3SOLA

Crystal structure of the type 2 secretion system pilotin gsps
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
91
structure length
91
Chain Sequence
SEQLEQMASIVSATRYLKMRCNRSDLPDEQSILNVANRIAIGKGWQSLTQEDIRKHSDDIYVRLTRDSTPEYIKCREFNRRLVPFIGELLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Type II secretion pathway related protein
publication title Crystal structure of the pilotin from the enterohemorrhagic Escherichia coli type II secretion system.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport
total genus 40
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2011-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1630 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3solA00
4K0UA 4A56A 3SOLA 3UTKA
chains in the Genus database with same CATH superfamily
3ZJ2A 2XAGB 3IHRA 5JR9C 5FVKA 5L3FB 2JMHA 2AE9A 2WDQA 4UXNB 5ETWA 4JBWF 3ZN1B 2CE7A 2YDSA 2ES0A 1SHZC 2FJDA 5HWXA 4HWDA 5EZYE 5IUXA 2I0MA 2DI4A 4ZOLE 3SS1A 5HXSA 1O3XA 3UU6A 4G2AA 2E2AA 3ZC0A 2LSYA 4I0UA 1HS7A 1MIWA 1G8XA 1VCSA 3PUGA 2CHNA 2LOSA 5LA6E 1WCRA 4HGAA 4LF9T 5ABGA 1BR0A 1US7B 1MNDA 2IIUA 5F8PA 5HXEA 4WBNE 2KINB 2D0TA 4HFVA 2BDEA 2Y48B 4ZXLA 1YW0A 2NW8A 1IAPA 2CBJA 4UF0B 2WM9A 1FMWA 1N36T 3L09A 4YSYA 1IBLT 4ISTA 5FY1A 4O2BE 3NRYA 4H9NC 1XMQT 3AEBA 4I50E 5FXVA 4HFBA 2V7LA 4HWIB 1HX1B 1UX4A 1ZEEA 3ZT7A 4U33A 4TV8E 1IBKT 5DJQC 4MLKA 5FY0A 2XZEA 5AQMB 4EGWA 5JH7E 5AQVB 4K0UA 5AQTB 5BR8T 1NEKA 3TLWA 2Q9QD 3HA4A 3N2KE 1CHUA 2WMOA 2V5CA 1N32T 4AXPA 1QUUA 4KP3C 5FXWA 3KV6A 3OKQA 1HNWT 4UEMA 2L9QA 2LRKA 2YK0A 3IBPA 5LGUB 4DR6T 2BG9B 2HH7A 3AA6B 4PJJA 4UF0A 4DR4T 2VL8A 2ZLYA 4TN7B 4EB6E 4PJNA 2JQ9A 3VU7H 3LK2B 3OVUA 1VCTA 2RA1A 4FI5A 3L39A 4P0BA 3CIRA 3O4XE 3PUSA 1YXRA 4HFHA 2NWBA 2EHOB 3T8OA 3QB5K 5FY7A 4AKHA 4Q25A 3AEEA 4TV9E 3AE5A 3FHNA 2FUPA 2XAJB 2NP9A 4DMVA 3EDUA 3UQ4A 4PW8A 4AKIA 2HPLA 3EVYA 4DO0A 3AA1B 3N2OA 3N2GE 5C8YE 2I59A 1WR0A 4WBOA 3H3AA 1XDPA 5L2LA 3H3MA 4TNVA 1BR1A 2PJQA 4YT0A 2DNXA 1T72A 1OEDE 4GOUA 1LVFA 1GQEA 5TAOA 2N9DA 3K8PC 2XSBA 2BG9A 3TKLB 4JYAT 3GN5B 3UU5A 4LF8T 2W62A 3AECA 3RI5A 4LFCT 2WMNA 3CQGB 2XUEA 3J7Yq 2FBWA 4YFSA 4NXNT 1U4QA 1UUSA 2YU2A 3O1IA 1OXZA 4UVAB 1KNPA 4CQIA 4ADZA 4DUYT 2YDQA 2WAUA 4DR5T 5IWAT 2VKHA 1NENA 2CBIA 2IAKA 4L5GA 1HR0T 2OA5A 2HPJA 5IHYA 4DUZT 3P4QA 2W00A 4KHZF 3RYHE 1SA0E 4F8HA 2WZHA 4YJ3E 2BG9C 2V7KA 4L9IA 4DV7T 3IA3A 4A5XA 3CX7B 4IE7A 2WBLA 2W66A 1I6ZA 4DV1T 4PFPA 2K24A 1HF8A 2LT3A 2Y6XA 2MPKA 2X0HA 4LF4T 1BR2A 2RPAA 3PUVF 2CM0A 5FXXA 2VK9A 1IJ6A 4JLEA 4O4JE 5AQHB 3RIFA 1N33T 5CA0E 3EAMA 2LSGA 3IEEA 4ZI3D 5LCYA 2MYSA 3Q5WA 4YXDA 3NVOA 1KNRA 3ZEFB 2PG8A 3DP7A 3GN5A 1X79A 4KBMB 2VL0A 2KZ7B 3EABA 1UCUA 2N2NA 3KVAA 4QKNA 3ETUA 2EHOD 4E7ZA 4O4HE 4IL4A 3FB2A 3KVBA 4H63H 2E5VA 2JQHA 2UUCT 4DV0T 3KV4A 5ABFB 3HKBE 4TWHA 1X9BA 4JEHB 2V7IA 2YKSA 3CPZA 4CN4A 4KX6A 4HFDA 4C90A 3AA7B 1N34T 4KUMB 5FL0A 4OX9T 5F5WA 1W0AA 2H3RA 4LF6T 4U31A 2LSJA 3OYZA 5AQIB 2RP4A 1HG2A 4HTEA 3EHZA 2DLRA 2XTLA 4I55E 3L3PA 5AQUB 3ONLC 2F4VT 2WWUA 5AQRB 3PUWF 5AQKB 4Z91A 5L3CB 4HN9A 2CWYA 4IHJE 3A7MA 5AQQB 3U3IA 4EV6A 3ETVA 3ZMUB 4KI0F 4YSXA 1LRZA 2E9XB 2HN1A 2UXCT 3VR8A 2XPKA 5DABA 3JC6D 2YOEA 2BKOA 5AQSB 4I4TE 3D0TA 3LBXA 1UURA 2XJ7A 2NW9A 2YU1A 3P8CD 2W4XA 3F31A 5LOVE 4DVDA 3WI3A 3QOFA 1Y64B 4QX8B 4CXXA 1W09A 3AAEB 1IJ5A 4X1YE 2V8SV 2BZBA 1J5ET 3NBXX 2B1EA 3UT5E 5ABEA 2LEHA 4UV8B 3RLFF 1OWAA 3H37A 1D0YA 5FL1A 2WP9A 2XQ8A 2FJBA 1M7KA 5LG4A 4O8SA 5CFBA 1YKEB 3GA8A 4QH1A 2DCFA 4QHOA 4LMJA 2V6XA 3V5UA 2XY8B 2W2UA 3BQLA 4WNKA 1NWMX 1WR6A 4NPPA 3A5XA 3QB5A 5FKYA 2IMLA 1D0ZA 5DQWA 2X9XA 3OTOT 2E9XA 4ILAA 4YHHT 2L3LA 4BA9A 4NXMT 2PFVA 2AXDS 1B7TA 5M4YA 2R6GF 3R84B 4YY3T 2LJLA 5FXZA 5L3BB 2D2SA 5JDHA 2V5DA 4PK5A 3EDVA 3ZSTA 4ILCA 2VKDA 2BS2A 5JDLA 3UUNA 4IE5A 4TX5A 3AEAA 1FMVA 4DBQA 3RRWA 3PUYF 2OV9A 3CMLA 4JI2T 1IZNB 4B3ST 1BR4A 2MOZA 4AISA 4BJMA 4NUVA 2E9XC 2V1DB 5JREA 4PK4A 3AVRA 3VRBA 5L47A 3BQIA 4GIWA 3UUXB 4ILBA 3PU8A 1ZOYA 4ZZBA 2L8KA 3PTRB 2ZM6T 5CA1E 5HCJA 4U7YA 2YDRA 2DHRA 1ZV4X 3ZN0B 2NR4A 1E7PA 2NOXA 4YTNA 3RC3A 2IHR1 5E0OA 2LRLA 2BBHA 2MBGA 5FVLA 4AKRB 3AE3A 4XZCA 3KDSE 3VR9A 3R6NA 2KT9A 3ZMTB 5LYJE 3BQKA 2VKOA 3P50A 2KLQA 3CQXC 5LBQB 5LP6E 2LM2A 4X1IE 3W15B 4KHPT 2XAHB 4ZI7E 4LMLA 5DQVA 4CZZB 3RYFE 4EZHA 5JDNA 5HAXA 5L4HA 3F57A 5HYAA 2K5BB 3PV0F 5L4EA 5JDMA 1J5WA 3ZT5A 2IC9A 5KXJA 2BS4A 2C5JA 3MJXA 1XDOA 1CUNA 2J47A 1SUMB 2LLYA 4EOZB 2CRBA 5LHGB 4AKLA 1D1AA 1EZ3A 3ZMSB 3I9WA 3T1HT 1UGOA 2LKGA 2OLTA 3CKDA 3AEDA 3MA9A 3AE7A 2VASA 1XWMA 5HEJA 3C64A 1QSDA 4GYRA 3ZMVB 4H9PC 3DJBA 4HFIA 4AQGA 4H63V 3ZCIA 3ZYKA 3RIUC 2XASB 3PUXF 4ILUA 4TWFA 5KMGP 4WZXA 3FZMB 4JEUB 3VKHA 1D1CA 2A9UA 2CCQA 3LG7A 3N9LA 4ERRA 3ESLA 2CA5A 4XAXB 3NZQA 2W61A 2FJAA 2BKNA 1FEWA 4U3CA 5IYZE 2ACZA 2K9AA 3RKOA 4IDZA 4C91A 2X0YA 4X66T 4UVCB 5ABHA 4AQYT 4IDQA 2NTYA 3E0ZA 4DMWA 2ACXA 5LHIB 2LKHA 4F6RC 4B6XA 2E8IA 1W9RA 3AE9A 1KFYA 3ZMZB 4B3RT 2XQ9A 5KDMC 5J2TE 2I6HA 3VRAA 2CXFA 1H7CA 2UUBT 2KNDA 1V9DA 3DTOA 2W67A 2ZMAA 4JV5T 3CWZB 4FJOA 5BMVE 4LF7T 2MAWA 3ZJ1A 2VVNA 3HR0A 4EYUA 5H6QB 4DV5T 2X9YA 2KMFA 3QK6A 2P9BA 4V1Av 2C5IT 1WYCA 3OJAA 3Q5EA 4LFAT 3KINB 1WRDA 4NIQA 4IDOA 2BBJA 3S4UA 3KBUA 4ZHQE 4KMCA 2LSIA 3GMIA 2J62A 3ZKRA 2KWIB 4Z8XA 3ZCJA 4DR1T 4CXWA 2Z6EA 3RGLA 4U74A 3OPCA 3RKGA 3WAKA 3LDQB 1FIOA 4A97A 2VWAA 3JADA 3UUBA 2QYWA 2G0UA 4X65T 2UXBT 4JI1T 2LE8A 3PE0A 1UX5A 3AB3B 3Q5XA 5CJ5A 1XMOT 4PJMA 1HG5A 1MMGA 1KK7A 5LBMA 1ZP0A 3SOLA 3RQUA 3ZYMA 3EI0A 2XAFB 3KFWX 3RQWA 3N9OA 5LMUT 5AQPB 2ODUA 2JJ9A 3MKDA 3LBXB 1YQ4A 4AIUA 1KEYA 5LJMA 2B76A 4HWCA 2WY2A 2XQAA 4JI0T 2X0LB 4QWNB 4OYKA 2QA7A 2XHEB 5HCMA 4EIWA 4P0AA 5C2TA 2J1DG 3UU4A 3OYXA 2IW5B 1S35A 4AI6A 3VHLA 4COFA 4EEBA 2UXXB 4ZS2A 1YQ3A 5JQGE 4YHJA 2IUBA 1AJ3A 2M6IA 5LB7B 1W0BA 2JQQA 5LNKA 2IDOB 2WU2A 2WDRA 3HI2A 4OHFA 4HKAA 3SFEA 4CN1A 3FBZA 4X20E 2LSKA 4N78D 4QH4A 1MNEA 4CXYA 4GKJT 2WU5A 5AQJB 3K3NA 2CHOA 3I1AA 3O9XA 3PDYA 5L3EB 3RYCE 4X5TA 2XAQB 2XQ4A 2XM1A 3SFDA 4EEDA 2Y8DA 2BS3A 4IDNA 3SRZA 2X68A 3E22E 5FMNA 1IBMT 2NTXA 2D5UA 3L8RA 4UVBB 2W0GA 2WZIA 3ABVA 3LK3B 3I0OA 3MXZA 1VRBA 2BG9E 4OFZA 4DBRA 2NW7A 4ANJA 4HWFA 2XQ3A 2WWVA 2VVSA 3RX6A 5J0ZA 2A3DA 2KXPB 3RPUA 3Q9DA 5JRCB 1MMDA 5KX5E 5LGTB 5AQOB 3M3ZB 4WYVA 4ZI2C 4DR3T 3FZFB 3LFMA 1OEDB 2XQ7A 3PJAJ 1Z0PA 3CX6B 1KNZA 2LHNA 2UU9T 3I0QA 2CLYC 3I9YA 5FYMA 1HTJF 3ZLIA 4P1NA 4Z90A 1ZKEA 4IE0A 2XSAA 4I43B 1ZHCA 4ZS3A 4BJNA 2H88A 3N9NA 1XNQT 2YEVC 3PUAA 2MTQA 5L3GB 1XZYA 2WQYA 3IF8B 1HNXT 1R8IA 2XQ5A 3CK6A 3AXJB 4H9QC 1MMNA 4DIDB 3UQ7A 2V7MA 3AE6A 4U2ZA 5HXHA 3ONXA 5HWYA 3UU8A 2YN6A 4PNIA 5JRCA 3AEGA 3CVRA 3ZSSA 3C4ZA 4IIJE 1OEDA 3C98B 4LF5T 3KV9A 1Y01A 5EK4A 2QRXA 3ANWB 3T1YT 5LMNT 1NAFA 4YLHA 2E9XD 3B57A 3FZHB 3C51A 3AVSA 3Q5DA 1KF6A 3C4XA 4JI4T 1SE7A 2BKPA 3RF1A 3LSVA 4AQFA 5HEGA 5LXTE 4ISSA 2Q9QA 3OBVE 2E5LT 1OEDC 3AAAB 3V5SA 2JPFA 2LOPA 4DV4T 3A8YC 3AXJA 2FJEA 5GONE 3RHWA 3RIUA 3AAIA 3AE1A 4NUUA 1Z8UA 4AQFC 3HKDE 4CN6A 4LMKA 1T8BA 5J1GA 2Q9QC 3K1SA 2ZM8A 4H9SE 4H9OC 2JQKA 3ANWA 1J1JA 4IT4A 3MK7C 3AE4A 4ZZCA 4LFBT 3NWIA 5HXCA 1M62A 3KV5A 1HCIA 4XBFB 1MMAA 4X1KE 3HKEE 2BVLA 4O4LE 4TNWA 3NRXA 3RYIE 3C50A 3CX8B 2IC6A 3FBLA 4TWDA 2SPCA 3TLSA 5HEOA 4ASKA 1E2AA 2BVMA 3NZPA 2LHRA 2WDVA 5HXRA 4GK5E 2UXNB 3TLTA 3UFEA 2H7OA 4U2YA 3UFGA 3FZLB 4MALA 5AQLB 2VQET 2CXLA 4G63A 3FXDB 4QXCB 4UR9A 5AQGB 2JMKA 4QH5A 4DNDA 4U7IA 3N9PA 4IE4A 5JDGA 4X64T 2XQYA 2C0SA 4U72A 4HWHA 4CI2B 2CWOA 1QLBA 3QUJA 3AEFA 3E08A 2UXDT 1D1BA 3Q2MA 3UU3A 3FXEB 1UK5A 2HN2A 2ZM0A 3HL6A 1YKHB 2X67A 1LVKA 5C3JA 3UULA 2WCAA 1WFDA 2DWKA 4DV6T 1L0VA 3RIAA 1JNZA 2W63A 1MIVA 1HFAA 3NKZA 1DU2A 1YD8G 1HNZT 4B3MT 2VKJA 3WAJA 4PFOA 5CB4E 2VB6A 4MBQA 4TZ4C 2KSRA 2X9HA 2X66A 4YTMA 4GKKT 3RRCA 4K0KT 3LK42 4O2AE 3TLUA 3PURA 2ZM2A 3JAFA 4UV9B 5EK3A 5JVDE 2CMRA 4JI8T 5HEHA 4YJ2E 3MZKB 1S94A 4IREA 4BAYB 3QC9A 4ZEYA 4IE6A 4IL9A 2XM2A 3KBTA 5FP3A 2X9WA 4DV3T 4EZ4A 4HEAA 1JNRA 5AQFB 3C4WA 4OK0A 3PUZF 2EHOA 2V6YB 2CEAA 3ZPOA 4DR2T 2ODVA 2GK9A 1D0XA 5ADXL 3P4PA 3RH3A 5EK2A 4TUYE 3AA0B 4E7SA 4YTPA 4DR7T 2QGSA 3LJCA 3PJAA 4ZI3C 4HFCA 1T7SA 3P4SA 2A2FX 2J4GA 3ZYLA 2PTFA 4L0RA 3GWHA 3ZT6A 4JI5T 3AE2A 3MACA 5LGNB 2CXDA 3K3OA 2WSSV 5LHHB 3TLVA 3N9QA 2EHOC 4J2CA 2K48A 3U78A 4GYSA 4X62T 3X1DA 3VKGA 3RC8A 2CPTA 4PK6A 2VURA 2M67A 2V7JA 3O1JA 4CI1B 5J2UE 2CLYB 3P7IA 3CQCB 4HFEA 4P09A 4EAHA 5F3JA 2JIWA 5AFUL 4A98A 2V6YA 4QX7B 4IDPA 2WS3A 4CI3B 2XQ6A 3J9X1 4JI3T 4WW0A 4MHCA 5H6RB 3HKCE 4AKGA 2VQFT 3O1HA 5JR9B 5AQNB 1G73A 3JC6C 4HE8A 4UIGA 1U5PA 1MIYA 4B3TT 3UTKA 3N5LA 4A56A 3K3QC 3PU3A 1XNRT 2V26A 4M1PA 2YINA 2LM9A 4JI7T 3EUHA 3JAEA 2A72A 3M65A 1HX8A 4IGUA 3QNUA 4JUYA 4OYJA 3SWHA 2H7VC 2JRKA 2H89A 1VOMA 3P4RA 4EYYR 5ABFA 1E1HB 4H9RC 3B13A 3P4WA 5L3DB 4O4IE 3B5MA 3PUQA 2KWHA 3N9MA 3JCFA 2M6BA 2HHHT 2D0UA 5FNVE 3G06A 1WLXA 4JI6T 3ONJA 5HEUA 5CGMA 5LJNA 4MFRA 1FJGT 2X51A 2UUAT 5JDQA 4EXTA 5JR9A 1LKXA 2N1GA 4QXBB 2D9DA 3UUMA 4QXHB 3BK9A 3FZKB 2DL1A 4ZI2D 4DV2T 4UELA 2K3WA 4PJLA 1T98A 5JTGA 2WB5A 5A1LA 2Q9QB 3AE8A 1WYBA 2QVAA 4YSZA 3F2EA 4PAGA 2PBIA 4GK0E 5JDFA 2C5KT 1I94T 2DWGA 3ZC1A 5LG3A
chains in the Genus database with same CATH topology
4XBFB 1MMAA 2XAGB 3GMIA 3ZJ2A 3IHRA 2DLRA 2XTLA 2KWIB 4Z8XA 4I55E 3ZCJA 3L3PA 5JR9C 4X1KE 3HKEE 2BVLA 4O4LE 4CXWA 5L3FB 3NRXA 2Z6EA 2JMHA 2WWUA 3RYIE 4U74A 4UXNB 5ETWA 3C50A 5L3CB 4HN9A 2CWYA 4IHJE 3U3IA 3ZN1B 2CE7A 3CX8B 3ETVA 3ZMUB 2IC6A 3FBLA 2ES0A 3WAKA 1SHZC 1FIOA 2SPCA 5HWXA 1LRZA 2E9XB 2VWAA 4ASKA 5EZYE 5DABA 3JC6D 2G0UA 2BVMA 3NZPA 2DI4A 4ZOLE 2LHRA 4I4TE 3SS1A 5HXSA 5HXRA 2LE8A 3PE0A 1O3XA 3D0TA 4GK5E 4G2AA 2UXNB 3LBXA 1UX5A 3AB3B 3Q5XA 3ZC0A 2LSYA 3UFEA 1HS7A 2NW9A 2H7OA 2YU1A 1MIWA 3P8CD 1G8XA 3F31A 5LOVE 3PUGA 4DVDA 3WI3A 2LOSA 4PJMA 5LA6E 1Y64B 4HGAA 4QX8B 4MALA 1HG5A 4CXXA 1MMGA 1KK7A 2CXLA 1BR0A 4G63A 5LBMA 3AAEB 1IJ5A 1US7B 4X1YE 1MNDA 3FXDB 4QXCB 2BZBA 3NBXX 2B1EA 3SOLA 2JMKA 3UT5E 3ZYMA 4DNDA 2LEHA 3N9PA 5F8PA 5HXEA 2XAFB 4IE4A 2KINB 2D0TA 4UV8B 4WBNE 5JDGA 4HFVA 1OWAA 2XQYA 3H37A 2BDEA 1D0YA 2C0SA 3KFWX 4U72A 4CI2B 2Y48B 3N9OA 2CWOA 2ODUA 2JJ9A 3MKDA 3LBXB 5LG4A 5LJMA 3QUJA 1YW0A 3E08A 2NW8A 1IAPA 4O8SA 4UF0B 1D1BA 1YKEB 2WM9A 1FMWA 3GA8A 3L09A 2DCFA 2X0LB 4QHOA 3V5UA 4ISTA 4QWNB 3Q2MA 4OYKA 2QA7A 2XHEB 3FXEB 2ZM0A 3HL6A 5FY1A 4EIWA 4O2BE 3NRYA 3BQLA 1YKHB 4H9NC 4WNKA 2J1DG 4P0AA 1NWMX 3OYXA 2X67A 1LVKA 1WR6A 3UULA 4I50E 2DWKA 2IW5B 1S35A 3A5XA 5FXVA 4AI6A 3VHLA 2W63A 1MIVA 1HFAA 2UXXB 2V7LA 1D0ZA 4ZS2A 1YD8G 5DQWA 5JQGE 2X9XA 1UX4A 1ZEEA 2VKJA 4YHJA 4PFOA 3WAJA 2E9XA 1AJ3A 5CB4E 2L3LA 2VB6A 4BA9A 4MBQA 2JQQA 4TZ4C 4TV8E 5LNKA 5DJQC 2PFVA 2X9HA 4MLKA 5FY0A 2X66A 1B7TA 5M4YA 3RRCA 3R84B 3LK42 2LJLA 4O2AE 5FXZA 5L3BB 2D2SA 3HI2A 3PURA 4HKAA 4OHFA 5JH7E 2ZM2A 5JDHA 4PK5A 4UV9B 5EK3A 4K0UA 3EDVA 5JVDE 2CMRA 4YJ2E 3MZKB 3FBZA 4X20E 2Q9QD 1S94A 2LSKA 3HA4A 3N2KE 4N78D 2VKDA 4BAYB 2WMOA 3QC9A 5JDLA 3UUNA 4AXPA 4IE6A 1MNEA 4IE5A 1QUUA 4KP3C 4TX5A 1FMVA 4DBQA 4CXYA 3KBTA 5FXWA 3RRWA 5FP3A 2X9WA 3KV6A 3OKQA 3CMLA 4UEMA 2L9QA 4EZ4A 2YK0A 4HEAA 1IZNB 3C4WA 4OK0A 3IBPA 3K3NA 2EHOA 1BR4A 2MOZA 3I1AA 4BJMA 3O9XA 4NUVA 2E9XC 3PDYA 5L3EB 2V1DB 3RYCE 5LGUB 2CEAA 5JREA 4PK4A 2XAQB 3ZPOA 2HH7A 3AVRA 2ODVA 2GK9A 1D0XA 3AA6B 3BQIA 2Y8DA 4PJJA 4GIWA 3UUXB 5ADXL 3PU8A 4UF0A 3SRZA 3RH3A 2VL8A 2X68A 2ZLYA 4TN7B 4EB6E 3E22E 2L8KA 3PTRB 4PJNA 5EK2A 4TUYE 3AA0B 3VU7H 4E7SA 3LK2B 5CA1E 5FMNA 2QGSA 3LJCA 4ZI3C 2DHRA 1ZV4X 2RA1A 2A2FX 3ZYLA 4FI5A 2NTXA 4L0RA 3GWHA 4P0BA 3ZN0B 3O4XE 2D5UA 4UVBB 3PUSA 2W0GA 3MACA 2NOXA 2NWBA 3LK3B 5LGNB 3I0OA 2CXDA 3MXZA 3K3OA 2EHOB 2WSSV 1VRBA 3RC3A 5E0OA 3T8OA 5FY7A 4AKHA 5LHHB 4OFZA 4DBRA 2MBGA 2NW7A 4ANJA 4TV9E 3N9QA 2EHOC 4AKRB 4J2CA 2K48A 3RX6A 4XZCA 2A3DA 2KXPB 3FHNA 3RPUA 3U78A 3KDSE 4GYSA 3Q9DA 3R6NA 5JRCB 1MMDA 2KT9A 3ZMTB 2XAJB 5KX5E 5LYJE 2NP9A 4DMVA 5LGTB 3RC8A 3VKGA 3BQKA 3EDUA 4PW8A 2VKOA 2KLQA 4AKIA 3CQXC 4ZI2C 3LFMA 2HPLA 3EVYA 4PK6A 4DO0A 3AA1B 5LBQB 3N2OA 5LP6E 2M67A 3N2GE 2V7JA 5C8YE 4X1IE 3W15B 1Z0PA 2XAHB 3O1JA 4ZI7E 3CX6B 4CI1B 1KNZA 2I59A 5DQVA 4CZZB 2CLYB 5J2UE 3RYFE 4EZHA 5JDNA 4WBOA 3H3AA 2LHNA 3P7IA 5L2LA 3I0QA 5HAXA 3CQCB 3F57A 2CLYC 1BR1A 5HYAA 2K5BB 3I9YA 5FYMA 1HTJF 3ZLIA 4P09A 4EAHA 5JDMA 5F3JA 2PJQA 2IC9A 5AFUL 1ZKEA 4IE0A 2C5JA 2DNXA 3MJXA 4GOUA 1LVFA 5TAOA 2N9DA 4I43B 4QX7B 1CUNA 1ZHCA 4CI3B 3K8PC 4ZS3A 3J9X1 3TKLB 4BJNA 4EOZB 3N9NA 5LHGB 3GN5B 2YEVC 4AKLA 1D1AA 1EZ3A 2W62A 3I9WA 3PUAA 4WW0A 3ZMSB 4MHCA 2MTQA 5L3GB 2WMNA 5H6RB 3CQGB 2XUEA 3IF8B 3J7Yq 3CKDA 3HKCE 4YFSA 4AKGA 3MA9A 3O1HA 1U4QA 2VASA 5JR9B 2YU2A 3O1IA 3C64A 1OXZA 4UVAB 1QSDA 4GYRA 1MMNA 4H9QC 1G73A 3JC6C 4HE8A 4ADZA 4CQIA 3ZMVB 2WAUA 2V7MA 4UIGA 4H9PC 1U5PA 3DJBA 4AQGA 4H63V 1MIYA 3ZCIA 3UTKA 2VKHA 3ZYKA 2IAKA 4L5GA 5HXHA 3N5LA 4A56A 3ONXA 2XASB 4ILUA 5HWYA 2OA5A 3K3QC 3PU3A 2HPJA 5KMGP 5IHYA 2W00A 2V26A 4PNIA 3RYHE 5JRCA 4JEUB 1SA0E 4M1PA 2YINA 3CVRA 2LM9A 4YJ3E 1D1CA 3VKHA 3EUHA 2CCQA 3LG7A 2V7KA 3C4ZA 4IIJE 3N9LA 4ERRA 3C98B 3ESLA 2CA5A 3KV9A 4XAXB 4L9IA 5EK4A 3NZQA 2A72A 3ANWB 3CX7B 3M65A 4IE7A 2W61A 1NAFA 4YLHA 1HX8A 2E9XD 3B57A 4IGUA 3C51A 2WBLA 1FEWA 3AVSA 4PFPA 2K24A 1HF8A 2LT3A 2Y6XA 3C4XA 5IYZE 4JUYA 4OYJA 1BR2A 3SWHA 2CM0A 2H7VC 2JRKA 2VK9A 5FXXA 1IJ6A 1VOMA 4EYYR 2K9AA 4JLEA 4AQFA 4O4JE 1E1HB 4H9RC 3RKOA 4IDZA 4C91A 3B13A 4UVCB 5L3DB 5LXTE 4ISSA 5CA0E 4O4IE 2LSGA 3PUQA 3IEEA 2KWHA 4ZI3D 5LCYA 3N9MA 2MYSA 3Q5WA 2Q9QA 2NTYA 3E0ZA 2D0UA 2ACXA 3OBVE 4DMWA 5LHIB 3ZEFB 4F6RC 2PG8A 5FNVE 4B6XA 1WLXA 3DP7A 3GN5A 2E8IA 5LJNA 1X79A 3ZMZB 4KBMB 2KZ7B 1UCUA 4MFRA 2N2NA 5KDMC 2X51A 3KVAA 4QKNA 5J2TE 3ETUA 5JDQA 2CXFA 3AAAB 2EHOD 3V5SA 1H7CA 4EXTA 4E7ZA 4O4HE 2JPFA 2LOPA 5JR9A 3FB2A 3KVBA 4H63H 1LKXA 2N1GA 2KNDA 4QXBB 1V9DA 3KV4A 3UUMA 4QXHB 5GONE 3BK9A 3DTOA 3HKBE 3AAIA 2ZMAA 4ZI2D 4JEHB 2V7IA 4NUUA 3CPZA 4UELA 3CWZB 4FJOA 4AQFC 4PJLA 1T98A 3HKDE 5BMVE 4C90A 5A1LA 2Q9QB 3AA7B 3ZJ1A 4KUMB 3HR0A 5J1GA 4EYUA 5H6QB 1WYBA 2X9YA 2KMFA 2H3RA 2Q9QC 3QK6A 2P9BA 4V1Av 2C5IT 1WYCA 2ZM8A 3F2EA 4PAGA 2PBIA 3OJAA 3KINB 4GK0E 5JDFA 1WRDA 4H9SE 2C5KT 2LSJA 4H9OC 3OYZA 2RP4A 1HG2A 4HTEA 3ANWA 2DWGA 3S4UA 3KBUA 3MK7C 3ZC1A 4ZHQE 5HXCA 4KMCA 3KV5A 1HCIA 2LSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K0U A;  4A56 A;  3SOL A;  3UTK A; 
#chains in the Genus database with same CATH topology
 3ZJ2 A;  2XAG B;  3IHR A;  5JR9 C;  5FVK A;  5L3F B;  2JMH A;  2AE9 A;  2WDQ A;  4UXN B;  5ETW A;  4JBW F;  3ZN1 B;  2CE7 A;  2YDS A;  2ES0 A;  1SHZ C;  2FJD A;  5HWX A;  4HWD A;  5EZY E;  5IUX A;  2I0M A;  2DI4 A;  4ZOL E;  3SS1 A;  5HXS A;  1O3X A;  3UU6 A;  4G2A A;  2E2A A;  3ZC0 A;  2LSY A;  4I0U A;  1HS7 A;  1MIW A;  1G8X A;  1VCS A;  3PUG A;  2CHN A;  2LOS A;  5LA6 E;  1WCR A;  4HGA A;  4LF9 T;  5ABG A;  1BR0 A;  1US7 B;  1MND A;  2IIU A;  5F8P A;  5HXE A;  4WBN E;  2KIN B;  2D0T A;  4HFV A;  2BDE A;  2Y48 B;  4ZXL A;  1YW0 A;  2NW8 A;  1IAP A;  2CBJ A;  4UF0 B;  2WM9 A;  1FMW A;  1N36 T;  3L09 A;  4YSY A;  1IBL T;  4IST A;  5FY1 A;  4O2B E;  3NRY A;  4H9N C;  1XMQ T;  3AEB A;  4I50 E;  5FXV A;  4HFB A;  2V7L A;  4HWI B;  1HX1 B;  1UX4 A;  1ZEE A;  3ZT7 A;  4U33 A;  4TV8 E;  1IBK T;  5DJQ C;  4MLK A;  5FY0 A;  2XZE A;  5AQM B;  4EGW A;  5JH7 E;  5AQV B;  4K0U A;  5AQT B;  5BR8 T;  1NEK A;  3TLW A;  2Q9Q D;  3HA4 A;  3N2K E;  1CHU A;  2WMO A;  2V5C A;  1N32 T;  4AXP A;  1QUU A;  4KP3 C;  5FXW A;  3KV6 A;  3OKQ A;  1HNW T;  4UEM A;  2L9Q A;  2LRK A;  2YK0 A;  3IBP A;  5LGU B;  4DR6 T;  2BG9 B;  2HH7 A;  3AA6 B;  4PJJ A;  4UF0 A;  4DR4 T;  2VL8 A;  2ZLY A;  4TN7 B;  4EB6 E;  4PJN A;  2JQ9 A;  3VU7 H;  3LK2 B;  3OVU A;  1VCT A;  2RA1 A;  4FI5 A;  3L39 A;  4P0B A;  3CIR A;  3O4X E;  3PUS A;  1YXR A;  4HFH A;  2NWB A;  2EHO B;  3T8O A;  3QB5 K;  5FY7 A;  4AKH A;  4Q25 A;  3AEE A;  4TV9 E;  3AE5 A;  3FHN A;  2FUP A;  2XAJ B;  2NP9 A;  4DMV A;  3EDU A;  3UQ4 A;  4PW8 A;  4AKI A;  2HPL A;  3EVY A;  4DO0 A;  3AA1 B;  3N2O A;  3N2G E;  5C8Y E;  2I59 A;  1WR0 A;  4WBO A;  3H3A A;  1XDP A;  5L2L A;  3H3M A;  4TNV A;  1BR1 A;  2PJQ A;  4YT0 A;  2DNX A;  1T72 A;  1OED E;  4GOU A;  1LVF A;  1GQE A;  5TAO A;  2N9D A;  3K8P C;  2XSB A;  2BG9 A;  3TKL B;  4JYA T;  3GN5 B;  3UU5 A;  4LF8 T;  2W62 A;  3AEC A;  3RI5 A;  4LFC T;  2WMN A;  3CQG B;  2XUE A;  3J7Y q;  2FBW A;  4YFS A;  4NXN T;  1U4Q A;  1UUS A;  2YU2 A;  3O1I A;  1OXZ A;  4UVA B;  1KNP A;  4CQI A;  4ADZ A;  4DUY T;  2YDQ A;  2WAU A;  4DR5 T;  5IWA T;  2VKH A;  1NEN A;  2CBI A;  2IAK A;  4L5G A;  1HR0 T;  2OA5 A;  2HPJ A;  5IHY A;  4DUZ T;  3P4Q A;  2W00 A;  4KHZ F;  3RYH E;  1SA0 E;  4F8H A;  2WZH A;  4YJ3 E;  2BG9 C;  2V7K A;  4L9I A;  4DV7 T;  3IA3 A;  4A5X A;  3CX7 B;  4IE7 A;  2WBL A;  2W66 A;  1I6Z A;  4DV1 T;  4PFP A;  2K24 A;  1HF8 A;  2LT3 A;  2Y6X A;  2MPK A;  2X0H A;  4LF4 T;  1BR2 A;  2RPA A;  3PUV F;  2CM0 A;  5FXX A;  2VK9 A;  1IJ6 A;  4JLE A;  4O4J E;  5AQH B;  3RIF A;  1N33 T;  5CA0 E;  3EAM A;  2LSG A;  3IEE A;  4ZI3 D;  5LCY A;  2MYS A;  3Q5W A;  4YXD A;  3NVO A;  1KNR A;  3ZEF B;  2PG8 A;  3DP7 A;  3GN5 A;  1X79 A;  4KBM B;  2VL0 A;  2KZ7 B;  3EAB A;  1UCU A;  2N2N A;  3KVA A;  4QKN A;  3ETU A;  2EHO D;  4E7Z A;  4O4H E;  4IL4 A;  3FB2 A;  3KVB A;  4H63 H;  2E5V A;  2JQH A;  2UUC T;  4DV0 T;  3KV4 A;  5ABF B;  3HKB E;  4TWH A;  1X9B A;  4JEH B;  2V7I A;  2YKS A;  3CPZ A;  4CN4 A;  4KX6 A;  4HFD A;  4C90 A;  3AA7 B;  1N34 T;  4KUM B;  5FL0 A;  4OX9 T;  5F5W A;  1W0A A;  2H3R A;  4LF6 T;  4U31 A;  2LSJ A;  3OYZ A;  5AQI B;  2RP4 A;  1HG2 A;  4HTE A;  3EHZ A;  2DLR A;  2XTL A;  4I55 E;  3L3P A;  5AQU B;  3ONL C;  2F4V T;  2WWU A;  5AQR B;  3PUW F;  5AQK B;  4Z91 A;  5L3C B;  4HN9 A;  2CWY A;  4IHJ E;  3A7M A;  5AQQ B;  3U3I A;  4EV6 A;  3ETV A;  3ZMU B;  4KI0 F;  4YSX A;  1LRZ A;  2E9X B;  2HN1 A;  2UXC T;  3VR8 A;  2XPK A;  5DAB A;  3JC6 D;  2YOE A;  2BKO A;  5AQS B;  4I4T E;  3D0T A;  3LBX A;  1UUR A;  2XJ7 A;  2NW9 A;  2YU1 A;  3P8C D;  2W4X A;  3F31 A;  5LOV E;  4DVD A;  3WI3 A;  3QOF A;  1Y64 B;  4QX8 B;  4CXX A;  1W09 A;  3AAE B;  1IJ5 A;  4X1Y E;  2V8S V;  2BZB A;  1J5E T;  3NBX X;  2B1E A;  3UT5 E;  5ABE A;  2LEH A;  4UV8 B;  3RLF F;  1OWA A;  3H37 A;  1D0Y A;  5FL1 A;  2WP9 A;  2XQ8 A;  2FJB A;  1M7K A;  5LG4 A;  4O8S A;  5CFB A;  1YKE B;  3GA8 A;  4QH1 A;  2DCF A;  4QHO A;  4LMJ A;  2V6X A;  3V5U A;  2XY8 B;  2W2U A;  3BQL A;  4WNK A;  1NWM X;  1WR6 A;  4NPP A;  3A5X A;  3QB5 A;  5FKY A;  2IML A;  1D0Z A;  5DQW A;  2X9X A;  3OTO T;  2E9X A;  4ILA A;  4YHH T;  2L3L A;  4BA9 A;  4NXM T;  2PFV A;  2AXD S;  1B7T A;  5M4Y A;  2R6G F;  3R84 B;  4YY3 T;  2LJL A;  5FXZ A;  5L3B B;  2D2S A;  5JDH A;  2V5D A;  4PK5 A;  3EDV A;  3ZST A;  4ILC A;  2VKD A;  2BS2 A;  5JDL A;  3UUN A;  4IE5 A;  4TX5 A;  3AEA A;  1FMV A;  4DBQ A;  3RRW A;  3PUY F;  2OV9 A;  3CML A;  4JI2 T;  1IZN B;  4B3S T;  1BR4 A;  2MOZ A;  4AIS A;  4BJM A;  4NUV A;  2E9X C;  2V1D B;  5JRE A;  4PK4 A;  3AVR A;  3VRB A;  5L47 A;  3BQI A;  4GIW A;  3UUX B;  4ILB A;  3PU8 A;  1ZOY A;  4ZZB A;  2L8K A;  3PTR B;  2ZM6 T;  5CA1 E;  5HCJ A;  4U7Y A;  2YDR A;  2DHR A;  1ZV4 X;  3ZN0 B;  2NR4 A;  1E7P A;  2NOX A;  4YTN A;  3RC3 A;  2IHR 1;  5E0O A;  2LRL A;  2BBH A;  2MBG A;  5FVL A;  4AKR B;  3AE3 A;  4XZC A;  3KDS E;  3VR9 A;  3R6N A;  2KT9 A;  3ZMT B;  5LYJ E;  3BQK A;  2VKO A;  3P50 A;  2KLQ A;  3CQX C;  5LBQ B;  5LP6 E;  2LM2 A;  4X1I E;  3W15 B;  4KHP T;  2XAH B;  4ZI7 E;  4LML A;  5DQV A;  4CZZ B;  3RYF E;  4EZH A;  5JDN A;  5HAX A;  5L4H A;  3F57 A;  5HYA A;  2K5B B;  3PV0 F;  5L4E A;  5JDM A;  1J5W A;  3ZT5 A;  2IC9 A;  5KXJ A;  2BS4 A;  2C5J A;  3MJX A;  1XDO A;  1CUN A;  2J47 A;  1SUM B;  2LLY A;  4EOZ B;  2CRB A;  5LHG B;  4AKL A;  1D1A A;  1EZ3 A;  3ZMS B;  3I9W A;  3T1H T;  1UGO A;  2LKG A;  2OLT A;  3CKD A;  3AED A;  3MA9 A;  3AE7 A;  2VAS A;  1XWM A;  5HEJ A;  3C64 A;  1QSD A;  4GYR A;  3ZMV B;  4H9P C;  3DJB A;  4HFI A;  4AQG A;  4H63 V;  3ZCI A;  3ZYK A;  3RIU C;  2XAS B;  3PUX F;  4ILU A;  4TWF A;  5KMG P;  4WZX A;  3FZM B;  4JEU B;  3VKH A;  1D1C A;  2A9U A;  2CCQ A;  3LG7 A;  3N9L A;  4ERR A;  3ESL A;  2CA5 A;  4XAX B;  3NZQ A;  2W61 A;  2FJA A;  2BKN A;  1FEW A;  4U3C A;  5IYZ E;  2ACZ A;  2K9A A;  3RKO A;  4IDZ A;  4C91 A;  2X0Y A;  4X66 T;  4UVC B;  5ABH A;  4AQY T;  4IDQ A;  2NTY A;  3E0Z A;  4DMW A;  2ACX A;  5LHI B;  2LKH A;  4F6R C;  4B6X A;  2E8I A;  1W9R A;  3AE9 A;  1KFY A;  3ZMZ B;  4B3R T;  2XQ9 A;  5KDM C;  5J2T E;  2I6H A;  3VRA A;  2CXF A;  1H7C A;  2UUB T;  2KND A;  1V9D A;  3DTO A;  2W67 A;  2ZMA A;  4JV5 T;  3CWZ B;  4FJO A;  5BMV E;  4LF7 T;  2MAW A;  3ZJ1 A;  2VVN A;  3HR0 A;  4EYU A;  5H6Q B;  4DV5 T;  2X9Y A;  2KMF A;  3QK6 A;  2P9B A;  4V1A v;  2C5I T;  1WYC A;  3OJA A;  3Q5E A;  4LFA T;  3KIN B;  1WRD A;  4NIQ A;  4IDO A;  2BBJ A;  3S4U A;  3KBU A;  4ZHQ E;  4KMC A;  2LSI A;  3GMI A;  2J62 A;  3ZKR A;  2KWI B;  4Z8X A;  3ZCJ A;  4DR1 T;  4CXW A;  2Z6E A;  3RGL A;  4U74 A;  3OPC A;  3RKG A;  3WAK A;  3LDQ B;  1FIO A;  4A97 A;  2VWA A;  3JAD A;  3UUB A;  2QYW A;  2G0U A;  4X65 T;  2UXB T;  4JI1 T;  2LE8 A;  3PE0 A;  1UX5 A;  3AB3 B;  3Q5X A;  5CJ5 A;  1XMO T;  4PJM A;  1HG5 A;  1MMG A;  1KK7 A;  5LBM A;  1ZP0 A;  3SOL A;  3RQU A;  3ZYM A;  3EI0 A;  2XAF B;  3KFW X;  3RQW A;  3N9O A;  5LMU T;  5AQP B;  2ODU A;  2JJ9 A;  3MKD A;  3LBX B;  1YQ4 A;  4AIU A;  1KEY A;  5LJM A;  2B76 A;  4HWC A;  2WY2 A;  2XQA A;  4JI0 T;  2X0L B;  4QWN B;  4OYK A;  2QA7 A;  2XHE B;  5HCM A;  4EIW A;  4P0A A;  5C2T A;  2J1D G;  3UU4 A;  3OYX A;  2IW5 B;  1S35 A;  4AI6 A;  3VHL A;  4COF A;  4EEB A;  2UXX B;  4ZS2 A;  1YQ3 A;  5JQG E;  4YHJ A;  2IUB A;  1AJ3 A;  2M6I A;  5LB7 B;  1W0B A;  2JQQ A;  5LNK A;  2IDO B;  2WU2 A;  2WDR A;  3HI2 A;  4OHF A;  4HKA A;  3SFE A;  4CN1 A;  3FBZ A;  4X20 E;  2LSK A;  4N78 D;  4QH4 A;  1MNE A;  4CXY A;  4GKJ T;  2WU5 A;  5AQJ B;  3K3N A;  2CHO A;  3I1A A;  3O9X A;  3PDY A;  5L3E B;  3RYC E;  4X5T A;  2XAQ B;  2XQ4 A;  2XM1 A;  3SFD A;  4EED A;  2Y8D A;  2BS3 A;  4IDN A;  3SRZ A;  2X68 A;  3E22 E;  5FMN A;  1IBM T;  2NTX A;  2D5U A;  3L8R A;  4UVB B;  2W0G A;  2WZI A;  3ABV A;  3LK3 B;  3I0O A;  3MXZ A;  1VRB A;  2BG9 E;  4OFZ A;  4DBR A;  2NW7 A;  4ANJ A;  4HWF A;  2XQ3 A;  2WWV A;  2VVS A;  3RX6 A;  5J0Z A;  2A3D A;  2KXP B;  3RPU A;  3Q9D A;  5JRC B;  1MMD A;  5KX5 E;  5LGT B;  5AQO B;  3M3Z B;  4WYV A;  4ZI2 C;  4DR3 T;  3FZF B;  3LFM A;  1OED B;  2XQ7 A;  3PJA J;  1Z0P A;  3CX6 B;  1KNZ A;  2LHN A;  2UU9 T;  3I0Q A;  2CLY C;  3I9Y A;  5FYM A;  1HTJ F;  3ZLI A;  4P1N A;  4Z90 A;  1ZKE A;  4IE0 A;  2XSA A;  4I43 B;  1ZHC A;  4ZS3 A;  4BJN A;  2H88 A;  3N9N A;  1XNQ T;  2YEV C;  3PUA A;  2MTQ A;  5L3G B;  1XZY A;  2WQY A;  3IF8 B;  1HNX T;  1R8I A;  2XQ5 A;  3CK6 A;  3AXJ B;  4H9Q C;  1MMN A;  4DID B;  3UQ7 A;  2V7M A;  3AE6 A;  4U2Z A;  5HXH A;  3ONX A;  5HWY A;  3UU8 A;  2YN6 A;  4PNI A;  5JRC A;  3AEG A;  3CVR A;  3ZSS A;  3C4Z A;  4IIJ E;  1OED A;  3C98 B;  4LF5 T;  3KV9 A;  1Y01 A;  5EK4 A;  2QRX A;  3ANW B;  3T1Y T;  5LMN T;  1NAF A;  4YLH A;  2E9X D;  3B57 A;  3FZH B;  3C51 A;  3AVS A;  3Q5D A;  1KF6 A;  3C4X A;  4JI4 T;  1SE7 A;  2BKP A;  3RF1 A;  3LSV A;  4AQF A;  5HEG A;  5LXT E;  4ISS A;  2Q9Q A;  3OBV E;  2E5L T;  1OED C;  3AAA B;  3V5S A;  2JPF A;  2LOP A;  4DV4 T;  3A8Y C;  3AXJ A;  2FJE A;  5GON E;  3RHW A;  3RIU A;  3AAI A;  3AE1 A;  4NUU A;  1Z8U A;  4AQF C;  3HKD E;  4CN6 A;  4LMK A;  1T8B A;  5J1G A;  2Q9Q C;  3K1S A;  2ZM8 A;  4H9S E;  4H9O C;  2JQK A;  3ANW A;  1J1J A;  4IT4 A;  3MK7 C;  3AE4 A;  4ZZC A;  4LFB T;  3NWI A;  5HXC A;  1M62 A;  3KV5 A;  1HCI A;  4XBF B;  1MMA A;  4X1K E;  3HKE E;  2BVL A;  4O4L E;  4TNW A;  3NRX A;  3RYI E;  3C50 A;  3CX8 B;  2IC6 A;  3FBL A;  4TWD A;  2SPC A;  3TLS A;  5HEO A;  4ASK A;  1E2A A;  2BVM A;  3NZP A;  2LHR A;  2WDV A;  5HXR A;  4GK5 E;  2UXN B;  3TLT A;  3UFE A;  2H7O A;  4U2Y A;  3UFG A;  3FZL B;  4MAL A;  5AQL B;  2VQE T;  2CXL A;  4G63 A;  3FXD B;  4QXC B;  4UR9 A;  5AQG B;  2JMK A;  4QH5 A;  4DND A;  4U7I A;  3N9P A;  4IE4 A;  5JDG A;  4X64 T;  2XQY A;  2C0S A;  4U72 A;  4HWH A;  4CI2 B;  2CWO A;  1QLB A;  3QUJ A;  3AEF A;  3E08 A;  2UXD T;  1D1B A;  3Q2M A;  3UU3 A;  3FXE B;  1UK5 A;  2HN2 A;  2ZM0 A;  3HL6 A;  1YKH B;  2X67 A;  1LVK A;  5C3J A;  3UUL A;  2WCA A;  1WFD A;  2DWK A;  4DV6 T;  1L0V A;  3RIA A;  1JNZ A;  2W63 A;  1MIV A;  1HFA A;  3NKZ A;  1DU2 A;  1YD8 G;  1HNZ T;  4B3M T;  2VKJ A;  3WAJ A;  4PFO A;  5CB4 E;  2VB6 A;  4MBQ A;  4TZ4 C;  2KSR A;  2X9H A;  2X66 A;  4YTM A;  4GKK T;  3RRC A;  4K0K T;  3LK4 2;  4O2A E;  3TLU A;  3PUR A;  2ZM2 A;  3JAF A;  4UV9 B;  5EK3 A;  5JVD E;  2CMR A;  4JI8 T;  5HEH A;  4YJ2 E;  3MZK B;  1S94 A;  4IRE A;  4BAY B;  3QC9 A;  4ZEY A;  4IE6 A;  4IL9 A;  2XM2 A;  3KBT A;  5FP3 A;  2X9W A;  4DV3 T;  4EZ4 A;  4HEA A;  1JNR A;  5AQF B;  3C4W A;  4OK0 A;  3PUZ F;  2EHO A;  2V6Y B;  2CEA A;  3ZPO A;  4DR2 T;  2ODV A;  2GK9 A;  1D0X A;  5ADX L;  3P4P A;  3RH3 A;  5EK2 A;  4TUY E;  3AA0 B;  4E7S A;  4YTP A;  4DR7 T;  2QGS A;  3LJC A;  3PJA A;  4ZI3 C;  4HFC A;  1T7S A;  3P4S A;  2A2F X;  2J4G A;  3ZYL A;  2PTF A;  4L0R A;  3GWH A;  3ZT6 A;  4JI5 T;  3AE2 A;  3MAC A;  5LGN B;  2CXD A;  3K3O A;  2WSS V;  5LHH B;  3TLV A;  3N9Q A;  2EHO C;  4J2C A;  2K48 A;  3U78 A;  4GYS A;  4X62 T;  3X1D A;  3VKG A;  3RC8 A;  2CPT A;  4PK6 A;  2VUR A;  2M67 A;  2V7J A;  3O1J A;  4CI1 B;  5J2U E;  2CLY B;  3P7I A;  3CQC B;  4HFE A;  4P09 A;  4EAH A;  5F3J A;  2JIW A;  5AFU L;  4A98 A;  2V6Y A;  4QX7 B;  4IDP A;  2WS3 A;  4CI3 B;  2XQ6 A;  3J9X 1;  4JI3 T;  4WW0 A;  4MHC A;  5H6R B;  3HKC E;  4AKG A;  2VQF T;  3O1H A;  5JR9 B;  5AQN B;  1G73 A;  3JC6 C;  4HE8 A;  4UIG A;  1U5P A;  1MIY A;  4B3T T;  3UTK A;  3N5L A;  4A56 A;  3K3Q C;  3PU3 A;  1XNR T;  2V26 A;  4M1P A;  2YIN A;  2LM9 A;  4JI7 T;  3EUH A;  3JAE A;  2A72 A;  3M65 A;  1HX8 A;  4IGU A;  3QNU A;  4JUY A;  4OYJ A;  3SWH A;  2H7V C;  2JRK A;  2H89 A;  1VOM A;  3P4R A;  4EYY R;  5ABF A;  1E1H B;  4H9R C;  3B13 A;  3P4W A;  5L3D B;  4O4I E;  3B5M A;  3PUQ A;  2KWH A;  3N9M A;  3JCF A;  2M6B A;  2HHH T;  2D0U A;  5FNV E;  3G06 A;  1WLX A;  4JI6 T;  3ONJ A;  5HEU A;  5CGM A;  5LJN A;  4MFR A;  1FJG T;  2X51 A;  2UUA T;  5JDQ A;  4EXT A;  5JR9 A;  1LKX A;  2N1G A;  4QXB B;  2D9D A;  3UUM A;  4QXH B;  3BK9 A;  3FZK B;  2DL1 A;  4ZI2 D;  4DV2 T;  4UEL A;  2K3W A;  4PJL A;  1T98 A;  5JTG A;  2WB5 A;  5A1L A;  2Q9Q B;  3AE8 A;  1WYB A;  2QVA A;  4YSZ A;  3F2E A;  4PAG A;  2PBI A;  4GK0 E;  5JDF A;  2C5K T;  1I94 T;  2DWG A;  3ZC1 A;  5LG3 A; 
#chains in the Genus database with same CATH homology
 4XBF B;  1MMA A;  2XAG B;  3GMI A;  3ZJ2 A;  3IHR A;  2DLR A;  2XTL A;  2KWI B;  4Z8X A;  4I55 E;  3ZCJ A;  3L3P A;  5JR9 C;  4X1K E;  3HKE E;  2BVL A;  4O4L E;  4CXW A;  5L3F B;  3NRX A;  2Z6E A;  2JMH A;  2WWU A;  3RYI E;  4U74 A;  4UXN B;  5ETW A;  3C50 A;  5L3C B;  4HN9 A;  2CWY A;  4IHJ E;  3U3I A;  3ZN1 B;  2CE7 A;  3CX8 B;  3ETV A;  3ZMU B;  2IC6 A;  3FBL A;  2ES0 A;  3WAK A;  1SHZ C;  1FIO A;  2SPC A;  5HWX A;  1LRZ A;  2E9X B;  2VWA A;  4ASK A;  5EZY E;  5DAB A;  3JC6 D;  2G0U A;  2BVM A;  3NZP A;  2DI4 A;  4ZOL E;  2LHR A;  4I4T E;  3SS1 A;  5HXS A;  5HXR A;  2LE8 A;  3PE0 A;  1O3X A;  3D0T A;  4GK5 E;  4G2A A;  2UXN B;  3LBX A;  1UX5 A;  3AB3 B;  3Q5X A;  3ZC0 A;  2LSY A;  3UFE A;  1HS7 A;  2NW9 A;  2H7O A;  2YU1 A;  1MIW A;  3P8C D;  1G8X A;  3F31 A;  5LOV E;  3PUG A;  4DVD A;  3WI3 A;  2LOS A;  4PJM A;  5LA6 E;  1Y64 B;  4HGA A;  4QX8 B;  4MAL A;  1HG5 A;  4CXX A;  1MMG A;  1KK7 A;  2CXL A;  1BR0 A;  4G63 A;  5LBM A;  3AAE B;  1IJ5 A;  1US7 B;  4X1Y E;  1MND A;  3FXD B;  4QXC B;  2BZB A;  3NBX X;  2B1E A;  3SOL A;  2JMK A;  3UT5 E;  3ZYM A;  4DND A;  2LEH A;  3N9P A;  5F8P A;  5HXE A;  2XAF B;  4IE4 A;  2KIN B;  2D0T A;  4UV8 B;  4WBN E;  5JDG A;  4HFV A;  1OWA A;  2XQY A;  3H37 A;  2BDE A;  1D0Y A;  2C0S A;  3KFW X;  4U72 A;  4CI2 B;  2Y48 B;  3N9O A;  2CWO A;  2ODU A;  2JJ9 A;  3MKD A;  3LBX B;  5LG4 A;  5LJM A;  3QUJ A;  1YW0 A;  3E08 A;  2NW8 A;  1IAP A;  4O8S A;  4UF0 B;  1D1B A;  1YKE B;  2WM9 A;  1FMW A;  3GA8 A;  3L09 A;  2DCF A;  2X0L B;  4QHO A;  3V5U A;  4IST A;  4QWN B;  3Q2M A;  4OYK A;  2QA7 A;  2XHE B;  3FXE B;  2ZM0 A;  3HL6 A;  5FY1 A;  4EIW A;  4O2B E;  3NRY A;  3BQL A;  1YKH B;  4H9N C;  4WNK A;  2J1D G;  4P0A A;  1NWM X;  3OYX A;  2X67 A;  1LVK A;  1WR6 A;  3UUL A;  4I50 E;  2DWK A;  2IW5 B;  1S35 A;  3A5X A;  5FXV A;  4AI6 A;  3VHL A;  2W63 A;  1MIV A;  1HFA A;  2UXX B;  2V7L A;  1D0Z A;  4ZS2 A;  1YD8 G;  5DQW A;  5JQG E;  2X9X A;  1UX4 A;  1ZEE A;  2VKJ A;  4YHJ A;  4PFO A;  3WAJ A;  2E9X A;  1AJ3 A;  5CB4 E;  2L3L A;  2VB6 A;  4BA9 A;  4MBQ A;  2JQQ A;  4TZ4 C;  4TV8 E;  5LNK A;  5DJQ C;  2PFV A;  2X9H A;  4MLK A;  5FY0 A;  2X66 A;  1B7T A;  5M4Y A;  3RRC A;  3R84 B;  3LK4 2;  2LJL A;  4O2A E;  5FXZ A;  5L3B B;  2D2S A;  3HI2 A;  3PUR A;  4HKA A;  4OHF A;  5JH7 E;  2ZM2 A;  5JDH A;  4PK5 A;  4UV9 B;  5EK3 A;  4K0U A;  3EDV A;  5JVD E;  2CMR A;  4YJ2 E;  3MZK B;  3FBZ A;  4X20 E;  2Q9Q D;  1S94 A;  2LSK A;  3HA4 A;  3N2K E;  4N78 D;  2VKD A;  4BAY B;  2WMO A;  3QC9 A;  5JDL A;  3UUN A;  4AXP A;  4IE6 A;  1MNE A;  4IE5 A;  1QUU A;  4KP3 C;  4TX5 A;  1FMV A;  4DBQ A;  4CXY A;  3KBT A;  5FXW A;  3RRW A;  5FP3 A;  2X9W A;  3KV6 A;  3OKQ A;  3CML A;  4UEM A;  2L9Q A;  4EZ4 A;  2YK0 A;  4HEA A;  1IZN B;  3C4W A;  4OK0 A;  3IBP A;  3K3N A;  2EHO A;  1BR4 A;  2MOZ A;  3I1A A;  4BJM A;  3O9X A;  4NUV A;  2E9X C;  3PDY A;  5L3E B;  2V1D B;  3RYC E;  5LGU B;  2CEA A;  5JRE A;  4PK4 A;  2XAQ B;  3ZPO A;  2HH7 A;  3AVR A;  2ODV A;  2GK9 A;  1D0X A;  3AA6 B;  3BQI A;  2Y8D A;  4PJJ A;  4GIW A;  3UUX B;  5ADX L;  3PU8 A;  4UF0 A;  3SRZ A;  3RH3 A;  2VL8 A;  2X68 A;  2ZLY A;  4TN7 B;  4EB6 E;  3E22 E;  2L8K A;  3PTR B;  4PJN A;  5EK2 A;  4TUY E;  3AA0 B;  3VU7 H;  4E7S A;  3LK2 B;  5CA1 E;  5FMN A;  2QGS A;  3LJC A;  4ZI3 C;  2DHR A;  1ZV4 X;  2RA1 A;  2A2F X;  3ZYL A;  4FI5 A;  2NTX A;  4L0R A;  3GWH A;  4P0B A;  3ZN0 B;  3O4X E;  2D5U A;  4UVB B;  3PUS A;  2W0G A;  3MAC A;  2NOX A;  2NWB A;  3LK3 B;  5LGN B;  3I0O A;  2CXD A;  3MXZ A;  3K3O A;  2EHO B;  2WSS V;  1VRB A;  3RC3 A;  5E0O A;  3T8O A;  5FY7 A;  4AKH A;  5LHH B;  4OFZ A;  4DBR A;  2MBG A;  2NW7 A;  4ANJ A;  4TV9 E;  3N9Q A;  2EHO C;  4AKR B;  4J2C A;  2K48 A;  3RX6 A;  4XZC A;  2A3D A;  2KXP B;  3FHN A;  3RPU A;  3U78 A;  3KDS E;  4GYS A;  3Q9D A;  3R6N A;  5JRC B;  1MMD A;  2KT9 A;  3ZMT B;  2XAJ B;  5KX5 E;  5LYJ E;  2NP9 A;  4DMV A;  5LGT B;  3RC8 A;  3VKG A;  3BQK A;  3EDU A;  4PW8 A;  2VKO A;  2KLQ A;  4AKI A;  3CQX C;  4ZI2 C;  3LFM A;  2HPL A;  3EVY A;  4PK6 A;  4DO0 A;  3AA1 B;  5LBQ B;  3N2O A;  5LP6 E;  2M67 A;  3N2G E;  2V7J A;  5C8Y E;  4X1I E;  3W15 B;  1Z0P A;  2XAH B;  3O1J A;  4ZI7 E;  3CX6 B;  4CI1 B;  1KNZ A;  2I59 A;  5DQV A;  4CZZ B;  2CLY B;  5J2U E;  3RYF E;  4EZH A;  5JDN A;  4WBO A;  3H3A A;  2LHN A;  3P7I A;  5L2L A;  3I0Q A;  5HAX A;  3CQC B;  3F57 A;  2CLY C;  1BR1 A;  5HYA A;  2K5B B;  3I9Y A;  5FYM A;  1HTJ F;  3ZLI A;  4P09 A;  4EAH A;  5JDM A;  5F3J A;  2PJQ A;  2IC9 A;  5AFU L;  1ZKE A;  4IE0 A;  2C5J A;  2DNX A;  3MJX A;  4GOU A;  1LVF A;  5TAO A;  2N9D A;  4I43 B;  4QX7 B;  1CUN A;  1ZHC A;  4CI3 B;  3K8P C;  4ZS3 A;  3J9X 1;  3TKL B;  4BJN A;  4EOZ B;  3N9N A;  5LHG B;  3GN5 B;  2YEV C;  4AKL A;  1D1A A;  1EZ3 A;  2W62 A;  3I9W A;  3PUA A;  4WW0 A;  3ZMS B;  4MHC A;  2MTQ A;  5L3G B;  2WMN A;  5H6R B;  3CQG B;  2XUE A;  3IF8 B;  3J7Y q;  3CKD A;  3HKC E;  4YFS A;  4AKG A;  3MA9 A;  3O1H A;  1U4Q A;  2VAS A;  5JR9 B;  2YU2 A;  3O1I A;  3C64 A;  1OXZ A;  4UVA B;  1QSD A;  4GYR A;  1MMN A;  4H9Q C;  1G73 A;  3JC6 C;  4HE8 A;  4ADZ A;  4CQI A;  3ZMV B;  2WAU A;  2V7M A;  4UIG A;  4H9P C;  1U5P A;  3DJB A;  4AQG A;  4H63 V;  1MIY A;  3ZCI A;  3UTK A;  2VKH A;  3ZYK A;  2IAK A;  4L5G A;  5HXH A;  3N5L A;  4A56 A;  3ONX A;  2XAS B;  4ILU A;  5HWY A;  2OA5 A;  3K3Q C;  3PU3 A;  2HPJ A;  5KMG P;  5IHY A;  2W00 A;  2V26 A;  4PNI A;  3RYH E;  5JRC A;  4JEU B;  1SA0 E;  4M1P A;  2YIN A;  3CVR A;  2LM9 A;  4YJ3 E;  1D1C A;  3VKH A;  3EUH A;  2CCQ A;  3LG7 A;  2V7K A;  3C4Z A;  4IIJ E;  3N9L A;  4ERR A;  3C98 B;  3ESL A;  2CA5 A;  3KV9 A;  4XAX B;  4L9I A;  5EK4 A;  3NZQ A;  2A72 A;  3ANW B;  3CX7 B;  3M65 A;  4IE7 A;  2W61 A;  1NAF A;  4YLH A;  1HX8 A;  2E9X D;  3B57 A;  4IGU A;  3C51 A;  2WBL A;  1FEW A;  3AVS A;  4PFP A;  2K24 A;  1HF8 A;  2LT3 A;  2Y6X A;  3C4X A;  5IYZ E;  4JUY A;  4OYJ A;  1BR2 A;  3SWH A;  2CM0 A;  2H7V C;  2JRK A;  2VK9 A;  5FXX A;  1IJ6 A;  1VOM A;  4EYY R;  2K9A A;  4JLE A;  4AQF A;  4O4J E;  1E1H B;  4H9R C;  3RKO A;  4IDZ A;  4C91 A;  3B13 A;  4UVC B;  5L3D B;  5LXT E;  4ISS A;  5CA0 E;  4O4I E;  2LSG A;  3PUQ A;  3IEE A;  2KWH A;  4ZI3 D;  5LCY A;  3N9M A;  2MYS A;  3Q5W A;  2Q9Q A;  2NTY A;  3E0Z A;  2D0U A;  2ACX A;  3OBV E;  4DMW A;  5LHI B;  3ZEF B;  4F6R C;  2PG8 A;  5FNV E;  4B6X A;  1WLX A;  3DP7 A;  3GN5 A;  2E8I A;  5LJN A;  1X79 A;  3ZMZ B;  4KBM B;  2KZ7 B;  1UCU A;  4MFR A;  2N2N A;  5KDM C;  2X51 A;  3KVA A;  4QKN A;  5J2T E;  3ETU A;  5JDQ A;  2CXF A;  3AAA B;  2EHO D;  3V5S A;  1H7C A;  4EXT A;  4E7Z A;  4O4H E;  2JPF A;  2LOP A;  5JR9 A;  3FB2 A;  3KVB A;  4H63 H;  1LKX A;  2N1G A;  2KND A;  4QXB B;  1V9D A;  3KV4 A;  3UUM A;  4QXH B;  5GON E;  3BK9 A;  3DTO A;  3HKB E;  3AAI A;  2ZMA A;  4ZI2 D;  4JEH B;  2V7I A;  4NUU A;  3CPZ A;  4UEL A;  3CWZ B;  4FJO A;  4AQF C;  4PJL A;  1T98 A;  3HKD E;  5BMV E;  4C90 A;  5A1L A;  2Q9Q B;  3AA7 B;  3ZJ1 A;  4KUM B;  3HR0 A;  5J1G A;  4EYU A;  5H6Q B;  1WYB A;  2X9Y A;  2KMF A;  2H3R A;  2Q9Q C;  3QK6 A;  2P9B A;  4V1A v;  2C5I T;  1WYC A;  2ZM8 A;  3F2E A;  4PAG A;  2PBI A;  3OJA A;  3KIN B;  4GK0 E;  5JDF A;  1WRD A;  4H9S E;  2C5K T;  2LSJ A;  4H9O C;  3OYZ A;  2RP4 A;  1HG2 A;  4HTE A;  3ANW A;  2DWG A;  3S4U A;  3KBU A;  3MK7 C;  3ZC1 A;  4ZHQ E;  5HXC A;  4KMC A;  3KV5 A;  1HCI A;  2LSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...