2A9UA

Structure of the n-terminal domain of human ubiquitin carboxyl-terminal hydrolase 8 (usp8)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
134
structure length
134
Chain Sequence
SVPKELYLSSSLKDLNKKTEVKPEKISTKSYVHSALKIFKTAEECRLDRDEERAYVLYMKYVTVYNLIKKRPDFKQQQDYFHSILGPGNIKKAVEEAERLSESLKLRYEEAEVRKKLEEKDRQEEAQRLQQKRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
publication title Amino-terminal Dimerization, NRDP1-Rhodanese Interaction, and Inhibited Catalytic Domain Conformation of the Ubiquitin-specific Protease 8 (USP8).
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2005-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08969 USP8_dimer USP8 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2a9uA01
1WCRA 2CRBA 5LB7B 3K1SA 4CN4A 2DL1A 2LRLA 2XZEA 3ZT7A 4ZEYA 4U31A 3ZT6A 4U7IA 4WZXA 4CN1A 5CGMA 3ZSTA 5FVLA 4P1NA 4U33A 2JQHA 2V6XA 2MPKA 4U2ZA 2A9UA 2V6YA 4U3CA 2V6YB 2W2UA 3ZT5A 2WWVA 5CJ5A 2CPTA 2LRKA 1WFDA 2RPAA 2JQKA 2WY2A 2JQ9A 4NIQA 1WR0A 4U7YA 2K3WA 4IT4A 1YXRA 3EABA 3ZSSA 4CN6A 4U2YA 4A5XA 5FVKA
chains in the Genus database with same CATH superfamily
3FBZA 2VB6A 2XAFB 1YQ4A 3LBXB 2PBIA 2XQYA 2JQQA 5AQGB 4U7YA 1KNRA 5AQOB 5JR9C 4QXCB 4NUUA 4GKJT 5JQGE 4U7IA 1JNRA 2X67A 2C5JA 3AE2A 3ZT5A 3CQXC 1I6ZA 1L0VA 4AXPA 2IAKA 3AXJB 1XWMA 3UUXB 5JTGA 3BQKA 3OJAA 2BKPA 2IC9A 2VASA 1FIOA 2WZHA 3ZMSB 3CX8B 5BMVE 3T1HT 3ZKRA 4DR6T 1MMGA 1SA0E 4YSYA 3L3PA 4IE4A 2XZEA 5HXEA 5DJQC 1D0ZA 1S35A 4YY3T 5ABFB 3IA3A 4OK0A 1JNZA 5LG4A 3ANWB 5JDHA 2LRKA 3LK2B 2I0MA 4HFCA 2KLQA 3VRBA 2N2NA 4YLHA 4EOZB 5H6QB 3P8CD 3RRCA 1IJ5A 2UXXB 2K5BB 2FUPA 2UUCT 3PURA 3EI0A 5FP3A 2IIUA 2HHHT 3UULA 2WS3A 1OWAA 4AKGA 4IGUA 4IT4A 4IDOA 2NTYA 2DL1A 4MBQA 3CIRA 3C4XA 3N9PA 4JI2T 4K0KT 5HEOA 2WQYA 5L3GB 4KUMB 3N9QA 1BR2A 4AIUA 2IW5B 2LSIA 3SRZA 4H9OC 4DMWA 5HAXA 5JRCB 5HCMA 2CEAA 5AFUL 4YSZA 2CCQA 4NIQA 1OXZA 3P50A 3KV5A 4DR4T 4V1Av 1D1CA 3ETVA 2LSKA 4AKHA 4H9PC 5FL1A 1IBKT 2KSRA 2UXDT 1XNRT 2C5KT 5J2TE 2M6BA 5LG3A 3X1DA 3EVYA 5F3JA 3I0OA 4LFBT 1DU2A 5DQWA 3N9OA 3SOLA 3DJBA 2V5DA 2XQ8A 4ZS2A 5FXZA 4IDZA 3RKGA 2XJ7A 2UXBT 1FEWA 3BK9A 1HS7A 2CWYA 4ZS3A 3GN5A 5FY0A 1V9DA 5HEUA 3D0TA 1HNWT 2D2SA 2JQKA 4EGWA 2WSSV 2K9AA 3DP7A 4H9SE 4I43B 2FJBA 2ZM2A 3ZCIA 3QB5A 1LRZA 1OEDC 3FZMB 4TNVA 3UTKA 2BKNA 2JMKA 4B3TT 3WI3A 3TLTA 1FJGT 4X5TA 4OFZA 3LK42 1UCUA 3CX7B 4U2ZA 4OYJA 4BA9A 3IF8B 3MACA 2OA5A 4JEHB 2M6IA 5LBQB 1GQEA 4WNKA 3O1JA 3LK3B 5CA0E 5E0OA 5C2TA 2WU5A 2XAQB 4O4JE 4B3ST 5C3JA 4HWCA 2VK9A 3EUHA 3RYIE 3Q5XA 3RI5A 3OTOT 3TKLB 4HFHA 4HFVA 4IE0A 2JMHA 4UXNB 4ILAA 4A98A 2A3DA 4EZ4A 2LOSA 4YXDA 1I94T 1KF6A 1OEDA 3ZYLA 2ACZA 2A72A 3LG7A 3N9MA 1SUMB 2XAGB 1YKEB 4OHFA 2YK0A 2V7MA 3T8OA 4X66T 4O4IE 3L39A 1G8XA 4YTNA 2AXDS 2XY8B 1IJ6A 5LBMA 3AE7A 4IE7A 2LKGA 2D5UA 3CX6B 4EZHA 3RYHE 3KVBA 4IE6A 3RIFA 2BDEA 2IDOB 1KNPA 4O2BE 2D0TA 3ZYKA 3PTRB 4KX6A 3JC6C 3CVRA 1BR1A 2CA5A 1QSDA 3LJCA 2X0HA 4JI5T 3LDQB 3PE0A 3O1HA 1US7B 3PV0F 2A9UA 3EHZA 4ZZCA 1J1JA 3AAAB 2WWUA 5LGNB 2ZLYA 1WLXA 3AE4A 5KX5E 2K3WA 4NXMT 2HPLA 2AE9A 3QC9A 4HWIB 5FYMA 2ODUA 1KNZA 5L3EB 4JYAT 4UF0B 2XQ5A 2X9XA 5HWYA 3PU3A 2RP4A 2BZBA 3RH3A 3F57A 2BS2A 4UEMA 2H7VC 4TX5A 4TWDA 3C51A 3L09A 2VKJA 4ASKA 3KINB 3P7IA 3K3QC 4MFRA 4NPPA 4ZZBA 2LLYA 2V7LA 5FXXA 3RQWA 4ANJA 3HA4A 4Z8XA 2Q9QB 3B13A 2W2UA 5LXTE 2RA1A 3I9YA 3UUMA 1W09A 1ZHCA 5FVKA 4A5XA 2CRBA 5ADXL 3EDUA 4DR3T 2E5VA 2XAHB 5ABEA 2XPKA 5HCJA 5JDGA 4IHJE 2BG9B 2YEVC 3A8YC 2XQ7A 4ERRA 3KVAA 4DV2T 3P4PA 2LM2A 5KMGP 4AKRB 4QWNB 1E1HB 3OPCA 5FXVA 1T7SA 4U74A 2MAWA 2H7OA 2E9XB 1ZP0A 1XMQT 1LKXA 3NRYA 2PG8A 4LMLA 3RRWA 2LEHA 2UU9T 1U5PA 4Z91A 3Q5DA 3T1YT 5LB7B 2X9YA 1SHZC 4HKAA 3AEFA 3AA6B 5AQUB 3AVSA 4TV9E 2QYWA 3OYXA 2X9WA 4ZI2D 4DV5T 4YHHT 4CQIA 1OEDE 4EEDA 3PUXF 2H89A 5EK4A 2CHNA 4X1IE 2WDVA 3ONLC 4X20E 3S4UA 2J62A 2VWAA 4CI3B 2NWBA 1D1AA 3NZPA 3PUQA 3JCFA 4LF6T 1WFDA 3AEBA 3TLUA 2XM2A 4ZOLE 2X0LB 4PFOA 3HKBE 4IDNA 4IDPA 4O4LE 3N2GE 4GKKT 3RIUC 2LSGA 3CWZB 2Y6XA 4FJOA 1T8BA 2MPKA 4ADZA 2Q9QD 3PJAJ 3O9XA 4UVAB 3P4QA 3LFMA 1U4QA 2CXLA 3IEEA 3U78A 4PK4A 4I4TE 4JLEA 2V8SV 4YT0A 5AQPB 3AB3B 5AQHB 5LHGB 2VKOA 5LP6E 2DLRA 2LSJA 4JEUB 2UUBT 1EZ3A 2FJAA 5LGTB 4CXWA 1VRBA 1MIVA 4IREA 2RPAA 4HEAA 3PUSA 5HXHA 2J47A 4ZI3D 3CQGB 3AE5A 1AJ3A 2GK9A 4ZHQE 5KDMC 5LJNA 2E9XD 3RIAA 4H9RC 3UFEA 5AQKB 5LCYA 4AISA 2QRXA 1O3XA 4HWFA 3VR8A 3P4RA 3HR0A 3MKDA 4DV7T 3CKDA 3ZYMA 3RIUA 4DR5T 2KWIB 2OLTA 4PAGA 4U33A 2VL8A 4I55E 4LF4T 4H63H 2LSYA 3AEAA 3I1AA 2WMOA 5LNKA 4JI4T 4DMVA 1CUNA 3QB5K 3HKDE 4YTPA 4DR7T 3AEEA 3ZMUB 1H7CA 2VKHA 3RPUA 2V6YA 4X65T 4OX9T 4AKLA 1WRDA 5HEJA 1XMOT 5AQIB 2WDQA 2CLYB 5L2LA 3H3MA 3NRXA 5J0ZA 4LMJA 4EV6A 2WDRA 3ZSTA 3ONXA 1N34T 2VKDA 4Z90A 2X66A 3Q5WA 5LYJE 3RC8A 4E7SA 4CN6A 3HI2A 3RQUA 3ZN1B 4JI8T 2ZMAA 2Y48B 1UUSA 1HR0T 4PJJA 4DR2T 4G2AA 5M4YA 1IAPA 1ZEEA 2N9DA 2NR4A 2CM0A 2BS4A 4F6RC 4ISSA 2L9QA 2XASB 5JDNA 3AE8A 1WCRA 3AE1A 3ZT7A 3VR9A 3LBXA 4UV9B 4J2CA 4LFCT 1VCSA 3R6NA 2HN2A 3PUWF 4TUYE 2E8IA 1YD8G 2VURA 3UU4A 5LJMA 3AE3A 4QX8B 5JVDE 4H9NC 4HFIA 2CPTA 5FY1A 3AXJA 4JI3T 3JADA 1HNZT 5EK3A 3AE6A 4MLKA 4HWHA 5LMNT 3UUBA 3NKZA 5H6RB 4U3CA 2XTLA 3CMLA 5HEGA 4CZZB 3MXZA 3PUYF 2CWOA 4GIWA 4GK0E 3ZN0B 2WY2A 1HNXT 2N1GA 4H63V 2SPCA 4HWDA 3M3ZB 3UU6A 4WBNE 1NWMX 5ABFA 5JDFA 5AQTB 3WAJA 4DIDB 3IHRA 3ANWA 2UXCT 1N36T 4H9QC 4TV8E 1S94A 2WAUA 2MTQA 3N9NA 2X9HA 2KWHA 1CHUA 1XZYA 5JDMA 5LHIB 1BR0A 2IC6A 2JQHA 3N5LA 4GYSA 2ZM6T 4AQFC 4DV0T 2W4XA 2NW8A 3FB2A 4X62T 2CHOA 4LF5T 2JJ9A 5JH7E 3FXEB 1FMVA 4LF7T 3C64A 3QK6A 3CK6A 4XBFB 4CI1B 1XDPA 3UU3A 4LFAT 2EHOB 2J1DG 5FNVE 1YKHB 4U2YA 5LMUT 3TLVA 4HGAA 3Q2MA 2DWKA 5J2UE 2UXNB 3MZKB 5ABGA 5JRCA 4P0BA 1MIYA 2XUEA 4HFDA 2V6XA 2XQAA 4AQGA 1VOMA 3AA1B 3TLWA 1W0BA 2WMNA 3P4WA 5L3BB 2XQ9A 3KV9A 3UT5E 1FMWA 3ZMVB 4KI0F 5HWXA 4U31A 2V7IA 3VU7H 4WBOA 1D1BA 1YQ3A 2M67A 5KXJA 4CXXA 2V5CA 1XDOA 3FZHB 1UK5A 4X64T 4AQFA 2I6HA 2W0GA 2BVMA 5AQLB 5EZYE 4UR9A 4EAHA 4EXTA 2VL0A 4CN1A 2YN6A 4AKIA 4EB6E 3OBVE 4DO0A 2HH7A 5AQMB 3AVRA 1HF8A 2CE7A 2A2FX 4DV3T 4FI5A 1HG5A 3JAEA 4DUYT 4PNIA 2YU2A 5AQJB 4DVDA 4HFEA 5HXCA 2XAJB 3RC3A 5AQSB 4DUZT 1MMDA 5JR9B 3EDVA 1MIWA 2KNDA 4O2AE 3RYCE 4PK5A 4IIJE 3PUZF 3MA9A 2B1EA 5FVLA 4P1NA 4YJ3E 2W61A 3C4ZA 4PFPA 4DR1T 3KV6A 2YINA 1MNDA 2EHOD 4AI6A 3AA7B 2C0SA 1NAFA 3AEDA 4ZEYA 1HG2A 2WB5A 4WW0A 3RHWA 4IDQA 3C98B 3AE9A 5ETWA 2P9BA 2WU2A 3A5XA 1WYBA 3FZFB 4M1PA 2IHR1 1WR0A 3ZSSA 3ZEFB 4A97A 4QKNA 4DBRA 2G0UA 3RGLA 4KHPT 5JREA 3UQ4A 1ZOYA 4TWHA 4ZI2C 1M62A 1QUUA 4KMCA 3RLFF 2VQFT 3UU5A 1Z8UA 3QNUA 3B5MA 1UGOA 4QH5A 4GYRA 3MK7C 3VKHA 5EK2A 2NOXA 3VHLA 4A56A 3J7Yq 2KMFA 3ZPOA 5L3CB 2QGSA 4OYKA 3HKCE 5L47A 5LGUB 2QA7A 4JI6T 2DHRA 1VCTA 5AQRB 5JDQA 3GA8A 4CN4A 3AA0B 1NEKA 3PUGA 2XSAA 5CGMA 2KXPB 2Q9QC 4JV5T 3PJAA 5FL0A 2DWGA 2LM9A 3KBTA 3V5UA 2MYSA 4L9IA 2X51A 2VVSA 4YJ2E 1G73A 2MBGA 2BG9C 4DV6T 3GN5B 4WZXA 4O8SA 5FKYA 3L8RA 2ZM0A 1B7TA 3M65A 5BR8T 2Y8DA 3RYFE 4GOUA 1MMAA 4EEBA 2KINB 4ZI3C 3E0ZA 1T98A 5F8PA 2H3RA 4UV8B 3IBPA 5LA6E 5AQFB 2CBIA 3V5SA 2E9XC 4UF0A 2BVLA 3KBUA 3DTOA 1IZNB 4EYUA 4GK5E 4ISTA 3Q9DA 1KK7A 4LF8T 4QXHB 1XNQT 2F4VT 4UVCB 4HFBA 2WM9A 3I0QA 2Q9QA 3ONJA 4HTEA 4C90A 2W63A 4PK6A 2L8KA 4N78D 1MMNA 4TWFA 5JR9A 5IYZE 3BQIA 1Y64B 3J9X1 3VKGA 2BG9A 3AECA 3W15B 3G06A 3O4XE 2CXDA 2Z6EA 4JBWF 2YDQA 4DNDA 4KBMB 4LF9T 2LJLA 1YW0A 3PDYA 2V7JA 1M7KA 3OVUA 3I9WA 1QLBA 1D0XA 3ETUA 4UELA 1J5WA 4YTMA 5FY7A 5A1LA 1OEDB 3A7MA 4WYVA 4HN9A 2E9XA 3CQCB 2NW9A 1UX5A 3ZC1A 1HCIA 3K3NA 1IBMT 1R8IA 2ZM8A 2E2AA 3AAIA 4EIWA 2LKHA 4YHJA 4QX7B 1WR6A 2DNXA 4IL9A 2BBJA 4YSXA 3C50A 2IMLA 4PJLA 2CXFA 4PJMA 5L3FB 3SFEA 3NVOA 3H37A 3ZC0A 1W9RA 4X1YE 2ES0A 5IUXA 5L3DB 4PJNA 3AAEB 4JI1T 2YKSA 2J4GA 3ZCJA 1Z0PA 3UQ7A 2R6GF 3K3OA 1MNEA 2X0YA 3NBXX 5ABHA 1UX4A 2VQET 3QOFA 3PU8A 3ZT6A 4QXBB 4COFA 4TNWA 5CB4E 2ACXA 1E2AA 2WCAA 3UFGA 4O4HE 1BR4A 5DQVA 1ZKEA 2K24A 2OV9A 3K8PC 1UURA 1E7PA 5HXSA 4X1KE 2JIWA 2YOEA 4MALA 3RX6A 2XHEB 2FBWA 4ILUA 2V26A 5HXRA 5LHHB 4ILBA 2WWVA 4I0UA 2MOZA 3F31A 4QH1A 3RKOA 2WBLA 4I50E 2LT3A 1WYCA 5IWAT 2CLYC 3UU8A 3F2EA 3HL6A 1NENA 2BKOA 3N2OA 3PUVF 3WAKA 5LOVE 2W66A 2HN1A 4L0RA 2FJDA 4P0AA 2YDSA 2KT9A 3HKEE 4TZ4C 3ESLA 3SS1A 3EABA 1IBLT 2LRLA 4JUYA 4ZI7E 2L3LA 4TN7B 2IUBA 1Y01A 4E7ZA 2D0UA 3FHNA 3Q5EA 2QVAA 3H3AA 3QUJA 2K48A 2BG9E 5TAOA 4NUVA 2JQ9A 5FMNA 3OYZA 3UUNA 2CBJA 2VVNA 2ODVA 3ZJ2A 4CI2B 2X68A 3MJXA 1D0YA 3ZJ1A 3E08A 2LOPA 2W00A 2WZIA 2PTFA 2PJQA 4IL4A 2PFVA 5HEHA 2XM1A 2BBHA 2D9DA 1X9BA 4QH4A 4BJNA 3BQLA 4Q25A 1KEYA 4K0UA 5CJ5A 2XQ4A 4F8HA 3LSVA 2CMRA 2V1DB 2LE8A 2WP9A 4HE8A 3U3IA 4B3MT 4LMKA 4KHZF 4KP3C 5L4EA 3FXDB 2FJEA 3JAFA 3KDSE 4P09A 1YXRA 3JC6D 2XSBA 2W62A 3B57A 4B3RT 4UVBB 2KZ7B 3KV4A 5IHYA 3N2KE 3C4WA 3SFDA 4B6XA 4NXNT 1SE7A 1N32T 3NZQA 2H88A 2JPFA 5CA1E 5HYAA 4XAXB 3FZLB 3RF1A 2E5LT 4JI0T 2DCFA 4XZCA 3ZMZB 4G63A 2YU1A 2W67A 4L5GA 1HX1B 1HX8A 5JDLA 3N9LA 3EAMA 5FXWA 4U72A 2YDRA 1X79A 3CPZA 4DBQA 3GWHA 2NP9A 4CXYA 2JRKA 1KFYA 2XQ6A 3FZKB 1LVFA 4JI7T 4DV4T 2NTXA 3VRAA 5C8YE 2EHOC 2LHRA 1N33T 4C91A 4QHOA 3AEGA 5CFBA 3PUAA 3KFWX 4MHCA 3ABVA 3TLSA 1HTJF 2C5IT 4EYYR 2V6YB 2DI4A 4BJMA 5J1GA 3NWIA 1LVKA 4BAYB 5AQQB 2XQ3A 5L4HA 3K1SA 2UUAT 4AQYT 2LHNA 5AQVB 3O1IA 3E22E 2HPJA 5F5WA 2BS3A 4ILCA 3OKQA 3FBLA 5DABA 3ZLIA 4IE5A 3SWHA 3GMIA 1J5ET 4YFSA 4UIGA 1ZV4X 5GONE 2V7KA 5AQNB 2NW7A 3R84B 2B76A 4DV1T 1HFAA 3P4SA 4ZXLA 2EHOA 2I59A 3ZMTB 1W0AA 4PW8A 1T72A
chains in the Genus database with same CATH topology
1WCRA 2CRBA 5LB7B 3K1SA 4CN4A 2DL1A 2LRLA 2XZEA 3ZT7A 4ZEYA 4U31A 3ZT6A 4U7IA 4WZXA 4CN1A 5CGMA 3ZSTA 5FVLA 4P1NA 4U33A 2JQHA 2V6XA 2MPKA 4U2ZA 2A9UA 2V6YA 4U3CA 2V6YB 2W2UA 3ZT5A 2WWVA 5CJ5A 2CPTA 2LRKA 1WFDA 2RPAA 2JQKA 2WY2A 2JQ9A 4NIQA 1WR0A 4U7YA 2K3WA 4IT4A 1YXRA 3EABA 3ZSSA 4CN6A 4U2YA 4A5XA 5FVKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WCR A;  2CRB A;  5LB7 B;  3K1S A;  4CN4 A;  2DL1 A;  2LRL A;  2XZE A;  3ZT7 A;  4ZEY A;  4U31 A;  3ZT6 A;  4U7I A;  4WZX A;  4CN1 A;  5CGM A;  3ZST A;  5FVL A;  4P1N A;  4U33 A;  2JQH A;  2V6X A;  2MPK A;  4U2Z A;  2A9U A;  2V6Y A;  4U3C A;  2V6Y B;  2W2U A;  3ZT5 A;  2WWV A;  5CJ5 A;  2CPT A;  2LRK A;  1WFD A;  2RPA A;  2JQK A;  2WY2 A;  2JQ9 A;  4NIQ A;  1WR0 A;  4U7Y A;  2K3W A;  4IT4 A;  1YXR A;  3EAB A;  3ZSS A;  4CN6 A;  4U2Y A;  4A5X A;  5FVK A; 
#chains in the Genus database with same CATH topology
 3FBZ A;  2VB6 A;  2XAF B;  1YQ4 A;  3LBX B;  2PBI A;  2XQY A;  2JQQ A;  5AQG B;  4U7Y A;  1KNR A;  5AQO B;  5JR9 C;  4QXC B;  4NUU A;  4GKJ T;  5JQG E;  4U7I A;  1JNR A;  2X67 A;  2C5J A;  3AE2 A;  3ZT5 A;  3CQX C;  1I6Z A;  1L0V A;  4AXP A;  2IAK A;  3AXJ B;  1XWM A;  3UUX B;  5JTG A;  3BQK A;  3OJA A;  2BKP A;  2IC9 A;  2VAS A;  1FIO A;  2WZH A;  3ZMS B;  3CX8 B;  5BMV E;  3T1H T;  3ZKR A;  4DR6 T;  1MMG A;  1SA0 E;  4YSY A;  3L3P A;  4IE4 A;  2XZE A;  5HXE A;  5DJQ C;  1D0Z A;  1S35 A;  4YY3 T;  5ABF B;  3IA3 A;  4OK0 A;  1JNZ A;  5LG4 A;  3ANW B;  5JDH A;  2LRK A;  3LK2 B;  2I0M A;  4HFC A;  2KLQ A;  3VRB A;  2N2N A;  4YLH A;  4EOZ B;  5H6Q B;  3P8C D;  3RRC A;  1IJ5 A;  2UXX B;  2K5B B;  2FUP A;  2UUC T;  3PUR A;  3EI0 A;  5FP3 A;  2IIU A;  2HHH T;  3UUL A;  2WS3 A;  1OWA A;  4AKG A;  4IGU A;  4IT4 A;  4IDO A;  2NTY A;  2DL1 A;  4MBQ A;  3CIR A;  3C4X A;  3N9P A;  4JI2 T;  4K0K T;  5HEO A;  2WQY A;  5L3G B;  4KUM B;  3N9Q A;  1BR2 A;  4AIU A;  2IW5 B;  2LSI A;  3SRZ A;  4H9O C;  4DMW A;  5HAX A;  5JRC B;  5HCM A;  2CEA A;  5AFU L;  4YSZ A;  2CCQ A;  4NIQ A;  1OXZ A;  3P50 A;  3KV5 A;  4DR4 T;  4V1A v;  1D1C A;  3ETV A;  2LSK A;  4AKH A;  4H9P C;  5FL1 A;  1IBK T;  2KSR A;  2UXD T;  1XNR T;  2C5K T;  5J2T E;  2M6B A;  5LG3 A;  3X1D A;  3EVY A;  5F3J A;  3I0O A;  4LFB T;  1DU2 A;  5DQW A;  3N9O A;  3SOL A;  3DJB A;  2V5D A;  2XQ8 A;  4ZS2 A;  5FXZ A;  4IDZ A;  3RKG A;  2XJ7 A;  2UXB T;  1FEW A;  3BK9 A;  1HS7 A;  2CWY A;  4ZS3 A;  3GN5 A;  5FY0 A;  1V9D A;  5HEU A;  3D0T A;  1HNW T;  2D2S A;  2JQK A;  4EGW A;  2WSS V;  2K9A A;  3DP7 A;  4H9S E;  4I43 B;  2FJB A;  2ZM2 A;  3ZCI A;  3QB5 A;  1LRZ A;  1OED C;  3FZM B;  4TNV A;  3UTK A;  2BKN A;  2JMK A;  4B3T T;  3WI3 A;  3TLT A;  1FJG T;  4X5T A;  4OFZ A;  3LK4 2;  1UCU A;  3CX7 B;  4U2Z A;  4OYJ A;  4BA9 A;  3IF8 B;  3MAC A;  2OA5 A;  4JEH B;  2M6I A;  5LBQ B;  1GQE A;  4WNK A;  3O1J A;  3LK3 B;  5CA0 E;  5E0O A;  5C2T A;  2WU5 A;  2XAQ B;  4O4J E;  4B3S T;  5C3J A;  4HWC A;  2VK9 A;  3EUH A;  3RYI E;  3Q5X A;  3RI5 A;  3OTO T;  3TKL B;  4HFH A;  4HFV A;  4IE0 A;  2JMH A;  4UXN B;  4ILA A;  4A98 A;  2A3D A;  4EZ4 A;  2LOS A;  4YXD A;  1I94 T;  1KF6 A;  1OED A;  3ZYL A;  2ACZ A;  2A72 A;  3LG7 A;  3N9M A;  1SUM B;  2XAG B;  1YKE B;  4OHF A;  2YK0 A;  2V7M A;  3T8O A;  4X66 T;  4O4I E;  3L39 A;  1G8X A;  4YTN A;  2AXD S;  2XY8 B;  1IJ6 A;  5LBM A;  3AE7 A;  4IE7 A;  2LKG A;  2D5U A;  3CX6 B;  4EZH A;  3RYH E;  3KVB A;  4IE6 A;  3RIF A;  2BDE A;  2IDO B;  1KNP A;  4O2B E;  2D0T A;  3ZYK A;  3PTR B;  4KX6 A;  3JC6 C;  3CVR A;  1BR1 A;  2CA5 A;  1QSD A;  3LJC A;  2X0H A;  4JI5 T;  3LDQ B;  3PE0 A;  3O1H A;  1US7 B;  3PV0 F;  2A9U A;  3EHZ A;  4ZZC A;  1J1J A;  3AAA B;  2WWU A;  5LGN B;  2ZLY A;  1WLX A;  3AE4 A;  5KX5 E;  2K3W A;  4NXM T;  2HPL A;  2AE9 A;  3QC9 A;  4HWI B;  5FYM A;  2ODU A;  1KNZ A;  5L3E B;  4JYA T;  4UF0 B;  2XQ5 A;  2X9X A;  5HWY A;  3PU3 A;  2RP4 A;  2BZB A;  3RH3 A;  3F57 A;  2BS2 A;  4UEM A;  2H7V C;  4TX5 A;  4TWD A;  3C51 A;  3L09 A;  2VKJ A;  4ASK A;  3KIN B;  3P7I A;  3K3Q C;  4MFR A;  4NPP A;  4ZZB A;  2LLY A;  2V7L A;  5FXX A;  3RQW A;  4ANJ A;  3HA4 A;  4Z8X A;  2Q9Q B;  3B13 A;  2W2U A;  5LXT E;  2RA1 A;  3I9Y A;  3UUM A;  1W09 A;  1ZHC A;  5FVK A;  4A5X A;  2CRB A;  5ADX L;  3EDU A;  4DR3 T;  2E5V A;  2XAH B;  5ABE A;  2XPK A;  5HCJ A;  5JDG A;  4IHJ E;  2BG9 B;  2YEV C;  3A8Y C;  2XQ7 A;  4ERR A;  3KVA A;  4DV2 T;  3P4P A;  2LM2 A;  5KMG P;  4AKR B;  4QWN B;  1E1H B;  3OPC A;  5FXV A;  1T7S A;  4U74 A;  2MAW A;  2H7O A;  2E9X B;  1ZP0 A;  1XMQ T;  1LKX A;  3NRY A;  2PG8 A;  4LML A;  3RRW A;  2LEH A;  2UU9 T;  1U5P A;  4Z91 A;  3Q5D A;  3T1Y T;  5LB7 B;  2X9Y A;  1SHZ C;  4HKA A;  3AEF A;  3AA6 B;  5AQU B;  3AVS A;  4TV9 E;  2QYW A;  3OYX A;  2X9W A;  4ZI2 D;  4DV5 T;  4YHH T;  4CQI A;  1OED E;  4EED A;  3PUX F;  2H89 A;  5EK4 A;  2CHN A;  4X1I E;  2WDV A;  3ONL C;  4X20 E;  3S4U A;  2J62 A;  2VWA A;  4CI3 B;  2NWB A;  1D1A A;  3NZP A;  3PUQ A;  3JCF A;  4LF6 T;  1WFD A;  3AEB A;  3TLU A;  2XM2 A;  4ZOL E;  2X0L B;  4PFO A;  3HKB E;  4IDN A;  4IDP A;  4O4L E;  3N2G E;  4GKK T;  3RIU C;  2LSG A;  3CWZ B;  2Y6X A;  4FJO A;  1T8B A;  2MPK A;  4ADZ A;  2Q9Q D;  3PJA J;  3O9X A;  4UVA B;  3P4Q A;  3LFM A;  1U4Q A;  2CXL A;  3IEE A;  3U78 A;  4PK4 A;  4I4T E;  4JLE A;  2V8S V;  4YT0 A;  5AQP B;  3AB3 B;  5AQH B;  5LHG B;  2VKO A;  5LP6 E;  2DLR A;  2LSJ A;  4JEU B;  2UUB T;  1EZ3 A;  2FJA A;  5LGT B;  4CXW A;  1VRB A;  1MIV A;  4IRE A;  2RPA A;  4HEA A;  3PUS A;  5HXH A;  2J47 A;  4ZI3 D;  3CQG B;  3AE5 A;  1AJ3 A;  2GK9 A;  4ZHQ E;  5KDM C;  5LJN A;  2E9X D;  3RIA A;  4H9R C;  3UFE A;  5AQK B;  5LCY A;  4AIS A;  2QRX A;  1O3X A;  4HWF A;  3VR8 A;  3P4R A;  3HR0 A;  3MKD A;  4DV7 T;  3CKD A;  3ZYM A;  3RIU A;  4DR5 T;  2KWI B;  2OLT A;  4PAG A;  4U33 A;  2VL8 A;  4I55 E;  4LF4 T;  4H63 H;  2LSY A;  3AEA A;  3I1A A;  2WMO A;  5LNK A;  4JI4 T;  4DMV A;  1CUN A;  3QB5 K;  3HKD E;  4YTP A;  4DR7 T;  3AEE A;  3ZMU B;  1H7C A;  2VKH A;  3RPU A;  2V6Y A;  4X65 T;  4OX9 T;  4AKL A;  1WRD A;  5HEJ A;  1XMO T;  5AQI B;  2WDQ A;  2CLY B;  5L2L A;  3H3M A;  3NRX A;  5J0Z A;  4LMJ A;  4EV6 A;  2WDR A;  3ZST A;  3ONX A;  1N34 T;  2VKD A;  4Z90 A;  2X66 A;  3Q5W A;  5LYJ E;  3RC8 A;  4E7S A;  4CN6 A;  3HI2 A;  3RQU A;  3ZN1 B;  4JI8 T;  2ZMA A;  2Y48 B;  1UUS A;  1HR0 T;  4PJJ A;  4DR2 T;  4G2A A;  5M4Y A;  1IAP A;  1ZEE A;  2N9D A;  2NR4 A;  2CM0 A;  2BS4 A;  4F6R C;  4ISS A;  2L9Q A;  2XAS B;  5JDN A;  3AE8 A;  1WCR A;  3AE1 A;  3ZT7 A;  3VR9 A;  3LBX A;  4UV9 B;  4J2C A;  4LFC T;  1VCS A;  3R6N A;  2HN2 A;  3PUW F;  4TUY E;  2E8I A;  1YD8 G;  2VUR A;  3UU4 A;  5LJM A;  3AE3 A;  4QX8 B;  5JVD E;  4H9N C;  4HFI A;  2CPT A;  5FY1 A;  3AXJ A;  4JI3 T;  3JAD A;  1HNZ T;  5EK3 A;  3AE6 A;  4MLK A;  4HWH A;  5LMN T;  3UUB A;  3NKZ A;  5H6R B;  4U3C A;  2XTL A;  3CML A;  5HEG A;  4CZZ B;  3MXZ A;  3PUY F;  2CWO A;  4GIW A;  4GK0 E;  3ZN0 B;  2WY2 A;  1HNX T;  2N1G A;  4H63 V;  2SPC A;  4HWD A;  3M3Z B;  3UU6 A;  4WBN E;  1NWM X;  5ABF A;  5JDF A;  5AQT B;  3WAJ A;  4DID B;  3IHR A;  3ANW A;  2UXC T;  1N36 T;  4H9Q C;  4TV8 E;  1S94 A;  2WAU A;  2MTQ A;  3N9N A;  2X9H A;  2KWH A;  1CHU A;  1XZY A;  5JDM A;  5LHI B;  1BR0 A;  2IC6 A;  2JQH A;  3N5L A;  4GYS A;  2ZM6 T;  4AQF C;  4DV0 T;  2W4X A;  2NW8 A;  3FB2 A;  4X62 T;  2CHO A;  4LF5 T;  2JJ9 A;  5JH7 E;  3FXE B;  1FMV A;  4LF7 T;  3C64 A;  3QK6 A;  3CK6 A;  4XBF B;  4CI1 B;  1XDP A;  3UU3 A;  4LFA T;  2EHO B;  2J1D G;  5FNV E;  1YKH B;  4U2Y A;  5LMU T;  3TLV A;  4HGA A;  3Q2M A;  2DWK A;  5J2U E;  2UXN B;  3MZK B;  5ABG A;  5JRC A;  4P0B A;  1MIY A;  2XUE A;  4HFD A;  2V6X A;  2XQA A;  4AQG A;  1VOM A;  3AA1 B;  3TLW A;  1W0B A;  2WMN A;  3P4W A;  5L3B B;  2XQ9 A;  3KV9 A;  3UT5 E;  1FMW A;  3ZMV B;  4KI0 F;  5HWX A;  4U31 A;  2V7I A;  3VU7 H;  4WBO A;  1D1B A;  1YQ3 A;  2M67 A;  5KXJ A;  4CXX A;  2V5C A;  1XDO A;  3FZH B;  1UK5 A;  4X64 T;  4AQF A;  2I6H A;  2W0G A;  2BVM A;  5AQL B;  5EZY E;  4UR9 A;  4EAH A;  4EXT A;  2VL0 A;  4CN1 A;  2YN6 A;  4AKI A;  4EB6 E;  3OBV E;  4DO0 A;  2HH7 A;  5AQM B;  3AVR A;  1HF8 A;  2CE7 A;  2A2F X;  4DV3 T;  4FI5 A;  1HG5 A;  3JAE A;  4DUY T;  4PNI A;  2YU2 A;  5AQJ B;  4DVD A;  4HFE A;  5HXC A;  2XAJ B;  3RC3 A;  5AQS B;  4DUZ T;  1MMD A;  5JR9 B;  3EDV A;  1MIW A;  2KND A;  4O2A E;  3RYC E;  4PK5 A;  4IIJ E;  3PUZ F;  3MA9 A;  2B1E A;  5FVL A;  4P1N A;  4YJ3 E;  2W61 A;  3C4Z A;  4PFP A;  4DR1 T;  3KV6 A;  2YIN A;  1MND A;  2EHO D;  4AI6 A;  3AA7 B;  2C0S A;  1NAF A;  3AED A;  4ZEY A;  1HG2 A;  2WB5 A;  4WW0 A;  3RHW A;  4IDQ A;  3C98 B;  3AE9 A;  5ETW A;  2P9B A;  2WU2 A;  3A5X A;  1WYB A;  3FZF B;  4M1P A;  2IHR 1;  1WR0 A;  3ZSS A;  3ZEF B;  4A97 A;  4QKN A;  4DBR A;  2G0U A;  3RGL A;  4KHP T;  5JRE A;  3UQ4 A;  1ZOY A;  4TWH A;  4ZI2 C;  1M62 A;  1QUU A;  4KMC A;  3RLF F;  2VQF T;  3UU5 A;  1Z8U A;  3QNU A;  3B5M A;  1UGO A;  4QH5 A;  4GYR A;  3MK7 C;  3VKH A;  5EK2 A;  2NOX A;  3VHL A;  4A56 A;  3J7Y q;  2KMF A;  3ZPO A;  5L3C B;  2QGS A;  4OYK A;  3HKC E;  5L47 A;  5LGU B;  2QA7 A;  4JI6 T;  2DHR A;  1VCT A;  5AQR B;  5JDQ A;  3GA8 A;  4CN4 A;  3AA0 B;  1NEK A;  3PUG A;  2XSA A;  5CGM A;  2KXP B;  2Q9Q C;  4JV5 T;  3PJA A;  5FL0 A;  2DWG A;  2LM9 A;  3KBT A;  3V5U A;  2MYS A;  4L9I A;  2X51 A;  2VVS A;  4YJ2 E;  1G73 A;  2MBG A;  2BG9 C;  4DV6 T;  3GN5 B;  4WZX A;  4O8S A;  5FKY A;  3L8R A;  2ZM0 A;  1B7T A;  3M65 A;  5BR8 T;  2Y8D A;  3RYF E;  4GOU A;  1MMA A;  4EEB A;  2KIN B;  4ZI3 C;  3E0Z A;  1T98 A;  5F8P A;  2H3R A;  4UV8 B;  3IBP A;  5LA6 E;  5AQF B;  2CBI A;  3V5S A;  2E9X C;  4UF0 A;  2BVL A;  3KBU A;  3DTO A;  1IZN B;  4EYU A;  4GK5 E;  4IST A;  3Q9D A;  1KK7 A;  4LF8 T;  4QXH B;  1XNQ T;  2F4V T;  4UVC B;  4HFB A;  2WM9 A;  3I0Q A;  2Q9Q A;  3ONJ A;  4HTE A;  4C90 A;  2W63 A;  4PK6 A;  2L8K A;  4N78 D;  1MMN A;  4TWF A;  5JR9 A;  5IYZ E;  3BQI A;  1Y64 B;  3J9X 1;  3VKG A;  2BG9 A;  3AEC A;  3W15 B;  3G06 A;  3O4X E;  2CXD A;  2Z6E A;  4JBW F;  2YDQ A;  4DND A;  4KBM B;  4LF9 T;  2LJL A;  1YW0 A;  3PDY A;  2V7J A;  1M7K A;  3OVU A;  3I9W A;  1QLB A;  1D0X A;  3ETU A;  4UEL A;  1J5W A;  4YTM A;  5FY7 A;  5A1L A;  1OED B;  3A7M A;  4WYV A;  4HN9 A;  2E9X A;  3CQC B;  2NW9 A;  1UX5 A;  3ZC1 A;  1HCI A;  3K3N A;  1IBM T;  1R8I A;  2ZM8 A;  2E2A A;  3AAI A;  4EIW A;  2LKH A;  4YHJ A;  4QX7 B;  1WR6 A;  2DNX A;  4IL9 A;  2BBJ A;  4YSX A;  3C50 A;  2IML A;  4PJL A;  2CXF A;  4PJM A;  5L3F B;  3SFE A;  3NVO A;  3H37 A;  3ZC0 A;  1W9R A;  4X1Y E;  2ES0 A;  5IUX A;  5L3D B;  4PJN A;  3AAE B;  4JI1 T;  2YKS A;  2J4G A;  3ZCJ A;  1Z0P A;  3UQ7 A;  2R6G F;  3K3O A;  1MNE A;  2X0Y A;  3NBX X;  5ABH A;  1UX4 A;  2VQE T;  3QOF A;  3PU8 A;  3ZT6 A;  4QXB B;  4COF A;  4TNW A;  5CB4 E;  2ACX A;  1E2A A;  2WCA A;  3UFG A;  4O4H E;  1BR4 A;  5DQV A;  1ZKE A;  2K24 A;  2OV9 A;  3K8P C;  1UUR A;  1E7P A;  5HXS A;  4X1K E;  2JIW A;  2YOE A;  4MAL A;  3RX6 A;  2XHE B;  2FBW A;  4ILU A;  2V26 A;  5HXR A;  5LHH B;  4ILB A;  2WWV A;  4I0U A;  2MOZ A;  3F31 A;  4QH1 A;  3RKO A;  2WBL A;  4I50 E;  2LT3 A;  1WYC A;  5IWA T;  2CLY C;  3UU8 A;  3F2E A;  3HL6 A;  1NEN A;  2BKO A;  3N2O A;  3PUV F;  3WAK A;  5LOV E;  2W66 A;  2HN1 A;  4L0R A;  2FJD A;  4P0A A;  2YDS A;  2KT9 A;  3HKE E;  4TZ4 C;  3ESL A;  3SS1 A;  3EAB A;  1IBL T;  2LRL A;  4JUY A;  4ZI7 E;  2L3L A;  4TN7 B;  2IUB A;  1Y01 A;  4E7Z A;  2D0U A;  3FHN A;  3Q5E A;  2QVA A;  3H3A A;  3QUJ A;  2K48 A;  2BG9 E;  5TAO A;  4NUV A;  2JQ9 A;  5FMN A;  3OYZ A;  3UUN A;  2CBJ A;  2VVN A;  2ODV A;  3ZJ2 A;  4CI2 B;  2X68 A;  3MJX A;  1D0Y A;  3ZJ1 A;  3E08 A;  2LOP A;  2W00 A;  2WZI A;  2PTF A;  2PJQ A;  4IL4 A;  2PFV A;  5HEH A;  2XM1 A;  2BBH A;  2D9D A;  1X9B A;  4QH4 A;  4BJN A;  3BQL A;  4Q25 A;  1KEY A;  4K0U A;  5CJ5 A;  2XQ4 A;  4F8H A;  3LSV A;  2CMR A;  2V1D B;  2LE8 A;  2WP9 A;  4HE8 A;  3U3I A;  4B3M T;  4LMK A;  4KHZ F;  4KP3 C;  5L4E A;  3FXD B;  2FJE A;  3JAF A;  3KDS E;  4P09 A;  1YXR A;  3JC6 D;  2XSB A;  2W62 A;  3B57 A;  4B3R T;  4UVB B;  2KZ7 B;  3KV4 A;  5IHY A;  3N2K E;  3C4W A;  3SFD A;  4B6X A;  4NXN T;  1SE7 A;  1N32 T;  3NZQ A;  2H88 A;  2JPF A;  5CA1 E;  5HYA A;  4XAX B;  3FZL B;  3RF1 A;  2E5L T;  4JI0 T;  2DCF A;  4XZC A;  3ZMZ B;  4G63 A;  2YU1 A;  2W67 A;  4L5G A;  1HX1 B;  1HX8 A;  5JDL A;  3N9L A;  3EAM A;  5FXW A;  4U72 A;  2YDR A;  1X79 A;  3CPZ A;  4DBQ A;  3GWH A;  2NP9 A;  4CXY A;  2JRK A;  1KFY A;  2XQ6 A;  3FZK B;  1LVF A;  4JI7 T;  4DV4 T;  2NTX A;  3VRA A;  5C8Y E;  2EHO C;  2LHR A;  1N33 T;  4C91 A;  4QHO A;  3AEG A;  5CFB A;  3PUA A;  3KFW X;  4MHC A;  3ABV A;  3TLS A;  1HTJ F;  2C5I T;  4EYY R;  2V6Y B;  2DI4 A;  4BJM A;  5J1G A;  3NWI A;  1LVK A;  4BAY B;  5AQQ B;  2XQ3 A;  5L4H A;  3K1S A;  2UUA T;  4AQY T;  2LHN A;  5AQV B;  3O1I A;  3E22 E;  2HPJ A;  5F5W A;  2BS3 A;  4ILC A;  3OKQ A;  3FBL A;  5DAB A;  3ZLI A;  4IE5 A;  3SWH A;  3GMI A;  1J5E T;  4YFS A;  4UIG A;  1ZV4 X;  5GON E;  2V7K A;  5AQN B;  2NW7 A;  3R84 B;  2B76 A;  4DV1 T;  1HFA A;  3P4S A;  4ZXL A;  2EHO A;  2I59 A;  3ZMT B;  1W0A A;  4PW8 A;  1T72 A; 
#chains in the Genus database with same CATH homology
 1WCR A;  2CRB A;  5LB7 B;  3K1S A;  4CN4 A;  2DL1 A;  2LRL A;  2XZE A;  3ZT7 A;  4ZEY A;  4U31 A;  3ZT6 A;  4U7I A;  4WZX A;  4CN1 A;  5CGM A;  3ZST A;  5FVL A;  4P1N A;  4U33 A;  2JQH A;  2V6X A;  2MPK A;  4U2Z A;  2A9U A;  2V6Y A;  4U3C A;  2V6Y B;  2W2U A;  3ZT5 A;  2WWV A;  5CJ5 A;  2CPT A;  2LRK A;  1WFD A;  2RPA A;  2JQK A;  2WY2 A;  2JQ9 A;  4NIQ A;  1WR0 A;  4U7Y A;  2K3W A;  4IT4 A;  1YXR A;  3EAB A;  3ZSS A;  4CN6 A;  4U2Y A;  4A5X A;  5FVK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...