1OXZA

Crystal structure of the human gga1 gat domain
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
132
structure length
132
Chain Sequence
DEEKSKMLARLLKSSHPEDLRAANKLIKEMVQEDQKRMEKISKRVNAIEEVNNNVKLLTEMVMSHSQGGAAAGSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEILQANDNLTQVINLYKQLVRGEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of Human GGA1 GAT Domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords ADP-ribosylation factor binding protein GGA1
total genus 51
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03127 GAT GAT domain
A PF18308 GGA_N-GAT GGA N-GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1oxzA01
1.20.58.160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1oxzA02
2YO3A 1T2KD 3VMXA 5AW9B 1SP4A 3HE5B 2WPSA 3VMYA 3VMZA 2H7HA 1NWMX 2WPRA 1DH3A 3HE4A 2Z5IA 2XZRA 2BASA 2P7JA 1JNMA 2W27A 3V4WA 2XV5A 5APWA 1O3XA 3TNUA 1OXZA 3V5BA 1CI6B 3A3YB 4GKGA 1MFZA 5AW8B 2R3CA 2ZXEB 2WTYA 5AVVB 3A5TA 2C9LY 2R32A 1NAFA 5AW1B 5AVUB 4RESB 3V4QA 1MUUA 5AVTB 5AVQB 5APSA 1IO4A 4I6MC 5AVRB 5AW5B 1GZLA 1A02F 3MGNA 1FOSE 3HE4B 4AUWA 1H89A 5AVXB 2WWWA 3IR9A 3L35A 3NXSA 2WPQA 3VYIA 1YYCA 5AW0B 4C7NA 3M06A 5APVA 3VN0A 1WR6A 1JUNA 2P67A 2N2NA 1HUCA 1S9KD 3MD0A 1NWQA 3A2AA 5AVYB 1H88A 2N9BA 1A02J 2E43A 1FAVA 2R5BA 4M3LA 5APTA 4I2LC 5APYA 4B86A 2VRSA 3P7KA 1GU4A 4AYCA 1OWAA 4C7NB 4EOTA 4KHXA 2IPPA 2YO2A 3P32A 4XE5B 1GK4A 4LC1A 3P8MC 2E42A 1X79A 4DZOA 1GTWA 1T2KC 3L36A 1GU5A 3TK1A 3NTNA 5AW4B 2P2UA 5AW2B 5APUA 5AW7B 1HBWA 1CZQA 3UIAA 3L37A 1CI6A 1GD2E 2Q5UA 2Q3IA 3TYYA 4GT1A 1G2CB 3HTKA 1S9KE 1X8YA 3M9BA 1YD8G 3KQGA 1SLQA 2W6AA 3M9HA 1WRDA 2Z5HA 2N9DA 3M0AA 4C46A 3TNUB 1J2JB 3A7OA 3O8ZA 1CSBA 3OAKA 3KDPB 5AVSB 4JYBA 5AVWB 5AW3B 1HWTC 2QM7A 2ZFCA 2KP8A 2Q7CA 1KQLA 4JYCA 1HJBA 1GK6A 2QM8A 2YNYA 3M91A 5AVZB 2C9NY 3M0DA 3HE5A 3NMDA 3LIEA 1MV8A 2WT7B 5AW6B 2WT7A 3LIDA 2XU6A 5APXA 3I5CA 3VTPC 1FOSF 3B8EB 5APQA 5CMZA 4HYTB 1H8AA 3NFQA 4AQRD 3T97A 2R5DA 3SWFA 2JJLA
chains in the Genus database with same CATH superfamily
5CA0E 4YHHT 3WAJA 3VMXA 2K88A 3HE5B 3H1IE 1HX1B 3CX6B 2CLYB 2XZRA 3AA1B 2N1TA 1Y64B 2C0XA 1L0LK 1NTMK 3RRWA 4B3ST 2QJKC 1LWUB 1JTHA 2JQQA 4I7ZC 1NU1J 2CHOA 2FBWA 4EZ4A 4UB8H 4HE8A 2E8IA 3CC7P 3ZT6A 5LHIB 2IMLA 5AQVB 2MBGA 2A06G 4UF0B 1EXJA 4EB6E 1VQ5P 5KLVK 1ZHCA 4HWIB 5AW5B 3RIFA 3V5SA 1FOSE 2UXCT 3H1HE 1YIJP 3BRVB 2E74C 4F6RC 2XJ7A 5JVDE 3D0TA 3PHLA 3CWZB 3RIAA 5APVA 3QK6A 3UU5A 2XASB 2N2NA 5FL1A 5AQFB 3AAIA 2J58A 1W0AA 1GU4A 4C7NB 4EOTA 3AVRA 3CXHD 4H9OC 3L8RA 4JI6T 3L71E 2H89C 1SQBK 4UVBB 3EDUA 3PP5A 3F2EA 3A0HH 1UGOA 4PJJA 1P84D 2K1AA 3KV9A 1SQPE 4ASKA 2XQ8A 1FDIA 2FJEA 4DUYT 1HTLC 5LP6E 4DBRA 2QE7H 3B5NC 3KXDA 2IIUA 4WYVA 3KPEA 1IFMA 3A8YC 1Z0PA 1FS0E 5GTIE 2NR4A 3GWHA 2IYOA 5AW3B 2MOZA 2DHRA 1IZNB 2FYZA 3BVHA 1UIIA 4JYCA 1KMIZ 1LTTC 3M91A 3G06A 3RL0B 4LF9T 3L75E 5GTHH 3V2QA 3CX8B 4EEDA 1RF1A 3PLNA 1X79B 1HNWT 2YKSA 1USEA 3ESLA 3I5CA 4PK4A 1VL2A 2DI4A 1VQ4P 4UV8B 3CX5H 2ZM8A 2FYNC 4NPPA 1NTKG 3L71J 2YO3A 2I0MA 4GIWA 4AI6A 1T2KD 3M9QA 2WPSA 2FJBA 3CKDA 2FBWC 4WNKA 5HXRA 2FFDB 4JBWF 3HL6A 3CXHI 3SOLA 2FJAA 4C91A 1O3XA 4IDZA 5ADXL 3CWBJ 5BVZA 3Q5SA 3QOFA 2FY8A 4CN4A 1LGHB 2VKOA 4CZZB 4A97A 1G8XA 3CCRP 2V7KA 1X9VA 3CWBD 2GUVA 1L0NK 3ZN0B 2WDVA 1KQGB 4CXXA 3L35A 3CVRA 1LP1A 2OYHC 2H88A 2FYUE 1YTZI 3OKQA 1KNPA 3AE5A 2QA7A 2ODVA 3MD0A 1LWUA 4IREA 5AVYB 4JEUB 3OPCA 3HUSA 2VRSA 1VQ7P 1OWAA 3MA9A 2VL0A 3WI3A 4DIDB 1NH4A 1PP9E 1HX8A 4Z8XA 1AQTA 1M62A 5JR9A 1VQKP 3L36A 3TGUG 3FHNA 4DV2T 5GTIH 1R5SA 2P2UA 3H25A 3RYCE 1HH0A 1MNEA 3USSA 4PJ0H 4E7ZA 3MHVA 3RBXA 2KS1B 4P09A 3AEFA 4H9QC 2IBZD 1G2CB 3HTKA 1LVFA 5CBOA 2IW5B 3V2NA 2E75D 3A0HE 5KTBA 3C8VA 3AB3B 5AQKB 1EZVG 4ASVA 4GYRA 3O8ZA 3AA0B 1Q2NA 3NVOA 3KDPB 3LJCA 1IBMT 2IBZG 2BVLA 2OTJP 2AXTE 3TLUA 2KP8A 2X68A 4DV6T 1GL2C 3S4UA 3JCUE 2C5IT 1YKHB 3N9NA 3RKOA 2V7MA 3L75J 3WUUA 3K3NA 1RE4A 1OEDC 1HS7A 2OYIA 4B3TT 4YXWH 1U5PA 4XBFB 1JY2N 4A56A 1M1JA 3E1IA 2CM0A 5J2UE 3CX5D 3H1LJ 3NKZA 4NIQA 1IFDA 1L0LG 1NTMG 3AE4A 2X0YA 4TWDA 3RK3E 4HFDA 4MFRA 1BCCG 3AA6B 3L70J 4KUMB 5FYMA 1NHLA 2KSEA 3BCCG 4GKGA 1KEYA 2M3BA 1WCRA 2OGUA 3CL3D 2IZ1A 1OVVA 4RKUJ 3A5TA 1EDIA 2A06E 4DMVA 5C2TA 3B71A 1JO5A 1NAFA 5J2TE 4QKNA 5FKYA 2EHOC 3T8OA 5APSA 4L75A 1HG2A 3NRXA 2YK0A 3GF3A 3AEEA 3I9WA 4H0LD 3VYIA 3N2OA 2M8RA 2HR3A 4ZOLE 3KV4A 3CQXC 3PUQA 3ZT5A 1N36T 2BKOA 2V5DA 4JYAT 1IFIA 1YITP 2XAJB 1K9MQ 3QB5K 2E43A 2MTQA 2JDIH 3KINB 1FAVA 5DQWA 5GONE 5APYA 3TGUE 4WBNE 3ZCIA 5LJMA 1S2EA 1G1IA 4ADZA 1SVFA 3LG7A 1L4AB 2RPAA 1FMVA 1OIPA 2ZYAA 2W83C 4V1Av 4L76A 1EDJA 1W9RA 1KNRA 5AW4B 3AEGC 3SFEC 3N9PA 1S5LE 4OGQC 3U1AA 2YKPA 1XDOA 3E0ZA 3ZC0A 1LP1B 3A7MA 4OYKA 1VQNP 2PJQA 3F5HA 1L0NG 2NPSC 5JQGE 4ZHQE 4O2BE 1ZN5A 2N9DA 3TNUB 3WMM0 3CCUP 3ONXA 4N78E 2OYIC 2E76D 1RE3A 2OYHA 3L73J 4PK5A 1QVFO 3C4WA 1ZP0A 2M67A 1KQLA 1EZVE 4YY3T 4BXLA 1ZLLA 4HKAA 4N3YB 1KYOD 4G2AA 2WT7A 1NTKK 4I55E 3U3IA 3RBZA 3Q5DA 5LMNT 5F5WA 1R8IA 1L0LJ 1NTMJ 3NFQA 3RL0D 2PRRA 3Q5WA 1ZOYA 4U72A 2D2SA 3KYQA 1UURA 2W62A 3TKLB 5JDFA 4K3AA 2QJPC 1AJYA 4W7YA 4YHJA 2I6HA 3AEDA 3H1LD 2ACZA 3A0BE 5M1BA 2SPCA 2HPLA 2V6XA 4O8SA 5FNVE 4DR7T 1JY3O 4ISTA 2DCFA 3U1CA 3R4YA 2NPSD 3N9QA 2ZXEB 3RQWA 3OYZA 3P4PA 1YJWP 3HI2A 1KYOI 3RKGA 1KILC 2VVSA 1KFYA 3JC6C 1LWUC 1IO4A 2YDSA 3PDYA 1GZLA 1A02F 2BBHA 1J5WA 2RH0A 3HD7C 5HCMA 1BSHA 3T1HT 5CCHC 2N1TC 5L3FB 3PH0A 2KNDA 1JCCA 4C7NA 1ZRTD 1M7KA 4GYSA 5IYZE 4JV5T 1FIOA 1D0ZA 2N9BA 2XUEA 2LXCB 2Y48B 4YT0A 1BE3E 4QH1A 4CPGA 2NOXA 3L39A 2AXTH 3AEBA 2E42A 4KT0J 1T2KC 1PGPA 2BCCG 5IHYA 2WSSH 3Q3DA 5TISE 2X9HA 4OHFA 5LYJE 2JWDA 4O4HE 4COFA 3GA8A 3GF7A 3Q9DA 3BASA 4OK0A 2WZHA 3PU3A 2ZYDA 5HAXA 2Q5UA 2Y9YA 4H9NC 3BCCD 1JY3N 2IYPA 4GIFA 3ZMVB 1X0TA 1YW0A 2W0GA 5KXJA 2XTLA 1KILD 3ONLC 3F57A 1YHQP 3VHLA 3ZSTA 4EYUA 3Q1MA 3WUTA 5AQIB 1BDDA 2VQET 3AEEC 3C9IA 2DL1A 5KKZB 1T7SA 2C0SA 1HFAA 1JOCA 5KAFE 4C90A 1V9DA 5H6RB 1NENA 2Q9IA 2RA1A 5AW6B 1QUUA 5F8PA 5LGTB 3H6PA 2X0HA 3JAEA 1KK7A 4U7YA 3JAFA 1HCIA 4DOJA 5CMZA 2XQYA 3AVSA 3RI5A 2KOGA 3CX5E 2A2FX 5AQTB 4ILBA 4EIWA 5B66H 2R5DA 2JJLA 1GL2B 3RL0C 1KTMA 3ZN1B 1M56D 2XNXA 2L3LA 3CCMP 3OYXA 1YTZT 2CRBA 2D2CB 2W00A 3G3ZA 3TGUD 3V5BA 1YQ4A 2XSAA 1J1DB 2E76C 2KUBA 1FZAA 2NZ2A 2WTYA 3Q2YA 1BE3D 2ZT9C 2UXBT 2D2CC 1T72A 1LTGC 2IFNA 1P84I 1S1CX 2K24A 3RIUC 3ZMZB 4XA4A 3TLWA 3LBXB 5EK2A 1AVYA 1ZP0C 1YYCA 4EOZB 1S72P 2V7JA 4GODA 2QRXA 1GW3A 3L71D 4H13D 5CCGD 1MZ9A 3EFGA 3Q5RA 1LRZA 1PP9D 4WW0A 1YJ9P 4AYCA 2WITA 3N9OA 2IPPA 2GA1A 2LEHA 3VRBA 1YKEB 1BGYE 1PPJE 2JRKA 4DZOA 2P9BA 3NZPA 3HTKB 1G2CA 1D0YA 1DU2A 1URQB 1L0LD 1NTMD 5JDMA 5TJHA 3AEDC 4A5XA 4MALA 3AE3C 4ZKPA 1TU3F 1AA0A 1IFNA 4ZI3D 3ZLIA 5CA1E 1IFPA 3EDVA 1D7MA 3KFWX 2LR2A 5HWYA 5BR8T 3KVBA 5AQLB 3KZIE 2CLYC 3KV5A 1OVUA 3B13A 3VOPA 2FFDC 4DUZT 4OGQB 3FBZA 4DR3T 3FZHB 3AE4C 3CX7B 4O4JE 5JRCB 3N2KE 2LKHA 5B66E 2KK7A 2LHRA 3MTUE 1PL5A 3QC9A 1EZVD 4UF0A 2LKGA 3M65A 3SS1A 5AVZB 4L74A 1QVGO 1EZ3A 3VRAA 3ZC1A 2YKOA 5FY7A 1RF0C 3LW5J 3AEFC 2L5GB 1FE6A 2CCQA 1XWMA 4KHZF 4YTPA 1S94A 4PD4E 3ZJ1A 2JP3A 2Y9ZA 2UUCT 3RK3D 1Z8UA 2VQFT 1T8ZA 4JEHB 2KT9A 3SFDC 4TV9E 4I0UA 3HUSB 4JQ0D 2H7HA 3AE6C 2ZAEB 5CJ0A 4U3FG 4WY4D 1KB9H 2W27A 1XDPA 4IHJE 2POHA 1JMBA 2GK9A 2XV5A 2KINB 2LE8A 1MKMA 3A3YB 4ZKUA 4TNVA 2VKHA 2E74B 4NPDA 1MFZA 1WR0A 2DWKA 2MKVA 4JBZA 4WBOA 3L74G 2VK9A 1L2PA 2QJKB 5AVQB 3UTKA 1QGKB 3VKHA 2W4XA 4PJNA 4IGUA 5AVXB 3QB5A 2X51A 2IBZI 2PTFA 5JDNA 4LFBT 1US7B 2W67A 4U3CA 1KILA 3IF4A 2H7VC 1PP9G 2YXRB 1H88A 4AQGA 4B86A 1Y8AA 5B5EH 5AQOB 3JCFA 2OV9A 2X67A 3EQ2A 4Y99B 1NTZD 2Y0EA 3R84B 3SFDA 4JI4T 1X79A 2J62A 1NJIQ 2GUSA 2VL8A 4A7PA 2ZXXA 1M1JB 4D6TD 2XY8B 5APUA 5AW7B 2FJDA 3GMIA 1HBWA 4KI0F 5AQNB 1N32T 1HGVA 4W7ZA 2XHEB 2DW3A 4H44D 2BKNA 2D9DA 2H89A 2OA5A 1WMKA 3ZJ2A 5L2LA 1N34T 1IK9A 5CBNA 5KAFH 2X9WA 4GOUA 3KQGA 2WDQA 3Q5XA 1EQ7A 4PFPA 1FZEA 1ZOYC 4LF6T 2J1DG 5LG4A 2Q9QD 1FJGT 1AVOA 4CXWA 1LT1A 2KI7B 3SRZA 3MIWA 1CHUA 4IL6E 4ZS2A 3AEAC 1BR1A 2IBZE 2KLVA 3L74E 3C1LA 3G4SP 3VP8A 2AXCA 3NMDA 1SFCB 2W61A 1QLED 2NWBA 2JEEA 1PV3A 3B8EB 3OW2O 1E5WA 1SQXD 5EFWB 4D6TJ 2YINA 3OA7A 3AAEB 4QHOA 1QEXA 2ZM6T 1CUNA 3ZMUB 3RRCA 1OEDE 3VMZA 1FZCA 1DH3A 1U57A 3N4XA 3SSUA 1UK5A 2P7JA 4U7JA 1LTJA 4J2CA 4DR4T 4ZI7E 3CCLP 2XPKA 3DTOA 3CQCB 1WFDA 4AKGA 3TNUA 1NTZG 2CWOA 1CI6B 2N1TB 2C0WA 4HFVA 1VOMA 2ZM2A 5BU8B 3CXHH 2C9LY 1BR0A 1LVKA 2JR8A 5CHXA 3HA4A 3D71A 1VQ8P 2ES0A 3GMAA 3L73E 2V7IA 5F3JA 4UVCB 2FYUG 3P8CE 2V7QH 3PU8A 2A06D 1WR6A 3A5XA 2DLRA 2KIKA 5L8RJ 1FBMA 2MPKA 1L4AA 4PW8A 2ZVOB 2IFMA 4H13C 2HN1A 2R5BA 3A0BH 4I43B 3O1JA 4WWIA 4IE4A 1RHZB 4H0LC 4AQYT 3AE1C 2CE7A 4DV7T 4X1KE 3FB2A 5CJ5A 2L8KA 1IK7A 5DJTB 3EFFK 2K9JB 3H32A 1GU5A 5KAIH 3NTNA 3HD7A 2BCCE 1X9BA 4U3FD 4AIUA 5H2FH 3I0OA 2YU1A 4HFEA 3P7IA 2MJZA 3ZCJA 1IC2A 3L70D 1LKXA 4EAHA 1ZEEA 3EHZA 3TYYA 1Q90D 4HFHA 1AFOA 5KJ7C 3ANWA 2ZM0A 2XQ5A 3E22E 1MNDA 2XZEA 2IUBA 4H9RC 3UULA 2K3WA 1SUMB 3L72G 2Z5HA 3O4XE 1KYOE 4JUYA 5L3CB 4I7ZB 4IFDK 3JC6D 5FVLA 4E7SA 1Q82Q 4XAXB 5H2FE 3PTRB 4ZZCA 2BG9B 3R2PA 2Q7CA 1HJBA 2FYNB 1GK6A 1OZHA 1N7SB 3M0DA 5E0OA 4BRYA 2CPSA 2CXLA 2CPBA 1SQQD 1SQQJ 2XQ9A 1MMNA 1P84E 4WZXA 4F8HA 3HKCE 3HKDE 4G63A 1D1BA 3VTPC 4JI5T 4ZZBA 5KKZC 1NGMB 4H44B 3H1LE 2QEXP 1CW5A 4HGAA 1FZFA 4D6TE 3SWFA 1S9KE 4BA9A 1ZKEA 4GK0E 1U7MA 1ZR2A 2QSIA 5AW9B 3AE7A 4HN9A 1W2EA 1RE4C 1NKZB 1SHZC 2HH7A 1SQPK 2JPFA 1Y9BA 2NPSB 2LSKA 1Y47A 3L70E 2VURA 1NTZJ 2EHOB 3AE8C 4IL6X 2R3SA 2Y0CA 4NUVA 2Q1KA 4TWFA 1NU1K 4P0BA 2OYHB 5BU5A 3ZMSB 4ILCA 3RYHE 4DV3T 2HODB 5AVTB 3H1KE 2J47A 5AQGB 1SFCC 1YQ4C 5LBQB 5LGUB 3OJAA 4UIGA 2WSFH 3HE4B 3B4SA 2IHR1 1XNRT 2K9YA 1LT9A 4EDFA 1BSNA 2Y6XA 5DJUB 4L5GA 4PFOA 4UELA 3UUBA 2W8ZA 4QMAA 2W63A 1VQMP 3L73G 3A2AA 3TGUJ 3ZYMA 3MUDC 2QYWA 2ZVNB 3P7KA 1S5LX 5H6QB 2N1TD 4W80A 4KHXA 4KBMB 5JDGA 3RIUA 2V7LA 1N73B 4U7IA 3RHWA 2JQ9A 5AW2B 2BEZF 4JI2T 3AE9A 2CHNA 3MACA 3ZDMA 4KJMA 2NW8A 4Y99C 3KBTA 4UV9B 3GW6A 3PE0A 2B76A 1G1JA 3AXJA 2IX7C 2NTYA 1N73C 3GHGC 4YTPC 4P1NA 4X64T 3I0QA 1X8YA 3G71P 3H1KD 3ETUA 3PUZF 4DO0A 3R6NA 5K5GB 1OW6A 3RL0g 1FZBA 5KLVD 1FZCB 3AE2A 4UVAB 1FJPA 2RN0A 4QXHB 3RYFE 2K9AA 2FYUJ 3GHGB 3SWYA 4DV1T 4TV8E 2NPSA 5M4YA 1SQXJ 1WRGA 2A9UA 2LOPA 4XFJA 4YSXA 2YNYA 1SQQG 4EV6A 2WDRA 2BBJA 1IBLT 4MLKA 3LW5H 1FZCC 4X1YE 2XU6A 2JWAA 4IE0A 3UU6A 5B5EE 2BCCD 4ASWA 3MJXA 4HWHA 3KVAA 5LCYA 2J59M 1HGZA 1BGYJ 3AE8A 1SQBD 1KFMA 1JEKA 1HF9A 2BG9A 1RQUA 4IOIH 4O4LE 2PP6A 1NKNA 4PAGA 2D0UA 4IDPA 1MIYA 4OVNF 2WZIA 1NTZE 2FXOA 2W90A 2OYOA 2OTLP 3LBXA 4EYYQ 3H1JE 3C4ZA 1FEWA 5AW8B 3CCQP 4HFBA 2KZ7B 2B9BA 2OQQA 5IUXA 3BRTB 1T6AA 1JM0A 1N7SA 2X9XA 1ZMEC 5TISH 2Z4EA 4HWDA 2E9XB 3UQ4A 3CC2P 3CQGB 2DNXA 1KB9E 3O6QA 1LJ2A 3UUMA 1RE3C 1Q7YQ 2X0LB 3ZSSA 3IEEA 4EEBA 3MK7C 3AECC 2KSJA 5AW0B 2KLQA 3M06A 1S35A 3T97B 4U31A 1S9KD 4DV5T 4GOFA 1BE3J 2BVMA 5ABEA 2KZIA 4PD4H 4TN7B 2XNDH 1W09A 1EZVI 2YN6A 2LJLA 4DR6T 3UU4A 3RC3A 4I50E 2K9JA 2YIUB 3H32B 2JKVA 1FZGA 1L0NJ 4LF8T 2HPCB 2CBIA 2XM2A 1SQVD 2M0BA 4EYYR 5HXHA 4H44C 1YQ3A 2IC6A 4GOEA 3RC8A 2Q9QA 2XAGB 2MYSA 4U74A 2Q3IA 5ETWA 5L3EB 3BCCJ 3BQLA 2FYUK 3ZMTB 2LOSA 2Q9QB 2QJYC 4H9SE 3D70A 1JTHB 3PUWF 2LSIA 1DD3A 3CMAP 3TF5A 2JO1A 3Q5PA 3RGUA 1J1JA 1T8BA 2IZ0A 3CK6A 1SQQE 3HE5A 4OFZA 1OW8A 4HB1A 4KX6A 3I9YA 1MFTA 3VU7H 2GM4A 1H0TB 3UFGA 4HYTB 4R4MA 2JIWA 3T97A 5LMUT 4K0KT 1FC2C 3VMYA 4AKRB 3H3MA 1RF1C 1NWMX 2P58A 3O6QB 3PUYF 1HF8A 1IFJA 1BCCJ 1VDFA 2C5JA 3FZFB 3EAMA 3UU8A 2EHOA 5J0ZA 1AQ5A 5LG3A 1OEDA 4PV1B 3OVUA 1VQPP 4C7RA 3H1JJ 3H1HG 4DT0A 4U3FE 3C4XA 1OW7A 3PURA 1M1JC 2BEQD 3RX6A 3H1KG 5AVUB 1NVOA 2I59A 4LFCT 4QX7B 1IBKT 2E5LT 3AE2C 4H13B 5HXSA 2W66A 1KYOH 1MMGA 2W2UA 1W5CE 2WU5A 2WB5A 3NBXX 4JI3T 1LTBC 2L91A 3RK2C 2P10A 1Q86Q 2HPJA 1IJ5A 4HFIA 4DV0T 5AQMB 4M3LA 2OYIB 3JSVC 2C5KT 3AEGA 1BDCA 1XNQT 1QL2A 4XE5B 1GK4A 1J1EC 3W15B 3GN5B 4DR2T 2NP9A 3GHGA 4NUUA 4WVZA 1KNZA 2BDEA 3ANWB 1DIPA 3AAAB 4JF7A 3IA3A 3ONJA 3W68A 3RPUA 1BCCE 2XKMA 5LGNB 5KX5E 2FUPA 2ZLYA 4UEMA 4U3FJ 1PZQA 4FI5A 4YTMA 4TLFA 4CI1B 3PRJA 1YD8G 1WYCA 4U2YA 2NW7A 1SLQA 1KC8Q 1JNRA 2H7OA 2O01N 5KLVE 5ABFB 3AA7B 1UCUA 5A1LA 1P84H 5KDMC 1HWTC 1SQXE 2XQ3A 2UXDT 4JI1T 1VQLP 4PNIA 4JPZB 5HXEA 2NRGA 4IFMA 5KAIE 3FZLB 2X9YA 3RK2D 2J4GA 2K5BB 2E5YA 2YDQA 3LIDA 4MN4C 1URQD 3K3QC 2HYNA 4ZNCA 4ZMDA 2ITAA 4AISA 5KJ7A 1M90Q 2WSCH 5APQA 1S5LH 3CCSP 3IN6A 3OTOT 3G9RA 4Z90A 1NAYA 3C50A 4BAYB 2AEFA 3N5LA 3MP7B 4N78D 4GKKT 3P4RA 3HE4A 4AKHA 2LSGA 2H88C 2Q3EA 1JNMA 3IHRA 5LHGB 4ZI2D 4CXYA 2WMMA 1KD1Q 4QXBB 5JRCA 1OXZA 3H1JG 2JMHA 3RH3A 4IDOA 3AE6A 2CXDA 1RY3A 5L3DB 2R3CA 5JH7E 3CPWO 2BG9C 3AECA 1UX5A 2WM9A 3OBVE 3C51A 1QSDA 1SQVJ 2HLOA 2M5AB 1SE7A 4P0AA 4IL6H 2VASA 3CI9A 1MUUA 5ABFA 4UB6E 1W0BA 5TAOA 2LRLA 2IDOB 1KB9D 5AQSB 4O2AE 3WAKA 1URQA 2WPQA 1N7LA 4YJ2E 4YSYA 1JY2P 5LJNA 1XZYA 5JTGA 4IT4A 5C8YE 1SFCA 2R44A 1USDA 2B1EA 3O1IA 2YDRA 1VQOP 1Z56A 1NWQA 3E1RA 3K1SA 4I2LC 2E75B 3CCVP 1QX8A 5AQJB 2BG9E 3F89A 3LFMA 4FJOA 3NWIA 3D6ZA 4WB4A 3P32A 4ZEYA 1XMOT 3EWKA 3HR0A 3ZEFB 3T1YT 2H3RA 1LT9C 5CCHA 2BCCJ 1Q81Q 5EZYE 3UIAA 3B5MA 3HKEE 1MMAA 2BS3A 2JMKA 1D1AA 2AEJA 3CWBE 1VPCA 3H1KJ 3K5BA 3RLFF 2PGDA 2UXXB 1SFCD 5LNKA 5KLVJ 3UU3A 5C39A 2KS1A 3H1JD 1VRBA 5AQRB 4JYBA 2MAWA 1WYBA 3I55P 1JY3P 2UUAT 1S3JA 3B5NB 1KQSO 1J1EB 3EABA 1OFCX 2WT7B 5GTHE 3LK3B 3L09A 2BKPA 4I1LA 5FXVA 5FMNA 1PGQA 1KILE 2XAFB 3VR8A 4N6JA 1KZUB 2W6JH 3H3AA 1SQPG 4CN6A 5E79E 4IE5A 4TT3H 5FP3A 3H1IJ 4LF7T 3FZMB 2KLUA 4Z1MH 2L9QA 2PAJA 1AJ3A 2W6BA 5C3JA 5HWXA 1L0NE 3UT5E 3V4WA 1NTKJ 3L71G 2WZ7A 2G8YA 3CCEP 3AE7C 1FDMA 2K48A 3K8PC 3PUGA 2WBLA 5AVVB 4H9PC 3H1HD 2HPCA 5KLIB 4AKIA 3VMAA 2XSBA 4LFAT 4PD4D 2LM2A 2K37A 4I6MC 5AVRB 4ILAA 5KMGP 3E08A 3QUJA 2WWWA 2UUBT 5CFBA 3H1HJ 3SFEA 1EC5A 5FVKA 1VQ9P 3L75G 4YPCA 2KNCB 2RMZA 1NTKD 4Z91A 2CWYA 4OH8B 1KN7A 4IL4A 3X1DA 1QL1A 4OX9T 3CPZA 4HJGH 1HVVA 3H1LG 2RP4A 2O3JA 4IE6A 4X65T 4LC1A 4PV1D 3MZWB 2E9XA 2V5CA 1GTWA 5JDQA 3P50A 2XQ4A 3GN5A 3RGLA 1SQPD 4CN1A 4GKJT 3W67A 4CQIA 3S4RA 3GG2A 3B5NA 4L0RA 1B7TA 3ABVC 4A98A 3WU2E 2ZJSE 1ZV4X 3RQUA 5DJQC 3FWLA 1DEEG 3RK3B 1LNQA 2E5VA 2SPZA 4YXDC 4IDQA 4HTEA 3ZYLA 5KLVG 4ZI2C 1VF5B 5EK3A 1HR0T 4DJGA 5AVSB 2D5UA 3N2GE 5AVWB 2LSYA 2PFVA 4B3RT 3JCUH 2ZFCA 3ETVA 1K04A 2PG8A 1MIVA 2VWAA 2VKDA 3N7NA 3IAOA 2YIUC 2WVRA 3FZKB 1FOSF 4OWFA 4HFCA 1H8AA 1N33T 2XQ7A 5DQVA 1YI2P 1L4AD 2CMRA 3FXDB 1MIWA 2Q6QA 3WU2H 4DV4T 3CC4P 3LSVA 1K73Q 4ANJA 1OX3A 3DP7A 4X62T 2BASA 4NPEA 3Q2MA 4IDNA 4AQFA 3MXZA 4LMLA 2V1DB 4UXNB 2KSRA 3ZYKA 5CJ4A 2QIWA 2KNCA 1RF0A 3BCCE 4RJTA 3HD7D 1FJKA 3AXJB 3FBLA 4H63V 1T98A 3RF1A 3CMEP 1YBKA 1DEBA 3L72E 4HEAA 3SWHA 4YTNA 3QNUA 4WY4C 3PUVF 3KBUA 5FXXA 3F31A 5JR9B 4DR1T 3C98B 2N9YB 1J1DC 2Z6EA 1JMMA 1SQVG 2V7QJ 3TSIA 3UUNA 2ACXA 1UUSA 1FMWA 3FX0A 3LK42 2WSEH 2D0TA 2NTXA 5LOVE 2QJPB 1URQC 3ABVA 4TUYE 3KHUA 2OTKE 3PUAA 1XMQT 3SWKA 3RK2B 5LBMA 1ZW0A 3TK1A 3FWNA 3CWBG 3PUXF 4IE7A 4QX8B 4BWNA 3K3OA 2Y0DA 2E9XD 3ZKRA 2KZJA 4OYJA 5FY1A 1NU1E 2RKLA 1OVRA 2YEVC 5AFUL 2I1JA 1RQVA 1N7SC 2KYVA 1SQVE 3N9LA 3V2RA 4C46A 1HNZT 1D0XA 5LA6E 2DWGA 4U2ZA 1L0ND 2IC9A 1PIXA 3UFEA 2UU9T 2WWUA 4H0LB 1J5ET 1SS1A 3PV0F 4L73A 4QXCB 2QM8A 5KLIC 4ERRA 2WSFJ 2OARA 3LIEA 2NW9A 3FXDA 5E79H 1E2AA 2HFED 4CI3B 5L4EA 2ODUA 4U33A 1PFIA 2WQYA 2B89A 4AQRD 2LKMA 1PPJD 1BGYD 3EI0A 3BATA 5CB4E 4D6TG 1NTZK 4BJNA 3L75D 1SP4A 2A45G 3IF8B 1ZRTE 2AE9A 2WWVA 2Z5IA 4K35A 1QLBA 4IFFA 3AEAA 4UR9A 5HCJA 1SQVK 5HEOA 1NTKE 1SQBE 2I8DA 2YMYA 4RO0A 2CBJA 3VP9A 1FDOA 2A45H 2P1JA 1EDLA 4KMCA 1SQPJ 2FYUD 2CXFA 4LF4T 2PFXA 3J9X1 2R32A 5AW1B 3L72J 2CK3H 2H8PD 4RESB 3V4QA 1NEKA 2FXPA 1OMIA 3VKGA 1JNZA 1OEDB 2R6GF 1G73A 1H89A 2V6YB 3TDKA 3NXSA 5FXZA 4GK5E 5JDHA 2M5AA 4TWHA 5HXCA 1U4QA 1XTGB 2CA5A 5FL0A 2UXNB 2IDBA 3B57A 1LTJC 3VN0A 2LHNA 2F4VT 5FXWA 3L74D 3LDQB 1JUNA 2O1JA 4UB6H 3ITKA 1JCDA 4ISSA 1A02J 1VF5D 2KWIB 2YXQB 4WBAA 3HD7B 1EDKA 5HYAA 2JQKA 1SQXK 4ILUA 4X5TA 1ZR4A 2I1KA 2ZMAA 1UIXA 4TNWA 2E2AA 3P8MC 2JJ9A 3H37A 4EGWA 3L73D 2BZBA 1AV1A 4O9BA 3P8CD 5LHHB 5AQUB 3P4WA 2N1GA 1CZQA 3KZIH 4OGQD 3L37A 1R8EA 2HN2A 2LRKA 1CI6A 4YFSA 4LF5T 3IBPA 2WP9A 2WMNA 2M6IA 4GT1A 5HEGA 1SQXG 4HWCA 3M9BA 1M1KQ 3VR9A 3M9HA 2VKJA 3MKDA 1J2JB 4TZ4C 5L47A 1GMJA 3OAKA 1M7LA 2EHOD 1E7PA 2WSEJ 3KV6A 3O1HA 2M3EA 4I4TE 1N7SD 3RK3C 2FFDA 1K05A 3J7Yq 2D2CD 4GDOA 2HODA 3NZQA 4CI2B 2XAHB 1VF5C 1N8RQ 4JLEA 1PGOA 2M6BA 3PJAA 5L3BB 3S1KA 4PJMA 4QWNB 1NTME 1L0LE 2CPTA 1JY2O 5IWAT 4XZCA 2WPRA 2K3RA 3H1ID 1W2BO 3RYIE 2V6YA 3L3PA 2YKQA 2FXMA 4EI2A 4X66T 2HG5D 1VCTA 4BJMA 4AXPA 3M0DC 5APWA 2IAKA 4O4IE 3I56P 1SQBJ 2WPVB 4LMJA 1KORA 1KQFB 1RF1B 3MUDA 2G3AA 3JC22 3UQ7A 1LTIC 2QA4P 2B88A 3CCJP 5CCGA 2G0UA 2J5UA 4LGDE 4LLHA 4HWFA 2X66A 2LXBA 4M1PA 1I6ZA 3E7KA 4AUWA 5AQQB 1VQ6P 2FKWB 3IR9A 2VB6A 1L0VA 4DCKA 1JB0J 4DVDA 3AE9C 1GL2D 4X1IE 5ABGA 3AEBC 1SQQK 1HUCA 2Y8DA 1X22A 1BR4A 4PJ0E 2XDJA 3I1AA 3ZPOA 4DMWA 1LTAC 4KHPT 2WQYC 4PK6A 4YXDA 4YLHA 2E5TA 4PJLA 2YO2A 4B3MT 4DR5T 1UX4A 1PPJG 1BGYG 1M57D 3PJSK 4AKLA 3HKBE 1DD4A 1ZXGA 3PTZA 1ZV8A 5LXTE 3EVYA 3BQKA 2ZYGA 5AQHB 2ZT9D 4YJ3E 1H0TA 1HJ0A 1GDTA 1KILB 1T3UA 1IJDB 3QWOC 2KXPB 3M3ZB 1PGJA 2E9XC 2XQAA 1GW4A 1GD2E 1NU1D 4KP3C 3TLSA 2E74D 3HUSC 4ZI3C 5FY0A 1YXRA 1T3JA 3O9XA 4MHCA 1GQEA 4NXMT 3B5ND 5CCGC 3PUSA 4QH4A 4Q25A 5LB7B 3A7OA 3U59A 2WMOA 2XAQB 1CSBA 3HRNA 2PBIA 4JI0T 4JI7T 2QM7A 3KDSE 4L9IA 4HKZH 3GLMA 3FXEA 1U7JA 3CD6P 4LMKA 3BQIA 4PD4I 2A3DA 2C9NY 4IIJE 1MV8A 1M8OB 1N73A 3TLTA 1LT9B 1WT6A 2XM1A 4K0UA 3MZKB 3FXEB 2WY2A 2V26A 1LTJB 1N86A 4QH5A 3L4FA 2UWJE 2O1KA 5DABA 4PV1C 2OLTA 3V5UA 2KMFA 1VCSA 1E1HB 4NPFX 4ZXLA 1K8AQ 2E75C 2ZT9B 3CXHE 4DBQA 3FGAD 4R4LA 2O01H 1Y01A 3L72D 4TX5A 4EZHA 1L4AC 5L4HA 2QG4A 2A72A 5BMVE 4HH2A 5HEHA 3OJAB 3CMLA 4B6XA 1NU1G 1XTCC 4MBQA 3UUXB 5CCHD 2AXDS 3AE5C 3CIRA 1KF6A 2VVNA 1FU1A 4X20E 5J1GA 3MGNA 1LTSC 3IFMA 3CLQA 2KWHA 3P4QA 2YMKA 4YSZA 4Y28J 4AQFC 4JI8T 3L74J 4NXNT 2Q9QC 2QJYB 4BRYB 3G6EP 3LK2B 2P67A 4IL9A 3V6IA 5AQPB 5JR9C 2LT3A 2B87A 2LM9A 1KB9I 5APTA 3QH9A 1YJNP 1BE3G 1IAPA 1YQ3C 1SA0E 4WY4A 1D1CA 2WAUA 3AE3A 1WLXA 5HEJA 3JADA 2LLYA 1DX7A 2E76B 5JREA 1PP9J 2XQ6A 5KJ7D 3Q5EA 5HEUA 3V2PA 3P4SA 1KV4A 1NOHA 3C64A 1EXIA 2V4HA 4WY4B 1BCCD 1HG5A 2QGSA 1SQBG 4DNDA 3H1IG 2B87B 1NO4A 2QVAA 1RH5B 2A45I 3DJBA 3ZT7A 1R5LA 3TLVA 2CEAA 3PJAJ 3D6YA 2HHHT 5CGMA 1E79H 4EIJA 2WSSV 4ZS3A 3S9OA 2V8SV 2W6AA 3II6A 3AE1A 3NRYA 1WRDA 2YU2A 3M0AA 2WU2A 3BK9A 2WCAA 1NYHA 1N2DC 3CX5I 1KFNA 2LSJA 1HNXT 5ABHA 4UB8E 5L3GB 1I94T 2H43A 1MMDA 4EXTA 1S4XA 2JQHA 1IJ6A 2WS3A 2O01J 1BR2A 2KB7P 1H7CA 2YOEA 3N9MA 2BS4A 5APXA 5JDLA 5EK4A 3EUHA 2BS2A 2WSCJ 3L70G 1HTJF 3U78A 2AEMA 3WUVA 1GL2A 4H63H
chains in the Genus database with same CATH topology
1GL2B 2CMRA 3FXDB 3RL0C 1MIWA 5CA0E 3WAJA 3VMXA 3HE5B 3ZN1B 1KFMA 3CX6B 4ANJA 2CLYB 2XZRA 3AA1B 2N1TA 3DP7A 2XNXA 2BASA 2L3LA 2PP6A 1Y64B 1NKNA 4O4LE 2C0XA 1L0LK 1NTMK 3OYXA 1YTZT 3Q2MA 4AQFA 3MXZA 3RRWA 2V1DB 4PAGA 4UXNB 2D0UA 3ZYKA 5CJ4A 1MIYA 1HS7A 2W00A 1LWUB 3G3ZA 1JTHA 3V5BA 2JQQA 1RF0A 3LBXA 3FBLA 3HD7D 1FJKA 4H63V 3ZMSB 4EZ4A 1J1DB 3C4ZA 1T98A 4HE8A 1FZAA 1FEWA 5AW8B 2E8IA 2WTYA 2KZ7B 1DEBA 5LHIB 2MBGA 3BRTB 4HEAA 3SWHA 1N7SA 2X9XA 4WY4C 4UF0B 4EB6E 2Z4EA 1LTGC 2IFNA 2K24A 3KBUA 5KMGP 5FXXA 5KLVK 1ZHCA 3F31A 3ZMZB 5JR9B 5AW5B 2E9XB 3C98B 4XA4A 1FOSE 3CQGB 2DNXA 3LBXB 3V5SA 1J1DC 3BRVB 1RE3C 3UUMA 4F6RC 5EK2A 2Z6EA 2X0LB 3IEEA 3D0TA 3CWZB 3MK7C 1JMMA 5JVDE 1YYCA 2KSJA 5AW0B 2KLQA 3UUNA 3TSIA 3M06A 5APVA 3QK6A 4EOZB 2ACXA 1S35A 2V7JA 1GW3A 2XASB 1FMWA 2N2NA 5CCGD 3LK42 4X20E 1MZ9A 3EFGA 1S9KD 5EZYE 2WSEH 2D0TA 1LRZA 2BVMA 2NTXA 5LOVE 3AAIA 1URQC 2J58A 4WW0A 1GU4A 4AYCA 4C7NB 2WITA 3N9OA 4EOTA 4TN7B 2IPPA 3AVRA 2LEHA 4H9OC 4TUYE 1YKEB 2LJLA 3PUAA 2JRKA 1SQBK 4UVBB 4DZOA 3RK2B 3EDUA 3RC3A 2P9BA 3NZPA 3TK1A 5LBMA 3PP5A 3H32B 4I50E 3HTKB 1FZGA 1G2CA 1D0YA 3F2EA 2HPCB 1URQB 4IE7A 4EYYR 4PJJA 4QX8B 5HXHA 5JDMA 3K3OA 2IC6A 3KV9A 3RC8A 2Q9QA 4ZKPA 2E9XD 4MALA 4UIGA 4ASKA 1IFNA 2XAGB 3ZLIA 2MYSA 4ZI3D 4U74A 2Q3IA 3EDVA 3KFWX 4OYJA 5ETWA 5FY1A 5HWYA 5CA1E 3KVBA 3BQLA 2FYUK 1HTLC 2CLYC 3KV5A 3B13A 3VOPA 2FFDC 3ZMTB 3B5NC 2YEVC 4DBRA 5AFUL 2I1JA 2LOSA 5LP6E 1N7SC 2KYVA 2Q9QB 3KPEA 1IFMA 3FBZA 1Z0PA 4H9SE 3N9LA 3V2RA 4C46A 1JTHB 3GWHA 3CX7B 4O4JE 5JRCB 3N2KE 1D0XA 5LA6E 2DWGA 2LSIA 2IC9A 5AW3B 2MOZA 3UFEA 2LHRA 2DHRA 3MTUE 1IZNB 2WWUA 3QC9A 2FYZA 3BVHA 4QXCB 4JYCA 2QM8A 4UF0A 1LTTC 3M91A 5AVZB 3M65A 3SS1A 3RL0B 3V2QA 1EZ3A 3HE5A 3CX8B 3ZC1A 4ERRA 2YKOA 3LIEA 1RF0C 2OARA 4OFZA 5FY7A 2NW9A 2HFED 3I9YA 4CI3B 1RF1A 2ODUA 1X79B 2L5GB 2CCQA 1PFIA 3ESLA 3I5CA 2GM4A 1S94A 4PK4A 3VU7H 3ZJ1A 2DI4A 4HYTB 3RK3D 4UV8B 1T8ZA 4AQRD 2ZM8A 2LKMA 3T97A 5CB4E 4AI6A 3BATA 2YO3A 4GIWA 4JEHB 1NTZK 2KT9A 1T2KD 4BJNA 3M9QA 4TV9E 1SP4A 2A45G 2WPSA 3VMYA 3HUSB 3IF8B 2H7HA 4AKRB 1RF1C 1NWMX 3CKDA 4WNKA 5HXRA 2Z5IA 1HF8A 2FFDB 3HL6A 5CJ0A 4IFFA 1SQVK 4WY4D 2W27A 3SOLA 1IFJA 2POHA 2GK9A 4IHJE 1VDFA 2XV5A 2YMYA 2C5JA 4C91A 1O3XA 3VP9A 2KINB 2EHOA 2A45H 2P1JA 4IDZA 5ADXL 2LE8A 4KMCA 5BVZA 1AQ5A 3A3YB 4ZKUA 2VKHA 1MFZA 4C7RA 2CXFA 3C4XA 1LGHB 2DWKA 3PURA 1M1JC 3J9X1 2R32A 4WBOA 5AW1B 3V4QA 2H8PD 4RESB 5AVUB 2VKOA 2VK9A 3RX6A 4CZZB 2I59A 3VKGA 4QX7B 1G8XA 2V7KA 5AVQB 1X9VA 3UTKA 5HXSA 3VKHA 2GUVA 1L0NK 3ZN0B 4PJNA 1G73A 1H89A 5AVXB 1MMGA 4IGUA 4CXXA 3L35A 3NXSA 5FXZA 3CVRA 2OYHC 4GK5E 5JDHA 5HXCA 2X51A 1U4QA 1XTGB 2CA5A 2UXNB 3B57A 5JDNA 1LTJC 1YTZI 3VN0A 2LHNA 3NBXX 3OKQA 5FXWA 1US7B 1JUNA 1KILA 1LTBC 2O1JA 2ODVA 2H7VC 2QA7A 3MD0A 3RK2C 5J1GA 1LWUA 5AVYB 1JCDA 1H88A 3HUSA 1IJ5A 1A02J 2HPJA 4JEUB 2KWIB 4ISSA 4AQGA 4M3LA 4WBAA 3HD7B 2OYIB 5HYAA 4B86A 2VRSA 2C5KT 1SQXK 4ILUA 1OWAA 3PDYA 1ZR4A 2I1KA 2ZMAA 2X67A 1QL2A 3EQ2A 4Y99B 3MA9A 3WI3A 4XE5B 1GK4A 1NH4A 1J1EC 3R84B 3P8MC 1HX8A 2JJ9A 1X79A 4Z8XA 3H37A 3W15B 2BZBA 3GN5B 5JR9A 2NP9A 3GHGA 3L36A 4NUUA 2GUSA 3FHNA 4O9BA 2VL8A 1KNZA 3P8CD 2P2UA 2BDEA 3ANWB 5LHHB 3AAAB 3RYCE 1M1JB 1HH0A 4JF7A 3RPUA 1MNEA 5APUA 5AW7B 2N1GA 3GMIA 1HBWA 1CZQA 1HGVA 3L37A 4W7ZA 2XHEB 4E7ZA 2XKMA 1CI6A 5LGNB 2OA5A 4YFSA 4P09A 3IBPA 5KX5E 2ZLYA 2WMNA 4H9QC 4UEMA 3ZJ2A 4FI5A 5L2LA 1IK9A 1G2CB 4GT1A 3HTKA 1LVFA 2X9WA 4GOUA 2IW5B 3M9BA 4CI1B 3V2NA 3KQGA 5KTBA 1WYCA 1YD8G 1EQ7A 1SLQA 2NW7A 3Q5XA 3M9HA 1FZEA 4PFPA 2H7OA 3AB3B 2VKJA 3MKDA 2J1DG 3AA7B 1J2JB 1UCUA 4GYRA 5LG4A 3O8ZA 2Q9QD 3AA0B 4TZ4C 5A1LA 3OAKA 2EHOD 1M7LA 4CXWA 3KDPB 3LJCA 3SRZA 5KDMC 3MIWA 1HWTC 3KV6A 3O1HA 4ZS2A 2BVLA 4I4TE 1N7SD 3RK3C 2FFDA 1BR1A 4PNIA 2KLVA 2KP8A 3J7Yq 5HXEA 2X68A 2HODA 4IFMA 1GL2C 1L4AD 2X9YA 3VP8A 3RK2D 3NZQA 2C5IT 3S4UA 3NMDA 1YKHB 3N9NA 1SFCB 3RKOA 2V7MA 4CI2B 2K5BB 2XAHB 3K3NA 1RE4A 3LIDA 2W61A 1URQD 2OYIA 2HYNA 2JEEA 2NWBA 3K3QC 4JLEA 1U5PA 5KJ7A 4XBFB 1JY2N 2WSCH 3B8EB 1E5WA 5APQA 1M1JA 3E1IA 4A56A 2YINA 5L3BB 3OA7A 3AAEB 2CM0A 4PJMA 4QHOA 4QWNB 5J2UE 1IFDA 3C50A 1CUNA 4BAYB 3ZMUB 3RRCA 3N5LA 1JY2O 4N78D 3VMZA 1FZCA 4XZCA 2WPRA 3RYIE 1DH3A 3N4XA 3L3PA 3HE4A 2YKQA 2FXMA 2LSGA 4MFRA 4AKHA 5L3EB 3AA6B 2HG5D 2P7JA 1JNMA 4BJMA 1LTJA 4J2CA 3IHRA 4AXPA 4ZI7E 4KUMB 5LHGB 3DTOA 5FYMA 3M0DC 5APWA 2IAKA 3CQCB 4O4IE 4QXBB 4ZI2D 4CXYA 1NHLA 3TNUA 1OXZA 5JRCA 4AKGA 2JMHA 3RH3A 2CWOA 1CI6B 4GKGA 2CXDA 1RY3A 2M3BA 1RF1B 5L3DB 2R3CA 2N1TB 3CL3D 3MUDA 5JH7E 2C0WA 3A5TA 3OBVE 1UX5A 1VOMA 2WM9A 3C51A 1QSDA 2ZM2A 2HLOA 5BU8B 2C9LY 4HFVA 4DMVA 1LTIC 1NAFA 1JO5A 2VASA 3CI9A 1MUUA 4P0AA 5CCGA 4QKNA 5J2TE 1BR0A 1LVKA 4LGDE 4LLHA 2G0UA 5CHXA 2EHOC 5TAOA 3ZCJA 3HA4A 2X66A 5APSA 4M1PA 3T8OA 1HG2A 2ES0A 2V7IA 4AUWA 3NRXA 5F3JA 2FKWB 4UVCB 2YK0A 3IR9A 4O2AE 2VB6A 1URQA 2WPQA 1N7LA 3WAKA 3I9WA 3P8CE 3VYIA 1JY2P 4DVDA 3N2OA 2M8RA 3PU8A 4ZOLE 5LJNA 4X1IE 1GL2D 3KV4A 3CQXC 3PUQA 1WR6A 5C8YE 1SFCA 2B1EA 3A5XA 2DLRA 3O1IA 1FBMA 1SQQK 1HUCA 1IFIA 1L4AA 1Z56A 1NWQA 2XAJB 2Y8DA 2IFMA 4PW8A 4YJ2E 2E43A 2MTQA 3KINB 1BR4A 1FAVA 2R5BA 2XDJA 5DQWA 3I1AA 4I2LC 5APYA 5GONE 3ZPOA 4PK6A 4DMWA 4WBNE 4I43B 3O1JA 3ZCIA 4IE4A 4YLHA 5LJMA 4PJLA 2YO2A 3LFMA 2CE7A 4FJOA 1G1IA 4ADZA 1SVFA 4WB4A 3LG7A 3P32A 1L4AB 1UX4A 1FMVA 3FB2A 4X1KE 4AKLA 4V1Av 2L8KA 3HKBE 3H32A 1GU5A 1ZV8A 3NTNA 3HD7A 5LXTE 3EVYA 3HR0A 3BQKA 5AW4B 2H3RA 3ZEFB 1LT9C 5CCHA 3N9PA 4YJ3E 3I0OA 2YU1A 3U1AA 3P7IA 2MJZA 1KILB 1IC2A 1IJDB 1T3UA 2YKPA 3UIAA 1GDTA 1LKXA 2KXPB 3HKEE 4EAHA 1ZEEA 1MMAA 2E9XC 3E0ZA 3ZC0A 1GW4A 1GD2E 4KP3C 3TYYA 1D1AA 2JMKA 3HUSC 4ZI3C 4OYKA 1AFOA 1VPCA 5KJ7C 3ANWA 1T3JA 2PJQA 2ZM0A 5FY0A 3O9XA 3E22E 1MNDA 2NPSC 4MHCA 4H9RC 3UULA 4ZHQE 5JQGE 4O2BE 1ZN5A 2Z5HA 3B5ND 5CCGC 2N9DA 3O4XE 4JUYA 5L3CB 3PUSA 3TNUB 3WMM0 2UXXB 3A7OA 1SFCD 3U59A 2WMOA 2XAQB 5LNKA 3JC6D 1CSBA 4IFDK 4E7SA 3HRNA 3ONXA 2PBIA 4N78E 1VRBA 4JYBA 2OYIC 4XAXB 2QM7A 1RE3A 2OYHA 3KDSE 3PTRB 4L9IA 4PK5A 1WYBA 1JY3P 3R2PA 2Q7CA 2M67A 1KQLA 3C4WA 1HJBA 1GK6A 3B5NB 3BQIA 2A3DA 2C9NY 1N7SB 3M0DA 5E0OA 1J1EB 2CPSA 2CXLA 1ZLLA 2CPBA 4HKAA 4N3YB 1MV8A 4IIJE 4G2AA 2WT7B 2WT7A 1MMNA 1NTKK 4I55E 3LK3B 1N73A 3U3IA 3HKCE 3HKDE 3L09A 4G63A 1LT9B 1WT6A 4I1LA 3VTPC 1D1BA 5FXVA 4K0UA 5FMNA 3MZKB 3FXEB 3NFQA 2V26A 3RL0D 1CW5A 2XAFB 4HGAA 1FZFA 3Q5WA 1LTJB 4N6JA 3SWFA 1S9KE 1KZUB 1N86A 4BA9A 1ZKEA 4GK0E 1ZR2A 5AW9B 4U72A 3L4FA 2D2SA 3KYQA 3H3AA 2W62A 1W2EA 1RE4C 1NKZB 2O1KA 1SHZC 4HN9A 5DABA 3TKLB 3V5UA 4IE5A 2KMFA 5JDFA 5FP3A 2HH7A 1SQPK 4W7YA 1E1HB 2JPFA 2NPSB 2LSKA 4EIWA 2L9QA 2PAJA 1AJ3A 2W6BA 4DBQA 5HWXA 4YHJA 3UT5E 2O01H 3V4WA 2EHOB 2SPCA 2HPLA 4O8SA 4TX5A 5FNVE 2WZ7A 4EZHA 1L4AC 1JY3O 4NUVA 4ISTA 2DCFA 3U1CA 1NU1K 2A72A 5BMVE 4HH2A 1FDMA 4P0BA 3OJAB 2K48A 2NPSD 2OYHB 3CMLA 3K8PC 2ZXEB 1XTCC 5BU5A 2WBLA 3N9QA 5AVVB 3PUGA 4MBQA 3RYHE 3UUXB 4H9PC 3OYZA 2HPCA 2HODB 5CCHD 4AKIA 5AVTB 3HI2A 1KILC 1SFCC 3JC6C 5LBQB 5LGUB 1LWUC 1IO4A 4I6MC 5AVRB 3OJAA 1FU1A 1GZLA 2WSFH 3MGNA 1A02F 3HE4B 3E08A 1LTSC 3IFMA 3CLQA 3HD7C 3QUJA 2WWWA 2KWHA 1LT9A 5CCHC 2N1TC 5L3FB 2KNDA 1JCCA 4C7NA 2Y6XA 5DQVA 4L5GA 4PFOA 4AQFC 4UELA 2Q9QC 4GYSA 5IYZE 3LK2B 1FIOA 2P67A 1D0ZA 2W63A 3A2AA 5JR9C 2N9BA 2CWYA 4OH8B 2XUEA 2LT3A 2LM9A 3ZYMA 2Y48B 5APTA 1QL1A 3CPZA 3P7KA 2NOXA 5H6QB 2N1TD 4W80A 4KHXA 1IAPA 1HVVA 4KBMB 4H63H 5JDGA 1SA0E 2RP4A 4WY4A 1D1CA 4IE6A 2WAUA 1WLXA 4LC1A 2V7LA 2E9XA 1N73B 2E42A 1DX7A 1GTWA 5JREA 1T2KC 5JDQA 5KJ7D 5IHYA 3GN5A 3V2PA 2X9HA 4OHFA 5LYJE 1NOHA 3C64A 4O4HE 4CQIA 5AW2B 3B5NA 4WY4B 1B7TA 3GA8A 4L0RA 2QGSA 1HG5A 3MACA 3Q9DA 3BASA 4OK0A 2NW8A 4Y99C 1ZV4X 3KBTA 4DNDA 4UV9B 3PU3A 3PE0A 5HAXA 5DJQC 1G1JA 2Q5UA 2IX7C 2NTYA 1NO4A 1N73C 4H9NC 2A45I 3GHGC 3DJBA 1JY3N 3RK3B 4GIFA 3I0QA 2CEAA 3ZMVB 1X8YA 1YW0A 4EIJA 2WSSV 2W0GA 3ETUA 4HTEA 4ZS3A 3NRYA 2XTLA 1KILD 2W6AA 3II6A 3F57A 1HGZA 1WRDA 2YU2A 3R6NA 3ZYLA 4DO0A 3VHLA 3M0AA 4EYUA 1FZBA 4ZI2C 1FZCB 3BK9A 4UVAB 1FJPA 5EK3A 5AVSB 2D5UA 3N2GE 5AVWB 2K9AA 2LSYA 4QXHB 3RYFE 2PFVA 3C9IA 3GHGB 3SWYA 1N2DC 4TV8E 2NPSA 2ZFCA 5M4YA 1WRGA 2C0SA 1KFNA 2LOPA 2LSJA 2PG8A 1HFAA 1JOCA 1MIVA 3ETVA 1V9DA 2YNYA 2VWAA 5H6RB 4C90A 5L3GB 2Q9IA 2H43A 1MMDA 2VKDA 4MLKA 2RA1A 3LW5H 3N7NA 1IJ6A 4B6XA 4EXTA 5AW6B 1FZCC 1BR2A 1QUUA 4X1YE 2XU6A 5F8PA 2KB7P 3H6PA 1H7CA 4IE0A 5LGTB 3N9MA 1KK7A 5APXA 1FOSF 5EK4A 5JDLA 3EUHA 1HCIA 4DOJA 5CMZA 2XQYA 3AVSA 1H8AA 3MJXA 2KOGA 2A2FX 3KVAA 1HTJF 5LCYA 3U78A 1LTAC 2R5DA 1GL2A 2J59M 2JJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YO3 A;  1T2K D;  3VMX A;  5AW9 B;  1SP4 A;  3HE5 B;  2WPS A;  3VMY A;  3VMZ A;  2H7H A;  1NWM X;  2WPR A;  1DH3 A;  3HE4 A;  2Z5I A;  2XZR A;  2BAS A;  2P7J A;  1JNM A;  2W27 A;  3V4W A;  2XV5 A;  5APW A;  1O3X A;  3TNU A;  1OXZ A;  3V5B A;  1CI6 B;  3A3Y B;  4GKG A;  1MFZ A;  5AW8 B;  2R3C A;  2ZXE B;  2WTY A;  5AVV B;  3A5T A;  2C9L Y;  2R32 A;  1NAF A;  5AW1 B;  5AVU B;  4RES B;  3V4Q A;  1MUU A;  5AVT B;  5AVQ B;  5APS A;  1IO4 A;  4I6M C;  5AVR B;  5AW5 B;  1GZL A;  1A02 F;  3MGN A;  1FOS E;  3HE4 B;  4AUW A;  1H89 A;  5AVX B;  2WWW A;  3IR9 A;  3L35 A;  3NXS A;  2WPQ A;  3VYI A;  1YYC A;  5AW0 B;  4C7N A;  3M06 A;  5APV A;  3VN0 A;  1WR6 A;  1JUN A;  2P67 A;  2N2N A;  1HUC A;  1S9K D;  3MD0 A;  1NWQ A;  3A2A A;  5AVY B;  1H88 A;  2N9B A;  1A02 J;  2E43 A;  1FAV A;  2R5B A;  4M3L A;  5APT A;  4I2L C;  5APY A;  4B86 A;  2VRS A;  3P7K A;  1GU4 A;  4AYC A;  1OWA A;  4C7N B;  4EOT A;  4KHX A;  2IPP A;  2YO2 A;  3P32 A;  4XE5 B;  1GK4 A;  4LC1 A;  3P8M C;  2E42 A;  1X79 A;  4DZO A;  1GTW A;  1T2K C;  3L36 A;  1GU5 A;  3TK1 A;  3NTN A;  5AW4 B;  2P2U A;  5AW2 B;  5APU A;  5AW7 B;  1HBW A;  1CZQ A;  3UIA A;  3L37 A;  1CI6 A;  1GD2 E;  2Q5U A;  2Q3I A;  3TYY A;  4GT1 A;  1G2C B;  3HTK A;  1S9K E;  1X8Y A;  3M9B A;  1YD8 G;  3KQG A;  1SLQ A;  2W6A A;  3M9H A;  1WRD A;  2Z5H A;  2N9D A;  3M0A A;  4C46 A;  3TNU B;  1J2J B;  3A7O A;  3O8Z A;  1CSB A;  3OAK A;  3KDP B;  5AVS B;  4JYB A;  5AVW B;  5AW3 B;  1HWT C;  2QM7 A;  2ZFC A;  2KP8 A;  2Q7C A;  1KQL A;  4JYC A;  1HJB A;  1GK6 A;  2QM8 A;  2YNY A;  3M91 A;  5AVZ B;  2C9N Y;  3M0D A;  3HE5 A;  3NMD A;  3LIE A;  1MV8 A;  2WT7 B;  5AW6 B;  2WT7 A;  3LID A;  2XU6 A;  5APX A;  3I5C A;  3VTP C;  1FOS F;  3B8E B;  5APQ A;  5CMZ A;  4HYT B;  1H8A A;  3NFQ A;  4AQR D;  3T97 A;  2R5D A;  3SWF A;  2JJL A; 
#chains in the Genus database with same CATH topology
 5CA0 E;  4YHH T;  3WAJ A;  3VMX A;  2K88 A;  3HE5 B;  3H1I E;  1HX1 B;  3CX6 B;  2CLY B;  2XZR A;  3AA1 B;  2N1T A;  1Y64 B;  2C0X A;  1L0L K;  1NTM K;  3RRW A;  4B3S T;  2QJK C;  1LWU B;  1JTH A;  2JQQ A;  4I7Z C;  1NU1 J;  2CHO A;  2FBW A;  4EZ4 A;  4UB8 H;  4HE8 A;  2E8I A;  3CC7 P;  3ZT6 A;  5LHI B;  2IML A;  5AQV B;  2MBG A;  2A06 G;  4UF0 B;  1EXJ A;  4EB6 E;  1VQ5 P;  5KLV K;  1ZHC A;  4HWI B;  5AW5 B;  3RIF A;  3V5S A;  1FOS E;  2UXC T;  3H1H E;  1YIJ P;  3BRV B;  2E74 C;  4F6R C;  2XJ7 A;  5JVD E;  3D0T A;  3PHL A;  3CWZ B;  3RIA A;  5APV A;  3QK6 A;  3UU5 A;  2XAS B;  2N2N A;  5FL1 A;  5AQF B;  3AAI A;  2J58 A;  1W0A A;  1GU4 A;  4C7N B;  4EOT A;  3AVR A;  3CXH D;  4H9O C;  3L8R A;  4JI6 T;  3L71 E;  2H89 C;  1SQB K;  4UVB B;  3EDU A;  3PP5 A;  3F2E A;  3A0H H;  1UGO A;  4PJJ A;  1P84 D;  2K1A A;  3KV9 A;  1SQP E;  4ASK A;  2XQ8 A;  1FDI A;  2FJE A;  4DUY T;  1HTL C;  5LP6 E;  4DBR A;  2QE7 H;  3B5N C;  3KXD A;  2IIU A;  4WYV A;  3KPE A;  1IFM A;  3A8Y C;  1Z0P A;  1FS0 E;  5GTI E;  2NR4 A;  3GWH A;  2IYO A;  5AW3 B;  2MOZ A;  2DHR A;  1IZN B;  2FYZ A;  3BVH A;  1UII A;  4JYC A;  1KMI Z;  1LTT C;  3M91 A;  3G06 A;  3RL0 B;  4LF9 T;  3L75 E;  5GTH H;  3V2Q A;  3CX8 B;  4EED A;  1RF1 A;  3PLN A;  1X79 B;  1HNW T;  2YKS A;  1USE A;  3ESL A;  3I5C A;  4PK4 A;  1VL2 A;  2DI4 A;  1VQ4 P;  4UV8 B;  3CX5 H;  2ZM8 A;  2FYN C;  4NPP A;  1NTK G;  3L71 J;  2YO3 A;  2I0M A;  4GIW A;  4AI6 A;  1T2K D;  3M9Q A;  2WPS A;  2FJB A;  3CKD A;  2FBW C;  4WNK A;  5HXR A;  2FFD B;  4JBW F;  3HL6 A;  3CXH I;  3SOL A;  2FJA A;  4C91 A;  1O3X A;  4IDZ A;  5ADX L;  3CWB J;  5BVZ A;  3Q5S A;  3QOF A;  2FY8 A;  4CN4 A;  1LGH B;  2VKO A;  4CZZ B;  4A97 A;  1G8X A;  3CCR P;  2V7K A;  1X9V A;  3CWB D;  2GUV A;  1L0N K;  3ZN0 B;  2WDV A;  1KQG B;  4CXX A;  3L35 A;  3CVR A;  1LP1 A;  2OYH C;  2H88 A;  2FYU E;  1YTZ I;  3OKQ A;  1KNP A;  3AE5 A;  2QA7 A;  2ODV A;  3MD0 A;  1LWU A;  4IRE A;  5AVY B;  4JEU B;  3OPC A;  3HUS A;  2VRS A;  1VQ7 P;  1OWA A;  3MA9 A;  2VL0 A;  3WI3 A;  4DID B;  1NH4 A;  1PP9 E;  1HX8 A;  4Z8X A;  1AQT A;  1M62 A;  5JR9 A;  1VQK P;  3L36 A;  3TGU G;  3FHN A;  4DV2 T;  5GTI H;  1R5S A;  2P2U A;  3H25 A;  3RYC E;  1HH0 A;  1MNE A;  3USS A;  4PJ0 H;  4E7Z A;  3MHV A;  3RBX A;  2KS1 B;  4P09 A;  3AEF A;  4H9Q C;  2IBZ D;  1G2C B;  3HTK A;  1LVF A;  5CBO A;  2IW5 B;  3V2N A;  2E75 D;  3A0H E;  5KTB A;  3C8V A;  3AB3 B;  5AQK B;  1EZV G;  4ASV A;  4GYR A;  3O8Z A;  3AA0 B;  1Q2N A;  3NVO A;  3KDP B;  3LJC A;  1IBM T;  2IBZ G;  2BVL A;  2OTJ P;  2AXT E;  3TLU A;  2KP8 A;  2X68 A;  4DV6 T;  1GL2 C;  3S4U A;  3JCU E;  2C5I T;  1YKH B;  3N9N A;  3RKO A;  2V7M A;  3L75 J;  3WUU A;  3K3N A;  1RE4 A;  1OED C;  1HS7 A;  2OYI A;  4B3T T;  4YXW H;  1U5P A;  4XBF B;  1JY2 N;  4A56 A;  1M1J A;  3E1I A;  2CM0 A;  5J2U E;  3CX5 D;  3H1L J;  3NKZ A;  4NIQ A;  1IFD A;  1L0L G;  1NTM G;  3AE4 A;  2X0Y A;  4TWD A;  3RK3 E;  4HFD A;  4MFR A;  1BCC G;  3AA6 B;  3L70 J;  4KUM B;  5FYM A;  1NHL A;  2KSE A;  3BCC G;  4GKG A;  1KEY A;  2M3B A;  1WCR A;  2OGU A;  3CL3 D;  2IZ1 A;  1OVV A;  4RKU J;  3A5T A;  1EDI A;  2A06 E;  4DMV A;  5C2T A;  3B71 A;  1JO5 A;  1NAF A;  5J2T E;  4QKN A;  5FKY A;  2EHO C;  3T8O A;  5APS A;  4L75 A;  1HG2 A;  3NRX A;  2YK0 A;  3GF3 A;  3AEE A;  3I9W A;  4H0L D;  3VYI A;  3N2O A;  2M8R A;  2HR3 A;  4ZOL E;  3KV4 A;  3CQX C;  3PUQ A;  3ZT5 A;  1N36 T;  2BKO A;  2V5D A;  4JYA T;  1IFI A;  1YIT P;  2XAJ B;  1K9M Q;  3QB5 K;  2E43 A;  2MTQ A;  2JDI H;  3KIN B;  1FAV A;  5DQW A;  5GON E;  5APY A;  3TGU E;  4WBN E;  3ZCI A;  5LJM A;  1S2E A;  1G1I A;  4ADZ A;  1SVF A;  3LG7 A;  1L4A B;  2RPA A;  1FMV A;  1OIP A;  2ZYA A;  2W83 C;  4V1A v;  4L76 A;  1EDJ A;  1W9R A;  1KNR A;  5AW4 B;  3AEG C;  3SFE C;  3N9P A;  1S5L E;  4OGQ C;  3U1A A;  2YKP A;  1XDO A;  3E0Z A;  3ZC0 A;  1LP1 B;  3A7M A;  4OYK A;  1VQN P;  2PJQ A;  3F5H A;  1L0N G;  2NPS C;  5JQG E;  4ZHQ E;  4O2B E;  1ZN5 A;  2N9D A;  3TNU B;  3WMM 0;  3CCU P;  3ONX A;  4N78 E;  2OYI C;  2E76 D;  1RE3 A;  2OYH A;  3L73 J;  4PK5 A;  1QVF O;  3C4W A;  1ZP0 A;  2M67 A;  1KQL A;  1EZV E;  4YY3 T;  4BXL A;  1ZLL A;  4HKA A;  4N3Y B;  1KYO D;  4G2A A;  2WT7 A;  1NTK K;  4I55 E;  3U3I A;  3RBZ A;  3Q5D A;  5LMN T;  5F5W A;  1R8I A;  1L0L J;  1NTM J;  3NFQ A;  3RL0 D;  2PRR A;  3Q5W A;  1ZOY A;  4U72 A;  2D2S A;  3KYQ A;  1UUR A;  2W62 A;  3TKL B;  5JDF A;  4K3A A;  2QJP C;  1AJY A;  4W7Y A;  4YHJ A;  2I6H A;  3AED A;  3H1L D;  2ACZ A;  3A0B E;  5M1B A;  2SPC A;  2HPL A;  2V6X A;  4O8S A;  5FNV E;  4DR7 T;  1JY3 O;  4IST A;  2DCF A;  3U1C A;  3R4Y A;  2NPS D;  3N9Q A;  2ZXE B;  3RQW A;  3OYZ A;  3P4P A;  1YJW P;  3HI2 A;  1KYO I;  3RKG A;  1KIL C;  2VVS A;  1KFY A;  3JC6 C;  1LWU C;  1IO4 A;  2YDS A;  3PDY A;  1GZL A;  1A02 F;  2BBH A;  1J5W A;  2RH0 A;  3HD7 C;  5HCM A;  1BSH A;  3T1H T;  5CCH C;  2N1T C;  5L3F B;  3PH0 A;  2KND A;  1JCC A;  4C7N A;  1ZRT D;  1M7K A;  4GYS A;  5IYZ E;  4JV5 T;  1FIO A;  1D0Z A;  2N9B A;  2XUE A;  2LXC B;  2Y48 B;  4YT0 A;  1BE3 E;  4QH1 A;  4CPG A;  2NOX A;  3L39 A;  2AXT H;  3AEB A;  2E42 A;  4KT0 J;  1T2K C;  1PGP A;  2BCC G;  5IHY A;  2WSS H;  3Q3D A;  5TIS E;  2X9H A;  4OHF A;  5LYJ E;  2JWD A;  4O4H E;  4COF A;  3GA8 A;  3GF7 A;  3Q9D A;  3BAS A;  4OK0 A;  2WZH A;  3PU3 A;  2ZYD A;  5HAX A;  2Q5U A;  2Y9Y A;  4H9N C;  3BCC D;  1JY3 N;  2IYP A;  4GIF A;  3ZMV B;  1X0T A;  1YW0 A;  2W0G A;  5KXJ A;  2XTL A;  1KIL D;  3ONL C;  3F57 A;  1YHQ P;  3VHL A;  3ZST A;  4EYU A;  3Q1M A;  3WUT A;  5AQI B;  1BDD A;  2VQE T;  3AEE C;  3C9I A;  2DL1 A;  5KKZ B;  1T7S A;  2C0S A;  1HFA A;  1JOC A;  5KAF E;  4C90 A;  1V9D A;  5H6R B;  1NEN A;  2Q9I A;  2RA1 A;  5AW6 B;  1QUU A;  5F8P A;  5LGT B;  3H6P A;  2X0H A;  3JAE A;  1KK7 A;  4U7Y A;  3JAF A;  1HCI A;  4DOJ A;  5CMZ A;  2XQY A;  3AVS A;  3RI5 A;  2KOG A;  3CX5 E;  2A2F X;  5AQT B;  4ILB A;  4EIW A;  5B66 H;  2R5D A;  2JJL A;  1GL2 B;  3RL0 C;  1KTM A;  3ZN1 B;  1M56 D;  2XNX A;  2L3L A;  3CCM P;  3OYX A;  1YTZ T;  2CRB A;  2D2C B;  2W00 A;  3G3Z A;  3TGU D;  3V5B A;  1YQ4 A;  2XSA A;  1J1D B;  2E76 C;  2KUB A;  1FZA A;  2NZ2 A;  2WTY A;  3Q2Y A;  1BE3 D;  2ZT9 C;  2UXB T;  2D2C C;  1T72 A;  1LTG C;  2IFN A;  1P84 I;  1S1C X;  2K24 A;  3RIU C;  3ZMZ B;  4XA4 A;  3TLW A;  3LBX B;  5EK2 A;  1AVY A;  1ZP0 C;  1YYC A;  4EOZ B;  1S72 P;  2V7J A;  4GOD A;  2QRX A;  1GW3 A;  3L71 D;  4H13 D;  5CCG D;  1MZ9 A;  3EFG A;  3Q5R A;  1LRZ A;  1PP9 D;  4WW0 A;  1YJ9 P;  4AYC A;  2WIT A;  3N9O A;  2IPP A;  2GA1 A;  2LEH A;  3VRB A;  1YKE B;  1BGY E;  1PPJ E;  2JRK A;  4DZO A;  2P9B A;  3NZP A;  3HTK B;  1G2C A;  1D0Y A;  1DU2 A;  1URQ B;  1L0L D;  1NTM D;  5JDM A;  5TJH A;  3AED C;  4A5X A;  4MAL A;  3AE3 C;  4ZKP A;  1TU3 F;  1AA0 A;  1IFN A;  4ZI3 D;  3ZLI A;  5CA1 E;  1IFP A;  3EDV A;  1D7M A;  3KFW X;  2LR2 A;  5HWY A;  5BR8 T;  3KVB A;  5AQL B;  3KZI E;  2CLY C;  3KV5 A;  1OVU A;  3B13 A;  3VOP A;  2FFD C;  4DUZ T;  4OGQ B;  3FBZ A;  4DR3 T;  3FZH B;  3AE4 C;  3CX7 B;  4O4J E;  5JRC B;  3N2K E;  2LKH A;  5B66 E;  2KK7 A;  2LHR A;  3MTU E;  1PL5 A;  3QC9 A;  1EZV D;  4UF0 A;  2LKG A;  3M65 A;  3SS1 A;  5AVZ B;  4L74 A;  1QVG O;  1EZ3 A;  3VRA A;  3ZC1 A;  2YKO A;  5FY7 A;  1RF0 C;  3LW5 J;  3AEF C;  2L5G B;  1FE6 A;  2CCQ A;  1XWM A;  4KHZ F;  4YTP A;  1S94 A;  4PD4 E;  3ZJ1 A;  2JP3 A;  2Y9Z A;  2UUC T;  3RK3 D;  1Z8U A;  2VQF T;  1T8Z A;  4JEH B;  2KT9 A;  3SFD C;  4TV9 E;  4I0U A;  3HUS B;  4JQ0 D;  2H7H A;  3AE6 C;  2ZAE B;  5CJ0 A;  4U3F G;  4WY4 D;  1KB9 H;  2W27 A;  1XDP A;  4IHJ E;  2POH A;  1JMB A;  2GK9 A;  2XV5 A;  2KIN B;  2LE8 A;  1MKM A;  3A3Y B;  4ZKU A;  4TNV A;  2VKH A;  2E74 B;  4NPD A;  1MFZ A;  1WR0 A;  2DWK A;  2MKV A;  4JBZ A;  4WBO A;  3L74 G;  2VK9 A;  1L2P A;  2QJK B;  5AVQ B;  3UTK A;  1QGK B;  3VKH A;  2W4X A;  4PJN A;  4IGU A;  5AVX B;  3QB5 A;  2X51 A;  2IBZ I;  2PTF A;  5JDN A;  4LFB T;  1US7 B;  2W67 A;  4U3C A;  1KIL A;  3IF4 A;  2H7V C;  1PP9 G;  2YXR B;  1H88 A;  4AQG A;  4B86 A;  1Y8A A;  5B5E H;  5AQO B;  3JCF A;  2OV9 A;  2X67 A;  3EQ2 A;  4Y99 B;  1NTZ D;  2Y0E A;  3R84 B;  3SFD A;  4JI4 T;  1X79 A;  2J62 A;  1NJI Q;  2GUS A;  2VL8 A;  4A7P A;  2ZXX A;  1M1J B;  4D6T D;  2XY8 B;  5APU A;  5AW7 B;  2FJD A;  3GMI A;  1HBW A;  4KI0 F;  5AQN B;  1N32 T;  1HGV A;  4W7Z A;  2XHE B;  2DW3 A;  4H44 D;  2BKN A;  2D9D A;  2H89 A;  2OA5 A;  1WMK A;  3ZJ2 A;  5L2L A;  1N34 T;  1IK9 A;  5CBN A;  5KAF H;  2X9W A;  4GOU A;  3KQG A;  2WDQ A;  3Q5X A;  1EQ7 A;  4PFP A;  1FZE A;  1ZOY C;  4LF6 T;  2J1D G;  5LG4 A;  2Q9Q D;  1FJG T;  1AVO A;  4CXW A;  1LT1 A;  2KI7 B;  3SRZ A;  3MIW A;  1CHU A;  4IL6 E;  4ZS2 A;  3AEA C;  1BR1 A;  2IBZ E;  2KLV A;  3L74 E;  3C1L A;  3G4S P;  3VP8 A;  2AXC A;  3NMD A;  1SFC B;  2W61 A;  1QLE D;  2NWB A;  2JEE A;  1PV3 A;  3B8E B;  3OW2 O;  1E5W A;  1SQX D;  5EFW B;  4D6T J;  2YIN A;  3OA7 A;  3AAE B;  4QHO A;  1QEX A;  2ZM6 T;  1CUN A;  3ZMU B;  3RRC A;  1OED E;  3VMZ A;  1FZC A;  1DH3 A;  1U57 A;  3N4X A;  3SSU A;  1UK5 A;  2P7J A;  4U7J A;  1LTJ A;  4J2C A;  4DR4 T;  4ZI7 E;  3CCL P;  2XPK A;  3DTO A;  3CQC B;  1WFD A;  4AKG A;  3TNU A;  1NTZ G;  2CWO A;  1CI6 B;  2N1T B;  2C0W A;  4HFV A;  1VOM A;  2ZM2 A;  5BU8 B;  3CXH H;  2C9L Y;  1BR0 A;  1LVK A;  2JR8 A;  5CHX A;  3HA4 A;  3D71 A;  1VQ8 P;  2ES0 A;  3GMA A;  3L73 E;  2V7I A;  5F3J A;  4UVC B;  2FYU G;  3P8C E;  2V7Q H;  3PU8 A;  2A06 D;  1WR6 A;  3A5X A;  2DLR A;  2KIK A;  5L8R J;  1FBM A;  2MPK A;  1L4A A;  4PW8 A;  2ZVO B;  2IFM A;  4H13 C;  2HN1 A;  2R5B A;  3A0B H;  4I43 B;  3O1J A;  4WWI A;  4IE4 A;  1RHZ B;  4H0L C;  4AQY T;  3AE1 C;  2CE7 A;  4DV7 T;  4X1K E;  3FB2 A;  5CJ5 A;  2L8K A;  1IK7 A;  5DJT B;  3EFF K;  2K9J B;  3H32 A;  1GU5 A;  5KAI H;  3NTN A;  3HD7 A;  2BCC E;  1X9B A;  4U3F D;  4AIU A;  5H2F H;  3I0O A;  2YU1 A;  4HFE A;  3P7I A;  2MJZ A;  3ZCJ A;  1IC2 A;  3L70 D;  1LKX A;  4EAH A;  1ZEE A;  3EHZ A;  3TYY A;  1Q90 D;  4HFH A;  1AFO A;  5KJ7 C;  3ANW A;  2ZM0 A;  2XQ5 A;  3E22 E;  1MND A;  2XZE A;  2IUB A;  4H9R C;  3UUL A;  2K3W A;  1SUM B;  3L72 G;  2Z5H A;  3O4X E;  1KYO E;  4JUY A;  5L3C B;  4I7Z B;  4IFD K;  3JC6 D;  5FVL A;  4E7S A;  1Q82 Q;  4XAX B;  5H2F E;  3PTR B;  4ZZC A;  2BG9 B;  3R2P A;  2Q7C A;  1HJB A;  2FYN B;  1GK6 A;  1OZH A;  1N7S B;  3M0D A;  5E0O A;  4BRY A;  2CPS A;  2CXL A;  2CPB A;  1SQQ D;  1SQQ J;  2XQ9 A;  1MMN A;  1P84 E;  4WZX A;  4F8H A;  3HKC E;  3HKD E;  4G63 A;  1D1B A;  3VTP C;  4JI5 T;  4ZZB A;  5KKZ C;  1NGM B;  4H44 B;  3H1L E;  2QEX P;  1CW5 A;  4HGA A;  1FZF A;  4D6T E;  3SWF A;  1S9K E;  4BA9 A;  1ZKE A;  4GK0 E;  1U7M A;  1ZR2 A;  2QSI A;  5AW9 B;  3AE7 A;  4HN9 A;  1W2E A;  1RE4 C;  1NKZ B;  1SHZ C;  2HH7 A;  1SQP K;  2JPF A;  1Y9B A;  2NPS B;  2LSK A;  1Y47 A;  3L70 E;  2VUR A;  1NTZ J;  2EHO B;  3AE8 C;  4IL6 X;  2R3S A;  2Y0C A;  4NUV A;  2Q1K A;  4TWF A;  1NU1 K;  4P0B A;  2OYH B;  5BU5 A;  3ZMS B;  4ILC A;  3RYH E;  4DV3 T;  2HOD B;  5AVT B;  3H1K E;  2J47 A;  5AQG B;  1SFC C;  1YQ4 C;  5LBQ B;  5LGU B;  3OJA A;  4UIG A;  2WSF H;  3HE4 B;  3B4S A;  2IHR 1;  1XNR T;  2K9Y A;  1LT9 A;  4EDF A;  1BSN A;  2Y6X A;  5DJU B;  4L5G A;  4PFO A;  4UEL A;  3UUB A;  2W8Z A;  4QMA A;  2W63 A;  1VQM P;  3L73 G;  3A2A A;  3TGU J;  3ZYM A;  3MUD C;  2QYW A;  2ZVN B;  3P7K A;  1S5L X;  5H6Q B;  2N1T D;  4W80 A;  4KHX A;  4KBM B;  5JDG A;  3RIU A;  2V7L A;  1N73 B;  4U7I A;  3RHW A;  2JQ9 A;  5AW2 B;  2BEZ F;  4JI2 T;  3AE9 A;  2CHN A;  3MAC A;  3ZDM A;  4KJM A;  2NW8 A;  4Y99 C;  3KBT A;  4UV9 B;  3GW6 A;  3PE0 A;  2B76 A;  1G1J A;  3AXJ A;  2IX7 C;  2NTY A;  1N73 C;  3GHG C;  4YTP C;  4P1N A;  4X64 T;  3I0Q A;  1X8Y A;  3G71 P;  3H1K D;  3ETU A;  3PUZ F;  4DO0 A;  3R6N A;  5K5G B;  1OW6 A;  3RL0 g;  1FZB A;  5KLV D;  1FZC B;  3AE2 A;  4UVA B;  1FJP A;  2RN0 A;  4QXH B;  3RYF E;  2K9A A;  2FYU J;  3GHG B;  3SWY A;  4DV1 T;  4TV8 E;  2NPS A;  5M4Y A;  1SQX J;  1WRG A;  2A9U A;  2LOP A;  4XFJ A;  4YSX A;  2YNY A;  1SQQ G;  4EV6 A;  2WDR A;  2BBJ A;  1IBL T;  4MLK A;  3LW5 H;  1FZC C;  4X1Y E;  2XU6 A;  2JWA A;  4IE0 A;  3UU6 A;  5B5E E;  2BCC D;  4ASW A;  3MJX A;  4HWH A;  3KVA A;  5LCY A;  2J59 M;  1HGZ A;  1BGY J;  3AE8 A;  1SQB D;  1KFM A;  1JEK A;  1HF9 A;  2BG9 A;  1RQU A;  4IOI H;  4O4L E;  2PP6 A;  1NKN A;  4PAG A;  2D0U A;  4IDP A;  1MIY A;  4OVN F;  2WZI A;  1NTZ E;  2FXO A;  2W90 A;  2OYO A;  2OTL P;  3LBX A;  4EYY Q;  3H1J E;  3C4Z A;  1FEW A;  5AW8 B;  3CCQ P;  4HFB A;  2KZ7 B;  2B9B A;  2OQQ A;  5IUX A;  3BRT B;  1T6A A;  1JM0 A;  1N7S A;  2X9X A;  1ZME C;  5TIS H;  2Z4E A;  4HWD A;  2E9X B;  3UQ4 A;  3CC2 P;  3CQG B;  2DNX A;  1KB9 E;  3O6Q A;  1LJ2 A;  3UUM A;  1RE3 C;  1Q7Y Q;  2X0L B;  3ZSS A;  3IEE A;  4EEB A;  3MK7 C;  3AEC C;  2KSJ A;  5AW0 B;  2KLQ A;  3M06 A;  1S35 A;  3T97 B;  4U31 A;  1S9K D;  4DV5 T;  4GOF A;  1BE3 J;  2BVM A;  5ABE A;  2KZI A;  4PD4 H;  4TN7 B;  2XND H;  1W09 A;  1EZV I;  2YN6 A;  2LJL A;  4DR6 T;  3UU4 A;  3RC3 A;  4I50 E;  2K9J A;  2YIU B;  3H32 B;  2JKV A;  1FZG A;  1L0N J;  4LF8 T;  2HPC B;  2CBI A;  2XM2 A;  1SQV D;  2M0B A;  4EYY R;  5HXH A;  4H44 C;  1YQ3 A;  2IC6 A;  4GOE A;  3RC8 A;  2Q9Q A;  2XAG B;  2MYS A;  4U74 A;  2Q3I A;  5ETW A;  5L3E B;  3BCC J;  3BQL A;  2FYU K;  3ZMT B;  2LOS A;  2Q9Q B;  2QJY C;  4H9S E;  3D70 A;  1JTH B;  3PUW F;  2LSI A;  1DD3 A;  3CMA P;  3TF5 A;  2JO1 A;  3Q5P A;  3RGU A;  1J1J A;  1T8B A;  2IZ0 A;  3CK6 A;  1SQQ E;  3HE5 A;  4OFZ A;  1OW8 A;  4HB1 A;  4KX6 A;  3I9Y A;  1MFT A;  3VU7 H;  2GM4 A;  1H0T B;  3UFG A;  4HYT B;  4R4M A;  2JIW A;  3T97 A;  5LMU T;  4K0K T;  1FC2 C;  3VMY A;  4AKR B;  3H3M A;  1RF1 C;  1NWM X;  2P58 A;  3O6Q B;  3PUY F;  1HF8 A;  1IFJ A;  1BCC J;  1VDF A;  2C5J A;  3FZF B;  3EAM A;  3UU8 A;  2EHO A;  5J0Z A;  1AQ5 A;  5LG3 A;  1OED A;  4PV1 B;  3OVU A;  1VQP P;  4C7R A;  3H1J J;  3H1H G;  4DT0 A;  4U3F E;  3C4X A;  1OW7 A;  3PUR A;  1M1J C;  2BEQ D;  3RX6 A;  3H1K G;  5AVU B;  1NVO A;  2I59 A;  4LFC T;  4QX7 B;  1IBK T;  2E5L T;  3AE2 C;  4H13 B;  5HXS A;  2W66 A;  1KYO H;  1MMG A;  2W2U A;  1W5C E;  2WU5 A;  2WB5 A;  3NBX X;  4JI3 T;  1LTB C;  2L91 A;  3RK2 C;  2P10 A;  1Q86 Q;  2HPJ A;  1IJ5 A;  4HFI A;  4DV0 T;  5AQM B;  4M3L A;  2OYI B;  3JSV C;  2C5K T;  3AEG A;  1BDC A;  1XNQ T;  1QL2 A;  4XE5 B;  1GK4 A;  1J1E C;  3W15 B;  3GN5 B;  4DR2 T;  2NP9 A;  3GHG A;  4NUU A;  4WVZ A;  1KNZ A;  2BDE A;  3ANW B;  1DIP A;  3AAA B;  4JF7 A;  3IA3 A;  3ONJ A;  3W68 A;  3RPU A;  1BCC E;  2XKM A;  5LGN B;  5KX5 E;  2FUP A;  2ZLY A;  4UEM A;  4U3F J;  1PZQ A;  4FI5 A;  4YTM A;  4TLF A;  4CI1 B;  3PRJ A;  1YD8 G;  1WYC A;  4U2Y A;  2NW7 A;  1SLQ A;  1KC8 Q;  1JNR A;  2H7O A;  2O01 N;  5KLV E;  5ABF B;  3AA7 B;  1UCU A;  5A1L A;  1P84 H;  5KDM C;  1HWT C;  1SQX E;  2XQ3 A;  2UXD T;  4JI1 T;  1VQL P;  4PNI A;  4JPZ B;  5HXE A;  2NRG A;  4IFM A;  5KAI E;  3FZL B;  2X9Y A;  3RK2 D;  2J4G A;  2K5B B;  2E5Y A;  2YDQ A;  3LID A;  4MN4 C;  1URQ D;  3K3Q C;  2HYN A;  4ZNC A;  4ZMD A;  2ITA A;  4AIS A;  5KJ7 A;  1M90 Q;  2WSC H;  5APQ A;  1S5L H;  3CCS P;  3IN6 A;  3OTO T;  3G9R A;  4Z90 A;  1NAY A;  3C50 A;  4BAY B;  2AEF A;  3N5L A;  3MP7 B;  4N78 D;  4GKK T;  3P4R A;  3HE4 A;  4AKH A;  2LSG A;  2H88 C;  2Q3E A;  1JNM A;  3IHR A;  5LHG B;  4ZI2 D;  4CXY A;  2WMM A;  1KD1 Q;  4QXB B;  5JRC A;  1OXZ A;  3H1J G;  2JMH A;  3RH3 A;  4IDO A;  3AE6 A;  2CXD A;  1RY3 A;  5L3D B;  2R3C A;  5JH7 E;  3CPW O;  2BG9 C;  3AEC A;  1UX5 A;  2WM9 A;  3OBV E;  3C51 A;  1QSD A;  1SQV J;  2HLO A;  2M5A B;  1SE7 A;  4P0A A;  4IL6 H;  2VAS A;  3CI9 A;  1MUU A;  5ABF A;  4UB6 E;  1W0B A;  5TAO A;  2LRL A;  2IDO B;  1KB9 D;  5AQS B;  4O2A E;  3WAK A;  1URQ A;  2WPQ A;  1N7L A;  4YJ2 E;  4YSY A;  1JY2 P;  5LJN A;  1XZY A;  5JTG A;  4IT4 A;  5C8Y E;  1SFC A;  2R44 A;  1USD A;  2B1E A;  3O1I A;  2YDR A;  1VQO P;  1Z56 A;  1NWQ A;  3E1R A;  3K1S A;  4I2L C;  2E75 B;  3CCV P;  1QX8 A;  5AQJ B;  2BG9 E;  3F89 A;  3LFM A;  4FJO A;  3NWI A;  3D6Z A;  4WB4 A;  3P32 A;  4ZEY A;  1XMO T;  3EWK A;  3HR0 A;  3ZEF B;  3T1Y T;  2H3R A;  1LT9 C;  5CCH A;  2BCC J;  1Q81 Q;  5EZY E;  3UIA A;  3B5M A;  3HKE E;  1MMA A;  2BS3 A;  2JMK A;  1D1A A;  2AEJ A;  3CWB E;  1VPC A;  3H1K J;  3K5B A;  3RLF F;  2PGD A;  2UXX B;  1SFC D;  5LNK A;  5KLV J;  3UU3 A;  5C39 A;  2KS1 A;  3H1J D;  1VRB A;  5AQR B;  4JYB A;  2MAW A;  1WYB A;  3I55 P;  1JY3 P;  2UUA T;  1S3J A;  3B5N B;  1KQS O;  1J1E B;  3EAB A;  1OFC X;  2WT7 B;  5GTH E;  3LK3 B;  3L09 A;  2BKP A;  4I1L A;  5FXV A;  5FMN A;  1PGQ A;  1KIL E;  2XAF B;  3VR8 A;  4N6J A;  1KZU B;  2W6J H;  3H3A A;  1SQP G;  4CN6 A;  5E79 E;  4IE5 A;  4TT3 H;  5FP3 A;  3H1I J;  4LF7 T;  3FZM B;  2KLU A;  4Z1M H;  2L9Q A;  2PAJ A;  1AJ3 A;  2W6B A;  5C3J A;  5HWX A;  1L0N E;  3UT5 E;  3V4W A;  1NTK J;  3L71 G;  2WZ7 A;  2G8Y A;  3CCE P;  3AE7 C;  1FDM A;  2K48 A;  3K8P C;  3PUG A;  2WBL A;  5AVV B;  4H9P C;  3H1H D;  2HPC A;  5KLI B;  4AKI A;  3VMA A;  2XSB A;  4LFA T;  4PD4 D;  2LM2 A;  2K37 A;  4I6M C;  5AVR B;  4ILA A;  5KMG P;  3E08 A;  3QUJ A;  2WWW A;  2UUB T;  5CFB A;  3H1H J;  3SFE A;  1EC5 A;  5FVK A;  1VQ9 P;  3L75 G;  4YPC A;  2KNC B;  2RMZ A;  1NTK D;  4Z91 A;  2CWY A;  4OH8 B;  1KN7 A;  4IL4 A;  3X1D A;  1QL1 A;  4OX9 T;  3CPZ A;  4HJG H;  1HVV A;  3H1L G;  2RP4 A;  2O3J A;  4IE6 A;  4X65 T;  4LC1 A;  4PV1 D;  3MZW B;  2E9X A;  2V5C A;  1GTW A;  5JDQ A;  3P50 A;  2XQ4 A;  3GN5 A;  3RGL A;  1SQP D;  4CN1 A;  4GKJ T;  3W67 A;  4CQI A;  3S4R A;  3GG2 A;  3B5N A;  4L0R A;  1B7T A;  3ABV C;  4A98 A;  3WU2 E;  2ZJS E;  1ZV4 X;  3RQU A;  5DJQ C;  3FWL A;  1DEE G;  3RK3 B;  1LNQ A;  2E5V A;  2SPZ A;  4YXD C;  4IDQ A;  4HTE A;  3ZYL A;  5KLV G;  4ZI2 C;  1VF5 B;  5EK3 A;  1HR0 T;  4DJG A;  5AVS B;  2D5U A;  3N2G E;  5AVW B;  2LSY A;  2PFV A;  4B3R T;  3JCU H;  2ZFC A;  3ETV A;  1K04 A;  2PG8 A;  1MIV A;  2VWA A;  2VKD A;  3N7N A;  3IAO A;  2YIU C;  2WVR A;  3FZK B;  1FOS F;  4OWF A;  4HFC A;  1H8A A;  1N33 T;  2XQ7 A;  5DQV A;  1YI2 P;  1L4A D;  2CMR A;  3FXD B;  1MIW A;  2Q6Q A;  3WU2 H;  4DV4 T;  3CC4 P;  3LSV A;  1K73 Q;  4ANJ A;  1OX3 A;  3DP7 A;  4X62 T;  2BAS A;  4NPE A;  3Q2M A;  4IDN A;  4AQF A;  3MXZ A;  4LML A;  2V1D B;  4UXN B;  2KSR A;  3ZYK A;  5CJ4 A;  2QIW A;  2KNC A;  1RF0 A;  3BCC E;  4RJT A;  3HD7 D;  1FJK A;  3AXJ B;  3FBL A;  4H63 V;  1T98 A;  3RF1 A;  3CME P;  1YBK A;  1DEB A;  3L72 E;  4HEA A;  3SWH A;  4YTN A;  3QNU A;  4WY4 C;  3PUV F;  3KBU A;  5FXX A;  3F31 A;  5JR9 B;  4DR1 T;  3C98 B;  2N9Y B;  1J1D C;  2Z6E A;  1JMM A;  1SQV G;  2V7Q J;  3TSI A;  3UUN A;  2ACX A;  1UUS A;  1FMW A;  3FX0 A;  3LK4 2;  2WSE H;  2D0T A;  2NTX A;  5LOV E;  2QJP B;  1URQ C;  3ABV A;  4TUY E;  3KHU A;  2OTK E;  3PUA A;  1XMQ T;  3SWK A;  3RK2 B;  5LBM A;  1ZW0 A;  3TK1 A;  3FWN A;  3CWB G;  3PUX F;  4IE7 A;  4QX8 B;  4BWN A;  3K3O A;  2Y0D A;  2E9X D;  3ZKR A;  2KZJ A;  4OYJ A;  5FY1 A;  1NU1 E;  2RKL A;  1OVR A;  2YEV C;  5AFU L;  2I1J A;  1RQV A;  1N7S C;  2KYV A;  1SQV E;  3N9L A;  3V2R A;  4C46 A;  1HNZ T;  1D0X A;  5LA6 E;  2DWG A;  4U2Z A;  1L0N D;  2IC9 A;  1PIX A;  3UFE A;  2UU9 T;  2WWU A;  4H0L B;  1J5E T;  1SS1 A;  3PV0 F;  4L73 A;  4QXC B;  2QM8 A;  5KLI C;  4ERR A;  2WSF J;  2OAR A;  3LIE A;  2NW9 A;  3FXD A;  5E79 H;  1E2A A;  2HFE D;  4CI3 B;  5L4E A;  2ODU A;  4U33 A;  1PFI A;  2WQY A;  2B89 A;  4AQR D;  2LKM A;  1PPJ D;  1BGY D;  3EI0 A;  3BAT A;  5CB4 E;  4D6T G;  1NTZ K;  4BJN A;  3L75 D;  1SP4 A;  2A45 G;  3IF8 B;  1ZRT E;  2AE9 A;  2WWV A;  2Z5I A;  4K35 A;  1QLB A;  4IFF A;  3AEA A;  4UR9 A;  5HCJ A;  1SQV K;  5HEO A;  1NTK E;  1SQB E;  2I8D A;  2YMY A;  4RO0 A;  2CBJ A;  3VP9 A;  1FDO A;  2A45 H;  2P1J A;  1EDL A;  4KMC A;  1SQP J;  2FYU D;  2CXF A;  4LF4 T;  2PFX A;  3J9X 1;  2R32 A;  5AW1 B;  3L72 J;  2CK3 H;  2H8P D;  4RES B;  3V4Q A;  1NEK A;  2FXP A;  1OMI A;  3VKG A;  1JNZ A;  1OED B;  2R6G F;  1G73 A;  1H89 A;  2V6Y B;  3TDK A;  3NXS A;  5FXZ A;  4GK5 E;  5JDH A;  2M5A A;  4TWH A;  5HXC A;  1U4Q A;  1XTG B;  2CA5 A;  5FL0 A;  2UXN B;  2IDB A;  3B57 A;  1LTJ C;  3VN0 A;  2LHN A;  2F4V T;  5FXW A;  3L74 D;  3LDQ B;  1JUN A;  2O1J A;  4UB6 H;  3ITK A;  1JCD A;  4ISS A;  1A02 J;  1VF5 D;  2KWI B;  2YXQ B;  4WBA A;  3HD7 B;  1EDK A;  5HYA A;  2JQK A;  1SQX K;  4ILU A;  4X5T A;  1ZR4 A;  2I1K A;  2ZMA A;  1UIX A;  4TNW A;  2E2A A;  3P8M C;  2JJ9 A;  3H37 A;  4EGW A;  3L73 D;  2BZB A;  1AV1 A;  4O9B A;  3P8C D;  5LHH B;  5AQU B;  3P4W A;  2N1G A;  1CZQ A;  3KZI H;  4OGQ D;  3L37 A;  1R8E A;  2HN2 A;  2LRK A;  1CI6 A;  4YFS A;  4LF5 T;  3IBP A;  2WP9 A;  2WMN A;  2M6I A;  4GT1 A;  5HEG A;  1SQX G;  4HWC A;  3M9B A;  1M1K Q;  3VR9 A;  3M9H A;  2VKJ A;  3MKD A;  1J2J B;  4TZ4 C;  5L47 A;  1GMJ A;  3OAK A;  1M7L A;  2EHO D;  1E7P A;  2WSE J;  3KV6 A;  3O1H A;  2M3E A;  4I4T E;  1N7S D;  3RK3 C;  2FFD A;  1K05 A;  3J7Y q;  2D2C D;  4GDO A;  2HOD A;  3NZQ A;  4CI2 B;  2XAH B;  1VF5 C;  1N8R Q;  4JLE A;  1PGO A;  2M6B A;  3PJA A;  5L3B B;  3S1K A;  4PJM A;  4QWN B;  1NTM E;  1L0L E;  2CPT A;  1JY2 O;  5IWA T;  4XZC A;  2WPR A;  2K3R A;  3H1I D;  1W2B O;  3RYI E;  2V6Y A;  3L3P A;  2YKQ A;  2FXM A;  4EI2 A;  4X66 T;  2HG5 D;  1VCT A;  4BJM A;  4AXP A;  3M0D C;  5APW A;  2IAK A;  4O4I E;  3I56 P;  1SQB J;  2WPV B;  4LMJ A;  1KOR A;  1KQF B;  1RF1 B;  3MUD A;  2G3A A;  3JC2 2;  3UQ7 A;  1LTI C;  2QA4 P;  2B88 A;  3CCJ P;  5CCG A;  2G0U A;  2J5U A;  4LGD E;  4LLH A;  4HWF A;  2X66 A;  2LXB A;  4M1P A;  1I6Z A;  3E7K A;  4AUW A;  5AQQ B;  1VQ6 P;  2FKW B;  3IR9 A;  2VB6 A;  1L0V A;  4DCK A;  1JB0 J;  4DVD A;  3AE9 C;  1GL2 D;  4X1I E;  5ABG A;  3AEB C;  1SQQ K;  1HUC A;  2Y8D A;  1X22 A;  1BR4 A;  4PJ0 E;  2XDJ A;  3I1A A;  3ZPO A;  4DMW A;  1LTA C;  4KHP T;  2WQY C;  4PK6 A;  4YXD A;  4YLH A;  2E5T A;  4PJL A;  2YO2 A;  4B3M T;  4DR5 T;  1UX4 A;  1PPJ G;  1BGY G;  1M57 D;  3PJS K;  4AKL A;  3HKB E;  1DD4 A;  1ZXG A;  3PTZ A;  1ZV8 A;  5LXT E;  3EVY A;  3BQK A;  2ZYG A;  5AQH B;  2ZT9 D;  4YJ3 E;  1H0T A;  1HJ0 A;  1GDT A;  1KIL B;  1T3U A;  1IJD B;  3QWO C;  2KXP B;  3M3Z B;  1PGJ A;  2E9X C;  2XQA A;  1GW4 A;  1GD2 E;  1NU1 D;  4KP3 C;  3TLS A;  2E74 D;  3HUS C;  4ZI3 C;  5FY0 A;  1YXR A;  1T3J A;  3O9X A;  4MHC A;  1GQE A;  4NXM T;  3B5N D;  5CCG C;  3PUS A;  4QH4 A;  4Q25 A;  5LB7 B;  3A7O A;  3U59 A;  2WMO A;  2XAQ B;  1CSB A;  3HRN A;  2PBI A;  4JI0 T;  4JI7 T;  2QM7 A;  3KDS E;  4L9I A;  4HKZ H;  3GLM A;  3FXE A;  1U7J A;  3CD6 P;  4LMK A;  3BQI A;  4PD4 I;  2A3D A;  2C9N Y;  4IIJ E;  1MV8 A;  1M8O B;  1N73 A;  3TLT A;  1LT9 B;  1WT6 A;  2XM1 A;  4K0U A;  3MZK B;  3FXE B;  2WY2 A;  2V26 A;  1LTJ B;  1N86 A;  4QH5 A;  3L4F A;  2UWJ E;  2O1K A;  5DAB A;  4PV1 C;  2OLT A;  3V5U A;  2KMF A;  1VCS A;  1E1H B;  4NPF X;  4ZXL A;  1K8A Q;  2E75 C;  2ZT9 B;  3CXH E;  4DBQ A;  3FGA D;  4R4L A;  2O01 H;  1Y01 A;  3L72 D;  4TX5 A;  4EZH A;  1L4A C;  5L4H A;  2QG4 A;  2A72 A;  5BMV E;  4HH2 A;  5HEH A;  3OJA B;  3CML A;  4B6X A;  1NU1 G;  1XTC C;  4MBQ A;  3UUX B;  5CCH D;  2AXD S;  3AE5 C;  3CIR A;  1KF6 A;  2VVN A;  1FU1 A;  4X20 E;  5J1G A;  3MGN A;  1LTS C;  3IFM A;  3CLQ A;  2KWH A;  3P4Q A;  2YMK A;  4YSZ A;  4Y28 J;  4AQF C;  4JI8 T;  3L74 J;  4NXN T;  2Q9Q C;  2QJY B;  4BRY B;  3G6E P;  3LK2 B;  2P67 A;  4IL9 A;  3V6I A;  5AQP B;  5JR9 C;  2LT3 A;  2B87 A;  2LM9 A;  1KB9 I;  5APT A;  3QH9 A;  1YJN P;  1BE3 G;  1IAP A;  1YQ3 C;  1SA0 E;  4WY4 A;  1D1C A;  2WAU A;  3AE3 A;  1WLX A;  5HEJ A;  3JAD A;  2LLY A;  1DX7 A;  2E76 B;  5JRE A;  1PP9 J;  2XQ6 A;  5KJ7 D;  3Q5E A;  5HEU A;  3V2P A;  3P4S A;  1KV4 A;  1NOH A;  3C64 A;  1EXI A;  2V4H A;  4WY4 B;  1BCC D;  1HG5 A;  2QGS A;  1SQB G;  4DND A;  3H1I G;  2B87 B;  1NO4 A;  2QVA A;  1RH5 B;  2A45 I;  3DJB A;  3ZT7 A;  1R5L A;  3TLV A;  2CEA A;  3PJA J;  3D6Y A;  2HHH T;  5CGM A;  1E79 H;  4EIJ A;  2WSS V;  4ZS3 A;  3S9O A;  2V8S V;  2W6A A;  3II6 A;  3AE1 A;  3NRY A;  1WRD A;  2YU2 A;  3M0A A;  2WU2 A;  3BK9 A;  2WCA A;  1NYH A;  1N2D C;  3CX5 I;  1KFN A;  2LSJ A;  1HNX T;  5ABH A;  4UB8 E;  5L3G B;  1I94 T;  2H43 A;  1MMD A;  4EXT A;  1S4X A;  2JQH A;  1IJ6 A;  2WS3 A;  2O01 J;  1BR2 A;  2KB7 P;  1H7C A;  2YOE A;  3N9M A;  2BS4 A;  5APX A;  5JDL A;  5EK4 A;  3EUH A;  2BS2 A;  2WSC J;  3L70 G;  1HTJ F;  3U78 A;  2AEM A;  3WUV A;  1GL2 A;  4H63 H; 
#chains in the Genus database with same CATH homology
 1GL2 B;  2CMR A;  3FXD B;  3RL0 C;  1MIW A;  5CA0 E;  3WAJ A;  3VMX A;  3HE5 B;  3ZN1 B;  1KFM A;  3CX6 B;  4ANJ A;  2CLY B;  2XZR A;  3AA1 B;  2N1T A;  3DP7 A;  2XNX A;  2BAS A;  2L3L A;  2PP6 A;  1Y64 B;  1NKN A;  4O4L E;  2C0X A;  1L0L K;  1NTM K;  3OYX A;  1YTZ T;  3Q2M A;  4AQF A;  3MXZ A;  3RRW A;  2V1D B;  4PAG A;  4UXN B;  2D0U A;  3ZYK A;  5CJ4 A;  1MIY A;  1HS7 A;  2W00 A;  1LWU B;  3G3Z A;  1JTH A;  3V5B A;  2JQQ A;  1RF0 A;  3LBX A;  3FBL A;  3HD7 D;  1FJK A;  4H63 V;  3ZMS B;  4EZ4 A;  1J1D B;  3C4Z A;  1T98 A;  4HE8 A;  1FZA A;  1FEW A;  5AW8 B;  2E8I A;  2WTY A;  2KZ7 B;  1DEB A;  5LHI B;  2MBG A;  3BRT B;  4HEA A;  3SWH A;  1N7S A;  2X9X A;  4WY4 C;  4UF0 B;  4EB6 E;  2Z4E A;  1LTG C;  2IFN A;  2K24 A;  3KBU A;  5KMG P;  5FXX A;  5KLV K;  1ZHC A;  3F31 A;  3ZMZ B;  5JR9 B;  5AW5 B;  2E9X B;  3C98 B;  4XA4 A;  1FOS E;  3CQG B;  2DNX A;  3LBX B;  3V5S A;  1J1D C;  3BRV B;  1RE3 C;  3UUM A;  4F6R C;  5EK2 A;  2Z6E A;  2X0L B;  3IEE A;  3D0T A;  3CWZ B;  3MK7 C;  1JMM A;  5JVD E;  1YYC A;  2KSJ A;  5AW0 B;  2KLQ A;  3UUN A;  3TSI A;  3M06 A;  5APV A;  3QK6 A;  4EOZ B;  2ACX A;  1S35 A;  2V7J A;  1GW3 A;  2XAS B;  1FMW A;  2N2N A;  5CCG D;  3LK4 2;  4X20 E;  1MZ9 A;  3EFG A;  1S9K D;  5EZY E;  2WSE H;  2D0T A;  1LRZ A;  2BVM A;  2NTX A;  5LOV E;  3AAI A;  1URQ C;  2J58 A;  4WW0 A;  1GU4 A;  4AYC A;  4C7N B;  2WIT A;  3N9O A;  4EOT A;  4TN7 B;  2IPP A;  3AVR A;  2LEH A;  4H9O C;  4TUY E;  1YKE B;  2LJL A;  3PUA A;  2JRK A;  1SQB K;  4UVB B;  4DZO A;  3RK2 B;  3EDU A;  3RC3 A;  2P9B A;  3NZP A;  3TK1 A;  5LBM A;  3PP5 A;  3H32 B;  4I50 E;  3HTK B;  1FZG A;  1G2C A;  1D0Y A;  3F2E A;  2HPC B;  1URQ B;  4IE7 A;  4EYY R;  4PJJ A;  4QX8 B;  5HXH A;  5JDM A;  3K3O A;  2IC6 A;  3KV9 A;  3RC8 A;  2Q9Q A;  4ZKP A;  2E9X D;  4MAL A;  4UIG A;  4ASK A;  1IFN A;  2XAG B;  3ZLI A;  2MYS A;  4ZI3 D;  4U74 A;  2Q3I A;  3EDV A;  3KFW X;  4OYJ A;  5ETW A;  5FY1 A;  5HWY A;  5CA1 E;  3KVB A;  3BQL A;  2FYU K;  1HTL C;  2CLY C;  3KV5 A;  3B13 A;  3VOP A;  2FFD C;  3ZMT B;  3B5N C;  2YEV C;  4DBR A;  5AFU L;  2I1J A;  2LOS A;  5LP6 E;  1N7S C;  2KYV A;  2Q9Q B;  3KPE A;  1IFM A;  3FBZ A;  1Z0P A;  4H9S E;  3N9L A;  3V2R A;  4C46 A;  1JTH B;  3GWH A;  3CX7 B;  4O4J E;  5JRC B;  3N2K E;  1D0X A;  5LA6 E;  2DWG A;  2LSI A;  2IC9 A;  5AW3 B;  2MOZ A;  3UFE A;  2LHR A;  2DHR A;  3MTU E;  1IZN B;  2WWU A;  3QC9 A;  2FYZ A;  3BVH A;  4QXC B;  4JYC A;  2QM8 A;  4UF0 A;  1LTT C;  3M91 A;  5AVZ B;  3M65 A;  3SS1 A;  3RL0 B;  3V2Q A;  1EZ3 A;  3HE5 A;  3CX8 B;  3ZC1 A;  4ERR A;  2YKO A;  3LIE A;  1RF0 C;  2OAR A;  4OFZ A;  5FY7 A;  2NW9 A;  2HFE D;  3I9Y A;  4CI3 B;  1RF1 A;  2ODU A;  1X79 B;  2L5G B;  2CCQ A;  1PFI A;  3ESL A;  3I5C A;  2GM4 A;  1S94 A;  4PK4 A;  3VU7 H;  3ZJ1 A;  2DI4 A;  4HYT B;  3RK3 D;  4UV8 B;  1T8Z A;  4AQR D;  2ZM8 A;  2LKM A;  3T97 A;  5CB4 E;  4AI6 A;  3BAT A;  2YO3 A;  4GIW A;  4JEH B;  1NTZ K;  2KT9 A;  1T2K D;  4BJN A;  3M9Q A;  4TV9 E;  1SP4 A;  2A45 G;  2WPS A;  3VMY A;  3HUS B;  3IF8 B;  2H7H A;  4AKR B;  1RF1 C;  1NWM X;  3CKD A;  4WNK A;  5HXR A;  2Z5I A;  1HF8 A;  2FFD B;  3HL6 A;  5CJ0 A;  4IFF A;  1SQV K;  4WY4 D;  2W27 A;  3SOL A;  1IFJ A;  2POH A;  2GK9 A;  4IHJ E;  1VDF A;  2XV5 A;  2YMY A;  2C5J A;  4C91 A;  1O3X A;  3VP9 A;  2KIN B;  2EHO A;  2A45 H;  2P1J A;  4IDZ A;  5ADX L;  2LE8 A;  4KMC A;  5BVZ A;  1AQ5 A;  3A3Y B;  4ZKU A;  2VKH A;  1MFZ A;  4C7R A;  2CXF A;  3C4X A;  1LGH B;  2DWK A;  3PUR A;  1M1J C;  3J9X 1;  2R32 A;  4WBO A;  5AW1 B;  3V4Q A;  2H8P D;  4RES B;  5AVU B;  2VKO A;  2VK9 A;  3RX6 A;  4CZZ B;  2I59 A;  3VKG A;  4QX7 B;  1G8X A;  2V7K A;  5AVQ B;  1X9V A;  3UTK A;  5HXS A;  3VKH A;  2GUV A;  1L0N K;  3ZN0 B;  4PJN A;  1G73 A;  1H89 A;  5AVX B;  1MMG A;  4IGU A;  4CXX A;  3L35 A;  3NXS A;  5FXZ A;  3CVR A;  2OYH C;  4GK5 E;  5JDH A;  5HXC A;  2X51 A;  1U4Q A;  1XTG B;  2CA5 A;  2UXN B;  3B57 A;  5JDN A;  1LTJ C;  1YTZ I;  3VN0 A;  2LHN A;  3NBX X;  3OKQ A;  5FXW A;  1US7 B;  1JUN A;  1KIL A;  1LTB C;  2O1J A;  2ODV A;  2H7V C;  2QA7 A;  3MD0 A;  3RK2 C;  5J1G A;  1LWU A;  5AVY B;  1JCD A;  1H88 A;  3HUS A;  1IJ5 A;  1A02 J;  2HPJ A;  4JEU B;  2KWI B;  4ISS A;  4AQG A;  4M3L A;  4WBA A;  3HD7 B;  2OYI B;  5HYA A;  4B86 A;  2VRS A;  2C5K T;  1SQX K;  4ILU A;  1OWA A;  3PDY A;  1ZR4 A;  2I1K A;  2ZMA A;  2X67 A;  1QL2 A;  3EQ2 A;  4Y99 B;  3MA9 A;  3WI3 A;  4XE5 B;  1GK4 A;  1NH4 A;  1J1E C;  3R84 B;  3P8M C;  1HX8 A;  2JJ9 A;  1X79 A;  4Z8X A;  3H37 A;  3W15 B;  2BZB A;  3GN5 B;  5JR9 A;  2NP9 A;  3GHG A;  3L36 A;  4NUU A;  2GUS A;  3FHN A;  4O9B A;  2VL8 A;  1KNZ A;  3P8C D;  2P2U A;  2BDE A;  3ANW B;  5LHH B;  3AAA B;  3RYC E;  1M1J B;  1HH0 A;  4JF7 A;  3RPU A;  1MNE A;  5APU A;  5AW7 B;  2N1G A;  3GMI A;  1HBW A;  1CZQ A;  1HGV A;  3L37 A;  4W7Z A;  2XHE B;  4E7Z A;  2XKM A;  1CI6 A;  5LGN B;  2OA5 A;  4YFS A;  4P09 A;  3IBP A;  5KX5 E;  2ZLY A;  2WMN A;  4H9Q C;  4UEM A;  3ZJ2 A;  4FI5 A;  5L2L A;  1IK9 A;  1G2C B;  4GT1 A;  3HTK A;  1LVF A;  2X9W A;  4GOU A;  2IW5 B;  3M9B A;  4CI1 B;  3V2N A;  3KQG A;  5KTB A;  1WYC A;  1YD8 G;  1EQ7 A;  1SLQ A;  2NW7 A;  3Q5X A;  3M9H A;  1FZE A;  4PFP A;  2H7O A;  3AB3 B;  2VKJ A;  3MKD A;  2J1D G;  3AA7 B;  1J2J B;  1UCU A;  4GYR A;  5LG4 A;  3O8Z A;  2Q9Q D;  3AA0 B;  4TZ4 C;  5A1L A;  3OAK A;  2EHO D;  1M7L A;  4CXW A;  3KDP B;  3LJC A;  3SRZ A;  5KDM C;  3MIW A;  1HWT C;  3KV6 A;  3O1H A;  4ZS2 A;  2BVL A;  4I4T E;  1N7S D;  3RK3 C;  2FFD A;  1BR1 A;  4PNI A;  2KLV A;  2KP8 A;  3J7Y q;  5HXE A;  2X68 A;  2HOD A;  4IFM A;  1GL2 C;  1L4A D;  2X9Y A;  3VP8 A;  3RK2 D;  3NZQ A;  2C5I T;  3S4U A;  3NMD A;  1YKH B;  3N9N A;  1SFC B;  3RKO A;  2V7M A;  4CI2 B;  2K5B B;  2XAH B;  3K3N A;  1RE4 A;  3LID A;  2W61 A;  1URQ D;  2OYI A;  2HYN A;  2JEE A;  2NWB A;  3K3Q C;  4JLE A;  1U5P A;  5KJ7 A;  4XBF B;  1JY2 N;  2WSC H;  3B8E B;  1E5W A;  5APQ A;  1M1J A;  3E1I A;  4A56 A;  2YIN A;  5L3B B;  3OA7 A;  3AAE B;  2CM0 A;  4PJM A;  4QHO A;  4QWN B;  5J2U E;  1IFD A;  3C50 A;  1CUN A;  4BAY B;  3ZMU B;  3RRC A;  3N5L A;  1JY2 O;  4N78 D;  3VMZ A;  1FZC A;  4XZC A;  2WPR A;  3RYI E;  1DH3 A;  3N4X A;  3L3P A;  3HE4 A;  2YKQ A;  2FXM A;  2LSG A;  4MFR A;  4AKH A;  5L3E B;  3AA6 B;  2HG5 D;  2P7J A;  1JNM A;  4BJM A;  1LTJ A;  4J2C A;  3IHR A;  4AXP A;  4ZI7 E;  4KUM B;  5LHG B;  3DTO A;  5FYM A;  3M0D C;  5APW A;  2IAK A;  3CQC B;  4O4I E;  4QXB B;  4ZI2 D;  4CXY A;  1NHL A;  3TNU A;  1OXZ A;  5JRC A;  4AKG A;  2JMH A;  3RH3 A;  2CWO A;  1CI6 B;  4GKG A;  2CXD A;  1RY3 A;  2M3B A;  1RF1 B;  5L3D B;  2R3C A;  2N1T B;  3CL3 D;  3MUD A;  5JH7 E;  2C0W A;  3A5T A;  3OBV E;  1UX5 A;  1VOM A;  2WM9 A;  3C51 A;  1QSD A;  2ZM2 A;  2HLO A;  5BU8 B;  2C9L Y;  4HFV A;  4DMV A;  1LTI C;  1NAF A;  1JO5 A;  2VAS A;  3CI9 A;  1MUU A;  4P0A A;  5CCG A;  4QKN A;  5J2T E;  1BR0 A;  1LVK A;  4LGD E;  4LLH A;  2G0U A;  5CHX A;  2EHO C;  5TAO A;  3ZCJ A;  3HA4 A;  2X66 A;  5APS A;  4M1P A;  3T8O A;  1HG2 A;  2ES0 A;  2V7I A;  4AUW A;  3NRX A;  5F3J A;  2FKW B;  4UVC B;  2YK0 A;  3IR9 A;  4O2A E;  2VB6 A;  1URQ A;  2WPQ A;  1N7L A;  3WAK A;  3I9W A;  3P8C E;  3VYI A;  1JY2 P;  4DVD A;  3N2O A;  2M8R A;  3PU8 A;  4ZOL E;  5LJN A;  4X1I E;  1GL2 D;  3KV4 A;  3CQX C;  3PUQ A;  1WR6 A;  5C8Y E;  1SFC A;  2B1E A;  3A5X A;  2DLR A;  3O1I A;  1FBM A;  1SQQ K;  1HUC A;  1IFI A;  1L4A A;  1Z56 A;  1NWQ A;  2XAJ B;  2Y8D A;  2IFM A;  4PW8 A;  4YJ2 E;  2E43 A;  2MTQ A;  3KIN B;  1BR4 A;  1FAV A;  2R5B A;  2XDJ A;  5DQW A;  3I1A A;  4I2L C;  5APY A;  5GON E;  3ZPO A;  4PK6 A;  4DMW A;  4WBN E;  4I43 B;  3O1J A;  3ZCI A;  4IE4 A;  4YLH A;  5LJM A;  4PJL A;  2YO2 A;  3LFM A;  2CE7 A;  4FJO A;  1G1I A;  4ADZ A;  1SVF A;  4WB4 A;  3LG7 A;  3P32 A;  1L4A B;  1UX4 A;  1FMV A;  3FB2 A;  4X1K E;  4AKL A;  4V1A v;  2L8K A;  3HKB E;  3H32 A;  1GU5 A;  1ZV8 A;  3NTN A;  3HD7 A;  5LXT E;  3EVY A;  3HR0 A;  3BQK A;  5AW4 B;  2H3R A;  3ZEF B;  1LT9 C;  5CCH A;  3N9P A;  4YJ3 E;  3I0O A;  2YU1 A;  3U1A A;  3P7I A;  2MJZ A;  1KIL B;  1IC2 A;  1IJD B;  1T3U A;  2YKP A;  3UIA A;  1GDT A;  1LKX A;  2KXP B;  3HKE E;  4EAH A;  1ZEE A;  1MMA A;  2E9X C;  3E0Z A;  3ZC0 A;  1GW4 A;  1GD2 E;  4KP3 C;  3TYY A;  1D1A A;  2JMK A;  3HUS C;  4ZI3 C;  4OYK A;  1AFO A;  1VPC A;  5KJ7 C;  3ANW A;  1T3J A;  2PJQ A;  2ZM0 A;  5FY0 A;  3O9X A;  3E22 E;  1MND A;  2NPS C;  4MHC A;  4H9R C;  3UUL A;  4ZHQ E;  5JQG E;  4O2B E;  1ZN5 A;  2Z5H A;  3B5N D;  5CCG C;  2N9D A;  3O4X E;  4JUY A;  5L3C B;  3PUS A;  3TNU B;  3WMM 0;  2UXX B;  3A7O A;  1SFC D;  3U59 A;  2WMO A;  2XAQ B;  5LNK A;  3JC6 D;  1CSB A;  4IFD K;  4E7S A;  3HRN A;  3ONX A;  2PBI A;  4N78 E;  1VRB A;  4JYB A;  2OYI C;  4XAX B;  2QM7 A;  1RE3 A;  2OYH A;  3KDS E;  3PTR B;  4L9I A;  4PK5 A;  1WYB A;  1JY3 P;  3R2P A;  2Q7C A;  2M67 A;  1KQL A;  3C4W A;  1HJB A;  1GK6 A;  3B5N B;  3BQI A;  2A3D A;  2C9N Y;  1N7S B;  3M0D A;  5E0O A;  1J1E B;  2CPS A;  2CXL A;  1ZLL A;  2CPB A;  4HKA A;  4N3Y B;  1MV8 A;  4IIJ E;  4G2A A;  2WT7 B;  2WT7 A;  1MMN A;  1NTK K;  4I55 E;  3LK3 B;  1N73 A;  3U3I A;  3HKC E;  3HKD E;  3L09 A;  4G63 A;  1LT9 B;  1WT6 A;  4I1L A;  3VTP C;  1D1B A;  5FXV A;  4K0U A;  5FMN A;  3MZK B;  3FXE B;  3NFQ A;  2V26 A;  3RL0 D;  1CW5 A;  2XAF B;  4HGA A;  1FZF A;  3Q5W A;  1LTJ B;  4N6J A;  3SWF A;  1S9K E;  1KZU B;  1N86 A;  4BA9 A;  1ZKE A;  4GK0 E;  1ZR2 A;  5AW9 B;  4U72 A;  3L4F A;  2D2S A;  3KYQ A;  3H3A A;  2W62 A;  1W2E A;  1RE4 C;  1NKZ B;  2O1K A;  1SHZ C;  4HN9 A;  5DAB A;  3TKL B;  3V5U A;  4IE5 A;  2KMF A;  5JDF A;  5FP3 A;  2HH7 A;  1SQP K;  4W7Y A;  1E1H B;  2JPF A;  2NPS B;  2LSK A;  4EIW A;  2L9Q A;  2PAJ A;  1AJ3 A;  2W6B A;  4DBQ A;  5HWX A;  4YHJ A;  3UT5 E;  2O01 H;  3V4W A;  2EHO B;  2SPC A;  2HPL A;  4O8S A;  4TX5 A;  5FNV E;  2WZ7 A;  4EZH A;  1L4A C;  1JY3 O;  4NUV A;  4IST A;  2DCF A;  3U1C A;  1NU1 K;  2A72 A;  5BMV E;  4HH2 A;  1FDM A;  4P0B A;  3OJA B;  2K48 A;  2NPS D;  2OYH B;  3CML A;  3K8P C;  2ZXE B;  1XTC C;  5BU5 A;  2WBL A;  3N9Q A;  5AVV B;  3PUG A;  4MBQ A;  3RYH E;  3UUX B;  4H9P C;  3OYZ A;  2HPC A;  2HOD B;  5CCH D;  4AKI A;  5AVT B;  3HI2 A;  1KIL C;  1SFC C;  3JC6 C;  5LBQ B;  5LGU B;  1LWU C;  1IO4 A;  4I6M C;  5AVR B;  3OJA A;  1FU1 A;  1GZL A;  2WSF H;  3MGN A;  1A02 F;  3HE4 B;  3E08 A;  1LTS C;  3IFM A;  3CLQ A;  3HD7 C;  3QUJ A;  2WWW A;  2KWH A;  1LT9 A;  5CCH C;  2N1T C;  5L3F B;  2KND A;  1JCC A;  4C7N A;  2Y6X A;  5DQV A;  4L5G A;  4PFO A;  4AQF C;  4UEL A;  2Q9Q C;  4GYS A;  5IYZ E;  3LK2 B;  1FIO A;  2P67 A;  1D0Z A;  2W63 A;  3A2A A;  5JR9 C;  2N9B A;  2CWY A;  4OH8 B;  2XUE A;  2LT3 A;  2LM9 A;  3ZYM A;  2Y48 B;  5APT A;  1QL1 A;  3CPZ A;  3P7K A;  2NOX A;  5H6Q B;  2N1T D;  4W80 A;  4KHX A;  1IAP A;  1HVV A;  4KBM B;  4H63 H;  5JDG A;  1SA0 E;  2RP4 A;  4WY4 A;  1D1C A;  4IE6 A;  2WAU A;  1WLX A;  4LC1 A;  2V7L A;  2E9X A;  1N73 B;  2E42 A;  1DX7 A;  1GTW A;  5JRE A;  1T2K C;  5JDQ A;  5KJ7 D;  5IHY A;  3GN5 A;  3V2P A;  2X9H A;  4OHF A;  5LYJ E;  1NOH A;  3C64 A;  4O4H E;  4CQI A;  5AW2 B;  3B5N A;  4WY4 B;  1B7T A;  3GA8 A;  4L0R A;  2QGS A;  1HG5 A;  3MAC A;  3Q9D A;  3BAS A;  4OK0 A;  2NW8 A;  4Y99 C;  1ZV4 X;  3KBT A;  4DND A;  4UV9 B;  3PU3 A;  3PE0 A;  5HAX A;  5DJQ C;  1G1J A;  2Q5U A;  2IX7 C;  2NTY A;  1NO4 A;  1N73 C;  4H9N C;  2A45 I;  3GHG C;  3DJB A;  1JY3 N;  3RK3 B;  4GIF A;  3I0Q A;  2CEA A;  3ZMV B;  1X8Y A;  1YW0 A;  4EIJ A;  2WSS V;  2W0G A;  3ETU A;  4HTE A;  4ZS3 A;  3NRY A;  2XTL A;  1KIL D;  2W6A A;  3II6 A;  3F57 A;  1HGZ A;  1WRD A;  2YU2 A;  3R6N A;  3ZYL A;  4DO0 A;  3VHL A;  3M0A A;  4EYU A;  1FZB A;  4ZI2 C;  1FZC B;  3BK9 A;  4UVA B;  1FJP A;  5EK3 A;  5AVS B;  2D5U A;  3N2G E;  5AVW B;  2K9A A;  2LSY A;  4QXH B;  3RYF E;  2PFV A;  3C9I A;  3GHG B;  3SWY A;  1N2D C;  4TV8 E;  2NPS A;  2ZFC A;  5M4Y A;  1WRG A;  2C0S A;  1KFN A;  2LOP A;  2LSJ A;  2PG8 A;  1HFA A;  1JOC A;  1MIV A;  3ETV A;  1V9D A;  2YNY A;  2VWA A;  5H6R B;  4C90 A;  5L3G B;  2Q9I A;  2H43 A;  1MMD A;  2VKD A;  4MLK A;  2RA1 A;  3LW5 H;  3N7N A;  1IJ6 A;  4B6X A;  4EXT A;  5AW6 B;  1FZC C;  1BR2 A;  1QUU A;  4X1Y E;  2XU6 A;  5F8P A;  2KB7 P;  3H6P A;  1H7C A;  4IE0 A;  5LGT B;  3N9M A;  1KK7 A;  5APX A;  1FOS F;  5EK4 A;  5JDL A;  3EUH A;  1HCI A;  4DOJ A;  5CMZ A;  2XQY A;  3AVS A;  1H8A A;  3MJX A;  2KOG A;  2A2F X;  3KVA A;  1HTJ F;  5LCY A;  3U78 A;  1LTA C;  2R5D A;  1GL2 A;  2J59 M;  2JJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...