3SOLA

Crystal structure of the type 2 secretion system pilotin gsps
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
91
structure length
91
Chain Sequence
SEQLEQMASIVSATRYLKMRCNRSDLPDEQSILNVANRIAIGKGWQSLTQEDIRKHSDDIYVRLTRDSTPEYIKCREFNRRLVPFIGELLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Type II secretion pathway related protein
publication title Crystal structure of the pilotin from the enterohemorrhagic Escherichia coli type II secretion system.
pubmed doi rcsb
source organism Escherichia coli
total genus 40
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2011-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1630 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3solA00
3SOLA 3UTKA 4A56A 4K0UA
chains in the Genus database with same CATH superfamily
4LMKA 2VQET 1M7KA 2EHOB 4IT4A 3CMLA 3FBLA 3SOLA 2WDRA 1E1HB 1YQ4A 2CXDA 2SPCA 3OPCA 1UX5A 1SUMB 4MFRA 3D0TA 4V1Av 2DNXA 3FZHB 3JAEA 3P50A 3LDQB 3OVUA 3CWZB 4U7IA 2JIWA 4YY3T 5FY7A 5E0OA 4DNDA 1GQEA 5J2UE 3AVRA 3FZLB 4CN1A 3KINB 5CJ5A 4P0BA 2WMOA 3O1JA 2XJ7A 3DJBA 1UUSA 3AA7B 5HEGA 4DUZT 1O3XA 2X0YA 2DLRA 2XQ3A 2DHRA 2C5JA 3NRXA 3TLVA 1W09A 1W9RA 2FJEA 4JBWF 4AQGA 2LHRA 2VWAA 2XAQB 2UXDT 4U7YA 2MBGA 2EHOC 2CE7A 5IWAT 2IMLA 2D9DA 4AIUA 4CI3B 2CXFA 4G2AA 4AKIA 1J1JA 3CK6A 1W0BA 4DR4T 4H9NC 4QXHB 3W15B 5LGTB 2NOXA 4CZZB 4H9PC 2GK9A 3X1DA 2V7IA 5FP3A 4MALA 3FZMB 3JADA 5F5WA 3ZLIA 4WW0A 2BS2A 3IBPA 4K0UA 5FL1A 2I59A 1OEDA 1NWMX 2OV9A 2J47A 5AQRB 2ZM0A 5LP6E 3K3QC 4JEHB 2LE8A 4PAGA 5HEHA 4PNIA 4UV8B 3AA1B 3NWIA 3QOFA 4U74A 5J0ZA 2VURA 4DBQA 1IAPA 4HWDA 4B3ST 3AE3A 4DO0A 2M6IA 4ILCA 3ANWA 2H89A 3C98B 5JR9A 4IE0A 4DMVA 4QH1A 2HHHT 2ES0A 4YTMA 2XQYA 4ILUA 1D0YA 4TV8E 4TUYE 4DV5T 4P09A 3KDSE 3PURA 3N9LA 2UU9T 3AA6B 2BBJA 5AQVB 2Y6XA 2AXDS 1SA0E 4HEAA 4A97A 5AQOB 5CB4E 3LSVA 4DV3T 4DV2T 5L4EA 4U2ZA 2XAFB 4PFOA 5DABA 3CKDA 2JQQA 4IE5A 4KHZF 1ZOYA 4DIDB 3RIFA 2XQAA 4UEMA 3ZN1B 2D0TA 1M62A 3SRZA 2VL0A 4H9RC 3ZYLA 4KBMB 2BG9A 3O1HA 4DR7T 3AXJB 3BQKA 4UR9A 3F31A 3C50A 3DTOA 3KV9A 5HAXA 4U31A 1U5PA 2XQ6A 3KVBA 5AQFB 3GN5B 4HWIB 3AAEB 3ZSSA 3SFEA 2LT3A 2M67A 4QH5A 3AEDA 3LK3B 2N9DA 3TLSA 4U33A 3MKDA 3NKZA 2VB6A 3HA4A 4UIGA 3TLTA 2V7MA 4KX6A 3T1HT 4LMJA 4F8HA 2PJQA 3UU8A 3J9X1 3CQXC 2Y48B 2XAHB 4O4IE 3PU3A 2LSKA 4JI6T 3WAJA 5AQPB 2WQYA 5HWYA 3O9XA 4IREA 2IIUA 5L4HA 4X5TA 1FIOA 4LFBT 4CXWA 3PUGA 3P8CD 3LBXB 3RIAA 2N2NA 2DCFA 3ZCJA 2LM9A 4IHJE 4M1PA 4X1YE 4HFVA 3RF1A 1QSDA 2A72A 3AA0B 1Y01A 2A3DA 3HR0A 3WAKA 2W4XA 2KSRA 5FXXA 4TNWA 1VCTA 5AQGB 5L2LA 3EAMA 4HFHA 4UXNB 2E5VA 4X1KE 5EK2A 4ADZA 3BQLA 2CXLA 2LSGA 4BAYB 3AAAB 1N34T 2HPJA 2LLYA 4GK5E 4ZI2D 3PUVF 4FI5A 1XWMA 2YEVC 2H3RA 3T8OA 4JI4T 4AQFC 2LOSA 4X1IE 1DU2A 3VRBA 2BVMA 4DV1T 1HX1B 4EXTA 3C64A 3CX7B 3FBZA 3AEGA 5L3EB 2WSSV 2JQ9A 3NZQA 3OYXA 3RI5A 1FEWA 3ZCIA 3UFGA 5HCJA 4UV9B 1KNPA 1KNRA 3RIUA 3UUMA 2A9UA 3P4PA 1XZYA 2W66A 2XSAA 2D2SA 2V5CA 1KK7A 2YN6A 2V7KA 5JTGA 2R6GF 3ESLA 3ZYMA 2AE9A 3N2GE 4A98A 3CX8B 2V5DA 3RKGA 4AKHA 2WY2A 4WNKA 2KINB 3AE7A 5AQLB 4ZS3A 3Q5WA 3ZMSB 3EI0A 5HXRA 3C51A 5ADXL 5KDMC 3HKBE 5KXJA 3ZEFB 3RYCE 2CA5A 4UF0B 1D1CA 2IC9A 5DJQC 4H63V 3PJAA 1HNWT 5LG3A 2PG8A 5AQKB 2OA5A 1V9DA 2K9AA 4PJMA 2LOPA 4TV9E 3OTOT 2ZM2A 2XM1A 5EK3A 5GONE 1IJ6A 2W2UA 2WDQA 4DMWA 2JQKA 5JRCB 3QNUA 4JI2T 2V6YA 3A5XA 4X66T 2RPAA 4ILBA 2V1DB 3ZYKA 2UXNB 2UUBT 4K0KT 5FY1A 1D0XA 2YK0A 4OHFA 1I94T 3UT5E 3LG7A 2F4VT 3P4QA 3N9QA 2KNDA 2VKOA 4GKKT 4O2BE 3N2OA 2X68A 2JJ9A 2LRLA 3RGLA 4EIWA 3SS1A 1IBKT 5EK4A 3ZT6A 2KT9A 3ZC1A 4JYAT 4HWCA 1UX4A 4JV5T 3PV0F 5CA0E 3L39A 1WLXA 1YD8G 4DUYT 5FXVA 4OK0A 2WCAA 5LMNT 4Q25A 5BR8T 2N1GA 4EEDA 3AECA 2IC6A 3CIRA 4IDPA 5ABGA 2FJBA 4KI0F 2UUCT 5TAOA 3N5LA 5L3CB 4PK4A 3FXDB 2DWKA 4UVCB 1HNZT 5FXWA 3VKGA 1XMQT 2CHNA 3KV4A 1UCUA 3QB5A 3ZMVB 4IIJE 4G63A 4B3RT 4DR1T 2X9HA 1HFAA 4IE4A 2HN2A 3CVRA 4C90A 2VK9A 5LCYA 2X0HA 2YINA 4A5XA 2VL8A 4OX9T 2BVLA 5LA6E 4XZCA 2RA1A 4JI8T 4JI1T 4YTNA 5AQJB 1YXRA 3LFMA 3F57A 4U2YA 2IHR1 4O4HE 1LVKA 3PUAA 2V6XA 2IDOB 1XDOA 5FVLA 2LM2A 1HNXT 2FJAA 3I0OA 5L47A 4DR2T 2W0GA 3QUJA 1KNZA 3A8YC 5ABFB 2V7JA 2ACZA 4IL4A 4LF7T 3ONJA 3FHNA 5A1LA 2DL1A 1YKEB 4OYKA 3VR9A 5AQUB 2YDRA 4AKRB 1WRDA 2CBJA 2J62A 3Q5DA 2NP9A 3ZJ2A 4HKAA 1MMDA 4ZI2C 2E5LT 5JVDE 3VRAA 1S35A 2I0MA 3C4ZA 2MTQA 3RH3A 1AJ3A 4WBOA 2W67A 2XM2A 2B1EA 3MZKB 5KMGP 2A2FX 3PUZF 1OXZA 3C4WA 1ZKEA 4XBFB 3O4XE 2YDQA 3IHRA 1MIYA 5JREA 3JAFA 1UK5A 4PJNA 1HCIA 2WP9A 2P9BA 3EDUA 2XHEB 3ETVA 1E7PA 1HX8A 4ZXLA 4IGUA 5AQQB 3KFWX 3F2EA 1HS7A 4ANJA 2LKGA 2BDEA 2L8KA 3ETUA 2H7VC 3ZKRA 1J5ET 1U4QA 2ZMAA 2ODVA 2XAGB 4HFIA 3EUHA 4DR6T 4AISA 3PUWF 2XAJB 2CM0A 3JC6D 2I6HA 5IUXA 1KFYA 2E9XA 5AQSB 4YHHT 4ZI7E 2L9QA 4H63H 2D0UA 1BR0A 2QA7A 5HWXA 4TNVA 2WAUA 2EHOA 3QK6A 3IA3A 3RQUA 3VU7H 4EYUA 2KXPB 4CXYA 5BMVE 3EVYA 3M3ZB 3RIUC 2MAWA 3N9MA 3V5SA 4UVAB 3PUSA 3KBTA 3RX6A 5AQMB 2WMNA 3R84B 2Z6EA 4EYYR 3UQ4A 4CI2B 2VKHA 3ZPOA 1LRZA 5H6RB 5C8YE 1J5WA 4EOZB 3FZKB 2W61A 5C2TA 2LSJA 2E9XD 3RC8A 2BBHA 2V7LA 1D1BA 3BQIA 4QWNB 1NAFA 3ONXA 3K3NA 3AEBA 4O8SA 5HXEA 4AXPA 2XASB 1US7B 1WCRA 1BR2A 3CQGB 4UELA 1IBMT 3OJAA 3RQWA 4P1NA 2J1DG 3T1YT 3E08A 2X66A 5LMUT 4NXNT 4EGWA 2VQFT 4HWFA 4YJ2E 4YTPA 3B57A 2M6BA 5LB7B 2ZLYA 4I50E 5F3JA 1MNDA 4U72A 4JI5T 3RRCA 4B6XA 3TLWA 1WYBA 1D0ZA 4TZ4C 2NWBA 3UU3A 4KUMB 5AQNB 3M65A 1HG5A 5CGMA 2WU5A 1FMWA 2HPLA 1FMVA 2CBIA 5ABHA 2D5UA 5FYMA 4MBQA 2LSYA 2LKHA 1MIWA 4ISTA 3OYZA 3UTKA 1XDPA 2JMHA 2V26A 4H9SE 4JUYA 5CFBA 2VASA 4JI0T 4DR3T 4IE6A 2XQ8A 1Z0PA 2CPTA 4U3CA 2QYWA 3K8PC 2WWVA 3P7IA 4I4TE 4QX7B 3PTRB 1VCSA 4AKGA 1OEDB 4NIQA 2E2AA 2X9XA 4ZI3D 3QC9A 5IHYA 1T72A 4HWHA 3RRWA 2PFVA 4O4LE 4H9OC 2CWYA 4BJMA 5LGUB 3U78A 3BK9A 4TWHA 5JDGA 2X67A 5LNKA 2PBIA 3ANWB 4OYJA 1SHZC 5JR9B 4Z8XA 5AQIB 2IAKA 2YU1A 3RYIE 3GMIA 4PFPA 3ZT7A 2C5KT 5HEOA 4H9QC 4JEUB 3UFEA 4DR5T 2H7OA 5FVKA 1WFDA 2W00A 3UU4A 2JPFA 2BKNA 4ZHQE 2LRKA 3ZMUB 3GWHA 3I1AA 5LG4A 4C91A 3ZSTA 4GOUA 4EEBA 3AEEA 3C4XA 4JLEA 4CI1B 3AXJA 2W62A 2BS3A 2NW7A 2VVNA 4DBRA 5HYAA 1OEDC 1HG2A 2NTYA 4A56A 2RP4A 4TWDA 2VKJA 2CRBA 3GN5A 4ISSA 1CUNA 1T8BA 4GYRA 3AEAA 4EZHA 4DV0T 3Q2MA 2BG9B 2E9XB 1MIVA 2WM9A 4PK6A 1N33T 2ZM6T 1FJGT 1HR0T 3AE8A 5FL0A 5HXCA 3B13A 4IDQA 2KWIB 1YW0A 4AQFA 3J7Yq 5JQGE 3RYFE 5HCMA 5AFUL 1HF8A 3LJCA 3NBXX 2WZHA 3O1IA 3AE9A 5JR9C 2KZ7B 3JC6C 2XSBA 3JCFA 3RHWA 4LF6T 3LK42 5LJNA 1ZP0A 4O4JE 3FZFB 3AEFA 2NW8A 1L0VA 4ZZCA 1N32T 4AI6A 3K3OA 4OFZA 3UQ7A 1ZV4X 1MNEA 3N9OA 2XUEA 1ZHCA 3LBXA 3H37A 1Y64B 4UVBB 2DWGA 3WI3A 3I0QA 3N9PA 5LXTE 2ZM8A 2JQHA 2UXBT 4GK0E 2V8SV 3E0ZA 1X9BA 4I43B 5FNVE 4LF4T 3MK7C 5FY0A 4CN6A 4NUVA 2CEAA 2MYSA 3VKHA 4HFEA 4ZEYA 2YKSA 2BG9C 2E9XC 4MLKA 1G8XA 2XTLA 1YKHB 4WYVA 3PE0A 2CLYB 2KLQA 2VKDA 3FB2A 4YJ3E 2ACXA 2J4GA 1MMAA 2Q9QA 1T98A 3MXZA 1MMNA 4DV4T 4CXXA 3ZMZB 3VHLA 5HEUA 1D1AA 2BS4A 2BKOA 4EV6A 2NR4A 2BZBA 3NZPA 2QRXA 1T7SA 3S4UA 1OEDE 4ILAA 2FBWA 4PJLA 1JNZA 4IDNA 3LK2B 2WDVA 2YU2A 3UUXB 4LFAT 3U3IA 3ZT5A 4GYSA 4HE8A 2WZIA 5JDLA 1XNQT 3AE1A 4I55E 4X20E 5DQWA 3H3AA 1BR1A 4LMLA 2KWHA 2K5BB 4YLHA 3ONLC 5FXZA 1OWAA 2Q9QD 3PU8A 2K3WA 2QVAA 4TWFA 3UU6A 4TN7B 5LOVE 1UGOA 2K24A 3RC3A 5JH7E 4LF5T 4COFA 4E7SA 4E7ZA 3GA8A 4I0UA 4X64T 2XY8B 4LFCT 4UF0A 2CLYC 4NPPA 2Y8DA 3KV6A 3FXEB 3AVSA 4L5GA 1WYCA 4HTEA 3P4SA 4QXCB 4WZXA 2X0LB 4YT0A 5LBQB 5C3JA 2CWOA 4JI7T 2XQ9A 1I6ZA 3ZMTB 1QLBA 4HFBA 5HXHA 5JRCA 2QGSA 3AB3B 3Q5EA 5AQHB 3RKOA 4ZI3C 2C5IT 4IL9A 2HN1A 2BG9E 2LHNA 4J2CA 2CMRA 3HKCE 2WBLA 2HH7A 5L3BB 3MJXA 1E2AA 3I9WA 4B3MT 3OKQA 3K1SA 4IDZA 4B3TT 2NTXA 3A7MA 1XNRT 4DV6T 1Z8UA 2OLTA 2XQ5A 1WR6A 3L3PA 3CPZA 3HKDE 5LHGB 3B5MA 1H7CA 2V6YB 3TKLB 3VR8A 3EDVA 2MOZA 3AAIA 4MHCA 2MPKA 5ABEA 2B76A 3QB5K 4O2AE 3R6NA 3EHZA 1IZNB 4KMCA 3G06A 4L9IA 3P4WA 2UXCT 1LVFA 4HN9A 3RYHE 4X65T 2L3LA 2C0SA 3UULA 4AKLA 4PJJA 2WB5A 5JDNA 3HKEE 5JDFA 3AE5A 5JDHA 4YSYA 1YQ3A 2NW9A 5LHHB 4ERRA 4WBNE 2EHOD 5L3GB 4HFCA 4YXDA 1XMOT 4CN4A 3ZJ1A 3CQCB 2X9YA 2ODUA 4AQYT 2E8IA 4QH4A 1G73A 1S94A 3E22E 3PDYA 1WR0A 3UUBA 3PUQA 4X62T 1CHUA 2XZEA 1NEKA 2IUBA 4DVDA 1B7TA 2UUAT 3HI2A 4YSXA 3ABVA 4LF8T 4EB6E 3PJAJ 4XAXB 4NXMT 3AE2A 2X9WA 2IW5B 5HXSA 2WWUA 4KHPT 1HTJF 2K48A 4N78D 2DI4A 4YHJA 3IF8B 5LYJE 5LHIB 1VRBA 1JNRA 5ETWA 4GIWA 3KBUA 2WU2A 3HL6A 2JMKA 3UU5A 4TX5A 3MA9A 2BKPA 4YFSA 2KMFA 3H3MA 3TLUA 5ABFA 5DQVA 2XPKA 4IE7A 4P0AA 3SFDA 1VOMA 5J2TE 3ZC0A 2G0UA 4KP3C 4PW8A 1MMGA 2Q9QB 5LJMA 3AE4A 3L8RA 1KEYA 3V5UA 2H88A 2YOEA 4ZS2A 3AE6A 1QUUA 3PUYF 5JDQA 4BJNA 3RLFF 4Z91A 3Q5XA 1ZEEA 4F6RC 2VVSA 1SE7A 4ZZBA 1W0AA 5CA1E 3N2KE 1KF6A 5FKYA 5EZYE 3UUNA 5L3DB 4FJOA 4ASKA 4JI3T 1R8IA 5AQTB 2XQ4A 5H6QB 4CQIA 4L0RA 3L09A 3KV5A 3SWHA 5J1GA 3ZN0B 4QXBB 1UURA 2X51A 1BR4A 3P4RA 4QKNA 3NVOA 4QX8B 4BA9A 4ZOLE 4NUUA 1LKXA 5LGNB 5HEJA 5FMNA 3MACA 2LEHA 4GKJT 1EZ3A 1IBLT 2XQ7A 2W63A 4PK5A 4EAHA 2CCQA 4IDOA 5M4YA 4EZ4A 5IYZE 4HGAA 2YDSA 2PTFA 4YSZA 2CHOA 3EABA 3IEEA 3KVAA 2Q9QC 2WS3A 2FUPA 5KX5E 3OBVE 1N36T 3Q9DA 5LBMA 3N9NA 3DP7A 5F8PA 2FJDA 3PUXF 4LF9T 2LJLA 4HFDA 2LSIA 4QHOA 2UXXB 1X79A 3I9YA 1IJ5A 4Z90A 5JDMA 1NENA 4DV7T 3RPUA 2JRKA 5L3FB 3NRYA 3CX6B
chains in the Genus database with same CATH topology
3VU7H 3FBZA 4EYUA 2KXPB 4CXYA 5BMVE 4PJLA 5L3EB 3EVYA 2EHOB 2WSSV 3LK2B 3CX7B 3UUXB 2YU2A 3NZQA 3OYXA 1FEWA 3N9MA 3U3IA 3V5SA 4UVAB 3CMLA 3KBTA 3PUSA 4GYSA 3RX6A 3FBLA 4HE8A 3ZCIA 3SOLA 2WMNA 3R84B 1E1HB 4UV9B 2Z6EA 4EYYR 5JDLA 4I55E 4X20E 2CXDA 4CI2B 2SPCA 5DQWA 3H3AA 2VKHA 1BR1A 3UUMA 3ZPOA 1LRZA 1UX5A 5H6RB 5C8YE 2KWHA 4EOZB 4MFRA 2K5BB 3D0TA 2W61A 4V1Av 2DNXA 4YLHA 2LSJA 5FXZA 1OWAA 2E9XD 2Q9QD 3PU8A 3CWZB 2D2SA 3RC8A 2V7LA 1KK7A 1D1BA 4TN7B 5FY7A 2V7KA 5E0OA 4DNDA 3BQIA 4QWNB 5LOVE 1NAFA 2K24A 3ESLA 3RC3A 3ZYMA 5J2UE 3ONXA 5JH7E 3N2GE 3K3NA 3CX8B 3AVRA 4AKHA 4E7SA 4E7ZA 3GA8A 4O8SA 4WNKA 5HXEA 3KINB 4AXPA 2XASB 1US7B 4P0BA 2KINB 1BR2A 4UF0A 3CQGB 4ZS3A 2WMOA 3Q5WA 4UELA 3O1JA 3ZMSB 3OJAA 2CLYC 5HXRA 3C51A 3DJBA 5ADXL 2Y8DA 3KV6A 5KDMC 3HKBE 2J1DG 3FXEB 3AA7B 3AVSA 3E08A 1O3XA 2X66A 4L5GA 1WYCA 2DLRA 4HTEA 2DHRA 3ZEFB 4QXCB 2X0LB 2C5JA 3RYCE 2CA5A 5LBQB 3NRXA 4YJ2E 4UF0B 1D1CA 2IC9A 5DJQC 3B57A 2CWOA 4H63V 3ZMTB 2ZLYA 4I50E 4AQGA 2LHRA 5F3JA 5HXHA 1MNDA 5JRCA 4U72A 2PG8A 2VWAA 2OA5A 2QGSA 2XAQB 3AB3B 3RRCA 1V9DA 4B6XA 2K9AA 4PJMA 2LOPA 1WYBA 4TV9E 3RKOA 2MBGA 2EHOC 1D0ZA 2ZM2A 2CE7A 4TZ4C 5EK3A 5GONE 1IJ6A 2NWBA 4ZI3C 2C5IT 4KUMB 4CI3B 2CXFA 3M65A 4DMWA 4G2AA 2LHNA 1HG5A 5JRCB 4J2CA 2CMRA 3HKCE 2WBLA 2HH7A 5L3BB 3MJXA 3A5XA 3I9WA 1FMWA 4AKIA 3OKQA 2HPLA 1FMVA 2V1DB 4H9NC 4IDZA 3ZYKA 2D5UA 2NTXA 4QXHB 5FYMA 2UXNB 4MBQA 5FY1A 3W15B 2LSYA 1WR6A 3L3PA 5LGTB 1D0XA 2YK0A 4OHFA 3CPZA 1MIWA 2NOXA 3HKDE 4CZZB 4ISTA 5LHGB 3OYZA 3UT5E 1H7CA 4H9PC 2GK9A 3UTKA 3LG7A 3TKLB 2V7IA 2JMHA 2V26A 3N9QA 2KNDA 3EDVA 5FP3A 2MOZA 4MALA 2VKOA 3AAIA 4H9SE 4JUYA 2VASA 4MHCA 4O2BE 3ZLIA 4WW0A 4IE6A 1Z0PA 2X68A 3N2OA 2JJ9A 3IBPA 4K0UA 4O2AE 4EIWA 3R6NA 3SS1A 2I59A 1IZNB 4KMCA 1NWMX 5EK4A 3K8PC 3P7IA 2KT9A 4L9IA 2ZM0A 3ZC1A 1LVFA 4I4TE 4QX7B 3PTRB 4HN9A 5LP6E 3RYHE 2L3LA 3K3QC 4JEHB 1UX4A 2C0SA 4AKGA 2LE8A 3UULA 4PAGA 4AKLA 4PNIA 4UV8B 4PJJA 3AA1B 5CA0E 5JDNA 4U74A 3HKEE 5JDFA 5JDHA 1WLXA 1YD8G 2NW9A 5LHHB 4DBQA 4ERRA 1IAPA 2EHOD 4WBNE 5L3GB 5FXVA 4OK0A 2X9XA 4DO0A 4ZI3D 3QC9A 2N1GA 5IHYA 3ANWA 2IC6A 3C98B 5JR9A 4IE0A 3ZJ1A 3RRWA 4DMVA 3CQCB 2PFVA 5TAOA 3N5LA 2X9YA 4O4LE 2ODUA 5L3CB 4PK4A 2ES0A 3FXDB 4H9OC 2E8IA 2CWYA 2DWKA 4BJMA 5LGUB 4UVCB 3U78A 2XQYA 3BK9A 1G73A 4ILUA 5JDGA 1D0YA 2X67A 5LNKA 2PBIA 1S94A 3ANWB 5FXWA 3VKGA 4OYJA 3KV4A 4TV8E 1UCUA 1SHZC 4TUYE 3ZMVB 3E22E 4IIJE 4G63A 4Z8XA 5JR9B 3PDYA 3KDSE 4P09A 3PURA 3N9LA 3AA6B 2IAKA 2YU1A 3RYIE 2X9HA 3PUQA 3GMIA 4PFPA 1HFAA 2C5KT 4IE4A 2Y6XA 4HEAA 1SA0E 3CVRA 4H9QC 4JEUB 3UFEA 4C90A 2VK9A 5CB4E 2H7OA 5LCYA 4DVDA 1B7TA 3HI2A 2YINA 2W00A 4EB6E 2XAFB 4PFOA 5DABA 2JPFA 2VL8A 4XAXB 2BVLA 5LA6E 4ZHQE 3CKDA 2JQQA 4IE5A 2X9WA 2IW5B 5HXSA 3ZMUB 3GWHA 3I1AA 2WWUA 2RA1A 4XZCA 5LG4A 1HTJF 2K48A 4N78D 4C91A 2DI4A 4YHJA 4UEMA 3IF8B 5LYJE 4GOUA 5LHIB 3C4XA 1VRBA 4JLEA 4CI1B 3ZN1B 2D0TA 3LFMA 5ETWA 2W62A 3SRZA 4GIWA 3KBUA 2NW7A 3F57A 2JMKA 3HL6A 4H9RC 4TX5A 4KBMB 3MA9A 3ZYLA 4O4HE 4YFSA 1LVKA 2KMFA 3PUAA 3O1HA 5DQVA 4IE7A 4DBRA 5HYAA 4P0AA 1HG2A 2NTYA 4A56A 2RP4A 2VKJA 3GN5A 4ISSA 1VOMA 1CUNA 4GYRA 4EZHA 3BQKA 5J2TE 3ZC0A 3I0OA 2G0UA 4KP3C 4PW8A 3F31A 3Q2MA 2W0GA 3C50A 3DTOA 1MMGA 2E9XB 2Q9QB 3KV9A 3QUJA 5HAXA 5LJMA 1KNZA 1MIVA 2WM9A 1U5PA 4PK6A 2V7JA 3KVBA 3V5UA 5HXCA 4ZS2A 3B13A 3GN5B 1QUUA 3AAEB 5JDQA 4BJNA 2KWIB 3FHNA 1YW0A 4AQFA 5A1LA 2LT3A 2M67A 5JQGE 3J7Yq 3RYFE 3Q5XA 1ZEEA 3LK3B 2N9DA 5AFUL 1HF8A 4F6RC 3LJCA 1YKEB 5CA1E 3N2KE 3NBXX 4OYKA 5EZYE 3O1IA 3UUNA 3MKDA 5JR9C 2KZ7B 5L3DB 4FJOA 4ASKA 3JC6C 4AKRB 2VB6A 1WRDA 3HA4A 5H6QB 4UIGA 4CQIA 4L0RA 2V7MA 3L09A 3KV5A 3SWHA 5J1GA 3LK42 2PJQA 3ZN0B 5LJNA 4QXBB 2NP9A 4O4JE 3ZJ2A 4HKAA 2X51A 3J9X1 1BR4A 1MMDA 4ZI2C 5JVDE 4QKNA 2NW8A 3CQXC 1S35A 2Y48B 2XAHB 4O4IE 3PU3A 4QX8B 3C4ZA 2MTQA 3RH3A 4BA9A 4AI6A 3K3OA 4OFZA 4ZOLE 2LSKA 4NUUA 1ZV4X 1MNEA 3N9OA 1AJ3A 4WBOA 2XUEA 1LKXA 1ZHCA 5LGNB 3LBXA 3H37A 1Y64B 2B1EA 4UVBB 3WAJA 2DWGA 3MZKB 5FMNA 3MACA 5KMGP 5HWYA 2A2FX 3O9XA 2LEHA 3WI3A 3I0QA 3N9PA 5LXTE 1OXZA 2ZM8A 3C4WA 1ZKEA 1EZ3A 4XBFB 3O4XE 1FIOA 3IHRA 4CXWA 2W63A 4GK0E 3PUGA 1MIYA 5JREA 4PJNA 3P8CD 1HCIA 3LBXB 2P9BA 3E0ZA 3EDUA 2N2NA 2XHEB 3ETVA 4PK5A 4I43B 4EAHA 2CCQA 1HX8A 2DCFA 5FNVE 3ZCJA 2LM9A 4IHJE 4M1PA 4X1YE 3MK7C 4HFVA 5FY0A 5M4YA 4IGUA 4NUVA 2CEAA 1QSDA 4HGAA 2MYSA 2A72A 5IYZE 3KFWX 4EZ4A 3AA0B 3F2EA 1HS7A 3VKHA 4ANJA 2A3DA 2BDEA 2L8KA 3HR0A 3ETUA 2H7VC 3IEEA 3KVAA 2E9XC 2Q9QC 3WAKA 4MLKA 1U4QA 5FXXA 1G8XA 2ZMAA 3OBVE 5KX5E 2XTLA 2ODVA 2XAGB 1YKHB 3Q9DA 3EUHA 5LBMA 3PE0A 5L2LA 2XAJB 3N9NA 2CM0A 3JC6D 3DP7A 5F8PA 2CLYB 2KLQA 4UXNB 4X1KE 5EK2A 4ADZA 2VKDA 3BQLA 3FB2A 2CXLA 4YJ3E 2ACXA 2LJLA 1MMAA 2E9XA 1T98A 2LSGA 2Q9QA 3MXZA 1MMNA 4BAYB 4ZI7E 2L9QA 2LSIA 3AAAB 4H63H 2D0UA 4QHOA 1BR0A 2HPJA 2QA7A 5HWXA 4GK5E 4CXXA 4ZI2D 2UXXB 4FI5A 1X79A 2WAUA 2YEVC 3I9YA 1IJ5A 2H3RA 3T8OA 3ZMZB 2EHOA 5JDMA 3VHLA 1D1AA 4AQFC 2LOSA 4X1IE 3QK6A 2BZBA 3NZPA 3RPUA 2JRKA 2BVMA 5L3FB 3S4UA 3NRYA 4EXTA 3C64A 3CX6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SOL A;  3UTK A;  4A56 A;  4K0U A; 
#chains in the Genus database with same CATH topology
 4LMK A;  2VQE T;  1M7K A;  2EHO B;  4IT4 A;  3CML A;  3FBL A;  3SOL A;  2WDR A;  1E1H B;  1YQ4 A;  2CXD A;  2SPC A;  3OPC A;  1UX5 A;  1SUM B;  4MFR A;  3D0T A;  4V1A v;  2DNX A;  3FZH B;  3JAE A;  3P50 A;  3LDQ B;  3OVU A;  3CWZ B;  4U7I A;  2JIW A;  4YY3 T;  5FY7 A;  5E0O A;  4DND A;  1GQE A;  5J2U E;  3AVR A;  3FZL B;  4CN1 A;  3KIN B;  5CJ5 A;  4P0B A;  2WMO A;  3O1J A;  2XJ7 A;  3DJB A;  1UUS A;  3AA7 B;  5HEG A;  4DUZ T;  1O3X A;  2X0Y A;  2DLR A;  2XQ3 A;  2DHR A;  2C5J A;  3NRX A;  3TLV A;  1W09 A;  1W9R A;  2FJE A;  4JBW F;  4AQG A;  2LHR A;  2VWA A;  2XAQ B;  2UXD T;  4U7Y A;  2MBG A;  2EHO C;  2CE7 A;  5IWA T;  2IML A;  2D9D A;  4AIU A;  4CI3 B;  2CXF A;  4G2A A;  4AKI A;  1J1J A;  3CK6 A;  1W0B A;  4DR4 T;  4H9N C;  4QXH B;  3W15 B;  5LGT B;  2NOX A;  4CZZ B;  4H9P C;  2GK9 A;  3X1D A;  2V7I A;  5FP3 A;  4MAL A;  3FZM B;  3JAD A;  5F5W A;  3ZLI A;  4WW0 A;  2BS2 A;  3IBP A;  4K0U A;  5FL1 A;  2I59 A;  1OED A;  1NWM X;  2OV9 A;  2J47 A;  5AQR B;  2ZM0 A;  5LP6 E;  3K3Q C;  4JEH B;  2LE8 A;  4PAG A;  5HEH A;  4PNI A;  4UV8 B;  3AA1 B;  3NWI A;  3QOF A;  4U74 A;  5J0Z A;  2VUR A;  4DBQ A;  1IAP A;  4HWD A;  4B3S T;  3AE3 A;  4DO0 A;  2M6I A;  4ILC A;  3ANW A;  2H89 A;  3C98 B;  5JR9 A;  4IE0 A;  4DMV A;  4QH1 A;  2HHH T;  2ES0 A;  4YTM A;  2XQY A;  4ILU A;  1D0Y A;  4TV8 E;  4TUY E;  4DV5 T;  4P09 A;  3KDS E;  3PUR A;  3N9L A;  2UU9 T;  3AA6 B;  2BBJ A;  5AQV B;  2Y6X A;  2AXD S;  1SA0 E;  4HEA A;  4A97 A;  5AQO B;  5CB4 E;  3LSV A;  4DV3 T;  4DV2 T;  5L4E A;  4U2Z A;  2XAF B;  4PFO A;  5DAB A;  3CKD A;  2JQQ A;  4IE5 A;  4KHZ F;  1ZOY A;  4DID B;  3RIF A;  2XQA A;  4UEM A;  3ZN1 B;  2D0T A;  1M62 A;  3SRZ A;  2VL0 A;  4H9R C;  3ZYL A;  4KBM B;  2BG9 A;  3O1H A;  4DR7 T;  3AXJ B;  3BQK A;  4UR9 A;  3F31 A;  3C50 A;  3DTO A;  3KV9 A;  5HAX A;  4U31 A;  1U5P A;  2XQ6 A;  3KVB A;  5AQF B;  3GN5 B;  4HWI B;  3AAE B;  3ZSS A;  3SFE A;  2LT3 A;  2M67 A;  4QH5 A;  3AED A;  3LK3 B;  2N9D A;  3TLS A;  4U33 A;  3MKD A;  3NKZ A;  2VB6 A;  3HA4 A;  4UIG A;  3TLT A;  2V7M A;  4KX6 A;  3T1H T;  4LMJ A;  4F8H A;  2PJQ A;  3UU8 A;  3J9X 1;  3CQX C;  2Y48 B;  2XAH B;  4O4I E;  3PU3 A;  2LSK A;  4JI6 T;  3WAJ A;  5AQP B;  2WQY A;  5HWY A;  3O9X A;  4IRE A;  2IIU A;  5L4H A;  4X5T A;  1FIO A;  4LFB T;  4CXW A;  3PUG A;  3P8C D;  3LBX B;  3RIA A;  2N2N A;  2DCF A;  3ZCJ A;  2LM9 A;  4IHJ E;  4M1P A;  4X1Y E;  4HFV A;  3RF1 A;  1QSD A;  2A72 A;  3AA0 B;  1Y01 A;  2A3D A;  3HR0 A;  3WAK A;  2W4X A;  2KSR A;  5FXX A;  4TNW A;  1VCT A;  5AQG B;  5L2L A;  3EAM A;  4HFH A;  4UXN B;  2E5V A;  4X1K E;  5EK2 A;  4ADZ A;  3BQL A;  2CXL A;  2LSG A;  4BAY B;  3AAA B;  1N34 T;  2HPJ A;  2LLY A;  4GK5 E;  4ZI2 D;  3PUV F;  4FI5 A;  1XWM A;  2YEV C;  2H3R A;  3T8O A;  4JI4 T;  4AQF C;  2LOS A;  4X1I E;  1DU2 A;  3VRB A;  2BVM A;  4DV1 T;  1HX1 B;  4EXT A;  3C64 A;  3CX7 B;  3FBZ A;  3AEG A;  5L3E B;  2WSS V;  2JQ9 A;  3NZQ A;  3OYX A;  3RI5 A;  1FEW A;  3ZCI A;  3UFG A;  5HCJ A;  4UV9 B;  1KNP A;  1KNR A;  3RIU A;  3UUM A;  2A9U A;  3P4P A;  1XZY A;  2W66 A;  2XSA A;  2D2S A;  2V5C A;  1KK7 A;  2YN6 A;  2V7K A;  5JTG A;  2R6G F;  3ESL A;  3ZYM A;  2AE9 A;  3N2G E;  4A98 A;  3CX8 B;  2V5D A;  3RKG A;  4AKH A;  2WY2 A;  4WNK A;  2KIN B;  3AE7 A;  5AQL B;  4ZS3 A;  3Q5W A;  3ZMS B;  3EI0 A;  5HXR A;  3C51 A;  5ADX L;  5KDM C;  3HKB E;  5KXJ A;  3ZEF B;  3RYC E;  2CA5 A;  4UF0 B;  1D1C A;  2IC9 A;  5DJQ C;  4H63 V;  3PJA A;  1HNW T;  5LG3 A;  2PG8 A;  5AQK B;  2OA5 A;  1V9D A;  2K9A A;  4PJM A;  2LOP A;  4TV9 E;  3OTO T;  2ZM2 A;  2XM1 A;  5EK3 A;  5GON E;  1IJ6 A;  2W2U A;  2WDQ A;  4DMW A;  2JQK A;  5JRC B;  3QNU A;  4JI2 T;  2V6Y A;  3A5X A;  4X66 T;  2RPA A;  4ILB A;  2V1D B;  3ZYK A;  2UXN B;  2UUB T;  4K0K T;  5FY1 A;  1D0X A;  2YK0 A;  4OHF A;  1I94 T;  3UT5 E;  3LG7 A;  2F4V T;  3P4Q A;  3N9Q A;  2KND A;  2VKO A;  4GKK T;  4O2B E;  3N2O A;  2X68 A;  2JJ9 A;  2LRL A;  3RGL A;  4EIW A;  3SS1 A;  1IBK T;  5EK4 A;  3ZT6 A;  2KT9 A;  3ZC1 A;  4JYA T;  4HWC A;  1UX4 A;  4JV5 T;  3PV0 F;  5CA0 E;  3L39 A;  1WLX A;  1YD8 G;  4DUY T;  5FXV A;  4OK0 A;  2WCA A;  5LMN T;  4Q25 A;  5BR8 T;  2N1G A;  4EED A;  3AEC A;  2IC6 A;  3CIR A;  4IDP A;  5ABG A;  2FJB A;  4KI0 F;  2UUC T;  5TAO A;  3N5L A;  5L3C B;  4PK4 A;  3FXD B;  2DWK A;  4UVC B;  1HNZ T;  5FXW A;  3VKG A;  1XMQ T;  2CHN A;  3KV4 A;  1UCU A;  3QB5 A;  3ZMV B;  4IIJ E;  4G63 A;  4B3R T;  4DR1 T;  2X9H A;  1HFA A;  4IE4 A;  2HN2 A;  3CVR A;  4C90 A;  2VK9 A;  5LCY A;  2X0H A;  2YIN A;  4A5X A;  2VL8 A;  4OX9 T;  2BVL A;  5LA6 E;  4XZC A;  2RA1 A;  4JI8 T;  4JI1 T;  4YTN A;  5AQJ B;  1YXR A;  3LFM A;  3F57 A;  4U2Y A;  2IHR 1;  4O4H E;  1LVK A;  3PUA A;  2V6X A;  2IDO B;  1XDO A;  5FVL A;  2LM2 A;  1HNX T;  2FJA A;  3I0O A;  5L47 A;  4DR2 T;  2W0G A;  3QUJ A;  1KNZ A;  3A8Y C;  5ABF B;  2V7J A;  2ACZ A;  4IL4 A;  4LF7 T;  3ONJ A;  3FHN A;  5A1L A;  2DL1 A;  1YKE B;  4OYK A;  3VR9 A;  5AQU B;  2YDR A;  4AKR B;  1WRD A;  2CBJ A;  2J62 A;  3Q5D A;  2NP9 A;  3ZJ2 A;  4HKA A;  1MMD A;  4ZI2 C;  2E5L T;  5JVD E;  3VRA A;  1S35 A;  2I0M A;  3C4Z A;  2MTQ A;  3RH3 A;  1AJ3 A;  4WBO A;  2W67 A;  2XM2 A;  2B1E A;  3MZK B;  5KMG P;  2A2F X;  3PUZ F;  1OXZ A;  3C4W A;  1ZKE A;  4XBF B;  3O4X E;  2YDQ A;  3IHR A;  1MIY A;  5JRE A;  3JAF A;  1UK5 A;  4PJN A;  1HCI A;  2WP9 A;  2P9B A;  3EDU A;  2XHE B;  3ETV A;  1E7P A;  1HX8 A;  4ZXL A;  4IGU A;  5AQQ B;  3KFW X;  3F2E A;  1HS7 A;  4ANJ A;  2LKG A;  2BDE A;  2L8K A;  3ETU A;  2H7V C;  3ZKR A;  1J5E T;  1U4Q A;  2ZMA A;  2ODV A;  2XAG B;  4HFI A;  3EUH A;  4DR6 T;  4AIS A;  3PUW F;  2XAJ B;  2CM0 A;  3JC6 D;  2I6H A;  5IUX A;  1KFY A;  2E9X A;  5AQS B;  4YHH T;  4ZI7 E;  2L9Q A;  4H63 H;  2D0U A;  1BR0 A;  2QA7 A;  5HWX A;  4TNV A;  2WAU A;  2EHO A;  3QK6 A;  3IA3 A;  3RQU A;  3VU7 H;  4EYU A;  2KXP B;  4CXY A;  5BMV E;  3EVY A;  3M3Z B;  3RIU C;  2MAW A;  3N9M A;  3V5S A;  4UVA B;  3PUS A;  3KBT A;  3RX6 A;  5AQM B;  2WMN A;  3R84 B;  2Z6E A;  4EYY R;  3UQ4 A;  4CI2 B;  2VKH A;  3ZPO A;  1LRZ A;  5H6R B;  5C8Y E;  1J5W A;  4EOZ B;  3FZK B;  2W61 A;  5C2T A;  2LSJ A;  2E9X D;  3RC8 A;  2BBH A;  2V7L A;  1D1B A;  3BQI A;  4QWN B;  1NAF A;  3ONX A;  3K3N A;  3AEB A;  4O8S A;  5HXE A;  4AXP A;  2XAS B;  1US7 B;  1WCR A;  1BR2 A;  3CQG B;  4UEL A;  1IBM T;  3OJA A;  3RQW A;  4P1N A;  2J1D G;  3T1Y T;  3E08 A;  2X66 A;  5LMU T;  4NXN T;  4EGW A;  2VQF T;  4HWF A;  4YJ2 E;  4YTP A;  3B57 A;  2M6B A;  5LB7 B;  2ZLY A;  4I50 E;  5F3J A;  1MND A;  4U72 A;  4JI5 T;  3RRC A;  4B6X A;  3TLW A;  1WYB A;  1D0Z A;  4TZ4 C;  2NWB A;  3UU3 A;  4KUM B;  5AQN B;  3M65 A;  1HG5 A;  5CGM A;  2WU5 A;  1FMW A;  2HPL A;  1FMV A;  2CBI A;  5ABH A;  2D5U A;  5FYM A;  4MBQ A;  2LSY A;  2LKH A;  1MIW A;  4IST A;  3OYZ A;  3UTK A;  1XDP A;  2JMH A;  2V26 A;  4H9S E;  4JUY A;  5CFB A;  2VAS A;  4JI0 T;  4DR3 T;  4IE6 A;  2XQ8 A;  1Z0P A;  2CPT A;  4U3C A;  2QYW A;  3K8P C;  2WWV A;  3P7I A;  4I4T E;  4QX7 B;  3PTR B;  1VCS A;  4AKG A;  1OED B;  4NIQ A;  2E2A A;  2X9X A;  4ZI3 D;  3QC9 A;  5IHY A;  1T72 A;  4HWH A;  3RRW A;  2PFV A;  4O4L E;  4H9O C;  2CWY A;  4BJM A;  5LGU B;  3U78 A;  3BK9 A;  4TWH A;  5JDG A;  2X67 A;  5LNK A;  2PBI A;  3ANW B;  4OYJ A;  1SHZ C;  5JR9 B;  4Z8X A;  5AQI B;  2IAK A;  2YU1 A;  3RYI E;  3GMI A;  4PFP A;  3ZT7 A;  2C5K T;  5HEO A;  4H9Q C;  4JEU B;  3UFE A;  4DR5 T;  2H7O A;  5FVK A;  1WFD A;  2W00 A;  3UU4 A;  2JPF A;  2BKN A;  4ZHQ E;  2LRK A;  3ZMU B;  3GWH A;  3I1A A;  5LG4 A;  4C91 A;  3ZST A;  4GOU A;  4EEB A;  3AEE A;  3C4X A;  4JLE A;  4CI1 B;  3AXJ A;  2W62 A;  2BS3 A;  2NW7 A;  2VVN A;  4DBR A;  5HYA A;  1OED C;  1HG2 A;  2NTY A;  4A56 A;  2RP4 A;  4TWD A;  2VKJ A;  2CRB A;  3GN5 A;  4ISS A;  1CUN A;  1T8B A;  4GYR A;  3AEA A;  4EZH A;  4DV0 T;  3Q2M A;  2BG9 B;  2E9X B;  1MIV A;  2WM9 A;  4PK6 A;  1N33 T;  2ZM6 T;  1FJG T;  1HR0 T;  3AE8 A;  5FL0 A;  5HXC A;  3B13 A;  4IDQ A;  2KWI B;  1YW0 A;  4AQF A;  3J7Y q;  5JQG E;  3RYF E;  5HCM A;  5AFU L;  1HF8 A;  3LJC A;  3NBX X;  2WZH A;  3O1I A;  3AE9 A;  5JR9 C;  2KZ7 B;  3JC6 C;  2XSB A;  3JCF A;  3RHW A;  4LF6 T;  3LK4 2;  5LJN A;  1ZP0 A;  4O4J E;  3FZF B;  3AEF A;  2NW8 A;  1L0V A;  4ZZC A;  1N32 T;  4AI6 A;  3K3O A;  4OFZ A;  3UQ7 A;  1ZV4 X;  1MNE A;  3N9O A;  2XUE A;  1ZHC A;  3LBX A;  3H37 A;  1Y64 B;  4UVB B;  2DWG A;  3WI3 A;  3I0Q A;  3N9P A;  5LXT E;  2ZM8 A;  2JQH A;  2UXB T;  4GK0 E;  2V8S V;  3E0Z A;  1X9B A;  4I43 B;  5FNV E;  4LF4 T;  3MK7 C;  5FY0 A;  4CN6 A;  4NUV A;  2CEA A;  2MYS A;  3VKH A;  4HFE A;  4ZEY A;  2YKS A;  2BG9 C;  2E9X C;  4MLK A;  1G8X A;  2XTL A;  1YKH B;  4WYV A;  3PE0 A;  2CLY B;  2KLQ A;  2VKD A;  3FB2 A;  4YJ3 E;  2ACX A;  2J4G A;  1MMA A;  2Q9Q A;  1T98 A;  3MXZ A;  1MMN A;  4DV4 T;  4CXX A;  3ZMZ B;  3VHL A;  5HEU A;  1D1A A;  2BS4 A;  2BKO A;  4EV6 A;  2NR4 A;  2BZB A;  3NZP A;  2QRX A;  1T7S A;  3S4U A;  1OED E;  4ILA A;  2FBW A;  4PJL A;  1JNZ A;  4IDN A;  3LK2 B;  2WDV A;  2YU2 A;  3UUX B;  4LFA T;  3U3I A;  3ZT5 A;  4GYS A;  4HE8 A;  2WZI A;  5JDL A;  1XNQ T;  3AE1 A;  4I55 E;  4X20 E;  5DQW A;  3H3A A;  1BR1 A;  4LML A;  2KWH A;  2K5B B;  4YLH A;  3ONL C;  5FXZ A;  1OWA A;  2Q9Q D;  3PU8 A;  2K3W A;  2QVA A;  4TWF A;  3UU6 A;  4TN7 B;  5LOV E;  1UGO A;  2K24 A;  3RC3 A;  5JH7 E;  4LF5 T;  4COF A;  4E7S A;  4E7Z A;  3GA8 A;  4I0U A;  4X64 T;  2XY8 B;  4LFC T;  4UF0 A;  2CLY C;  4NPP A;  2Y8D A;  3KV6 A;  3FXE B;  3AVS A;  4L5G A;  1WYC A;  4HTE A;  3P4S A;  4QXC B;  4WZX A;  2X0L B;  4YT0 A;  5LBQ B;  5C3J A;  2CWO A;  4JI7 T;  2XQ9 A;  1I6Z A;  3ZMT B;  1QLB A;  4HFB A;  5HXH A;  5JRC A;  2QGS A;  3AB3 B;  3Q5E A;  5AQH B;  3RKO A;  4ZI3 C;  2C5I T;  4IL9 A;  2HN1 A;  2BG9 E;  2LHN A;  4J2C A;  2CMR A;  3HKC E;  2WBL A;  2HH7 A;  5L3B B;  3MJX A;  1E2A A;  3I9W A;  4B3M T;  3OKQ A;  3K1S A;  4IDZ A;  4B3T T;  2NTX A;  3A7M A;  1XNR T;  4DV6 T;  1Z8U A;  2OLT A;  2XQ5 A;  1WR6 A;  3L3P A;  3CPZ A;  3HKD E;  5LHG B;  3B5M A;  1H7C A;  2V6Y B;  3TKL B;  3VR8 A;  3EDV A;  2MOZ A;  3AAI A;  4MHC A;  2MPK A;  5ABE A;  2B76 A;  3QB5 K;  4O2A E;  3R6N A;  3EHZ A;  1IZN B;  4KMC A;  3G06 A;  4L9I A;  3P4W A;  2UXC T;  1LVF A;  4HN9 A;  3RYH E;  4X65 T;  2L3L A;  2C0S A;  3UUL A;  4AKL A;  4PJJ A;  2WB5 A;  5JDN A;  3HKE E;  5JDF A;  3AE5 A;  5JDH A;  4YSY A;  1YQ3 A;  2NW9 A;  5LHH B;  4ERR A;  4WBN E;  2EHO D;  5L3G B;  4HFC A;  4YXD A;  1XMO T;  4CN4 A;  3ZJ1 A;  3CQC B;  2X9Y A;  2ODU A;  4AQY T;  2E8I A;  4QH4 A;  1G73 A;  1S94 A;  3E22 E;  3PDY A;  1WR0 A;  3UUB A;  3PUQ A;  4X62 T;  1CHU A;  2XZE A;  1NEK A;  2IUB A;  4DVD A;  1B7T A;  2UUA T;  3HI2 A;  4YSX A;  3ABV A;  4LF8 T;  4EB6 E;  3PJA J;  4XAX B;  4NXM T;  3AE2 A;  2X9W A;  2IW5 B;  5HXS A;  2WWU A;  4KHP T;  1HTJ F;  2K48 A;  4N78 D;  2DI4 A;  4YHJ A;  3IF8 B;  5LYJ E;  5LHI B;  1VRB A;  1JNR A;  5ETW A;  4GIW A;  3KBU A;  2WU2 A;  3HL6 A;  2JMK A;  3UU5 A;  4TX5 A;  3MA9 A;  2BKP A;  4YFS A;  2KMF A;  3H3M A;  3TLU A;  5ABF A;  5DQV A;  2XPK A;  4IE7 A;  4P0A A;  3SFD A;  1VOM A;  5J2T E;  3ZC0 A;  2G0U A;  4KP3 C;  4PW8 A;  1MMG A;  2Q9Q B;  5LJM A;  3AE4 A;  3L8R A;  1KEY A;  3V5U A;  2H88 A;  2YOE A;  4ZS2 A;  3AE6 A;  1QUU A;  3PUY F;  5JDQ A;  4BJN A;  3RLF F;  4Z91 A;  3Q5X A;  1ZEE A;  4F6R C;  2VVS A;  1SE7 A;  4ZZB A;  1W0A A;  5CA1 E;  3N2K E;  1KF6 A;  5FKY A;  5EZY E;  3UUN A;  5L3D B;  4FJO A;  4ASK A;  4JI3 T;  1R8I A;  5AQT B;  2XQ4 A;  5H6Q B;  4CQI A;  4L0R A;  3L09 A;  3KV5 A;  3SWH A;  5J1G A;  3ZN0 B;  4QXB B;  1UUR A;  2X51 A;  1BR4 A;  3P4R A;  4QKN A;  3NVO A;  4QX8 B;  4BA9 A;  4ZOL E;  4NUU A;  1LKX A;  5LGN B;  5HEJ A;  5FMN A;  3MAC A;  2LEH A;  4GKJ T;  1EZ3 A;  1IBL T;  2XQ7 A;  2W63 A;  4PK5 A;  4EAH A;  2CCQ A;  4IDO A;  5M4Y A;  4EZ4 A;  5IYZ E;  4HGA A;  2YDS A;  2PTF A;  4YSZ A;  2CHO A;  3EAB A;  3IEE A;  3KVA A;  2Q9Q C;  2WS3 A;  2FUP A;  5KX5 E;  3OBV E;  1N36 T;  3Q9D A;  5LBM A;  3N9N A;  3DP7 A;  5F8P A;  2FJD A;  3PUX F;  4LF9 T;  2LJL A;  4HFD A;  2LSI A;  4QHO A;  2UXX B;  1X79 A;  3I9Y A;  1IJ5 A;  4Z90 A;  5JDM A;  1NEN A;  4DV7 T;  3RPU A;  2JRK A;  5L3F B;  3NRY A;  3CX6 B; 
#chains in the Genus database with same CATH homology
 3VU7 H;  3FBZ A;  4EYU A;  2KXP B;  4CXY A;  5BMV E;  4PJL A;  5L3E B;  3EVY A;  2EHO B;  2WSS V;  3LK2 B;  3CX7 B;  3UUX B;  2YU2 A;  3NZQ A;  3OYX A;  1FEW A;  3N9M A;  3U3I A;  3V5S A;  4UVA B;  3CML A;  3KBT A;  3PUS A;  4GYS A;  3RX6 A;  3FBL A;  4HE8 A;  3ZCI A;  3SOL A;  2WMN A;  3R84 B;  1E1H B;  4UV9 B;  2Z6E A;  4EYY R;  5JDL A;  4I55 E;  4X20 E;  2CXD A;  4CI2 B;  2SPC A;  5DQW A;  3H3A A;  2VKH A;  1BR1 A;  3UUM A;  3ZPO A;  1LRZ A;  1UX5 A;  5H6R B;  5C8Y E;  2KWH A;  4EOZ B;  4MFR A;  2K5B B;  3D0T A;  2W61 A;  4V1A v;  2DNX A;  4YLH A;  2LSJ A;  5FXZ A;  1OWA A;  2E9X D;  2Q9Q D;  3PU8 A;  3CWZ B;  2D2S A;  3RC8 A;  2V7L A;  1KK7 A;  1D1B A;  4TN7 B;  5FY7 A;  2V7K A;  5E0O A;  4DND A;  3BQI A;  4QWN B;  5LOV E;  1NAF A;  2K24 A;  3ESL A;  3RC3 A;  3ZYM A;  5J2U E;  3ONX A;  5JH7 E;  3N2G E;  3K3N A;  3CX8 B;  3AVR A;  4AKH A;  4E7S A;  4E7Z A;  3GA8 A;  4O8S A;  4WNK A;  5HXE A;  3KIN B;  4AXP A;  2XAS B;  1US7 B;  4P0B A;  2KIN B;  1BR2 A;  4UF0 A;  3CQG B;  4ZS3 A;  2WMO A;  3Q5W A;  4UEL A;  3O1J A;  3ZMS B;  3OJA A;  2CLY C;  5HXR A;  3C51 A;  3DJB A;  5ADX L;  2Y8D A;  3KV6 A;  5KDM C;  3HKB E;  2J1D G;  3FXE B;  3AA7 B;  3AVS A;  3E08 A;  1O3X A;  2X66 A;  4L5G A;  1WYC A;  2DLR A;  4HTE A;  2DHR A;  3ZEF B;  4QXC B;  2X0L B;  2C5J A;  3RYC E;  2CA5 A;  5LBQ B;  3NRX A;  4YJ2 E;  4UF0 B;  1D1C A;  2IC9 A;  5DJQ C;  3B57 A;  2CWO A;  4H63 V;  3ZMT B;  2ZLY A;  4I50 E;  4AQG A;  2LHR A;  5F3J A;  5HXH A;  1MND A;  5JRC A;  4U72 A;  2PG8 A;  2VWA A;  2OA5 A;  2QGS A;  2XAQ B;  3AB3 B;  3RRC A;  1V9D A;  4B6X A;  2K9A A;  4PJM A;  2LOP A;  1WYB A;  4TV9 E;  3RKO A;  2MBG A;  2EHO C;  1D0Z A;  2ZM2 A;  2CE7 A;  4TZ4 C;  5EK3 A;  5GON E;  1IJ6 A;  2NWB A;  4ZI3 C;  2C5I T;  4KUM B;  4CI3 B;  2CXF A;  3M65 A;  4DMW A;  4G2A A;  2LHN A;  1HG5 A;  5JRC B;  4J2C A;  2CMR A;  3HKC E;  2WBL A;  2HH7 A;  5L3B B;  3MJX A;  3A5X A;  3I9W A;  1FMW A;  4AKI A;  3OKQ A;  2HPL A;  1FMV A;  2V1D B;  4H9N C;  4IDZ A;  3ZYK A;  2D5U A;  2NTX A;  4QXH B;  5FYM A;  2UXN B;  4MBQ A;  5FY1 A;  3W15 B;  2LSY A;  1WR6 A;  3L3P A;  5LGT B;  1D0X A;  2YK0 A;  4OHF A;  3CPZ A;  1MIW A;  2NOX A;  3HKD E;  4CZZ B;  4IST A;  5LHG B;  3OYZ A;  3UT5 E;  1H7C A;  4H9P C;  2GK9 A;  3UTK A;  3LG7 A;  3TKL B;  2V7I A;  2JMH A;  2V26 A;  3N9Q A;  2KND A;  3EDV A;  5FP3 A;  2MOZ A;  4MAL A;  2VKO A;  3AAI A;  4H9S E;  4JUY A;  2VAS A;  4MHC A;  4O2B E;  3ZLI A;  4WW0 A;  4IE6 A;  1Z0P A;  2X68 A;  3N2O A;  2JJ9 A;  3IBP A;  4K0U A;  4O2A E;  4EIW A;  3R6N A;  3SS1 A;  2I59 A;  1IZN B;  4KMC A;  1NWM X;  5EK4 A;  3K8P C;  3P7I A;  2KT9 A;  4L9I A;  2ZM0 A;  3ZC1 A;  1LVF A;  4I4T E;  4QX7 B;  3PTR B;  4HN9 A;  5LP6 E;  3RYH E;  2L3L A;  3K3Q C;  4JEH B;  1UX4 A;  2C0S A;  4AKG A;  2LE8 A;  3UUL A;  4PAG A;  4AKL A;  4PNI A;  4UV8 B;  4PJJ A;  3AA1 B;  5CA0 E;  5JDN A;  4U74 A;  3HKE E;  5JDF A;  5JDH A;  1WLX A;  1YD8 G;  2NW9 A;  5LHH B;  4DBQ A;  4ERR A;  1IAP A;  2EHO D;  4WBN E;  5L3G B;  5FXV A;  4OK0 A;  2X9X A;  4DO0 A;  4ZI3 D;  3QC9 A;  2N1G A;  5IHY A;  3ANW A;  2IC6 A;  3C98 B;  5JR9 A;  4IE0 A;  3ZJ1 A;  3RRW A;  4DMV A;  3CQC B;  2PFV A;  5TAO A;  3N5L A;  2X9Y A;  4O4L E;  2ODU A;  5L3C B;  4PK4 A;  2ES0 A;  3FXD B;  4H9O C;  2E8I A;  2CWY A;  2DWK A;  4BJM A;  5LGU B;  4UVC B;  3U78 A;  2XQY A;  3BK9 A;  1G73 A;  4ILU A;  5JDG A;  1D0Y A;  2X67 A;  5LNK A;  2PBI A;  1S94 A;  3ANW B;  5FXW A;  3VKG A;  4OYJ A;  3KV4 A;  4TV8 E;  1UCU A;  1SHZ C;  4TUY E;  3ZMV B;  3E22 E;  4IIJ E;  4G63 A;  4Z8X A;  5JR9 B;  3PDY A;  3KDS E;  4P09 A;  3PUR A;  3N9L A;  3AA6 B;  2IAK A;  2YU1 A;  3RYI E;  2X9H A;  3PUQ A;  3GMI A;  4PFP A;  1HFA A;  2C5K T;  4IE4 A;  2Y6X A;  4HEA A;  1SA0 E;  3CVR A;  4H9Q C;  4JEU B;  3UFE A;  4C90 A;  2VK9 A;  5CB4 E;  2H7O A;  5LCY A;  4DVD A;  1B7T A;  3HI2 A;  2YIN A;  2W00 A;  4EB6 E;  2XAF B;  4PFO A;  5DAB A;  2JPF A;  2VL8 A;  4XAX B;  2BVL A;  5LA6 E;  4ZHQ E;  3CKD A;  2JQQ A;  4IE5 A;  2X9W A;  2IW5 B;  5HXS A;  3ZMU B;  3GWH A;  3I1A A;  2WWU A;  2RA1 A;  4XZC A;  5LG4 A;  1HTJ F;  2K48 A;  4N78 D;  4C91 A;  2DI4 A;  4YHJ A;  4UEM A;  3IF8 B;  5LYJ E;  4GOU A;  5LHI B;  3C4X A;  1VRB A;  4JLE A;  4CI1 B;  3ZN1 B;  2D0T A;  3LFM A;  5ETW A;  2W62 A;  3SRZ A;  4GIW A;  3KBU A;  2NW7 A;  3F57 A;  2JMK A;  3HL6 A;  4H9R C;  4TX5 A;  4KBM B;  3MA9 A;  3ZYL A;  4O4H E;  4YFS A;  1LVK A;  2KMF A;  3PUA A;  3O1H A;  5DQV A;  4IE7 A;  4DBR A;  5HYA A;  4P0A A;  1HG2 A;  2NTY A;  4A56 A;  2RP4 A;  2VKJ A;  3GN5 A;  4ISS A;  1VOM A;  1CUN A;  4GYR A;  4EZH A;  3BQK A;  5J2T E;  3ZC0 A;  3I0O A;  2G0U A;  4KP3 C;  4PW8 A;  3F31 A;  3Q2M A;  2W0G A;  3C50 A;  3DTO A;  1MMG A;  2E9X B;  2Q9Q B;  3KV9 A;  3QUJ A;  5HAX A;  5LJM A;  1KNZ A;  1MIV A;  2WM9 A;  1U5P A;  4PK6 A;  2V7J A;  3KVB A;  3V5U A;  5HXC A;  4ZS2 A;  3B13 A;  3GN5 B;  1QUU A;  3AAE B;  5JDQ A;  4BJN A;  2KWI B;  3FHN A;  1YW0 A;  4AQF A;  5A1L A;  2LT3 A;  2M67 A;  5JQG E;  3J7Y q;  3RYF E;  3Q5X A;  1ZEE A;  3LK3 B;  2N9D A;  5AFU L;  1HF8 A;  4F6R C;  3LJC A;  1YKE B;  5CA1 E;  3N2K E;  3NBX X;  4OYK A;  5EZY E;  3O1I A;  3UUN A;  3MKD A;  5JR9 C;  2KZ7 B;  5L3D B;  4FJO A;  4ASK A;  3JC6 C;  4AKR B;  2VB6 A;  1WRD A;  3HA4 A;  5H6Q B;  4UIG A;  4CQI A;  4L0R A;  2V7M A;  3L09 A;  3KV5 A;  3SWH A;  5J1G A;  3LK4 2;  2PJQ A;  3ZN0 B;  5LJN A;  4QXB B;  2NP9 A;  4O4J E;  3ZJ2 A;  4HKA A;  2X51 A;  3J9X 1;  1BR4 A;  1MMD A;  4ZI2 C;  5JVD E;  4QKN A;  2NW8 A;  3CQX C;  1S35 A;  2Y48 B;  2XAH B;  4O4I E;  3PU3 A;  4QX8 B;  3C4Z A;  2MTQ A;  3RH3 A;  4BA9 A;  4AI6 A;  3K3O A;  4OFZ A;  4ZOL E;  2LSK A;  4NUU A;  1ZV4 X;  1MNE A;  3N9O A;  1AJ3 A;  4WBO A;  2XUE A;  1LKX A;  1ZHC A;  5LGN B;  3LBX A;  3H37 A;  1Y64 B;  2B1E A;  4UVB B;  3WAJ A;  2DWG A;  3MZK B;  5FMN A;  3MAC A;  5KMG P;  5HWY A;  2A2F X;  3O9X A;  2LEH A;  3WI3 A;  3I0Q A;  3N9P A;  5LXT E;  1OXZ A;  2ZM8 A;  3C4W A;  1ZKE A;  1EZ3 A;  4XBF B;  3O4X E;  1FIO A;  3IHR A;  4CXW A;  2W63 A;  4GK0 E;  3PUG A;  1MIY A;  5JRE A;  4PJN A;  3P8C D;  1HCI A;  3LBX B;  2P9B A;  3E0Z A;  3EDU A;  2N2N A;  2XHE B;  3ETV A;  4PK5 A;  4I43 B;  4EAH A;  2CCQ A;  1HX8 A;  2DCF A;  5FNV E;  3ZCJ A;  2LM9 A;  4IHJ E;  4M1P A;  4X1Y E;  3MK7 C;  4HFV A;  5FY0 A;  5M4Y A;  4IGU A;  4NUV A;  2CEA A;  1QSD A;  4HGA A;  2MYS A;  2A72 A;  5IYZ E;  3KFW X;  4EZ4 A;  3AA0 B;  3F2E A;  1HS7 A;  3VKH A;  4ANJ A;  2A3D A;  2BDE A;  2L8K A;  3HR0 A;  3ETU A;  2H7V C;  3IEE A;  3KVA A;  2E9X C;  2Q9Q C;  3WAK A;  4MLK A;  1U4Q A;  5FXX A;  1G8X A;  2ZMA A;  3OBV E;  5KX5 E;  2XTL A;  2ODV A;  2XAG B;  1YKH B;  3Q9D A;  3EUH A;  5LBM A;  3PE0 A;  5L2L A;  2XAJ B;  3N9N A;  2CM0 A;  3JC6 D;  3DP7 A;  5F8P A;  2CLY B;  2KLQ A;  4UXN B;  4X1K E;  5EK2 A;  4ADZ A;  2VKD A;  3BQL A;  3FB2 A;  2CXL A;  4YJ3 E;  2ACX A;  2LJL A;  1MMA A;  2E9X A;  1T98 A;  2LSG A;  2Q9Q A;  3MXZ A;  1MMN A;  4BAY B;  4ZI7 E;  2L9Q A;  2LSI A;  3AAA B;  4H63 H;  2D0U A;  4QHO A;  1BR0 A;  2HPJ A;  2QA7 A;  5HWX A;  4GK5 E;  4CXX A;  4ZI2 D;  2UXX B;  4FI5 A;  1X79 A;  2WAU A;  2YEV C;  3I9Y A;  1IJ5 A;  2H3R A;  3T8O A;  3ZMZ B;  2EHO A;  5JDM A;  3VHL A;  1D1A A;  4AQF C;  2LOS A;  4X1I E;  3QK6 A;  2BZB A;  3NZP A;  3RPU A;  2JRK A;  2BVM A;  5L3F B;  3S4U A;  3NRY A;  4EXT A;  3C64 A;  3CX6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...