1OXZA

Crystal structure of the human gga1 gat domain
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
132
structure length
132
Chain Sequence
DEEKSKMLARLLKSSHPEDLRAANKLIKEMVQEDQKRMEKISKRVNAIEEVNNNVKLLTEMVMSHSQGGAAAGSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEILQANDNLTQVINLYKQLVRGEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords ADP-ribosylation factor binding protein GGA1
publication title Crystal Structure of Human GGA1 GAT Domain
pubmed doi rcsb
source organism Homo sapiens
total genus 51
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03127 GAT GAT domain
A PF18308 GGA_N-GAT GGA N-GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1oxzA01
1.20.58.160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1oxzA02
4DZOA 2E43A 4KHXA 5AW4B 5AW8B 1GK4A 3L36A 1X79A 3M06A 3I5CA 4XE5B 2P7JA 1HWTC 1WRDA 1A02J 2N2NA 5AW9B 1HBWA 2Q5UA 3HE4B 3MGNA 1YYCA 1S9KE 4JYBA 3MD0A 3P7KA 3VYIA 5AVTB 1OWAA 3UIAA 2N9BA 5APXA 5AVZB 1GU5A 2R3CA 2H7HA 2WT7A 3M9BA 5AVXB 1GK6A 1MV8A 3A3YB 3NFQA 3A7OA 3VMYA 1GTWA 1A02F 1G2CB 4C7NA 1O3XA 3NMDA 5AVSB 1FOSE 2QM8A 3T97A 3M0DA 1JNMA 1NAFA 3KQGA 3P32A 5AW1B 2Q3IA 4M3LA 3KDPB 3OAKA 2WPRA 5AVWB 2QM7A 5APYA 1JUNA 3V4WA 2XV5A 5APQA 2JJLA 5AW7B 2WPQA 4I6MC 3HE4A 1NWMX 3M9HA 5AW3B 1SP4A 3L35A 3TNUB 4HYTB 4AQRD 2W6AA 1S9KD 1T2KC 1X8YA 3HE5B 1CI6B 3NXSA 1CZQA 2YNYA 3V5BA 2YO3A 3B8EB 2WPSA 2C9NY 1J2JB 1H8AA 3A5TA 3M91A 1NWQA 2XZRA 1FAVA 5AVQB 2Z5HA 3SWFA 1GU4A 4LC1A 3A2AA 2P67A 2R5DA 2XU6A 5AVYB 4C46A 2KP8A 1IO4A 3HTKA 3NTNA 2C9LY 3O8ZA 4I2LC 3VTPC 3VMZA 5APSA 1YD8G 1WR6A 3TK1A 3TYYA 1GZLA 1T2KD 2ZFCA 5AVRB 2WTYA 2ZXEB 1HJBA 3IR9A 1H88A 4GKGA 3TNUA 1H89A 3V4QA 3HE5A 1MFZA 1CI6A 1GD2E 4AYCA 3M0AA 4B86A 4GT1A 1OXZA 5APUA 3LIEA 3P8MC 4JYCA 2N9DA 2WT7B 4RESB 1HUCA 3L37A 5CMZA 2R5BA 5AVVB 5APWA 5AW5B 2R32A 2VRSA 5APTA 3VMXA 1DH3A 5APVA 3VN0A 1FOSF 5AW2B 2Q7CA 5AW0B 4C7NB 5AW6B 3LIDA 1SLQA 5AVUB 2BASA 2P2UA 1CSBA 2W27A 4EOTA 4AUWA 2IPPA 2YO2A 2Z5IA 2E42A 1KQLA 2WWWA 1MUUA
chains in the Genus database with same CATH superfamily
4PFOA 3H1KD 2CMRA 3LK42 2RMZA 1LTGC 2OARA 1RE3A 1EDJA 2V6XA 4JUYA 4HFBA 3TF5A 1FZCB 4YT0A 4NXNT 2P58A 2DCFA 1BE3J 2YK0A 2OV9A 4COFA 2WMNA 2QSIA 3BASA 2CHOA 2FYUJ 1HR0T 1RE4C 5AVXB 2LE8A 3NFQA 2B87B 2VQET 3RBZA 1A02F 3RF1A 1RF1A 1KMIZ 4TV9E 3ZT6A 3ZSTA 1LTSC 3NMDA 2MYSA 5L3FB 2SPCA 3LSVA 3RL0C 1NU1D 3L71D 4W7YA 2QJYB 3IF4A 4EGWA 4AQGA 3BCCG 1ZW0A 4WY4D 4CZZB 4U33A 2JMHA 4HFDA 4HB1A 1SQBG 1ZOYC 4PFPA 1KB9H 4O4IE 1KILD 3A5XA 3P50A 4XZCA 3UQ7A 4H13C 3UUMA 1VF5C 2ZXXA 3NXSA 1YIJP 4ZI2D 2Q9QC 3B8EB 2KLUA 1Y64B 3USSA 5ABEA 2HR3A 5FY1A 4YPCA 3EVYA 1FAVA 3PURA 4IOIH 1XWMA 1KF6A 3H1JG 3W67A 1QVFO 5J2TE 3JAFA 4I0UA 3AEEC 4DBQA 3GW6A 5KLVD 1OFCX 4IDPA 4QXBB 2FBWC 4A56A 1L0LK 3L72E 3RL0B 1JY2N 2PG8A 2ZFCA 1GL2A 1ZP0A 3LW5H 2BCCJ 3F5HA 2M3EA 3PDYA 3PUWF 4JV5T 2KSJA 3ZEFB 2YXRB 1VQ8P 1PV3A 3UU4A 2D2SA 2X66A 1X22A 2R3SA 4PD4E 3II6A 5KTBA 2HPLA 2FYNB 3LIEA 4TWHA 4JI4T 1XTCC 5KX5E 5AQUB 2R32A 1NTZJ 1L0NG 1W5CE 5AW2B 2LHRA 2Q9QB 4IDNA 4H63H 2NPSC 5DJTB 3AAIA 3Q1MA 3T1YT 2QIWA 4D6TD 1ZV8A 3CCLP 4KHXA 1LTJA 3AEBC 2CRBA 3B13A 4HWFA 1D7MA 5B66E 4DV5T 2KNDA 4XE5B 4H9SE 5AQNB 2IBZG 5KAIE 5KXJA 3CCEP 2CA5A 1DD4A 4JYBA 4B3ST 1VPCA 2A06D 1OEDE 2IDOB 3D6ZA 4I4TE 2HG5D 3PHLA 5AQVB 3AE9C 3H1KJ 1GK6A 3ZN1B 3KVAA 1QL1A 2J58A 4I43B 3AE1A 5HEJA 2QE7H 2Y0CA 5CCGA 4AQFA 5FXVA 3Q5XA 4UXNB 2FFDB 1JOCA 3HKEE 4WBOA 1JNMA 4W7ZA 1MFTA 4KT0J 3IAOA 4DR7T 4QXCB 1VQOP 2N1TB 3RK3E 4FJOA 2OYOA 1SFCC 5APYA 5E0OA 1QVGO 2WPVB 1HTJF 5AW7B 2NPSB 3PRJA 3CKDA 4ZKPA 5B5EE 3LDQB 1FIOA 2W63A 4EIWA 4LMLA 2OTLP 2L3LA 1S5LE 3ONXA 1PL5A 3ZCIA 4E7SA 1J5ET 3NVOA 4JI5T 3RRWA 4JYAT 2ZM0A 4ASWA 3HL6A 1GU4A 5EK4A 2JWAA 2W00A 4XBFB 1GDTA 2CHNA 3AVSA 4JF7A 2YKSA 3H3MA 4O4HE 3SWHA 5L3GB 3HRNA 3H1HD 2X67A 3B4SA 3H1KE 5GTHH 2M8RA 4X20E 1S5LX 4TWDA 5HEOA 1YD8G 2BG9A 3TYYA 3FZFB 3PU8A 4ZHQE 2YXQB 5L3DB 4TZ4C 4OGQD 3CXHH 4P1NA 1N73C 1M8OB 2NWBA 5LG3A 4UB6H 3FWLA 2KZJA 3V5UA 1SFCB 3ZC1A 1G2CA 3RX6A 3GHGC 4ZZCA 3M0AA 2VK9A 3ZJ1A 1YJ9P 3AE8C 5KLVJ 2UXXB 3ZJ2A 5AFUL 4X66T 3PJAA 4OX9T 3QH9A 3PTRB 4IL6H 5AW5B 1SQPK 2XAQB 1NU1E 1FOSF 4IHJE 3L71E 4X1KE 3HUSB 1LTIC 4AIUA 1NKNA 1ZLLA 1JNZA 2LOPA 4EEBA 4DR4T 2WWWA 3FXDA 3Q5DA 1KZUB 2WU5A 3AE6C 2XDJA 1EZVE 2WSCH 4YTPA 1OW7A 1T98A 1HG5A 3S1KA 4NUUA 4OHFA 5AQRB 3CI9A 1UIIA 5M4YA 4GODA 4EEDA 3JADA 3JCFA 3MD0A 1B7TA 3IBPA 5HXSA 4DT0A 2W67A 4BAYB 1GL2B 3V2QA 3QNUA 5AVZB 3HD7A 4BJMA 5FL0A 1NKZB 1WYCA 4H9OC 3KV4A 4GOFA 2OYIC 2D2CD 2Y0EA 3OYXA 3L73J 1L4AC 2D5UA 1X9BA 1KEYA 4QMAA 1SVFA 2H88C 3J7Yq 5KLVE 3TGUG 2BS2A 5LHIB 3G3ZA 3ZYMA 2JR8A 2IBZI 5KJ7A 4EZ4A 1ZR4A 4Z8XA 1BGYJ 1CW5A 3U3IA 4GOEA 4KUMB 3ZT7A 3TLVA 5ABFB 2YNYA 3FXEB 3V5BA 2JDIH 2MKVA 2C9NY 3RYFE 1RHZB 2KSEA 2XPKA 4DMVA 5JR9C 1SQBD 1FZFA 2E5TA 2HH7A 2WMMA 3KV5A 2JRKA 2DW3A 1NGMB 2XKMA 3RK2B 5JDLA 1IK7A 3F2EA 4QWNB 3NZQA 3CMEP 1L4AB 1LP1A 1T2KD 4EXTA 1KNPA 2OA5A 2UUCT 3KHUA 1YI2P 3IR9A 3L73E 4GKGA 4PD4H 3H1ID 2KMFA 2YU2A 2KINB 4Z91A 5EK2A 1HGVA 4BRYB 3D71A 4UELA 2EHOA 1HUCA 1T8ZA 4PV1D 4XFJA 1YKEB 1BGYE 5IWAT 3VN0A 1P84I 4A97A 2FJEA 4RJTA 1JY3O 2K3WA 2YDRA 3N2KE 2DI4A 5JR9B 5FYMA 1JB0J 5B66H 1FE6A 1MUUA 3PV0F 4HFIA 1SQVG 1IJ5A 4IE4A 4EZHA 5JVDE 3RQUA 5KAIH 2I8DA 5GONE 1QSDA 4HWHA 4ASKA 2YN6A 1L0ND 3DTOA 1VQ7P 1PIXA 1T72A 3UIAA 2DHRA 4EOZB 4NPEA 5TJHA 2E9XA 4YFSA 2H89C 1ZMEC 3EI0A 2PP6A 3UT5E 1G2CB 1NO4A 2IYOA 5AQLB 1NTKK 2E74B 3C50A 2LHNA 3O4XE 2FXMA 3QUJA 2UXBT 2WBLA 3H1HE 4H0LC 1N7SA 4ADZA 1NTMG 3V4WA 3B57A 4ZS2A 1BCCD 5APQA 5H6QB 3BQIA 1IFMA 3M9HA 3CQXC 1S5LH 3CCMP 3P4WA 1SP4A 4DV4T 2YOEA 3L35A 5FMNA 2WMOA 1CI6B 1JMMA 2WZIA 2CPTA 3A8YC 3TLWA 3ZMTB 2I1JA 2YEVC 1UGOA 3SOLA 1W0BA 2K3RA 2HODA 4L74A 4QX8B 4UF0A 4UVAB 4JQ0D 2V7IA 3Q2MA 5FVLA 1IFNA 5CBOA 4MN4C 3BCCJ 2E8IA 3H32B 3HTKA 4NPFX 4EB6E 2IUBA 3CIRA 3CPWO 1FDMA 5K5GB 3I56P 4YY3T 4AKIA 1T3UA 5JRCB 2C0WA 3H6PA 3SWYA 3VHLA 2LM9A 4XAXB 3U1CA 2QJPB 3OW2O 4H0LB 2B76A 3RIUA 1P84D 2ZM8A 1KK7A 2E75B 1VQLP 2XQ6A 1JMBA 4EIJA 4LMJA 2OTKE 4QH4A 4WY4A 1M1JA 2VL8A 1OMIA 3CX5I 1D1BA 2WM9A 1WYBA 1YTZT 1KILA 4R4LA 3H1JJ 3G4SP 4ZI3D 2M67A 4HJGH 3ZN0B 2VURA 1KFNA 1OEDC 2I0MA 4RO0A 2M0BA 1MIVA 1U5PA 2FJDA 3I5CA 4AISA 5DJQC 4D6TG 4X1YE 1KQSO 2J5UA 3BCCE 2FYUK 5HEGA 5L3EB 1YJNP 1OVUA 1Q90D 2W62A 3L70J 4KHPT 1OWAA 5KJ7D 2LXCB 2KWIB 2R3CA 3RK3C 1SQBE 3CCRP 1HGZA 2IC9A 3G06A 3I0QA 4ZXLA 4LFCT 1URQD 3NZPA 5AQIB 2A06G 3LBXB 1BR4A 4X64T 5HWXA 2QJKC 1LT9A 1D1AA 5EZYE 5JDFA 3PUZF 4F8HA 3ZMZB 1KC8Q 2JWDA 2BKOA 1T6AA 2AE9A 3AE4A 2E76C 1OW8A 2ZVNB 5DJUB 2DWGA 3N4XA 3QC9A 3EHZA 1K04A 5AW3B 4Y28J 3PUSA 3H1JE 1Q86Q 1OEDB 3D0TA 2KI7B 2ZT9B 5LB7B 4L0RA 1RF0C 3L75G 4YJ3E 2KXPB 1NAYA 4O8SA 5CA0E 1S3JA 3AE7C 1VCSA 1SUMB 3E1RA 2I1KA 4HGAA 4U72A 1N32T 2Z5HA 2LKHA 1SQQJ 2WQYC 2NTXA 3RK3B 2WWUA 3KBUA 2EHOD 2Z6EA 1EDKA 3P4SA 2OYHA 5CB4E 3FB2A 1KNRA 1N8RQ 3CCJP 2XNXA 3B5ND 4BXLA 2IZ1A 3CX5D 2WCAA 4N6JA 4V1Av 1X79B 1L0NE 4F6RC 3PJAJ 3HE5A 3UU8A 4U3FG 1L0VA 2W61A 2BZBA 2VKJA 3UU5A 5GTIE 2WSCJ 2YDQA 2WT7B 1K05A 3A0HE 1NTZK 3MIWA 2IBZE 3ESLA 5C2TA 2R5BA 5F5WA 1Q82Q 1FZCC 4IE0A 3S4UA 1L2PA 3HKCE 3CC2P 1RH5B 2BASA 1AQTA 4DOJA 1E7PA 1G73A 3SFDA 4Q25A 3PLNA 3RIAA 3FZKB 4ZNCA 5AW4B 1GK4A 1MIWA 1SQQE 3HTKB 2Q5UA 2BG9E 1VCTA 3VKGA 1IFJA 3R6NA 4OK0A 4DR2T 3AEGC 1SQVD 3WMM0 4NXMT 1T7SA 4JPZB 5JQGE 1HF9A 4WYVA 3I1AA 2HPCB 3BRTB 1KN7A 5CA1E 3UFGA 2ZAEB 2KIKA 4DV0T 2NR4A 3VOPA 4ZEYA 2XSBA 1IBMT 3SS1A 2D0UA 4GYRA 3AEFC 4DV6T 3WUUA 4OH8B 2I59A 2CXFA 4Y99C 3R4YA 3OPCA 1WCRA 3RGLA 3L72J 4YXDA 1SE7A 1XDOA 1MMGA 1NTMD 2B88A 2BS4A 5DQVA 2WVRA 3OBVE 3BRVB 4I7ZC 4HFVA 2M5AA 2A45G 4U31A 3FZHB 1JM0A 3A2AA 4PK5A 1Z56A 1LKXA 3AEDA 4PJMA 1YITP 5HEUA 2H7VC 2C9LY 2FYNC 4PJ0H 3JCUH 3TGUJ 3IN6A 2XZEA 4ILCA 2CBIA 4PK6A 5APSA 2V7QJ 2QG4A 3K5BA 1WR0A 2QEXP 1FZGA 4IL9A 1FMVA 4H9PC 3VRAA 4OYJA 4LFAT 3PUGA 3V6IA 4H9NC 4UVBB 2AEMA 3HR0A 5KLVK 2RP4A 5BU5A 3U78A 3P4PA 4LF6T 4UVCB 5AQFB 3ZMSB 3MACA 4Y99B 4RESB 1QEXA 3H1IG 3ZC0A 2UWJE 2LKGA 4BWNA 2P1JA 3JC6C 3NRXA 5HCMA 3AE5C 4DCKA 3CWZB 5APVA 3Q5PA 4CQIA 4LGDE 4C7NB 4EI2A 3ETVA 4IDOA 3W15B 1IJ6A 2YO2A 4I7ZB 1UIXA 3OYZA 4DZOA 4B6XA 3VRBA 4JI8T 1N7LA 3MUDC 2ZVOB 5HYAA 3C4WA 5FY7A 1PFIA 2XQ5A 1GQEA 5AW9B 4A7PA 3EWKA 2FFDC 2N9YB 1JY3P 2ACXA 2N1TC 5CCHD 3TGUE 3Q5RA 2MPKA 4H9QC 3ETUA 1N34T 2Y48B 1IFPA 1Y01A 1OIPA 4PJNA 1SQXG 3VMYA 3CC7P 2X9XA 2Q1KA 5AVSB 5HXCA 3ZMUB 4G63A 2MJZA 3GHGA 2LT3A 2O3JA 1BSHA 3LFMA 2WSEJ 1RE3C 2JP3A 2PFVA 5F8PA 2WPRA 3EUHA 2W66A 1XDPA 4C90A 3CX5E 1PGQA 2BVLA 3A7MA 2KUBA 3UULA 2H7OA 3UQ4A 1HNWT 3HE4A 4GOUA 5AQKB 1USDA 3P7IA 3ZYLA 3ANWB 1BCCG 2IFNA 2YO3A 2WPSA 4LF5T 3RL0D 4ZKUA 1KORA 2G0UA 3DJBA 3MTUE 4MALA 2NZ2A 5JTGA 2XHEB 2Y8DA 4TX5A 5AQMB 5JDHA 4ILBA 4IREA 3L75D 2LRKA 4CXYA 1FBMA 1E2AA 3C4XA 5ABHA 1LTAC 1Y8AA 1VOMA 4DV7T 2LR2A 4OGQB 4CI3B 4H13D 1VF5D 2IC6A 2XQ4A 3RYIE 2I6HA 3QB5K 2K9JA 1WR6A 1NU1J 1SS1A 3L71J 3KV6A 2WTYA 1R8IA 4JI1T 3D70A 2PGDA 2Q9QD 2UUBT 3G6EP 3HUSC 3PTZA 2KLVA 2AEJA 3L39A 1D0ZA 4H44C 2PRRA 3GN5A 5GTIH 3CCQP 2LRLA 3RI5A 1SQVE 3WAJA 3A0HH 2XUEA 3QWOC 5APUA 2CM0A 3P8MC 2QGSA 4O4LE 1V9DA 4PJJA 2E5LT 2A45I 1JNRA 2ODUA 3IHRA 3CCVP 1RF1B 3C98B 1OZHA 5AW6B 1SLQA 1QGKB 4U3FD 3ZMVB 1RY3A 2K9AA 1GL2C 5JH7E 1ZP0C 2V6YA 2UU9T 1J1EC 1LRZA 2BDEA 3KYQA 3KBTA 4GKJT 4DMWA 1Y9BA 4HWIB 4E7ZA 2M3BA 2WDVA 2DWKA 3TSIA 2BEQD 2XAJB 1MNDA 1OW6A 3KZIE 3DP7A 5TISE 4KP3C 2CLYC 4UIGA 1LTTC 1EZ3A 3WAKA 2D2CB 3EDVA 3EQ2A 2O01N 2NW9A 2NPSD 4L9IA 2CE7A 3I9YA 4H44B 2L91A 2NTYA 4JI6T 1Q81Q 2LKMA 2WY2A 4LMKA 4NPPA 5EFWB 2PTFA 3PJSK 1LVKA 3Q9DA 2ZYGA 1KILE 2HHHT 2IIUA 3CX6B 3H1LG 4IIJE 5C3JA 3AXJA 1KD1Q 1FJPA 2C5IT 2XAHB 1S1CX 5H6RB 4D6TJ 4B3MT 3MHVA 4IE6A 4KBMB 1KNZA 1KQGB 1J1EB 1M56D 4HYTB 5LOVE 3RK2C 3AE1C 2C0SA 3IEEA 1CZQA 4AQFC 5CCGC 1WLXA 1BE3G 5HXEA 1SQPD 3AEAA 2FYUG 2VVSA 2XZRA 3N9MA 4P0BA 3X1DA 4N3YB 5AVQB 1S35A 1SFCD 2CLYB 4AKRB 2V7MA 1AA0A 1JEKA 5CJ4A 1IO4A 3VP9A 2O1KA 3MJXA 4ISTA 1UK5A 4WNKA 3L8RA 4DR6T 1LTJB 3JSVC 1AQ5A 1URQA 2NP9A 1MMDA 2CWYA 3AE2A 3TNUA 3V4QA 2B9BA 2JPFA 1JO5A 4JBWF 1UCUA 4OWFA 2LSGA 1WMKA 5JREA 3ZLIA 3V2PA 2YMKA 5A1LA 1HX8A 4EV6A 2BBJA 4D6TE 3L74D 1DH3A 2VRSA 1AJ3A 2LJLA 1IBKT 2KZ7B 4X62T 1UURA 3E22E 5IUXA 2WDRA 2BG9C 2LSKA 3AE3A 3A0BE 4IT4A 1DU2A 4TN7B 2X9YA 2V8SV 4U7IA 1S4XA 3FX0A 3AECA 3N9NA 1EC5A 3CXHI 3F57A 4U74A 2A06E 1BR1A 2AXCA 1Z8UA 2E74C 2B1EA 3H1HJ 3EAMA 1G1JA 5L4EA 1YYCA 4LF8T 1PGOA 4H63V 2V7QH 1R5LA 2LSIA 2BCCG 3KINB 2FUPA 4UR9A 1YQ3A 1S2EA 5CJ5A 3B5NA 3A7OA 3KFWX 2JQ9A 1N2DC 1FZEA 4ANJA 2V7JA 2QM8A 3FBLA 3T97A 3CK6A 2AXTE 3L75E 4YTPC 4QH1A 1IBLT 4O4JE 1LWUA 2RA1A 3L4FA 1PP9G 1ZRTD 3CX5H 2NW8A 3GWHA 3KDPB 1BR0A 3RH3A 2V5DA 1NTZG 2X0HA 1XMQT 4JEHB 3CMAP 2V7LA 4J2CA 1SQXD 2BG9B 3RBXA 2LSJA 2X0YA 3SFEA 2J59M 3HD7C 1JY3N 3CX8B 4TUYE 1S9KD 3N5LA 3RIFA 1VQ5P 1L4AD 5CJ0A 1IC2A 1VDFA 2QA7A 2R6GF 2XQ7A 3C51A 2M6IA 3RYHE 5LCYA 1SQQK 1T8BA 3BQLA 3Q5EA 2Y9YA 2XQAA 2QJPC 3RC8A 3J9X1 2E75C 4EYUA 1NENA 4U3FE 2B89A 4C46A 2OLTA 2ZLYA 5AQGB 3B71A 5B5EH 5FXZA 1H0TA 3KXDA 4L76A 3FXDB 1I94T 2K88A 2W6BA 2VQFT 2IYPA 2JQQA 4NPDA 1G8XA 3UUNA 5DABA 2WSEH 3ZYKA 4P0AA 1IFDA 1N33T 4YSYA 4AYCA 1PGPA 3O6QA 4CXXA 5AQJB 1DIPA 4LF7T 2LXBA 4ZS3A 3AA1B 1USEA 3HD7B 3CXHD 1YQ4A 1QLBA 4ERRA 1WFDA 5APWA 4CN6A 2GM4A 1X9VA 2QA4P 4IGUA 4PK4A 5HXHA 4HN9A 1EZVG 1K8AQ 5AVUB 2P2UA 2KK7A 1SQBJ 3Q3DA 2A3DA 2KNCA 3BVHA 4K3AA 1AVOA 1SHZC 1VRBA 3EABA 3I9WA 3S9OA 3T8OA 3L36A 4HEAA 3N9QA 1WRDA 2XAGB 5KDMC 3KZIH 2N2NA 1HBWA 5TISH 3MGNA 3OJAA 5TAOA 2HPJA 4YSZA 1NEKA 1NJIQ 2PFXA 1URQB 1K9MQ 2H7HA 2VB6A 5FY0A 3H1IJ 5IHYA 3N7NA 1O3XA 1VL2A 2H43A 2KSRA 4HTEA 4IE7A 2ZT9C 3RC3A 1QL2A 1M90Q 2Q3IA 3WI3A 1G1IA 3LK2B 3P8CD 1LT1A 4DV2T 2L5GB 2D9DA 4K0KT 5LGUB 1M62A 4P09A 1M1KQ 1LP1B 1L0LG 3UUBA 1NWMX 5C39A 1JCCA 2X9HA 2RKLA 2E9XC 1EQ7A 1LJ2A 2W6AA 3UU6A 3V2NA 3WU2E 2J62A 2B87A 1L0NJ 4Z1MH 3H1LD 2CBJA 4K35A 1SQXJ 3PH0A 2EHOB 3PE0A 4UV9B 4H0LD 3C8VA 1EDLA 1I6ZA 3HA4A 3SWFA 2X0LB 1N7SC 2KZIA 2W4XA 3ABVA 2XM1A 2VKOA 4I50E 5CCHA 2WZHA 3IFMA 4I2LC 1BE3D 2Q6QA 2W0GA 1NVOA 4L5GA 5AQHB 2KS1A 3H1IE 2IFMA 2FYUD 1HTLC 1LWUB 2H8PD 3ONJA 5AQOB 4BA9A 3I55P 1D1CA 2PAJA 1FJKA 1MFZA 2ZM6T 1GD2E 1J5WA 1BCCJ 2Y6XA 3M0DC 4EYYQ 2P10A 1GMJA 4KJMA 3AEFA 4RKUJ 1BGYG 2C0XA 1MNEA 4IDQA 2C5KT 4L73A 4ZMDA 2E9XB 3O1JA 3WUTA 1RE4A 3A0BH 2Q7CA 1NH4A 1DEEG 4WVZA 2WB5A 3TLSA 5CHXA 1KFYA 1YJWP 4EAHA 1QLED 3RLFF 3GG2A 2J47A 1ZV4X 1HNXT 3FBZA 3RIUC 1SQXE 1N7SB 4O9BA 1HWTC 2P7JA 2BS3A 3AA6B 5L47A 4AKGA 2Y9ZA 4WY4C 1M1JC 4AQYT 1S9KE 3GA8A 1ZOYA 3OVUA 1WRGA 2XJ7A 1S72P 4DR5T 1FJGT 2Q3EA 1KILC 1JTHA 5HCJA 3A3YB 5LMUT 3AA0B 4YTNA 2AXTH 2Q9QA 3O6QB 4ZI2C 3V2RA 2HODB 3TDKA 4C7RA 1EZVI 2HYNA 5H2FE 3K3OA 3MKDA 1Z0PA 1BCCE 4UF0B 1NAFA 4EYYR 3P32A 1YKHB 2BCCD 1YW0A 2A9UA 4WW0A 3OKQA 5FXWA 1PZQA 3CVRA 1MIYA 3VR9A 4U7YA 1E79H 3P4RA 2ES0A 1R8EA 3AE5A 3AEEA 4GK0E 1YBKA 4UV8B 4XA4A 1KV4A 3RK3D 2FBWA 2YDSA 3MXZA 1PP9D 3AA7B 4EDFA 1QUUA 3CMLA 1NTZD 2O01J 1QX8A 1J2JB 3PU3A 1AV1A 1M1JB 1J1DC 4WY4B 1UX5A 2ACZA 4IL4A 3OJAB 3U1AA 2HN2A 2XQYA 3K1SA 1FZAA 1NWQA 2FFDA 5E79E 1IK9A 2JQHA 3N2GE 1KILB 2P67A 2JEEA 5AVYB 2E76D 4HWDA 1SQPG 2N1TA 3AE4C 5LXTE 4G2AA 1NU1K 2AEFA 2XQ3A 1YHQP 2PBIA 1P84E 1ZXGA 4A5XA 2NPSA 1MKMA 1E1HB 4HKZH 1KYOI 3UTKA 1LNQA 2WU2A 2KOGA 4CXWA 1H88A 5FL1A 1AVYA 4WB4A 2K37A 4JLEA 2DL1A 1H89A 3AEBA 2JO1A 3GF3A 4GT1A 4KMCA 4WZXA 4JYCA 4IL6X 5CMZA 3H3AA 5L3CB 2OYHC 5AW0B 1FS0E 3AE9A 5JDNA 1KQFB 3SRZA 1XMOT 4YHJA 4JI7T 1HH0A 1J1DB 4FI5A 1HF8A 2DNXA 4AUWA 2JQKA 3N2OA 1W9RA 3P8CE 1KQLA 3L74G 2PJQA 2XSAA 3CPZA 1LT9B 2WITA 3PUYF 4IDZA 5CFBA 3M06A 3ZKRA 2K9YA 2V7KA 1SFCA 2FY8A 2WSSV 1EZVD 1Q2NA 2KS1B 1UX4A 3SSUA 3VYIA 5HXRA 2POHA 5AVTB 4QH5A 3K3NA 5APXA 3H1LE 4CPGA 2KT9A 3V5SA 1MV8A 1U7JA 4O2AE 1JY2O 3SFDC 3HUSA 3NBXX 3IA3A 1S94A 5LGNB 2YKPA 2V26A 5AW1B 4M3LA 4KX6A 3HKDE 1BE3E 1E5WA 3OAKA 2K48A 5AVWB 2OYHB 2QM7A 2A45H 5HAXA 4CI1B 1IFIA 2FYUE 1J1JA 2JJ9A 4I6MC 5BR8T 3WUVA 3WU2H 4I1LA 3VR8A 3MK7C 1X8YA 1GW3A 3HE5B 4TT3H 1N73A 4OGQC 4KHZF 4ILAA 2YMYA 3ZSSA 5JDGA 5LHGB 5KLIC 3M91A 3L70G 3A5TA 2UXNB 1N36T 1KYOD 4WBAA 1L0LD 3AE8A 1VQ4P 2VASA 3O1IA 1SQVJ 1BDDA 4H13B 3CWBG 1JTHB 2IHR1 1VF5B 1D0XA 1PP9J 5M1BA 2MAWA 1W2BO 2CWOA 3TLTA 1Q7YQ 4WBNE 5J0ZA 1U57A 4YXDC 2GUVA 1RF1C 2YIUC 3AE6A 2QRXA 5ABGA 3FHNA 5ABFA 3FXEA 4HFEA 1HG2A 2FXPA 4DR1T 3L73D 5BU8B 2QVAA 5L8RJ 3W68A 2FJAA 3PUVF 1PPJG 2RN0A 2HFED 1BDCA 5FXXA 4YSXA 3AAAB 3AEDC 2WSFJ 1UUSA 4B3RT 4X1IE 1HS7A 2IX7C 3LIDA 1K73Q 1KB9I 1NTMJ 2BCCE 1NTKG 4MBQA 5FKYA 4W80A 5KLIB 2OYIA 2QYWA 5LG4A 2IPPA 4OVNF 2D2CC 1SQQG 1BGYD 1L4AA 3UUXB 2E43A 2HN1A 4HWCA 2H88A 4X5TA 4DUYT 5JDMA 1AFOA 3O9XA 5L4HA 1A02J 3CX7B 4C91A 1YTZI 1PP9E 1LTBC 2NW7A 5F3JA 3JC6D 4IFFA 4BRYA 1NTZE 3AB3B 5EK3A 3VKHA 5LNKA 2YIUB 1HVVA 5H2FH 3HKBE 2CEAA 1NOHA 2M5AB 4R4MA 2GK9A 4KI0F 2WAUA 1ZN5A 5JR9A 3LJCA 2F4VT 4IFDK 3OA7A 2MOZA 5IYZE 3NRYA 4U3CA 5LJNA 2VKHA 4AXPA 2XV5A 4DO0A 2YKOA 4HH2A 2HLOA 2N1TD 1HX1B 1BR2A 3H37A 3TKLB 1NTME 4JI0T 3I0OA 1D0YA 1T2KC 4GKKT 4LF9T 4U7JA 2ZM2A 1OVRA 4K0UA 3PUQA 3G71P 4NIQA 3CQCB 3AAEB 4ZI7E 1LTJC 5E79H 5AQSB 1FDOA 2YU1A 5AQTB 2M6BA 1U4QA 1MZ9A 2UXDT 4LC1A 2XQ9A 2XU6A 2KP8A 5LGTB 4GK5E 1P84H 4PV1C 1FU1A 4UB8E 4WWIA 5KKZC 1VQ6P 2Z4EA 1Y47A 2YKQA 2IMLA 2ZXEB 5LMNT 3BQKA 1L0LJ 4AI6A 2KB7P 3KVBA 1W09A 2IZ0A 3GMIA 3RKOA 3TLUA 5CGMA 5LA6E 1YXRA 1CI6A 1KB9D 3F89A 3IF8B 4TNWA 4B86A 2V1DB 4NUVA 4CN1A 1HFAA 3L72G 4ZZBA 5AVVB 1VQMP 2GA1A 1IZNB 5APTA 1N73B 5CBNA 1SQBK 1CHUA 2H89A 2O01H 3H32A 2CPSA 3GHGB 3R84B 2Z5IA 4I55E 3VMAA 3P4QA 5KMGP 2DLRA 3K8PC 4DV3T 4UEMA 5JRCA 4H44D 1FZBA 1NHLA 5LHHB 4OFZA 2LOSA 3NWIA 3L75J 4A98A 1WT6A 4MLKA 1KTMA 4PV1B 4OYKA 2XNDH 1KFMA 3HE4B 2ZYAA 5KKZB 2UXCT 2ODVA 3P7KA 2CPBA 3CL3D 4TNVA 1U7MA 2BBHA 3F31A 1HNZT 4DJGA 3BCCD 1KYOE 1GL2D 4B3TT 1L0LE 3EFFK 1GTWA 3MP7B 1OX3A 2FXOA 3CD6P 3M3ZB 2OTJP 3VP8A 2WDQA 3UFEA 4BJNA 3RKGA 4CN4A 4IE5A 3EFGA 3KPEA 4H9RC 3L3PA 5JDQA 4CI2B 2K9JB 4U3FJ 2E5VA 3L09A 2OYIB 4YXWH 3KV9A 2ITAA 4JBZA 2E5YA 1L0NK 1VQKP 2JIWA 4ISSA 3GN5B 3N9LA 2VKDA 1SQXK 1XNQT 3CC4P 4AKHA 4IFMA 4PJLA 3H1JD 1GW4A 5HEHA 2V4HA 2BVMA 3LBXA 1CUNA 3FZLB 5LBMA 3ONLC 2J1DG 2KLQA 1XTGB 2IW5B 4MHCA 5LJMA 1ZEEA 3NTNA 3MZWB 1MMAA 2LM2A 2MBGA 2V6YB 2XY8B 4Z90A 3RK2D 3L70D 5FP3A 4YHHT 4ZI3C 1HJBA 1OEDA 1H7CA 3GF7A 5CCGD 2YINA 3CWBD 3N9PA 2GUSA 3NKZA 2C5JA 3AEAC 4X65T 1OXZA 1EXJA 3K3QC 5FVKA 2KWHA 2V5CA 3H25A 3H1KG 3MA9A 5ADXL 2G3AA 3E7KA 5KAFE 2J4GA 1X0TA 5KJ7C 3VU7H 1DD3A 4GDOA 3ZCJA 1SQPJ 3G9RA 3E08A 1W0AA 4QKNA 2IBZD 1FMWA 4LFBT 2RH0A 1URQC 2E42A 2D0TA 4DV1T 1PPJD 3AE2C 5AW8B 4N78D 2JMKA 2FKWB 1X79A 2W8ZA 1R5SA 3ITKA 2MTQA 2XASB 3AXJB 3D6YA 5FNVE 4JI2T 5AQQB 2VWAA 1NU1G 3L71G 5J1GA 3ZDMA 1RQUA 1NTKD 3C1LA 2N9BA 1SQQD 1GU5A 1RQVA 5C8YE 2WT7A 1M7LA 1PGJA 2ZYDA 1HCIA 1RF0A 3AE3C 3S4RA 2BKNA 2LEHA 4PAGA 3RHWA 1FOSE 3AE7A 5LBQB 2Y0DA 3AECC 3M0DA 1IJDB 2XAFB 4AKLA 3KQGA 3LW5J 1ZHCA 3QOFA 2WZ7A 4LLHA 2E74D 4PD4I 3L74J 2WSFH 2BKPA 2WQYA 4O2BE 2W90A 1JUNA 2ZJSE 4QX7B 3E0ZA 2JJLA 1IAPA 2EHOC 2WPQA 2NOXA 1JY2P 4GYSA 1DX7A 3SWKA 1YQ3C 1KB9E 1SQPE 3JCUE 4PJ0E 3TNUB 3B5NC 2XTLA 4AQRD 3PP5A 2OGUA 3JAEA 4ZOLE 4DVDA 5LYJE 3M9QA 3LK3B 5L3BB 5KLVG 3RGUA 2HPCA 2WWVA 4DNDA 3EDUA 2W6JH 1LWUC 3CCSP 3BK9A 1DEBA 2R5DA 2CXDA 4UB8H 2XQ8A 3C9IA 4GIWA 1FDIA 2A2FX 2WSSH 2RPAA 1FZCA 4TV8E 4DR3T 3T1HT 3HD7D 4PNIA 3SFEC 2L8KA 1HJ0A 5DQWA 3RQWA 1XNRT 1N86A 3R2PA 1LGHB 3RPUA 2SPZA 2L9QA 2WS3A 4LF4T 1XZYA 3L74E 3M65A 4DUZT 4HE8A 3GMAA 2E75D 5J2UE 2K24A 2X51A 2UUAT 1ZKEA 3L37A 2CXLA 2NRGA 2JKVA 3B5NB 1FEWA 3AEGA 3VMXA 4ILUA 3C4ZA 1OVVA 1EDIA 3L73G 1JCDA 3CWBJ 3C64A 4DBRA 2K5BB 1MMNA 3OTOT 3JC22 3T97B 2W27A 4EOTA 5AQPB 4YTMA 3MZKB 4JEUB 4L75A 4TLFA 2CK3H 3FZMB 4PW8A 3L72D 1TU3F 3CCUP 3FGAD 3CLQA 4GIFA 2AXDS 2VL0A 2O1JA 3FWNA 1BSNA 1YQ4C 2KYVA 2WP9A 1KYOH 4PD4D 2IAKA 3M9BA 2E2AA 1ZRTE 3O1HA 1VQNP 3TGUD 4C7NA 4DIDB 3RL0g 2Q9IA 3Q2YA 1NTKJ 2W83C 4JI3T 1US7B 2R44A 3HI2A 2A72A 3L70E 2X68A 1H0TB 2ZMAA 1ZR2A 4ASVA 1SA0E 2W2UA 1M7KA 4YJ2E 1VQPP 3CWBE 3U59A 2N1GA 3E1IA 4U2ZA 3RYCE 2QJKB 1LVFA 3Q5SA 4MFRA 3H1HG 5HWYA 3RRCA 5BVZA 2ZT9D 1H8AA 3BATA 3GLMA 4HFHA 2P9BA 4U2YA 3PUXF 1SQVK 2E76B 3B5MA 2BEZF 4HKAA 3KDSE 5L2LA 2LLYA 4M1PA 3O8ZA 1PPJE 3VTPC 2CCQA 2KNCB 5BMVE 4N78E 3VMZA 2E9XD 5LP6E 3TK1A 1GZLA 5AVRB 5ETWA 5GTHE 4QXHB 2H3RA 3UU3A 1VQ9P 3ZT5A 3ANWA 4YLHA 1NTKE 3MUDA 2VVNA 3CXHE 3CQGB 4TWFA 4QHOA 3QB5A 2G8YA 4UB6E 1M57D 3N9OA 2X9WA 1AJYA 5KAFH 1FC2C 1N7SD 2QJYC 3QK6A 1LT9C 4HFCA 2IDBA 2N9DA 3ABVC 2XM2A 2FJBA 1EXIA 2FYZA 2LSYA 1NTMK 5CCHC 1W2EA 2K1AA 4IL6E 3ZPOA 2OQQA 1CSBA 3H1LJ 3Q5WA 3PUAA 1NYHA 3LG7A 3AVRA 1T3JA
chains in the Genus database with same CATH topology
4PFOA 2CMRA 3LK42 1LTGC 2OARA 1RE3A 4JUYA 1FZCB 2DCFA 2YK0A 2WMNA 3BASA 1RE4C 5AVXB 2LE8A 3NFQA 1A02F 1RF1A 4TV9E 5L3FB 1LTSC 3NMDA 2MYSA 2SPCA 3RL0C 4W7YA 4AQGA 4WY4D 4CZZB 2JMHA 4PFPA 4O4IE 1KILD 3A5XA 4XZCA 3UUMA 3NXSA 4ZI2D 2Q9QC 3B8EB 1Y64B 5FY1A 3EVYA 1FAVA 3PURA 5J2TE 4DBQA 4QXBB 4A56A 1L0LK 3RL0B 1JY2N 2PG8A 2ZFCA 1GL2A 3LW5H 3PDYA 2KSJA 3ZEFB 2D2SA 2X66A 3II6A 5KTBA 2HPLA 3LIEA 1XTCC 5KX5E 2R32A 5AW2B 2LHRA 2Q9QB 4H63H 2NPSC 3AAIA 1ZV8A 4KHXA 1LTJA 3B13A 2KNDA 4XE5B 4H9SE 2CA5A 4JYBA 1VPCA 4I4TE 2HG5D 3ZN1B 1GK6A 3KVAA 1QL1A 2J58A 4I43B 4AQFA 5CCGA 5FXVA 3Q5XA 4UXNB 2FFDB 1JOCA 3HKEE 4WBOA 1JNMA 4W7ZA 4QXCB 2N1TB 4FJOA 1SFCC 5APYA 5E0OA 1HTJF 5AW7B 2NPSB 3CKDA 4ZKPA 1FIOA 2W63A 4EIWA 2L3LA 3ONXA 3ZCIA 4E7SA 3RRWA 2ZM0A 3HL6A 1GU4A 5EK4A 2W00A 4XBFB 1GDTA 4O4HE 3AVSA 4JF7A 3SWHA 5L3GB 3HRNA 2X67A 2M8RA 4X20E 1YD8G 3TYYA 3PU8A 4ZHQE 5L3DB 4TZ4C 1N73C 2NWBA 3V5UA 1SFCB 3ZC1A 1G2CA 3RX6A 3GHGC 3M0AA 2VK9A 3ZJ1A 3ZJ2A 5AFUL 2UXXB 3PTRB 5AW5B 1SQPK 2XAQB 4IHJE 1FOSF 4X1KE 3HUSB 1LTIC 1NKNA 1ZLLA 2LOPA 2WWWA 1KZUB 2XDJA 2WSCH 1T98A 1HG5A 4NUUA 4OHFA 3CI9A 5M4YA 5HXSA 3MD0A 1B7TA 3IBPA 4BAYB 1GL2B 3V2QA 5AVZB 3HD7A 4BJMA 1NKZB 1WYCA 4H9OC 3KV4A 2OYIC 3OYXA 2D5UA 1L4AC 1SVFA 3J7Yq 5LHIB 3G3ZA 3ZYMA 5KJ7A 4EZ4A 1ZR4A 4Z8XA 1CW5A 3U3IA 4KUMB 2YNYA 3FXEB 3V5BA 2C9NY 3RYFE 4DMVA 5JR9C 1FZFA 2HH7A 3KV5A 2JRKA 2XKMA 3RK2B 5JDLA 3F2EA 4QWNB 3NZQA 1L4AB 1T2KD 4EXTA 2OA5A 3IR9A 4GKGA 2KMFA 2YU2A 2KINB 5EK2A 1HGVA 4UELA 2EHOA 1HUCA 1T8ZA 1YKEB 3VN0A 1JY3O 3N2KE 2DI4A 5JR9B 5FYMA 1MUUA 1IJ5A 4IE4A 4EZHA 5JVDE 5GONE 1QSDA 4ASKA 3DTOA 3UIAA 2DHRA 4EOZB 2E9XA 4YFSA 2PP6A 3UT5E 1G2CB 1NO4A 1NTKK 3C50A 2LHNA 3O4XE 2FXMA 3QUJA 2WBLA 1N7SA 4ADZA 3V4WA 3B57A 4ZS2A 5APQA 5H6QB 3BQIA 1IFMA 3M9HA 3CQXC 1SP4A 3L35A 5FMNA 2WMOA 1CI6B 1JMMA 3ZMTB 2I1JA 2YEVC 3SOLA 2HODA 4QX8B 4UF0A 4UVAB 2V7IA 3Q2MA 1IFNA 2E8IA 3H32B 3HTKA 4EB6E 1FDMA 4AKIA 1T3UA 5JRCB 2C0WA 3H6PA 3SWYA 3VHLA 2LM9A 4XAXB 3U1CA 2ZM8A 1KK7A 4EIJA 4WY4A 1M1JA 2VL8A 1D1BA 2WM9A 1WYBA 1YTZT 1KILA 4ZI3D 2M67A 3ZN0B 1KFNA 1MIVA 1U5PA 3I5CA 5DJQC 4X1YE 5L3EB 2FYUK 2W62A 1OWAA 5KJ7D 2KWIB 2R3CA 3RK3C 1HGZA 2IC9A 3I0QA 1URQD 3NZPA 3LBXB 1BR4A 5HWXA 1LT9A 1D1AA 5EZYE 5JDFA 3ZMZB 2DWGA 3N4XA 3QC9A 5AW3B 3PUSA 3D0TA 4L0RA 1RF0C 4YJ3E 2KXPB 4O8SA 5CA0E 2I1KA 4HGAA 4U72A 2Z5HA 2NTXA 3RK3B 2WWUA 3KBUA 2EHOD 2Z6EA 2OYHA 5CB4E 3FB2A 2XNXA 3B5ND 4N6JA 4V1Av 1X79B 4F6RC 3HE5A 2W61A 2BZBA 2VKJA 2WT7B 1NTZK 3MIWA 3ESLA 2R5BA 1FZCC 4IE0A 3S4UA 3HKCE 2BASA 4DOJA 1G73A 5AW4B 1GK4A 1MIWA 3HTKB 2Q5UA 3VKGA 1IFJA 3R6NA 4OK0A 3WMM0 5JQGE 3I1AA 2HPCB 3BRTB 5CA1E 3VOPA 3SS1A 2D0UA 4GYRA 4OH8B 2I59A 2CXFA 4Y99C 1MMGA 5DQVA 3OBVE 3BRVB 4HFVA 2A45G 3A2AA 4PK5A 1Z56A 1LKXA 4PJMA 2H7VC 2C9LY 4PK6A 5APSA 1FZGA 1FMVA 4H9PC 4OYJA 3PUGA 4H9NC 4UVBB 3HR0A 5KLVK 2RP4A 5BU5A 3U78A 4UVCB 3ZMSB 3MACA 4Y99B 4RESB 3ZC0A 3JC6C 2P1JA 3NRXA 3CWZB 5APVA 4CQIA 4LGDE 4C7NB 3ETVA 3W15B 1IJ6A 2YO2A 3OYZA 4DZOA 4B6XA 1N7LA 5HYAA 3C4WA 5FY7A 1PFIA 5AW9B 2FFDC 1JY3P 2ACXA 2N1TC 5CCHD 4H9QC 3ETUA 2Y48B 4PJNA 3VMYA 2X9XA 5AVSB 5HXCA 3ZMUB 4G63A 2MJZA 3GHGA 2LT3A 3LFMA 1RE3C 2PFVA 5F8PA 2WPRA 3EUHA 4C90A 2BVLA 3UULA 2H7OA 3HE4A 4GOUA 3P7IA 3ZYLA 3ANWB 2IFNA 2YO3A 2WPSA 3RL0D 4ZKUA 2G0UA 3DJBA 3MTUE 4MALA 2XHEB 2Y8DA 4TX5A 5JDHA 4CXYA 1FBMA 3C4XA 1LTAC 1VOMA 4CI3B 2IC6A 3RYIE 1WR6A 3KV6A 2WTYA 2Q9QD 3HUSC 2KLVA 1D0ZA 3GN5A 3WAJA 2XUEA 5APUA 2CM0A 3P8MC 2QGSA 4O4LE 1V9DA 4PJJA 2A45I 2ODUA 3IHRA 1RF1B 3C98B 5AW6B 1SLQA 3ZMVB 1RY3A 2K9AA 1GL2C 5JH7E 1J1EC 1LRZA 2BDEA 3KYQA 3KBTA 4DMWA 4E7ZA 2M3BA 2DWKA 3TSIA 2XAJB 1MNDA 3DP7A 4KP3C 2CLYC 4UIGA 1LTTC 1EZ3A 3WAKA 3EDVA 3EQ2A 2NW9A 2NPSD 4L9IA 2CE7A 3I9YA 2NTYA 2LKMA 1LVKA 3Q9DA 3CX6B 4IIJE 1FJPA 2C5IT 2XAHB 5H6RB 4IE6A 4KBMB 1KNZA 1J1EB 4HYTB 5LOVE 3RK2C 2C0SA 3IEEA 1CZQA 4AQFC 5CCGC 1WLXA 5HXEA 2XZRA 3N9MA 4P0BA 4N3YB 5AVQB 1S35A 1SFCD 2CLYB 4AKRB 2V7MA 5CJ4A 1IO4A 3VP9A 2O1KA 3MJXA 4ISTA 4WNKA 1LTJB 1AQ5A 1URQA 2NP9A 1MMDA 2CWYA 3TNUA 3V4QA 2JPFA 1JO5A 1UCUA 2LSGA 5JREA 3ZLIA 3V2PA 5A1LA 1HX8A 1DH3A 2VRSA 1AJ3A 2LJLA 2KZ7B 3E22E 2LSKA 4TN7B 2X9YA 3N9NA 3F57A 4U74A 1BR1A 2B1EA 1G1JA 1YYCA 4H63V 2LSIA 3KINB 3B5NA 3A7OA 3KFWX 1N2DC 1FZEA 4ANJA 2V7JA 2QM8A 3FBLA 3T97A 4O4JE 1LWUA 2RA1A 3L4FA 2NW8A 3GWHA 3KDPB 1BR0A 3RH3A 4JEHB 4J2CA 2V7LA 2LSJA 2J59M 3HD7C 1JY3N 3CX8B 4TUYE 1S9KD 3N5LA 1L4AD 5CJ0A 1IC2A 1VDFA 2QA7A 3RYHE 3C51A 5LCYA 1SQQK 3BQLA 3RC8A 3J9X1 4EYUA 2ZLYA 4C46A 5FXZA 3FXDB 2W6BA 2JQQA 1G8XA 3UUNA 5DABA 2WSEH 3ZYKA 4P0AA 1IFDA 4AYCA 4CXXA 4ZS3A 3AA1B 3HD7B 4ERRA 5APWA 2GM4A 1X9VA 4IGUA 4PK4A 5HXHA 4HN9A 5AVUB 2P2UA 2A3DA 3BVHA 1VRBA 1SHZC 3I9WA 3T8OA 3L36A 4HEAA 3N9QA 1WRDA 2XAGB 5KDMC 2N2NA 1HBWA 3MGNA 3OJAA 5TAOA 2HPJA 1URQB 2H7HA 2VB6A 5FY0A 5IHYA 3N7NA 1O3XA 4HTEA 2H43A 4IE7A 3RC3A 1QL2A 2Q3IA 3WI3A 1G1IA 3LK2B 3P8CD 2L5GB 5LGUB 4P09A 1NWMX 1JCCA 2X9HA 2E9XC 1EQ7A 2W6AA 3V2NA 2EHOB 3PE0A 4UV9B 3HA4A 3SWFA 2X0LB 1N7SC 2VKOA 4I50E 5CCHA 3IFMA 4I2LC 2W0GA 4L5GA 2IFMA 1HTLC 1LWUB 2H8PD 4BA9A 1D1CA 2PAJA 1FJKA 1MFZA 1GD2E 2Y6XA 3M0DC 2C0XA 1MNEA 2C5KT 2E9XB 3O1JA 1RE4A 2Q7CA 1NH4A 5CHXA 4EAHA 1ZV4X 3FBZA 1N7SB 4O9BA 1HWTC 2P7JA 3AA6B 4AKGA 4WY4C 1M1JC 1S9KE 3GA8A 1WRGA 1KILC 1JTHA 3A3YB 3AA0B 2Q9QA 4ZI2C 3V2RA 2HODB 4C7RA 2HYNA 3K3OA 3MKDA 4UF0B 1Z0PA 1NAFA 4EYYR 3P32A 1YKHB 1YW0A 4WW0A 3OKQA 5FXWA 3CVRA 1MIYA 2ES0A 4UV8B 4GK0E 4XA4A 3RK3D 3MXZA 3AA7B 1QUUA 3CMLA 3PU3A 1J2JB 4WY4B 1M1JB 1J1DC 1UX5A 3OJAB 3U1AA 2XQYA 1FZAA 1NWQA 2FFDA 1IK9A 3N2GE 1KILB 2P67A 2JEEA 5AVYB 2N1TA 5LXTE 4G2AA 1NU1K 2PBIA 2NPSA 1E1HB 3UTKA 2KOGA 4CXWA 1H88A 4WB4A 4JLEA 1H89A 4GT1A 4KMCA 4JYCA 5CMZA 3H3AA 5L3CB 2OYHC 5AW0B 5JDNA 3SRZA 4YHJA 1HH0A 1J1DB 4FI5A 1HF8A 2DNXA 4AUWA 3N2OA 3P8CE 1KQLA 2PJQA 3CPZA 1LT9B 2WITA 4IDZA 3M06A 2V7KA 1SFCA 2WSSV 1UX4A 3VYIA 5HXRA 2POHA 5AVTB 3K3NA 5APXA 2KT9A 3V5SA 1MV8A 4O2AE 1JY2O 3HUSA 3NBXX 1S94A 5LGNB 2YKPA 2V26A 5AW1B 4M3LA 3HKDE 1E5WA 2K48A 3OAKA 5AVWB 2OYHB 2QM7A 2A45H 5HAXA 4CI1B 1IFIA 2JJ9A 4I6MC 4I1LA 3MK7C 1X8YA 1GW3A 3HE5B 1N73A 2YMYA 5JDGA 5LHGB 3A5TA 3M91A 2UXNB 4WBAA 2VASA 3O1IA 1JTHB 1D0XA 2CWOA 4WBNE 2GUVA 1RF1C 3FHNA 1HG2A 5BU8B 2HFED 5FXXA 3AAAB 4X1IE 1HS7A 2IX7C 3LIDA 4MBQA 4W80A 2OYIA 5LG4A 2IPPA 1L4AA 3UUXB 2E43A 5JDMA 1AFOA 3O9XA 1A02J 3CX7B 4C91A 1YTZI 5F3JA 1LTBC 2NW7A 3JC6D 4IFFA 3AB3B 5EK3A 3VKHA 5LNKA 1HVVA 3HKBE 2CEAA 1NOHA 2GK9A 2WAUA 1ZN5A 5JR9A 3LJCA 4IFDK 3OA7A 2MOZA 5IYZE 3NRYA 5LJNA 2VKHA 4AXPA 2XV5A 4DO0A 2YKOA 4HH2A 2HLOA 2N1TD 1BR2A 3H37A 3TKLB 3I0OA 1D0YA 1T2KC 2ZM2A 4K0UA 3PUQA 3CQCB 3AAEB 4ZI7E 1LTJC 2YU1A 1U4QA 1MZ9A 4LC1A 2XU6A 2KP8A 5LGTB 4GK5E 1FU1A 2Z4EA 2YKQA 2ZXEB 3BQKA 4AI6A 2KB7P 3KVBA 3GMIA 3RKOA 5LA6E 1CI6A 3IF8B 4B86A 2V1DB 4NUVA 1HFAA 5AVVB 5APTA 1IZNB 1N73B 1SQBK 2O01H 3H32A 2CPSA 3GHGB 3R84B 2Z5IA 4I55E 5KMGP 2DLRA 3K8PC 4UEMA 5JRCA 1FZBA 1NHLA 5LHHB 4OFZA 2LOSA 1WT6A 4MLKA 4OYKA 1KFMA 3HE4B 2ODVA 3P7KA 2CPBA 3CL3D 3F31A 1GL2D 1GTWA 3VP8A 3UFEA 4BJNA 4IE5A 3EFGA 3KPEA 4H9RC 3L3PA 5JDQA 4CI2B 3L09A 2OYIB 3KV9A 1L0NK 4ISSA 3GN5B 3N9LA 2VKDA 1SQXK 4AKHA 4IFMA 4PJLA 1GW4A 2BVMA 3LBXA 1CUNA 5LBMA 2J1DG 2KLQA 1XTGB 2IW5B 4MHCA 5LJMA 1ZEEA 3NTNA 1MMAA 2MBGA 3RK2D 5FP3A 4ZI3C 1HJBA 1H7CA 5CCGD 2YINA 3N9PA 2GUSA 2C5JA 1OXZA 3K3QC 2KWHA 3MA9A 5ADXL 5KJ7C 3VU7H 3ZCJA 3E08A 4QKNA 1FMWA 1URQC 2E42A 2D0TA 5AW8B 4N78D 2JMKA 2FKWB 1X79A 2MTQA 2XASB 5FNVE 2VWAA 5J1GA 2N9BA 1GU5A 5C8YE 2WT7A 1M7LA 1HCIA 1RF0A 2LEHA 4PAGA 1FOSE 5LBQB 3M0DA 2XAFB 1IJDB 4AKLA 3KQGA 1ZHCA 2WZ7A 4LLHA 2WSFH 4O2BE 1JUNA 4QX7B 3E0ZA 2JJLA 1IAPA 2EHOC 2WPQA 2NOXA 1JY2P 4GYSA 1DX7A 2XTLA 3TNUB 3B5NC 4AQRD 3PP5A 4ZOLE 4DVDA 5LYJE 3M9QA 3LK3B 5L3BB 2HPCA 4DNDA 3EDUA 1LWUC 3BK9A 1DEBA 2R5DA 2CXDA 4GIWA 3C9IA 2A2FX 1FZCA 4TV8E 3HD7D 4PNIA 2L8KA 5DQWA 1N86A 3R2PA 1LGHB 3RPUA 2L9QA 3M65A 4HE8A 5J2UE 2K24A 2X51A 1ZKEA 3L37A 2CXLA 3B5NB 1FEWA 3VMXA 4ILUA 3C4ZA 1JCDA 3C64A 4DBRA 2K5BB 1MMNA 2W27A 4EOTA 3MZKB 4JEUB 4PW8A 3CLQA 4GIFA 2O1JA 2KYVA 2IAKA 3M9BA 3O1HA 4C7NA 2Q9IA 1US7B 3HI2A 2A72A 2X68A 2ZMAA 1ZR2A 1SA0E 4YJ2E 3U59A 2N1GA 3E1IA 3RYCE 1LVFA 4MFRA 5HWYA 3RRCA 5BVZA 1H8AA 3BATA 2P9BA 1SQVK 4HKAA 3KDSE 5L2LA 4M1PA 3O8ZA 3VTPC 2CCQA 5BMVE 4N78E 3VMZA 2E9XD 5LP6E 3TK1A 1GZLA 5AVRB 5ETWA 4QXHB 2H3RA 3ANWA 4YLHA 3MUDA 3CQGB 4QHOA 3N9OA 2X9WA 1N7SD 3QK6A 1LT9C 2N9DA 2FYZA 2LSYA 1NTMK 5CCHC 1W2EA 3ZPOA 1CSBA 3Q5WA 3PUAA 3LG7A 3AVRA 1T3JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DZO A;  2E43 A;  4KHX A;  5AW4 B;  5AW8 B;  1GK4 A;  3L36 A;  1X79 A;  3M06 A;  3I5C A;  4XE5 B;  2P7J A;  1HWT C;  1WRD A;  1A02 J;  2N2N A;  5AW9 B;  1HBW A;  2Q5U A;  3HE4 B;  3MGN A;  1YYC A;  1S9K E;  4JYB A;  3MD0 A;  3P7K A;  3VYI A;  5AVT B;  1OWA A;  3UIA A;  2N9B A;  5APX A;  5AVZ B;  1GU5 A;  2R3C A;  2H7H A;  2WT7 A;  3M9B A;  5AVX B;  1GK6 A;  1MV8 A;  3A3Y B;  3NFQ A;  3A7O A;  3VMY A;  1GTW A;  1A02 F;  1G2C B;  4C7N A;  1O3X A;  3NMD A;  5AVS B;  1FOS E;  2QM8 A;  3T97 A;  3M0D A;  1JNM A;  1NAF A;  3KQG A;  3P32 A;  5AW1 B;  2Q3I A;  4M3L A;  3KDP B;  3OAK A;  2WPR A;  5AVW B;  2QM7 A;  5APY A;  1JUN A;  3V4W A;  2XV5 A;  5APQ A;  2JJL A;  5AW7 B;  2WPQ A;  4I6M C;  3HE4 A;  1NWM X;  3M9H A;  5AW3 B;  1SP4 A;  3L35 A;  3TNU B;  4HYT B;  4AQR D;  2W6A A;  1S9K D;  1T2K C;  1X8Y A;  3HE5 B;  1CI6 B;  3NXS A;  1CZQ A;  2YNY A;  3V5B A;  2YO3 A;  3B8E B;  2WPS A;  2C9N Y;  1J2J B;  1H8A A;  3A5T A;  3M91 A;  1NWQ A;  2XZR A;  1FAV A;  5AVQ B;  2Z5H A;  3SWF A;  1GU4 A;  4LC1 A;  3A2A A;  2P67 A;  2R5D A;  2XU6 A;  5AVY B;  4C46 A;  2KP8 A;  1IO4 A;  3HTK A;  3NTN A;  2C9L Y;  3O8Z A;  4I2L C;  3VTP C;  3VMZ A;  5APS A;  1YD8 G;  1WR6 A;  3TK1 A;  3TYY A;  1GZL A;  1T2K D;  2ZFC A;  5AVR B;  2WTY A;  2ZXE B;  1HJB A;  3IR9 A;  1H88 A;  4GKG A;  3TNU A;  1H89 A;  3V4Q A;  3HE5 A;  1MFZ A;  1CI6 A;  1GD2 E;  4AYC A;  3M0A A;  4B86 A;  4GT1 A;  1OXZ A;  5APU A;  3LIE A;  3P8M C;  4JYC A;  2N9D A;  2WT7 B;  4RES B;  1HUC A;  3L37 A;  5CMZ A;  2R5B A;  5AVV B;  5APW A;  5AW5 B;  2R32 A;  2VRS A;  5APT A;  3VMX A;  1DH3 A;  5APV A;  3VN0 A;  1FOS F;  5AW2 B;  2Q7C A;  5AW0 B;  4C7N B;  5AW6 B;  3LID A;  1SLQ A;  5AVU B;  2BAS A;  2P2U A;  1CSB A;  2W27 A;  4EOT A;  4AUW A;  2IPP A;  2YO2 A;  2Z5I A;  2E42 A;  1KQL A;  2WWW A;  1MUU A; 
#chains in the Genus database with same CATH topology
 4PFO A;  3H1K D;  2CMR A;  3LK4 2;  2RMZ A;  1LTG C;  2OAR A;  1RE3 A;  1EDJ A;  2V6X A;  4JUY A;  4HFB A;  3TF5 A;  1FZC B;  4YT0 A;  4NXN T;  2P58 A;  2DCF A;  1BE3 J;  2YK0 A;  2OV9 A;  4COF A;  2WMN A;  2QSI A;  3BAS A;  2CHO A;  2FYU J;  1HR0 T;  1RE4 C;  5AVX B;  2LE8 A;  3NFQ A;  2B87 B;  2VQE T;  3RBZ A;  1A02 F;  3RF1 A;  1RF1 A;  1KMI Z;  4TV9 E;  3ZT6 A;  3ZST A;  1LTS C;  3NMD A;  2MYS A;  5L3F B;  2SPC A;  3LSV A;  3RL0 C;  1NU1 D;  3L71 D;  4W7Y A;  2QJY B;  3IF4 A;  4EGW A;  4AQG A;  3BCC G;  1ZW0 A;  4WY4 D;  4CZZ B;  4U33 A;  2JMH A;  4HFD A;  4HB1 A;  1SQB G;  1ZOY C;  4PFP A;  1KB9 H;  4O4I E;  1KIL D;  3A5X A;  3P50 A;  4XZC A;  3UQ7 A;  4H13 C;  3UUM A;  1VF5 C;  2ZXX A;  3NXS A;  1YIJ P;  4ZI2 D;  2Q9Q C;  3B8E B;  2KLU A;  1Y64 B;  3USS A;  5ABE A;  2HR3 A;  5FY1 A;  4YPC A;  3EVY A;  1FAV A;  3PUR A;  4IOI H;  1XWM A;  1KF6 A;  3H1J G;  3W67 A;  1QVF O;  5J2T E;  3JAF A;  4I0U A;  3AEE C;  4DBQ A;  3GW6 A;  5KLV D;  1OFC X;  4IDP A;  4QXB B;  2FBW C;  4A56 A;  1L0L K;  3L72 E;  3RL0 B;  1JY2 N;  2PG8 A;  2ZFC A;  1GL2 A;  1ZP0 A;  3LW5 H;  2BCC J;  3F5H A;  2M3E A;  3PDY A;  3PUW F;  4JV5 T;  2KSJ A;  3ZEF B;  2YXR B;  1VQ8 P;  1PV3 A;  3UU4 A;  2D2S A;  2X66 A;  1X22 A;  2R3S A;  4PD4 E;  3II6 A;  5KTB A;  2HPL A;  2FYN B;  3LIE A;  4TWH A;  4JI4 T;  1XTC C;  5KX5 E;  5AQU B;  2R32 A;  1NTZ J;  1L0N G;  1W5C E;  5AW2 B;  2LHR A;  2Q9Q B;  4IDN A;  4H63 H;  2NPS C;  5DJT B;  3AAI A;  3Q1M A;  3T1Y T;  2QIW A;  4D6T D;  1ZV8 A;  3CCL P;  4KHX A;  1LTJ A;  3AEB C;  2CRB A;  3B13 A;  4HWF A;  1D7M A;  5B66 E;  4DV5 T;  2KND A;  4XE5 B;  4H9S E;  5AQN B;  2IBZ G;  5KAI E;  5KXJ A;  3CCE P;  2CA5 A;  1DD4 A;  4JYB A;  4B3S T;  1VPC A;  2A06 D;  1OED E;  2IDO B;  3D6Z A;  4I4T E;  2HG5 D;  3PHL A;  5AQV B;  3AE9 C;  3H1K J;  1GK6 A;  3ZN1 B;  3KVA A;  1QL1 A;  2J58 A;  4I43 B;  3AE1 A;  5HEJ A;  2QE7 H;  2Y0C A;  5CCG A;  4AQF A;  5FXV A;  3Q5X A;  4UXN B;  2FFD B;  1JOC A;  3HKE E;  4WBO A;  1JNM A;  4W7Z A;  1MFT A;  4KT0 J;  3IAO A;  4DR7 T;  4QXC B;  1VQO P;  2N1T B;  3RK3 E;  4FJO A;  2OYO A;  1SFC C;  5APY A;  5E0O A;  1QVG O;  2WPV B;  1HTJ F;  5AW7 B;  2NPS B;  3PRJ A;  3CKD A;  4ZKP A;  5B5E E;  3LDQ B;  1FIO A;  2W63 A;  4EIW A;  4LML A;  2OTL P;  2L3L A;  1S5L E;  3ONX A;  1PL5 A;  3ZCI A;  4E7S A;  1J5E T;  3NVO A;  4JI5 T;  3RRW A;  4JYA T;  2ZM0 A;  4ASW A;  3HL6 A;  1GU4 A;  5EK4 A;  2JWA A;  2W00 A;  4XBF B;  1GDT A;  2CHN A;  3AVS A;  4JF7 A;  2YKS A;  3H3M A;  4O4H E;  3SWH A;  5L3G B;  3HRN A;  3H1H D;  2X67 A;  3B4S A;  3H1K E;  5GTH H;  2M8R A;  4X20 E;  1S5L X;  4TWD A;  5HEO A;  1YD8 G;  2BG9 A;  3TYY A;  3FZF B;  3PU8 A;  4ZHQ E;  2YXQ B;  5L3D B;  4TZ4 C;  4OGQ D;  3CXH H;  4P1N A;  1N73 C;  1M8O B;  2NWB A;  5LG3 A;  4UB6 H;  3FWL A;  2KZJ A;  3V5U A;  1SFC B;  3ZC1 A;  1G2C A;  3RX6 A;  3GHG C;  4ZZC A;  3M0A A;  2VK9 A;  3ZJ1 A;  1YJ9 P;  3AE8 C;  5KLV J;  2UXX B;  3ZJ2 A;  5AFU L;  4X66 T;  3PJA A;  4OX9 T;  3QH9 A;  3PTR B;  4IL6 H;  5AW5 B;  1SQP K;  2XAQ B;  1NU1 E;  1FOS F;  4IHJ E;  3L71 E;  4X1K E;  3HUS B;  1LTI C;  4AIU A;  1NKN A;  1ZLL A;  1JNZ A;  2LOP A;  4EEB A;  4DR4 T;  2WWW A;  3FXD A;  3Q5D A;  1KZU B;  2WU5 A;  3AE6 C;  2XDJ A;  1EZV E;  2WSC H;  4YTP A;  1OW7 A;  1T98 A;  1HG5 A;  3S1K A;  4NUU A;  4OHF A;  5AQR B;  3CI9 A;  1UII A;  5M4Y A;  4GOD A;  4EED A;  3JAD A;  3JCF A;  3MD0 A;  1B7T A;  3IBP A;  5HXS A;  4DT0 A;  2W67 A;  4BAY B;  1GL2 B;  3V2Q A;  3QNU A;  5AVZ B;  3HD7 A;  4BJM A;  5FL0 A;  1NKZ B;  1WYC A;  4H9O C;  3KV4 A;  4GOF A;  2OYI C;  2D2C D;  2Y0E A;  3OYX A;  3L73 J;  1L4A C;  2D5U A;  1X9B A;  1KEY A;  4QMA A;  1SVF A;  2H88 C;  3J7Y q;  5KLV E;  3TGU G;  2BS2 A;  5LHI B;  3G3Z A;  3ZYM A;  2JR8 A;  2IBZ I;  5KJ7 A;  4EZ4 A;  1ZR4 A;  4Z8X A;  1BGY J;  1CW5 A;  3U3I A;  4GOE A;  4KUM B;  3ZT7 A;  3TLV A;  5ABF B;  2YNY A;  3FXE B;  3V5B A;  2JDI H;  2MKV A;  2C9N Y;  3RYF E;  1RHZ B;  2KSE A;  2XPK A;  4DMV A;  5JR9 C;  1SQB D;  1FZF A;  2E5T A;  2HH7 A;  2WMM A;  3KV5 A;  2JRK A;  2DW3 A;  1NGM B;  2XKM A;  3RK2 B;  5JDL A;  1IK7 A;  3F2E A;  4QWN B;  3NZQ A;  3CME P;  1L4A B;  1LP1 A;  1T2K D;  4EXT A;  1KNP A;  2OA5 A;  2UUC T;  3KHU A;  1YI2 P;  3IR9 A;  3L73 E;  4GKG A;  4PD4 H;  3H1I D;  2KMF A;  2YU2 A;  2KIN B;  4Z91 A;  5EK2 A;  1HGV A;  4BRY B;  3D71 A;  4UEL A;  2EHO A;  1HUC A;  1T8Z A;  4PV1 D;  4XFJ A;  1YKE B;  1BGY E;  5IWA T;  3VN0 A;  1P84 I;  4A97 A;  2FJE A;  4RJT A;  1JY3 O;  2K3W A;  2YDR A;  3N2K E;  2DI4 A;  5JR9 B;  5FYM A;  1JB0 J;  5B66 H;  1FE6 A;  1MUU A;  3PV0 F;  4HFI A;  1SQV G;  1IJ5 A;  4IE4 A;  4EZH A;  5JVD E;  3RQU A;  5KAI H;  2I8D A;  5GON E;  1QSD A;  4HWH A;  4ASK A;  2YN6 A;  1L0N D;  3DTO A;  1VQ7 P;  1PIX A;  1T72 A;  3UIA A;  2DHR A;  4EOZ B;  4NPE A;  5TJH A;  2E9X A;  4YFS A;  2H89 C;  1ZME C;  3EI0 A;  2PP6 A;  3UT5 E;  1G2C B;  1NO4 A;  2IYO A;  5AQL B;  1NTK K;  2E74 B;  3C50 A;  2LHN A;  3O4X E;  2FXM A;  3QUJ A;  2UXB T;  2WBL A;  3H1H E;  4H0L C;  1N7S A;  4ADZ A;  1NTM G;  3V4W A;  3B57 A;  4ZS2 A;  1BCC D;  5APQ A;  5H6Q B;  3BQI A;  1IFM A;  3M9H A;  3CQX C;  1S5L H;  3CCM P;  3P4W A;  1SP4 A;  4DV4 T;  2YOE A;  3L35 A;  5FMN A;  2WMO A;  1CI6 B;  1JMM A;  2WZI A;  2CPT A;  3A8Y C;  3TLW A;  3ZMT B;  2I1J A;  2YEV C;  1UGO A;  3SOL A;  1W0B A;  2K3R A;  2HOD A;  4L74 A;  4QX8 B;  4UF0 A;  4UVA B;  4JQ0 D;  2V7I A;  3Q2M A;  5FVL A;  1IFN A;  5CBO A;  4MN4 C;  3BCC J;  2E8I A;  3H32 B;  3HTK A;  4NPF X;  4EB6 E;  2IUB A;  3CIR A;  3CPW O;  1FDM A;  5K5G B;  3I56 P;  4YY3 T;  4AKI A;  1T3U A;  5JRC B;  2C0W A;  3H6P A;  3SWY A;  3VHL A;  2LM9 A;  4XAX B;  3U1C A;  2QJP B;  3OW2 O;  4H0L B;  2B76 A;  3RIU A;  1P84 D;  2ZM8 A;  1KK7 A;  2E75 B;  1VQL P;  2XQ6 A;  1JMB A;  4EIJ A;  4LMJ A;  2OTK E;  4QH4 A;  4WY4 A;  1M1J A;  2VL8 A;  1OMI A;  3CX5 I;  1D1B A;  2WM9 A;  1WYB A;  1YTZ T;  1KIL A;  4R4L A;  3H1J J;  3G4S P;  4ZI3 D;  2M67 A;  4HJG H;  3ZN0 B;  2VUR A;  1KFN A;  1OED C;  2I0M A;  4RO0 A;  2M0B A;  1MIV A;  1U5P A;  2FJD A;  3I5C A;  4AIS A;  5DJQ C;  4D6T G;  4X1Y E;  1KQS O;  2J5U A;  3BCC E;  2FYU K;  5HEG A;  5L3E B;  1YJN P;  1OVU A;  1Q90 D;  2W62 A;  3L70 J;  4KHP T;  1OWA A;  5KJ7 D;  2LXC B;  2KWI B;  2R3C A;  3RK3 C;  1SQB E;  3CCR P;  1HGZ A;  2IC9 A;  3G06 A;  3I0Q A;  4ZXL A;  4LFC T;  1URQ D;  3NZP A;  5AQI B;  2A06 G;  3LBX B;  1BR4 A;  4X64 T;  5HWX A;  2QJK C;  1LT9 A;  1D1A A;  5EZY E;  5JDF A;  3PUZ F;  4F8H A;  3ZMZ B;  1KC8 Q;  2JWD A;  2BKO A;  1T6A A;  2AE9 A;  3AE4 A;  2E76 C;  1OW8 A;  2ZVN B;  5DJU B;  2DWG A;  3N4X A;  3QC9 A;  3EHZ A;  1K04 A;  5AW3 B;  4Y28 J;  3PUS A;  3H1J E;  1Q86 Q;  1OED B;  3D0T A;  2KI7 B;  2ZT9 B;  5LB7 B;  4L0R A;  1RF0 C;  3L75 G;  4YJ3 E;  2KXP B;  1NAY A;  4O8S A;  5CA0 E;  1S3J A;  3AE7 C;  1VCS A;  1SUM B;  3E1R A;  2I1K A;  4HGA A;  4U72 A;  1N32 T;  2Z5H A;  2LKH A;  1SQQ J;  2WQY C;  2NTX A;  3RK3 B;  2WWU A;  3KBU A;  2EHO D;  2Z6E A;  1EDK A;  3P4S A;  2OYH A;  5CB4 E;  3FB2 A;  1KNR A;  1N8R Q;  3CCJ P;  2XNX A;  3B5N D;  4BXL A;  2IZ1 A;  3CX5 D;  2WCA A;  4N6J A;  4V1A v;  1X79 B;  1L0N E;  4F6R C;  3PJA J;  3HE5 A;  3UU8 A;  4U3F G;  1L0V A;  2W61 A;  2BZB A;  2VKJ A;  3UU5 A;  5GTI E;  2WSC J;  2YDQ A;  2WT7 B;  1K05 A;  3A0H E;  1NTZ K;  3MIW A;  2IBZ E;  3ESL A;  5C2T A;  2R5B A;  5F5W A;  1Q82 Q;  1FZC C;  4IE0 A;  3S4U A;  1L2P A;  3HKC E;  3CC2 P;  1RH5 B;  2BAS A;  1AQT A;  4DOJ A;  1E7P A;  1G73 A;  3SFD A;  4Q25 A;  3PLN A;  3RIA A;  3FZK B;  4ZNC A;  5AW4 B;  1GK4 A;  1MIW A;  1SQQ E;  3HTK B;  2Q5U A;  2BG9 E;  1VCT A;  3VKG A;  1IFJ A;  3R6N A;  4OK0 A;  4DR2 T;  3AEG C;  1SQV D;  3WMM 0;  4NXM T;  1T7S A;  4JPZ B;  5JQG E;  1HF9 A;  4WYV A;  3I1A A;  2HPC B;  3BRT B;  1KN7 A;  5CA1 E;  3UFG A;  2ZAE B;  2KIK A;  4DV0 T;  2NR4 A;  3VOP A;  4ZEY A;  2XSB A;  1IBM T;  3SS1 A;  2D0U A;  4GYR A;  3AEF C;  4DV6 T;  3WUU A;  4OH8 B;  2I59 A;  2CXF A;  4Y99 C;  3R4Y A;  3OPC A;  1WCR A;  3RGL A;  3L72 J;  4YXD A;  1SE7 A;  1XDO A;  1MMG A;  1NTM D;  2B88 A;  2BS4 A;  5DQV A;  2WVR A;  3OBV E;  3BRV B;  4I7Z C;  4HFV A;  2M5A A;  2A45 G;  4U31 A;  3FZH B;  1JM0 A;  3A2A A;  4PK5 A;  1Z56 A;  1LKX A;  3AED A;  4PJM A;  1YIT P;  5HEU A;  2H7V C;  2C9L Y;  2FYN C;  4PJ0 H;  3JCU H;  3TGU J;  3IN6 A;  2XZE A;  4ILC A;  2CBI A;  4PK6 A;  5APS A;  2V7Q J;  2QG4 A;  3K5B A;  1WR0 A;  2QEX P;  1FZG A;  4IL9 A;  1FMV A;  4H9P C;  3VRA A;  4OYJ A;  4LFA T;  3PUG A;  3V6I A;  4H9N C;  4UVB B;  2AEM A;  3HR0 A;  5KLV K;  2RP4 A;  5BU5 A;  3U78 A;  3P4P A;  4LF6 T;  4UVC B;  5AQF B;  3ZMS B;  3MAC A;  4Y99 B;  4RES B;  1QEX A;  3H1I G;  3ZC0 A;  2UWJ E;  2LKG A;  4BWN A;  2P1J A;  3JC6 C;  3NRX A;  5HCM A;  3AE5 C;  4DCK A;  3CWZ B;  5APV A;  3Q5P A;  4CQI A;  4LGD E;  4C7N B;  4EI2 A;  3ETV A;  4IDO A;  3W15 B;  1IJ6 A;  2YO2 A;  4I7Z B;  1UIX A;  3OYZ A;  4DZO A;  4B6X A;  3VRB A;  4JI8 T;  1N7L A;  3MUD C;  2ZVO B;  5HYA A;  3C4W A;  5FY7 A;  1PFI A;  2XQ5 A;  1GQE A;  5AW9 B;  4A7P A;  3EWK A;  2FFD C;  2N9Y B;  1JY3 P;  2ACX A;  2N1T C;  5CCH D;  3TGU E;  3Q5R A;  2MPK A;  4H9Q C;  3ETU A;  1N34 T;  2Y48 B;  1IFP A;  1Y01 A;  1OIP A;  4PJN A;  1SQX G;  3VMY A;  3CC7 P;  2X9X A;  2Q1K A;  5AVS B;  5HXC A;  3ZMU B;  4G63 A;  2MJZ A;  3GHG A;  2LT3 A;  2O3J A;  1BSH A;  3LFM A;  2WSE J;  1RE3 C;  2JP3 A;  2PFV A;  5F8P A;  2WPR A;  3EUH A;  2W66 A;  1XDP A;  4C90 A;  3CX5 E;  1PGQ A;  2BVL A;  3A7M A;  2KUB A;  3UUL A;  2H7O A;  3UQ4 A;  1HNW T;  3HE4 A;  4GOU A;  5AQK B;  1USD A;  3P7I A;  3ZYL A;  3ANW B;  1BCC G;  2IFN A;  2YO3 A;  2WPS A;  4LF5 T;  3RL0 D;  4ZKU A;  1KOR A;  2G0U A;  3DJB A;  3MTU E;  4MAL A;  2NZ2 A;  5JTG A;  2XHE B;  2Y8D A;  4TX5 A;  5AQM B;  5JDH A;  4ILB A;  4IRE A;  3L75 D;  2LRK A;  4CXY A;  1FBM A;  1E2A A;  3C4X A;  5ABH A;  1LTA C;  1Y8A A;  1VOM A;  4DV7 T;  2LR2 A;  4OGQ B;  4CI3 B;  4H13 D;  1VF5 D;  2IC6 A;  2XQ4 A;  3RYI E;  2I6H A;  3QB5 K;  2K9J A;  1WR6 A;  1NU1 J;  1SS1 A;  3L71 J;  3KV6 A;  2WTY A;  1R8I A;  4JI1 T;  3D70 A;  2PGD A;  2Q9Q D;  2UUB T;  3G6E P;  3HUS C;  3PTZ A;  2KLV A;  2AEJ A;  3L39 A;  1D0Z A;  4H44 C;  2PRR A;  3GN5 A;  5GTI H;  3CCQ P;  2LRL A;  3RI5 A;  1SQV E;  3WAJ A;  3A0H H;  2XUE A;  3QWO C;  5APU A;  2CM0 A;  3P8M C;  2QGS A;  4O4L E;  1V9D A;  4PJJ A;  2E5L T;  2A45 I;  1JNR A;  2ODU A;  3IHR A;  3CCV P;  1RF1 B;  3C98 B;  1OZH A;  5AW6 B;  1SLQ A;  1QGK B;  4U3F D;  3ZMV B;  1RY3 A;  2K9A A;  1GL2 C;  5JH7 E;  1ZP0 C;  2V6Y A;  2UU9 T;  1J1E C;  1LRZ A;  2BDE A;  3KYQ A;  3KBT A;  4GKJ T;  4DMW A;  1Y9B A;  4HWI B;  4E7Z A;  2M3B A;  2WDV A;  2DWK A;  3TSI A;  2BEQ D;  2XAJ B;  1MND A;  1OW6 A;  3KZI E;  3DP7 A;  5TIS E;  4KP3 C;  2CLY C;  4UIG A;  1LTT C;  1EZ3 A;  3WAK A;  2D2C B;  3EDV A;  3EQ2 A;  2O01 N;  2NW9 A;  2NPS D;  4L9I A;  2CE7 A;  3I9Y A;  4H44 B;  2L91 A;  2NTY A;  4JI6 T;  1Q81 Q;  2LKM A;  2WY2 A;  4LMK A;  4NPP A;  5EFW B;  2PTF A;  3PJS K;  1LVK A;  3Q9D A;  2ZYG A;  1KIL E;  2HHH T;  2IIU A;  3CX6 B;  3H1L G;  4IIJ E;  5C3J A;  3AXJ A;  1KD1 Q;  1FJP A;  2C5I T;  2XAH B;  1S1C X;  5H6R B;  4D6T J;  4B3M T;  3MHV A;  4IE6 A;  4KBM B;  1KNZ A;  1KQG B;  1J1E B;  1M56 D;  4HYT B;  5LOV E;  3RK2 C;  3AE1 C;  2C0S A;  3IEE A;  1CZQ A;  4AQF C;  5CCG C;  1WLX A;  1BE3 G;  5HXE A;  1SQP D;  3AEA A;  2FYU G;  2VVS A;  2XZR A;  3N9M A;  4P0B A;  3X1D A;  4N3Y B;  5AVQ B;  1S35 A;  1SFC D;  2CLY B;  4AKR B;  2V7M A;  1AA0 A;  1JEK A;  5CJ4 A;  1IO4 A;  3VP9 A;  2O1K A;  3MJX A;  4IST A;  1UK5 A;  4WNK A;  3L8R A;  4DR6 T;  1LTJ B;  3JSV C;  1AQ5 A;  1URQ A;  2NP9 A;  1MMD A;  2CWY A;  3AE2 A;  3TNU A;  3V4Q A;  2B9B A;  2JPF A;  1JO5 A;  4JBW F;  1UCU A;  4OWF A;  2LSG A;  1WMK A;  5JRE A;  3ZLI A;  3V2P A;  2YMK A;  5A1L A;  1HX8 A;  4EV6 A;  2BBJ A;  4D6T E;  3L74 D;  1DH3 A;  2VRS A;  1AJ3 A;  2LJL A;  1IBK T;  2KZ7 B;  4X62 T;  1UUR A;  3E22 E;  5IUX A;  2WDR A;  2BG9 C;  2LSK A;  3AE3 A;  3A0B E;  4IT4 A;  1DU2 A;  4TN7 B;  2X9Y A;  2V8S V;  4U7I A;  1S4X A;  3FX0 A;  3AEC A;  3N9N A;  1EC5 A;  3CXH I;  3F57 A;  4U74 A;  2A06 E;  1BR1 A;  2AXC A;  1Z8U A;  2E74 C;  2B1E A;  3H1H J;  3EAM A;  1G1J A;  5L4E A;  1YYC A;  4LF8 T;  1PGO A;  4H63 V;  2V7Q H;  1R5L A;  2LSI A;  2BCC G;  3KIN B;  2FUP A;  4UR9 A;  1YQ3 A;  1S2E A;  5CJ5 A;  3B5N A;  3A7O A;  3KFW X;  2JQ9 A;  1N2D C;  1FZE A;  4ANJ A;  2V7J A;  2QM8 A;  3FBL A;  3T97 A;  3CK6 A;  2AXT E;  3L75 E;  4YTP C;  4QH1 A;  1IBL T;  4O4J E;  1LWU A;  2RA1 A;  3L4F A;  1PP9 G;  1ZRT D;  3CX5 H;  2NW8 A;  3GWH A;  3KDP B;  1BR0 A;  3RH3 A;  2V5D A;  1NTZ G;  2X0H A;  1XMQ T;  4JEH B;  3CMA P;  2V7L A;  4J2C A;  1SQX D;  2BG9 B;  3RBX A;  2LSJ A;  2X0Y A;  3SFE A;  2J59 M;  3HD7 C;  1JY3 N;  3CX8 B;  4TUY E;  1S9K D;  3N5L A;  3RIF A;  1VQ5 P;  1L4A D;  5CJ0 A;  1IC2 A;  1VDF A;  2QA7 A;  2R6G F;  2XQ7 A;  3C51 A;  2M6I A;  3RYH E;  5LCY A;  1SQQ K;  1T8B A;  3BQL A;  3Q5E A;  2Y9Y A;  2XQA A;  2QJP C;  3RC8 A;  3J9X 1;  2E75 C;  4EYU A;  1NEN A;  4U3F E;  2B89 A;  4C46 A;  2OLT A;  2ZLY A;  5AQG B;  3B71 A;  5B5E H;  5FXZ A;  1H0T A;  3KXD A;  4L76 A;  3FXD B;  1I94 T;  2K88 A;  2W6B A;  2VQF T;  2IYP A;  2JQQ A;  4NPD A;  1G8X A;  3UUN A;  5DAB A;  2WSE H;  3ZYK A;  4P0A A;  1IFD A;  1N33 T;  4YSY A;  4AYC A;  1PGP A;  3O6Q A;  4CXX A;  5AQJ B;  1DIP A;  4LF7 T;  2LXB A;  4ZS3 A;  3AA1 B;  1USE A;  3HD7 B;  3CXH D;  1YQ4 A;  1QLB A;  4ERR A;  1WFD A;  5APW A;  4CN6 A;  2GM4 A;  1X9V A;  2QA4 P;  4IGU A;  4PK4 A;  5HXH A;  4HN9 A;  1EZV G;  1K8A Q;  5AVU B;  2P2U A;  2KK7 A;  1SQB J;  3Q3D A;  2A3D A;  2KNC A;  3BVH A;  4K3A A;  1AVO A;  1SHZ C;  1VRB A;  3EAB A;  3I9W A;  3S9O A;  3T8O A;  3L36 A;  4HEA A;  3N9Q A;  1WRD A;  2XAG B;  5KDM C;  3KZI H;  2N2N A;  1HBW A;  5TIS H;  3MGN A;  3OJA A;  5TAO A;  2HPJ A;  4YSZ A;  1NEK A;  1NJI Q;  2PFX A;  1URQ B;  1K9M Q;  2H7H A;  2VB6 A;  5FY0 A;  3H1I J;  5IHY A;  3N7N A;  1O3X A;  1VL2 A;  2H43 A;  2KSR A;  4HTE A;  4IE7 A;  2ZT9 C;  3RC3 A;  1QL2 A;  1M90 Q;  2Q3I A;  3WI3 A;  1G1I A;  3LK2 B;  3P8C D;  1LT1 A;  4DV2 T;  2L5G B;  2D9D A;  4K0K T;  5LGU B;  1M62 A;  4P09 A;  1M1K Q;  1LP1 B;  1L0L G;  3UUB A;  1NWM X;  5C39 A;  1JCC A;  2X9H A;  2RKL A;  2E9X C;  1EQ7 A;  1LJ2 A;  2W6A A;  3UU6 A;  3V2N A;  3WU2 E;  2J62 A;  2B87 A;  1L0N J;  4Z1M H;  3H1L D;  2CBJ A;  4K35 A;  1SQX J;  3PH0 A;  2EHO B;  3PE0 A;  4UV9 B;  4H0L D;  3C8V A;  1EDL A;  1I6Z A;  3HA4 A;  3SWF A;  2X0L B;  1N7S C;  2KZI A;  2W4X A;  3ABV A;  2XM1 A;  2VKO A;  4I50 E;  5CCH A;  2WZH A;  3IFM A;  4I2L C;  1BE3 D;  2Q6Q A;  2W0G A;  1NVO A;  4L5G A;  5AQH B;  2KS1 A;  3H1I E;  2IFM A;  2FYU D;  1HTL C;  1LWU B;  2H8P D;  3ONJ A;  5AQO B;  4BA9 A;  3I55 P;  1D1C A;  2PAJ A;  1FJK A;  1MFZ A;  2ZM6 T;  1GD2 E;  1J5W A;  1BCC J;  2Y6X A;  3M0D C;  4EYY Q;  2P10 A;  1GMJ A;  4KJM A;  3AEF A;  4RKU J;  1BGY G;  2C0X A;  1MNE A;  4IDQ A;  2C5K T;  4L73 A;  4ZMD A;  2E9X B;  3O1J A;  3WUT A;  1RE4 A;  3A0B H;  2Q7C A;  1NH4 A;  1DEE G;  4WVZ A;  2WB5 A;  3TLS A;  5CHX A;  1KFY A;  1YJW P;  4EAH A;  1QLE D;  3RLF F;  3GG2 A;  2J47 A;  1ZV4 X;  1HNX T;  3FBZ A;  3RIU C;  1SQX E;  1N7S B;  4O9B A;  1HWT C;  2P7J A;  2BS3 A;  3AA6 B;  5L47 A;  4AKG A;  2Y9Z A;  4WY4 C;  1M1J C;  4AQY T;  1S9K E;  3GA8 A;  1ZOY A;  3OVU A;  1WRG A;  2XJ7 A;  1S72 P;  4DR5 T;  1FJG T;  2Q3E A;  1KIL C;  1JTH A;  5HCJ A;  3A3Y B;  5LMU T;  3AA0 B;  4YTN A;  2AXT H;  2Q9Q A;  3O6Q B;  4ZI2 C;  3V2R A;  2HOD B;  3TDK A;  4C7R A;  1EZV I;  2HYN A;  5H2F E;  3K3O A;  3MKD A;  1Z0P A;  1BCC E;  4UF0 B;  1NAF A;  4EYY R;  3P32 A;  1YKH B;  2BCC D;  1YW0 A;  2A9U A;  4WW0 A;  3OKQ A;  5FXW A;  1PZQ A;  3CVR A;  1MIY A;  3VR9 A;  4U7Y A;  1E79 H;  3P4R A;  2ES0 A;  1R8E A;  3AE5 A;  3AEE A;  4GK0 E;  1YBK A;  4UV8 B;  4XA4 A;  1KV4 A;  3RK3 D;  2FBW A;  2YDS A;  3MXZ A;  1PP9 D;  3AA7 B;  4EDF A;  1QUU A;  3CML A;  1NTZ D;  2O01 J;  1QX8 A;  1J2J B;  3PU3 A;  1AV1 A;  1M1J B;  1J1D C;  4WY4 B;  1UX5 A;  2ACZ A;  4IL4 A;  3OJA B;  3U1A A;  2HN2 A;  2XQY A;  3K1S A;  1FZA A;  1NWQ A;  2FFD A;  5E79 E;  1IK9 A;  2JQH A;  3N2G E;  1KIL B;  2P67 A;  2JEE A;  5AVY B;  2E76 D;  4HWD A;  1SQP G;  2N1T A;  3AE4 C;  5LXT E;  4G2A A;  1NU1 K;  2AEF A;  2XQ3 A;  1YHQ P;  2PBI A;  1P84 E;  1ZXG A;  4A5X A;  2NPS A;  1MKM A;  1E1H B;  4HKZ H;  1KYO I;  3UTK A;  1LNQ A;  2WU2 A;  2KOG A;  4CXW A;  1H88 A;  5FL1 A;  1AVY A;  4WB4 A;  2K37 A;  4JLE A;  2DL1 A;  1H89 A;  3AEB A;  2JO1 A;  3GF3 A;  4GT1 A;  4KMC A;  4WZX A;  4JYC A;  4IL6 X;  5CMZ A;  3H3A A;  5L3C B;  2OYH C;  5AW0 B;  1FS0 E;  3AE9 A;  5JDN A;  1KQF B;  3SRZ A;  1XMO T;  4YHJ A;  4JI7 T;  1HH0 A;  1J1D B;  4FI5 A;  1HF8 A;  2DNX A;  4AUW A;  2JQK A;  3N2O A;  1W9R A;  3P8C E;  1KQL A;  3L74 G;  2PJQ A;  2XSA A;  3CPZ A;  1LT9 B;  2WIT A;  3PUY F;  4IDZ A;  5CFB A;  3M06 A;  3ZKR A;  2K9Y A;  2V7K A;  1SFC A;  2FY8 A;  2WSS V;  1EZV D;  1Q2N A;  2KS1 B;  1UX4 A;  3SSU A;  3VYI A;  5HXR A;  2POH A;  5AVT B;  4QH5 A;  3K3N A;  5APX A;  3H1L E;  4CPG A;  2KT9 A;  3V5S A;  1MV8 A;  1U7J A;  4O2A E;  1JY2 O;  3SFD C;  3HUS A;  3NBX X;  3IA3 A;  1S94 A;  5LGN B;  2YKP A;  2V26 A;  5AW1 B;  4M3L A;  4KX6 A;  3HKD E;  1BE3 E;  1E5W A;  3OAK A;  2K48 A;  5AVW B;  2OYH B;  2QM7 A;  2A45 H;  5HAX A;  4CI1 B;  1IFI A;  2FYU E;  1J1J A;  2JJ9 A;  4I6M C;  5BR8 T;  3WUV A;  3WU2 H;  4I1L A;  3VR8 A;  3MK7 C;  1X8Y A;  1GW3 A;  3HE5 B;  4TT3 H;  1N73 A;  4OGQ C;  4KHZ F;  4ILA A;  2YMY A;  3ZSS A;  5JDG A;  5LHG B;  5KLI C;  3M91 A;  3L70 G;  3A5T A;  2UXN B;  1N36 T;  1KYO D;  4WBA A;  1L0L D;  3AE8 A;  1VQ4 P;  2VAS A;  3O1I A;  1SQV J;  1BDD A;  4H13 B;  3CWB G;  1JTH B;  2IHR 1;  1VF5 B;  1D0X A;  1PP9 J;  5M1B A;  2MAW A;  1W2B O;  2CWO A;  3TLT A;  1Q7Y Q;  4WBN E;  5J0Z A;  1U57 A;  4YXD C;  2GUV A;  1RF1 C;  2YIU C;  3AE6 A;  2QRX A;  5ABG A;  3FHN A;  5ABF A;  3FXE A;  4HFE A;  1HG2 A;  2FXP A;  4DR1 T;  3L73 D;  5BU8 B;  2QVA A;  5L8R J;  3W68 A;  2FJA A;  3PUV F;  1PPJ G;  2RN0 A;  2HFE D;  1BDC A;  5FXX A;  4YSX A;  3AAA B;  3AED C;  2WSF J;  1UUS A;  4B3R T;  4X1I E;  1HS7 A;  2IX7 C;  3LID A;  1K73 Q;  1KB9 I;  1NTM J;  2BCC E;  1NTK G;  4MBQ A;  5FKY A;  4W80 A;  5KLI B;  2OYI A;  2QYW A;  5LG4 A;  2IPP A;  4OVN F;  2D2C C;  1SQQ G;  1BGY D;  1L4A A;  3UUX B;  2E43 A;  2HN1 A;  4HWC A;  2H88 A;  4X5T A;  4DUY T;  5JDM A;  1AFO A;  3O9X A;  5L4H A;  1A02 J;  3CX7 B;  4C91 A;  1YTZ I;  1PP9 E;  1LTB C;  2NW7 A;  5F3J A;  3JC6 D;  4IFF A;  4BRY A;  1NTZ E;  3AB3 B;  5EK3 A;  3VKH A;  5LNK A;  2YIU B;  1HVV A;  5H2F H;  3HKB E;  2CEA A;  1NOH A;  2M5A B;  4R4M A;  2GK9 A;  4KI0 F;  2WAU A;  1ZN5 A;  5JR9 A;  3LJC A;  2F4V T;  4IFD K;  3OA7 A;  2MOZ A;  5IYZ E;  3NRY A;  4U3C A;  5LJN A;  2VKH A;  4AXP A;  2XV5 A;  4DO0 A;  2YKO A;  4HH2 A;  2HLO A;  2N1T D;  1HX1 B;  1BR2 A;  3H37 A;  3TKL B;  1NTM E;  4JI0 T;  3I0O A;  1D0Y A;  1T2K C;  4GKK T;  4LF9 T;  4U7J A;  2ZM2 A;  1OVR A;  4K0U A;  3PUQ A;  3G71 P;  4NIQ A;  3CQC B;  3AAE B;  4ZI7 E;  1LTJ C;  5E79 H;  5AQS B;  1FDO A;  2YU1 A;  5AQT B;  2M6B A;  1U4Q A;  1MZ9 A;  2UXD T;  4LC1 A;  2XQ9 A;  2XU6 A;  2KP8 A;  5LGT B;  4GK5 E;  1P84 H;  4PV1 C;  1FU1 A;  4UB8 E;  4WWI A;  5KKZ C;  1VQ6 P;  2Z4E A;  1Y47 A;  2YKQ A;  2IML A;  2ZXE B;  5LMN T;  3BQK A;  1L0L J;  4AI6 A;  2KB7 P;  3KVB A;  1W09 A;  2IZ0 A;  3GMI A;  3RKO A;  3TLU A;  5CGM A;  5LA6 E;  1YXR A;  1CI6 A;  1KB9 D;  3F89 A;  3IF8 B;  4TNW A;  4B86 A;  2V1D B;  4NUV A;  4CN1 A;  1HFA A;  3L72 G;  4ZZB A;  5AVV B;  1VQM P;  2GA1 A;  1IZN B;  5APT A;  1N73 B;  5CBN A;  1SQB K;  1CHU A;  2H89 A;  2O01 H;  3H32 A;  2CPS A;  3GHG B;  3R84 B;  2Z5I A;  4I55 E;  3VMA A;  3P4Q A;  5KMG P;  2DLR A;  3K8P C;  4DV3 T;  4UEM A;  5JRC A;  4H44 D;  1FZB A;  1NHL A;  5LHH B;  4OFZ A;  2LOS A;  3NWI A;  3L75 J;  4A98 A;  1WT6 A;  4MLK A;  1KTM A;  4PV1 B;  4OYK A;  2XND H;  1KFM A;  3HE4 B;  2ZYA A;  5KKZ B;  2UXC T;  2ODV A;  3P7K A;  2CPB A;  3CL3 D;  4TNV A;  1U7M A;  2BBH A;  3F31 A;  1HNZ T;  4DJG A;  3BCC D;  1KYO E;  1GL2 D;  4B3T T;  1L0L E;  3EFF K;  1GTW A;  3MP7 B;  1OX3 A;  2FXO A;  3CD6 P;  3M3Z B;  2OTJ P;  3VP8 A;  2WDQ A;  3UFE A;  4BJN A;  3RKG A;  4CN4 A;  4IE5 A;  3EFG A;  3KPE A;  4H9R C;  3L3P A;  5JDQ A;  4CI2 B;  2K9J B;  4U3F J;  2E5V A;  3L09 A;  2OYI B;  4YXW H;  3KV9 A;  2ITA A;  4JBZ A;  2E5Y A;  1L0N K;  1VQK P;  2JIW A;  4ISS A;  3GN5 B;  3N9L A;  2VKD A;  1SQX K;  1XNQ T;  3CC4 P;  4AKH A;  4IFM A;  4PJL A;  3H1J D;  1GW4 A;  5HEH A;  2V4H A;  2BVM A;  3LBX A;  1CUN A;  3FZL B;  5LBM A;  3ONL C;  2J1D G;  2KLQ A;  1XTG B;  2IW5 B;  4MHC A;  5LJM A;  1ZEE A;  3NTN A;  3MZW B;  1MMA A;  2LM2 A;  2MBG A;  2V6Y B;  2XY8 B;  4Z90 A;  3RK2 D;  3L70 D;  5FP3 A;  4YHH T;  4ZI3 C;  1HJB A;  1OED A;  1H7C A;  3GF7 A;  5CCG D;  2YIN A;  3CWB D;  3N9P A;  2GUS A;  3NKZ A;  2C5J A;  3AEA C;  4X65 T;  1OXZ A;  1EXJ A;  3K3Q C;  5FVK A;  2KWH A;  2V5C A;  3H25 A;  3H1K G;  3MA9 A;  5ADX L;  2G3A A;  3E7K A;  5KAF E;  2J4G A;  1X0T A;  5KJ7 C;  3VU7 H;  1DD3 A;  4GDO A;  3ZCJ A;  1SQP J;  3G9R A;  3E08 A;  1W0A A;  4QKN A;  2IBZ D;  1FMW A;  4LFB T;  2RH0 A;  1URQ C;  2E42 A;  2D0T A;  4DV1 T;  1PPJ D;  3AE2 C;  5AW8 B;  4N78 D;  2JMK A;  2FKW B;  1X79 A;  2W8Z A;  1R5S A;  3ITK A;  2MTQ A;  2XAS B;  3AXJ B;  3D6Y A;  5FNV E;  4JI2 T;  5AQQ B;  2VWA A;  1NU1 G;  3L71 G;  5J1G A;  3ZDM A;  1RQU A;  1NTK D;  3C1L A;  2N9B A;  1SQQ D;  1GU5 A;  1RQV A;  5C8Y E;  2WT7 A;  1M7L A;  1PGJ A;  2ZYD A;  1HCI A;  1RF0 A;  3AE3 C;  3S4R A;  2BKN A;  2LEH A;  4PAG A;  3RHW A;  1FOS E;  3AE7 A;  5LBQ B;  2Y0D A;  3AEC C;  3M0D A;  1IJD B;  2XAF B;  4AKL A;  3KQG A;  3LW5 J;  1ZHC A;  3QOF A;  2WZ7 A;  4LLH A;  2E74 D;  4PD4 I;  3L74 J;  2WSF H;  2BKP A;  2WQY A;  4O2B E;  2W90 A;  1JUN A;  2ZJS E;  4QX7 B;  3E0Z A;  2JJL A;  1IAP A;  2EHO C;  2WPQ A;  2NOX A;  1JY2 P;  4GYS A;  1DX7 A;  3SWK A;  1YQ3 C;  1KB9 E;  1SQP E;  3JCU E;  4PJ0 E;  3TNU B;  3B5N C;  2XTL A;  4AQR D;  3PP5 A;  2OGU A;  3JAE A;  4ZOL E;  4DVD A;  5LYJ E;  3M9Q A;  3LK3 B;  5L3B B;  5KLV G;  3RGU A;  2HPC A;  2WWV A;  4DND A;  3EDU A;  2W6J H;  1LWU C;  3CCS P;  3BK9 A;  1DEB A;  2R5D A;  2CXD A;  4UB8 H;  2XQ8 A;  3C9I A;  4GIW A;  1FDI A;  2A2F X;  2WSS H;  2RPA A;  1FZC A;  4TV8 E;  4DR3 T;  3T1H T;  3HD7 D;  4PNI A;  3SFE C;  2L8K A;  1HJ0 A;  5DQW A;  3RQW A;  1XNR T;  1N86 A;  3R2P A;  1LGH B;  3RPU A;  2SPZ A;  2L9Q A;  2WS3 A;  4LF4 T;  1XZY A;  3L74 E;  3M65 A;  4DUZ T;  4HE8 A;  3GMA A;  2E75 D;  5J2U E;  2K24 A;  2X51 A;  2UUA T;  1ZKE A;  3L37 A;  2CXL A;  2NRG A;  2JKV A;  3B5N B;  1FEW A;  3AEG A;  3VMX A;  4ILU A;  3C4Z A;  1OVV A;  1EDI A;  3L73 G;  1JCD A;  3CWB J;  3C64 A;  4DBR A;  2K5B B;  1MMN A;  3OTO T;  3JC2 2;  3T97 B;  2W27 A;  4EOT A;  5AQP B;  4YTM A;  3MZK B;  4JEU B;  4L75 A;  4TLF A;  2CK3 H;  3FZM B;  4PW8 A;  3L72 D;  1TU3 F;  3CCU P;  3FGA D;  3CLQ A;  4GIF A;  2AXD S;  2VL0 A;  2O1J A;  3FWN A;  1BSN A;  1YQ4 C;  2KYV A;  2WP9 A;  1KYO H;  4PD4 D;  2IAK A;  3M9B A;  2E2A A;  1ZRT E;  3O1H A;  1VQN P;  3TGU D;  4C7N A;  4DID B;  3RL0 g;  2Q9I A;  3Q2Y A;  1NTK J;  2W83 C;  4JI3 T;  1US7 B;  2R44 A;  3HI2 A;  2A72 A;  3L70 E;  2X68 A;  1H0T B;  2ZMA A;  1ZR2 A;  4ASV A;  1SA0 E;  2W2U A;  1M7K A;  4YJ2 E;  1VQP P;  3CWB E;  3U59 A;  2N1G A;  3E1I A;  4U2Z A;  3RYC E;  2QJK B;  1LVF A;  3Q5S A;  4MFR A;  3H1H G;  5HWY A;  3RRC A;  5BVZ A;  2ZT9 D;  1H8A A;  3BAT A;  3GLM A;  4HFH A;  2P9B A;  4U2Y A;  3PUX F;  1SQV K;  2E76 B;  3B5M A;  2BEZ F;  4HKA A;  3KDS E;  5L2L A;  2LLY A;  4M1P A;  3O8Z A;  1PPJ E;  3VTP C;  2CCQ A;  2KNC B;  5BMV E;  4N78 E;  3VMZ A;  2E9X D;  5LP6 E;  3TK1 A;  1GZL A;  5AVR B;  5ETW A;  5GTH E;  4QXH B;  2H3R A;  3UU3 A;  1VQ9 P;  3ZT5 A;  3ANW A;  4YLH A;  1NTK E;  3MUD A;  2VVN A;  3CXH E;  3CQG B;  4TWF A;  4QHO A;  3QB5 A;  2G8Y A;  4UB6 E;  1M57 D;  3N9O A;  2X9W A;  1AJY A;  5KAF H;  1FC2 C;  1N7S D;  2QJY C;  3QK6 A;  1LT9 C;  4HFC A;  2IDB A;  2N9D A;  3ABV C;  2XM2 A;  2FJB A;  1EXI A;  2FYZ A;  2LSY A;  1NTM K;  5CCH C;  1W2E A;  2K1A A;  4IL6 E;  3ZPO A;  2OQQ A;  1CSB A;  3H1L J;  3Q5W A;  3PUA A;  1NYH A;  3LG7 A;  3AVR A;  1T3J A; 
#chains in the Genus database with same CATH homology
 4PFO A;  2CMR A;  3LK4 2;  1LTG C;  2OAR A;  1RE3 A;  4JUY A;  1FZC B;  2DCF A;  2YK0 A;  2WMN A;  3BAS A;  1RE4 C;  5AVX B;  2LE8 A;  3NFQ A;  1A02 F;  1RF1 A;  4TV9 E;  5L3F B;  1LTS C;  3NMD A;  2MYS A;  2SPC A;  3RL0 C;  4W7Y A;  4AQG A;  4WY4 D;  4CZZ B;  2JMH A;  4PFP A;  4O4I E;  1KIL D;  3A5X A;  4XZC A;  3UUM A;  3NXS A;  4ZI2 D;  2Q9Q C;  3B8E B;  1Y64 B;  5FY1 A;  3EVY A;  1FAV A;  3PUR A;  5J2T E;  4DBQ A;  4QXB B;  4A56 A;  1L0L K;  3RL0 B;  1JY2 N;  2PG8 A;  2ZFC A;  1GL2 A;  3LW5 H;  3PDY A;  2KSJ A;  3ZEF B;  2D2S A;  2X66 A;  3II6 A;  5KTB A;  2HPL A;  3LIE A;  1XTC C;  5KX5 E;  2R32 A;  5AW2 B;  2LHR A;  2Q9Q B;  4H63 H;  2NPS C;  3AAI A;  1ZV8 A;  4KHX A;  1LTJ A;  3B13 A;  2KND A;  4XE5 B;  4H9S E;  2CA5 A;  4JYB A;  1VPC A;  4I4T E;  2HG5 D;  3ZN1 B;  1GK6 A;  3KVA A;  1QL1 A;  2J58 A;  4I43 B;  4AQF A;  5CCG A;  5FXV A;  3Q5X A;  4UXN B;  2FFD B;  1JOC A;  3HKE E;  4WBO A;  1JNM A;  4W7Z A;  4QXC B;  2N1T B;  4FJO A;  1SFC C;  5APY A;  5E0O A;  1HTJ F;  5AW7 B;  2NPS B;  3CKD A;  4ZKP A;  1FIO A;  2W63 A;  4EIW A;  2L3L A;  3ONX A;  3ZCI A;  4E7S A;  3RRW A;  2ZM0 A;  3HL6 A;  1GU4 A;  5EK4 A;  2W00 A;  4XBF B;  1GDT A;  4O4H E;  3AVS A;  4JF7 A;  3SWH A;  5L3G B;  3HRN A;  2X67 A;  2M8R A;  4X20 E;  1YD8 G;  3TYY A;  3PU8 A;  4ZHQ E;  5L3D B;  4TZ4 C;  1N73 C;  2NWB A;  3V5U A;  1SFC B;  3ZC1 A;  1G2C A;  3RX6 A;  3GHG C;  3M0A A;  2VK9 A;  3ZJ1 A;  3ZJ2 A;  5AFU L;  2UXX B;  3PTR B;  5AW5 B;  1SQP K;  2XAQ B;  4IHJ E;  1FOS F;  4X1K E;  3HUS B;  1LTI C;  1NKN A;  1ZLL A;  2LOP A;  2WWW A;  1KZU B;  2XDJ A;  2WSC H;  1T98 A;  1HG5 A;  4NUU A;  4OHF A;  3CI9 A;  5M4Y A;  5HXS A;  3MD0 A;  1B7T A;  3IBP A;  4BAY B;  1GL2 B;  3V2Q A;  5AVZ B;  3HD7 A;  4BJM A;  1NKZ B;  1WYC A;  4H9O C;  3KV4 A;  2OYI C;  3OYX A;  2D5U A;  1L4A C;  1SVF A;  3J7Y q;  5LHI B;  3G3Z A;  3ZYM A;  5KJ7 A;  4EZ4 A;  1ZR4 A;  4Z8X A;  1CW5 A;  3U3I A;  4KUM B;  2YNY A;  3FXE B;  3V5B A;  2C9N Y;  3RYF E;  4DMV A;  5JR9 C;  1FZF A;  2HH7 A;  3KV5 A;  2JRK A;  2XKM A;  3RK2 B;  5JDL A;  3F2E A;  4QWN B;  3NZQ A;  1L4A B;  1T2K D;  4EXT A;  2OA5 A;  3IR9 A;  4GKG A;  2KMF A;  2YU2 A;  2KIN B;  5EK2 A;  1HGV A;  4UEL A;  2EHO A;  1HUC A;  1T8Z A;  1YKE B;  3VN0 A;  1JY3 O;  3N2K E;  2DI4 A;  5JR9 B;  5FYM A;  1MUU A;  1IJ5 A;  4IE4 A;  4EZH A;  5JVD E;  5GON E;  1QSD A;  4ASK A;  3DTO A;  3UIA A;  2DHR A;  4EOZ B;  2E9X A;  4YFS A;  2PP6 A;  3UT5 E;  1G2C B;  1NO4 A;  1NTK K;  3C50 A;  2LHN A;  3O4X E;  2FXM A;  3QUJ A;  2WBL A;  1N7S A;  4ADZ A;  3V4W A;  3B57 A;  4ZS2 A;  5APQ A;  5H6Q B;  3BQI A;  1IFM A;  3M9H A;  3CQX C;  1SP4 A;  3L35 A;  5FMN A;  2WMO A;  1CI6 B;  1JMM A;  3ZMT B;  2I1J A;  2YEV C;  3SOL A;  2HOD A;  4QX8 B;  4UF0 A;  4UVA B;  2V7I A;  3Q2M A;  1IFN A;  2E8I A;  3H32 B;  3HTK A;  4EB6 E;  1FDM A;  4AKI A;  1T3U A;  5JRC B;  2C0W A;  3H6P A;  3SWY A;  3VHL A;  2LM9 A;  4XAX B;  3U1C A;  2ZM8 A;  1KK7 A;  4EIJ A;  4WY4 A;  1M1J A;  2VL8 A;  1D1B A;  2WM9 A;  1WYB A;  1YTZ T;  1KIL A;  4ZI3 D;  2M67 A;  3ZN0 B;  1KFN A;  1MIV A;  1U5P A;  3I5C A;  5DJQ C;  4X1Y E;  5L3E B;  2FYU K;  2W62 A;  1OWA A;  5KJ7 D;  2KWI B;  2R3C A;  3RK3 C;  1HGZ A;  2IC9 A;  3I0Q A;  1URQ D;  3NZP A;  3LBX B;  1BR4 A;  5HWX A;  1LT9 A;  1D1A A;  5EZY E;  5JDF A;  3ZMZ B;  2DWG A;  3N4X A;  3QC9 A;  5AW3 B;  3PUS A;  3D0T A;  4L0R A;  1RF0 C;  4YJ3 E;  2KXP B;  4O8S A;  5CA0 E;  2I1K A;  4HGA A;  4U72 A;  2Z5H A;  2NTX A;  3RK3 B;  2WWU A;  3KBU A;  2EHO D;  2Z6E A;  2OYH A;  5CB4 E;  3FB2 A;  2XNX A;  3B5N D;  4N6J A;  4V1A v;  1X79 B;  4F6R C;  3HE5 A;  2W61 A;  2BZB A;  2VKJ A;  2WT7 B;  1NTZ K;  3MIW A;  3ESL A;  2R5B A;  1FZC C;  4IE0 A;  3S4U A;  3HKC E;  2BAS A;  4DOJ A;  1G73 A;  5AW4 B;  1GK4 A;  1MIW A;  3HTK B;  2Q5U A;  3VKG A;  1IFJ A;  3R6N A;  4OK0 A;  3WMM 0;  5JQG E;  3I1A A;  2HPC B;  3BRT B;  5CA1 E;  3VOP A;  3SS1 A;  2D0U A;  4GYR A;  4OH8 B;  2I59 A;  2CXF A;  4Y99 C;  1MMG A;  5DQV A;  3OBV E;  3BRV B;  4HFV A;  2A45 G;  3A2A A;  4PK5 A;  1Z56 A;  1LKX A;  4PJM A;  2H7V C;  2C9L Y;  4PK6 A;  5APS A;  1FZG A;  1FMV A;  4H9P C;  4OYJ A;  3PUG A;  4H9N C;  4UVB B;  3HR0 A;  5KLV K;  2RP4 A;  5BU5 A;  3U78 A;  4UVC B;  3ZMS B;  3MAC A;  4Y99 B;  4RES B;  3ZC0 A;  3JC6 C;  2P1J A;  3NRX A;  3CWZ B;  5APV A;  4CQI A;  4LGD E;  4C7N B;  3ETV A;  3W15 B;  1IJ6 A;  2YO2 A;  3OYZ A;  4DZO A;  4B6X A;  1N7L A;  5HYA A;  3C4W A;  5FY7 A;  1PFI A;  5AW9 B;  2FFD C;  1JY3 P;  2ACX A;  2N1T C;  5CCH D;  4H9Q C;  3ETU A;  2Y48 B;  4PJN A;  3VMY A;  2X9X A;  5AVS B;  5HXC A;  3ZMU B;  4G63 A;  2MJZ A;  3GHG A;  2LT3 A;  3LFM A;  1RE3 C;  2PFV A;  5F8P A;  2WPR A;  3EUH A;  4C90 A;  2BVL A;  3UUL A;  2H7O A;  3HE4 A;  4GOU A;  3P7I A;  3ZYL A;  3ANW B;  2IFN A;  2YO3 A;  2WPS A;  3RL0 D;  4ZKU A;  2G0U A;  3DJB A;  3MTU E;  4MAL A;  2XHE B;  2Y8D A;  4TX5 A;  5JDH A;  4CXY A;  1FBM A;  3C4X A;  1LTA C;  1VOM A;  4CI3 B;  2IC6 A;  3RYI E;  1WR6 A;  3KV6 A;  2WTY A;  2Q9Q D;  3HUS C;  2KLV A;  1D0Z A;  3GN5 A;  3WAJ A;  2XUE A;  5APU A;  2CM0 A;  3P8M C;  2QGS A;  4O4L E;  1V9D A;  4PJJ A;  2A45 I;  2ODU A;  3IHR A;  1RF1 B;  3C98 B;  5AW6 B;  1SLQ A;  3ZMV B;  1RY3 A;  2K9A A;  1GL2 C;  5JH7 E;  1J1E C;  1LRZ A;  2BDE A;  3KYQ A;  3KBT A;  4DMW A;  4E7Z A;  2M3B A;  2DWK A;  3TSI A;  2XAJ B;  1MND A;  3DP7 A;  4KP3 C;  2CLY C;  4UIG A;  1LTT C;  1EZ3 A;  3WAK A;  3EDV A;  3EQ2 A;  2NW9 A;  2NPS D;  4L9I A;  2CE7 A;  3I9Y A;  2NTY A;  2LKM A;  1LVK A;  3Q9D A;  3CX6 B;  4IIJ E;  1FJP A;  2C5I T;  2XAH B;  5H6R B;  4IE6 A;  4KBM B;  1KNZ A;  1J1E B;  4HYT B;  5LOV E;  3RK2 C;  2C0S A;  3IEE A;  1CZQ A;  4AQF C;  5CCG C;  1WLX A;  5HXE A;  2XZR A;  3N9M A;  4P0B A;  4N3Y B;  5AVQ B;  1S35 A;  1SFC D;  2CLY B;  4AKR B;  2V7M A;  5CJ4 A;  1IO4 A;  3VP9 A;  2O1K A;  3MJX A;  4IST A;  4WNK A;  1LTJ B;  1AQ5 A;  1URQ A;  2NP9 A;  1MMD A;  2CWY A;  3TNU A;  3V4Q A;  2JPF A;  1JO5 A;  1UCU A;  2LSG A;  5JRE A;  3ZLI A;  3V2P A;  5A1L A;  1HX8 A;  1DH3 A;  2VRS A;  1AJ3 A;  2LJL A;  2KZ7 B;  3E22 E;  2LSK A;  4TN7 B;  2X9Y A;  3N9N A;  3F57 A;  4U74 A;  1BR1 A;  2B1E A;  1G1J A;  1YYC A;  4H63 V;  2LSI A;  3KIN B;  3B5N A;  3A7O A;  3KFW X;  1N2D C;  1FZE A;  4ANJ A;  2V7J A;  2QM8 A;  3FBL A;  3T97 A;  4O4J E;  1LWU A;  2RA1 A;  3L4F A;  2NW8 A;  3GWH A;  3KDP B;  1BR0 A;  3RH3 A;  4JEH B;  4J2C A;  2V7L A;  2LSJ A;  2J59 M;  3HD7 C;  1JY3 N;  3CX8 B;  4TUY E;  1S9K D;  3N5L A;  1L4A D;  5CJ0 A;  1IC2 A;  1VDF A;  2QA7 A;  3RYH E;  3C51 A;  5LCY A;  1SQQ K;  3BQL A;  3RC8 A;  3J9X 1;  4EYU A;  2ZLY A;  4C46 A;  5FXZ A;  3FXD B;  2W6B A;  2JQQ A;  1G8X A;  3UUN A;  5DAB A;  2WSE H;  3ZYK A;  4P0A A;  1IFD A;  4AYC A;  4CXX A;  4ZS3 A;  3AA1 B;  3HD7 B;  4ERR A;  5APW A;  2GM4 A;  1X9V A;  4IGU A;  4PK4 A;  5HXH A;  4HN9 A;  5AVU B;  2P2U A;  2A3D A;  3BVH A;  1VRB A;  1SHZ C;  3I9W A;  3T8O A;  3L36 A;  4HEA A;  3N9Q A;  1WRD A;  2XAG B;  5KDM C;  2N2N A;  1HBW A;  3MGN A;  3OJA A;  5TAO A;  2HPJ A;  1URQ B;  2H7H A;  2VB6 A;  5FY0 A;  5IHY A;  3N7N A;  1O3X A;  4HTE A;  2H43 A;  4IE7 A;  3RC3 A;  1QL2 A;  2Q3I A;  3WI3 A;  1G1I A;  3LK2 B;  3P8C D;  2L5G B;  5LGU B;  4P09 A;  1NWM X;  1JCC A;  2X9H A;  2E9X C;  1EQ7 A;  2W6A A;  3V2N A;  2EHO B;  3PE0 A;  4UV9 B;  3HA4 A;  3SWF A;  2X0L B;  1N7S C;  2VKO A;  4I50 E;  5CCH A;  3IFM A;  4I2L C;  2W0G A;  4L5G A;  2IFM A;  1HTL C;  1LWU B;  2H8P D;  4BA9 A;  1D1C A;  2PAJ A;  1FJK A;  1MFZ A;  1GD2 E;  2Y6X A;  3M0D C;  2C0X A;  1MNE A;  2C5K T;  2E9X B;  3O1J A;  1RE4 A;  2Q7C A;  1NH4 A;  5CHX A;  4EAH A;  1ZV4 X;  3FBZ A;  1N7S B;  4O9B A;  1HWT C;  2P7J A;  3AA6 B;  4AKG A;  4WY4 C;  1M1J C;  1S9K E;  3GA8 A;  1WRG A;  1KIL C;  1JTH A;  3A3Y B;  3AA0 B;  2Q9Q A;  4ZI2 C;  3V2R A;  2HOD B;  4C7R A;  2HYN A;  3K3O A;  3MKD A;  4UF0 B;  1Z0P A;  1NAF A;  4EYY R;  3P32 A;  1YKH B;  1YW0 A;  4WW0 A;  3OKQ A;  5FXW A;  3CVR A;  1MIY A;  2ES0 A;  4UV8 B;  4GK0 E;  4XA4 A;  3RK3 D;  3MXZ A;  3AA7 B;  1QUU A;  3CML A;  3PU3 A;  1J2J B;  4WY4 B;  1M1J B;  1J1D C;  1UX5 A;  3OJA B;  3U1A A;  2XQY A;  1FZA A;  1NWQ A;  2FFD A;  1IK9 A;  3N2G E;  1KIL B;  2P67 A;  2JEE A;  5AVY B;  2N1T A;  5LXT E;  4G2A A;  1NU1 K;  2PBI A;  2NPS A;  1E1H B;  3UTK A;  2KOG A;  4CXW A;  1H88 A;  4WB4 A;  4JLE A;  1H89 A;  4GT1 A;  4KMC A;  4JYC A;  5CMZ A;  3H3A A;  5L3C B;  2OYH C;  5AW0 B;  5JDN A;  3SRZ A;  4YHJ A;  1HH0 A;  1J1D B;  4FI5 A;  1HF8 A;  2DNX A;  4AUW A;  3N2O A;  3P8C E;  1KQL A;  2PJQ A;  3CPZ A;  1LT9 B;  2WIT A;  4IDZ A;  3M06 A;  2V7K A;  1SFC A;  2WSS V;  1UX4 A;  3VYI A;  5HXR A;  2POH A;  5AVT B;  3K3N A;  5APX A;  2KT9 A;  3V5S A;  1MV8 A;  4O2A E;  1JY2 O;  3HUS A;  3NBX X;  1S94 A;  5LGN B;  2YKP A;  2V26 A;  5AW1 B;  4M3L A;  3HKD E;  1E5W A;  2K48 A;  3OAK A;  5AVW B;  2OYH B;  2QM7 A;  2A45 H;  5HAX A;  4CI1 B;  1IFI A;  2JJ9 A;  4I6M C;  4I1L A;  3MK7 C;  1X8Y A;  1GW3 A;  3HE5 B;  1N73 A;  2YMY A;  5JDG A;  5LHG B;  3A5T A;  3M91 A;  2UXN B;  4WBA A;  2VAS A;  3O1I A;  1JTH B;  1D0X A;  2CWO A;  4WBN E;  2GUV A;  1RF1 C;  3FHN A;  1HG2 A;  5BU8 B;  2HFE D;  5FXX A;  3AAA B;  4X1I E;  1HS7 A;  2IX7 C;  3LID A;  4MBQ A;  4W80 A;  2OYI A;  5LG4 A;  2IPP A;  1L4A A;  3UUX B;  2E43 A;  5JDM A;  1AFO A;  3O9X A;  1A02 J;  3CX7 B;  4C91 A;  1YTZ I;  5F3J A;  1LTB C;  2NW7 A;  3JC6 D;  4IFF A;  3AB3 B;  5EK3 A;  3VKH A;  5LNK A;  1HVV A;  3HKB E;  2CEA A;  1NOH A;  2GK9 A;  2WAU A;  1ZN5 A;  5JR9 A;  3LJC A;  4IFD K;  3OA7 A;  2MOZ A;  5IYZ E;  3NRY A;  5LJN A;  2VKH A;  4AXP A;  2XV5 A;  4DO0 A;  2YKO A;  4HH2 A;  2HLO A;  2N1T D;  1BR2 A;  3H37 A;  3TKL B;  3I0O A;  1D0Y A;  1T2K C;  2ZM2 A;  4K0U A;  3PUQ A;  3CQC B;  3AAE B;  4ZI7 E;  1LTJ C;  2YU1 A;  1U4Q A;  1MZ9 A;  4LC1 A;  2XU6 A;  2KP8 A;  5LGT B;  4GK5 E;  1FU1 A;  2Z4E A;  2YKQ A;  2ZXE B;  3BQK A;  4AI6 A;  2KB7 P;  3KVB A;  3GMI A;  3RKO A;  5LA6 E;  1CI6 A;  3IF8 B;  4B86 A;  2V1D B;  4NUV A;  1HFA A;  5AVV B;  5APT A;  1IZN B;  1N73 B;  1SQB K;  2O01 H;  3H32 A;  2CPS A;  3GHG B;  3R84 B;  2Z5I A;  4I55 E;  5KMG P;  2DLR A;  3K8P C;  4UEM A;  5JRC A;  1FZB A;  1NHL A;  5LHH B;  4OFZ A;  2LOS A;  1WT6 A;  4MLK A;  4OYK A;  1KFM A;  3HE4 B;  2ODV A;  3P7K A;  2CPB A;  3CL3 D;  3F31 A;  1GL2 D;  1GTW A;  3VP8 A;  3UFE A;  4BJN A;  4IE5 A;  3EFG A;  3KPE A;  4H9R C;  3L3P A;  5JDQ A;  4CI2 B;  3L09 A;  2OYI B;  3KV9 A;  1L0N K;  4ISS A;  3GN5 B;  3N9L A;  2VKD A;  1SQX K;  4AKH A;  4IFM A;  4PJL A;  1GW4 A;  2BVM A;  3LBX A;  1CUN A;  5LBM A;  2J1D G;  2KLQ A;  1XTG B;  2IW5 B;  4MHC A;  5LJM A;  1ZEE A;  3NTN A;  1MMA A;  2MBG A;  3RK2 D;  5FP3 A;  4ZI3 C;  1HJB A;  1H7C A;  5CCG D;  2YIN A;  3N9P A;  2GUS A;  2C5J A;  1OXZ A;  3K3Q C;  2KWH A;  3MA9 A;  5ADX L;  5KJ7 C;  3VU7 H;  3ZCJ A;  3E08 A;  4QKN A;  1FMW A;  1URQ C;  2E42 A;  2D0T A;  5AW8 B;  4N78 D;  2JMK A;  2FKW B;  1X79 A;  2MTQ A;  2XAS B;  5FNV E;  2VWA A;  5J1G A;  2N9B A;  1GU5 A;  5C8Y E;  2WT7 A;  1M7L A;  1HCI A;  1RF0 A;  2LEH A;  4PAG A;  1FOS E;  5LBQ B;  3M0D A;  2XAF B;  1IJD B;  4AKL A;  3KQG A;  1ZHC A;  2WZ7 A;  4LLH A;  2WSF H;  4O2B E;  1JUN A;  4QX7 B;  3E0Z A;  2JJL A;  1IAP A;  2EHO C;  2WPQ A;  2NOX A;  1JY2 P;  4GYS A;  1DX7 A;  2XTL A;  3TNU B;  3B5N C;  4AQR D;  3PP5 A;  4ZOL E;  4DVD A;  5LYJ E;  3M9Q A;  3LK3 B;  5L3B B;  2HPC A;  4DND A;  3EDU A;  1LWU C;  3BK9 A;  1DEB A;  2R5D A;  2CXD A;  4GIW A;  3C9I A;  2A2F X;  1FZC A;  4TV8 E;  3HD7 D;  4PNI A;  2L8K A;  5DQW A;  1N86 A;  3R2P A;  1LGH B;  3RPU A;  2L9Q A;  3M65 A;  4HE8 A;  5J2U E;  2K24 A;  2X51 A;  1ZKE A;  3L37 A;  2CXL A;  3B5N B;  1FEW A;  3VMX A;  4ILU A;  3C4Z A;  1JCD A;  3C64 A;  4DBR A;  2K5B B;  1MMN A;  2W27 A;  4EOT A;  3MZK B;  4JEU B;  4PW8 A;  3CLQ A;  4GIF A;  2O1J A;  2KYV A;  2IAK A;  3M9B A;  3O1H A;  4C7N A;  2Q9I A;  1US7 B;  3HI2 A;  2A72 A;  2X68 A;  2ZMA A;  1ZR2 A;  1SA0 E;  4YJ2 E;  3U59 A;  2N1G A;  3E1I A;  3RYC E;  1LVF A;  4MFR A;  5HWY A;  3RRC A;  5BVZ A;  1H8A A;  3BAT A;  2P9B A;  1SQV K;  4HKA A;  3KDS E;  5L2L A;  4M1P A;  3O8Z A;  3VTP C;  2CCQ A;  5BMV E;  4N78 E;  3VMZ A;  2E9X D;  5LP6 E;  3TK1 A;  1GZL A;  5AVR B;  5ETW A;  4QXH B;  2H3R A;  3ANW A;  4YLH A;  3MUD A;  3CQG B;  4QHO A;  3N9O A;  2X9W A;  1N7S D;  3QK6 A;  1LT9 C;  2N9D A;  2FYZ A;  2LSY A;  1NTM K;  5CCH C;  1W2E A;  3ZPO A;  1CSB A;  3Q5W A;  3PUA A;  3LG7 A;  3AVR A;  1T3J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...