1OXZA

Crystal structure of the human gga1 gat domain
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
132
structure length
132
Chain Sequence
b'DEEKSKMLARLLKSSHPEDLRAANKLIKEMVQEDQKRMEKISKRVNAIEEVNNNVKLLTEMVMSHSQGGAAAGSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEILQANDNLTQVINLYKQLVRGEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADP-ribosylation factor binding protein GGA1
publication title Crystal Structure of Human GGA1 GAT Domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 51
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03127 GAT GAT domain
A PF18308 GGA_N-GAT GGA N-GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1oxzA01
1.20.58.160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1oxzA02
1O3XA 2W27A 2YO2A 3SWFA 1YD8G 2XZRA 1DH3A 3NFQA 3B8EB 1H89A 2E42A 1HBWA 1IO4A 5AW9B 3HE4B 3KQGA 2WPRA 2R32A 5AVZB 4EOTA 5AVVB 5AW4B 2P2UA 3HE4A 5AW0B 1NWQA 2N2NA 1HJBA 2ZXEB 4M3LA 1MV8A 4JYCA 2P67A 5APYA 5APSA 1CSBA 5AW8B 1YYCA 5AVYB 3VMXA 4C46A 1CZQA 2C9LY 1J2JB 3L36A 2Q5UA 2R5BA 3A7OA 1H88A 3NMDA 3LIDA 2ZFCA 3M0AA 3M06A 5CMZA 3L37A 2KP8A 5APQA 3VYIA 1FOSF 2Z5HA 1GU4A 2E43A 3IR9A 3M0DA 2Q7CA 2YNYA 1SLQA 1JUNA 3VN0A 3OAKA 1T2KD 1SP4A 1A02J 3MD0A 1G2CB 3VMYA 2BASA 2R3CA 3M91A 1H8AA 3NTNA 2XU6A 4XE5B 1JNMA 4JYBA 1WRDA 3M9HA 3TK1A 4B86A 1KQLA 1T2KC 2W6AA 2WTYA 3TYYA 3V4WA 4I6MC 2R5DA 1CI6A 3P32A 5AW5B 3T97A 1S9KE 1NAFA 1GU5A 3L35A 1S9KD 2N9DA 2WPSA 1MFZA 4C7NA 1HWTC 3HTKA 2C9NY 1FOSE 5AW3B 2P7JA 3P7KA 1X79A 5APXA 1GD2E 3MGNA 5AVXB 4DZOA 2IPPA 4I2LC 5APTA 2JJLA 3A5TA 5APVA 5APUA 2WT7A 3O8ZA 3A3YB 3VMZA 5APWA 2Z5IA 4AQRD 5AVUB 3V4QA 3HE5A 4GT1A 1MUUA 1GZLA 4LC1A 1OXZA 5AVTB 5AVSB 2XV5A 1CI6B 4AUWA 2H7HA 2WWWA 3NXSA 2YO3A 4RESB 5AVWB 2N9BA 4C7NB 5AW7B 3V5BA 5AW2B 3UIAA 1GK6A 3KDPB 4KHXA 3VTPC 2WPQA 4AYCA 2QM8A 1WR6A 1X8YA 3M9BA 1FAVA 2Q3IA 1NWMX 1OWAA 2VRSA 3I5CA 1GK4A 5AVRB 2WT7B 1GTWA 5AW6B 3LIEA 3TNUB 1HUCA 5AVQB 3A2AA 2QM7A 4GKGA 3HE5B 3P8MC 1A02F 3TNUA 4HYTB 5AW1B
chains in the Genus database with same CATH superfamily
3QNUA 3HRNA 3IA3A 1D1CA 4QXBB 1E5WA 4I50E 1G73A 3Q2MA 5FXVA 4IE7A 1Q86Q 1VQ6P 1JCCA 5KJ7D 4GK0E 1PP9E 2CA5A 3CWBJ 2Q9QD 3CPWO 1P84H 4DV7T 3EABA 5J2TE 3HKDE 1NTZK 2FFDC 4EYYR 4JBZA 3CX6B 1BSNA 3E22E 3H1HE 1VF5B 3L71G 3WAJA 3V2RA 5HEGA 4YXDC 5JDFA 1NO4A 1NU1J 3M06A 5CMZA 5AQJB 1QL2A 2LEHA 1USDA 2M8RA 1DD3A 4ZI3D 4KHZF 3SRZA 2K9AA 3BCCD 2X0LB 3VOPA 2Y9ZA 2OTKE 4IIJE 1SFCB 2H8PD 2ZM8A 3ZSTA 2RA1A 4JYBA 2XAFB 3L70G 1T98A 2IFMA 1KQLA 5L2LA 1BDCA 2BKPA 2O01J 1UX4A 2NP9A 2KSRA 1GW3A 3V2PA 3KV9A 1KZUB 4E7ZA 2Y9YA 3OKQA 4C7NA 2KWHA 1EZVE 3Q5RA 5LYJE 5CCGC 3O1HA 4AI6A 4OGQD 4ISTA 4HWFA 5AQNB 3VMZA 4AQRD 2IC6A 5AVUB 3HE5A 2J59M 3CX5D 1VQNP 2CWOA 4WBNE 3II6A 4JBWF 1OVUA 1EZ3A 1K9MQ 4ZI7E 5A1LA 4BJMA 4QH4A 1SFCC 1VQKP 3H1KJ 4KUMB 4G63A 2XQAA 2ODVA 2QM8A 1FMVA 3M9BA 2CM0A 3JAEA 4HFEA 3KVAA 5FY0A 1J1EB 4QKNA 3N9OA 3FWNA 1WMKA 2AXCA 1VQ4P 2JWAA 4YHJA 2VKHA 4EI2A 5CCGA 2YDSA 1BE3J 2OTJP 3HE4B 2WPRA 4DO0A 2FYUG 3EUHA 1E7PA 2ZT9B 2UWJE 4O4LE 2JP3A 1W9RA 5M4YA 1Q7YQ 2B1EA 1QLBA 1I94T 5FY1A 1FZEA 3U1AA 1V9DA 2N2NA 2IX7C 2K9YA 2XUEA 1D1AA 3CCQP 2X68A 1K04A 1KMIZ 1ZOYC 3I9WA 4WNKA 1SFCA 4YXWH 3L36A 5H6QB 3NMDA 4HTEA 2G8YA 2WSEH 2YKPA 1NTME 3N2OA 3CXHI 4R4LA 1FJPA 2Z5HA 2WSCH 1S4XA 2WSSV 3IR9A 3M0DA 1JUNA 4JUYA 2XSBA 5CBOA 3R2PA 3TSIA 1NU1D 4JYAT 1JY2O 3L72D 2WB5A 3C64A 2ZT9C 3NTNA 4OHFA 1JY3O 4EEBA 1WRDA 4U2YA 3CQXC 3SWYA 1J5ET 1FMWA 2IYPA 5LNKA 2W2UA 1RQUA 3M3ZB 2LSYA 2LKMA 4GODA 1GDTA 2QGSA 2KZIA 2AEMA 4YFSA 2WY2A 2XQ4A 3I0OA 3AE4C 2GUVA 3C4ZA 2XNDH 4B3ST 2E2AA 3Q2YA 1MIYA 3E08A 4LMKA 5FYMA 3B57A 4H9PC 1JMBA 3CCMP 1LWUB 1DEBA 2ZMAA 1XNRT 4BA9A 4EAHA 1LTAC 3KV4A 1Y8AA 3AEBC 5HXHA 1MMDA 1LTTC 5CCHC 4IDQA 2A45I 4UXNB 2E9XD 4YJ3E 4PV1B 2WBLA 2FXOA 4O9BA 1WR6A 2QA7A 1WYCA 3HR0A 5KDMC 2OV9A 3W68A 1H0TB 5EZYE 5FXZA 5FMNA 1RE4C 2AEFA 4IT4A 2KS1B 1T72A 2E5VA 5AQTB 1D1BA 1JM0A 3BQIA 3EWKA 1JOCA 3B8EB 3T1HT 3ZJ1A 5AW9B 2ZLYA 3FXDB 2L8KA 4PJLA 4U7IA 3VKGA 1BCCE 1DX7A 1Z0PA 3PUXF 1NTZE 3K8PC 2LR2A 4B3MT 5JDLA 3MZWB 4IGUA 3L3PA 4D6TD 3AEBA 1N7SB 3UUXB 3P4PA 3MXZA 2C0WA 1MV8A 5CCHA 2W6BA 5HWXA 4XFJA 2HFED 2WWVA 1SVFA 5HEUA 4PV1C 4XA4A 3JCFA 3L74D 2XQ3A 3P4QA 5DJUB 3QK6A 2GUSA 2BCCE 3LW5J 2RP4A 3H3MA 4PK4A 2DHRA 1ZRTD 2BBHA 1AVYA 1NTKJ 1QLED 4CXXA 2RH0A 5JRCB 3PURA 2KMFA 1RE4A 1KFYA 2Q7CA 1IFIA 3HA4A 3CX7B 4HFDA 2A72A 2MKVA 2A06D 2ZJSE 1MNEA 3FX0A 2WMNA 1RY3A 3GHGB 1HF9A 2MBGA 1OIPA 3FWLA 1LWUA 3AEEC 2A9UA 2KNCB 2M5AB 4V1Av 3CK6A 3GWHA 3LK42 3ETUA 5KAIE 4KHPT 3RLFF 5AW5B 1PPJD 3CXHE 1SQBK 4IL9A 2FYUK 1GU5A 1NGMB 2PJQA 3H1ID 2ODUA 2N9DA 5AQIB 4H9NC 3KV5A 5LMUT 3S4RA 4HFBA 3AEGC 2IZ0A 2D2CB 4GIFA 2FUPA 3ZMUB 2XAQB 4YJ2E 3BCCG 3LDQB 2JMHA 1Q81Q 5DJQC 4HKAA 1OMIA 2I1KA 1H0TA 2LKHA 2Q3EA 1XMQT 3B13A 4EB6E 4CQIA 3TLUA 5AVTB 3G06A 2NR4A 1DU2A 1FZFA 4TLFA 3U3IA 3P7IA 1VOMA 1BGYD 3RIAA 2H89C 1L0NJ 3GHGC 2PP6A 5HXSA 1D0XA 1LRZA 3VHLA 3FXDA 2W63A 3PUQA 2IC9A 2JWDA 1GK4A 3QB5K 3AEEA 1L4AB 1OVRA 2K88A 1N7SA 5ABEA 1NHLA 2BS3A 2HN1A 3ANWB 1SQXJ 1KB9I 3JC6D 4CI2B 4U3FE 3MHVA 1VRBA 1YD8G 3N9QA 4X64T 4N78D 1R5SA 5L3FB 4DUYT 1H89A 3CIRA 3P8CE 3SOLA 3ZT5A 5IYZE 1KILC 3PLNA 4ZKPA 2IDOB 5L3CB 4CPGA 3X1DA 5BR8T 2RN0A 4JEUB 3BK9A 5LJMA 5JRCA 1YQ3A 4I1LA 1SS1A 3CCSP 4WW0A 1R8EA 2O01H 3ZYKA 3ITKA 5APYA 4QH5A 3SFDC 2BS4A 2H89A 4AKHA 3GHGA 5JDQA 5L3GB 2K9JB 2C9LY 3KHUA 2W4XA 5CFBA 1NYHA 2Q1KA 3H1JJ 3CCRP 1K05A 2CXDA 1L4AC 4RKUJ 2KNCA 1GW4A 1W5CE 2M5AA 3Q5PA 3RK3C 4EIWA 4HN9A 5H2FH 4L5GA 5EFWB 1T2KD 3AE3A 3L73J 2ACXA 3RKGA 3ZKRA 4C7RA 3TLWA 1SQVD 3Q5WA 1NTKD 4WBOA 4HWCA 2H7OA 3CMLA 1RF1B 5JREA 3SSUA 5L47A 3F89A 4DR3T 1OEDC 1YJ9P 1H7CA 1OZHA 3CWBG 1X9BA 1LVFA 3OYZA 4RJTA 3PH0A 2LXBA 1S9KD 1DD4A 1LT9B 3WI3A 2QJPB 3TGUJ 3VRBA 4TWDA 4F8HA 3P7KA 3L71E 3L75J 1T3UA 2E5LT 1KYOI 2MPKA 1EXIA 1WCRA 5APUA 2CE7A 4GKJT 3CC7P 5LGNB 4YTNA 4NPPA 1L4AA 1NU1G 2Z6EA 2PBIA 3V5SA 3L39A 1T6AA 3ANWA 4P0AA 4JI6T 3RK2C 4TZ4C 3NXSA 2L5GB 3B4SA 5JQGE 3U1CA 3VP8A 1OW8A 3CKDA 1X79B 4K35A 2MTQA 5AQPB 4AYCA 3ZN0B 3PTRB 3I9YA 1OWAA 1W09A 4OWFA 2WSEJ 5KAFH 4ILCA 4DV4T 1LTJB 3TNUB 3L70E 1KILE 1L0ND 1QVGO 5AVQB 3O4XE 3CMAP 4X66T 5KLVJ 2ZM6T 4DVDA 1LT9C 1HGZA 2QJPC 2J1DG 1OFCX 1MMAA 2P58A 1XTCC 2HR3A 2MAWA 1IFPA 4KMCA 1RE3C 2FXPA 2NPSD 5GTIE 1IK7A 3H32B 5JVDE 1IO4A 3NZQA 2KUBA 4OK0A 1MMNA 3F57A 3KZIE 2C5KT 5M1BA 5FL1A 3EFFK 4O8SA 2O3JA 2HG5D 1KQGB 4CN4A 1ZP0A 2KIKA 4MN4C 1L0LK 1NOHA 3RK3E 2L3LA 2KSEA 1X22A 1QGKB 3WUUA 3FBLA 4JI8T 3VMAA 2V7JA 4DBRA 1KNRA 4MALA 4PK5A 4H63V 1KB9E 1ZMEC 3WUTA 5J0ZA 1N2DC 2CMRA 4U31A 3UU8A 3H1KG 2JJ9A 1JY2P 3CCJP 1RF1A 5F8PA 2XQ9A 1LTJC 2WDVA 3LK3B 5HXCA 3RKOA 3L37A 2NOXA 3AE5C 3AECC 4UELA 4IDOA 3B5ND 5L4EA 1OEDE 2LM9A 3AVSA 4IE6A 2ZAEB 1VQ8P 1LT9A 5B66E 3QB5A 1SQPK 2PGDA 3VN0A 1S5LX 1IFNA 2JDIH 3OAKA 4CN1A 4A5XA 1G2CB 3MUDC 3PP5A 1RE3A 3RRWA 5CHXA 1BE3G 2QRXA 3A7MA 2FYUE 3AAEB 4XZCA 1EXJA 1UURA 3NRYA 4A56A 1AQ5A 2OTLP 5AQLB 4I4TE 3HUSA 5LJNA 1EDIA 4X1IE 2K1AA 3W67A 3L35A 5L8RJ 3TF5A 1GQEA 3PUVF 3CQCB 5JDNA 2WCAA 3T8OA 5AW3B 1X79A 3RRCA 3JSVC 1YJNP 1AV1A 2H88A 3AE6C 3EVYA 2PFVA 4HWHA 3AE5A 1MFTA 2XM2A 3AECA 2QJKC 4KI0F 4BRYB 1AFOA 4WWIA 3N9LA 3R84B 3QOFA 2WWWA 2IZ1A 2ZVOB 2NTXA 3H32A 3N9MA 1X8YA 2GK9A 1PV3A 3C98B 4GOUA 4DV2T 2EHOB 3AEFC 5DABA 2V8SV 4IE4A 3DP7A 5DQWA 3AE8C 2CPSA 4IFMA 2W27A 2HYNA 3UUMA 1USEA 1SUMB 2XZRA 3ZMZB 1JO5A 3AXJB 3WAKA 2Y6XA 4JV5T 1VCTA 5KLVD 1FZCB 3HKBE 4MBQA 3PUYF 2OYHB 2FBWC 2V5DA 1HCIA 3BQLA 1FBMA 2WSSH 4DR6T 4GYRA 3RGLA 4TX5A 3Q5XA 1S5LE 3CX5I 2P67A 3RL0g 4UB6E 4ZI2C 1G2CA 2Q6QA 5L3BB 3VU7H 1CZQA 4TT3H 2KSJA 2Q5UA 2EHOC 5FVKA 3F5HA 2ZFCA 5ABFA 4LFBT 3FZKB 1EQ7A 1ZN5A 5JDMA 1KNPA 2E5YA 1VQPP 2CWYA 2YINA 3RF1A 1YQ4A 1KD1Q 3J7Yq 4R4MA 1U7MA 4ANJA 1LTSC 5HCMA 1N86A 2VQET 3VMYA 1FZCC 2R3CA 1J1DC 4HEAA 4BJNA 4PFPA 5EK4A 1WT6A 2BKNA 4XE5B 2OYHC 3TK1A 4OGQC 2XQ7A 2WTYA 4JI0T 2QA4P 4IL6X 1HNWT 3OVUA 4HWDA 2DL1A 3L72J 4AQYT 3E7KA 3HTKA 2WPVB 4NPDA 1GL2B 3D6ZA 4L74A 2NTYA 2YXRB 1EZVD 1GD2E 4AKIA 3MGNA 1KTMA 2J47A 2V7LA 4UVBB 3UU3A 2M0BA 4HKZH 3Q5EA 5APWA 3RHWA 2VL0A 1NTKG 2PRRA 4UB8H 4LC1A 2AE9A 3T97B 2QG4A 1RF0C 1EDJA 1NEKA 3B71A 3D6YA 2KZ7B 2SPCA 1VQ9P 4EIJA 1HG2A 1VQMP 3AXJA 3H3AA 3VTPC 3JAFA 5B5EE 1FZCA 2FFDA 4U33A 3QH9A 4Z91A 3N2KE 3QUJA 2LSGA 3SWHA 1YI2P 3O9XA 3CL3D 2D0UA 2FJBA 4MHCA 1VPCA 2YMKA 3RYFE 4YXDA 1KK7A 5AW1B 1QVFO 3ESLA 1BCCJ 4NPEA 2W0GA 1GL2C 5CJ4A 3NFQA 3Q1MA 2E42A 1D0ZA 1SQQK 5HWYA 3K3NA 3A0BE 5BMVE 1L0LE 2E74B 4OYJA 2P2UA 4X20E 1JNZA 2BCCJ 1RF0A 2YXQB 5HXRA 2MYSA 2V6YB 2VK9A 5IHYA 3ONJA 2QVAA 1KYOH 2OGUA 5APSA 1L0NG 5TAOA 3VMXA 3BVHA 4ASVA 2JQQA 3RIFA 3H6PA 3VR8A 4YSXA 2FYZA 3RI5A 2X67A 3CLQA 4D6TJ 2NW9A 3PUGA 1ZHCA 1SQPE 1NTMD 2D9DA 4IL6E 5J1GA 4CN6A 2KYVA 3I56P 3L74J 3I0QA 4MLKA 3Q9DA 2YNYA 1SLQA 1UIXA 1SQXG 1Y64B 4A7PA 2DCFA 1XZYA 3CX5E 2M67A 3M91A 4CXWA 2E74C 1VF5D 2X0HA 5CCGD 1KC8Q 5KXJA 4L9IA 4CXYA 1BSHA 3T97A 2CLYB 2ZXXA 2XPKA 2WPSA 3IAOA 3V2NA 1N8RQ 2E75B 1EDLA 2VQFT 4IL4A 2YOEA 2W61A 2RMZA 3A5TA 1WLXA 3O8ZA 3LJCA 3H1JG 2IBZD 1SFCD 3V4QA 4U7JA 2G0UA 3H1IJ 4GT1A 1FEWA 1FIOA 1GZLA 4AUWA 2H7HA 2XAJB 2M3BA 5LHGB 2N9BA 3H37A 4WB4A 5LOVE 2P10A 3L73G 3UIAA 2H43A 3H1LJ 1N73B 4UF0B 5AQHB 3V5UA 4BAYB 3PDYA 1YJWP 2WPQA 1UGOA 5GONE 3PRJA 3G71P 5AVRB 1ZOYA 2BDEA 4U3FJ 4C90A 3M65A 1HUCA 3KBUA 2CLYC 2B76A 3CWBE 3FZLB 1S35A 2XM1A 3ZEFB 2YDRA 1BGYJ 3N9NA 2WZ7A 5DJTB 2JQKA 2V6YA 2IDBA 1QX8A 2E75C 2ZYDA 3OJAB 1HR0T 3TGUG 1IFDA 3ZMTB 2CK3H 1HBWA 3L75G 4Y28J 2W6JH 1N7LA 4ILBA 1BCCD 3HE4A 4P1NA 1NTZD 1MMGA 3MK7C 1E1HB 1NWQA 4UIGA 5JH7E 3FB2A 3E1IA 1IBLT 2YKQA 3GF3A 1W0BA 2WAUA 1N73C 5F3JA 5LP6E 1S72P 3D70A 1M56D 1JNRA 4EZHA 3N7NA 4YPCA 2XJ7A 2P9BA 3EAMA 4PJNA 3AE4A 2BCCD 2V7MA 4QX7B 4ILUA 1IJ6A 2KLVA 2ZM2A 2ZT9D 1XWMA 5KLVG 2CCQA 3E1RA 2GM4A 2PFXA 3J9X1 3EQ2A 1SP4A 3PUAA 4GKKT 2VVSA 1LJ2A 5BU8B 2V5CA 5AQQB 3P4RA 1YKHB 2XAHB 1IC2A 3CWZB 3AA6B 1JTHB 4PD4I 4KJMA 3F2EA 2K3RA 2K3WA 1SQVJ 3FXEB 4DUZT 4BWNA 2DW3A 3CXHD 2QIWA 2C9NY 1N73A 4UF0A 2XHEB 2HODB 3FZHB 4H9RC 3Q3DA 2UUBT 5ETWA 5CCHD 3H1KE 5APTA 5C2TA 3KV6A 3HD7B 4L73A 5C8YE 3A3YB 3RC3A 3CCEP 2JMKA 2RPAA 4MFRA 1BR0A 4DV0T 1MUUA 3BRTB 1VQ7P 1WR0A 3ZMSB 4U74A 2JQHA 1HVVA 4PJ0E 2QEXP 4AQFC 1T8ZA 4RESB 3OJAA 1G1JA 2UXXB 1Y47A 3JC6C 5E79E 3Q5DA 4ZXLA 2WDQA 1NWMX 3S4UA 1NH4A 1BE3E 1SQXK 1S94A 3LIEA 1HNZT 3TLTA 2E76B 4M1PA 3H1LD 1KILB 4HYTB 1W0AA 2XAGB 4J2CA 1SQQE 2XQ6A 2BEZF 3MKDA 4EOZB 4Q25A 2KS1A 4U3FD 2CHOA 4H63H 1DH3A 1WRGA 4QH1A 3HD7C 4P09A 4IOIH 5CJ5A 4PV1D 4EOTA 5AVVB 2KOGA 2UXNB 2ZM0A 3KDSE 1VQLP 4NUUA 5K5GB 1CW5A 1LNQA 2D2SA 4B3RT 1VQOP 3RK3B 1Q90D 3USSA 2J62A 2X66A 4NXNT 4F6RC 1FZGA 2LSKA 2W66A 1LKXA 3VR9A 2OYIB 2E76C 1JTHA 4HFHA 1LVKA 3AEGA 3C8VA 1P84I 3LFMA 3CPZA 5APQA 4H13B 1PGPA 2K48A 1PGQA 3FXEA 3S9OA 1E2AA 2XY8B 4C91A 2KB7P 1OEDB 1YITP 1SQBJ 2WM9A 4G2AA 1N7SD 4W7YA 5KKZC 4TUYE 2HODA 1G1IA 2N1TC 3LK2B 3NWIA 3PUZF 1FJGT 3JADA 3O6QB 5H6RB 3HD7A 4EDFA 1ZLLA 5C39A 4H44B 3MTUE 2CEAA 3A5XA 2W6AA 4H0LB 5LA6E 3RQWA 2JR8A 1T7SA 5JR9C 2AXTE 3SS1A 3SWKA 1UUSA 5FY7A 2LHNA 3B5MA 5HEHA 1R5LA 3RYIE 5APXA 3AVRA 3RQUA 4DZOA 4GDOA 2IPPA 2KXPB 4I2LC 3RK2B 5APVA 2OYIC 3RC8A 4WY4B 2KLUA 2NWBA 4H13C 1LTIC 1KILA 2W90A 4N78E 2WU5A 3JCUE 3TLVA 3G3ZA 4PD4E 3AA1B 2V1DB 1IK9A 5AQFB 3PUSA 2CRBA 5AW7B 3V5BA 2UXDT 2IFNA 1YKEB 4ERRA 3CVRA 4H44C 4WZXA 5KX5E 1LP1B 3SFDA 4H0LC 5AFUL 4X65T 2D2CD 2QM7A 1L0VA 3P4WA 4X62T 1URQB 1DEEG 4H9QC 1O3XA 3ZN1B 5CA0E 2BBJA 2V7QJ 3L72G 2IBZG 3RL0C 4IDNA 1BR2A 4WY4C 1MKMA 3ZMVB 1VCSA 1YXRA 3AEAC 1FZBA 1PFIA 2OYIA 3I1AA 2ZYAA 5AVZB 4YTPC 4N3YB 1X0TA 4ZS2A 5KAIH 2XQ5A 4P0BA 3CXHH 3BQKA 4QXCB 2LRLA 2VB6A 2YU2A 4LF9T 1OEDA 1L4AD 4M3LA 1YIJP 4JI7T 1NAYA 2B88A 5TISE 5CB4E 2LE8A 4EXTA 3UUBA 3O6QA 3UU5A 3ONLC 2OA5A 3D71A 1PP9J 3GMIA 4AQGA 2K9JA 3QWOC 4CI1B 3K3OA 1URQC 1GU4A 1FDOA 2WITA 2E43A 4NIQA 2UUCT 3S1KA 2ES0A 4LMJA 3H1HJ 1BCCG 3MD0A 3UQ7A 2QYWA 3AA7B 2BG9C 2G3AA 3FGAD 1G8XA 1N32T 4WY4A 2BEQD 2IMLA 2JIWA 2XU6A 4LF4T 2QJYB 3AEAA 1E79H 4B86A 1UX5A 4YTPA 1SQBD 2FYUD 3HL6A 2Y0CA 5BVZA 4I6MC 1M7KA 3PU8A 3T1YT 1P84E 2Y48B 4EV6A 4NPFX 1QUUA 2BCCG 5HCJA 1HWTC 2H7VC 3UULA 4I55E 4ISSA 2A45H 2K5BB 1KORA 2QJKB 1L0NE 3PJSK 2JJLA 2ZVNB 5HEOA 3SFEC 2LRKA 3AB3B 4D6TG 3L4FA 1URQA 3RBXA 4LF8T 3AAIA 1TU3F 4JI4T 3RYHE 3RGUA 2X9XA 3L74G 1SQXE 4COFA 1KQFB 2XZEA 2CBJA 2WS3A 1HS7A 4ZZCA 2M6IA 2QJYC 3PHLA 2B87B 2FJAA 3I5CA 4JEHB 4HGAA 3CCUP 1GTWA 4U2ZA 4ZNCA 1KYOD 1RQVA 1LTJA 3KVBA 4OVNF 3TNUA 1D7MA 5AQRB 2A06G 4TNWA 1ZR4A 1L0LJ 1VQ5P 3GN5B 3ZC0A 3CD6P 3PTZA 2LLYA 4X5TA 2I6HA 1DIPA 3EDVA 2AEJA 3VKHA 5DQVA 3AAAB 2R32A 2KI7B 3H1JE 3SFEA 3MUDA 5AQUB 1PPJG 1XTGB 1ZKEA 1KFNA 4QXHB 3H1IG 4DNDA 1HJBA 4GOFA 3KXDA 1GMJA 5KJ7C 4DJGA 2Q9QC 1CSBA 3L73E 5AW8B 4YTMA 3H1LG 3G4SP 1IZNB 5LG3A 2CPBA 3MA9A 2BG9E 1XDOA 2D0TA 1XNQT 4U7YA 5AQOB 4U3FG 4DV5T 1KV4A 2V26A 1J1DB 4PW8A 4Z8XA 3AE1C 3AE6A 2A45G 1BGYG 2KT9A 2LHRA 1PP9D 2VKJA 4OGQB 2B89A 3OPCA 3LBXB 3TGUE 2VL8A 2BASA 4WBAA 4ZI3C 1NU1K 3GG2A 3L75E 1NTMJ 2YKOA 2YK0A 1N34T 2GA1A 3M9HA 2K24A 3H1HD 4DR5T 2R44A 3U78A 4AXPA 4IFDK 4DV6T 3CX8B 1U57A 4AKRB 3H25A 5CGMA 3AEFA 4H9OC 2R6GF 3PV0F 1YTZT 1MFZA 1NJIQ 3KBTA 2RKLA 5GTIH 4UR9A 1N33T 2F4VT 3AE8A 1S1CX 4KP3C 4IDPA 1JB0J 2B87A 2M3EA 5BU5A 1K73Q 3KZIH 2W62A 1UIIA 2Q9IA 2MJZA 4LF6T 2CPTA 3NKZA 1U5PA 4HE8A 3OA7A 2LT3A 3P4SA 2H3RA 1U4QA 2KZJA 2LM2A 2JKVA 3AE1A 1CI6B 5KLVE 2YO3A 1YHQP 4DBQA 3GN5A 1KB9H 4BRYA 2FBWA 5AW2B 1UK5A 3BRVB 3F31A 2KWIB 4IHJE 3R6NA 2WT7B 3GLMA 4QMAA 4JLEA 1I6ZA 3A2AA 3QC9A 2XQYA 2ACZA 2EHOA 1K8AQ 5B66H 2HLOA 1T3JA 1SQVG 2Y0DA 5HYAA 4U72A 1YBKA 2WMOA 5LG4A 3AE7C 3PJAA 4ZHQE 1AQTA 1KQSO 3V6IA 2WQYC 3C4XA 4ZI2D 3IN6A 4KX6A 4JI2T 5AW4B 1L0LD 1FDMA 3ABVC 1KNZA 2IHR1 3EHZA 1M57D 1ZXGA 2VKDA 2EHOD 4CZZB 2OYHA 2IBZI 3K1SA 1IFMA 1FS0E 2LOSA 1J5WA 3LBXA 2JQ9A 1MIWA 3WU2E 3ZCJA 3ZPOA 5GTHE 1YYCA 5AVYB 4C46A 4HJGH 3NZPA 4TNVA 4B6XA 4ILAA 4NXMT 4TV8E 1NTZJ 3M0AA 2VKOA 3UFEA 1Q2NA 1D0YA 3AE2C 1XDPA 1SQPD 1VF5C 3BCCE 1Z8UA 1Z56A 4Z1MH 2XNXA 3O1IA 2XKMA 1LTBC 3WMM0 4AIUA 4FJOA 3OYXA 1N36T 2W83C 4ZS3A 3AE7A 3BATA 1BDDA 1H8AA 4I7ZB 1W2BO 5F5WA 3MJXA 2J5UA 2WQYA 3IF4A 2C5JA 1IAPA 2I59A 1SHZC 1QEXA 2I8DA 3ZYMA 1MIVA 3ZJ2A 2CXLA 3ABVA 2E9XB 4HH2A 3ZC1A 1CI6A 3P32A 4W80A 1WFDA 3L09A 1FZAA 2K37A 2DWGA 1CHUA 3ONXA 2A2FX 1FC2C 2XASB 2V7QH 2ZYGA 1GL2A 1SE7A 3C9IA 2WT7A 3M0DC 3MACA 2Z5IA 4H9SE 3AE2A 3A8YC 2KNDA 3EDUA 3FHNA 4AKLA 4DOJA 2O1JA 4GOEA 3W15B 1S5LH 2J58A 1MNDA 5LBQB 2FKWB 4O4HE 1OW6A 4UB6H 5KMGP 3U59A 1SQBG 1AJYA 1GK6A 4I7ZC 2YIUB 1FAVA 5FL0A 1GL2D 3EFGA 1SQQJ 2CHNA 3C51A 2D5UA 5AW6B 2E9XC 1L2PA 1NVOA 3G9RA 3V2QA 4YLHA 3CWBD 2FXMA 4TWFA 3ZT7A 1J1EC 4EYYQ 3DTOA 2DI4A 1QL1A 1EDKA 4PJMA 1WYBA 2XSAA 4JF7A 5AW0B 2YU1A 1US7B 3ZDMA 1LGHB 1S3JA 5AQKB 2WDRA 2YIUC 5LXTE 2MOZA 1J2JB 1RH5B 2NZ2A 2JEEA 1M7LA 3LIDA 1HTLC 1T8BA 2QE7H 2Y0EA 4LFCT 2XTLA 4EGWA 4LFAT 2E9XA 4LF5T 1Y9BA 3VYIA 1FOSF 3AE9C 2E74D 3MIWA 1KF6A 4EEDA 1NU1E 5LGUB 1A02J 1ZR2A 5ABHA 3L72E 2IBZE 2OQQA 5KLIB 5FKYA 4DCKA 5B5EH 3ZSSA 3UQ4A 1ZV8A 3LSVA 3KYQA 5TJHA 3E0ZA 3N4XA 1SQVK 2WSFH 1NTKK 3IFMA 1MZ9A 2WP9A 3DJBA 1JNMA 1OW7A 2HPLA 4PK6A 2X0YA 2OLTA 2YDQA 3WU2H 5GTHH 2R5DA 4X1KE 3TLSA 1RHZB 1HNXT 4IDZA 1JY2N 3IBPA 2DNXA 3UTKA 3RH3A 1HF8A 3UU6A 2M6BA 4OH8B 3KFWX 3WUVA 2NRGA 1JY3N 2IYOA 3A0BH 4ZOLE 3AA0B 3VRAA 3H1KD 1PP9G 3UT5E 3CCVP 2CBIA 4DR2T 1IBMT 5LHIB 3AE9A 4HB1A 1AA0A 5AVWB 5H2FE 5KLIC 1LWUC 1ZW0A 4YY3T 3H1HG 3L71J 2DLRA 4L75A 4JI5T 3OTOT 2Q3IA 2JPFA 4FI5A 1HTJF 1AVOA 2E75D 5J2UE 3CC4P 3R4YA 1BE3D 1IBKT 4IL6H 2O01N 1PGJA 2X9WA 5LCYA 5EK3A 4QHOA 4ADZA 1L0NK 4W7ZA 2WU2A 5HAXA 5HXEA 5L4HA 1SQQD 1FDIA 3CX5H 3I55P 3TKLB 5FXXA 3FBZA 3KQGA 3L70J 1Q82Q 2BKOA 2VVNA 4D6TE 4YSZA 4PFOA 4ZMDA 1M1JB 1Y01A 2X9YA 3ZYLA 4EYUA 4DV3T 4JYCA 3L74E 3C50A 4DR1T 1EZVG 2R3SA 5LB7B 4WVZA 2IAKA 4AKGA 5LBMA 1UCUA 1H88A 1N7SC 2R5BA 1ZRTE 2XQ8A 5FNVE 4HFVA 2I0MA 5KAFE 5KKZB 2KP8A 2BS2A 3RYCE 2N1TB 2V7KA 4QX8B 4PJJA 3P8CD 4YSYA 2LXCB 2BVLA 1EC5A 4LF7T 2A06E 4X1YE 2C0SA 3IEEA 1NENA 3O1JA 3IHRA 2WMMA 1L0LG 4RO0A 4O2AE 4AQFA 3MP7B 5JR9B 1YQ3C 4B3TT 4A97A 4EZ4A 1T2KC 1M1JC 2FY8A 4K3AA 1PPJE 2HN2A 2LSIA 5LMNT 4JI3T 4UVAB 3H1IE 3UUNA 1PGOA 2L91A 2V7IA 4K0KT 2IIUA 1SQPG 3H1LE 3CQGB 2FYUJ 1M1KQ 1BR4A 1HJ0A 4PAGA 3N2GE 3AE3C 3C4WA 4XAXB 1HGVA 2D2CC 4UVCB 1W2EA 1BGYE 2NPSB 2LJLA 5KTBA 2OYOA 3K5BA 4PD4D 3CMEP 1J1JA 1HH0A 4KT0J 2KINB 1YTZI 3MZKB 4KHXA 3N5LA 2FJEA 1JMMA 4JPZB 5EK2A 2VRSA 2E8IA 3OW2O 1PZQA 4JQ0D 3BASA 1NTMG 4IE5A 3A0HE 2VWAA 3RL0B 3TDKA 1M1JA 3L71D 3HD7D 4DR7T 3P8MC 1OVVA 4I0UA 1M62A 1X9VA 2V4HA 3N9PA 1FJKA 4GYSA 3HKCE 1IJDB 2HPJA 3JC22 4O4JE 2SPZA 4TWHA 3B5NB 3NVOA 2N1TA 4ZEYA 5KLVK 1OX3A 2FYNB 2L9QA 2WVRA 1NKNA 3P50A 4L0RA 2NPSC 2ZXEB 5HEJA 2E76D 4ZKUA 1JCDA 4ASWA 3L8RA 3L70D 5AQVB 1KILD 5L3DB 4OFZA 1YW0A 2N1GA 4WYVA 5JR9A 3FZMB 3RBZA 5L3EB 2FJDA 3FZFB 4L76A 3A7OA 3CCLP 4O2BE 3HKEE 3RX6A 2LOPA 1NKZB 4DR4T 2N1TD 4IFFA 2BG9B 4CI3B 2KK7A 2NW7A 4IREA 4PJ0H 3EI0A 5IUXA 5IWAT 2UU9T 1VDFA 2JRKA 2WZHA 3NBXX 2UXCT 3K3QC 4A98A 1SQVE 1NTKE 3ZCIA 2ITAA 5E79H 4QWNB 1HG5A 2J4GA 3CC2P 4HFIA 3B5NC 3RK3D 4KBMB 5CBNA 2JO1A 1CUNA 1ZP0C 2HPCB 2CXFA 2X9HA 1SA0E 4TV9E 2FYNC 3HUSB 5LGTB 1KB9D 4DT0A 3TYYA 1PIXA 3V4WA 1B7TA 1LTGC 1S9KE 3RIUC 2VURA 2NPSA 2IUBA 1RF1C 5JTGA 1P84D 3CI9A 4H13D 3VP9A 2QSIA 4ZZBA 2BZBA 2PTFA 4HWIB 4DIDB 2WSCJ 1NTZG 1FE6A 2B9BA 2HHHT 1AJ3A 2XDJA 3GA8A 3D0TA 1OXZA 4H44D 3UFGA 1S2EA 2E5TA 4H0LD 3KPEA 3NRXA 2P1JA 5AQGB 1SQXD 3ETVA 2PG8A 3KDPB 5FP3A 2C0XA 1M8OB 4TN7B 3ZLIA 3B5NA 1XMOT 1ZEEA 3HUSC 2KLQA 2LKGA 3RL0D 2V6XA 4DV1T 1ZV4X 3RK2D 3PU3A 1LP1A 4WY4D 4JI1T 5ABGA 4HFCA 3RPUA 1IJ5A 5CJ0A 3RIUA 4IE0A 2H88C 4UV9B 2DWKA 2YO2A 4DMWA 5JDGA 3SWFA 4O4IE 4LGDE 2W8ZA 2A3DA 4LMLA 2NW8A 3PE0A 1JY3P 1IFJA 2WSFJ 1U7JA 2WZIA 3IF8B 2N9YB 2BG9A 2Q9QB 4K0UA 2POHA 3H1JD 4N6JA 3Q5SA 5AQMB 3M9QA 3GF7A 4LLHA 4OX9T 1M90Q 4UB8E 2AXTH 3LG7A 3GW6A 1URQD 3A0HH 1QSDA 5ABFB 1SQBE 5FVLA 2Z4EA 3KINB 1KEYA 5E0OA 3L73D 5JDHA 4YHHT 3BCCJ 2W00A 2HPCA 4PNIA 3UU4A 4OYKA 2IW5B 1LT1A 4DMVA 1SQQG 2HH7A 2BVMA 3AEDC 1VL2A 3JCUH 4Y99B 3OBVE 4PD4H 4YT0A 1EZVI 1NTMK 2OARA 3PJAJ 1HX1B 1R8IA 2YKSA 1HX8A 1FU1A 2I1JA 3TGUD 1BR1A 5AQSB 5C3JA 4XBFB 4Z90A 1SQPJ 3L75D 1PL5A 4AISA 4UEMA 1KFMA 2Y8DA 3HTKB 4UV8B 1NAFA 2YN6A 2O1KA 4BXLA 1KN7A 1FOSE 2P7JA 4E7SA 1KYOE 2YMYA 2C5IT 5ADXL 5AVXB 5CA1E 4I43B 3LW5H 1YQ4C 2W67A 4U3CA 2VASA 4Y99C 3ZT6A 3AEDA 4NUVA 2X51A 5LHHB 5AVSB 2XV5A 5TISH 3PUWF 2UXBT 2FFDB 1JEKA 4C7NB 2WWUA 2AXDS 4GK5E 5FXWA 4GIWA 2YEVC 2PAJA 5KJ7A 3G6EP 2Q9QA 3HI2A 3GMAA 4ASKA 2UUAT 1HFAA 4GKGA 3HE5B 3C1LA 1A02F 2LSJA
chains in the Genus database with same CATH topology
3HRNA 1D1CA 4QXBB 1E5WA 4I50E 1G73A 3Q2MA 5FXVA 4IE7A 1JCCA 5KJ7D 4GK0E 2CA5A 2Q9QD 5J2TE 3HKDE 1NTZK 2FFDC 4EYYR 3CX6B 3E22E 3WAJA 3V2RA 5JDFA 1NO4A 3M06A 5CMZA 1QL2A 2LEHA 2M8RA 4ZI3D 3SRZA 2K9AA 2X0LB 3VOPA 4IIJE 1SFCB 2H8PD 2ZM8A 2RA1A 4JYBA 2XAFB 1T98A 2IFMA 1KQLA 5L2LA 1UX4A 2NP9A 1GW3A 3V2PA 3KV9A 1KZUB 4E7ZA 3OKQA 4C7NA 2KWHA 5LYJE 5CCGC 3O1HA 4AI6A 4ISTA 3VMZA 4AQRD 2IC6A 5AVUB 3HE5A 2J59M 2CWOA 4WBNE 3II6A 1EZ3A 4ZI7E 5A1LA 4BJMA 1SFCC 4KUMB 4G63A 2ODVA 2QM8A 1FMVA 3M9BA 2CM0A 3KVAA 5FY0A 1J1EB 4QKNA 3N9OA 4YHJA 2VKHA 5CCGA 3HE4B 2WPRA 4DO0A 3EUHA 4O4LE 5M4YA 2B1EA 5FY1A 1FZEA 3U1AA 1V9DA 2N2NA 2IX7C 2XUEA 1D1AA 2X68A 3I9WA 4WNKA 1SFCA 3L36A 5H6QB 3NMDA 4HTEA 2WSEH 2YKPA 3N2OA 1FJPA 2Z5HA 2WSCH 2WSSV 3IR9A 3M0DA 1JUNA 4JUYA 3R2PA 3TSIA 1JY2O 3C64A 3NTNA 4OHFA 1JY3O 1WRDA 3CQXC 3SWYA 1FMWA 5LNKA 2LSYA 2LKMA 2QGSA 1GDTA 4YFSA 3I0OA 2GUVA 3C4ZA 1MIYA 3E08A 5FYMA 3B57A 4H9PC 1LWUB 1DEBA 2ZMAA 4BA9A 4EAHA 1LTAC 3KV4A 5HXHA 1MMDA 1LTTC 5CCHC 2A45I 4UXNB 2E9XD 4YJ3E 2WBLA 4O9BA 1WR6A 2QA7A 1WYCA 3HR0A 5KDMC 5EZYE 5FXZA 5FMNA 1RE4C 1D1BA 3BQIA 1JOCA 3B8EB 3ZJ1A 5AW9B 2ZLYA 3FXDB 2L8KA 4PJLA 3VKGA 1DX7A 1Z0PA 3K8PC 5JDLA 4IGUA 3L3PA 1N7SB 3UUXB 3MXZA 2C0WA 1MV8A 5CCHA 2W6BA 5HWXA 2HFED 1SVFA 4XA4A 3QK6A 2GUSA 2RP4A 4PK4A 2DHRA 4CXXA 5JRCB 3PURA 2KMFA 1RE4A 2Q7CA 1IFIA 3HA4A 3CX7B 2A72A 1MNEA 2WMNA 1RY3A 3GHGB 2MBGA 1LWUA 4V1Av 3GWHA 3LK42 3ETUA 5AW5B 1SQBK 2FYUK 1GU5A 2PJQA 2ODUA 2N9DA 4H9NC 3KV5A 4GIFA 3ZMUB 2XAQB 4YJ2E 2JMHA 5DJQC 4HKAA 2I1KA 3B13A 4EB6E 4CQIA 5AVTB 1FZFA 3U3IA 3P7IA 1VOMA 3GHGC 2PP6A 5HXSA 1D0XA 1LRZA 3VHLA 2W63A 3PUQA 2IC9A 1GK4A 1L4AB 1N7SA 1NHLA 3ANWB 3JC6D 4CI2B 1VRBA 1YD8G 3N9QA 4N78D 5L3FB 1H89A 3P8CE 3SOLA 5IYZE 1KILC 4ZKPA 5L3CB 4JEUB 3BK9A 5LJMA 5JRCA 4I1LA 4WW0A 2O01H 3ZYKA 5APYA 4AKHA 3GHGA 5JDQA 5L3GB 2C9LY 2CXDA 1L4AC 1GW4A 3RK3C 4EIWA 4HN9A 4L5GA 1T2KD 2ACXA 4C7RA 3Q5WA 4WBOA 2H7OA 3CMLA 1RF1B 5JREA 1H7CA 1LVFA 3OYZA 1S9KD 1LT9B 3WI3A 3P7KA 1T3UA 5APUA 2CE7A 5LGNB 1L4AA 2Z6EA 2PBIA 3V5SA 3ANWA 4P0AA 3RK2C 4TZ4C 3NXSA 2L5GB 5JQGE 3U1CA 3VP8A 3CKDA 1X79B 3ZN0B 2MTQA 4AYCA 3PTRB 3I9YA 1OWAA 1LTJB 3TNUB 5AVQB 3O4XE 4DVDA 1LT9C 1HGZA 2J1DG 1MMAA 1XTCC 4KMCA 1RE3C 2NPSD 3H32B 5JVDE 1IO4A 3NZQA 4OK0A 1MMNA 3F57A 2C5KT 4O8SA 2HG5D 1L0LK 1NOHA 2L3LA 3FBLA 2V7JA 4DBRA 4MALA 4PK5A 4H63V 1N2DC 2CMRA 2JJ9A 1JY2P 1RF1A 5F8PA 1LTJC 3LK3B 5HXCA 3RKOA 3L37A 2NOXA 4UELA 3B5ND 2LM9A 3AVSA 4IE6A 1LT9A 1SQPK 3VN0A 1IFNA 3OAKA 1G2CB 3PP5A 1RE3A 3RRWA 5CHXA 4XZCA 3AAEB 3NRYA 4A56A 1AQ5A 4I4TE 3HUSA 5LJNA 4X1IE 3L35A 3CQCB 5JDNA 3T8OA 5AW3B 1X79A 3RRCA 3EVYA 2PFVA 1AFOA 3N9LA 3R84B 2WWWA 2NTXA 3H32A 3N9MA 1X8YA 2GK9A 3C98B 4GOUA 2EHOB 5DABA 4IE4A 3DP7A 5DQWA 2CPSA 4IFMA 2W27A 2HYNA 3UUMA 2XZRA 3ZMZB 1JO5A 3WAKA 2Y6XA 1FZCB 3HKBE 4MBQA 2OYHB 3BQLA 1HCIA 1FBMA 4GYRA 4TX5A 3Q5XA 2P67A 4ZI2C 1G2CA 5L3BB 3VU7H 1CZQA 2KSJA 2Q5UA 2EHOC 2ZFCA 1EQ7A 1ZN5A 5JDMA 2CWYA 2YINA 3J7Yq 4ANJA 1LTSC 1N86A 3VMYA 1FZCC 2R3CA 1J1DC 4HEAA 4BJNA 4PFPA 5EK4A 1WT6A 4XE5B 2OYHC 3TK1A 2WTYA 3HTKA 1GL2B 2NTYA 1GD2E 4AKIA 3MGNA 2V7LA 4UVBB 5APWA 4LC1A 1RF0C 2KZ7B 2SPCA 1HG2A 4EIJA 3H3AA 3VTPC 1FZCA 2FFDA 3N2KE 3QUJA 2LSGA 3SWHA 3O9XA 3CL3D 2D0UA 4MHCA 1VPCA 3RYFE 1KK7A 5AW1B 3ESLA 2W0GA 1GL2C 5CJ4A 3NFQA 1D0ZA 2E42A 1SQQK 5HWYA 3K3NA 5BMVE 4OYJA 2P2UA 4X20E 1RF0A 5HXRA 2MYSA 2VK9A 5IHYA 5APSA 5TAOA 3VMXA 3BVHA 2JQQA 3H6PA 2FYZA 2X67A 3CLQA 2NW9A 3PUGA 1ZHCA 5J1GA 2KYVA 3I0QA 4MLKA 3Q9DA 2YNYA 1SLQA 1Y64B 2DCFA 2M67A 3M91A 4CXWA 5CCGD 4L9IA 4CXYA 3T97A 2CLYB 2WPSA 3V2NA 2W61A 3A5TA 1WLXA 3O8ZA 3LJCA 1SFCD 3V4QA 2G0UA 4GT1A 1FEWA 1FIOA 1GZLA 4AUWA 2H7HA 2XAJB 2M3BA 5LHGB 2N9BA 3H37A 4WB4A 5LOVE 2H43A 3UIAA 1N73B 4UF0B 3V5UA 4BAYB 3PDYA 2WPQA 5GONE 5AVRB 2BDEA 4C90A 3M65A 1HUCA 3KBUA 2CLYC 1S35A 3ZEFB 3N9NA 2WZ7A 3OJAB 1IFDA 3ZMTB 1HBWA 1N7LA 3HE4A 1MMGA 3MK7C 1E1HB 1NWQA 4UIGA 5JH7E 3FB2A 3E1IA 2YKQA 2WAUA 1N73C 5F3JA 5LP6E 4EZHA 3N7NA 2P9BA 4PJNA 2V7MA 4QX7B 4ILUA 1IJ6A 2KLVA 2ZM2A 2CCQA 2GM4A 3J9X1 3EQ2A 1SP4A 3PUAA 5BU8B 1YKHB 2XAHB 1IC2A 3CWZB 3AA6B 1JTHB 3F2EA 3FXEB 2C9NY 1N73A 4UF0A 2XHEB 2HODB 4H9RC 5ETWA 5CCHD 5APTA 3KV6A 3HD7B 5C8YE 3A3YB 3RC3A 4MFRA 2JMKA 1BR0A 1MUUA 3BRTB 3ZMSB 4U74A 1HVVA 4AQFC 1T8ZA 4RESB 3OJAA 1G1JA 2UXXB 3JC6C 3S4UA 1NWMX 1NH4A 1SQXK 1S94A 3LIEA 4M1PA 1KILB 4HYTB 4J2CA 2XAGB 3MKDA 4EOZB 4H63H 1DH3A 1WRGA 3HD7C 4P09A 4EOTA 5AVVB 2KOGA 2UXNB 2ZM0A 3KDSE 4NUUA 1CW5A 2D2SA 3RK3B 2X66A 4F6RC 1FZGA 2LSKA 1LKXA 2OYIB 1JTHA 1LVKA 3LFMA 3CPZA 5APQA 2K48A 4C91A 2KB7P 2WM9A 4G2AA 1N7SD 4W7YA 4TUYE 2HODA 1G1IA 2N1TC 3LK2B 5H6RB 3HD7A 1ZLLA 3MTUE 2CEAA 3A5XA 2W6AA 5LA6E 5JR9C 3SS1A 5FY7A 2LHNA 3RYIE 5APXA 3AVRA 4DZOA 2IPPA 2KXPB 4I2LC 3RK2B 5APVA 2OYIC 3RC8A 4WY4B 2NWBA 1LTIC 1KILA 4N78E 3G3ZA 3AA1B 2V1DB 1IK9A 3PUSA 5AW7B 3V5BA 2IFNA 1YKEB 4ERRA 3CVRA 5KX5E 5AFUL 2QM7A 1URQB 4H9QC 1O3XA 3ZN1B 5CA0E 3RL0C 1BR2A 4WY4C 3ZMVB 1FZBA 1PFIA 2OYIA 3I1AA 5AVZB 4N3YB 4ZS2A 4P0BA 3BQKA 4QXCB 2VB6A 2YU2A 1L4AD 4M3LA 5CB4E 2LE8A 4EXTA 2OA5A 3GMIA 4AQGA 4CI1B 3K3OA 1URQC 1GU4A 2WITA 2E43A 2ES0A 3MD0A 3AA7B 1G8XA 4WY4A 2XU6A 4B86A 1UX5A 3HL6A 5BVZA 4I6MC 3PU8A 2Y48B 1QUUA 1HWTC 2H7VC 3UULA 4I55E 4ISSA 2A45H 2K5BB 2JJLA 3AB3B 3L4FA 1URQA 3AAIA 3RYHE 2X9XA 1HS7A 3I5CA 4JEHB 4HGAA 1GTWA 1LTJA 3KVBA 3TNUA 1ZR4A 3GN5B 3ZC0A 3EDVA 3VKHA 5DQVA 3AAAB 2R32A 3MUDA 1ZKEA 1XTGB 1KFNA 4QXHB 4DNDA 1HJBA 5KJ7C 2Q9QC 1CSBA 5AW8B 1IZNB 2CPBA 3MA9A 2D0TA 2V26A 1J1DB 4PW8A 4Z8XA 2A45G 2KT9A 2LHRA 2VKJA 3LBXB 2VL8A 2BASA 4WBAA 4ZI3C 1NU1K 2YKOA 2YK0A 3M9HA 2K24A 3U78A 4AXPA 4IFDK 3CX8B 4AKRB 4H9OC 1YTZT 1MFZA 3KBTA 4KP3C 5BU5A 2W62A 2Q9IA 2MJZA 1U5PA 4HE8A 3OA7A 2LT3A 2H3RA 1U4QA 1CI6B 2YO3A 4DBQA 3GN5A 5AW2B 3BRVB 3F31A 2KWIB 4IHJE 3R6NA 2WT7B 4JLEA 3A2AA 3QC9A 2XQYA 2EHOA 2HLOA 1T3JA 5HYAA 4U72A 2WMOA 5LG4A 4ZHQE 3C4XA 4ZI2D 5AW4B 1FDMA 1KNZA 4CZZB 2VKDA 2EHOD 2OYHA 1IFMA 2LOSA 3LBXA 1MIWA 3ZCJA 3ZPOA 1YYCA 5AVYB 4C46A 3NZPA 4B6XA 4TV8E 3M0AA 2VKOA 3UFEA 1D0YA 1Z56A 2XNXA 3O1IA 2XKMA 1LTBC 3WMM0 4FJOA 3OYXA 4ZS3A 3BATA 1H8AA 3MJXA 2C5JA 1IAPA 2I59A 1SHZC 3ZYMA 1MIVA 3ZJ2A 2CXLA 2E9XB 4HH2A 3ZC1A 1CI6A 3P32A 4W80A 3L09A 1FZAA 2DWGA 3ONXA 2A2FX 2XASB 1GL2A 3C9IA 2WT7A 3M0DC 3MACA 2Z5IA 4H9SE 2KNDA 3EDUA 3FHNA 4AKLA 4DOJA 2O1JA 3W15B 2J58A 1MNDA 5LBQB 2FKWB 4O4HE 5KMGP 3U59A 1GK6A 1FAVA 1GL2D 3EFGA 3C51A 2D5UA 5AW6B 2E9XC 3V2QA 4YLHA 2FXMA 1J1EC 3DTOA 2DI4A 1QL1A 4PJMA 1WYBA 4JF7A 5AW0B 2YU1A 1US7B 1LGHB 5LXTE 2MOZA 1J2JB 2JEEA 1M7LA 3LIDA 1HTLC 2XTLA 2E9XA 3VYIA 1FOSF 3MIWA 5LGUB 1A02J 1ZR2A 1ZV8A 3KYQA 3E0ZA 3N4XA 1SQVK 2WSFH 1NTKK 3IFMA 1MZ9A 3DJBA 1JNMA 2HPLA 4PK6A 2R5DA 4X1KE 4IDZA 1JY2N 3IBPA 2DNXA 3UTKA 3RH3A 1HF8A 4OH8B 3KFWX 1JY3N 4ZOLE 3AA0B 3UT5E 5LHIB 5AVWB 1LWUC 2DLRA 2Q3IA 2JPFA 4FI5A 1HTJF 5J2UE 2X9WA 5LCYA 5EK3A 4QHOA 4ADZA 1L0NK 4W7ZA 5HAXA 5HXEA 3TKLB 5FXXA 3FBZA 3KQGA 4PFOA 1M1JB 2X9YA 3ZYLA 4EYUA 4JYCA 3C50A 4AKGA 2IAKA 5LBMA 1UCUA 2R5BA 1N7SC 1H88A 5FNVE 4HFVA 2KP8A 3RYCE 2N1TB 2V7KA 4QX8B 4PJJA 3P8CD 2BVLA 4X1YE 2C0SA 3IEEA 3O1JA 3IHRA 4O2AE 4AQFA 5JR9B 4EZ4A 1T2KC 1M1JC 2LSIA 4UVAB 3UUNA 2V7IA 3CQGB 1BR4A 4PAGA 3N2GE 3C4WA 4XAXB 1HGVA 4UVCB 1W2EA 2NPSB 2LJLA 5KTBA 1HH0A 2KINB 1YTZI 3MZKB 4KHXA 3N5LA 1JMMA 5EK2A 2VRSA 2E8IA 3BASA 4IE5A 2VWAA 3RL0B 1M1JA 3HD7D 3P8MC 1X9VA 3N9PA 1FJKA 4GYSA 3HKCE 1IJDB 2HPJA 4O4JE 3B5NB 2N1TA 5KLVK 2L9QA 1NKNA 4L0RA 2NPSC 2ZXEB 4ZKUA 1JCDA 1KILD 5L3DB 4OFZA 1YW0A 2N1GA 5JR9A 5L3EB 3A7OA 4O2BE 3HKEE 3RX6A 2LOPA 1NKZB 2N1TD 4IFFA 4CI3B 2NW7A 1VDFA 2JRKA 3NBXX 3K3QC 3ZCIA 4QWNB 1HG5A 3B5NC 3RK3D 4KBMB 1CUNA 2HPCB 2CXFA 2X9HA 1SA0E 4TV9E 3HUSB 5LGTB 3TYYA 3V4WA 1B7TA 1LTGC 1S9KE 2NPSA 1RF1C 3CI9A 3VP9A 2BZBA 1AJ3A 2XDJA 3GA8A 3D0TA 1OXZA 3KPEA 3NRXA 2P1JA 3ETVA 2PG8A 3KDPB 5FP3A 3ZLIA 2C0XA 4TN7B 3B5NA 1ZEEA 3HUSC 2KLQA 3RL0D 1ZV4X 3RK2D 3PU3A 4WY4D 3RPUA 1IJ5A 5CJ0A 4IE0A 4UV9B 2DWKA 2YO2A 4DMWA 5JDGA 3SWFA 4O4IE 4LGDE 2A3DA 2NW8A 3PE0A 1JY3P 1IFJA 3IF8B 2Q9QB 4K0UA 2POHA 4N6JA 3M9QA 4LLHA 3LG7A 1URQD 1QSDA 2Z4EA 3KINB 5E0OA 5JDHA 4PNIA 2W00A 2HPCA 4OYKA 2IW5B 4DMVA 2HH7A 2BVMA 4Y99B 3OBVE 1NTMK 2OARA 1HX8A 1FU1A 2I1JA 1BR1A 4XBFB 4UEMA 1KFMA 2Y8DA 3HTKB 4UV8B 1NAFA 2O1KA 1FOSE 2P7JA 4E7SA 2YMYA 2C5IT 5ADXL 5AVXB 5CA1E 4I43B 3LW5H 2VASA 4Y99C 4NUVA 2X51A 5LHHB 5AVSB 2XV5A 2FFDB 4C7NB 2WWUA 4GK5E 5FXWA 4GIWA 2YEVC 2PAJA 5KJ7A 2Q9QA 3HI2A 4ASKA 1HFAA 4GKGA 3HE5B 1A02F 2LSJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O3X A;  2W27 A;  2YO2 A;  3SWF A;  1YD8 G;  2XZR A;  1DH3 A;  3NFQ A;  3B8E B;  1H89 A;  2E42 A;  1HBW A;  1IO4 A;  5AW9 B;  3HE4 B;  3KQG A;  2WPR A;  2R32 A;  5AVZ B;  4EOT A;  5AVV B;  5AW4 B;  2P2U A;  3HE4 A;  5AW0 B;  1NWQ A;  2N2N A;  1HJB A;  2ZXE B;  4M3L A;  1MV8 A;  4JYC A;  2P67 A;  5APY A;  5APS A;  1CSB A;  5AW8 B;  1YYC A;  5AVY B;  3VMX A;  4C46 A;  1CZQ A;  2C9L Y;  1J2J B;  3L36 A;  2Q5U A;  2R5B A;  3A7O A;  1H88 A;  3NMD A;  3LID A;  2ZFC A;  3M0A A;  3M06 A;  5CMZ A;  3L37 A;  2KP8 A;  5APQ A;  3VYI A;  1FOS F;  2Z5H A;  1GU4 A;  2E43 A;  3IR9 A;  3M0D A;  2Q7C A;  2YNY A;  1SLQ A;  1JUN A;  3VN0 A;  3OAK A;  1T2K D;  1SP4 A;  1A02 J;  3MD0 A;  1G2C B;  3VMY A;  2BAS A;  2R3C A;  3M91 A;  1H8A A;  3NTN A;  2XU6 A;  4XE5 B;  1JNM A;  4JYB A;  1WRD A;  3M9H A;  3TK1 A;  4B86 A;  1KQL A;  1T2K C;  2W6A A;  2WTY A;  3TYY A;  3V4W A;  4I6M C;  2R5D A;  1CI6 A;  3P32 A;  5AW5 B;  3T97 A;  1S9K E;  1NAF A;  1GU5 A;  3L35 A;  1S9K D;  2N9D A;  2WPS A;  1MFZ A;  4C7N A;  1HWT C;  3HTK A;  2C9N Y;  1FOS E;  5AW3 B;  2P7J A;  3P7K A;  1X79 A;  5APX A;  1GD2 E;  3MGN A;  5AVX B;  4DZO A;  2IPP A;  4I2L C;  5APT A;  2JJL A;  3A5T A;  5APV A;  5APU A;  2WT7 A;  3O8Z A;  3A3Y B;  3VMZ A;  5APW A;  2Z5I A;  4AQR D;  5AVU B;  3V4Q A;  3HE5 A;  4GT1 A;  1MUU A;  1GZL A;  4LC1 A;  1OXZ A;  5AVT B;  5AVS B;  2XV5 A;  1CI6 B;  4AUW A;  2H7H A;  2WWW A;  3NXS A;  2YO3 A;  4RES B;  5AVW B;  2N9B A;  4C7N B;  5AW7 B;  3V5B A;  5AW2 B;  3UIA A;  1GK6 A;  3KDP B;  4KHX A;  3VTP C;  2WPQ A;  4AYC A;  2QM8 A;  1WR6 A;  1X8Y A;  3M9B A;  1FAV A;  2Q3I A;  1NWM X;  1OWA A;  2VRS A;  3I5C A;  1GK4 A;  5AVR B;  2WT7 B;  1GTW A;  5AW6 B;  3LIE A;  3TNU B;  1HUC A;  5AVQ B;  3A2A A;  2QM7 A;  4GKG A;  3HE5 B;  3P8M C;  1A02 F;  3TNU A;  4HYT B;  5AW1 B; 
#chains in the Genus database with same CATH topology
 3QNU A;  3HRN A;  3IA3 A;  1D1C A;  4QXB B;  1E5W A;  4I50 E;  1G73 A;  3Q2M A;  5FXV A;  4IE7 A;  1Q86 Q;  1VQ6 P;  1JCC A;  5KJ7 D;  4GK0 E;  1PP9 E;  2CA5 A;  3CWB J;  2Q9Q D;  3CPW O;  1P84 H;  4DV7 T;  3EAB A;  5J2T E;  3HKD E;  1NTZ K;  2FFD C;  4EYY R;  4JBZ A;  3CX6 B;  1BSN A;  3E22 E;  3H1H E;  1VF5 B;  3L71 G;  3WAJ A;  3V2R A;  5HEG A;  4YXD C;  5JDF A;  1NO4 A;  1NU1 J;  3M06 A;  5CMZ A;  5AQJ B;  1QL2 A;  2LEH A;  1USD A;  2M8R A;  1DD3 A;  4ZI3 D;  4KHZ F;  3SRZ A;  2K9A A;  3BCC D;  2X0L B;  3VOP A;  2Y9Z A;  2OTK E;  4IIJ E;  1SFC B;  2H8P D;  2ZM8 A;  3ZST A;  2RA1 A;  4JYB A;  2XAF B;  3L70 G;  1T98 A;  2IFM A;  1KQL A;  5L2L A;  1BDC A;  2BKP A;  2O01 J;  1UX4 A;  2NP9 A;  2KSR A;  1GW3 A;  3V2P A;  3KV9 A;  1KZU B;  4E7Z A;  2Y9Y A;  3OKQ A;  4C7N A;  2KWH A;  1EZV E;  3Q5R A;  5LYJ E;  5CCG C;  3O1H A;  4AI6 A;  4OGQ D;  4IST A;  4HWF A;  5AQN B;  3VMZ A;  4AQR D;  2IC6 A;  5AVU B;  3HE5 A;  2J59 M;  3CX5 D;  1VQN P;  2CWO A;  4WBN E;  3II6 A;  4JBW F;  1OVU A;  1EZ3 A;  1K9M Q;  4ZI7 E;  5A1L A;  4BJM A;  4QH4 A;  1SFC C;  1VQK P;  3H1K J;  4KUM B;  4G63 A;  2XQA A;  2ODV A;  2QM8 A;  1FMV A;  3M9B A;  2CM0 A;  3JAE A;  4HFE A;  3KVA A;  5FY0 A;  1J1E B;  4QKN A;  3N9O A;  3FWN A;  1WMK A;  2AXC A;  1VQ4 P;  2JWA A;  4YHJ A;  2VKH A;  4EI2 A;  5CCG A;  2YDS A;  1BE3 J;  2OTJ P;  3HE4 B;  2WPR A;  4DO0 A;  2FYU G;  3EUH A;  1E7P A;  2ZT9 B;  2UWJ E;  4O4L E;  2JP3 A;  1W9R A;  5M4Y A;  1Q7Y Q;  2B1E A;  1QLB A;  1I94 T;  5FY1 A;  1FZE A;  3U1A A;  1V9D A;  2N2N A;  2IX7 C;  2K9Y A;  2XUE A;  1D1A A;  3CCQ P;  2X68 A;  1K04 A;  1KMI Z;  1ZOY C;  3I9W A;  4WNK A;  1SFC A;  4YXW H;  3L36 A;  5H6Q B;  3NMD A;  4HTE A;  2G8Y A;  2WSE H;  2YKP A;  1NTM E;  3N2O A;  3CXH I;  4R4L A;  1FJP A;  2Z5H A;  2WSC H;  1S4X A;  2WSS V;  3IR9 A;  3M0D A;  1JUN A;  4JUY A;  2XSB A;  5CBO A;  3R2P A;  3TSI A;  1NU1 D;  4JYA T;  1JY2 O;  3L72 D;  2WB5 A;  3C64 A;  2ZT9 C;  3NTN A;  4OHF A;  1JY3 O;  4EEB A;  1WRD A;  4U2Y A;  3CQX C;  3SWY A;  1J5E T;  1FMW A;  2IYP A;  5LNK A;  2W2U A;  1RQU A;  3M3Z B;  2LSY A;  2LKM A;  4GOD A;  1GDT A;  2QGS A;  2KZI A;  2AEM A;  4YFS A;  2WY2 A;  2XQ4 A;  3I0O A;  3AE4 C;  2GUV A;  3C4Z A;  2XND H;  4B3S T;  2E2A A;  3Q2Y A;  1MIY A;  3E08 A;  4LMK A;  5FYM A;  3B57 A;  4H9P C;  1JMB A;  3CCM P;  1LWU B;  1DEB A;  2ZMA A;  1XNR T;  4BA9 A;  4EAH A;  1LTA C;  3KV4 A;  1Y8A A;  3AEB C;  5HXH A;  1MMD A;  1LTT C;  5CCH C;  4IDQ A;  2A45 I;  4UXN B;  2E9X D;  4YJ3 E;  4PV1 B;  2WBL A;  2FXO A;  4O9B A;  1WR6 A;  2QA7 A;  1WYC A;  3HR0 A;  5KDM C;  2OV9 A;  3W68 A;  1H0T B;  5EZY E;  5FXZ A;  5FMN A;  1RE4 C;  2AEF A;  4IT4 A;  2KS1 B;  1T72 A;  2E5V A;  5AQT B;  1D1B A;  1JM0 A;  3BQI A;  3EWK A;  1JOC A;  3B8E B;  3T1H T;  3ZJ1 A;  5AW9 B;  2ZLY A;  3FXD B;  2L8K A;  4PJL A;  4U7I A;  3VKG A;  1BCC E;  1DX7 A;  1Z0P A;  3PUX F;  1NTZ E;  3K8P C;  2LR2 A;  4B3M T;  5JDL A;  3MZW B;  4IGU A;  3L3P A;  4D6T D;  3AEB A;  1N7S B;  3UUX B;  3P4P A;  3MXZ A;  2C0W A;  1MV8 A;  5CCH A;  2W6B A;  5HWX A;  4XFJ A;  2HFE D;  2WWV A;  1SVF A;  5HEU A;  4PV1 C;  4XA4 A;  3JCF A;  3L74 D;  2XQ3 A;  3P4Q A;  5DJU B;  3QK6 A;  2GUS A;  2BCC E;  3LW5 J;  2RP4 A;  3H3M A;  4PK4 A;  2DHR A;  1ZRT D;  2BBH A;  1AVY A;  1NTK J;  1QLE D;  4CXX A;  2RH0 A;  5JRC B;  3PUR A;  2KMF A;  1RE4 A;  1KFY A;  2Q7C A;  1IFI A;  3HA4 A;  3CX7 B;  4HFD A;  2A72 A;  2MKV A;  2A06 D;  2ZJS E;  1MNE A;  3FX0 A;  2WMN A;  1RY3 A;  3GHG B;  1HF9 A;  2MBG A;  1OIP A;  3FWL A;  1LWU A;  3AEE C;  2A9U A;  2KNC B;  2M5A B;  4V1A v;  3CK6 A;  3GWH A;  3LK4 2;  3ETU A;  5KAI E;  4KHP T;  3RLF F;  5AW5 B;  1PPJ D;  3CXH E;  1SQB K;  4IL9 A;  2FYU K;  1GU5 A;  1NGM B;  2PJQ A;  3H1I D;  2ODU A;  2N9D A;  5AQI B;  4H9N C;  3KV5 A;  5LMU T;  3S4R A;  4HFB A;  3AEG C;  2IZ0 A;  2D2C B;  4GIF A;  2FUP A;  3ZMU B;  2XAQ B;  4YJ2 E;  3BCC G;  3LDQ B;  2JMH A;  1Q81 Q;  5DJQ C;  4HKA A;  1OMI A;  2I1K A;  1H0T A;  2LKH A;  2Q3E A;  1XMQ T;  3B13 A;  4EB6 E;  4CQI A;  3TLU A;  5AVT B;  3G06 A;  2NR4 A;  1DU2 A;  1FZF A;  4TLF A;  3U3I A;  3P7I A;  1VOM A;  1BGY D;  3RIA A;  2H89 C;  1L0N J;  3GHG C;  2PP6 A;  5HXS A;  1D0X A;  1LRZ A;  3VHL A;  3FXD A;  2W63 A;  3PUQ A;  2IC9 A;  2JWD A;  1GK4 A;  3QB5 K;  3AEE A;  1L4A B;  1OVR A;  2K88 A;  1N7S A;  5ABE A;  1NHL A;  2BS3 A;  2HN1 A;  3ANW B;  1SQX J;  1KB9 I;  3JC6 D;  4CI2 B;  4U3F E;  3MHV A;  1VRB A;  1YD8 G;  3N9Q A;  4X64 T;  4N78 D;  1R5S A;  5L3F B;  4DUY T;  1H89 A;  3CIR A;  3P8C E;  3SOL A;  3ZT5 A;  5IYZ E;  1KIL C;  3PLN A;  4ZKP A;  2IDO B;  5L3C B;  4CPG A;  3X1D A;  5BR8 T;  2RN0 A;  4JEU B;  3BK9 A;  5LJM A;  5JRC A;  1YQ3 A;  4I1L A;  1SS1 A;  3CCS P;  4WW0 A;  1R8E A;  2O01 H;  3ZYK A;  3ITK A;  5APY A;  4QH5 A;  3SFD C;  2BS4 A;  2H89 A;  4AKH A;  3GHG A;  5JDQ A;  5L3G B;  2K9J B;  2C9L Y;  3KHU A;  2W4X A;  5CFB A;  1NYH A;  2Q1K A;  3H1J J;  3CCR P;  1K05 A;  2CXD A;  1L4A C;  4RKU J;  2KNC A;  1GW4 A;  1W5C E;  2M5A A;  3Q5P A;  3RK3 C;  4EIW A;  4HN9 A;  5H2F H;  4L5G A;  5EFW B;  1T2K D;  3AE3 A;  3L73 J;  2ACX A;  3RKG A;  3ZKR A;  4C7R A;  3TLW A;  1SQV D;  3Q5W A;  1NTK D;  4WBO A;  4HWC A;  2H7O A;  3CML A;  1RF1 B;  5JRE A;  3SSU A;  5L47 A;  3F89 A;  4DR3 T;  1OED C;  1YJ9 P;  1H7C A;  1OZH A;  3CWB G;  1X9B A;  1LVF A;  3OYZ A;  4RJT A;  3PH0 A;  2LXB A;  1S9K D;  1DD4 A;  1LT9 B;  3WI3 A;  2QJP B;  3TGU J;  3VRB A;  4TWD A;  4F8H A;  3P7K A;  3L71 E;  3L75 J;  1T3U A;  2E5L T;  1KYO I;  2MPK A;  1EXI A;  1WCR A;  5APU A;  2CE7 A;  4GKJ T;  3CC7 P;  5LGN B;  4YTN A;  4NPP A;  1L4A A;  1NU1 G;  2Z6E A;  2PBI A;  3V5S A;  3L39 A;  1T6A A;  3ANW A;  4P0A A;  4JI6 T;  3RK2 C;  4TZ4 C;  3NXS A;  2L5G B;  3B4S A;  5JQG E;  3U1C A;  3VP8 A;  1OW8 A;  3CKD A;  1X79 B;  4K35 A;  2MTQ A;  5AQP B;  4AYC A;  3ZN0 B;  3PTR B;  3I9Y A;  1OWA A;  1W09 A;  4OWF A;  2WSE J;  5KAF H;  4ILC A;  4DV4 T;  1LTJ B;  3TNU B;  3L70 E;  1KIL E;  1L0N D;  1QVG O;  5AVQ B;  3O4X E;  3CMA P;  4X66 T;  5KLV J;  2ZM6 T;  4DVD A;  1LT9 C;  1HGZ A;  2QJP C;  2J1D G;  1OFC X;  1MMA A;  2P58 A;  1XTC C;  2HR3 A;  2MAW A;  1IFP A;  4KMC A;  1RE3 C;  2FXP A;  2NPS D;  5GTI E;  1IK7 A;  3H32 B;  5JVD E;  1IO4 A;  3NZQ A;  2KUB A;  4OK0 A;  1MMN A;  3F57 A;  3KZI E;  2C5K T;  5M1B A;  5FL1 A;  3EFF K;  4O8S A;  2O3J A;  2HG5 D;  1KQG B;  4CN4 A;  1ZP0 A;  2KIK A;  4MN4 C;  1L0L K;  1NOH A;  3RK3 E;  2L3L A;  2KSE A;  1X22 A;  1QGK B;  3WUU A;  3FBL A;  4JI8 T;  3VMA A;  2V7J A;  4DBR A;  1KNR A;  4MAL A;  4PK5 A;  4H63 V;  1KB9 E;  1ZME C;  3WUT A;  5J0Z A;  1N2D C;  2CMR A;  4U31 A;  3UU8 A;  3H1K G;  2JJ9 A;  1JY2 P;  3CCJ P;  1RF1 A;  5F8P A;  2XQ9 A;  1LTJ C;  2WDV A;  3LK3 B;  5HXC A;  3RKO A;  3L37 A;  2NOX A;  3AE5 C;  3AEC C;  4UEL A;  4IDO A;  3B5N D;  5L4E A;  1OED E;  2LM9 A;  3AVS A;  4IE6 A;  2ZAE B;  1VQ8 P;  1LT9 A;  5B66 E;  3QB5 A;  1SQP K;  2PGD A;  3VN0 A;  1S5L X;  1IFN A;  2JDI H;  3OAK A;  4CN1 A;  4A5X A;  1G2C B;  3MUD C;  3PP5 A;  1RE3 A;  3RRW A;  5CHX A;  1BE3 G;  2QRX A;  3A7M A;  2FYU E;  3AAE B;  4XZC A;  1EXJ A;  1UUR A;  3NRY A;  4A56 A;  1AQ5 A;  2OTL P;  5AQL B;  4I4T E;  3HUS A;  5LJN A;  1EDI A;  4X1I E;  2K1A A;  3W67 A;  3L35 A;  5L8R J;  3TF5 A;  1GQE A;  3PUV F;  3CQC B;  5JDN A;  2WCA A;  3T8O A;  5AW3 B;  1X79 A;  3RRC A;  3JSV C;  1YJN P;  1AV1 A;  2H88 A;  3AE6 C;  3EVY A;  2PFV A;  4HWH A;  3AE5 A;  1MFT A;  2XM2 A;  3AEC A;  2QJK C;  4KI0 F;  4BRY B;  1AFO A;  4WWI A;  3N9L A;  3R84 B;  3QOF A;  2WWW A;  2IZ1 A;  2ZVO B;  2NTX A;  3H32 A;  3N9M A;  1X8Y A;  2GK9 A;  1PV3 A;  3C98 B;  4GOU A;  4DV2 T;  2EHO B;  3AEF C;  5DAB A;  2V8S V;  4IE4 A;  3DP7 A;  5DQW A;  3AE8 C;  2CPS A;  4IFM A;  2W27 A;  2HYN A;  3UUM A;  1USE A;  1SUM B;  2XZR A;  3ZMZ B;  1JO5 A;  3AXJ B;  3WAK A;  2Y6X A;  4JV5 T;  1VCT A;  5KLV D;  1FZC B;  3HKB E;  4MBQ A;  3PUY F;  2OYH B;  2FBW C;  2V5D A;  1HCI A;  3BQL A;  1FBM A;  2WSS H;  4DR6 T;  4GYR A;  3RGL A;  4TX5 A;  3Q5X A;  1S5L E;  3CX5 I;  2P67 A;  3RL0 g;  4UB6 E;  4ZI2 C;  1G2C A;  2Q6Q A;  5L3B B;  3VU7 H;  1CZQ A;  4TT3 H;  2KSJ A;  2Q5U A;  2EHO C;  5FVK A;  3F5H A;  2ZFC A;  5ABF A;  4LFB T;  3FZK B;  1EQ7 A;  1ZN5 A;  5JDM A;  1KNP A;  2E5Y A;  1VQP P;  2CWY A;  2YIN A;  3RF1 A;  1YQ4 A;  1KD1 Q;  3J7Y q;  4R4M A;  1U7M A;  4ANJ A;  1LTS C;  5HCM A;  1N86 A;  2VQE T;  3VMY A;  1FZC C;  2R3C A;  1J1D C;  4HEA A;  4BJN A;  4PFP A;  5EK4 A;  1WT6 A;  2BKN A;  4XE5 B;  2OYH C;  3TK1 A;  4OGQ C;  2XQ7 A;  2WTY A;  4JI0 T;  2QA4 P;  4IL6 X;  1HNW T;  3OVU A;  4HWD A;  2DL1 A;  3L72 J;  4AQY T;  3E7K A;  3HTK A;  2WPV B;  4NPD A;  1GL2 B;  3D6Z A;  4L74 A;  2NTY A;  2YXR B;  1EZV D;  1GD2 E;  4AKI A;  3MGN A;  1KTM A;  2J47 A;  2V7L A;  4UVB B;  3UU3 A;  2M0B A;  4HKZ H;  3Q5E A;  5APW A;  3RHW A;  2VL0 A;  1NTK G;  2PRR A;  4UB8 H;  4LC1 A;  2AE9 A;  3T97 B;  2QG4 A;  1RF0 C;  1EDJ A;  1NEK A;  3B71 A;  3D6Y A;  2KZ7 B;  2SPC A;  1VQ9 P;  4EIJ A;  1HG2 A;  1VQM P;  3AXJ A;  3H3A A;  3VTP C;  3JAF A;  5B5E E;  1FZC A;  2FFD A;  4U33 A;  3QH9 A;  4Z91 A;  3N2K E;  3QUJ A;  2LSG A;  3SWH A;  1YI2 P;  3O9X A;  3CL3 D;  2D0U A;  2FJB A;  4MHC A;  1VPC A;  2YMK A;  3RYF E;  4YXD A;  1KK7 A;  5AW1 B;  1QVF O;  3ESL A;  1BCC J;  4NPE A;  2W0G A;  1GL2 C;  5CJ4 A;  3NFQ A;  3Q1M A;  2E42 A;  1D0Z A;  1SQQ K;  5HWY A;  3K3N A;  3A0B E;  5BMV E;  1L0L E;  2E74 B;  4OYJ A;  2P2U A;  4X20 E;  1JNZ A;  2BCC J;  1RF0 A;  2YXQ B;  5HXR A;  2MYS A;  2V6Y B;  2VK9 A;  5IHY A;  3ONJ A;  2QVA A;  1KYO H;  2OGU A;  5APS A;  1L0N G;  5TAO A;  3VMX A;  3BVH A;  4ASV A;  2JQQ A;  3RIF A;  3H6P A;  3VR8 A;  4YSX A;  2FYZ A;  3RI5 A;  2X67 A;  3CLQ A;  4D6T J;  2NW9 A;  3PUG A;  1ZHC A;  1SQP E;  1NTM D;  2D9D A;  4IL6 E;  5J1G A;  4CN6 A;  2KYV A;  3I56 P;  3L74 J;  3I0Q A;  4MLK A;  3Q9D A;  2YNY A;  1SLQ A;  1UIX A;  1SQX G;  1Y64 B;  4A7P A;  2DCF A;  1XZY A;  3CX5 E;  2M67 A;  3M91 A;  4CXW A;  2E74 C;  1VF5 D;  2X0H A;  5CCG D;  1KC8 Q;  5KXJ A;  4L9I A;  4CXY A;  1BSH A;  3T97 A;  2CLY B;  2ZXX A;  2XPK A;  2WPS A;  3IAO A;  3V2N A;  1N8R Q;  2E75 B;  1EDL A;  2VQF T;  4IL4 A;  2YOE A;  2W61 A;  2RMZ A;  3A5T A;  1WLX A;  3O8Z A;  3LJC A;  3H1J G;  2IBZ D;  1SFC D;  3V4Q A;  4U7J A;  2G0U A;  3H1I J;  4GT1 A;  1FEW A;  1FIO A;  1GZL A;  4AUW A;  2H7H A;  2XAJ B;  2M3B A;  5LHG B;  2N9B A;  3H37 A;  4WB4 A;  5LOV E;  2P10 A;  3L73 G;  3UIA A;  2H43 A;  3H1L J;  1N73 B;  4UF0 B;  5AQH B;  3V5U A;  4BAY B;  3PDY A;  1YJW P;  2WPQ A;  1UGO A;  5GON E;  3PRJ A;  3G71 P;  5AVR B;  1ZOY A;  2BDE A;  4U3F J;  4C90 A;  3M65 A;  1HUC A;  3KBU A;  2CLY C;  2B76 A;  3CWB E;  3FZL B;  1S35 A;  2XM1 A;  3ZEF B;  2YDR A;  1BGY J;  3N9N A;  2WZ7 A;  5DJT B;  2JQK A;  2V6Y A;  2IDB A;  1QX8 A;  2E75 C;  2ZYD A;  3OJA B;  1HR0 T;  3TGU G;  1IFD A;  3ZMT B;  2CK3 H;  1HBW A;  3L75 G;  4Y28 J;  2W6J H;  1N7L A;  4ILB A;  1BCC D;  3HE4 A;  4P1N A;  1NTZ D;  1MMG A;  3MK7 C;  1E1H B;  1NWQ A;  4UIG A;  5JH7 E;  3FB2 A;  3E1I A;  1IBL T;  2YKQ A;  3GF3 A;  1W0B A;  2WAU A;  1N73 C;  5F3J A;  5LP6 E;  1S72 P;  3D70 A;  1M56 D;  1JNR A;  4EZH A;  3N7N A;  4YPC A;  2XJ7 A;  2P9B A;  3EAM A;  4PJN A;  3AE4 A;  2BCC D;  2V7M A;  4QX7 B;  4ILU A;  1IJ6 A;  2KLV A;  2ZM2 A;  2ZT9 D;  1XWM A;  5KLV G;  2CCQ A;  3E1R A;  2GM4 A;  2PFX A;  3J9X 1;  3EQ2 A;  1SP4 A;  3PUA A;  4GKK T;  2VVS A;  1LJ2 A;  5BU8 B;  2V5C A;  5AQQ B;  3P4R A;  1YKH B;  2XAH B;  1IC2 A;  3CWZ B;  3AA6 B;  1JTH B;  4PD4 I;  4KJM A;  3F2E A;  2K3R A;  2K3W A;  1SQV J;  3FXE B;  4DUZ T;  4BWN A;  2DW3 A;  3CXH D;  2QIW A;  2C9N Y;  1N73 A;  4UF0 A;  2XHE B;  2HOD B;  3FZH B;  4H9R C;  3Q3D A;  2UUB T;  5ETW A;  5CCH D;  3H1K E;  5APT A;  5C2T A;  3KV6 A;  3HD7 B;  4L73 A;  5C8Y E;  3A3Y B;  3RC3 A;  3CCE P;  2JMK A;  2RPA A;  4MFR A;  1BR0 A;  4DV0 T;  1MUU A;  3BRT B;  1VQ7 P;  1WR0 A;  3ZMS B;  4U74 A;  2JQH A;  1HVV A;  4PJ0 E;  2QEX P;  4AQF C;  1T8Z A;  4RES B;  3OJA A;  1G1J A;  2UXX B;  1Y47 A;  3JC6 C;  5E79 E;  3Q5D A;  4ZXL A;  2WDQ A;  1NWM X;  3S4U A;  1NH4 A;  1BE3 E;  1SQX K;  1S94 A;  3LIE A;  1HNZ T;  3TLT A;  2E76 B;  4M1P A;  3H1L D;  1KIL B;  4HYT B;  1W0A A;  2XAG B;  4J2C A;  1SQQ E;  2XQ6 A;  2BEZ F;  3MKD A;  4EOZ B;  4Q25 A;  2KS1 A;  4U3F D;  2CHO A;  4H63 H;  1DH3 A;  1WRG A;  4QH1 A;  3HD7 C;  4P09 A;  4IOI H;  5CJ5 A;  4PV1 D;  4EOT A;  5AVV B;  2KOG A;  2UXN B;  2ZM0 A;  3KDS E;  1VQL P;  4NUU A;  5K5G B;  1CW5 A;  1LNQ A;  2D2S A;  4B3R T;  1VQO P;  3RK3 B;  1Q90 D;  3USS A;  2J62 A;  2X66 A;  4NXN T;  4F6R C;  1FZG A;  2LSK A;  2W66 A;  1LKX A;  3VR9 A;  2OYI B;  2E76 C;  1JTH A;  4HFH A;  1LVK A;  3AEG A;  3C8V A;  1P84 I;  3LFM A;  3CPZ A;  5APQ A;  4H13 B;  1PGP A;  2K48 A;  1PGQ A;  3FXE A;  3S9O A;  1E2A A;  2XY8 B;  4C91 A;  2KB7 P;  1OED B;  1YIT P;  1SQB J;  2WM9 A;  4G2A A;  1N7S D;  4W7Y A;  5KKZ C;  4TUY E;  2HOD A;  1G1I A;  2N1T C;  3LK2 B;  3NWI A;  3PUZ F;  1FJG T;  3JAD A;  3O6Q B;  5H6R B;  3HD7 A;  4EDF A;  1ZLL A;  5C39 A;  4H44 B;  3MTU E;  2CEA A;  3A5X A;  2W6A A;  4H0L B;  5LA6 E;  3RQW A;  2JR8 A;  1T7S A;  5JR9 C;  2AXT E;  3SS1 A;  3SWK A;  1UUS A;  5FY7 A;  2LHN A;  3B5M A;  5HEH A;  1R5L A;  3RYI E;  5APX A;  3AVR A;  3RQU A;  4DZO A;  4GDO A;  2IPP A;  2KXP B;  4I2L C;  3RK2 B;  5APV A;  2OYI C;  3RC8 A;  4WY4 B;  2KLU A;  2NWB A;  4H13 C;  1LTI C;  1KIL A;  2W90 A;  4N78 E;  2WU5 A;  3JCU E;  3TLV A;  3G3Z A;  4PD4 E;  3AA1 B;  2V1D B;  1IK9 A;  5AQF B;  3PUS A;  2CRB A;  5AW7 B;  3V5B A;  2UXD T;  2IFN A;  1YKE B;  4ERR A;  3CVR A;  4H44 C;  4WZX A;  5KX5 E;  1LP1 B;  3SFD A;  4H0L C;  5AFU L;  4X65 T;  2D2C D;  2QM7 A;  1L0V A;  3P4W A;  4X62 T;  1URQ B;  1DEE G;  4H9Q C;  1O3X A;  3ZN1 B;  5CA0 E;  2BBJ A;  2V7Q J;  3L72 G;  2IBZ G;  3RL0 C;  4IDN A;  1BR2 A;  4WY4 C;  1MKM A;  3ZMV B;  1VCS A;  1YXR A;  3AEA C;  1FZB A;  1PFI A;  2OYI A;  3I1A A;  2ZYA A;  5AVZ B;  4YTP C;  4N3Y B;  1X0T A;  4ZS2 A;  5KAI H;  2XQ5 A;  4P0B A;  3CXH H;  3BQK A;  4QXC B;  2LRL A;  2VB6 A;  2YU2 A;  4LF9 T;  1OED A;  1L4A D;  4M3L A;  1YIJ P;  4JI7 T;  1NAY A;  2B88 A;  5TIS E;  5CB4 E;  2LE8 A;  4EXT A;  3UUB A;  3O6Q A;  3UU5 A;  3ONL C;  2OA5 A;  3D71 A;  1PP9 J;  3GMI A;  4AQG A;  2K9J A;  3QWO C;  4CI1 B;  3K3O A;  1URQ C;  1GU4 A;  1FDO A;  2WIT A;  2E43 A;  4NIQ A;  2UUC T;  3S1K A;  2ES0 A;  4LMJ A;  3H1H J;  1BCC G;  3MD0 A;  3UQ7 A;  2QYW A;  3AA7 B;  2BG9 C;  2G3A A;  3FGA D;  1G8X A;  1N32 T;  4WY4 A;  2BEQ D;  2IML A;  2JIW A;  2XU6 A;  4LF4 T;  2QJY B;  3AEA A;  1E79 H;  4B86 A;  1UX5 A;  4YTP A;  1SQB D;  2FYU D;  3HL6 A;  2Y0C A;  5BVZ A;  4I6M C;  1M7K A;  3PU8 A;  3T1Y T;  1P84 E;  2Y48 B;  4EV6 A;  4NPF X;  1QUU A;  2BCC G;  5HCJ A;  1HWT C;  2H7V C;  3UUL A;  4I55 E;  4ISS A;  2A45 H;  2K5B B;  1KOR A;  2QJK B;  1L0N E;  3PJS K;  2JJL A;  2ZVN B;  5HEO A;  3SFE C;  2LRK A;  3AB3 B;  4D6T G;  3L4F A;  1URQ A;  3RBX A;  4LF8 T;  3AAI A;  1TU3 F;  4JI4 T;  3RYH E;  3RGU A;  2X9X A;  3L74 G;  1SQX E;  4COF A;  1KQF B;  2XZE A;  2CBJ A;  2WS3 A;  1HS7 A;  4ZZC A;  2M6I A;  2QJY C;  3PHL A;  2B87 B;  2FJA A;  3I5C A;  4JEH B;  4HGA A;  3CCU P;  1GTW A;  4U2Z A;  4ZNC A;  1KYO D;  1RQV A;  1LTJ A;  3KVB A;  4OVN F;  3TNU A;  1D7M A;  5AQR B;  2A06 G;  4TNW A;  1ZR4 A;  1L0L J;  1VQ5 P;  3GN5 B;  3ZC0 A;  3CD6 P;  3PTZ A;  2LLY A;  4X5T A;  2I6H A;  1DIP A;  3EDV A;  2AEJ A;  3VKH A;  5DQV A;  3AAA B;  2R32 A;  2KI7 B;  3H1J E;  3SFE A;  3MUD A;  5AQU B;  1PPJ G;  1XTG B;  1ZKE A;  1KFN A;  4QXH B;  3H1I G;  4DND A;  1HJB A;  4GOF A;  3KXD A;  1GMJ A;  5KJ7 C;  4DJG A;  2Q9Q C;  1CSB A;  3L73 E;  5AW8 B;  4YTM A;  3H1L G;  3G4S P;  1IZN B;  5LG3 A;  2CPB A;  3MA9 A;  2BG9 E;  1XDO A;  2D0T A;  1XNQ T;  4U7Y A;  5AQO B;  4U3F G;  4DV5 T;  1KV4 A;  2V26 A;  1J1D B;  4PW8 A;  4Z8X A;  3AE1 C;  3AE6 A;  2A45 G;  1BGY G;  2KT9 A;  2LHR A;  1PP9 D;  2VKJ A;  4OGQ B;  2B89 A;  3OPC A;  3LBX B;  3TGU E;  2VL8 A;  2BAS A;  4WBA A;  4ZI3 C;  1NU1 K;  3GG2 A;  3L75 E;  1NTM J;  2YKO A;  2YK0 A;  1N34 T;  2GA1 A;  3M9H A;  2K24 A;  3H1H D;  4DR5 T;  2R44 A;  3U78 A;  4AXP A;  4IFD K;  4DV6 T;  3CX8 B;  1U57 A;  4AKR B;  3H25 A;  5CGM A;  3AEF A;  4H9O C;  2R6G F;  3PV0 F;  1YTZ T;  1MFZ A;  1NJI Q;  3KBT A;  2RKL A;  5GTI H;  4UR9 A;  1N33 T;  2F4V T;  3AE8 A;  1S1C X;  4KP3 C;  4IDP A;  1JB0 J;  2B87 A;  2M3E A;  5BU5 A;  1K73 Q;  3KZI H;  2W62 A;  1UII A;  2Q9I A;  2MJZ A;  4LF6 T;  2CPT A;  3NKZ A;  1U5P A;  4HE8 A;  3OA7 A;  2LT3 A;  3P4S A;  2H3R A;  1U4Q A;  2KZJ A;  2LM2 A;  2JKV A;  3AE1 A;  1CI6 B;  5KLV E;  2YO3 A;  1YHQ P;  4DBQ A;  3GN5 A;  1KB9 H;  4BRY A;  2FBW A;  5AW2 B;  1UK5 A;  3BRV B;  3F31 A;  2KWI B;  4IHJ E;  3R6N A;  2WT7 B;  3GLM A;  4QMA A;  4JLE A;  1I6Z A;  3A2A A;  3QC9 A;  2XQY A;  2ACZ A;  2EHO A;  1K8A Q;  5B66 H;  2HLO A;  1T3J A;  1SQV G;  2Y0D A;  5HYA A;  4U72 A;  1YBK A;  2WMO A;  5LG4 A;  3AE7 C;  3PJA A;  4ZHQ E;  1AQT A;  1KQS O;  3V6I A;  2WQY C;  3C4X A;  4ZI2 D;  3IN6 A;  4KX6 A;  4JI2 T;  5AW4 B;  1L0L D;  1FDM A;  3ABV C;  1KNZ A;  2IHR 1;  3EHZ A;  1M57 D;  1ZXG A;  2VKD A;  2EHO D;  4CZZ B;  2OYH A;  2IBZ I;  3K1S A;  1IFM A;  1FS0 E;  2LOS A;  1J5W A;  3LBX A;  2JQ9 A;  1MIW A;  3WU2 E;  3ZCJ A;  3ZPO A;  5GTH E;  1YYC A;  5AVY B;  4C46 A;  4HJG H;  3NZP A;  4TNV A;  4B6X A;  4ILA A;  4NXM T;  4TV8 E;  1NTZ J;  3M0A A;  2VKO A;  3UFE A;  1Q2N A;  1D0Y A;  3AE2 C;  1XDP A;  1SQP D;  1VF5 C;  3BCC E;  1Z8U A;  1Z56 A;  4Z1M H;  2XNX A;  3O1I A;  2XKM A;  1LTB C;  3WMM 0;  4AIU A;  4FJO A;  3OYX A;  1N36 T;  2W83 C;  4ZS3 A;  3AE7 A;  3BAT A;  1BDD A;  1H8A A;  4I7Z B;  1W2B O;  5F5W A;  3MJX A;  2J5U A;  2WQY A;  3IF4 A;  2C5J A;  1IAP A;  2I59 A;  1SHZ C;  1QEX A;  2I8D A;  3ZYM A;  1MIV A;  3ZJ2 A;  2CXL A;  3ABV A;  2E9X B;  4HH2 A;  3ZC1 A;  1CI6 A;  3P32 A;  4W80 A;  1WFD A;  3L09 A;  1FZA A;  2K37 A;  2DWG A;  1CHU A;  3ONX A;  2A2F X;  1FC2 C;  2XAS B;  2V7Q H;  2ZYG A;  1GL2 A;  1SE7 A;  3C9I A;  2WT7 A;  3M0D C;  3MAC A;  2Z5I A;  4H9S E;  3AE2 A;  3A8Y C;  2KND A;  3EDU A;  3FHN A;  4AKL A;  4DOJ A;  2O1J A;  4GOE A;  3W15 B;  1S5L H;  2J58 A;  1MND A;  5LBQ B;  2FKW B;  4O4H E;  1OW6 A;  4UB6 H;  5KMG P;  3U59 A;  1SQB G;  1AJY A;  1GK6 A;  4I7Z C;  2YIU B;  1FAV A;  5FL0 A;  1GL2 D;  3EFG A;  1SQQ J;  2CHN A;  3C51 A;  2D5U A;  5AW6 B;  2E9X C;  1L2P A;  1NVO A;  3G9R A;  3V2Q A;  4YLH A;  3CWB D;  2FXM A;  4TWF A;  3ZT7 A;  1J1E C;  4EYY Q;  3DTO A;  2DI4 A;  1QL1 A;  1EDK A;  4PJM A;  1WYB A;  2XSA A;  4JF7 A;  5AW0 B;  2YU1 A;  1US7 B;  3ZDM A;  1LGH B;  1S3J A;  5AQK B;  2WDR A;  2YIU C;  5LXT E;  2MOZ A;  1J2J B;  1RH5 B;  2NZ2 A;  2JEE A;  1M7L A;  3LID A;  1HTL C;  1T8B A;  2QE7 H;  2Y0E A;  4LFC T;  2XTL A;  4EGW A;  4LFA T;  2E9X A;  4LF5 T;  1Y9B A;  3VYI A;  1FOS F;  3AE9 C;  2E74 D;  3MIW A;  1KF6 A;  4EED A;  1NU1 E;  5LGU B;  1A02 J;  1ZR2 A;  5ABH A;  3L72 E;  2IBZ E;  2OQQ A;  5KLI B;  5FKY A;  4DCK A;  5B5E H;  3ZSS A;  3UQ4 A;  1ZV8 A;  3LSV A;  3KYQ A;  5TJH A;  3E0Z A;  3N4X A;  1SQV K;  2WSF H;  1NTK K;  3IFM A;  1MZ9 A;  2WP9 A;  3DJB A;  1JNM A;  1OW7 A;  2HPL A;  4PK6 A;  2X0Y A;  2OLT A;  2YDQ A;  3WU2 H;  5GTH H;  2R5D A;  4X1K E;  3TLS A;  1RHZ B;  1HNX T;  4IDZ A;  1JY2 N;  3IBP A;  2DNX A;  3UTK A;  3RH3 A;  1HF8 A;  3UU6 A;  2M6B A;  4OH8 B;  3KFW X;  3WUV A;  2NRG A;  1JY3 N;  2IYO A;  3A0B H;  4ZOL E;  3AA0 B;  3VRA A;  3H1K D;  1PP9 G;  3UT5 E;  3CCV P;  2CBI A;  4DR2 T;  1IBM T;  5LHI B;  3AE9 A;  4HB1 A;  1AA0 A;  5AVW B;  5H2F E;  5KLI C;  1LWU C;  1ZW0 A;  4YY3 T;  3H1H G;  3L71 J;  2DLR A;  4L75 A;  4JI5 T;  3OTO T;  2Q3I A;  2JPF A;  4FI5 A;  1HTJ F;  1AVO A;  2E75 D;  5J2U E;  3CC4 P;  3R4Y A;  1BE3 D;  1IBK T;  4IL6 H;  2O01 N;  1PGJ A;  2X9W A;  5LCY A;  5EK3 A;  4QHO A;  4ADZ A;  1L0N K;  4W7Z A;  2WU2 A;  5HAX A;  5HXE A;  5L4H A;  1SQQ D;  1FDI A;  3CX5 H;  3I55 P;  3TKL B;  5FXX A;  3FBZ A;  3KQG A;  3L70 J;  1Q82 Q;  2BKO A;  2VVN A;  4D6T E;  4YSZ A;  4PFO A;  4ZMD A;  1M1J B;  1Y01 A;  2X9Y A;  3ZYL A;  4EYU A;  4DV3 T;  4JYC A;  3L74 E;  3C50 A;  4DR1 T;  1EZV G;  2R3S A;  5LB7 B;  4WVZ A;  2IAK A;  4AKG A;  5LBM A;  1UCU A;  1H88 A;  1N7S C;  2R5B A;  1ZRT E;  2XQ8 A;  5FNV E;  4HFV A;  2I0M A;  5KAF E;  5KKZ B;  2KP8 A;  2BS2 A;  3RYC E;  2N1T B;  2V7K A;  4QX8 B;  4PJJ A;  3P8C D;  4YSY A;  2LXC B;  2BVL A;  1EC5 A;  4LF7 T;  2A06 E;  4X1Y E;  2C0S A;  3IEE A;  1NEN A;  3O1J A;  3IHR A;  2WMM A;  1L0L G;  4RO0 A;  4O2A E;  4AQF A;  3MP7 B;  5JR9 B;  1YQ3 C;  4B3T T;  4A97 A;  4EZ4 A;  1T2K C;  1M1J C;  2FY8 A;  4K3A A;  1PPJ E;  2HN2 A;  2LSI A;  5LMN T;  4JI3 T;  4UVA B;  3H1I E;  3UUN A;  1PGO A;  2L91 A;  2V7I A;  4K0K T;  2IIU A;  1SQP G;  3H1L E;  3CQG B;  2FYU J;  1M1K Q;  1BR4 A;  1HJ0 A;  4PAG A;  3N2G E;  3AE3 C;  3C4W A;  4XAX B;  1HGV A;  2D2C C;  4UVC B;  1W2E A;  1BGY E;  2NPS B;  2LJL A;  5KTB A;  2OYO A;  3K5B A;  4PD4 D;  3CME P;  1J1J A;  1HH0 A;  4KT0 J;  2KIN B;  1YTZ I;  3MZK B;  4KHX A;  3N5L A;  2FJE A;  1JMM A;  4JPZ B;  5EK2 A;  2VRS A;  2E8I A;  3OW2 O;  1PZQ A;  4JQ0 D;  3BAS A;  1NTM G;  4IE5 A;  3A0H E;  2VWA A;  3RL0 B;  3TDK A;  1M1J A;  3L71 D;  3HD7 D;  4DR7 T;  3P8M C;  1OVV A;  4I0U A;  1M62 A;  1X9V A;  2V4H A;  3N9P A;  1FJK A;  4GYS A;  3HKC E;  1IJD B;  2HPJ A;  3JC2 2;  4O4J E;  2SPZ A;  4TWH A;  3B5N B;  3NVO A;  2N1T A;  4ZEY A;  5KLV K;  1OX3 A;  2FYN B;  2L9Q A;  2WVR A;  1NKN A;  3P50 A;  4L0R A;  2NPS C;  2ZXE B;  5HEJ A;  2E76 D;  4ZKU A;  1JCD A;  4ASW A;  3L8R A;  3L70 D;  5AQV B;  1KIL D;  5L3D B;  4OFZ A;  1YW0 A;  2N1G A;  4WYV A;  5JR9 A;  3FZM B;  3RBZ A;  5L3E B;  2FJD A;  3FZF B;  4L76 A;  3A7O A;  3CCL P;  4O2B E;  3HKE E;  3RX6 A;  2LOP A;  1NKZ B;  4DR4 T;  2N1T D;  4IFF A;  2BG9 B;  4CI3 B;  2KK7 A;  2NW7 A;  4IRE A;  4PJ0 H;  3EI0 A;  5IUX A;  5IWA T;  2UU9 T;  1VDF A;  2JRK A;  2WZH A;  3NBX X;  2UXC T;  3K3Q C;  4A98 A;  1SQV E;  1NTK E;  3ZCI A;  2ITA A;  5E79 H;  4QWN B;  1HG5 A;  2J4G A;  3CC2 P;  4HFI A;  3B5N C;  3RK3 D;  4KBM B;  5CBN A;  2JO1 A;  1CUN A;  1ZP0 C;  2HPC B;  2CXF A;  2X9H A;  1SA0 E;  4TV9 E;  2FYN C;  3HUS B;  5LGT B;  1KB9 D;  4DT0 A;  3TYY A;  1PIX A;  3V4W A;  1B7T A;  1LTG C;  1S9K E;  3RIU C;  2VUR A;  2NPS A;  2IUB A;  1RF1 C;  5JTG A;  1P84 D;  3CI9 A;  4H13 D;  3VP9 A;  2QSI A;  4ZZB A;  2BZB A;  2PTF A;  4HWI B;  4DID B;  2WSC J;  1NTZ G;  1FE6 A;  2B9B A;  2HHH T;  1AJ3 A;  2XDJ A;  3GA8 A;  3D0T A;  1OXZ A;  4H44 D;  3UFG A;  1S2E A;  2E5T A;  4H0L D;  3KPE A;  3NRX A;  2P1J A;  5AQG B;  1SQX D;  3ETV A;  2PG8 A;  3KDP B;  5FP3 A;  2C0X A;  1M8O B;  4TN7 B;  3ZLI A;  3B5N A;  1XMO T;  1ZEE A;  3HUS C;  2KLQ A;  2LKG A;  3RL0 D;  2V6X A;  4DV1 T;  1ZV4 X;  3RK2 D;  3PU3 A;  1LP1 A;  4WY4 D;  4JI1 T;  5ABG A;  4HFC A;  3RPU A;  1IJ5 A;  5CJ0 A;  3RIU A;  4IE0 A;  2H88 C;  4UV9 B;  2DWK A;  2YO2 A;  4DMW A;  5JDG A;  3SWF A;  4O4I E;  4LGD E;  2W8Z A;  2A3D A;  4LML A;  2NW8 A;  3PE0 A;  1JY3 P;  1IFJ A;  2WSF J;  1U7J A;  2WZI A;  3IF8 B;  2N9Y B;  2BG9 A;  2Q9Q B;  4K0U A;  2POH A;  3H1J D;  4N6J A;  3Q5S A;  5AQM B;  3M9Q A;  3GF7 A;  4LLH A;  4OX9 T;  1M90 Q;  4UB8 E;  2AXT H;  3LG7 A;  3GW6 A;  1URQ D;  3A0H H;  1QSD A;  5ABF B;  1SQB E;  5FVL A;  2Z4E A;  3KIN B;  1KEY A;  5E0O A;  3L73 D;  5JDH A;  4YHH T;  3BCC J;  2W00 A;  2HPC A;  4PNI A;  3UU4 A;  4OYK A;  2IW5 B;  1LT1 A;  4DMV A;  1SQQ G;  2HH7 A;  2BVM A;  3AED C;  1VL2 A;  3JCU H;  4Y99 B;  3OBV E;  4PD4 H;  4YT0 A;  1EZV I;  1NTM K;  2OAR A;  3PJA J;  1HX1 B;  1R8I A;  2YKS A;  1HX8 A;  1FU1 A;  2I1J A;  3TGU D;  1BR1 A;  5AQS B;  5C3J A;  4XBF B;  4Z90 A;  1SQP J;  3L75 D;  1PL5 A;  4AIS A;  4UEM A;  1KFM A;  2Y8D A;  3HTK B;  4UV8 B;  1NAF A;  2YN6 A;  2O1K A;  4BXL A;  1KN7 A;  1FOS E;  2P7J A;  4E7S A;  1KYO E;  2YMY A;  2C5I T;  5ADX L;  5AVX B;  5CA1 E;  4I43 B;  3LW5 H;  1YQ4 C;  2W67 A;  4U3C A;  2VAS A;  4Y99 C;  3ZT6 A;  3AED A;  4NUV A;  2X51 A;  5LHH B;  5AVS B;  2XV5 A;  5TIS H;  3PUW F;  2UXB T;  2FFD B;  1JEK A;  4C7N B;  2WWU A;  2AXD S;  4GK5 E;  5FXW A;  4GIW A;  2YEV C;  2PAJ A;  5KJ7 A;  3G6E P;  2Q9Q A;  3HI2 A;  3GMA A;  4ASK A;  2UUA T;  1HFA A;  4GKG A;  3HE5 B;  3C1L A;  1A02 F;  2LSJ A; 
#chains in the Genus database with same CATH homology
 3HRN A;  1D1C A;  4QXB B;  1E5W A;  4I50 E;  1G73 A;  3Q2M A;  5FXV A;  4IE7 A;  1JCC A;  5KJ7 D;  4GK0 E;  2CA5 A;  2Q9Q D;  5J2T E;  3HKD E;  1NTZ K;  2FFD C;  4EYY R;  3CX6 B;  3E22 E;  3WAJ A;  3V2R A;  5JDF A;  1NO4 A;  3M06 A;  5CMZ A;  1QL2 A;  2LEH A;  2M8R A;  4ZI3 D;  3SRZ A;  2K9A A;  2X0L B;  3VOP A;  4IIJ E;  1SFC B;  2H8P D;  2ZM8 A;  2RA1 A;  4JYB A;  2XAF B;  1T98 A;  2IFM A;  1KQL A;  5L2L A;  1UX4 A;  2NP9 A;  1GW3 A;  3V2P A;  3KV9 A;  1KZU B;  4E7Z A;  3OKQ A;  4C7N A;  2KWH A;  5LYJ E;  5CCG C;  3O1H A;  4AI6 A;  4IST A;  3VMZ A;  4AQR D;  2IC6 A;  5AVU B;  3HE5 A;  2J59 M;  2CWO A;  4WBN E;  3II6 A;  1EZ3 A;  4ZI7 E;  5A1L A;  4BJM A;  1SFC C;  4KUM B;  4G63 A;  2ODV A;  2QM8 A;  1FMV A;  3M9B A;  2CM0 A;  3KVA A;  5FY0 A;  1J1E B;  4QKN A;  3N9O A;  4YHJ A;  2VKH A;  5CCG A;  3HE4 B;  2WPR A;  4DO0 A;  3EUH A;  4O4L E;  5M4Y A;  2B1E A;  5FY1 A;  1FZE A;  3U1A A;  1V9D A;  2N2N A;  2IX7 C;  2XUE A;  1D1A A;  2X68 A;  3I9W A;  4WNK A;  1SFC A;  3L36 A;  5H6Q B;  3NMD A;  4HTE A;  2WSE H;  2YKP A;  3N2O A;  1FJP A;  2Z5H A;  2WSC H;  2WSS V;  3IR9 A;  3M0D A;  1JUN A;  4JUY A;  3R2P A;  3TSI A;  1JY2 O;  3C64 A;  3NTN A;  4OHF A;  1JY3 O;  1WRD A;  3CQX C;  3SWY A;  1FMW A;  5LNK A;  2LSY A;  2LKM A;  2QGS A;  1GDT A;  4YFS A;  3I0O A;  2GUV A;  3C4Z A;  1MIY A;  3E08 A;  5FYM A;  3B57 A;  4H9P C;  1LWU B;  1DEB A;  2ZMA A;  4BA9 A;  4EAH A;  1LTA C;  3KV4 A;  5HXH A;  1MMD A;  1LTT C;  5CCH C;  2A45 I;  4UXN B;  2E9X D;  4YJ3 E;  2WBL A;  4O9B A;  1WR6 A;  2QA7 A;  1WYC A;  3HR0 A;  5KDM C;  5EZY E;  5FXZ A;  5FMN A;  1RE4 C;  1D1B A;  3BQI A;  1JOC A;  3B8E B;  3ZJ1 A;  5AW9 B;  2ZLY A;  3FXD B;  2L8K A;  4PJL A;  3VKG A;  1DX7 A;  1Z0P A;  3K8P C;  5JDL A;  4IGU A;  3L3P A;  1N7S B;  3UUX B;  3MXZ A;  2C0W A;  1MV8 A;  5CCH A;  2W6B A;  5HWX A;  2HFE D;  1SVF A;  4XA4 A;  3QK6 A;  2GUS A;  2RP4 A;  4PK4 A;  2DHR A;  4CXX A;  5JRC B;  3PUR A;  2KMF A;  1RE4 A;  2Q7C A;  1IFI A;  3HA4 A;  3CX7 B;  2A72 A;  1MNE A;  2WMN A;  1RY3 A;  3GHG B;  2MBG A;  1LWU A;  4V1A v;  3GWH A;  3LK4 2;  3ETU A;  5AW5 B;  1SQB K;  2FYU K;  1GU5 A;  2PJQ A;  2ODU A;  2N9D A;  4H9N C;  3KV5 A;  4GIF A;  3ZMU B;  2XAQ B;  4YJ2 E;  2JMH A;  5DJQ C;  4HKA A;  2I1K A;  3B13 A;  4EB6 E;  4CQI A;  5AVT B;  1FZF A;  3U3I A;  3P7I A;  1VOM A;  3GHG C;  2PP6 A;  5HXS A;  1D0X A;  1LRZ A;  3VHL A;  2W63 A;  3PUQ A;  2IC9 A;  1GK4 A;  1L4A B;  1N7S A;  1NHL A;  3ANW B;  3JC6 D;  4CI2 B;  1VRB A;  1YD8 G;  3N9Q A;  4N78 D;  5L3F B;  1H89 A;  3P8C E;  3SOL A;  5IYZ E;  1KIL C;  4ZKP A;  5L3C B;  4JEU B;  3BK9 A;  5LJM A;  5JRC A;  4I1L A;  4WW0 A;  2O01 H;  3ZYK A;  5APY A;  4AKH A;  3GHG A;  5JDQ A;  5L3G B;  2C9L Y;  2CXD A;  1L4A C;  1GW4 A;  3RK3 C;  4EIW A;  4HN9 A;  4L5G A;  1T2K D;  2ACX A;  4C7R A;  3Q5W A;  4WBO A;  2H7O A;  3CML A;  1RF1 B;  5JRE A;  1H7C A;  1LVF A;  3OYZ A;  1S9K D;  1LT9 B;  3WI3 A;  3P7K A;  1T3U A;  5APU A;  2CE7 A;  5LGN B;  1L4A A;  2Z6E A;  2PBI A;  3V5S A;  3ANW A;  4P0A A;  3RK2 C;  4TZ4 C;  3NXS A;  2L5G B;  5JQG E;  3U1C A;  3VP8 A;  3CKD A;  1X79 B;  3ZN0 B;  2MTQ A;  4AYC A;  3PTR B;  3I9Y A;  1OWA A;  1LTJ B;  3TNU B;  5AVQ B;  3O4X E;  4DVD A;  1LT9 C;  1HGZ A;  2J1D G;  1MMA A;  1XTC C;  4KMC A;  1RE3 C;  2NPS D;  3H32 B;  5JVD E;  1IO4 A;  3NZQ A;  4OK0 A;  1MMN A;  3F57 A;  2C5K T;  4O8S A;  2HG5 D;  1L0L K;  1NOH A;  2L3L A;  3FBL A;  2V7J A;  4DBR A;  4MAL A;  4PK5 A;  4H63 V;  1N2D C;  2CMR A;  2JJ9 A;  1JY2 P;  1RF1 A;  5F8P A;  1LTJ C;  3LK3 B;  5HXC A;  3RKO A;  3L37 A;  2NOX A;  4UEL A;  3B5N D;  2LM9 A;  3AVS A;  4IE6 A;  1LT9 A;  1SQP K;  3VN0 A;  1IFN A;  3OAK A;  1G2C B;  3PP5 A;  1RE3 A;  3RRW A;  5CHX A;  4XZC A;  3AAE B;  3NRY A;  4A56 A;  1AQ5 A;  4I4T E;  3HUS A;  5LJN A;  4X1I E;  3L35 A;  3CQC B;  5JDN A;  3T8O A;  5AW3 B;  1X79 A;  3RRC A;  3EVY A;  2PFV A;  1AFO A;  3N9L A;  3R84 B;  2WWW A;  2NTX A;  3H32 A;  3N9M A;  1X8Y A;  2GK9 A;  3C98 B;  4GOU A;  2EHO B;  5DAB A;  4IE4 A;  3DP7 A;  5DQW A;  2CPS A;  4IFM A;  2W27 A;  2HYN A;  3UUM A;  2XZR A;  3ZMZ B;  1JO5 A;  3WAK A;  2Y6X A;  1FZC B;  3HKB E;  4MBQ A;  2OYH B;  3BQL A;  1HCI A;  1FBM A;  4GYR A;  4TX5 A;  3Q5X A;  2P67 A;  4ZI2 C;  1G2C A;  5L3B B;  3VU7 H;  1CZQ A;  2KSJ A;  2Q5U A;  2EHO C;  2ZFC A;  1EQ7 A;  1ZN5 A;  5JDM A;  2CWY A;  2YIN A;  3J7Y q;  4ANJ A;  1LTS C;  1N86 A;  3VMY A;  1FZC C;  2R3C A;  1J1D C;  4HEA A;  4BJN A;  4PFP A;  5EK4 A;  1WT6 A;  4XE5 B;  2OYH C;  3TK1 A;  2WTY A;  3HTK A;  1GL2 B;  2NTY A;  1GD2 E;  4AKI A;  3MGN A;  2V7L A;  4UVB B;  5APW A;  4LC1 A;  1RF0 C;  2KZ7 B;  2SPC A;  1HG2 A;  4EIJ A;  3H3A A;  3VTP C;  1FZC A;  2FFD A;  3N2K E;  3QUJ A;  2LSG A;  3SWH A;  3O9X A;  3CL3 D;  2D0U A;  4MHC A;  1VPC A;  3RYF E;  1KK7 A;  5AW1 B;  3ESL A;  2W0G A;  1GL2 C;  5CJ4 A;  3NFQ A;  1D0Z A;  2E42 A;  1SQQ K;  5HWY A;  3K3N A;  5BMV E;  4OYJ A;  2P2U A;  4X20 E;  1RF0 A;  5HXR A;  2MYS A;  2VK9 A;  5IHY A;  5APS A;  5TAO A;  3VMX A;  3BVH A;  2JQQ A;  3H6P A;  2FYZ A;  2X67 A;  3CLQ A;  2NW9 A;  3PUG A;  1ZHC A;  5J1G A;  2KYV A;  3I0Q A;  4MLK A;  3Q9D A;  2YNY A;  1SLQ A;  1Y64 B;  2DCF A;  2M67 A;  3M91 A;  4CXW A;  5CCG D;  4L9I A;  4CXY A;  3T97 A;  2CLY B;  2WPS A;  3V2N A;  2W61 A;  3A5T A;  1WLX A;  3O8Z A;  3LJC A;  1SFC D;  3V4Q A;  2G0U A;  4GT1 A;  1FEW A;  1FIO A;  1GZL A;  4AUW A;  2H7H A;  2XAJ B;  2M3B A;  5LHG B;  2N9B A;  3H37 A;  4WB4 A;  5LOV E;  2H43 A;  3UIA A;  1N73 B;  4UF0 B;  3V5U A;  4BAY B;  3PDY A;  2WPQ A;  5GON E;  5AVR B;  2BDE A;  4C90 A;  3M65 A;  1HUC A;  3KBU A;  2CLY C;  1S35 A;  3ZEF B;  3N9N A;  2WZ7 A;  3OJA B;  1IFD A;  3ZMT B;  1HBW A;  1N7L A;  3HE4 A;  1MMG A;  3MK7 C;  1E1H B;  1NWQ A;  4UIG A;  5JH7 E;  3FB2 A;  3E1I A;  2YKQ A;  2WAU A;  1N73 C;  5F3J A;  5LP6 E;  4EZH A;  3N7N A;  2P9B A;  4PJN A;  2V7M A;  4QX7 B;  4ILU A;  1IJ6 A;  2KLV A;  2ZM2 A;  2CCQ A;  2GM4 A;  3J9X 1;  3EQ2 A;  1SP4 A;  3PUA A;  5BU8 B;  1YKH B;  2XAH B;  1IC2 A;  3CWZ B;  3AA6 B;  1JTH B;  3F2E A;  3FXE B;  2C9N Y;  1N73 A;  4UF0 A;  2XHE B;  2HOD B;  4H9R C;  5ETW A;  5CCH D;  5APT A;  3KV6 A;  3HD7 B;  5C8Y E;  3A3Y B;  3RC3 A;  4MFR A;  2JMK A;  1BR0 A;  1MUU A;  3BRT B;  3ZMS B;  4U74 A;  1HVV A;  4AQF C;  1T8Z A;  4RES B;  3OJA A;  1G1J A;  2UXX B;  3JC6 C;  3S4U A;  1NWM X;  1NH4 A;  1SQX K;  1S94 A;  3LIE A;  4M1P A;  1KIL B;  4HYT B;  4J2C A;  2XAG B;  3MKD A;  4EOZ B;  4H63 H;  1DH3 A;  1WRG A;  3HD7 C;  4P09 A;  4EOT A;  5AVV B;  2KOG A;  2UXN B;  2ZM0 A;  3KDS E;  4NUU A;  1CW5 A;  2D2S A;  3RK3 B;  2X66 A;  4F6R C;  1FZG A;  2LSK A;  1LKX A;  2OYI B;  1JTH A;  1LVK A;  3LFM A;  3CPZ A;  5APQ A;  2K48 A;  4C91 A;  2KB7 P;  2WM9 A;  4G2A A;  1N7S D;  4W7Y A;  4TUY E;  2HOD A;  1G1I A;  2N1T C;  3LK2 B;  5H6R B;  3HD7 A;  1ZLL A;  3MTU E;  2CEA A;  3A5X A;  2W6A A;  5LA6 E;  5JR9 C;  3SS1 A;  5FY7 A;  2LHN A;  3RYI E;  5APX A;  3AVR A;  4DZO A;  2IPP A;  2KXP B;  4I2L C;  3RK2 B;  5APV A;  2OYI C;  3RC8 A;  4WY4 B;  2NWB A;  1LTI C;  1KIL A;  4N78 E;  3G3Z A;  3AA1 B;  2V1D B;  1IK9 A;  3PUS A;  5AW7 B;  3V5B A;  2IFN A;  1YKE B;  4ERR A;  3CVR A;  5KX5 E;  5AFU L;  2QM7 A;  1URQ B;  4H9Q C;  1O3X A;  3ZN1 B;  5CA0 E;  3RL0 C;  1BR2 A;  4WY4 C;  3ZMV B;  1FZB A;  1PFI A;  2OYI A;  3I1A A;  5AVZ B;  4N3Y B;  4ZS2 A;  4P0B A;  3BQK A;  4QXC B;  2VB6 A;  2YU2 A;  1L4A D;  4M3L A;  5CB4 E;  2LE8 A;  4EXT A;  2OA5 A;  3GMI A;  4AQG A;  4CI1 B;  3K3O A;  1URQ C;  1GU4 A;  2WIT A;  2E43 A;  2ES0 A;  3MD0 A;  3AA7 B;  1G8X A;  4WY4 A;  2XU6 A;  4B86 A;  1UX5 A;  3HL6 A;  5BVZ A;  4I6M C;  3PU8 A;  2Y48 B;  1QUU A;  1HWT C;  2H7V C;  3UUL A;  4I55 E;  4ISS A;  2A45 H;  2K5B B;  2JJL A;  3AB3 B;  3L4F A;  1URQ A;  3AAI A;  3RYH E;  2X9X A;  1HS7 A;  3I5C A;  4JEH B;  4HGA A;  1GTW A;  1LTJ A;  3KVB A;  3TNU A;  1ZR4 A;  3GN5 B;  3ZC0 A;  3EDV A;  3VKH A;  5DQV A;  3AAA B;  2R32 A;  3MUD A;  1ZKE A;  1XTG B;  1KFN A;  4QXH B;  4DND A;  1HJB A;  5KJ7 C;  2Q9Q C;  1CSB A;  5AW8 B;  1IZN B;  2CPB A;  3MA9 A;  2D0T A;  2V26 A;  1J1D B;  4PW8 A;  4Z8X A;  2A45 G;  2KT9 A;  2LHR A;  2VKJ A;  3LBX B;  2VL8 A;  2BAS A;  4WBA A;  4ZI3 C;  1NU1 K;  2YKO A;  2YK0 A;  3M9H A;  2K24 A;  3U78 A;  4AXP A;  4IFD K;  3CX8 B;  4AKR B;  4H9O C;  1YTZ T;  1MFZ A;  3KBT A;  4KP3 C;  5BU5 A;  2W62 A;  2Q9I A;  2MJZ A;  1U5P A;  4HE8 A;  3OA7 A;  2LT3 A;  2H3R A;  1U4Q A;  1CI6 B;  2YO3 A;  4DBQ A;  3GN5 A;  5AW2 B;  3BRV B;  3F31 A;  2KWI B;  4IHJ E;  3R6N A;  2WT7 B;  4JLE A;  3A2A A;  3QC9 A;  2XQY A;  2EHO A;  2HLO A;  1T3J A;  5HYA A;  4U72 A;  2WMO A;  5LG4 A;  4ZHQ E;  3C4X A;  4ZI2 D;  5AW4 B;  1FDM A;  1KNZ A;  4CZZ B;  2VKD A;  2EHO D;  2OYH A;  1IFM A;  2LOS A;  3LBX A;  1MIW A;  3ZCJ A;  3ZPO A;  1YYC A;  5AVY B;  4C46 A;  3NZP A;  4B6X A;  4TV8 E;  3M0A A;  2VKO A;  3UFE A;  1D0Y A;  1Z56 A;  2XNX A;  3O1I A;  2XKM A;  1LTB C;  3WMM 0;  4FJO A;  3OYX A;  4ZS3 A;  3BAT A;  1H8A A;  3MJX A;  2C5J A;  1IAP A;  2I59 A;  1SHZ C;  3ZYM A;  1MIV A;  3ZJ2 A;  2CXL A;  2E9X B;  4HH2 A;  3ZC1 A;  1CI6 A;  3P32 A;  4W80 A;  3L09 A;  1FZA A;  2DWG A;  3ONX A;  2A2F X;  2XAS B;  1GL2 A;  3C9I A;  2WT7 A;  3M0D C;  3MAC A;  2Z5I A;  4H9S E;  2KND A;  3EDU A;  3FHN A;  4AKL A;  4DOJ A;  2O1J A;  3W15 B;  2J58 A;  1MND A;  5LBQ B;  2FKW B;  4O4H E;  5KMG P;  3U59 A;  1GK6 A;  1FAV A;  1GL2 D;  3EFG A;  3C51 A;  2D5U A;  5AW6 B;  2E9X C;  3V2Q A;  4YLH A;  2FXM A;  1J1E C;  3DTO A;  2DI4 A;  1QL1 A;  4PJM A;  1WYB A;  4JF7 A;  5AW0 B;  2YU1 A;  1US7 B;  1LGH B;  5LXT E;  2MOZ A;  1J2J B;  2JEE A;  1M7L A;  3LID A;  1HTL C;  2XTL A;  2E9X A;  3VYI A;  1FOS F;  3MIW A;  5LGU B;  1A02 J;  1ZR2 A;  1ZV8 A;  3KYQ A;  3E0Z A;  3N4X A;  1SQV K;  2WSF H;  1NTK K;  3IFM A;  1MZ9 A;  3DJB A;  1JNM A;  2HPL A;  4PK6 A;  2R5D A;  4X1K E;  4IDZ A;  1JY2 N;  3IBP A;  2DNX A;  3UTK A;  3RH3 A;  1HF8 A;  4OH8 B;  3KFW X;  1JY3 N;  4ZOL E;  3AA0 B;  3UT5 E;  5LHI B;  5AVW B;  1LWU C;  2DLR A;  2Q3I A;  2JPF A;  4FI5 A;  1HTJ F;  5J2U E;  2X9W A;  5LCY A;  5EK3 A;  4QHO A;  4ADZ A;  1L0N K;  4W7Z A;  5HAX A;  5HXE A;  3TKL B;  5FXX A;  3FBZ A;  3KQG A;  4PFO A;  1M1J B;  2X9Y A;  3ZYL A;  4EYU A;  4JYC A;  3C50 A;  4AKG A;  2IAK A;  5LBM A;  1UCU A;  2R5B A;  1N7S C;  1H88 A;  5FNV E;  4HFV A;  2KP8 A;  3RYC E;  2N1T B;  2V7K A;  4QX8 B;  4PJJ A;  3P8C D;  2BVL A;  4X1Y E;  2C0S A;  3IEE A;  3O1J A;  3IHR A;  4O2A E;  4AQF A;  5JR9 B;  4EZ4 A;  1T2K C;  1M1J C;  2LSI A;  4UVA B;  3UUN A;  2V7I A;  3CQG B;  1BR4 A;  4PAG A;  3N2G E;  3C4W A;  4XAX B;  1HGV A;  4UVC B;  1W2E A;  2NPS B;  2LJL A;  5KTB A;  1HH0 A;  2KIN B;  1YTZ I;  3MZK B;  4KHX A;  3N5L A;  1JMM A;  5EK2 A;  2VRS A;  2E8I A;  3BAS A;  4IE5 A;  2VWA A;  3RL0 B;  1M1J A;  3HD7 D;  3P8M C;  1X9V A;  3N9P A;  1FJK A;  4GYS A;  3HKC E;  1IJD B;  2HPJ A;  4O4J E;  3B5N B;  2N1T A;  5KLV K;  2L9Q A;  1NKN A;  4L0R A;  2NPS C;  2ZXE B;  4ZKU A;  1JCD A;  1KIL D;  5L3D B;  4OFZ A;  1YW0 A;  2N1G A;  5JR9 A;  5L3E B;  3A7O A;  4O2B E;  3HKE E;  3RX6 A;  2LOP A;  1NKZ B;  2N1T D;  4IFF A;  4CI3 B;  2NW7 A;  1VDF A;  2JRK A;  3NBX X;  3K3Q C;  3ZCI A;  4QWN B;  1HG5 A;  3B5N C;  3RK3 D;  4KBM B;  1CUN A;  2HPC B;  2CXF A;  2X9H A;  1SA0 E;  4TV9 E;  3HUS B;  5LGT B;  3TYY A;  3V4W A;  1B7T A;  1LTG C;  1S9K E;  2NPS A;  1RF1 C;  3CI9 A;  3VP9 A;  2BZB A;  1AJ3 A;  2XDJ A;  3GA8 A;  3D0T A;  1OXZ A;  3KPE A;  3NRX A;  2P1J A;  3ETV A;  2PG8 A;  3KDP B;  5FP3 A;  3ZLI A;  2C0X A;  4TN7 B;  3B5N A;  1ZEE A;  3HUS C;  2KLQ A;  3RL0 D;  1ZV4 X;  3RK2 D;  3PU3 A;  4WY4 D;  3RPU A;  1IJ5 A;  5CJ0 A;  4IE0 A;  4UV9 B;  2DWK A;  2YO2 A;  4DMW A;  5JDG A;  3SWF A;  4O4I E;  4LGD E;  2A3D A;  2NW8 A;  3PE0 A;  1JY3 P;  1IFJ A;  3IF8 B;  2Q9Q B;  4K0U A;  2POH A;  4N6J A;  3M9Q A;  4LLH A;  3LG7 A;  1URQ D;  1QSD A;  2Z4E A;  3KIN B;  5E0O A;  5JDH A;  4PNI A;  2W00 A;  2HPC A;  4OYK A;  2IW5 B;  4DMV A;  2HH7 A;  2BVM A;  4Y99 B;  3OBV E;  1NTM K;  2OAR A;  1HX8 A;  1FU1 A;  2I1J A;  1BR1 A;  4XBF B;  4UEM A;  1KFM A;  2Y8D A;  3HTK B;  4UV8 B;  1NAF A;  2O1K A;  1FOS E;  2P7J A;  4E7S A;  2YMY A;  2C5I T;  5ADX L;  5AVX B;  5CA1 E;  4I43 B;  3LW5 H;  2VAS A;  4Y99 C;  4NUV A;  2X51 A;  5LHH B;  5AVS B;  2XV5 A;  2FFD B;  4C7N B;  2WWU A;  4GK5 E;  5FXW A;  4GIW A;  2YEV C;  2PAJ A;  5KJ7 A;  2Q9Q A;  3HI2 A;  4ASK A;  1HFA A;  4GKG A;  3HE5 B;  1A02 F;  2LSJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...