1OXZA

Crystal structure of the human gga1 gat domain
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
132
structure length
132
Chain Sequence
DEEKSKMLARLLKSSHPEDLRAANKLIKEMVQEDQKRMEKISKRVNAIEEVNNNVKLLTEMVMSHSQGGAAAGSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEILQANDNLTQVINLYKQLVRGEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADP-ribosylation factor binding protein GGA1
publication title Crystal Structure of Human GGA1 GAT Domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 51
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03127 GAT GAT domain
A PF18308 GGA_N-GAT GGA N-GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1oxzA01
1.20.58.160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1oxzA02
1CI6B 5AVTB 2E43A 3L37A 2IPPA 3TYYA 2QM8A 3M0AA 1A02J 3A7OA 2QM7A 5APVA 5AVYB 1S9KE 2BASA 3M06A 3VMXA 2WPQA 3VMZA 3HE4A 5AVXB 3VYIA 3A5TA 2WPSA 3OAKA 5AW8B 5AVUB 1OWAA 3HE5B 2Q7CA 3M91A 3MD0A 2XZRA 1T2KD 2R5DA 4AYCA 1X8YA 1GK4A 4RESB 5AW6B 4B86A 3P7KA 2N9BA 2JJLA 1CSBA 3TK1A 1S9KD 5APTA 4JYBA 1SP4A 5AW5B 3SWFA 5CMZA 5APWA 2WPRA 1OXZA 5APYA 2Z5HA 2XU6A 5AVRB 1JNMA 2N9DA 5APSA 2Z5IA 3NTNA 1HWTC 2Q3IA 4DZOA 1H88A 2Q5UA 3A3YB 4XE5B 1DH3A 1H8AA 3VTPC 5AVZB 1G2CB 1KQLA 3NMDA 3LIDA 1MFZA 3M0DA 4C7NA 1WR6A 4C46A 1H89A 1MUUA 3V5BA 3A2AA 2YO3A 3V4QA 4M3LA 1T2KC 1O3XA 2WT7A 2P7JA 2R32A 3KQGA 4LC1A 2P67A 5AW3B 1MV8A 1IO4A 1JUNA 3NFQA 5AW7B 4KHXA 2H7HA 1GTWA 3P32A 3O8ZA 2E42A 1GU4A 1FOSE 1X79A 5AVSB 2WTYA 3B8EB 3VMYA 3LIEA 1GU5A 5AVWB 2ZFCA 4GKGA 3P8MC 2N2NA 3V4WA 3HE4B 1HJBA 5APXA 2R3CA 1NWMX 4AUWA 3L35A 3HTKA 2YO2A 3VN0A 2XV5A 1FAVA 2ZXEB 1A02F 3TNUA 1YYCA 5AW1B 1WRDA 1GD2E 1GZLA 5AVVB 2WT7B 2VRSA 1CI6A 5AVQB 2R5BA 2WWWA 1NAFA 3M9BA 4AQRD 3IR9A 3I5CA 1HUCA 1FOSF 3M9HA 5AW4B 4HYTB 1SLQA 4I2LC 1J2JB 3MGNA 5AW2B 2P2UA 1NWQA 2C9LY 3NXSA 5AW9B 3KDPB 1HBWA 2KP8A 3HE5A 4I6MC 5APQA 1CZQA 2YNYA 5AW0B 2C9NY 3T97A 2W6AA 4C7NB 1YD8G 3UIAA 5APUA 1GK6A 3TNUB 4GT1A 4EOTA 2W27A 3L36A 4JYCA
chains in the Genus database with same CATH superfamily
3SSUA 1S5LH 5GTIH 3EAMA 1S72P 2RH0A 1ZOYA 1LTTC 3FZMB 3VMXA 3VMZA 4AKRB 2IBZI 1ZHCA 3HL6A 3ZKRA 2K3WA 5AW8B 2WVRA 3N9MA 3PURA 2KUBA 2M8RA 3S9OA 4QX8B 3A7MA 3PUVF 4YTPC 3V2QA 1W0AA 3MXZA 4WY4B 2Z5HA 2K9AA 2B88A 3JADA 4DR5T 1T8ZA 2IBZE 3BK9A 2CK3H 1L0LD 4DZOA 5BMVE 3H1HG 3KPEA 2KNCB 1IFMA 3NMDA 3H6PA 2FYUG 4O4LE 4C7NA 5TAOA 3RF1A 2WZIA 2E2AA 5EK2A 2KOGA 2WMOA 3PJAJ 4TNVA 1FDIA 1JMMA 5ADXL 3QK6A 3C9IA 2XASB 3RYHE 4C7RA 1ZP0A 1ZV4X 3HD7C 1E2AA 4ZKPA 3UU6A 3O9XA 5FXWA 1YITP 4RKUJ 1GL2C 2EHOB 3LBXB 4DVDA 4ILBA 1XNQT 5AQTB 4O4HE 3GF3A 1IFNA 3FGAD 1T8BA 4XAXB 3GHGB 3L73E 4WBOA 4ZI3D 2CHNA 1KNZA 2RA1A 1SFCD 4IFDK 1LTJA 2JWAA 1FDOA 2QSIA 3L71G 2XDJA 4DV1T 2C5JA 5KJ7D 5AVVB 5KLIC 2LR2A 2I6HA 1TU3F 1QL1A 4YTMA 5L3EB 4YT0A 2XUEA 3RC3A 3AECC 3KV5A 3S1KA 4PJMA 1HUCA 3Q5WA 2RPAA 1T3JA 5C2TA 2AXDS 3ABVA 4I2LC 1D1CA 4DBRA 4Z8XA 1HTJF 2CXDA 1USEA 3KDSE 3SRZA 3DJBA 1LNQA 2AXTH 5APQA 2QIWA 3H1LJ 3AE2A 3HKDE 3GG2A 3MKDA 4JI6T 2VKHA 1HNXT 1GK6A 1S5LE 2KIKA 4LF6T 3UIAA 3CVRA 4J2CA 5GTIE 3L74G 1LTAC 1HJ0A 4OX9T 2H88A 1HNWT 1NH4A 4YPCA 3I9YA 2NPSA 2IW5B 4DCKA 2BVLA 2XNDH 4X20E 2UUAT 3HE5B 4X65T 2ACXA 4PV1B 1CSBA 3AE4A 3V5SA 3B13A 1IK7A 5CMZA 5CFBA 4TWDA 5KLVK 3N2KE 1L0NK 4PFPA 1G8XA 3H3AA 2Y0EA 2Z5IA 1N36T 5CCGD 3HRNA 1M62A 1H8AA 5LB7B 3FBLA 1NTKK 2DW3A 5AVZB 5LNKA 5M4YA 3CMLA 3SFEC 3AEDA 3AVSA 2FXPA 3V5BA 3A2AA 1SQPE 4LFCT 1SQVD 3KXDA 1KNRA 3K5BA 2QA7A 5KXJA 2FYNC 4QHOA 3H37A 4LC1A 4JI0T 1MNDA 3CCJP 1ZXGA 2XAQB 1CUNA 3L72D 3B8EB 1SQPD 4O2AE 1J5WA 4DR1T 3CX5D 3AEAC 1BR2A 1HJBA 2JEEA 5FL0A 3RIUC 5J2UE 2B87A 1NWMX 3BATA 5JR9A 3H1LG 3R84B 5L4EA 4BXLA 3RL0g 5KAIH 2SPCA 1ZRTD 3JC6D 4JV5T 1EDIA 4JYAT 1UGOA 2CXLA 2JDIH 3PUZF 3VKHA 2FBWC 5AW4B 1YTZI 2V7IA 3DTOA 3TGUE 2AXTE 2LXCB 2BG9A 2XQAA 2DLRA 3L75E 3VR8A 3CCMP 3HD7B 3VRBA 4D6TD 2BKPA 2Q9QD 3AE9A 1YBKA 3UUMA 2CPSA 2WSFH 1GL2B 3KVBA 4EZ4A 3TGUD 3E1RA 1FJGT 4NUUA 1U5PA 4EZHA 3L75D 3ONJA 3U59A 1KZUB 1PL5A 5TJHA 3MZKB 4OYJA 2XQYA 4X5TA 3FXEB 3GWHA 4Z1MH 4CN1A 3MZWB 4KHZF 1N7SC 2XZEA 3KV6A 4I43B 5IUXA 2DWGA 5CCHD 4DV4T 5KLIB 2Q7CA 2E9XC 4AKIA 4DV3T 1NKZB 1VPCA 2MJZA 2E75C 3V2PA 2C5IT 1NTMK 4JBWF 1XNRT 2GUSA 2X9YA 5APWA 2CEAA 5LMUT 4PAGA 5KLVE 4X1KE 1ZKEA 4DR7T 2MPKA 2KYVA 3B5NA 4L9IA 2QGSA 5KLVJ 2YIUC 4DOJA 1JY3P 3ESLA 1L0NJ 3N9OA 1WYCA 4OH8B 1AJ3A 2HH7A 1RQUA 4ZOLE 2HN1A 3TSIA 1NTKJ 3CX8B 4U31A 1BE3D 1E7PA 1SQQD 4K35A 2DWKA 5AQLB 1W09A 2W00A 1M1JA 2LSKA 4H0LC 4UVAB 3H1JE 2E42A 1VQKP 3CX7B 3Q9DA 1KQFB 2JR8A 2XM1A 2Z6EA 2ZM0A 2N1TB 1VQ4P 2RMZA 4WYVA 1RF1C 2YOEA 1MIWA 4BJNA 2OTLP 2SPZA 3Q2YA 5HXEA 3HTKA 2D5UA 3N2OA 2V5CA 1EZ3A 3PUSA 5JDQA 2ZM6T 2XSBA 4DIDB 1NGMB 3ZT7A 3O1IA 4IREA 1S94A 4JI8T 2NZ2A 5FL1A 1AVYA 1BCCD 3R4YA 4OGQC 1B7TA 4HWIB 3MGNA 2WITA 2JIWA 4Z91A 3RRWA 5HEUA 2CPTA 2FYNB 1Q90D 3CXHH 3M65A 2LXBA 2CMRA 1OEDA 1PPJD 2V8SV 1YTZT 1KORA 2UUBT 3TNUB 4IDPA 2WSFJ 1FIOA 3QB5K 1QEXA 2D2CD 4QH4A 3F2EA 1MMDA 5AVYB 2LOSA 2B89A 4O2BE 2WU2A 2XQ4A 5FXZA 2J62A 3IA3A 1IFPA 3RKGA 2M6BA 4ADZA 1X79B 3GN5A 4U7JA 1J1JA 3L39A 3HE4A 1DEEG 3HUSA 3OKQA 4HKAA 4UB6H 5KLVG 4N3YB 3TF5A 2W67A 4ZMDA 3A0BE 1L0NG 4NPFX 3IAOA 5F3JA 1MMAA 2K48A 1YW0A 4H44D 1KTMA 1PP9D 2Y6XA 1BGYE 2K9JB 4EYYR 2OYIC 4MALA 4X66T 1NTKG 4KT0J 2W6BA 1HGVA 3QWOC 1NTZE 2ZYGA 2KLUA 4ILAA 3RPUA 1OXZA 1LJ2A 4EYYQ 5J1GA 4UB8H 2FFDA 2UXBT 3RBZA 1NTMJ 2N9DA 4A5XA 3Q1MA 1W9RA 5L8RJ 4DR6T 3LDQB 2BBHA 2BBJA 4L5GA 2WSCH 3ZN0B 3HKCE 2Y9ZA 2F4VT 4CXWA 4OHFA 3OPCA 1R8IA 1WR6A 1BSHA 2UWJE 2LT3A 3ANWA 5J0ZA 5LGNB 3JC22 2VVNA 1EZVD 1VQ5P 4AQYT 2WT7A 3P4RA 1VL2A 2KSRA 3BCCD 3NBXX 2JQ9A 3RGLA 4WZXA 3CCLP 3IEEA 3ZMSB 2BEZF 5LP6E 1P84I 2I0MA 1N7SB 5AVSB 4H9RC 5GONE 4KP3C 3RYIE 5AFUL 2UU9T 3P7IA 5HEGA 4ZXLA 2E9XB 4W7ZA 2CLYB 3AEFA 4AQGA 3CPWO 3USSA 2E75B 2WDVA 1KB9D 3LK2B 4AUWA 2YO2A 4P09A 1BDCA 1SFCC 3L70E 2CBJA 1MNEA 2G3AA 1YYCA 1QL2A 1DIPA 4IIJE 3AEGC 1H7CA 1P84E 5KJ7C 2WAUA 2J5UA 2M5AA 3A8YC 1N33T 2YIUB 5CCGA 2KZ7B 1KEYA 4IDOA 1LWUC 3UUXB 1IBKT 3L70D 3RBXA 4ILCA 3KZIH 3I55P 2H7OA 1WR0A 2YN6A 1P84D 4I6MC 4H0LB 2NPSD 3AAAB 2M0BA 1I6ZA 5KMGP 3MA9A 4IDQA 2AEMA 2LKHA 2NW7A 2JO1A 4L76A 4Z90A 1JTHA 1VF5D 4H9SE 5CJ4A 4HJGH 4JF7A 5CBNA 2X0LB 4IE6A 2O01N 2XQ3A 2WY2A 4EYUA 4GKKT 1RF1B 1NOHA 1YIJP 2KK7A 1NTMG 4NIQA 1H0TA 4EB6E 4UB6E 1FZCC 1E79H 4GIFA 3AA6B 4IOIH 1HG5A 1RHZB 3II6A 4PFOA 1JCCA 1FBMA 2O01J 3I1AA 4B86A 5HEOA 1N73B 3AE3C 2KWIB 5C39A 3VHLA 5BVZA 3RKOA 2WDQA 4OGQB 4B6XA 3N2GE 4KI0F 1VQPP 4UV9B 1WCRA 3RH3A 2QA4P 4AKHA 2ZT9C 1EQ7A 5AQQB 3NTNA 2R3SA 1VQLP 1MMNA 1HS7A 1T6AA 3AEEC 4I55E 1IBMT 2KMFA 3Q5PA 4DBQA 2VB6A 3M0DA 5F8PA 2WSCJ 1SQBE 5J2TE 2XQ6A 1AA0A 1VRBA 1L0LK 1YKEB 2CWYA 3V4QA 4P0AA 2WQYC 5L2LA 1FDMA 5M1BA 3W68A 2V6YB 5LCYA 1LT9C 2NW8A 3KQGA 3IHRA 2A72A 3B57A 2W62A 3N4XA 4U3FJ 1LVKA 1GTWA 3CWBG 3P4QA 2BG9E 2OYHB 2Q6QA 3TLVA 2A2FX 5FY1A 4C91A 3NKZA 5FY0A 5JQGE 2A06G 4UR9A 1OZHA 3Q5DA 1FC2C 5HCJA 4DV6T 1X0TA 2GK9A 3UU8A 1HR0T 1XDOA 2DHRA 4UF0B 3H1IE 1US7B 1Z8UA 1VQ6P 1XMOT 2A45I 1WRDA 1VQ7P 3EHZA 5LOVE 3H1IJ 3ZEFB 4XBFB 1NAFA 4COFA 2IX7C 1YI2P 4KHPT 3KZIE 2E5LT 4ISTA 1YJ9P 1USDA 1KFYA 3AEBA 3AXJA 2ZVOB 2JJ9A 5AW2B 5KTBA 3RX6A 4YHJA 3LK42 1L4AD 5IYZE 2E74D 3C4WA 2Q9QC 5APUA 3CMAP 4JI1T 1X9BA 3SFDA 3E1IA 5ABFB 4PK5A 2LLYA 2YDSA 1URQC 1GW3A 3UQ4A 4PJNA 3M06A 5AQUB 3H1HD 2WMNA 4ZI2D 5AVUB 2FYUD 5LGTB 1T2KD 1JB0J 2OARA 1S4XA 1MIYA 2QJKC 3BASA 4TUYE 3L4FA 2XAGB 5JDNA 4HE8A 3KINB 1LWUB 5L47A 2LM2A 2M3BA 1M1KQ 1X22A 2KSEA 4PD4D 1G73A 3PUXF 1JO5A 4TNWA 5L3FB 5HWXA 1S2EA 4U3FG 2LHRA 5EK3A 5APSA 2Y48B 2KINB 3MK7C 2V7QJ 1HNZT 1HWTC 2X51A 1SA0E 4PJJA 4P1NA 2ZYAA 4U7IA 3ZSTA 1Z56A 5CBOA 3O6QA 4DUYT 2KS1B 1IFIA 4HB1A 1MFZA 2OTJP 3KBUA 1FZGA 3KBTA 1KILD 3CLQA 1L0LE 3AE8A 2W6JH 2VL8A 2W66A 3GA8A 4DR3T 3H3MA 3RL0C 3QOFA 4AQFC 4NXMT 1ZMEC 2P1JA 1FZCB 1L0VA 1L0LJ 2BCCD 4OFZA 3GF7A 1GU4A 2NR4A 3VKGA 5HXCA 3CC4P 2JQKA 3KYQA 4DV2T 3LIEA 3AA0B 4R4LA 4YY3T 2JPFA 3FB2A 1OEDE 2D0TA 1RE4C 4EV6A 1MZ9A 2QJPC 4PJ0H 5LXTE 4L73A 2L91A 2UXCT 1SQPK 5EFWB 2ZT9B 2CCQA 4HKZH 4G2AA 2YMYA 3CX5H 1CI6A 2FXOA 3PUAA 3L74D 2V1DB 2LRKA 5AQGB 3VMAA 3RK3D 2CBIA 2GM4A 3U1CA 3IF8B 1ZOYC 2FXMA 1LT9B 4IE7A 5LJMA 3T97A 4YXWH 3PE0A 3ZMUB 5ETWA 4GK0E 2VKDA 3L73J 2X66A 2Y0CA 4GT1A 2HPCB 4HFDA 3JAEA 3L8RA 2Y9YA 5DJUB 3C51A 4CZZB 2B76A 3L37A 4OK0A 3OJAB 1A02J 2D2CC 2QM7A 3C4ZA 3ZN1B 4YSYA 2N1TA 2PJQA 4HFHA 1JM0A 1KK7A 1M90Q 2D0UA 2YEVC 1R8EA 2UXNB 1HG2A 2WU5A 1FJPA 1OW6A 4LF9T 1QVGO 5AQHB 3IN6A 2HODB 4A97A 1GK4A 4GDOA 2W63A 4ZZCA 3MACA 5FP3A 2KNDA 1U7JA 2XU6A 1ZP0C 3F31A 1E1HB 5L4HA 1H88A 1DH3A 1LTBC 2VVSA 3H1KE 3MJXA 1AVOA 4WVZA 2LE8A 2W83C 1H89A 3CC2P 2WDRA 2IBZG 2YO3A 3H1LD 1XTGB 1URQB 1KQSO 4H13B 3CX5I 3H1KD 1LTJC 2LSJA 3OVUA 3L3PA 3RIUA 1M57D 2PAJA 3P32A 4WY4D 1T72A 1X79A 1SQVE 3AB3B 1D0ZA 3VMYA 1IJ6A 2V7MA 3E08A 4U7YA 4PJ0E 3PU8A 4EGWA 2O3JA 4U2ZA 1SQVJ 5APXA 1YQ3A 2R3CA 4JI4T 2KZIA 2ZM2A 3ABVC 2ZXEB 4DT0A 3L72E 5HEJA 4LF5T 2G8YA 3C98B 1U57A 3CX5E 3L73G 3N7NA 3AE2C 3CI9A 5AQVB 1HFAA 5AQIB 3RC8A 1RE3A 4YXDA 1SQPJ 4QH5A 2MYSA 1JCDA 2EHOD 1JY2P 4HTEA 3RYFE 3AE6A 2QE7H 1ZRTE 4ZKUA 1LT1A 2IZ0A 3H32B 3ZC1A 3I56P 5AW0B 2C9NY 2H88C 3PP5A 3RL0B 2WWVA 3V5UA 4YFSA 2BZBA 3WMM0 3TLSA 4ISSA 2NPSC 1VQMP 5JDFA 4RO0A 2J1DG 4JYCA 4TWFA 4EIJA 2IPPA 2CRBA 4BA9A 2VK9A 3AE4C 4PK6A 1FZBA 4D6TE 1G1JA 3UU5A 3AAEB 2IC9A 4BRYA 1G2CA 4D6TJ 3FXDB 1NJIQ 3JAFA 2P9BA 3AE1A 2NW9A 1BR4A 2XAJB 3A5XA 3NVOA 4AYCA 2FJBA 3TGUJ 4RESB 1QLED 4O4JE 3UFEA 2N9BA 2JJLA 4F6RC 3IBPA 3L75J 4GOUA 2B9BA 3Q3DA 5ABGA 2ZYDA 3AEDC 2X0HA 1UIIA 4CI3B 3P4PA 4AKGA 3B5MA 3N9NA 5L3GB 3LSVA 3OTOT 2K88A 3OYZA 1L4AA 1JY3O 3BRVB 1Q82Q 3GMAA 2HPJA 2HLOA 5C3JA 5TISH 3ZMTB 1MUUA 2JRKA 3A0BH 1S1CX 4PV1D 1NYHA 1RY3A 4Y28J 1NTZK 1OVRA 2E76C 5JR9C 2VQET 4KHXA 4PK4A 2MBGA 1SQPG 3RK2C 4YLHA 1BE3E 1SQQE 5JRCA 4EIWA 4JI3T 2X0YA 3N9QA 1J1EC 1OIPA 4CN6A 4AIUA 1LTGC 4NUVA 5AQSB 4O8SA 3OYXA 3ZYMA 1HGZA 1N73A 4C90A 1JOCA 2BG9C 3E0ZA 5AW1B 1EXIA 4P0BA 3ETVA 1XMQT 1GD2E 4IE4A 5B66H 1IAPA 3K1SA 5KKZC 2ODVA 2R5BA 3AE9C 2QEXP 2HYNA 2KB7P 4GOEA 3OBVE 4HWFA 1KB9H 2HG5D 1SLQA 3MP7B 3Q5XA 3H1JJ 2JQQA 3JCUE 3Q5SA 1KILA 3QH9A 4D6TG 1HBWA 4X64T 1IFDA 1BCCE 4DV0T 1L0ND 1NU1E 2W90A 2XJ7A 2E8IA 3TGUG 2E74C 2W2UA 3UU4A 3CCRP 1NTKD 1FZEA 3L75G 4FJOA 4CQIA 2OYHA 5A1LA 5KAFH 1P84H 1NU1D 1PPJE 1N86A 2HN2A 1WFDA 4HGAA 4YJ2E 2IYOA 1JEKA 3UUNA 4UF0A 3B5NC 2XZRA 1GW4A 2B1EA 3HD7D 1HX1B 3AA1B 2BS4A 1YQ4A 4JYBA 3AA7B 2L5GB 5JDLA 1NO4A 1GL2D 3I9WA 1X9VA 1RF0A 5CJ5A 4YJ3E 1OVVA 3V6IA 1M1JC 1PP9E 3O4XE 2XKMA 4TT3H 5L3CB 1KN7A 4K3AA 1EZVI 5TISE 3LIDA 1PP9J 4O4IE 5DABA 1N7LA 2FJDA 5AQPB 1U7MA 1YJNP 2W61A 1PGOA 3EVYA 3D71A 1QX8A 1OMIA 4ASVA 2GUVA 2PTFA 2P7JA 1FZFA 5AQRB 2V7KA 5ABFA 2YU2A 4JEUB 3TLUA 4PJLA 3CPZA 1BGYJ 3X1DA 1KD1Q 2VKJA 1KNPA 4B3ST 4I7ZC 4LFBT 1KB9I 1W0BA 1BDDA 1NTZJ 1EZVE 1WMKA 1UURA 1SQXD 2WBLA 2WSSV 3BCCE 2LKGA 3H1JG 1HH0A 3N9LA 2GA1A 2IFMA 3W67A 1SQBK 1A02F 4WWIA 5B66E 1PV3A 4B3MT 5HAXA 4YHHT 3WUTA 5AVQB 1QUUA 2KI7B 2XM2A 5AQNB 4HFBA 1OEDC 1KB9E 2PBIA 3EWKA 2XTLA 1FU1A 3K3OA 1UCUA 2RN0A 5JREA 4IE0A 2N1TD 2WSEH 4HWDA 2X67A 4JQ0D 4ZZBA 2B87B 4DMWA 2BS2A 4A56A 4EAHA 4ZI3C 2E76B 2MAWA 2BEQD 2I1JA 2R44A 1OW8A 3HUSC 3AE5A 5JR9B 4MBQA 4CI2B 2AXCA 3EUHA 5DQVA 4UVBB 1EC5A 3RK2B 1LKXA 4U3CA 4WY4A 5KAFE 3L70J 3QC9A 3A7OA 1N2DC 2K37A 1BSNA 3ZJ1A 2JP3A 2WPQA 5GTHE 2KNCA 2X68A 3C64A 2FFDC 2X9XA 4QXCB 2KZJA 3NZPA 3D6ZA 5LJNA 2BG9B 4QXBB 5HXRA 3M91A 3ZDMA 5KKZB 4BJMA 4HWHA 1GDTA 1JNRA 1N32T 1DD4A 2A45H 3SWFA 4DUZT 4CXYA 1WRGA 2EHOA 3LBXA 1SVFA 2OQQA 2YMKA 3CWBD 3N9PA 2UXXB 1BGYG 3AE7A 3MUDA 3ZMZB 1FMWA 4JUYA 1FS0E 1NTZG 3GHGA 4G63A 2D9DA 4L0RA 5BU5A 3PTZA 2A06D 3KVAA 4MLKA 2XQ9A 5H6QB 4PD4H 2IDBA 3AEFC 4M3LA 2WSSH 3G06A 5AW3B 3VRAA 3OJAA 4H9PC 2LOPA 3JSVC 3EDUA 5HEHA 1FZAA 3B5NB 4QMAA 4ANJA 3SWKA 3CCQP 2J59M 3SS1A 1VCTA 5CCGC 5B5EE 1EDJA 1AQ5A 2HODA 1FAVA 1J1DC 3IF4A 2K5BB 2FJAA 3G6EP 1LGHB 1UIXA 4DNDA 2QRXA 4B3RT 1DD3A 1M1JB 2K24A 4JI5T 3ZT5A 1SQBJ 5EZYE 4IHJE 5H6RB 3IR9A 2PRRA 3L70G 2OGUA 1WT6A 1FOSF 1N7SD 2IAKA 3KV9A 3RGUA 2JKVA 3EFGA 4DV7T 4H9QC 1YJWP 2E9XD 3HE5A 2OYIB 2E75D 1AQTA 3HTKB 3EI0A 4I4TE 3T1YT 3Q2MA 3FZHB 4N78E 2RP4A 1Q2NA 3O1HA 2YDQA 3CCVP 5CJ0A 1PGPA 4EOZB 5DQWA 2L9QA 2HFED 3BQLA 1R5SA 3TYYA 3JC6C 1NEKA 2QM8A 3M0AA 3EDVA 2Z4EA 1BR0A 3E7KA 2VQFT 4U3FD 4U74A 3JCFA 2IDOB 2VASA 2H89A 5CA1E 4N78D 3LK3B 5L3DB 2WPSA 1FJKA 1VCSA 3P8CD 4Y99C 2ZVNB 3CCSP 4IFFA 1JNZA 2XHEB 4GK5E 3ZPOA 2P58A 4PD4I 5AW6B 1OEDB 4WNKA 4MHCA 4H0LD 1XWMA 4NPEA 3M9QA 3H1HE 3M0DC 3CQGB 3CC7P 2LKMA 2WPRA 4QX7B 3Q5RA 4X1YE 2WWUA 2FYUE 2CHOA 2H7VC 4TZ4C 4L75A 2NWBA 2WP9A 3H1HJ 1QVFO 2K3RA 3B71A 2FJEA 4HH2A 4WB4A 2MOZA 2H8PD 3GN5B 1D7MA 5BU8B 2FYUJ 1ZEEA 4KJMA 2DNXA 1SFCB 2D2SA 2L8KA 4PD4E 4CPGA 4YTPA 4DR2T 4GYRA 5FYMA 5EK4A 3MTUE 5CCHC 3C50A 4AKLA 3CCUP 1K05A 2K1AA 2V4HA 2BKNA 3ZMVB 4HFEA 3ZT6A 5AQKB 2LSYA 4PV1C 3LFMA 3D6YA 3RYCE 3NFQA 5AQMB 1SQBG 4OGQD 2FFDB 4HFIA 2XPKA 1KILE 3R6NA 1Y9BA 3FX0A 4L74A 4LFAT 1NVOA 3L71E 1WLXA 4IGUA 2WCAA 1D0XA 2NTXA 3HD7A 1AJYA 2BCCE 1Y01A 3RQUA 3AEBC 3VR9A 1MIVA 1S35A 3ANWB 4ZEYA 1GL2A 1T3UA 3HI2A 1QGKB 3GLMA 2BCCJ 3L71D 2WT7B 5JDMA 3CQXC 3H1IG 3ONXA 3M9HA 1KYOD 1SQVK 3PH0A 4HYTB 2K9YA 3FXEA 2IIUA 3SFDC 2JMKA 2WB5A 1HX8A 1Q86Q 2XY8B 3F57A 1Y8AA 2FY8A 5AW9B 3L74E 3SWHA 2YNYA 5LBMA 4GYSA 2PG8A 3BVHA 3HR0A 2I8DA 3RK3E 3AECA 3L74J 1IJ5A 4WBNE 2HPLA 5LBQB 4EEBA 2PP6A 2QYWA 2E43A 4ZNCA 5CB4E 3T8OA 2M5AB 1KFMA 2YXRB 2A45G 1BR1A 4DMVA 1J1DB 3G3ZA 3VYIA 3CCEP 3RQWA 3OW2O 3J9X1 3O1JA 1ZN5A 3UQ7A 2M3EA 3PJSK 3U3IA 4H63V 1X8YA 1IZNB 2IBZD 2W4XA 5APTA 4NPPA 3Q5EA 2J47A 1KMIZ 2J4GA 4BAYB 1JTHB 4ILUA 3G4SP 1YKHB 5AVRB 3FHNA 4LGDE 1OVUA 3AE8C 1YXRA 3A0HH 3ONLC 2OLTA 1PFIA 2E5YA 2LSIA 3U78A 2Q3IA 4JPZB 1H0TB 4XE5B 3P4SA 4OYKA 3C8VA 3ITKA 3CIRA 5LHIB 1VQ9P 1CHUA 2FKWB 2VURA 3FZKB 1ZLLA 2X9HA 4JLEA 1L2PA 4IL6X 4X1IE 2M6IA 3B4SA 1UK5A 4TWHA 2NTYA 4ERRA 3RHWA 1N34T 4H44C 3QUJA 2R32A 3L73D 3SWYA 1IO4A 2BCCG 1T7SA 4OWFA 5K5GB 2Q3EA 3TKLB 2ITAA 4GOFA 5FVLA 1L0LG 3RIAA 3H1LE 4Y99B 1RH5B 3SFEA 5FXXA 1M8OB 4CI1B 2E5VA 4GKGA 3CWZB 2LEHA 3T1HT 2Q9QB 4DR4T 3VN0A 2LSGA 2ZM8A 3H1KJ 3CX6B 3TNUA 5LA6E 2IC6A 4IDZA 1GZLA 4B3TT 3GW6A 1K9MQ 3AEAA 5C8YE 2YXQB 4JI2T 1JY2O 3ZLIA 1SQQK 1J2JB 1KV4A 4A7PA 2QJKB 3KDPB 2KP8A 4IFMA 3SOLA 2N1TC 2CM0A 3UFGA 4TV9E 2N9YB 5CHXA 2K9JA 1YD8G 2FBWA 2ZT9D 5AVTB 3W15B 2BS3A 3L72J 2XQ5A 2NOXA 4H63H 2V26A 1OX3A 1S9KE 4WBAA 3QB5A 3AXJB 1IBLT 1XTCC 3LJCA 3PUGA 1MFTA 1OWAA 3K8PC 4JEHB 3MD0A 5HCMA 1NU1K 4KMCA 3RRCA 3WI3A 3JCUH 3UU3A 1W5CE 3P7KA 3CD6P 1S9KD 2WZHA 3RLFF 2XQ8A 3VP9A 4IL6H 5APYA 5BR8T 3A0HE 1VF5C 3DP7A 1N7SA 4U33A 2KSJA 2QJPB 1I94T 5LMNT 2E9XA 2XAHB 3D0TA 4I0UA 4QWNB 3TLTA 1LP1B 3CK6A 4HFCA 1KF6A 3CQCB 2HHHT 2FYZA 1AFOA 5JDHA 2PGDA 1O3XA 1EDKA 1YQ3C 3H1KG 3QNUA 1M7KA 4DJGA 2HR3A 2L3LA 2IZ1A 5H2FH 4M1PA 1FOSE 2ZAEB 4GIWA 1RE3C 4YXDC 3LW5H 3VU7H 2A9UA 5LG4A 4BWNA 3O6QB 5JDGA 1HTLC 2XNXA 2P10A 3AE6C 2JMHA 3PUWF 1SQVG 4IL9A 5DJTB 3WU2H 1HVVA 1SQXK 4AI6A 4YTNA 2D2CB 3PTRB 1URQD 5DJQC 4R4MA 3M9BA 2CWOA 4H13D 4K0UA 1RF1A 3L72G 1SS1A 2CA5A 3UT5E 5ABHA 2W0GA 2NP9A 1IJDB 2O1KA 3BRTB 3H25A 4GKJT 2C0XA 2JQHA 4H44B 2OTKE 1CZQA 2CLYC 3NRYA 1BE3J 1SQQJ 4C7NB 2C0WA 2ZMAA 3PDYA 5LGUB 5L3BB 3AE1C 3PHLA 3K3NA 3BQIA 1NWQA 2YK0A 1CI6B 4UVCB 1T98A 2WPVB 1L0NE 2LHNA 5FMNA 1IC2A 4XFJA 5APVA 3KV4A 4CN4A 3BQKA 1IK9A 2BASA 4WW0A 1ZW0A 1VOMA 1MMGA 2AEFA 2G0UA 1NTKE 2V7LA 3A5TA 2A3DA 3PUQA 2PFVA 2E5TA 3OAKA 1K8AQ 1XDPA 4MN4C 1VQNP 1ZR4A 2KLQA 5KLVD 3ETUA 3T97B 2V5DA 4ASWA 1L4AC 1LTJB 3RL0D 3PRJA 4IT4A 4IL6E 2M67A 2V6YA 5AW5B 2Y8DA 2DI4A 3UUBA 1BCCJ 1NU1J 5AQFB 3NWIA 4EI2A 4XA4A 1JNMA 5JH7E 3C1LA 3NRXA 1M7LA 4H9NC 4IDNA 1VDFA 5F5WA 3ZCIA 2VWAA 4X62T 2OYIA 5GTHH 4V1Av 3H1JD 1J5ET 2DCFA 3F89A 3R2PA 5KAIE 4ZI2C 1W2BO 2C5KT 4QXHB 1T2KC 1EXJA 4I50E 4TN7B 1VQ8P 1D0YA 2P67A 1MV8A 2CPBA 3ZSSA 5H2FE 5HWYA 5AW7B 1N73C 3ZYLA 4LF8T 1IFJA 1E5WA 1NKNA 2WTYA 3OA7A 2V7JA 4HFVA 2KT9A 5AVWB 2JWDA 2ZFCA 3P8MC 2ACZA 5AQOB 3LW5J 2NPSB 1QLBA 2ES0A 5JVDE 2KLVA 3L35A 3WU2E 2ZLYA 4ZS3A 1Q7YQ 4KX6A 1GQEA 3PJAA 1BE3G 5FXVA 1SQQG 2PFXA 1VF5B 1M56D 1SQXE 3NZQA 1KILC 5FY7A 4LMKA 1DEBA 2I59A 1KC8Q 4TV8E 1SHZC 2VL0A 2WWWA 1EDLA 1CW5A 1HF9A 1SQXJ 1NAYA 1PIXA 3GMIA 5LHGB 3EABA 1UX4A 2KXPB 5E0OA 4A98A 1SFCA 2RKLA 2OYHC 2OV9A 2O01H 3NXSA 4LMLA 3AEGA 4LLHA 1JMBA 5KJ7A 4ZI7E 2O1JA 3V2NA 5B5EH 3KHUA 3BCCJ 3M3ZB 1NTME 2OA5A 1LWUA 2YKQA 4EOTA 2FUPA 4UIGA 1WYBA 4TX5A 1JY2N 4U2YA 3PV0F 2YINA 1UX5A 1BCCG 1NU1G 3VOPA 1R5LA 3WUVA 1YQ4C 3S4UA 2C0SA 1LTIC 1K73Q 1BGYD 2IUBA 1Q81Q 3N5LA 4GODA 1RF0C 1NTMD 5AVXB 1NTZD 3RK3C 4UELA 2KS1A 2WZ7A 2Q1KA 1YHQP 4EEDA 3RIFA 3G71P 2LJLA 2WMMA 4QKNA 2Y0DA 2R5DA 4DO0A 1PPJG 1FMVA 1KFNA 4AISA 4F8HA 1S3JA 4W80A 3TK1A 2QJYC 1LRZA 2IYPA 1FZCA 5LHHB 2WS3A 4NXNT 2AE9A 3TDKA 3UULA 2YKPA 3C4XA 4UV8B 3V2RA 1J1EB 3FBZA 1Y64B 1MKMA 2LRLA 1KQGB 3LG7A 5CA0E 2ODUA 5KX5E 3A3YB 5LYJE 4JI7T 3VTPC 4BRYB 1G2CB 3FWLA 3AE3A 3CXHI 3RI5A 4Q25A 5IHYA 4C46A 3CWBE 1PP9G 1HCIA 1U4QA 2MKVA 3I0QA 1LVFA 5AQJB 1PGQA 1NENA 4E7ZA 2J58A 1VQOP 3CWBJ 5E79H 2A06E 1OFCX 2YKSA 3AEEA 3AAIA 4HEAA 2FYUK 3O8ZA 2BDEA 2KWHA 5CGMA 2BVMA 3EFFK 3FWNA 3K3QC 4NPDA 1SQXG 2X9WA 4ZS2A 1GU5A 3TLWA 2POHA 4FI5A 4U72A 3CXHE 3ZCJA 3V4WA 1L4AB 2WQYA 2QG4A 4LF4T 4YSZA 1LT9A 2E74B 2Q9IA 1EZVG 3CMEP 1D1AA 2BKOA 2HPCA 4RJTA 3BCCG 3PLNA 4TLFA 4PNIA 2XAFB 3CXHD 2VRSA 4HN9A 1AV1A 3AE5C 3FZLB 4UXNB 1JY3N 2I1KA 2IHR1 3G9RA 2AEJA 4WY4C 1K04A 3PU3A 5JRCB 3D70A 5ABEA 3HKEE 4ZHQE 4LF7T 3FZFB 3S4RA 2N1GA 1DU2A 4QH1A 4UB8E 1KYOH 5FVKA 1OW7A 3L09A 2V7QH 4K0KT 3UTKA 1UUSA 3WAKA 4W7YA 2YKOA 1HF8A 3KFWX 3P4WA 4XZCA 1DX7A 2EHOC 2Q9QA 2WM9A 3AVRA 4I1LA 4UEMA 3AE7C 3MUDC 1KILB 1ZV8A 4CXXA 2UUCT 1W2EA 4U3FE 2WSEJ 3GHGC 2DL1A 1S5LX 1Z0PA 5FNVE 2E76D 1URQA 4ASKA 1SP4A 5LG3A 5HXSA 4I7ZB 3MIWA 1XZYA 2IFNA 2NRGA 3RK2D 3P8CE 1SQBD 2W8ZA 4IL4A 3WAJA 4N6JA 1PGJA 2MTQA 3F5HA 5CCHA 2Q5UA 3HKBE 3PUYF 4HWCA 3EQ2A 4KBMB 3WUUA 4KUMB 4EXTA 2YU1A 1KQLA 2V6XA 1FE6A 2R6GF 3IFMA 3HA4A 3ZJ2A 2XQ7A 4LMJA 5HYAA 1RQVA 4YSXA 2XSAA 5E79E 4MFRA 1JUNA 2OYOA 1SUMB 4EDFA 2H7HA 2QVAA 2VKOA 3U1AA 3RK3B 1PZQA 3H1ID 5FKYA 4OVNF 2ZJSE 5HXHA 2CE7A 2N2NA 2UXDT 3HE4B 3HUSB 3H32A 3VP8A 1ZR2A 1V9DA 3I0OA 3P50A 2QJYB 2XV5A 3CL3D 1D1BA 4AQFA 2H3RA 4H9OC 3ZC0A 3CKDA 3ZYKA 1KYOI 3E22E 3MHVA 4AXPA 2IMLA 1QSDA 4E7SA 1G1IA 1RE4A 4O9BA 4AQRD 4IE5A 3I5CA 2ZXXA 4H13C 3J7Yq 1FEWA 4JBZA 4DV5T 5KDMC 1LP1A 4PW8A 2YDRA 2P2UA 3B5ND 3FXDA 1GMJA 1Y47A 2H43A 2C9LY 2LM9A 1N8RQ 5JTGA 1NHLA 2W6AA 3L71J 2H89C 1SE7A 1KYOE 5IWAT 2CXFA 2W27A 3L36A 1LTSC
chains in the Genus database with same CATH topology
1LTTC 3VMXA 3VMZA 4AKRB 1ZHCA 3HL6A 5AW8B 3N9MA 3PURA 2M8RA 4QX8B 3V2QA 3MXZA 4WY4B 2Z5HA 2K9AA 1T8ZA 3BK9A 4DZOA 5BMVE 3KPEA 1IFMA 3NMDA 3H6PA 4O4LE 4C7NA 5TAOA 5EK2A 2KOGA 2WMOA 1JMMA 5ADXL 3QK6A 3C9IA 2XASB 3RYHE 4C7RA 1ZV4X 3HD7C 4ZKPA 3O9XA 5FXWA 1GL2C 2EHOB 3LBXB 4DVDA 4O4HE 1IFNA 4XAXB 3GHGB 4WBOA 4ZI3D 1KNZA 2RA1A 1SFCD 4IFDK 1LTJA 2XDJA 2C5JA 5KJ7D 5AVVB 1QL1A 5L3EB 2XUEA 3RC3A 3KV5A 4PJMA 1HUCA 3Q5WA 1T3JA 4I2LC 1D1CA 4DBRA 4Z8XA 1HTJF 2CXDA 3KDSE 3SRZA 3DJBA 5APQA 3HKDE 3MKDA 2VKHA 1GK6A 3UIAA 3CVRA 4J2CA 1LTAC 1NH4A 3I9YA 2NPSA 2IW5B 2BVLA 4X20E 3HE5B 2ACXA 1CSBA 3V5SA 3B13A 5CMZA 5KLVK 3N2KE 1L0NK 4PFPA 1G8XA 3H3AA 2Z5IA 5CCGD 3HRNA 1H8AA 3FBLA 1NTKK 5AVZB 5LNKA 5M4YA 3CMLA 3AVSA 3V5BA 3A2AA 2QA7A 4QHOA 3H37A 4LC1A 1MNDA 2XAQB 1CUNA 3B8EB 4O2AE 1BR2A 1HJBA 2JEEA 5J2UE 1NWMX 3BATA 5JR9A 3R84B 2SPCA 3JC6D 2CXLA 3VKHA 5AW4B 1YTZI 2V7IA 3DTOA 2DLRA 3HD7B 2Q9QD 3UUMA 2CPSA 2WSFH 1GL2B 3KVBA 4EZ4A 4NUUA 1U5PA 4EZHA 3U59A 1KZUB 3MZKB 4OYJA 2XQYA 3FXEB 3GWHA 1N7SC 3KV6A 4I43B 2DWGA 5CCHD 2Q7CA 2E9XC 4AKIA 1NKZB 1VPCA 2MJZA 3V2PA 2C5IT 1NTMK 2GUSA 2X9YA 5APWA 2CEAA 4PAGA 4X1KE 1ZKEA 2KYVA 3B5NA 4L9IA 2QGSA 4DOJA 1JY3P 3ESLA 3N9OA 1WYCA 4OH8B 1AJ3A 2HH7A 4ZOLE 3TSIA 3CX8B 2DWKA 2W00A 1M1JA 2LSKA 4UVAB 2E42A 3CX7B 3Q9DA 2ZM0A 2Z6EA 2N1TB 1RF1C 4BJNA 1MIWA 5HXEA 3HTKA 2D5UA 3N2OA 1EZ3A 3PUSA 5JDQA 3O1IA 1S94A 1B7TA 3MGNA 2WITA 3RRWA 3M65A 2CMRA 1YTZT 3TNUB 1FIOA 3F2EA 1MMDA 5AVYB 2LOSA 4O2BE 5FXZA 4ADZA 1X79B 3GN5A 3HE4A 3HUSA 3OKQA 4HKAA 4N3YB 5F3JA 1MMAA 2K48A 1YW0A 2Y6XA 4EYYR 2OYIC 4MALA 2W6BA 1HGVA 3RPUA 1OXZA 5J1GA 2FFDA 2N9DA 4L5GA 2WSCH 3ZN0B 3HKCE 4CXWA 4OHFA 1WR6A 2LT3A 3ANWA 5LGNB 2WT7A 3NBXX 3ZMSB 3IEEA 5LP6E 1N7SB 5AVSB 4H9RC 5GONE 4KP3C 3RYIE 5AFUL 3P7IA 2E9XB 4W7ZA 2CLYB 4AQGA 3LK2B 4AUWA 2YO2A 4P09A 1SFCC 1MNEA 1YYCA 1QL2A 4IIJE 1H7CA 5KJ7C 2WAUA 5CCGA 2KZ7B 1LWUC 3UUXB 2H7OA 4I6MC 2NPSD 3AAAB 5KMGP 3MA9A 2NW7A 1JTHA 4H9SE 5CJ4A 4JF7A 2X0LB 4IE6A 4EYUA 1RF1B 1NOHA 4EB6E 1FZCC 4GIFA 3AA6B 1HG5A 3II6A 4PFOA 1JCCA 1FBMA 3I1AA 4B86A 1N73B 2KWIB 3VHLA 5BVZA 3RKOA 4B6XA 3N2GE 3RH3A 4UV9B 4AKHA 1EQ7A 3NTNA 1MMNA 1HS7A 4I55E 2KMFA 4DBQA 2VB6A 3M0DA 5F8PA 5J2TE 1VRBA 1L0LK 1YKEB 2CWYA 3V4QA 4P0AA 5L2LA 1FDMA 5LCYA 1LT9C 2NW8A 3KQGA 3IHRA 2A72A 3B57A 2W62A 3N4XA 1LVKA 1GTWA 2OYHB 2A2FX 5FY1A 4C91A 5FY0A 5JQGE 2GK9A 2DHRA 4UF0B 1US7B 2A45I 1WRDA 5LOVE 3ZEFB 4XBFB 1NAFA 2IX7C 4ISTA 2JJ9A 5AW2B 5KTBA 3RX6A 4YHJA 3LK42 1L4AD 5IYZE 3C4WA 2Q9QC 5APUA 3E1IA 4PK5A 1URQC 1GW3A 4PJNA 3M06A 2WMNA 4ZI2D 5AVUB 5LGTB 1T2KD 2OARA 1MIYA 3BASA 4TUYE 3L4FA 2XAGB 5JDNA 4HE8A 3KINB 1LWUB 2M3BA 1G73A 1JO5A 5L3FB 5HWXA 2LHRA 5EK3A 5APSA 2Y48B 2KINB 3MK7C 1HWTC 2X51A 1SA0E 4PJJA 1Z56A 1IFIA 1MFZA 3KBUA 1FZGA 3KBTA 1KILD 3CLQA 2VL8A 3GA8A 3RL0C 4AQFC 2P1JA 1FZCB 4OFZA 1GU4A 3VKGA 5HXCA 3KYQA 3LIEA 3AA0B 2JPFA 3FB2A 2D0TA 1RE4C 1MZ9A 5LXTE 1SQPK 2CCQA 4G2AA 2YMYA 1CI6A 3PUAA 2V1DB 3RK3D 2GM4A 3U1CA 3IF8B 2FXMA 1LT9B 4IE7A 5LJMA 3T97A 3ZMUB 3PE0A 5ETWA 4GK0E 2VKDA 2X66A 4GT1A 2HPCB 4CZZB 3C51A 3L37A 4OK0A 3OJAB 1A02J 2QM7A 3C4ZA 3ZN1B 2N1TA 2PJQA 1KK7A 2D0UA 2YEVC 2UXNB 1HG2A 1FJPA 2HODB 1GK4A 2W63A 3MACA 5FP3A 2KNDA 2XU6A 3F31A 1E1HB 1H88A 1DH3A 1LTBC 3MJXA 2LE8A 1H89A 2YO3A 1XTGB 1URQB 1LTJC 2LSJA 3L3PA 3P32A 2PAJA 4WY4D 1X79A 3AB3B 1D0ZA 3VMYA 1IJ6A 2V7MA 3E08A 3PU8A 5APXA 2R3CA 2ZM2A 2ZXEB 3C98B 3N7NA 3CI9A 1HFAA 3RC8A 1RE3A 2MYSA 1JCDA 2EHOD 1JY2P 4HTEA 3RYFE 4ZKUA 3H32B 3ZC1A 2C9NY 5AW0B 3V5UA 3PP5A 3RL0B 4YFSA 2BZBA 3WMM0 4ISSA 2NPSC 5JDFA 2J1DG 4JYCA 4EIJA 2IPPA 4BA9A 2VK9A 4PK6A 1FZBA 1G1JA 3AAEB 2IC9A 1G2CA 3FXDB 2P9BA 2NW9A 1BR4A 2XAJB 3A5XA 4AYCA 4RESB 3UFEA 4O4JE 2N9BA 2JJLA 4F6RC 3IBPA 4GOUA 4CI3B 4AKGA 3N9NA 5L3GB 3OYZA 1L4AA 1JY3O 3BRVB 2HPJA 2HLOA 3ZMTB 1MUUA 2JRKA 1RY3A 1NTZK 5JR9C 4KHXA 4PK4A 2MBGA 3RK2C 4YLHA 5JRCA 4EIWA 3N9QA 1J1EC 1LTGC 4NUVA 4O8SA 3OYXA 3ZYMA 1HGZA 1N73A 4C90A 1JOCA 3E0ZA 5AW1B 4P0BA 3ETVA 1GD2E 4IE4A 1IAPA 2ODVA 2R5BA 2HYNA 2KB7P 3OBVE 2HG5D 1SLQA 3Q5XA 2JQQA 1KILA 1HBWA 1IFDA 2E8IA 1FZEA 4FJOA 4CQIA 2OYHA 5A1LA 1N86A 4HGAA 4YJ2E 3UUNA 4UF0A 3B5NC 2XZRA 1GW4A 2B1EA 3HD7D 3AA1B 4JYBA 3AA7B 2L5GB 5JDLA 1NO4A 1GL2D 3I9WA 1X9VA 1RF0A 4YJ3E 1M1JC 3O4XE 2XKMA 5L3CB 3LIDA 4O4IE 5DABA 1N7LA 2W61A 3EVYA 2GUVA 2P7JA 1FZFA 2V7KA 2YU2A 4JEUB 4PJLA 3CPZA 2VKJA 2WBLA 2WSSV 1HH0A 3N9LA 2IFMA 1SQBK 1A02F 5HAXA 5AVQB 1QUUA 2PBIA 2XTLA 1FU1A 3K3OA 1UCUA 5JREA 4IE0A 2N1TD 2WSEH 2X67A 4DMWA 4A56A 4EAHA 4ZI3C 5JR9B 2I1JA 3HUSC 4MBQA 4CI2B 3EUHA 5DQVA 4UVBB 3RK2B 1LKXA 4WY4A 3QC9A 3A7OA 1N2DC 3ZJ1A 2WPQA 2X68A 3C64A 2FFDC 2X9XA 4QXCB 3NZPA 5LJNA 4QXBB 5HXRA 3M91A 4BJMA 1GDTA 2A45H 3SWFA 4CXYA 1WRGA 2EHOA 3LBXA 1SVFA 3N9PA 2UXXB 3MUDA 3ZMZB 1FMWA 4JUYA 3GHGA 4G63A 4L0RA 5BU5A 3KVAA 4MLKA 5H6QB 4M3LA 5AW3B 3OJAA 4H9PC 2LOPA 3EDUA 1FZAA 3B5NB 4ANJA 2J59M 3SS1A 5CCGC 1AQ5A 2HODA 1FAVA 1J1DC 2K5BB 1LGHB 4DNDA 1M1JB 2K24A 5EZYE 4IHJE 5H6RB 3IR9A 1WT6A 1FOSF 1N7SD 2IAKA 3KV9A 3EFGA 4H9QC 2E9XD 3HE5A 2OYIB 3HTKB 4I4TE 3Q2MA 4N78E 2RP4A 3O1HA 5CJ0A 4EOZB 5DQWA 2L9QA 2HFED 3BQLA 3TYYA 3JC6C 2QM8A 3M0AA 3EDVA 2Z4EA 1BR0A 4U74A 5CA1E 2VASA 4N78D 3LK3B 5L3DB 2WPSA 1FJKA 3P8CD 4Y99C 4IFFA 2XHEB 4GK5E 3ZPOA 5AW6B 4WNKA 4MHCA 3M9QA 3M0DC 3CQGB 2LKMA 2WPRA 4QX7B 4X1YE 2WWUA 2H7VC 4TZ4C 2NWBA 4HH2A 4WB4A 2MOZA 2H8PD 3GN5B 1ZEEA 5BU8B 2DNXA 1SFCB 2D2SA 2L8KA 4GYRA 5FYMA 5EK4A 3MTUE 5CCHC 3C50A 4AKLA 3ZMVB 2LSYA 3LFMA 3RYCE 3NFQA 2FFDB 3R6NA 1WLXA 4IGUA 1D0XA 2NTXA 3HD7A 1MIVA 1S35A 3ANWB 1GL2A 1T3UA 3HI2A 2WT7B 5JDMA 3CQXC 3ONXA 3M9HA 1SQVK 4HYTB 2JMKA 1HX8A 3F57A 5AW9B 3SWHA 2YNYA 5LBMA 4GYSA 2PG8A 3BVHA 3HR0A 4WBNE 1IJ5A 2HPLA 5LBQB 2PP6A 2E43A 5CB4E 3T8OA 1KFMA 2A45G 1BR1A 4DMVA 1J1DB 3G3ZA 3VYIA 3J9X1 3O1JA 1ZN5A 3U3IA 4H63V 1X8YA 1IZNB 5APTA 4BAYB 1JTHB 4ILUA 1YKHB 5AVRB 3FHNA 4LGDE 1PFIA 2LSIA 3U78A 2Q3IA 4XE5B 4OYKA 5LHIB 2FKWB 1ZLLA 2X9HA 4JLEA 4X1IE 2NTYA 4ERRA 3QUJA 2R32A 3SWYA 1IO4A 3TKLB 4Y99B 5FXXA 4CI1B 3CWZB 4GKGA 2LEHA 2Q9QB 3VN0A 2LSGA 2ZM8A 3CX6B 3TNUA 5LA6E 2IC6A 4IDZA 1GZLA 5C8YE 1JY2O 3ZLIA 1SQQK 1J2JB 3KDPB 2KP8A 4IFMA 3SOLA 2N1TC 2CM0A 4TV9E 5CHXA 1YD8G 5AVTB 3W15B 2NOXA 4H63H 2V26A 1S9KE 4WBAA 1XTCC 3LJCA 3PUGA 1OWAA 3K8PC 4JEHB 3MD0A 1NU1K 4KMCA 3RRCA 3WI3A 3P7KA 1S9KD 3VP9A 5APYA 3DP7A 1N7SA 2KSJA 2E9XA 2XAHB 3D0TA 4QWNB 3CQCB 2FYZA 1AFOA 5JDHA 1O3XA 2L3LA 4M1PA 1FOSE 4GIWA 1RE3C 3LW5H 3VU7H 5LG4A 5JDGA 1HTLC 2XNXA 2JMHA 1HVVA 1SQXK 4AI6A 3PTRB 1URQD 5DJQC 3M9BA 2CWOA 4K0UA 1RF1A 2CA5A 3UT5E 2W0GA 2NP9A 1IJDB 2O1KA 3BRTB 2C0XA 1CZQA 2CLYC 3NRYA 4C7NB 2C0WA 2ZMAA 3PDYA 5LGUB 5L3BB 3K3NA 3BQIA 1NWQA 2YK0A 1CI6B 4UVCB 1T98A 2LHNA 5FMNA 1IC2A 5APVA 3KV4A 3BQKA 1IK9A 2BASA 4WW0A 1VOMA 1MMGA 2G0UA 2V7LA 3A5TA 2A3DA 3PUQA 2PFVA 3OAKA 2KLQA 1ZR4A 3ETUA 1L4AC 1LTJB 3RL0D 2M67A 5AW5B 2Y8DA 2DI4A 4XA4A 1JNMA 5JH7E 3NRXA 1M7LA 4H9NC 1VDFA 3ZCIA 2VWAA 2OYIA 4V1Av 2DCFA 3R2PA 4ZI2C 2C5KT 4QXHB 1T2KC 4I50E 4TN7B 1D0YA 2P67A 1MV8A 2CPBA 5HWYA 5AW7B 1N73C 3ZYLA 1IFJA 1E5WA 1NKNA 2WTYA 3OA7A 2V7JA 4HFVA 2KT9A 5AVWB 2ZFCA 3P8MC 2NPSB 2ES0A 5JVDE 2KLVA 3L35A 2ZLYA 4ZS3A 5FXVA 3NZQA 1KILC 5FY7A 1DEBA 2I59A 4TV8E 1SHZC 2WWWA 1CW5A 3GMIA 5LHGB 1UX4A 2KXPB 5E0OA 1SFCA 2OYHC 2O01H 3NXSA 4LLHA 5KJ7A 4ZI7E 2O1JA 3V2NA 2OA5A 1LWUA 2YKQA 4EOTA 4UIGA 1WYBA 4TX5A 1JY2N 2YINA 1UX5A 3VOPA 3S4UA 2C0SA 1LTIC 3N5LA 1RF0C 5AVXB 3RK3C 4UELA 2WZ7A 2LJLA 4QKNA 2R5DA 4DO0A 1FMVA 1KFNA 4W80A 3TK1A 1LRZA 1FZCA 5LHHB 3UULA 2YKPA 3C4XA 4UV8B 3V2RA 1J1EB 3FBZA 1Y64B 5CA0E 5KX5E 3LG7A 2ODUA 5LYJE 3A3YB 3VTPC 1G2CB 5IHYA 4C46A 1HCIA 1U4QA 3I0QA 1LVFA 4E7ZA 2J58A 3AAIA 4HEAA 2FYUK 3O8ZA 2BDEA 2KWHA 2BVMA 3K3QC 2X9WA 4ZS2A 1GU5A 2POHA 4FI5A 4U72A 3ZCJA 3V4WA 1L4AB 1LT9A 2Q9IA 1D1AA 2HPCA 4PNIA 2XAFB 2VRSA 4HN9A 4UXNB 1JY3N 2I1KA 4WY4C 3PU3A 5JRCB 3HKEE 4ZHQE 2N1GA 3L09A 3UTKA 3WAKA 4W7YA 2YKOA 1HF8A 3KFWX 4XZCA 1DX7A 2EHOC 2Q9QA 2WM9A 3AVRA 4I1LA 4UEMA 1KILB 1ZV8A 4CXXA 1W2EA 3GHGC 1Z0PA 5FNVE 1URQA 4ASKA 1SP4A 5HXSA 3MIWA 2IFNA 3RK2D 3P8CE 3WAJA 4N6JA 2MTQA 5CCHA 2Q5UA 3HKBE 4KBMB 3EQ2A 4KUMB 4EXTA 2YU1A 1KQLA 3IFMA 3HA4A 3ZJ2A 5HYAA 4MFRA 1JUNA 2H7HA 2VKOA 3U1AA 3RK3B 5HXHA 2CE7A 2N2NA 3HE4B 3HUSB 3H32A 3VP8A 1ZR2A 1V9DA 3I0OA 2XV5A 3CL3D 1D1BA 4AQFA 2H3RA 4H9OC 3ZC0A 3CKDA 3ZYKA 3E22E 4AXPA 1QSDA 4E7SA 1G1IA 1RE4A 4O9BA 4AQRD 4IE5A 3I5CA 3J7Yq 1FEWA 5KDMC 4PW8A 2P2UA 3B5ND 2H43A 2C9LY 2LM9A 1NHLA 2W6AA 2CXFA 2W27A 3L36A 1LTSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CI6 B;  5AVT B;  2E43 A;  3L37 A;  2IPP A;  3TYY A;  2QM8 A;  3M0A A;  1A02 J;  3A7O A;  2QM7 A;  5APV A;  5AVY B;  1S9K E;  2BAS A;  3M06 A;  3VMX A;  2WPQ A;  3VMZ A;  3HE4 A;  5AVX B;  3VYI A;  3A5T A;  2WPS A;  3OAK A;  5AW8 B;  5AVU B;  1OWA A;  3HE5 B;  2Q7C A;  3M91 A;  3MD0 A;  2XZR A;  1T2K D;  2R5D A;  4AYC A;  1X8Y A;  1GK4 A;  4RES B;  5AW6 B;  4B86 A;  3P7K A;  2N9B A;  2JJL A;  1CSB A;  3TK1 A;  1S9K D;  5APT A;  4JYB A;  1SP4 A;  5AW5 B;  3SWF A;  5CMZ A;  5APW A;  2WPR A;  1OXZ A;  5APY A;  2Z5H A;  2XU6 A;  5AVR B;  1JNM A;  2N9D A;  5APS A;  2Z5I A;  3NTN A;  1HWT C;  2Q3I A;  4DZO A;  1H88 A;  2Q5U A;  3A3Y B;  4XE5 B;  1DH3 A;  1H8A A;  3VTP C;  5AVZ B;  1G2C B;  1KQL A;  3NMD A;  3LID A;  1MFZ A;  3M0D A;  4C7N A;  1WR6 A;  4C46 A;  1H89 A;  1MUU A;  3V5B A;  3A2A A;  2YO3 A;  3V4Q A;  4M3L A;  1T2K C;  1O3X A;  2WT7 A;  2P7J A;  2R32 A;  3KQG A;  4LC1 A;  2P67 A;  5AW3 B;  1MV8 A;  1IO4 A;  1JUN A;  3NFQ A;  5AW7 B;  4KHX A;  2H7H A;  1GTW A;  3P32 A;  3O8Z A;  2E42 A;  1GU4 A;  1FOS E;  1X79 A;  5AVS B;  2WTY A;  3B8E B;  3VMY A;  3LIE A;  1GU5 A;  5AVW B;  2ZFC A;  4GKG A;  3P8M C;  2N2N A;  3V4W A;  3HE4 B;  1HJB A;  5APX A;  2R3C A;  1NWM X;  4AUW A;  3L35 A;  3HTK A;  2YO2 A;  3VN0 A;  2XV5 A;  1FAV A;  2ZXE B;  1A02 F;  3TNU A;  1YYC A;  5AW1 B;  1WRD A;  1GD2 E;  1GZL A;  5AVV B;  2WT7 B;  2VRS A;  1CI6 A;  5AVQ B;  2R5B A;  2WWW A;  1NAF A;  3M9B A;  4AQR D;  3IR9 A;  3I5C A;  1HUC A;  1FOS F;  3M9H A;  5AW4 B;  4HYT B;  1SLQ A;  4I2L C;  1J2J B;  3MGN A;  5AW2 B;  2P2U A;  1NWQ A;  2C9L Y;  3NXS A;  5AW9 B;  3KDP B;  1HBW A;  2KP8 A;  3HE5 A;  4I6M C;  5APQ A;  1CZQ A;  2YNY A;  5AW0 B;  2C9N Y;  3T97 A;  2W6A A;  4C7N B;  1YD8 G;  3UIA A;  5APU A;  1GK6 A;  3TNU B;  4GT1 A;  4EOT A;  2W27 A;  3L36 A;  4JYC A; 
#chains in the Genus database with same CATH topology
 3SSU A;  1S5L H;  5GTI H;  3EAM A;  1S72 P;  2RH0 A;  1ZOY A;  1LTT C;  3FZM B;  3VMX A;  3VMZ A;  4AKR B;  2IBZ I;  1ZHC A;  3HL6 A;  3ZKR A;  2K3W A;  5AW8 B;  2WVR A;  3N9M A;  3PUR A;  2KUB A;  2M8R A;  3S9O A;  4QX8 B;  3A7M A;  3PUV F;  4YTP C;  3V2Q A;  1W0A A;  3MXZ A;  4WY4 B;  2Z5H A;  2K9A A;  2B88 A;  3JAD A;  4DR5 T;  1T8Z A;  2IBZ E;  3BK9 A;  2CK3 H;  1L0L D;  4DZO A;  5BMV E;  3H1H G;  3KPE A;  2KNC B;  1IFM A;  3NMD A;  3H6P A;  2FYU G;  4O4L E;  4C7N A;  5TAO A;  3RF1 A;  2WZI A;  2E2A A;  5EK2 A;  2KOG A;  2WMO A;  3PJA J;  4TNV A;  1FDI A;  1JMM A;  5ADX L;  3QK6 A;  3C9I A;  2XAS B;  3RYH E;  4C7R A;  1ZP0 A;  1ZV4 X;  3HD7 C;  1E2A A;  4ZKP A;  3UU6 A;  3O9X A;  5FXW A;  1YIT P;  4RKU J;  1GL2 C;  2EHO B;  3LBX B;  4DVD A;  4ILB A;  1XNQ T;  5AQT B;  4O4H E;  3GF3 A;  1IFN A;  3FGA D;  1T8B A;  4XAX B;  3GHG B;  3L73 E;  4WBO A;  4ZI3 D;  2CHN A;  1KNZ A;  2RA1 A;  1SFC D;  4IFD K;  1LTJ A;  2JWA A;  1FDO A;  2QSI A;  3L71 G;  2XDJ A;  4DV1 T;  2C5J A;  5KJ7 D;  5AVV B;  5KLI C;  2LR2 A;  2I6H A;  1TU3 F;  1QL1 A;  4YTM A;  5L3E B;  4YT0 A;  2XUE A;  3RC3 A;  3AEC C;  3KV5 A;  3S1K A;  4PJM A;  1HUC A;  3Q5W A;  2RPA A;  1T3J A;  5C2T A;  2AXD S;  3ABV A;  4I2L C;  1D1C A;  4DBR A;  4Z8X A;  1HTJ F;  2CXD A;  1USE A;  3KDS E;  3SRZ A;  3DJB A;  1LNQ A;  2AXT H;  5APQ A;  2QIW A;  3H1L J;  3AE2 A;  3HKD E;  3GG2 A;  3MKD A;  4JI6 T;  2VKH A;  1HNX T;  1GK6 A;  1S5L E;  2KIK A;  4LF6 T;  3UIA A;  3CVR A;  4J2C A;  5GTI E;  3L74 G;  1LTA C;  1HJ0 A;  4OX9 T;  2H88 A;  1HNW T;  1NH4 A;  4YPC A;  3I9Y A;  2NPS A;  2IW5 B;  4DCK A;  2BVL A;  2XND H;  4X20 E;  2UUA T;  3HE5 B;  4X65 T;  2ACX A;  4PV1 B;  1CSB A;  3AE4 A;  3V5S A;  3B13 A;  1IK7 A;  5CMZ A;  5CFB A;  4TWD A;  5KLV K;  3N2K E;  1L0N K;  4PFP A;  1G8X A;  3H3A A;  2Y0E A;  2Z5I A;  1N36 T;  5CCG D;  3HRN A;  1M62 A;  1H8A A;  5LB7 B;  3FBL A;  1NTK K;  2DW3 A;  5AVZ B;  5LNK A;  5M4Y A;  3CML A;  3SFE C;  3AED A;  3AVS A;  2FXP A;  3V5B A;  3A2A A;  1SQP E;  4LFC T;  1SQV D;  3KXD A;  1KNR A;  3K5B A;  2QA7 A;  5KXJ A;  2FYN C;  4QHO A;  3H37 A;  4LC1 A;  4JI0 T;  1MND A;  3CCJ P;  1ZXG A;  2XAQ B;  1CUN A;  3L72 D;  3B8E B;  1SQP D;  4O2A E;  1J5W A;  4DR1 T;  3CX5 D;  3AEA C;  1BR2 A;  1HJB A;  2JEE A;  5FL0 A;  3RIU C;  5J2U E;  2B87 A;  1NWM X;  3BAT A;  5JR9 A;  3H1L G;  3R84 B;  5L4E A;  4BXL A;  3RL0 g;  5KAI H;  2SPC A;  1ZRT D;  3JC6 D;  4JV5 T;  1EDI A;  4JYA T;  1UGO A;  2CXL A;  2JDI H;  3PUZ F;  3VKH A;  2FBW C;  5AW4 B;  1YTZ I;  2V7I A;  3DTO A;  3TGU E;  2AXT E;  2LXC B;  2BG9 A;  2XQA A;  2DLR A;  3L75 E;  3VR8 A;  3CCM P;  3HD7 B;  3VRB A;  4D6T D;  2BKP A;  2Q9Q D;  3AE9 A;  1YBK A;  3UUM A;  2CPS A;  2WSF H;  1GL2 B;  3KVB A;  4EZ4 A;  3TGU D;  3E1R A;  1FJG T;  4NUU A;  1U5P A;  4EZH A;  3L75 D;  3ONJ A;  3U59 A;  1KZU B;  1PL5 A;  5TJH A;  3MZK B;  4OYJ A;  2XQY A;  4X5T A;  3FXE B;  3GWH A;  4Z1M H;  4CN1 A;  3MZW B;  4KHZ F;  1N7S C;  2XZE A;  3KV6 A;  4I43 B;  5IUX A;  2DWG A;  5CCH D;  4DV4 T;  5KLI B;  2Q7C A;  2E9X C;  4AKI A;  4DV3 T;  1NKZ B;  1VPC A;  2MJZ A;  2E75 C;  3V2P A;  2C5I T;  1NTM K;  4JBW F;  1XNR T;  2GUS A;  2X9Y A;  5APW A;  2CEA A;  5LMU T;  4PAG A;  5KLV E;  4X1K E;  1ZKE A;  4DR7 T;  2MPK A;  2KYV A;  3B5N A;  4L9I A;  2QGS A;  5KLV J;  2YIU C;  4DOJ A;  1JY3 P;  3ESL A;  1L0N J;  3N9O A;  1WYC A;  4OH8 B;  1AJ3 A;  2HH7 A;  1RQU A;  4ZOL E;  2HN1 A;  3TSI A;  1NTK J;  3CX8 B;  4U31 A;  1BE3 D;  1E7P A;  1SQQ D;  4K35 A;  2DWK A;  5AQL B;  1W09 A;  2W00 A;  1M1J A;  2LSK A;  4H0L C;  4UVA B;  3H1J E;  2E42 A;  1VQK P;  3CX7 B;  3Q9D A;  1KQF B;  2JR8 A;  2XM1 A;  2Z6E A;  2ZM0 A;  2N1T B;  1VQ4 P;  2RMZ A;  4WYV A;  1RF1 C;  2YOE A;  1MIW A;  4BJN A;  2OTL P;  2SPZ A;  3Q2Y A;  5HXE A;  3HTK A;  2D5U A;  3N2O A;  2V5C A;  1EZ3 A;  3PUS A;  5JDQ A;  2ZM6 T;  2XSB A;  4DID B;  1NGM B;  3ZT7 A;  3O1I A;  4IRE A;  1S94 A;  4JI8 T;  2NZ2 A;  5FL1 A;  1AVY A;  1BCC D;  3R4Y A;  4OGQ C;  1B7T A;  4HWI B;  3MGN A;  2WIT A;  2JIW A;  4Z91 A;  3RRW A;  5HEU A;  2CPT A;  2FYN B;  1Q90 D;  3CXH H;  3M65 A;  2LXB A;  2CMR A;  1OED A;  1PPJ D;  2V8S V;  1YTZ T;  1KOR A;  2UUB T;  3TNU B;  4IDP A;  2WSF J;  1FIO A;  3QB5 K;  1QEX A;  2D2C D;  4QH4 A;  3F2E A;  1MMD A;  5AVY B;  2LOS A;  2B89 A;  4O2B E;  2WU2 A;  2XQ4 A;  5FXZ A;  2J62 A;  3IA3 A;  1IFP A;  3RKG A;  2M6B A;  4ADZ A;  1X79 B;  3GN5 A;  4U7J A;  1J1J A;  3L39 A;  3HE4 A;  1DEE G;  3HUS A;  3OKQ A;  4HKA A;  4UB6 H;  5KLV G;  4N3Y B;  3TF5 A;  2W67 A;  4ZMD A;  3A0B E;  1L0N G;  4NPF X;  3IAO A;  5F3J A;  1MMA A;  2K48 A;  1YW0 A;  4H44 D;  1KTM A;  1PP9 D;  2Y6X A;  1BGY E;  2K9J B;  4EYY R;  2OYI C;  4MAL A;  4X66 T;  1NTK G;  4KT0 J;  2W6B A;  1HGV A;  3QWO C;  1NTZ E;  2ZYG A;  2KLU A;  4ILA A;  3RPU A;  1OXZ A;  1LJ2 A;  4EYY Q;  5J1G A;  4UB8 H;  2FFD A;  2UXB T;  3RBZ A;  1NTM J;  2N9D A;  4A5X A;  3Q1M A;  1W9R A;  5L8R J;  4DR6 T;  3LDQ B;  2BBH A;  2BBJ A;  4L5G A;  2WSC H;  3ZN0 B;  3HKC E;  2Y9Z A;  2F4V T;  4CXW A;  4OHF A;  3OPC A;  1R8I A;  1WR6 A;  1BSH A;  2UWJ E;  2LT3 A;  3ANW A;  5J0Z A;  5LGN B;  3JC2 2;  2VVN A;  1EZV D;  1VQ5 P;  4AQY T;  2WT7 A;  3P4R A;  1VL2 A;  2KSR A;  3BCC D;  3NBX X;  2JQ9 A;  3RGL A;  4WZX A;  3CCL P;  3IEE A;  3ZMS B;  2BEZ F;  5LP6 E;  1P84 I;  2I0M A;  1N7S B;  5AVS B;  4H9R C;  5GON E;  4KP3 C;  3RYI E;  5AFU L;  2UU9 T;  3P7I A;  5HEG A;  4ZXL A;  2E9X B;  4W7Z A;  2CLY B;  3AEF A;  4AQG A;  3CPW O;  3USS A;  2E75 B;  2WDV A;  1KB9 D;  3LK2 B;  4AUW A;  2YO2 A;  4P09 A;  1BDC A;  1SFC C;  3L70 E;  2CBJ A;  1MNE A;  2G3A A;  1YYC A;  1QL2 A;  1DIP A;  4IIJ E;  3AEG C;  1H7C A;  1P84 E;  5KJ7 C;  2WAU A;  2J5U A;  2M5A A;  3A8Y C;  1N33 T;  2YIU B;  5CCG A;  2KZ7 B;  1KEY A;  4IDO A;  1LWU C;  3UUX B;  1IBK T;  3L70 D;  3RBX A;  4ILC A;  3KZI H;  3I55 P;  2H7O A;  1WR0 A;  2YN6 A;  1P84 D;  4I6M C;  4H0L B;  2NPS D;  3AAA B;  2M0B A;  1I6Z A;  5KMG P;  3MA9 A;  4IDQ A;  2AEM A;  2LKH A;  2NW7 A;  2JO1 A;  4L76 A;  4Z90 A;  1JTH A;  1VF5 D;  4H9S E;  5CJ4 A;  4HJG H;  4JF7 A;  5CBN A;  2X0L B;  4IE6 A;  2O01 N;  2XQ3 A;  2WY2 A;  4EYU A;  4GKK T;  1RF1 B;  1NOH A;  1YIJ P;  2KK7 A;  1NTM G;  4NIQ A;  1H0T A;  4EB6 E;  4UB6 E;  1FZC C;  1E79 H;  4GIF A;  3AA6 B;  4IOI H;  1HG5 A;  1RHZ B;  3II6 A;  4PFO A;  1JCC A;  1FBM A;  2O01 J;  3I1A A;  4B86 A;  5HEO A;  1N73 B;  3AE3 C;  2KWI B;  5C39 A;  3VHL A;  5BVZ A;  3RKO A;  2WDQ A;  4OGQ B;  4B6X A;  3N2G E;  4KI0 F;  1VQP P;  4UV9 B;  1WCR A;  3RH3 A;  2QA4 P;  4AKH A;  2ZT9 C;  1EQ7 A;  5AQQ B;  3NTN A;  2R3S A;  1VQL P;  1MMN A;  1HS7 A;  1T6A A;  3AEE C;  4I55 E;  1IBM T;  2KMF A;  3Q5P A;  4DBQ A;  2VB6 A;  3M0D A;  5F8P A;  2WSC J;  1SQB E;  5J2T E;  2XQ6 A;  1AA0 A;  1VRB A;  1L0L K;  1YKE B;  2CWY A;  3V4Q A;  4P0A A;  2WQY C;  5L2L A;  1FDM A;  5M1B A;  3W68 A;  2V6Y B;  5LCY A;  1LT9 C;  2NW8 A;  3KQG A;  3IHR A;  2A72 A;  3B57 A;  2W62 A;  3N4X A;  4U3F J;  1LVK A;  1GTW A;  3CWB G;  3P4Q A;  2BG9 E;  2OYH B;  2Q6Q A;  3TLV A;  2A2F X;  5FY1 A;  4C91 A;  3NKZ A;  5FY0 A;  5JQG E;  2A06 G;  4UR9 A;  1OZH A;  3Q5D A;  1FC2 C;  5HCJ A;  4DV6 T;  1X0T A;  2GK9 A;  3UU8 A;  1HR0 T;  1XDO A;  2DHR A;  4UF0 B;  3H1I E;  1US7 B;  1Z8U A;  1VQ6 P;  1XMO T;  2A45 I;  1WRD A;  1VQ7 P;  3EHZ A;  5LOV E;  3H1I J;  3ZEF B;  4XBF B;  1NAF A;  4COF A;  2IX7 C;  1YI2 P;  4KHP T;  3KZI E;  2E5L T;  4IST A;  1YJ9 P;  1USD A;  1KFY A;  3AEB A;  3AXJ A;  2ZVO B;  2JJ9 A;  5AW2 B;  5KTB A;  3RX6 A;  4YHJ A;  3LK4 2;  1L4A D;  5IYZ E;  2E74 D;  3C4W A;  2Q9Q C;  5APU A;  3CMA P;  4JI1 T;  1X9B A;  3SFD A;  3E1I A;  5ABF B;  4PK5 A;  2LLY A;  2YDS A;  1URQ C;  1GW3 A;  3UQ4 A;  4PJN A;  3M06 A;  5AQU B;  3H1H D;  2WMN A;  4ZI2 D;  5AVU B;  2FYU D;  5LGT B;  1T2K D;  1JB0 J;  2OAR A;  1S4X A;  1MIY A;  2QJK C;  3BAS A;  4TUY E;  3L4F A;  2XAG B;  5JDN A;  4HE8 A;  3KIN B;  1LWU B;  5L47 A;  2LM2 A;  2M3B A;  1M1K Q;  1X22 A;  2KSE A;  4PD4 D;  1G73 A;  3PUX F;  1JO5 A;  4TNW A;  5L3F B;  5HWX A;  1S2E A;  4U3F G;  2LHR A;  5EK3 A;  5APS A;  2Y48 B;  2KIN B;  3MK7 C;  2V7Q J;  1HNZ T;  1HWT C;  2X51 A;  1SA0 E;  4PJJ A;  4P1N A;  2ZYA A;  4U7I A;  3ZST A;  1Z56 A;  5CBO A;  3O6Q A;  4DUY T;  2KS1 B;  1IFI A;  4HB1 A;  1MFZ A;  2OTJ P;  3KBU A;  1FZG A;  3KBT A;  1KIL D;  3CLQ A;  1L0L E;  3AE8 A;  2W6J H;  2VL8 A;  2W66 A;  3GA8 A;  4DR3 T;  3H3M A;  3RL0 C;  3QOF A;  4AQF C;  4NXM T;  1ZME C;  2P1J A;  1FZC B;  1L0V A;  1L0L J;  2BCC D;  4OFZ A;  3GF7 A;  1GU4 A;  2NR4 A;  3VKG A;  5HXC A;  3CC4 P;  2JQK A;  3KYQ A;  4DV2 T;  3LIE A;  3AA0 B;  4R4L A;  4YY3 T;  2JPF A;  3FB2 A;  1OED E;  2D0T A;  1RE4 C;  4EV6 A;  1MZ9 A;  2QJP C;  4PJ0 H;  5LXT E;  4L73 A;  2L91 A;  2UXC T;  1SQP K;  5EFW B;  2ZT9 B;  2CCQ A;  4HKZ H;  4G2A A;  2YMY A;  3CX5 H;  1CI6 A;  2FXO A;  3PUA A;  3L74 D;  2V1D B;  2LRK A;  5AQG B;  3VMA A;  3RK3 D;  2CBI A;  2GM4 A;  3U1C A;  3IF8 B;  1ZOY C;  2FXM A;  1LT9 B;  4IE7 A;  5LJM A;  3T97 A;  4YXW H;  3PE0 A;  3ZMU B;  5ETW A;  4GK0 E;  2VKD A;  3L73 J;  2X66 A;  2Y0C A;  4GT1 A;  2HPC B;  4HFD A;  3JAE A;  3L8R A;  2Y9Y A;  5DJU B;  3C51 A;  4CZZ B;  2B76 A;  3L37 A;  4OK0 A;  3OJA B;  1A02 J;  2D2C C;  2QM7 A;  3C4Z A;  3ZN1 B;  4YSY A;  2N1T A;  2PJQ A;  4HFH A;  1JM0 A;  1KK7 A;  1M90 Q;  2D0U A;  2YEV C;  1R8E A;  2UXN B;  1HG2 A;  2WU5 A;  1FJP A;  1OW6 A;  4LF9 T;  1QVG O;  5AQH B;  3IN6 A;  2HOD B;  4A97 A;  1GK4 A;  4GDO A;  2W63 A;  4ZZC A;  3MAC A;  5FP3 A;  2KND A;  1U7J A;  2XU6 A;  1ZP0 C;  3F31 A;  1E1H B;  5L4H A;  1H88 A;  1DH3 A;  1LTB C;  2VVS A;  3H1K E;  3MJX A;  1AVO A;  4WVZ A;  2LE8 A;  2W83 C;  1H89 A;  3CC2 P;  2WDR A;  2IBZ G;  2YO3 A;  3H1L D;  1XTG B;  1URQ B;  1KQS O;  4H13 B;  3CX5 I;  3H1K D;  1LTJ C;  2LSJ A;  3OVU A;  3L3P A;  3RIU A;  1M57 D;  2PAJ A;  3P32 A;  4WY4 D;  1T72 A;  1X79 A;  1SQV E;  3AB3 B;  1D0Z A;  3VMY A;  1IJ6 A;  2V7M A;  3E08 A;  4U7Y A;  4PJ0 E;  3PU8 A;  4EGW A;  2O3J A;  4U2Z A;  1SQV J;  5APX A;  1YQ3 A;  2R3C A;  4JI4 T;  2KZI A;  2ZM2 A;  3ABV C;  2ZXE B;  4DT0 A;  3L72 E;  5HEJ A;  4LF5 T;  2G8Y A;  3C98 B;  1U57 A;  3CX5 E;  3L73 G;  3N7N A;  3AE2 C;  3CI9 A;  5AQV B;  1HFA A;  5AQI B;  3RC8 A;  1RE3 A;  4YXD A;  1SQP J;  4QH5 A;  2MYS A;  1JCD A;  2EHO D;  1JY2 P;  4HTE A;  3RYF E;  3AE6 A;  2QE7 H;  1ZRT E;  4ZKU A;  1LT1 A;  2IZ0 A;  3H32 B;  3ZC1 A;  3I56 P;  5AW0 B;  2C9N Y;  2H88 C;  3PP5 A;  3RL0 B;  2WWV A;  3V5U A;  4YFS A;  2BZB A;  3WMM 0;  3TLS A;  4ISS A;  2NPS C;  1VQM P;  5JDF A;  4RO0 A;  2J1D G;  4JYC A;  4TWF A;  4EIJ A;  2IPP A;  2CRB A;  4BA9 A;  2VK9 A;  3AE4 C;  4PK6 A;  1FZB A;  4D6T E;  1G1J A;  3UU5 A;  3AAE B;  2IC9 A;  4BRY A;  1G2C A;  4D6T J;  3FXD B;  1NJI Q;  3JAF A;  2P9B A;  3AE1 A;  2NW9 A;  1BR4 A;  2XAJ B;  3A5X A;  3NVO A;  4AYC A;  2FJB A;  3TGU J;  4RES B;  1QLE D;  4O4J E;  3UFE A;  2N9B A;  2JJL A;  4F6R C;  3IBP A;  3L75 J;  4GOU A;  2B9B A;  3Q3D A;  5ABG A;  2ZYD A;  3AED C;  2X0H A;  1UII A;  4CI3 B;  3P4P A;  4AKG A;  3B5M A;  3N9N A;  5L3G B;  3LSV A;  3OTO T;  2K88 A;  3OYZ A;  1L4A A;  1JY3 O;  3BRV B;  1Q82 Q;  3GMA A;  2HPJ A;  2HLO A;  5C3J A;  5TIS H;  3ZMT B;  1MUU A;  2JRK A;  3A0B H;  1S1C X;  4PV1 D;  1NYH A;  1RY3 A;  4Y28 J;  1NTZ K;  1OVR A;  2E76 C;  5JR9 C;  2VQE T;  4KHX A;  4PK4 A;  2MBG A;  1SQP G;  3RK2 C;  4YLH A;  1BE3 E;  1SQQ E;  5JRC A;  4EIW A;  4JI3 T;  2X0Y A;  3N9Q A;  1J1E C;  1OIP A;  4CN6 A;  4AIU A;  1LTG C;  4NUV A;  5AQS B;  4O8S A;  3OYX A;  3ZYM A;  1HGZ A;  1N73 A;  4C90 A;  1JOC A;  2BG9 C;  3E0Z A;  5AW1 B;  1EXI A;  4P0B A;  3ETV A;  1XMQ T;  1GD2 E;  4IE4 A;  5B66 H;  1IAP A;  3K1S A;  5KKZ C;  2ODV A;  2R5B A;  3AE9 C;  2QEX P;  2HYN A;  2KB7 P;  4GOE A;  3OBV E;  4HWF A;  1KB9 H;  2HG5 D;  1SLQ A;  3MP7 B;  3Q5X A;  3H1J J;  2JQQ A;  3JCU E;  3Q5S A;  1KIL A;  3QH9 A;  4D6T G;  1HBW A;  4X64 T;  1IFD A;  1BCC E;  4DV0 T;  1L0N D;  1NU1 E;  2W90 A;  2XJ7 A;  2E8I A;  3TGU G;  2E74 C;  2W2U A;  3UU4 A;  3CCR P;  1NTK D;  1FZE A;  3L75 G;  4FJO A;  4CQI A;  2OYH A;  5A1L A;  5KAF H;  1P84 H;  1NU1 D;  1PPJ E;  1N86 A;  2HN2 A;  1WFD A;  4HGA A;  4YJ2 E;  2IYO A;  1JEK A;  3UUN A;  4UF0 A;  3B5N C;  2XZR A;  1GW4 A;  2B1E A;  3HD7 D;  1HX1 B;  3AA1 B;  2BS4 A;  1YQ4 A;  4JYB A;  3AA7 B;  2L5G B;  5JDL A;  1NO4 A;  1GL2 D;  3I9W A;  1X9V A;  1RF0 A;  5CJ5 A;  4YJ3 E;  1OVV A;  3V6I A;  1M1J C;  1PP9 E;  3O4X E;  2XKM A;  4TT3 H;  5L3C B;  1KN7 A;  4K3A A;  1EZV I;  5TIS E;  3LID A;  1PP9 J;  4O4I E;  5DAB A;  1N7L A;  2FJD A;  5AQP B;  1U7M A;  1YJN P;  2W61 A;  1PGO A;  3EVY A;  3D71 A;  1QX8 A;  1OMI A;  4ASV A;  2GUV A;  2PTF A;  2P7J A;  1FZF A;  5AQR B;  2V7K A;  5ABF A;  2YU2 A;  4JEU B;  3TLU A;  4PJL A;  3CPZ A;  1BGY J;  3X1D A;  1KD1 Q;  2VKJ A;  1KNP A;  4B3S T;  4I7Z C;  4LFB T;  1KB9 I;  1W0B A;  1BDD A;  1NTZ J;  1EZV E;  1WMK A;  1UUR A;  1SQX D;  2WBL A;  2WSS V;  3BCC E;  2LKG A;  3H1J G;  1HH0 A;  3N9L A;  2GA1 A;  2IFM A;  3W67 A;  1SQB K;  1A02 F;  4WWI A;  5B66 E;  1PV3 A;  4B3M T;  5HAX A;  4YHH T;  3WUT A;  5AVQ B;  1QUU A;  2KI7 B;  2XM2 A;  5AQN B;  4HFB A;  1OED C;  1KB9 E;  2PBI A;  3EWK A;  2XTL A;  1FU1 A;  3K3O A;  1UCU A;  2RN0 A;  5JRE A;  4IE0 A;  2N1T D;  2WSE H;  4HWD A;  2X67 A;  4JQ0 D;  4ZZB A;  2B87 B;  4DMW A;  2BS2 A;  4A56 A;  4EAH A;  4ZI3 C;  2E76 B;  2MAW A;  2BEQ D;  2I1J A;  2R44 A;  1OW8 A;  3HUS C;  3AE5 A;  5JR9 B;  4MBQ A;  4CI2 B;  2AXC A;  3EUH A;  5DQV A;  4UVB B;  1EC5 A;  3RK2 B;  1LKX A;  4U3C A;  4WY4 A;  5KAF E;  3L70 J;  3QC9 A;  3A7O A;  1N2D C;  2K37 A;  1BSN A;  3ZJ1 A;  2JP3 A;  2WPQ A;  5GTH E;  2KNC A;  2X68 A;  3C64 A;  2FFD C;  2X9X A;  4QXC B;  2KZJ A;  3NZP A;  3D6Z A;  5LJN A;  2BG9 B;  4QXB B;  5HXR A;  3M91 A;  3ZDM A;  5KKZ B;  4BJM A;  4HWH A;  1GDT A;  1JNR A;  1N32 T;  1DD4 A;  2A45 H;  3SWF A;  4DUZ T;  4CXY A;  1WRG A;  2EHO A;  3LBX A;  1SVF A;  2OQQ A;  2YMK A;  3CWB D;  3N9P A;  2UXX B;  1BGY G;  3AE7 A;  3MUD A;  3ZMZ B;  1FMW A;  4JUY A;  1FS0 E;  1NTZ G;  3GHG A;  4G63 A;  2D9D A;  4L0R A;  5BU5 A;  3PTZ A;  2A06 D;  3KVA A;  4MLK A;  2XQ9 A;  5H6Q B;  4PD4 H;  2IDB A;  3AEF C;  4M3L A;  2WSS H;  3G06 A;  5AW3 B;  3VRA A;  3OJA A;  4H9P C;  2LOP A;  3JSV C;  3EDU A;  5HEH A;  1FZA A;  3B5N B;  4QMA A;  4ANJ A;  3SWK A;  3CCQ P;  2J59 M;  3SS1 A;  1VCT A;  5CCG C;  5B5E E;  1EDJ A;  1AQ5 A;  2HOD A;  1FAV A;  1J1D C;  3IF4 A;  2K5B B;  2FJA A;  3G6E P;  1LGH B;  1UIX A;  4DND A;  2QRX A;  4B3R T;  1DD3 A;  1M1J B;  2K24 A;  4JI5 T;  3ZT5 A;  1SQB J;  5EZY E;  4IHJ E;  5H6R B;  3IR9 A;  2PRR A;  3L70 G;  2OGU A;  1WT6 A;  1FOS F;  1N7S D;  2IAK A;  3KV9 A;  3RGU A;  2JKV A;  3EFG A;  4DV7 T;  4H9Q C;  1YJW P;  2E9X D;  3HE5 A;  2OYI B;  2E75 D;  1AQT A;  3HTK B;  3EI0 A;  4I4T E;  3T1Y T;  3Q2M A;  3FZH B;  4N78 E;  2RP4 A;  1Q2N A;  3O1H A;  2YDQ A;  3CCV P;  5CJ0 A;  1PGP A;  4EOZ B;  5DQW A;  2L9Q A;  2HFE D;  3BQL A;  1R5S A;  3TYY A;  3JC6 C;  1NEK A;  2QM8 A;  3M0A A;  3EDV A;  2Z4E A;  1BR0 A;  3E7K A;  2VQF T;  4U3F D;  4U74 A;  3JCF A;  2IDO B;  2VAS A;  2H89 A;  5CA1 E;  4N78 D;  3LK3 B;  5L3D B;  2WPS A;  1FJK A;  1VCS A;  3P8C D;  4Y99 C;  2ZVN B;  3CCS P;  4IFF A;  1JNZ A;  2XHE B;  4GK5 E;  3ZPO A;  2P58 A;  4PD4 I;  5AW6 B;  1OED B;  4WNK A;  4MHC A;  4H0L D;  1XWM A;  4NPE A;  3M9Q A;  3H1H E;  3M0D C;  3CQG B;  3CC7 P;  2LKM A;  2WPR A;  4QX7 B;  3Q5R A;  4X1Y E;  2WWU A;  2FYU E;  2CHO A;  2H7V C;  4TZ4 C;  4L75 A;  2NWB A;  2WP9 A;  3H1H J;  1QVF O;  2K3R A;  3B71 A;  2FJE A;  4HH2 A;  4WB4 A;  2MOZ A;  2H8P D;  3GN5 B;  1D7M A;  5BU8 B;  2FYU J;  1ZEE A;  4KJM A;  2DNX A;  1SFC B;  2D2S A;  2L8K A;  4PD4 E;  4CPG A;  4YTP A;  4DR2 T;  4GYR A;  5FYM A;  5EK4 A;  3MTU E;  5CCH C;  3C50 A;  4AKL A;  3CCU P;  1K05 A;  2K1A A;  2V4H A;  2BKN A;  3ZMV B;  4HFE A;  3ZT6 A;  5AQK B;  2LSY A;  4PV1 C;  3LFM A;  3D6Y A;  3RYC E;  3NFQ A;  5AQM B;  1SQB G;  4OGQ D;  2FFD B;  4HFI A;  2XPK A;  1KIL E;  3R6N A;  1Y9B A;  3FX0 A;  4L74 A;  4LFA T;  1NVO A;  3L71 E;  1WLX A;  4IGU A;  2WCA A;  1D0X A;  2NTX A;  3HD7 A;  1AJY A;  2BCC E;  1Y01 A;  3RQU A;  3AEB C;  3VR9 A;  1MIV A;  1S35 A;  3ANW B;  4ZEY A;  1GL2 A;  1T3U A;  3HI2 A;  1QGK B;  3GLM A;  2BCC J;  3L71 D;  2WT7 B;  5JDM A;  3CQX C;  3H1I G;  3ONX A;  3M9H A;  1KYO D;  1SQV K;  3PH0 A;  4HYT B;  2K9Y A;  3FXE A;  2IIU A;  3SFD C;  2JMK A;  2WB5 A;  1HX8 A;  1Q86 Q;  2XY8 B;  3F57 A;  1Y8A A;  2FY8 A;  5AW9 B;  3L74 E;  3SWH A;  2YNY A;  5LBM A;  4GYS A;  2PG8 A;  3BVH A;  3HR0 A;  2I8D A;  3RK3 E;  3AEC A;  3L74 J;  1IJ5 A;  4WBN E;  2HPL A;  5LBQ B;  4EEB A;  2PP6 A;  2QYW A;  2E43 A;  4ZNC A;  5CB4 E;  3T8O A;  2M5A B;  1KFM A;  2YXR B;  2A45 G;  1BR1 A;  4DMV A;  1J1D B;  3G3Z A;  3VYI A;  3CCE P;  3RQW A;  3OW2 O;  3J9X 1;  3O1J A;  1ZN5 A;  3UQ7 A;  2M3E A;  3PJS K;  3U3I A;  4H63 V;  1X8Y A;  1IZN B;  2IBZ D;  2W4X A;  5APT A;  4NPP A;  3Q5E A;  2J47 A;  1KMI Z;  2J4G A;  4BAY B;  1JTH B;  4ILU A;  3G4S P;  1YKH B;  5AVR B;  3FHN A;  4LGD E;  1OVU A;  3AE8 C;  1YXR A;  3A0H H;  3ONL C;  2OLT A;  1PFI A;  2E5Y A;  2LSI A;  3U78 A;  2Q3I A;  4JPZ B;  1H0T B;  4XE5 B;  3P4S A;  4OYK A;  3C8V A;  3ITK A;  3CIR A;  5LHI B;  1VQ9 P;  1CHU A;  2FKW B;  2VUR A;  3FZK B;  1ZLL A;  2X9H A;  4JLE A;  1L2P A;  4IL6 X;  4X1I E;  2M6I A;  3B4S A;  1UK5 A;  4TWH A;  2NTY A;  4ERR A;  3RHW A;  1N34 T;  4H44 C;  3QUJ A;  2R32 A;  3L73 D;  3SWY A;  1IO4 A;  2BCC G;  1T7S A;  4OWF A;  5K5G B;  2Q3E A;  3TKL B;  2ITA A;  4GOF A;  5FVL A;  1L0L G;  3RIA A;  3H1L E;  4Y99 B;  1RH5 B;  3SFE A;  5FXX A;  1M8O B;  4CI1 B;  2E5V A;  4GKG A;  3CWZ B;  2LEH A;  3T1H T;  2Q9Q B;  4DR4 T;  3VN0 A;  2LSG A;  2ZM8 A;  3H1K J;  3CX6 B;  3TNU A;  5LA6 E;  2IC6 A;  4IDZ A;  1GZL A;  4B3T T;  3GW6 A;  1K9M Q;  3AEA A;  5C8Y E;  2YXQ B;  4JI2 T;  1JY2 O;  3ZLI A;  1SQQ K;  1J2J B;  1KV4 A;  4A7P A;  2QJK B;  3KDP B;  2KP8 A;  4IFM A;  3SOL A;  2N1T C;  2CM0 A;  3UFG A;  4TV9 E;  2N9Y B;  5CHX A;  2K9J A;  1YD8 G;  2FBW A;  2ZT9 D;  5AVT B;  3W15 B;  2BS3 A;  3L72 J;  2XQ5 A;  2NOX A;  4H63 H;  2V26 A;  1OX3 A;  1S9K E;  4WBA A;  3QB5 A;  3AXJ B;  1IBL T;  1XTC C;  3LJC A;  3PUG A;  1MFT A;  1OWA A;  3K8P C;  4JEH B;  3MD0 A;  5HCM A;  1NU1 K;  4KMC A;  3RRC A;  3WI3 A;  3JCU H;  3UU3 A;  1W5C E;  3P7K A;  3CD6 P;  1S9K D;  2WZH A;  3RLF F;  2XQ8 A;  3VP9 A;  4IL6 H;  5APY A;  5BR8 T;  3A0H E;  1VF5 C;  3DP7 A;  1N7S A;  4U33 A;  2KSJ A;  2QJP B;  1I94 T;  5LMN T;  2E9X A;  2XAH B;  3D0T A;  4I0U A;  4QWN B;  3TLT A;  1LP1 B;  3CK6 A;  4HFC A;  1KF6 A;  3CQC B;  2HHH T;  2FYZ A;  1AFO A;  5JDH A;  2PGD A;  1O3X A;  1EDK A;  1YQ3 C;  3H1K G;  3QNU A;  1M7K A;  4DJG A;  2HR3 A;  2L3L A;  2IZ1 A;  5H2F H;  4M1P A;  1FOS E;  2ZAE B;  4GIW A;  1RE3 C;  4YXD C;  3LW5 H;  3VU7 H;  2A9U A;  5LG4 A;  4BWN A;  3O6Q B;  5JDG A;  1HTL C;  2XNX A;  2P10 A;  3AE6 C;  2JMH A;  3PUW F;  1SQV G;  4IL9 A;  5DJT B;  3WU2 H;  1HVV A;  1SQX K;  4AI6 A;  4YTN A;  2D2C B;  3PTR B;  1URQ D;  5DJQ C;  4R4M A;  3M9B A;  2CWO A;  4H13 D;  4K0U A;  1RF1 A;  3L72 G;  1SS1 A;  2CA5 A;  3UT5 E;  5ABH A;  2W0G A;  2NP9 A;  1IJD B;  2O1K A;  3BRT B;  3H25 A;  4GKJ T;  2C0X A;  2JQH A;  4H44 B;  2OTK E;  1CZQ A;  2CLY C;  3NRY A;  1BE3 J;  1SQQ J;  4C7N B;  2C0W A;  2ZMA A;  3PDY A;  5LGU B;  5L3B B;  3AE1 C;  3PHL A;  3K3N A;  3BQI A;  1NWQ A;  2YK0 A;  1CI6 B;  4UVC B;  1T98 A;  2WPV B;  1L0N E;  2LHN A;  5FMN A;  1IC2 A;  4XFJ A;  5APV A;  3KV4 A;  4CN4 A;  3BQK A;  1IK9 A;  2BAS A;  4WW0 A;  1ZW0 A;  1VOM A;  1MMG A;  2AEF A;  2G0U A;  1NTK E;  2V7L A;  3A5T A;  2A3D A;  3PUQ A;  2PFV A;  2E5T A;  3OAK A;  1K8A Q;  1XDP A;  4MN4 C;  1VQN P;  1ZR4 A;  2KLQ A;  5KLV D;  3ETU A;  3T97 B;  2V5D A;  4ASW A;  1L4A C;  1LTJ B;  3RL0 D;  3PRJ A;  4IT4 A;  4IL6 E;  2M67 A;  2V6Y A;  5AW5 B;  2Y8D A;  2DI4 A;  3UUB A;  1BCC J;  1NU1 J;  5AQF B;  3NWI A;  4EI2 A;  4XA4 A;  1JNM A;  5JH7 E;  3C1L A;  3NRX A;  1M7L A;  4H9N C;  4IDN A;  1VDF A;  5F5W A;  3ZCI A;  2VWA A;  4X62 T;  2OYI A;  5GTH H;  4V1A v;  3H1J D;  1J5E T;  2DCF A;  3F89 A;  3R2P A;  5KAI E;  4ZI2 C;  1W2B O;  2C5K T;  4QXH B;  1T2K C;  1EXJ A;  4I50 E;  4TN7 B;  1VQ8 P;  1D0Y A;  2P67 A;  1MV8 A;  2CPB A;  3ZSS A;  5H2F E;  5HWY A;  5AW7 B;  1N73 C;  3ZYL A;  4LF8 T;  1IFJ A;  1E5W A;  1NKN A;  2WTY A;  3OA7 A;  2V7J A;  4HFV A;  2KT9 A;  5AVW B;  2JWD A;  2ZFC A;  3P8M C;  2ACZ A;  5AQO B;  3LW5 J;  2NPS B;  1QLB A;  2ES0 A;  5JVD E;  2KLV A;  3L35 A;  3WU2 E;  2ZLY A;  4ZS3 A;  1Q7Y Q;  4KX6 A;  1GQE A;  3PJA A;  1BE3 G;  5FXV A;  1SQQ G;  2PFX A;  1VF5 B;  1M56 D;  1SQX E;  3NZQ A;  1KIL C;  5FY7 A;  4LMK A;  1DEB A;  2I59 A;  1KC8 Q;  4TV8 E;  1SHZ C;  2VL0 A;  2WWW A;  1EDL A;  1CW5 A;  1HF9 A;  1SQX J;  1NAY A;  1PIX A;  3GMI A;  5LHG B;  3EAB A;  1UX4 A;  2KXP B;  5E0O A;  4A98 A;  1SFC A;  2RKL A;  2OYH C;  2OV9 A;  2O01 H;  3NXS A;  4LML A;  3AEG A;  4LLH A;  1JMB A;  5KJ7 A;  4ZI7 E;  2O1J A;  3V2N A;  5B5E H;  3KHU A;  3BCC J;  3M3Z B;  1NTM E;  2OA5 A;  1LWU A;  2YKQ A;  4EOT A;  2FUP A;  4UIG A;  1WYB A;  4TX5 A;  1JY2 N;  4U2Y A;  3PV0 F;  2YIN A;  1UX5 A;  1BCC G;  1NU1 G;  3VOP A;  1R5L A;  3WUV A;  1YQ4 C;  3S4U A;  2C0S A;  1LTI C;  1K73 Q;  1BGY D;  2IUB A;  1Q81 Q;  3N5L A;  4GOD A;  1RF0 C;  1NTM D;  5AVX B;  1NTZ D;  3RK3 C;  4UEL A;  2KS1 A;  2WZ7 A;  2Q1K A;  1YHQ P;  4EED A;  3RIF A;  3G71 P;  2LJL A;  2WMM A;  4QKN A;  2Y0D A;  2R5D A;  4DO0 A;  1PPJ G;  1FMV A;  1KFN A;  4AIS A;  4F8H A;  1S3J A;  4W80 A;  3TK1 A;  2QJY C;  1LRZ A;  2IYP A;  1FZC A;  5LHH B;  2WS3 A;  4NXN T;  2AE9 A;  3TDK A;  3UUL A;  2YKP A;  3C4X A;  4UV8 B;  3V2R A;  1J1E B;  3FBZ A;  1Y64 B;  1MKM A;  2LRL A;  1KQG B;  3LG7 A;  5CA0 E;  2ODU A;  5KX5 E;  3A3Y B;  5LYJ E;  4JI7 T;  3VTP C;  4BRY B;  1G2C B;  3FWL A;  3AE3 A;  3CXH I;  3RI5 A;  4Q25 A;  5IHY A;  4C46 A;  3CWB E;  1PP9 G;  1HCI A;  1U4Q A;  2MKV A;  3I0Q A;  1LVF A;  5AQJ B;  1PGQ A;  1NEN A;  4E7Z A;  2J58 A;  1VQO P;  3CWB J;  5E79 H;  2A06 E;  1OFC X;  2YKS A;  3AEE A;  3AAI A;  4HEA A;  2FYU K;  3O8Z A;  2BDE A;  2KWH A;  5CGM A;  2BVM A;  3EFF K;  3FWN A;  3K3Q C;  4NPD A;  1SQX G;  2X9W A;  4ZS2 A;  1GU5 A;  3TLW A;  2POH A;  4FI5 A;  4U72 A;  3CXH E;  3ZCJ A;  3V4W A;  1L4A B;  2WQY A;  2QG4 A;  4LF4 T;  4YSZ A;  1LT9 A;  2E74 B;  2Q9I A;  1EZV G;  3CME P;  1D1A A;  2BKO A;  2HPC A;  4RJT A;  3BCC G;  3PLN A;  4TLF A;  4PNI A;  2XAF B;  3CXH D;  2VRS A;  4HN9 A;  1AV1 A;  3AE5 C;  3FZL B;  4UXN B;  1JY3 N;  2I1K A;  2IHR 1;  3G9R A;  2AEJ A;  4WY4 C;  1K04 A;  3PU3 A;  5JRC B;  3D70 A;  5ABE A;  3HKE E;  4ZHQ E;  4LF7 T;  3FZF B;  3S4R A;  2N1G A;  1DU2 A;  4QH1 A;  4UB8 E;  1KYO H;  5FVK A;  1OW7 A;  3L09 A;  2V7Q H;  4K0K T;  3UTK A;  1UUS A;  3WAK A;  4W7Y A;  2YKO A;  1HF8 A;  3KFW X;  3P4W A;  4XZC A;  1DX7 A;  2EHO C;  2Q9Q A;  2WM9 A;  3AVR A;  4I1L A;  4UEM A;  3AE7 C;  3MUD C;  1KIL B;  1ZV8 A;  4CXX A;  2UUC T;  1W2E A;  4U3F E;  2WSE J;  3GHG C;  2DL1 A;  1S5L X;  1Z0P A;  5FNV E;  2E76 D;  1URQ A;  4ASK A;  1SP4 A;  5LG3 A;  5HXS A;  4I7Z B;  3MIW A;  1XZY A;  2IFN A;  2NRG A;  3RK2 D;  3P8C E;  1SQB D;  2W8Z A;  4IL4 A;  3WAJ A;  4N6J A;  1PGJ A;  2MTQ A;  3F5H A;  5CCH A;  2Q5U A;  3HKB E;  3PUY F;  4HWC A;  3EQ2 A;  4KBM B;  3WUU A;  4KUM B;  4EXT A;  2YU1 A;  1KQL A;  2V6X A;  1FE6 A;  2R6G F;  3IFM A;  3HA4 A;  3ZJ2 A;  2XQ7 A;  4LMJ A;  5HYA A;  1RQV A;  4YSX A;  2XSA A;  5E79 E;  4MFR A;  1JUN A;  2OYO A;  1SUM B;  4EDF A;  2H7H A;  2QVA A;  2VKO A;  3U1A A;  3RK3 B;  1PZQ A;  3H1I D;  5FKY A;  4OVN F;  2ZJS E;  5HXH A;  2CE7 A;  2N2N A;  2UXD T;  3HE4 B;  3HUS B;  3H32 A;  3VP8 A;  1ZR2 A;  1V9D A;  3I0O A;  3P50 A;  2QJY B;  2XV5 A;  3CL3 D;  1D1B A;  4AQF A;  2H3R A;  4H9O C;  3ZC0 A;  3CKD A;  3ZYK A;  1KYO I;  3E22 E;  3MHV A;  4AXP A;  2IML A;  1QSD A;  4E7S A;  1G1I A;  1RE4 A;  4O9B A;  4AQR D;  4IE5 A;  3I5C A;  2ZXX A;  4H13 C;  3J7Y q;  1FEW A;  4JBZ A;  4DV5 T;  5KDM C;  1LP1 A;  4PW8 A;  2YDR A;  2P2U A;  3B5N D;  3FXD A;  1GMJ A;  1Y47 A;  2H43 A;  2C9L Y;  2LM9 A;  1N8R Q;  5JTG A;  1NHL A;  2W6A A;  3L71 J;  2H89 C;  1SE7 A;  1KYO E;  5IWA T;  2CXF A;  2W27 A;  3L36 A;  1LTS C; 
#chains in the Genus database with same CATH homology
 1LTT C;  3VMX A;  3VMZ A;  4AKR B;  1ZHC A;  3HL6 A;  5AW8 B;  3N9M A;  3PUR A;  2M8R A;  4QX8 B;  3V2Q A;  3MXZ A;  4WY4 B;  2Z5H A;  2K9A A;  1T8Z A;  3BK9 A;  4DZO A;  5BMV E;  3KPE A;  1IFM A;  3NMD A;  3H6P A;  4O4L E;  4C7N A;  5TAO A;  5EK2 A;  2KOG A;  2WMO A;  1JMM A;  5ADX L;  3QK6 A;  3C9I A;  2XAS B;  3RYH E;  4C7R A;  1ZV4 X;  3HD7 C;  4ZKP A;  3O9X A;  5FXW A;  1GL2 C;  2EHO B;  3LBX B;  4DVD A;  4O4H E;  1IFN A;  4XAX B;  3GHG B;  4WBO A;  4ZI3 D;  1KNZ A;  2RA1 A;  1SFC D;  4IFD K;  1LTJ A;  2XDJ A;  2C5J A;  5KJ7 D;  5AVV B;  1QL1 A;  5L3E B;  2XUE A;  3RC3 A;  3KV5 A;  4PJM A;  1HUC A;  3Q5W A;  1T3J A;  4I2L C;  1D1C A;  4DBR A;  4Z8X A;  1HTJ F;  2CXD A;  3KDS E;  3SRZ A;  3DJB A;  5APQ A;  3HKD E;  3MKD A;  2VKH A;  1GK6 A;  3UIA A;  3CVR A;  4J2C A;  1LTA C;  1NH4 A;  3I9Y A;  2NPS A;  2IW5 B;  2BVL A;  4X20 E;  3HE5 B;  2ACX A;  1CSB A;  3V5S A;  3B13 A;  5CMZ A;  5KLV K;  3N2K E;  1L0N K;  4PFP A;  1G8X A;  3H3A A;  2Z5I A;  5CCG D;  3HRN A;  1H8A A;  3FBL A;  1NTK K;  5AVZ B;  5LNK A;  5M4Y A;  3CML A;  3AVS A;  3V5B A;  3A2A A;  2QA7 A;  4QHO A;  3H37 A;  4LC1 A;  1MND A;  2XAQ B;  1CUN A;  3B8E B;  4O2A E;  1BR2 A;  1HJB A;  2JEE A;  5J2U E;  1NWM X;  3BAT A;  5JR9 A;  3R84 B;  2SPC A;  3JC6 D;  2CXL A;  3VKH A;  5AW4 B;  1YTZ I;  2V7I A;  3DTO A;  2DLR A;  3HD7 B;  2Q9Q D;  3UUM A;  2CPS A;  2WSF H;  1GL2 B;  3KVB A;  4EZ4 A;  4NUU A;  1U5P A;  4EZH A;  3U59 A;  1KZU B;  3MZK B;  4OYJ A;  2XQY A;  3FXE B;  3GWH A;  1N7S C;  3KV6 A;  4I43 B;  2DWG A;  5CCH D;  2Q7C A;  2E9X C;  4AKI A;  1NKZ B;  1VPC A;  2MJZ A;  3V2P A;  2C5I T;  1NTM K;  2GUS A;  2X9Y A;  5APW A;  2CEA A;  4PAG A;  4X1K E;  1ZKE A;  2KYV A;  3B5N A;  4L9I A;  2QGS A;  4DOJ A;  1JY3 P;  3ESL A;  3N9O A;  1WYC A;  4OH8 B;  1AJ3 A;  2HH7 A;  4ZOL E;  3TSI A;  3CX8 B;  2DWK A;  2W00 A;  1M1J A;  2LSK A;  4UVA B;  2E42 A;  3CX7 B;  3Q9D A;  2ZM0 A;  2Z6E A;  2N1T B;  1RF1 C;  4BJN A;  1MIW A;  5HXE A;  3HTK A;  2D5U A;  3N2O A;  1EZ3 A;  3PUS A;  5JDQ A;  3O1I A;  1S94 A;  1B7T A;  3MGN A;  2WIT A;  3RRW A;  3M65 A;  2CMR A;  1YTZ T;  3TNU B;  1FIO A;  3F2E A;  1MMD A;  5AVY B;  2LOS A;  4O2B E;  5FXZ A;  4ADZ A;  1X79 B;  3GN5 A;  3HE4 A;  3HUS A;  3OKQ A;  4HKA A;  4N3Y B;  5F3J A;  1MMA A;  2K48 A;  1YW0 A;  2Y6X A;  4EYY R;  2OYI C;  4MAL A;  2W6B A;  1HGV A;  3RPU A;  1OXZ A;  5J1G A;  2FFD A;  2N9D A;  4L5G A;  2WSC H;  3ZN0 B;  3HKC E;  4CXW A;  4OHF A;  1WR6 A;  2LT3 A;  3ANW A;  5LGN B;  2WT7 A;  3NBX X;  3ZMS B;  3IEE A;  5LP6 E;  1N7S B;  5AVS B;  4H9R C;  5GON E;  4KP3 C;  3RYI E;  5AFU L;  3P7I A;  2E9X B;  4W7Z A;  2CLY B;  4AQG A;  3LK2 B;  4AUW A;  2YO2 A;  4P09 A;  1SFC C;  1MNE A;  1YYC A;  1QL2 A;  4IIJ E;  1H7C A;  5KJ7 C;  2WAU A;  5CCG A;  2KZ7 B;  1LWU C;  3UUX B;  2H7O A;  4I6M C;  2NPS D;  3AAA B;  5KMG P;  3MA9 A;  2NW7 A;  1JTH A;  4H9S E;  5CJ4 A;  4JF7 A;  2X0L B;  4IE6 A;  4EYU A;  1RF1 B;  1NOH A;  4EB6 E;  1FZC C;  4GIF A;  3AA6 B;  1HG5 A;  3II6 A;  4PFO A;  1JCC A;  1FBM A;  3I1A A;  4B86 A;  1N73 B;  2KWI B;  3VHL A;  5BVZ A;  3RKO A;  4B6X A;  3N2G E;  3RH3 A;  4UV9 B;  4AKH A;  1EQ7 A;  3NTN A;  1MMN A;  1HS7 A;  4I55 E;  2KMF A;  4DBQ A;  2VB6 A;  3M0D A;  5F8P A;  5J2T E;  1VRB A;  1L0L K;  1YKE B;  2CWY A;  3V4Q A;  4P0A A;  5L2L A;  1FDM A;  5LCY A;  1LT9 C;  2NW8 A;  3KQG A;  3IHR A;  2A72 A;  3B57 A;  2W62 A;  3N4X A;  1LVK A;  1GTW A;  2OYH B;  2A2F X;  5FY1 A;  4C91 A;  5FY0 A;  5JQG E;  2GK9 A;  2DHR A;  4UF0 B;  1US7 B;  2A45 I;  1WRD A;  5LOV E;  3ZEF B;  4XBF B;  1NAF A;  2IX7 C;  4IST A;  2JJ9 A;  5AW2 B;  5KTB A;  3RX6 A;  4YHJ A;  3LK4 2;  1L4A D;  5IYZ E;  3C4W A;  2Q9Q C;  5APU A;  3E1I A;  4PK5 A;  1URQ C;  1GW3 A;  4PJN A;  3M06 A;  2WMN A;  4ZI2 D;  5AVU B;  5LGT B;  1T2K D;  2OAR A;  1MIY A;  3BAS A;  4TUY E;  3L4F A;  2XAG B;  5JDN A;  4HE8 A;  3KIN B;  1LWU B;  2M3B A;  1G73 A;  1JO5 A;  5L3F B;  5HWX A;  2LHR A;  5EK3 A;  5APS A;  2Y48 B;  2KIN B;  3MK7 C;  1HWT C;  2X51 A;  1SA0 E;  4PJJ A;  1Z56 A;  1IFI A;  1MFZ A;  3KBU A;  1FZG A;  3KBT A;  1KIL D;  3CLQ A;  2VL8 A;  3GA8 A;  3RL0 C;  4AQF C;  2P1J A;  1FZC B;  4OFZ A;  1GU4 A;  3VKG A;  5HXC A;  3KYQ A;  3LIE A;  3AA0 B;  2JPF A;  3FB2 A;  2D0T A;  1RE4 C;  1MZ9 A;  5LXT E;  1SQP K;  2CCQ A;  4G2A A;  2YMY A;  1CI6 A;  3PUA A;  2V1D B;  3RK3 D;  2GM4 A;  3U1C A;  3IF8 B;  2FXM A;  1LT9 B;  4IE7 A;  5LJM A;  3T97 A;  3ZMU B;  3PE0 A;  5ETW A;  4GK0 E;  2VKD A;  2X66 A;  4GT1 A;  2HPC B;  4CZZ B;  3C51 A;  3L37 A;  4OK0 A;  3OJA B;  1A02 J;  2QM7 A;  3C4Z A;  3ZN1 B;  2N1T A;  2PJQ A;  1KK7 A;  2D0U A;  2YEV C;  2UXN B;  1HG2 A;  1FJP A;  2HOD B;  1GK4 A;  2W63 A;  3MAC A;  5FP3 A;  2KND A;  2XU6 A;  3F31 A;  1E1H B;  1H88 A;  1DH3 A;  1LTB C;  3MJX A;  2LE8 A;  1H89 A;  2YO3 A;  1XTG B;  1URQ B;  1LTJ C;  2LSJ A;  3L3P A;  3P32 A;  2PAJ A;  4WY4 D;  1X79 A;  3AB3 B;  1D0Z A;  3VMY A;  1IJ6 A;  2V7M A;  3E08 A;  3PU8 A;  5APX A;  2R3C A;  2ZM2 A;  2ZXE B;  3C98 B;  3N7N A;  3CI9 A;  1HFA A;  3RC8 A;  1RE3 A;  2MYS A;  1JCD A;  2EHO D;  1JY2 P;  4HTE A;  3RYF E;  4ZKU A;  3H32 B;  3ZC1 A;  2C9N Y;  5AW0 B;  3V5U A;  3PP5 A;  3RL0 B;  4YFS A;  2BZB A;  3WMM 0;  4ISS A;  2NPS C;  5JDF A;  2J1D G;  4JYC A;  4EIJ A;  2IPP A;  4BA9 A;  2VK9 A;  4PK6 A;  1FZB A;  1G1J A;  3AAE B;  2IC9 A;  1G2C A;  3FXD B;  2P9B A;  2NW9 A;  1BR4 A;  2XAJ B;  3A5X A;  4AYC A;  4RES B;  3UFE A;  4O4J E;  2N9B A;  2JJL A;  4F6R C;  3IBP A;  4GOU A;  4CI3 B;  4AKG A;  3N9N A;  5L3G B;  3OYZ A;  1L4A A;  1JY3 O;  3BRV B;  2HPJ A;  2HLO A;  3ZMT B;  1MUU A;  2JRK A;  1RY3 A;  1NTZ K;  5JR9 C;  4KHX A;  4PK4 A;  2MBG A;  3RK2 C;  4YLH A;  5JRC A;  4EIW A;  3N9Q A;  1J1E C;  1LTG C;  4NUV A;  4O8S A;  3OYX A;  3ZYM A;  1HGZ A;  1N73 A;  4C90 A;  1JOC A;  3E0Z A;  5AW1 B;  4P0B A;  3ETV A;  1GD2 E;  4IE4 A;  1IAP A;  2ODV A;  2R5B A;  2HYN A;  2KB7 P;  3OBV E;  2HG5 D;  1SLQ A;  3Q5X A;  2JQQ A;  1KIL A;  1HBW A;  1IFD A;  2E8I A;  1FZE A;  4FJO A;  4CQI A;  2OYH A;  5A1L A;  1N86 A;  4HGA A;  4YJ2 E;  3UUN A;  4UF0 A;  3B5N C;  2XZR A;  1GW4 A;  2B1E A;  3HD7 D;  3AA1 B;  4JYB A;  3AA7 B;  2L5G B;  5JDL A;  1NO4 A;  1GL2 D;  3I9W A;  1X9V A;  1RF0 A;  4YJ3 E;  1M1J C;  3O4X E;  2XKM A;  5L3C B;  3LID A;  4O4I E;  5DAB A;  1N7L A;  2W61 A;  3EVY A;  2GUV A;  2P7J A;  1FZF A;  2V7K A;  2YU2 A;  4JEU B;  4PJL A;  3CPZ A;  2VKJ A;  2WBL A;  2WSS V;  1HH0 A;  3N9L A;  2IFM A;  1SQB K;  1A02 F;  5HAX A;  5AVQ B;  1QUU A;  2PBI A;  2XTL A;  1FU1 A;  3K3O A;  1UCU A;  5JRE A;  4IE0 A;  2N1T D;  2WSE H;  2X67 A;  4DMW A;  4A56 A;  4EAH A;  4ZI3 C;  5JR9 B;  2I1J A;  3HUS C;  4MBQ A;  4CI2 B;  3EUH A;  5DQV A;  4UVB B;  3RK2 B;  1LKX A;  4WY4 A;  3QC9 A;  3A7O A;  1N2D C;  3ZJ1 A;  2WPQ A;  2X68 A;  3C64 A;  2FFD C;  2X9X A;  4QXC B;  3NZP A;  5LJN A;  4QXB B;  5HXR A;  3M91 A;  4BJM A;  1GDT A;  2A45 H;  3SWF A;  4CXY A;  1WRG A;  2EHO A;  3LBX A;  1SVF A;  3N9P A;  2UXX B;  3MUD A;  3ZMZ B;  1FMW A;  4JUY A;  3GHG A;  4G63 A;  4L0R A;  5BU5 A;  3KVA A;  4MLK A;  5H6Q B;  4M3L A;  5AW3 B;  3OJA A;  4H9P C;  2LOP A;  3EDU A;  1FZA A;  3B5N B;  4ANJ A;  2J59 M;  3SS1 A;  5CCG C;  1AQ5 A;  2HOD A;  1FAV A;  1J1D C;  2K5B B;  1LGH B;  4DND A;  1M1J B;  2K24 A;  5EZY E;  4IHJ E;  5H6R B;  3IR9 A;  1WT6 A;  1FOS F;  1N7S D;  2IAK A;  3KV9 A;  3EFG A;  4H9Q C;  2E9X D;  3HE5 A;  2OYI B;  3HTK B;  4I4T E;  3Q2M A;  4N78 E;  2RP4 A;  3O1H A;  5CJ0 A;  4EOZ B;  5DQW A;  2L9Q A;  2HFE D;  3BQL A;  3TYY A;  3JC6 C;  2QM8 A;  3M0A A;  3EDV A;  2Z4E A;  1BR0 A;  4U74 A;  5CA1 E;  2VAS A;  4N78 D;  3LK3 B;  5L3D B;  2WPS A;  1FJK A;  3P8C D;  4Y99 C;  4IFF A;  2XHE B;  4GK5 E;  3ZPO A;  5AW6 B;  4WNK A;  4MHC A;  3M9Q A;  3M0D C;  3CQG B;  2LKM A;  2WPR A;  4QX7 B;  4X1Y E;  2WWU A;  2H7V C;  4TZ4 C;  2NWB A;  4HH2 A;  4WB4 A;  2MOZ A;  2H8P D;  3GN5 B;  1ZEE A;  5BU8 B;  2DNX A;  1SFC B;  2D2S A;  2L8K A;  4GYR A;  5FYM A;  5EK4 A;  3MTU E;  5CCH C;  3C50 A;  4AKL A;  3ZMV B;  2LSY A;  3LFM A;  3RYC E;  3NFQ A;  2FFD B;  3R6N A;  1WLX A;  4IGU A;  1D0X A;  2NTX A;  3HD7 A;  1MIV A;  1S35 A;  3ANW B;  1GL2 A;  1T3U A;  3HI2 A;  2WT7 B;  5JDM A;  3CQX C;  3ONX A;  3M9H A;  1SQV K;  4HYT B;  2JMK A;  1HX8 A;  3F57 A;  5AW9 B;  3SWH A;  2YNY A;  5LBM A;  4GYS A;  2PG8 A;  3BVH A;  3HR0 A;  4WBN E;  1IJ5 A;  2HPL A;  5LBQ B;  2PP6 A;  2E43 A;  5CB4 E;  3T8O A;  1KFM A;  2A45 G;  1BR1 A;  4DMV A;  1J1D B;  3G3Z A;  3VYI A;  3J9X 1;  3O1J A;  1ZN5 A;  3U3I A;  4H63 V;  1X8Y A;  1IZN B;  5APT A;  4BAY B;  1JTH B;  4ILU A;  1YKH B;  5AVR B;  3FHN A;  4LGD E;  1PFI A;  2LSI A;  3U78 A;  2Q3I A;  4XE5 B;  4OYK A;  5LHI B;  2FKW B;  1ZLL A;  2X9H A;  4JLE A;  4X1I E;  2NTY A;  4ERR A;  3QUJ A;  2R32 A;  3SWY A;  1IO4 A;  3TKL B;  4Y99 B;  5FXX A;  4CI1 B;  3CWZ B;  4GKG A;  2LEH A;  2Q9Q B;  3VN0 A;  2LSG A;  2ZM8 A;  3CX6 B;  3TNU A;  5LA6 E;  2IC6 A;  4IDZ A;  1GZL A;  5C8Y E;  1JY2 O;  3ZLI A;  1SQQ K;  1J2J B;  3KDP B;  2KP8 A;  4IFM A;  3SOL A;  2N1T C;  2CM0 A;  4TV9 E;  5CHX A;  1YD8 G;  5AVT B;  3W15 B;  2NOX A;  4H63 H;  2V26 A;  1S9K E;  4WBA A;  1XTC C;  3LJC A;  3PUG A;  1OWA A;  3K8P C;  4JEH B;  3MD0 A;  1NU1 K;  4KMC A;  3RRC A;  3WI3 A;  3P7K A;  1S9K D;  3VP9 A;  5APY A;  3DP7 A;  1N7S A;  2KSJ A;  2E9X A;  2XAH B;  3D0T A;  4QWN B;  3CQC B;  2FYZ A;  1AFO A;  5JDH A;  1O3X A;  2L3L A;  4M1P A;  1FOS E;  4GIW A;  1RE3 C;  3LW5 H;  3VU7 H;  5LG4 A;  5JDG A;  1HTL C;  2XNX A;  2JMH A;  1HVV A;  1SQX K;  4AI6 A;  3PTR B;  1URQ D;  5DJQ C;  3M9B A;  2CWO A;  4K0U A;  1RF1 A;  2CA5 A;  3UT5 E;  2W0G A;  2NP9 A;  1IJD B;  2O1K A;  3BRT B;  2C0X A;  1CZQ A;  2CLY C;  3NRY A;  4C7N B;  2C0W A;  2ZMA A;  3PDY A;  5LGU B;  5L3B B;  3K3N A;  3BQI A;  1NWQ A;  2YK0 A;  1CI6 B;  4UVC B;  1T98 A;  2LHN A;  5FMN A;  1IC2 A;  5APV A;  3KV4 A;  3BQK A;  1IK9 A;  2BAS A;  4WW0 A;  1VOM A;  1MMG A;  2G0U A;  2V7L A;  3A5T A;  2A3D A;  3PUQ A;  2PFV A;  3OAK A;  2KLQ A;  1ZR4 A;  3ETU A;  1L4A C;  1LTJ B;  3RL0 D;  2M67 A;  5AW5 B;  2Y8D A;  2DI4 A;  4XA4 A;  1JNM A;  5JH7 E;  3NRX A;  1M7L A;  4H9N C;  1VDF A;  3ZCI A;  2VWA A;  2OYI A;  4V1A v;  2DCF A;  3R2P A;  4ZI2 C;  2C5K T;  4QXH B;  1T2K C;  4I50 E;  4TN7 B;  1D0Y A;  2P67 A;  1MV8 A;  2CPB A;  5HWY A;  5AW7 B;  1N73 C;  3ZYL A;  1IFJ A;  1E5W A;  1NKN A;  2WTY A;  3OA7 A;  2V7J A;  4HFV A;  2KT9 A;  5AVW B;  2ZFC A;  3P8M C;  2NPS B;  2ES0 A;  5JVD E;  2KLV A;  3L35 A;  2ZLY A;  4ZS3 A;  5FXV A;  3NZQ A;  1KIL C;  5FY7 A;  1DEB A;  2I59 A;  4TV8 E;  1SHZ C;  2WWW A;  1CW5 A;  3GMI A;  5LHG B;  1UX4 A;  2KXP B;  5E0O A;  1SFC A;  2OYH C;  2O01 H;  3NXS A;  4LLH A;  5KJ7 A;  4ZI7 E;  2O1J A;  3V2N A;  2OA5 A;  1LWU A;  2YKQ A;  4EOT A;  4UIG A;  1WYB A;  4TX5 A;  1JY2 N;  2YIN A;  1UX5 A;  3VOP A;  3S4U A;  2C0S A;  1LTI C;  3N5L A;  1RF0 C;  5AVX B;  3RK3 C;  4UEL A;  2WZ7 A;  2LJL A;  4QKN A;  2R5D A;  4DO0 A;  1FMV A;  1KFN A;  4W80 A;  3TK1 A;  1LRZ A;  1FZC A;  5LHH B;  3UUL A;  2YKP A;  3C4X A;  4UV8 B;  3V2R A;  1J1E B;  3FBZ A;  1Y64 B;  5CA0 E;  5KX5 E;  3LG7 A;  2ODU A;  5LYJ E;  3A3Y B;  3VTP C;  1G2C B;  5IHY A;  4C46 A;  1HCI A;  1U4Q A;  3I0Q A;  1LVF A;  4E7Z A;  2J58 A;  3AAI A;  4HEA A;  2FYU K;  3O8Z A;  2BDE A;  2KWH A;  2BVM A;  3K3Q C;  2X9W A;  4ZS2 A;  1GU5 A;  2POH A;  4FI5 A;  4U72 A;  3ZCJ A;  3V4W A;  1L4A B;  1LT9 A;  2Q9I A;  1D1A A;  2HPC A;  4PNI A;  2XAF B;  2VRS A;  4HN9 A;  4UXN B;  1JY3 N;  2I1K A;  4WY4 C;  3PU3 A;  5JRC B;  3HKE E;  4ZHQ E;  2N1G A;  3L09 A;  3UTK A;  3WAK A;  4W7Y A;  2YKO A;  1HF8 A;  3KFW X;  4XZC A;  1DX7 A;  2EHO C;  2Q9Q A;  2WM9 A;  3AVR A;  4I1L A;  4UEM A;  1KIL B;  1ZV8 A;  4CXX A;  1W2E A;  3GHG C;  1Z0P A;  5FNV E;  1URQ A;  4ASK A;  1SP4 A;  5HXS A;  3MIW A;  2IFN A;  3RK2 D;  3P8C E;  3WAJ A;  4N6J A;  2MTQ A;  5CCH A;  2Q5U A;  3HKB E;  4KBM B;  3EQ2 A;  4KUM B;  4EXT A;  2YU1 A;  1KQL A;  3IFM A;  3HA4 A;  3ZJ2 A;  5HYA A;  4MFR A;  1JUN A;  2H7H A;  2VKO A;  3U1A A;  3RK3 B;  5HXH A;  2CE7 A;  2N2N A;  3HE4 B;  3HUS B;  3H32 A;  3VP8 A;  1ZR2 A;  1V9D A;  3I0O A;  2XV5 A;  3CL3 D;  1D1B A;  4AQF A;  2H3R A;  4H9O C;  3ZC0 A;  3CKD A;  3ZYK A;  3E22 E;  4AXP A;  1QSD A;  4E7S A;  1G1I A;  1RE4 A;  4O9B A;  4AQR D;  4IE5 A;  3I5C A;  3J7Y q;  1FEW A;  5KDM C;  4PW8 A;  2P2U A;  3B5N D;  2H43 A;  2C9L Y;  2LM9 A;  1NHL A;  2W6A A;  2CXF A;  2W27 A;  3L36 A;  1LTS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...