP D;  5B66 E;  1VOM A;  1NU1 G;  4N3Y B;  2CWY A;  4M3L A;  1PZQ A;  2V7M A;  5E0O A;  2X9W A;  3N5L A;  1EZ3 A;  4DR4 T;  1SFC A;  1OED C;  3K3N A;  3N2G E;  5CFB A;  3PV0 F;  1L4A D;  1PIX A;  3LFM A;  1NTK D;  1LP1 B;  2FYN C;  1L0L E;  2WSF H;  3BAS A;  1KK7 A;  4KT0 J;  1JY3 N;  4UR9 A;  2H88 C;  3EAB A;  1KFM A;  4Z8X A;  2LOS A;  4UVC B;  1D0Z A;  1HX8 A;  1LGH B;  2BG9 E;  1ZXG A;  2NTY A;  4OGQ D;  5DQW A;  2K37 A;  2PRR A;  1URQ A;  2OYO A;  4IGU A;  1ZR4 A;  2POH A;  2XZR A;  2BEZ F;  3HD7 B;  5J0Z A;  3TGU D;  1Y64 B;  2E76 B;  3PUG A;  3RK2 B;  2E5T A;  3II6 A;  5AW7 B;  1D1A A;  4ADZ A;  3L75 G;  2V7I A;  3M0A A;  3UFG A;  2QGS A;  2JEE A;  4IRE A;  1Q7Y Q;  3LW5 J;  1YKH B;  3H1H E;  2M8R A;  3QB5 K;  3V5B A;  5AQJ B;  3RRW A;  1LT1 A;  3CVR A;  3ZMS B;  2R32 A;  5KTB A;  4G63 A;  3H1H J;  2VRS A;  2J62 A;  4EYU A;  3MK7 C;  1XZY A;  5CJ4 A;  4U33 A;  5LMU T;  1VQM P;  2LT3 A;  3H1J D;  4PV1 C;  1KYO E;  2K24 A;  3BCC D;  5CMZ A;  3HKB E;  2OYH C;  2A45 I;  2BG9 B;  2QJK B;  5CCG D;  3MXZ A;  4QH5 A;  4JBZ A;  2E74 C;  3L75 J;  3PUQ A;  1NKN A;  5AVS B;  3NWI A;  1KFN A;  2HPL A;  3GG2 A;  4MHC A;  1HH0 A;  2JO1 A;  2WSS H;  4IDZ A;  3CXH I;  4I4T E;  4ILA A;  3BRT B;  1BR0 A;  4BA9 A;  2IW5 B;  2XSB A;  3L36 A;  3AEC C;  4JI6 T;  5KAF H;  4ZNC A;  2QJP C;  3NRY A;  3HTK A;  1DU2 A;  4L75 A;  5BU5 A;  2WMM A;  3KQG A;  1EDL A;  5L3F B;  1EZV E;  2N1T C;  3CXH D;  1NTK G;  3AAI A;  4CZZ B;  1NAY A;  2A9U A;  5F3J A;  2X9X A;  3RK3 E;  1HTL C;  2E76 D;  4GIF A;  1LTB C;  4PJL A;  3HD7 D;  5KJ7 C;  1FZC B;  2H7H A;  5M1B A;  2IAK A;  2DL1 A;  2BCC J;  3ETU A;  1AQ5 A;  4BJN A;  5LHH B;  2N9B A;  3O9X A;  2V4H A;  2HPC A;  1N7S C;  3WAJ A;  1R5L A;  1VF5 B;  4U7J A;  4O4J E;  1OIP A;  3PUX F;  4WBN E;  3U59 A;  2VQF T;  4Z1M H;  4IE4 A;  2CHN A;  4YXD C;  1T2K C;  1N2D C;  3FZK B;  2FXO A;  4KHP T;  1A02 J;  4DOJ A;  4ZMD A;  3KXD A;  3ETV A;  4DUZ T;  4I50 E;  2D2S A;  2K48 A;  1LTJ A;  4K3A A;  2AXC A;  3ITK A;  4MAL A;  1LTS C;  1IFN A;  1X79 A;  1LRZ A;  2N2N A;  3N9N A;  4A97 A;  3CXH E;  2J5U A;  2FXM A;  1BGY D;  3G3Z A;  1SLQ A;  4PK6 A;  3Q5D A;  1M56 D;  3CWB G;  1JNM A;  1KOR A;  3ZN1 B;  5AQU B;  4ZI7 E;  2D5U A;  2XDJ A;  4GOU A;  5DAB A;  5L47 A;  4HE8 A;  4CPG A;  4K0U A;  2KWH A;  2XNX A;  1XNQ T;  1UGO A;  1FDO A;  1CI6 A;  3A0B E;  3M9B A;  3ZCI A;  2KLU A;  5B5E E;  2V6X A;  3FZM B;  4YSY A;  4QMA A;  5AVQ B;  3ZPO A;  2HLO A;  2RN0 A;  1IFD A;  2PTF A;  3R6N A;  5L3E B;  2K3R A;  4H44 D;  2Q9Q A;  1URQ D;  1WRG A;  1WRD A;  1EZV D;  1HUC A;  1FOS F;  1RE3 A;  1OED E;  2BBJ A;  4A5X A;  1SQB D;  2WZ7 A;  1RHZ B;  2ZYA A;  2NR4 A;  1AVO A;  1L0N D;  3TYY A;  1S72 P;  3B5N A;  3KPE A;  3M65 A;  2X67 A;  5AQQ B;  3S4U A;  1NEK A;  1X9B A;  3KZI E;  2ITA A;  4GT1 A;  3L73 G;  1VQ5 P;  1I6Z A;  3CML A;  2YNY A;  2MPK A;  4AKH A;  4QXC B;  1RH5 B;  1FZE A;  2FYU G;  2Y9Z A;  5AVY B;  5AW4 B;  2BZB A;  1G1J A;  3T1H T;  1MFT A;  4DJG A;  1SQQ D;  2WPS A;  3IHR A;  2EHO C;  5IWA T;  4U31 A;  1JB0 J;  3H1J E;  1PP9 D;  1TU3 F;  3RQW A;  3H25 A;  2C5J A;  3D6Z A;  1QVG O;  4H0L D;  2V1D B;  1Q2N A;  4OWF A;  2Z4E A;  4UXN B;  2BG9 C;  1KF6 A;  1SQB E;  5GON E;  3VP8 A;  3CME P;  1IFJ A;  3V2P A;  1IC2 A;  2XQY A;  1FJP A;  1KIL E;  3QK6 A;  3AVS A;  3Q5E A;  1VQP P;  1SQQ K;  1HX1 B;  1J1D B;  1Z56 A;  3PJS K;  3AA6 B;  3NRX A;  2Y0D A;  3X1D A;  4IL4 A;  1SE7 A;  2IPP A;  5FXV A;  4K0K T;  3O1I A;  3BAT A;  2AXT E;  1E5W A;  2ZYD A;  5LXT E;  3O8Z A;  2E5L T;  4K35 A;  2JP3 A;  4UF0 A;  5H2F H;  2MAW A;  1DH3 A;  1BE3 D;  4QWN B;  2A72 A;  5J2U E;  1BCC E;  3LG7 A;  3ONL C;  1URQ B;  2WWU A;  4YJ3 E;  3RYH E;  2B76 A;  3HUS B;  3RGU A;  4AKI A;  3CC4 P;  5HEJ A;  1U5P A;  4YTM A;  1NTZ G;  4OK0 A;  2EHO D;  2IZ0 A;  2YXQ B;  4A56 A;  1Q86 Q;  2N9Y B;  1S94 A;  3I9W A;  2LEH A;  4CN4 A;  2AEJ A;  1L0N J;  1LTI C;  5KLV G;  2I59 A;  1HCI A;  1JCD A;  2W6A A;  3L73 D;  1EXJ A;  4UVA B;  5HXE A;  3RYI E;  3LIE A;  1VDF A;  4XAX B;  2OV9 A;  4PJJ A;  1FDI A;  2B9B A;  5HEO A;  1SQX E;  4AYC A;  5AW6 B;  3F2E A;  1OWA A;  3Q3D A;  3WMM 0;  5EK2 A;  2OYI A;  4BWN A;  2XM1 A;  4YY3 T;  2Q5U A;  1RF0 C;  1SQQ J;  2OAR A;  4JYC A;  1H89 A;  2JR8 A;  2QJP B;  3GMI A;  5L3G B;  3RL0 D;  2WTY A;  4DMV A;  2WSC J;  2WS3 A;  2QSI A;  2CHO A;  1DIP A;  3F31 A;  1S2E A;  3A0H H;  3GMA A;  1IFP A;  1YJN P;  4KMC A;  2AEF A;  4YLH A;  4QH4 A;  3MZK B;  2YDS A;  4OH8 B;  3H1L J;  5APS A;  3C9I A;  3KVB A;  4O2B E;  3ZN0 B;  1YI2 P;  5M4Y A;  1IBK T;  1MMA A;  2LSJ A;  3RIA A;  4NXM T;  2HR3 A;  1L4A B;  3CWB E;  2WQY C;  2CEA A;  4DBR A;  3UU5 A;  3L4F A;  3SFE C;  2V6Y B;  2NP9 A;  1BE3 E;  3O6Q A;  5JDG A;  1W5C E;  3A8Y C;  4N78 E;  2KI7 B;  5LA6 E;  4COF A;  1NO4 A;  3BQL A;  2UXX B;  4HWC A;  5CCH C;  1L0L J;  3AE7 A;  5AW3 B;  1NVO A;  4ZKU A;  1LTJ B;  4H9N C;  1S1C X;  1ZRT E;  3GWH A;  3RK3 D;  5AQL B;  3T97 A;  2R5B A;  3AVR A;  3IEE A;  1IBL T;  3SWK A;  2E75 D;  2VL8 A;  4YHH T;  3CX6 B;  4U72 A;  4WYV A;  1YKE B;  4PFP A;  4ZOL E;  4KUM B;  3SS1 A;  1XDP A;  1UIX A;  1GK6 A;  4LC1 A;  3CX7 B;  4Z91 A;  3L75 E;  1EDI A;  4HWH A;  4A98 A;  3T8O A;  4LGD E;  1FZF A;  4YFS A;  3SFD A;  2V7J A;  2P1J A;  4YTP C;  2LSK A;  4OYK A;  2YOE A;  2C5K T;  2DHR A;  1JMB A;  1X79 B;  1KB9 I;  2W66 A;  4DBQ A;  5JRE A;  2LLY A;  2WCA A;  4H13 B;  3RK3 C;  4LF4 T;  1VQN P;  2XSA A;  4JF7 A;  5C2T A;  2UXB T;  2YEV C;  4HKA A;  5LYJ E;  1EDK A;  3CIR A;  1T3U A;  2IML A;  3BVH A;  4IHJ E;  1P84 I;  4LF9 T;  1ZME C;  4QH1 A;  2M3E A;  5HXR A;  3J7Y q;  1OVU A;  1BR4 A;  4H9Q C;  4TWF A;  5LJM A;  4M1P A;  3MHV A;  1N7S D;  4PJM A;  2JMK A;  3Q2M A;  5FY1 A;  2X0Y A;  2QA7 A;  2VVN A;  1E2A A;  4X1I E;  4OHF A;  1NKZ B;  4DR2 T;  4I43 B;  5HCJ A;  4HFH A;  3HD7 A;  1H7C A;  3C4W A;  5JTG A;  3JC2 2;  3TLU A;  3UUX B;  2W61 A;  1NHL A;  5APQ A;  3H1K G;  3G9R A;  1E79 H;  2CLY B;  3ZJ1 A;  3UU4 A;  1FC2 C;  3C4Z A;  3KV4 A;  3KYQ A;  2R6G F;  3OYZ A;  3QC9 A;  3L73 E;  1YW0 A;  3N2O A;  5B66 H;  4JYA T;  1MUU A;  2BCC E;  3HE5 B;  5FVL A;  5H6R B;  1J1D C;  3PTZ A;  4DMW A;  1NU1 E;  1T8B A;  3MIW A;  5CCH D;  3I0Q A;  5EFW B;  3UQ4 A;  4EGW A;  3BCC J;  2K1A A;  2CXF A;  4HEA A;  1N33 T;  2H7V C;  4JLE A;  2M3B A;  3VRB A;  3AAE B;  3W68 A;  1KIL A;  1AJ3 A;  2J58 A;  1MFZ A;  1OW7 A;  2NRG A;  3EFF K;  2A3D A;  3E1R A;  2E9X D;  4KI0 F;  4L0R A;  4TWH A;  2N1G A;  2W63 A;  1LP1 A;  1JM0 A;  2D2C C;  1AV1 A;  1BE3 G;  5AQI B;  5IYZ E;  4BJM A;  3D70 A;  1LT9 C;  1PP9 E;  3ZMT B;  1PV3 A;  1L4A A;  2E74 B;  4PV1 B;  4JPZ B;  2OTL P;  4UB8 E;  2DNX A;  4X62 T;  2XAG B;  3O1H A;  1BR1 A;  5HXS A;  4FI5 A;  2L5G B;  4DND A;  3TLS A;  2V7Q J;  3MUD C;  3F89 A;  1XWM A;  1LKX A;  1JY2 P;  3UIA A;  2LJL A;  5LP6 E;  5BR8 T;  3A5X A;  4CI2 B;  2K9A A;  4J2C A;  3H37 A;  5CA0 E;  3KZI H;  1V9D A;  1FS0 E;  3AED C;  2I0M A;  1VCS A;  4EEB A;  3L09 A;  4YJ2 E;  3F5H A;  3M06 A;  3DJB A;  3L71 G;  1FMW A;  5AW2 B;  1SFC D;  2LXC B;  4HWD A;  4I7Z B;  5AQH B;  2I8D A;  2GA1 A;  5F5W A;  3PUY F;  2OYI B;  3JAF A;  5AQK B;  5JR9 A;  2G0U A;  3EHZ A;  2BKN A;  4IL6 X;  3T1Y T;  4XFJ A;  1JOC A;  1AQT A;  5CJ0 A;  2XUE A;  3PUR A;  2XQ9 A;  3OVU A;  4IFD K;  3AEB A;  1YTZ I;  2O1K A;  2BEQ D;  4CXW A;  1RE4 C;  2D0T A;  4CI3 B;  1NU1 D;  2L3L A;  3AE9 A;  4H0L B;  1FEW A;  3PUV F;  5FKY A;  4QXB B;  4DR7 T;  2CE7 A;  1QLB A;  2VKD A;  2AXT H;  4JV5 T;  4HFV A;  1QL1 A;  2E42 A;  4OYJ A;  4AKG A;  4JI0 T;  4C46 A;  3RK2 D;  4QX8 B;  2IIU A;  4B3T T;  1HVV A;  3IBP A;  1VL2 A;  1GL2 C;  1OZH A;  3VP9 A;  3PTR B;  3H1L G;  2FYU E;  3AE6 C;  3BQI A;  4EZH A;  1WYB A;  3H1J J;  4IE6 A;  1GU5 A;  1XMO T;  3MD0 A;  3ZMV B;  4AQF A;  1NTZ K;  2ZLY A;  1JO5 A;  2LRL A;  2QIW A;  2FKW B;  3UTK A;  3I5C A;  2KLV A;  5FMN A;  1SQB K;  5KLV E;  1IFI A;  2ZVO B;  4LF7 T;  4DCK A;  4HJG H;  3VKH A;  2Y0E A;  2DW3 A;  2JWD A;  2ZVN B;  3SFE A;  1VQO P;  3TSI A;  3CC2 P;  1SQV G;  4UF0 B;  2C0S A;  1HJB A;  1PGO A;  2KZJ A;  1G1I A;  1QVF O;  3AE1 C;  3LW5 H;  3U1C A;  5E79 H;  1IBM T;  2AEM A;  5JRC A;  2CLY C;  3PJA A;  5BMV E;  5KLV K;  4ZS3 A;  2E75 B;  4WBO A;  1S5L H;  3P8C E;  1USE A;  2XU6 A;  4LML A;  2KSJ A;  4X5T A;  4P0A A;  2WSE H;  4WB4 A;  1EZV G;  2KK7 A;  3WI3 A;  4AIS A;  5CA1 E;  3ZT7 A;  5AFU L;  2MYS A;  3RIU C;  1K73 Q;  1VQ4 P;  5CCH A;  2BCC D;  1MIY A;  4TV8 E;  1GL2 D;  1KIL C;  3E7K A;  4TNV A;  5LGU B;  4PJ0 E;  3A0H E;  3A0B H;  3HE4 B;  3CQX C;  2NZ2 A;  5J2T E;  1KEY A;  4TLF A;  2VVS A;  2FYN B;  3SFD C;  3H1L E;  3MP7 B;  5DJT B;  4WNK A;  4HFI A;  1LT9 A;  2VWA A;  4C7N A;  3H1K D;  4PW8 A;  4LFA T;  4JQ0 D;  2Z5H A;  2YMY A;  4PD4 E;  3CKD A;  4R4L A;  4KBM B;  2IYO A;  3TF5 A;  3QB5 A;  1QL2 A;  3AE3 A;  3BQK A;  4LFB T;  2AXD S;  5ADX L;  4CXY A;  1RQU A;  3MUD A;  1JTH A;  2HYN A;  1HJ0 A;  3KFW X;  1JMM A;  2G3A A;  4ZI3 C;  1WLX A;  4Y99 C;  2D2C D;  3Q5S A;  2XAF B;  2MTQ A;  2WSE J;  1SQP E;  4O4I E;  1K8A Q;  4UIG A;  3AE4 A;  1AVY A;  5JDQ A;  4I2L C;  5L4H A;  4LFC T;  2YKS A;  4DV1 T;  2BAS A;  3G71 P;  2CM0 A;  2Q9Q D;  5F8P A;  5FY7 A;  2UXC T;  3AB3 B;  5JH7 E;  1RF0 A;  5BVZ A;  2BKP A;  5HXC A;  1N32 T;  2B88 A;  1SS1 A;  2W27 A;  2XAQ B;  3H1K J;  3MKD A;  5JR9 C;  3H3A A;  1GMJ A;  1IK9 A;  3VHL A;  1T98 A;  5BU8 B;  5AVX B;  2LOP A;  3H1L D;  4I7Z C;  1S9K D;  2HPC B;  3UT5 E;  1RQV A;  3H1K E;  1SQB G;  3CX5 I;  4JI5 T;  1RE4 A;  2ZFC A;  1SFC B;  1W09 A;  2UUC T;  4NUU A;  3L8R A;  4UEM A;  3RL0 g;  2QJY B;  1EDJ A;  3JSV C;  1U4Q A;  1BSN A;  2HN2 A;  3RC3 A;  3HD7 C;  5DJQ C;  4HFC A;  3CCM P;  4B3R T;  2XJ7 A;  1ZP0 C;  5LGT B;  1KQF B;  3RQU A;  4OVN F;  4OGQ C;  5KKZ B;  5FXX A;  1SA0 E;  3G6E P;  2HPJ A;  4H44 B;  3CPZ A;  4YTN A;  3KIN B;  1E7P A;  4U7I A;  3EWK A;  4U7Y A;  2SPZ A;  3C1L A;  3O4X E;  3AE7 C;  1ZN5 A;  2W8Z A;  3RIF A;  5L3C B;  4KP3 C;  1NTZ J;  3CD6 P;  2QG4 A;  3IR9 A;  2BS4 A;  1E1H B;  2NW7 A;  1QX8 A;  5GTH H;  4HFD A;  2CPB A;  3CCU P;  4IDQ A;  4ZZB A;  4DV7 T;  4DID B;  3T97 B;  2YU1 A;  1R8E A;  3P7K A;  1GU4 A;  2CMR A;  2H7O A;  2YKQ A;  3CPW O;  3GHG B;  2RP4 A;  5KX5 E;  3WUU A;  2UWJ E;  2LSY A;  1FOS E;  3EI0 A;  5JDN A;  2FYU J;  3HE4 A;  2KZ7 B;  5JDH A;  2NW8 A;  5LHI B;  1SQV D;  5FNV E;  3KVA A;  2X51 A;  2KZI A;  3WUV A;  4NXN T;  4GKK T;  1G8X A;  2Q6Q A;  1MND A;  1YJ9 P;  2YO2 A;  2JRK A;  3LJC A;  4EXT A;  4OGQ B;  2ZM2 A;  3AA1 B;  2O01 H;  1L4A C;  5AQG B;  4TZ4 C;  3AEF A;  4H9O C;  4HH2 A;  1XNR T;  4H0L C;  1L0N G;  2VKH A;  3ZKR A;  1MMD A;  1YQ4 A;  3NFQ A;  2PFV A;  2LM2 A;  4TNW A;  2ZAE B;  2XQ7 A;  3UU6 A;  4GYR A;  1RF1 B;  4G2A A;  4RJT A;  3KBU A;  4AXP A;  2N1T A;  2GUS A;  3HL6 A;  2V5D A;  4CI1 B;  4AQG A;  2HOD B;  2W62 A;  2H89 C;  3C98 B;  2M6I A;  2ODV A;  2UU9 T;  1KV4 A;  1YQ3 C;  3KDP B;  3AEB C;  3GN5 B;  3C64 A;  1OED A;  5JVD E;  5ETW A;  5HXH A;  3E08 A;  3NMD A;  4WBA A;  1VPC A;  1L0N E;  2MKV A;  1FU1 A;  5AVT B;  4NPF X;  4WWI A;  2WSC H;  1NTK K;  1IO4 A;  1UX5 A;  2C5I T;  3PU8 A;  3RKG A;  3RF1 A;  3ZST A;  4I1L A;  2WT7 A;  2ZM8 A;  3CWB D;  2FUP A;  5KMG P;  3UUN A;  2P10 A;  2F4V T;  3FGA D;  3IAO A;  2QA4 P;  3WUT A;  1WYC A;  5IUX A;  3I9Y A;  3RYC E;  1YHQ P;  4RKU J;  1AJY A;  3IFM A;  4PV1 D;  1GDT A;  3P8M C;  1P84 H;  3RX6 A;  3N9M A;  1T3J A;  4DV0 T;  3B57 A;  2IBZ D;  1K05 A;  2XM2 A;  1KB9 E;  1WMK A;  3TLT A;  2CA5 A;  5HYA A;  5DQV A;  2OA5 A;  2V8S V;  3AE6 A;  1NTM E;  3AEG A;  3UUB A;  1RF1 A;  4KHZ F;  4JUY A;  3AE8 A;  3RK3 B;  2J59 M;  3CMA P;  2E75 C;  2IHR 1;  1LWU C;  2OTK E;  5FVK A;  2E76 C;  3FHN A;  3RK2 C;  3GF7 A;  2MBG A;  3TGU J;  4WY4 A;  3B13 A;  3ZC0 A;  4EIW A;  1SQV J;  3D0T A;  4EZ4 A;  4UVB B;  2OLT A;  2VAS A;  1JCC A;  1KNZ A;  2AE9 A;  3B4S A;  1JNZ A;  3L39 A;  5KLV D;  3SWF A;  1Y8A A;  2X66 A;  2XV5 A;  1SHZ C;  2QVA A;  3AE5 A;  1DD4 A;  3CCL P;  3LK2 B;  3U3I A;  5TJH A;  2XQ8 A;  4P0B A;  2BVL A;  4NIQ A;  3AA0 B;  1SUM B;  4DV4 T;  4H63 H;  2Y0C A;  3EDU A;  3ONX A;  3GW6 A;  5J1G A;  2CPS A;  3L3P A;  3PUA A;  2ZT9 B;  4CXX A;  3R2P A;  5KAI E;  4IOI H;  4RO0 A;  2XAS B;  1FMV A;  1M62 A;  3FB2 A;  2WVR A;  1IJ5 A;  1L0L K;  3LBX B;  4IL6 E;  2KUB A;  4DT0 A;  3UUM A;  1W9R A;  4FJO A;  4TV9 E;  5C3J A;  4JEH B;  2HOD A;  2YDR A;  3FZF B;  3HTK B;  3KV9 A;  4U3C A;  2C0X A;  2WDR A;  4YXW H;  4D6T E;  1NOH A;  2FYZ A;  3N9Q A;  1YJW P;  5HWX A;  2P7J A;  3ANW A;  1L0L D;  3NZP A;  1GZL A;  4GKJ T;  2WB5 A;  1SQX D;  1NJI Q;  3FBL A;  5TIS H;  2X0H A;  4D6T J;  1N7S A;  2XAJ B;  2IZ1 A;  2FBW A;  2NTX A;  5E79 E;  1M57 D;  2W0G A;  1NYH A;  1FZC C;  5AQF B;  5LGN B;  3AE9 C;  2IBZ G;  4AKR B;  3M9Q A;  2ZT9 C;  4O8S A;  5JDL A;  3ZSS A;  1KTM A;  4F8H A;  1W0A A;  4NPP A;  1D0Y A;  3CQC B;  3V5S A;  4N6J A;  2W6B A;  2WMO A;  5LB7 B;  3FXD B;  3G4S P;  2X9H A;  4YSZ A;  3RBX A;  2ZXE B;  2YXR B;  1Y9B A;  3VMA A;  4ZI3 D;  4QHO A;  4DV2 T;  3CLQ A;  3OA7 A;  2P2U A;  4EDF A;  2E2A A;  4DV6 T;  2FJB A;  2W83 C;  1NWQ A;  2H8P D;  2RPA A;  2WP9 A;  1Q82 Q;  1BCC D;  5AVZ B;  4ILU A;  3TLW A;  2Y6X A;  4LMK A;  5APX A;  1D7M A;  3PDY A;  5AW5 B;  1PGJ A;  2KXP B;  3A5T A;  2LR2 A;  2JQQ A;  5APY A;  3QUJ A;  3ZEF B;  3CCR P;  3P4R A;  1HTJ F;  1MKM A;  2X68 A;  4PD4 H;  3L70 D;  4C91 A;  3FXE B;  1GD2 E;  3ANW B;  3TLV A;  2CXD A;  5FL0 A;  4UB8 H;  1GL2 A;  2Q7C A;  4ZHQ E;  3EVY A;  2X9Y A;  2H3R A;  1KIL D;  2W00 A;  4GKG A;  4IE5 A;  3CWZ B;  1M1J B;  2NPS B;  3L71 J;  3FXE A;  3L73 J;  1HF9 A;  5FXZ A;  1YD8 G;  2KIN B;  1HNW T;  4YT0 A;  1NWM X;  3HKE E;  2CPT A;  5ABF A;  2V7Q H;  3QOF A;  1J2J B;  3ZMU B;  2WWV A;  1N36 T;  3VKG A;  1LTG C;  4U2Z A;  1BDD A;  3K8P C;  1RY3 A;  3VR8 A;  4EED A;  3AE8 C;  3L74 J;  1IFM A;  3E1I A;  4IST A;  2KS1 B;  3H1I D;  3K3O A;  1UX4 A;  3CX5 E;  3Q2Y A;  1H0T B;  2I1K A;  2IUB A;  2Q9Q C;  2V7K A;  1N73 B;  3V2Q A;  1M1K Q;  1XTG B;  5KJ7 A;  3L74 E;  2WAU A;  5JDM A;  3N2K E;  4AKL A;  1RE3 C;  2I1J A;  1GW3 A;  3DP7 A;  3B5M A;  3H1I G;  1AA0 A;  3AXJ B;  4JI8 T;  1ZV4 X;  1BSH A;  4ZEY A;  2R5D A;  3L71 D;  2YIU C;  3TGU E;  3RLF F;  4ASK A;  3B5N C;  1S3J A;  2B87 A;  3PH0 A;  1SQV E;  2ODU A;  4JI4 T;  3PLN A;  1SQP G;  2M5A A;  4HGA A;  4AQR D;  3VN0 A;  2WU2 A;  1MIW A;  2E9X B;  3RI5 A;  4W7Z A;  1BE3 J;  4EOZ B;  4B3S T;  2B87 B;  2OQQ A;  1JY2 N;  2PP6 A;  4Y28 J;  3H1J G;  1FE6 A;  2HG5 D;  5LCY A;  3D6Y A;  1WFD A;  1ZR2 A;  1I94 T;  1KQS O;  4PNI A;  3RH3 A;  2W90 A;  3L72 G;  3FZH B;  1M8O B;  3EFG A;  2KIK A;  3CX5 D;  4IDN A;  1SQQ G;  5LBM A;  4U3F D;  4P1N A;  1PL5 A;  2Z6E A;  3Q1M A;  4O4L E;  1PGQ A;  3B5N D;  4UB6 E;  3L37 A;  1US7 B;  2PG8 A;  5AQP B;  5LOV E;  4C7R A;  3P50 A;  5CHX A;  2FJA A;  4X20 E;  3J9X 1;  4C7N B;  1J1E C;  1MMN A;  3U78 A;  5FXW A;  2WBL A;  4R4M A;  4P09 A;  1G2C B;  2E9X C;  2ZM6 T;  3PUZ F;  3OPC A;  2N9D A;  3TNU A;  4LMJ A;  2FBW C;  1OED B;  3H32 B;  5LMN T;  3PUW F;  4IDP A;  5FYM A;  3H3M A;  2M67 A;  1T2K D;  1H8A A;  2IC9 A;  4MLK A;  2FYU K;  2QM7 A;  1JY3 P;  2WDQ A;  1U57 A;  2WZI A;  1KYO D;  2UUA T;  3KDS E;  3L72 D;  1OVR A;  1NTZ E;  1DEE G;  2XKM A;  3HUS C;  4BRY A;  1VRB A;  2QE7 H;  2Y8D A;  1S5L E;  3G06 A;  3RGL A;  2K9J B;  1SVF A;  4DR6 T;  4I55 E;  4Y99 B;  1X9V A;  4HWF A;  3CL3 D;  2ACZ A;  5FP3 A;  4GYS A;  2FFD C;  1QEX A;  4RES B;  3RKO A;  2KLQ A;  5HCM A;  1WT6 A;  1EQ7 A;  4HYT B;  1MIV A;  3OYX A;  3R84 B;  4PJ0 H;  3NKZ A;  5L2L A;  1Y01 A;  1ZP0 A;  3TK1 A;  3PJA J;  4IE0 A;  4DV5 T;  3USS A;  5AQO B;  3UU3 A;  4CN6 A;  3N9O A;  2JDI H;  3B8E B;  3JCU E;  2N1T D;  5ABH A;  2YIN A;  2ZMA A;  3L35 A;  4WY4 C;  3RPU A;  2NWB A;  1CHU A;  1L0V A;  4EYY R;  2M6B A;  3N4X A;  5LNK A;  3RL0 B;  2ZXX A;  1JNR A;  1P84 E;  2PBI A;  3H6P A;  2BBH A;  4HTE A;  2C0W A;  1PP9 G;  4C90 A;  4BRY B;  5HEG A;  3AEA C;  4LF8 T;  1KB9 H;  2QJY C;  2VQE T;  3NZQ A;  4AUW A;  2DI4 A;  2DWK A;  3N9L A;  4X66 T;  2FYU D;  2ZJS E;  2PJQ A;  3OTO T;  2KOG A;  1BCC G;  2VL0 A;  2OYH B;  2EHO A;  4AQY T;  2FJE A;  3ZDM A;  5GTI E;  1M1J C;  2NPS C;  3A7O A;  3ZYL A;  2KB7 P;  1BCC J;  1ZKE A;  2VKJ A;  3JAD A;  3W67 A;  3AA7 B;  2YKO A;  3VRA A;  4U2Y A;  2CBJ A;  3QNU A;  5FY0 A;  3CX8 B;  5HWY A;  3HA4 A;  4IIJ E;  1HGZ A;  2E5Y A; 
#chains in the Genus database with same CATH homology
 2WSS V;  3O4X E;  3H32 A;  4PJJ A;  1ZN5 A;  4ZS2 A;  1SQV K;  4AYC A;  5AW6 B;  3F2E A;  5L3C B;  2KMF A;  4KP3 C;  1OWA A;  2V7L A;  2NOX A;  4MBQ A;  3VMY A;  3IR9 A;  3HR0 A;  1NH4 A;  3V2N A;  3WMM 0;  1E1H B;  2NW7 A;  3NBX X;  4I6M C;  5EK2 A;  2OYI A;  5C8Y E;  2ZM0 A;  1X8Y A;  2CPB A;  4OFZ A;  3OJA B;  2N1T B;  4CI2 B;  2Q5U A;  3GHG C;  3LK3 B;  1RF0 C;  2OAR A;  2YU1 A;  4JYC A;  2NW9 A;  1H89 A;  2YO3 A;  1SQP K;  2IFN A;  3LID A;  3P7K A;  1GU4 A;  2CMR A;  2H7O A;  3I1A A;  2YKQ A;  1FZC A;  2A2F X;  3GHG B;  2RP4 A;  4U74 A;  4QKN A;  3GMI A;  5KX5 E;  1LTJ C;  1CZQ A;  1FDM A;  2LSY A;  3RL0 D;  5L3G B;  3U1A A;  1FOS E;  2WTY A;  4XBF B;  3V2R A;  4L5G A;  5JDN A;  2HFE D;  3HE4 A;  2KZ7 B;  4DMV A;  2NW8 A;  5JDH A;  5LHI B;  3PP5 A;  3CI9 A;  1LVF A;  5FNV E;  3KVA A;  2X51 A;  5L3D B;  2Y48 B;  3F31 A;  3TNU B;  3ZJ2 A;  3DTO A;  2PAJ A;  4KMC A;  1G8X A;  1MND A;  2JRK A;  3LJC A;  2YO2 A;  4YLH A;  4DVD A;  1HF8 A;  3MZK B;  2R3C A;  4EAH A;  4OH8 B;  4EXT A;  5APS A;  3C9I A;  3C50 A;  3KVB A;  2ZM2 A;  4O2B E;  3ZN0 B;  3AA1 B;  2O01 H;  5HAX A;  5M4Y A;  1L4A C;  2DCF A;  3AAA B;  4TZ4 C;  1FZG A;  1MMA A;  2ES0 A;  2LSJ A;  2IC6 A;  4H9O C;  4HH2 A;  1FJK A;  1L4A B;  2VKH A;  4QX7 B;  3CQG B;  1MMD A;  2YK0 A;  3ZMZ B;  1QUU A;  3NFQ A;  1RF1 C;  2HH7 A;  2PFV A;  2CEA A;  2CXL A;  3N9P A;  3L4F A;  4DBR A;  2NP9 A;  3LBX A;  1RF1 B;  4GYR A;  3ZYK A;  2SPC A;  4G2A A;  5JDG A;  4N78 E;  3KBU A;  2N1T A;  1JY3 O;  2GUS A;  3EDV A;  3HL6 A;  2X0L B;  3K3Q C;  1NO4 A;  1ZHC A;  3Q9D A;  3BQL A;  5LA6 E;  3ZLI A;  4CI1 B;  4AQG A;  1GL2 B;  2UXX B;  5JDF A;  4L9I A;  5CCH C;  2HOD B;  2CCQ A;  4UEL A;  5L3B B;  1HG2 A;  2B1E A;  1KZU B;  5AW3 B;  4ZKU A;  2W62 A;  3SRZ A;  3C98 B;  1LTJ B;  1YYC A;  2ODV A;  4H9N C;  4H63 V;  3M0D C;  4ERR A;  1N73 C;  3MTU E;  3N7N A;  3GWH A;  3RK3 D;  4ZI2 D;  3KDP B;  2IFM A;  3T97 A;  3GN5 B;  3C64 A;  4NUV A;  2R5B A;  5JVD E;  3AVR A;  3IEE A;  5ETW A;  2VL8 A;  4H9P C;  4X1Y E;  5HXH A;  3E08 A;  3NMD A;  1VPC A;  1FBM A;  1ZV8 A;  3P8C D;  4WBA A;  2KWI B;  1FU1 A;  5AVT B;  4EOT A;  3CX6 B;  4PJN A;  4U72 A;  3ZC1 A;  2WSC H;  2JMH A;  1NTK K;  1IO4 A;  1UX5 A;  3B5N B;  1YKE B;  1N7S B;  1JY2 O;  1J1E B;  2C5I T;  2P9B A;  4KUM B;  3M9H A;  1W2E A;  3I0O A;  3SS1 A;  4I1L A;  2WT7 A;  1GK6 A;  4LC1 A;  2ZM8 A;  5KMG P;  3CX7 B;  3BRV B;  3UUN A;  1LTA C;  3ESL A;  4JEU B;  4QXH B;  1IZN B;  1WYC A;  4X1K E;  5A1L A;  2VK9 A;  1QSD A;  3I9Y A;  3RYC E;  3T8O A;  4E7Z A;  3IFM A;  3BK9 A;  2WWW A;  1DEB A;  4LGD E;  4PFP A;  1GDT A;  3P8M C;  4TN7 B;  1FZF A;  4AKL A;  3RX6 A;  4YFS A;  5LJN A;  3N9M A;  1T3J A;  3VU7 H;  1HG5 A;  2V7J A;  2P1J A;  5CCG C;  1OXZ A;  2WT7 B;  2LSK A;  1LVK A;  4MFR A;  2EHO B;  4OYK A;  2C5K T;  2DHR A;  3B57 A;  1CUN A;  1X79 B;  2FFD A;  5APW A;  4UV8 B;  3OAK A;  1S9K E;  4DBQ A;  4XE5 B;  4ISS A;  2CA5 A;  5HYA A;  5LGN B;  5JRE A;  5APT A;  3RC8 A;  5DQV A;  3NXS A;  2OA5 A;  3JC6 C;  4N78 D;  3HKC E;  3VOP A;  2V26 A;  2RA1 A;  3RK3 C;  4ZI2 C;  2Q9Q B;  4JF7 A;  3PUS A;  1RF1 A;  1MMG A;  3W15 B;  4JUY A;  4BAY B;  3EQ2 A;  2WM9 A;  3RK3 B;  2J59 M;  2YEV C;  1M7L A;  1T8Z A;  3OKQ A;  4HKA A;  1FAV A;  1LWU C;  5LYJ E;  3FHN A;  3RK2 C;  2MBG A;  3A3Y B;  1T3U A;  3BVH A;  2LE8 A;  4WY4 A;  3VMZ A;  3HI2 A;  4IHJ E;  3B13 A;  3UUL A;  5LHG B;  3ZC0 A;  2D0U A;  3D0T A;  4EIW A;  5HXR A;  1CI6 B;  2Z5I A;  2WPQ A;  1BR4 A;  2VB6 A;  2DWG A;  4H9Q C;  4EZ4 A;  5LJM A;  5EK3 A;  3J7Y q;  4UVB B;  4ZHQ E;  4M1P A;  2VAS A;  1JCC A;  3VTP C;  3LK4 2;  3OJA A;  1VOM A;  1KNZ A;  1N7S D;  4N3Y B;  2WIT A;  2CWY A;  4PJM A;  2JMK A;  2LM9 A;  4M3L A;  3Q2M A;  2V7M A;  4GYS A;  5E0O A;  5FY1 A;  2X9W A;  1IJ6 A;  1EZ3 A;  3N5L A;  1SFC A;  3K3N A;  2QA7 A;  3N2G E;  4XZC A;  1L4A D;  4ZI3 D;  3LFM A;  3SWF A;  5CCG A;  2X66 A;  2XV5 A;  1SHZ C;  1SP4 A;  2QM8 A;  2WSF H;  1GTW A;  3BAS A;  4X1I E;  1KK7 A;  1NKZ B;  1DX7 A;  4OHF A;  4AI6 A;  1JY3 N;  3JC6 D;  3LK2 B;  4H9R C;  4I43 B;  3U3I A;  3HD7 A;  1H7C A;  1KFM A;  3C4W A;  4P0B A;  4Z8X A;  2LOS A;  1CW5 A;  2BVL A;  4UVC B;  4ZKP A;  1NU1 K;  2W61 A;  1D0Z A;  1HX8 A;  1WR6 A;  3AA0 B;  3PE0 A;  3UUX B;  1NHL A;  5APQ A;  1LGH B;  4H63 H;  3RRC A;  2CLY B;  2NTY A;  3ZJ1 A;  3EDU A;  3WAK A;  3ONX A;  3OBV E;  5DQW A;  5J1G A;  4DZO A;  3C4Z A;  1URQ A;  2CPS A;  3L3P A;  3PUA A;  4LLH A;  3KV4 A;  3PU8 A;  1ZR4 A;  3KYQ A;  4IGU A;  2POH A;  2XZR A;  4CXX A;  3HD7 B;  3R2P A;  3Q5X A;  5JQG E;  1Y64 B;  2XAS B;  3OYZ A;  3RK2 B;  1FMV A;  3PUG A;  3FB2 A;  3QC9 A;  3II6 A;  1D1A A;  5AW7 B;  1L0L K;  1IJ5 A;  2C9N Y;  4ADZ A;  2V7I A;  1YW0 A;  3M0A A;  4MAL A;  3N2O A;  3LBX B;  3SOL A;  5AVU B;  5AW1 B;  1MUU A;  3HE5 B;  2QGS A;  5H6R B;  2JEE A;  4F6R C;  5APU A;  1J1D C;  3TKL B;  3UUM A;  4FJO A;  1UCU A;  4TV9 E;  1MNE A;  4DMW A;  2J1D G;  1YKH B;  3MIW A;  2M8R A;  5AVV B;  5CCH D;  3I0Q A;  2HOD A;  4JEH B;  4EIJ A;  2DLR A;  3MA9 A;  3HTK B;  2O1J A;  3KV9 A;  3V5B A;  2C0X A;  3RRW A;  3CVR A;  2CXF A;  3ZMS B;  4HEA A;  4B6X A;  1NTM K;  2H7V C;  4JLE A;  2M3B A;  3AAE B;  1NOH A;  1KIL A;  2FYZ A;  2R32 A;  5LG4 A;  2J58 A;  1MFZ A;  1AJ3 A;  3N9Q A;  2A3D A;  5KTB A;  4G63 A;  5HWX A;  4W7Y A;  2P7J A;  2VRS A;  3ANW A;  3NZP A;  1GZL A;  4EYU A;  3HUS A;  3MK7 C;  2E9X D;  5CJ4 A;  2OYI C;  4L0R A;  2E9X A;  3FBL A;  1SFC C;  2N1G A;  2W63 A;  1N7S A;  2JPF A;  1URQ C;  2LT3 A;  2XAJ B;  3KBT A;  2NTX A;  2K24 A;  3HKB E;  2W0G A;  5CMZ A;  1FZC C;  1D0X A;  1LT9 C;  2OYH C;  2A45 I;  3E22 E;  5IYZ E;  2WMN A;  3ZMT B;  5JDM A;  4B86 A;  2GM4 A;  3M9Q A;  1L4A A;  2DNX A;  4YHJ A;  1FZA A;  4PAG A;  4AKR B;  5CCG D;  3MXZ A;  4O8S A;  5KDM C;  5JDL A;  2IX7 C;  4O2A E;  2XAG B;  5IHY A;  3O1H A;  1BR1 A;  1D0Y A;  3CQC B;  3V5S A;  2XAH B;  2L5G B;  4N6J A;  2W6B A;  3PUQ A;  4FI5 A;  4DND A;  2WMO A;  1NKN A;  5AVS B;  3FXD B;  2X9H A;  1LKX A;  1JY2 P;  1KFN A;  3UIA A;  2HPL A;  2LJL A;  4PFO A;  5LP6 E;  4MHC A;  1HH0 A;  2ZXE B;  1HBW A;  3A5X A;  4IDZ A;  2K9A A;  4WY4 D;  4J2C A;  3CLQ A;  3OA7 A;  2P2U A;  3H37 A;  4QHO A;  1AFO A;  4I4T E;  5CA0 E;  3BRT B;  2H8P D;  1NWQ A;  4BA9 A;  1V9D A;  1BR0 A;  5LBQ B;  1ZEE A;  2IW5 B;  5AVZ B;  4ILU A;  2Y6X A;  3VMX A;  3IF8 B;  3L09 A;  5APX A;  4YJ2 E;  3M06 A;  1N73 A;  3DJB A;  3L36 A;  3PDY A;  5AW5 B;  2KXP B;  3MAC A;  1FMW A;  5AW2 B;  3A5T A;  1SFC D;  2JQQ A;  3NRY A;  4AQF C;  3HTK A;  5APY A;  5AVR B;  2LSG A;  3QUJ A;  3ZEF B;  5BU5 A;  3KV6 A;  3KQG A;  2Q9I A;  1HTJ F;  2OYI B;  5L3F B;  2N1T C;  2X68 A;  5AVW B;  2OYH A;  3AAI A;  4CZZ B;  4C91 A;  3FXE B;  2X9X A;  5JR9 A;  2G0U A;  5F3J A;  1HTL C;  5JRC B;  4JYB A;  4GIF A;  1LTB C;  1GD2 E;  3ANW B;  2CXD A;  4PJL A;  3HD7 D;  5KJ7 C;  1FZC B;  2H7H A;  1GL2 A;  2IAK A;  1JOC A;  3PTR B;  4IE7 A;  2Q7C A;  5CJ0 A;  2XUE A;  3EVY A;  2KT9 A;  2X9Y A;  3ETU A;  3PUR A;  4BJM A;  1SQX K;  4IFD K;  1AQ5 A;  2H3R A;  4BJN A;  5LHH B;  1KIL D;  2N9B A;  2W00 A;  4GK0 E;  4GKG A;  3O9X A;  1MV8 A;  1YTZ I;  2HPC A;  4IE5 A;  2O1K A;  1M1J B;  2NPS B;  3CWZ B;  1N7S C;  2L8K A;  5FXZ A;  3UFE A;  4CXW A;  1RE4 C;  3WAJ A;  2D0T A;  1YD8 G;  4CI3 B;  1S35 A;  2KIN B;  1HS7 A;  2L3L A;  3C4X A;  1GW4 A;  4O4J E;  2LSI A;  2L9Q A;  1NWM X;  1FEW A;  1YTZ T;  3HKE E;  2Q3I A;  3U59 A;  4ANJ A;  4WBN E;  4IE4 A;  4QXB B;  2CE7 A;  2VKO A;  1G73 A;  1J2J B;  1T2K C;  1N2D C;  3ZMU B;  3VKG A;  2VKD A;  2UXN B;  1LTG C;  2JJL A;  4HFV A;  1QL1 A;  1RY3 A;  3K8P C;  2E42 A;  1L0N K;  1IFM A;  4OYJ A;  3E1I A;  3GA8 A;  4IST A;  4AKG A;  1A02 J;  3GHG A;  1GK4 A;  4DOJ A;  2LHR A;  4C46 A;  3ETV A;  3K3O A;  1FZB A;  3RK2 D;  4PK4 A;  1UX4 A;  4I50 E;  4QX8 B;  2D2S A;  5H6Q B;  2K48 A;  1LTJ A;  2YKP A;  1H88 A;  2I1K A;  1HVV A;  1N7L A;  2Q9Q C;  2V7K A;  1N73 B;  3V2Q A;  2WAU A;  1XTG B;  5KJ7 A;  3IBP A;  1LTS C;  1GL2 C;  1IFN A;  3HE5 A;  3VP9 A;  1LRZ A;  1RE3 C;  2I1J A;  1KQL A;  3MGN A;  1X79 A;  1GW3 A;  2N2N A;  3DP7 A;  3N9N A;  1JTH B;  3BQI A;  4EZH A;  1WYB A;  2FXM A;  2BDE A;  5EZY E;  4IE6 A;  3G3Z A;  1ZV4 X;  1SLQ A;  4PK6 A;  1GU5 A;  4E7S A;  3MD0 A;  2R5D A;  2GK9 A;  1JNM A;  3ZMV B;  4AQF A;  1NTZ K;  4ASK A;  3B5N C;  3ZN1 B;  4ZI7 E;  2D5U A;  2XDJ A;  2ZLY A;  4GOU A;  5DAB A;  4IFF A;  1KIL B;  1JO5 A;  2ODU A;  2FKW B;  4HE8 A;  3I5C A;  4H9S E;  3UTK A;  5HXS A;  2KLV A;  4K0U A;  5FMN A;  1SQB K;  4HGA A;  1IFI A;  4AQR D;  2KWH A;  3VN0 A;  2KP8 A;  2MJZ A;  2XNX A;  1MIW A;  2E9X B;  4W7Z A;  1CI6 A;  4EOZ B;  3VKH A;  3M9B A;  3ZCI A;  5AVQ B;  4PK5 A;  3TSI A;  1PFI A;  1JY2 N;  2PP6 A;  1Z0P A;  2HLO A;  4UF0 B;  3ZPO A;  1IFD A;  1IJD B;  2HG5 D;  1HJB A;  2C0S A;  5LCY A;  3A2A A;  3Q5W A;  1G1I A;  4W80 A;  3LW5 H;  3R6N A;  3U1C A;  1ZR2 A;  5L3E B;  2Q9Q A;  1URQ D;  1WRG A;  4PNI A;  1WRD A;  3RH3 A;  1A02 F;  1HUC A;  3SWH A;  1RE3 A;  1FOS F;  3EFG A;  2WZ7 A;  3M0D A;  5JRC A;  2CLY C;  5BMV E;  5KLV K;  1BR2 A;  4ZS3 A;  4WBO A;  1LWU B;  4O4H E;  5LBM A;  3P8C E;  2CWO A;  4DO0 A;  3TYY A;  2XU6 A;  2Z6E A;  4O4L E;  2KSJ A;  4P0A A;  2WSE H;  3B5N D;  4WB4 A;  3B5N A;  3L37 A;  4HN9 A;  1G2C A;  1US7 B;  2PG8 A;  3KPE A;  3WI3 A;  2KYV A;  3M65 A;  5CA1 E;  5AW8 B;  4EB6 E;  5AFU L;  2GUV A;  2MYS A;  5LOV E;  4C7R A;  5CCH A;  2H43 A;  1MIY A;  2X67 A;  5CHX A;  4TV8 E;  3S4U A;  1GL2 D;  1KIL C;  4X20 E;  3J9X 1;  4C7N B;  3HKD E;  5LGU B;  4GT1 A;  1J1E C;  5AW9 B;  2E43 A;  1FIO A;  1HFA A;  1MMN A;  4GIW A;  5FXW A;  3U78 A;  2WBL A;  3CML A;  2YNY A;  3V4Q A;  4P09 A;  5KJ7 D;  3HE4 B;  3CQX C;  1G2C B;  2E9X C;  5J2T E;  4AKH A;  4QXC B;  4CQI A;  1O3X A;  3PU3 A;  3MJX A;  2N9D A;  1FZE A;  2A45 G;  5JR9 B;  3TNU A;  5APV A;  5AVY B;  5AW4 B;  3H32 B;  4WNK A;  2BZB A;  1LT9 A;  5FYM A;  2WPR A;  2VWA A;  4C7N A;  1G1J A;  2M67 A;  1T2K D;  1H8A A;  3NTN A;  2IC9 A;  4PW8 A;  4MLK A;  1MZ9 A;  2FYU K;  2YMY A;  2Z5H A;  2QM7 A;  1JY3 P;  3CKD A;  2WPS A;  3V4W A;  2EHO C;  1HGV A;  3IHR A;  4KBM B;  1QL2 A;  3ZCJ A;  2P67 A;  3BQK A;  3FBZ A;  2YU2 A;  3KDS E;  1M1J A;  2NPS A;  5ADX L;  2NPS D;  2XKM A;  3HUS C;  2C5J A;  1VRB A;  3HRN A;  2Y8D A;  4CXY A;  3MUD A;  1SVF A;  1JTH A;  2HYN A;  2V1D B;  1LWU A;  3F57 A;  1LT9 B;  3KFW X;  4Y99 B;  4I55 E;  5CB4 E;  2Z4E A;  4AXP A;  4UXN B;  1X9V A;  1JMM A;  3SWY A;  3CL3 D;  4ZI3 C;  1WLX A;  4IFM A;  4Y99 C;  1HWT C;  3OYX A;  5GON E;  5FP3 A;  2XAF B;  3VP8 A;  2MTQ A;  1IFJ A;  2FFD C;  3V2P A;  1IC2 A;  1IAP A;  2ACX A;  1FJP A;  2XQY A;  4O4I E;  4RES B;  4GK5 E;  4UIG A;  3RKO A;  5JDQ A;  4I2L C;  2KLQ A;  3QK6 A;  2FFD B;  3AVS A;  1WT6 A;  1EQ7 A;  1ZLL A;  4HYT B;  1MIV A;  2K5B B;  2BAS A;  1SQQ K;  2CM0 A;  2LHN A;  3R84 B;  1J1D B;  1Z56 A;  2Q9Q D;  3AA6 B;  5F8P A;  3NRX A;  5L2L A;  5FY7 A;  2IPP A;  5FXV A;  5EK4 A;  3O1I A;  3BAT A;  3TK1 A;  3E0Z A;  1E5W A;  4IE0 A;  5LXT E;  3AB3 B;  4UV9 B;  1RF0 A;  5BVZ A;  2XTL A;  3P7I A;  5HXC A;  5JH7 E;  3N9O A;  3M91 A;  2W27 A;  3B8E B;  2N1T D;  2MOZ A;  2YIN A;  3O8Z A;  3L35 A;  4WY4 C;  2XAQ B;  2ZMA A;  3MKD A;  4UF0 A;  3RPU A;  2NWB A;  4TX5 A;  2XHE B;  3H3A A;  5JR9 C;  4V1A v;  1IK9 A;  3RL0 C;  4EYY R;  3VHL A;  4WY4 B;  4KHX A;  3N4X A;  1D1B A;  1T98 A;  5BU8 B;  5TAO A;  5AVX B;  2LOP A;  1XTC C;  1DH3 A;  5LNK A;  3RL0 B;  2KND A;  1S9K D;  3O1J A;  2BVM A;  4QWN B;  4ZOL E;  2HPC B;  3UT5 E;  2A72 A;  2PBI A;  5J2U E;  3LG7 A;  3H6P A;  2A45 H;  1URQ B;  2WWU A;  4HTE A;  1NAF A;  2C0W A;  1CSB A;  4C90 A;  4XA4 A;  4O9B A;  4YJ3 E;  3RYH E;  1D1C A;  3HUS B;  4AKI A;  1RE4 A;  1N86 A;  2ZFC A;  1SFC B;  3P32 A;  5AW0 B;  3ZYM A;  3NZQ A;  1JUN A;  4AUW A;  1U5P A;  2DI4 A;  2DWK A;  4TUY E;  3N9L A;  4NUU A;  4UEM A;  3V5U A;  2PJQ A;  2KOG A;  2E8I A;  4OK0 A;  3N2K E;  1U4Q A;  2EHO D;  2OYH B;  1B7T A;  2EHO A;  3RC3 A;  4A56 A;  2LKM A;  3HD7 C;  1S94 A;  3GN5 A;  5DJQ C;  3KV5 A;  3EUH A;  3RYF E;  3I9W A;  2LEH A;  1M1J C;  2NPS C;  1LTI C;  3A7O A;  2C9L Y;  3ZYL A;  3VYI A;  5LGT B;  2I59 A;  1HCI A;  2KB7 P;  1ZKE A;  1JCD A;  2VKJ A;  3AA7 B;  2W6A A;  2YKO A;  1SA0 E;  4UVA B;  1LTT C;  3C51 A;  5FXX A;  2JJ9 A;  2HPJ A;  5FY0 A;  3CPZ A;  3CX8 B;  5HWY A;  3RYI E;  3KIN B;  5HXE A;  3LIE A;  1VDF A;  4WW0 A;  3HA4 A;  4IIJ E;  4XAX B;  1HGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...