3BQKA

Structure of a chondroitin sulphate binding dbl3x from a var2csa encoded pfemp1 protein in complex with sulphate
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
360
structure length
338
Chain Sequence
SCDLNATNYIRGCQSKTYDGKIFPGKGGEKQWICKDTIIHGDTNGACIPPRTQNLCVGELWDKSYGGRSNIKNDTKELLKEKIKNAIHKETELLYEYHDTGTAIISKNDKKGQKGKNDPNGLPKGFCHAVQRSFIDYKNMILGTSVNIYEHIGKLQEDIKKIIEKGTPQQSTENVNAWWKGIEREMWDAVRCAITKINKKNNNSIFNGDECGVSPPTDQSVSWFKEWGEQFCIERLRYEQNIREACTEKKCINSGDKIQGACKRKCEKYKKYISEKKQEWDKQKTKYENKYVGKSASDLLKENYPECISANFDFIFNDNIEYKTYYPYGDYSSICSCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Erythrocyte membrane protein 1
publication title The structure of a chondroitin sulfate-binding domain important in placental malaria.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Cell adhesion
total genus 119
structure length 338
sequence length 360
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05424 Duffy_binding Duffy binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.830 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3bqkA01
1.20.1310.20 Mainly Alpha Up-down Bundle 5 helical Cullin repeat like 5 helical Cullin repeat like 3bqkA02
4YFSA 2YK0A 3BQLA 2XU0A 3BQKA 4NUUA 3RRCA 3BQIA 3CPZA 2Y8DA 4NUVA 3CMLA 2WAUA 3C64A 5F3JA
chains in the Genus database with same CATH superfamily
3T8OA 2CWOA 4MLKA 4AQFA 2HH7A 3M3ZB 5JH7E 1E1HB 3NZQA 2UXXB 3VR9A 4IIJE 3AECA 5M4YA 4CN6A 3RX6A 3AE8A 3MACA 2WB5A 1FIOA 1OEDA 2YU2A 1XDOA 3A5XA 2XQ3A 3RIFA 1ZKEA 5LB7B 4Z8XA 4GKKT 4N9F3 2AE9A 5AQQB 3ZMVB 5C2TA 4MBQA 4QH4A 1NEKA 1S35A 1HX8A 2BZBA 3PUVF 4GK5E 2ZLYA 3LK2B 1NWMX 1T8BA 2A2FX 2CHOA 3NVOA 4OYJA 2YK0A 4HWFA 4O4JE 2CBIA 3J7Yq 3L8RA 2IC9A 2H89A 2IIUA 3N9MA 3VHLA 4ILCA 3CQCB 2E9XD 2BVMA 4CI1B 4HE8A 5F5WA 4EZHA 2CM0A 1OEDB 1FMVA 5FVLA 4X5TA 2CXDA 3C50A 3AE7A 1OWAA 2IW5B 4X64T 4JI6T 5ABEA 2UUBT 2BS4A 3B13A 5AQMB 3KINB 3A7MA 2F4VT 4YTNA 3ZT5A 4WNKA 2V7JA 4JEHB 4UEMA 5FP3A 5IWAT 3CX8B 2WAUA 2WP9A 5LJNA 1WR0A 4DV6T 5EK3A 2X0YA 4TV9E 3TKLB 2W2UA 4HN9A 3PUWF 4I43B 1HTJF 4ERRA 1HCIA 2XASB 2J4GA 5AQOB 1KF6A 3R6NA 2LT3A 3AAEB 5LBQB 1LDJA 4WYVA 2W62A 3GA8A 4E7ZA 2ACXA 4C90A 1NAFA 2QVAA 4IE6A 2VKJA 2Q9QD 4G63A 4WQOD 1KEYA 4QX7B 3ONXA 1D1AA 5ADXL 2LSGA 2XM2A 2SPCA 2XQ6A 5BMVE 3UU6A 2GK9A 4LMLA 3O1JA 3P4RA 2HN1A 1ZP0A 4DV0T 4UVBB 3ETUA 5HCMA 3FHNA 5L4EA 4CN1A 1YQ3A 5FL1A 3UQ4A 4G2AA 4OFZA 2JQKA 1LDKA 3NWIA 4O4LE 4IREA 3AXJA 2JMKA 4CN4A 4Q25A 2NR4A 1IBMT 3AA1B 4QXBB 1G73A 2V1DB 1VOMA 2JQHA 2NTYA 3C51A 4A64A 4TWDA 3N9NA 3PUZF 5DQWA 4I0UA 1J5ET 4YLHA 2X9YA 3O1HA 4Z90A 5FMNA 3UFGA 3I9YA 4ZZCA 5IHYA 2V7MA 5HXCA 3UU5A 2HHHT 3TLVA 3RRCA 3IEEA 2N1GA 3FXEB 3O9XA 4AKIA 3AVRA 3SS1A 1VCSA 1LDKB 4HFIA 2KWIB 2ZMAA 3AXJB 4ZHQE 5DQVA 5F8PA 5LHIB 3AAIA 1JNRA 4NXNT 3ZEFB 1XWMA 3P4PA 1E2AA 3BQIA 5CGMA 4UVCB 2Q9QA 3RF1A 3P7IA 3RKOA 1Z8UA 3ESLA 3ZN0B 4EZ4A 2G0UA 2WZKA 2WDQA 4IHJE 3PU8A 1QUUA 5AQIB 3FZMB 4X66T 4H9QC 2K9AA 4JI4T 2Z6EA 2H88A 3ZMUB 3GMIA 5ETWA 4A5XA 4O4HE 4GYSA 3LBXA 4U7YA 3AAAB 3LG7A 5JDGA 1WFDA 2XZEA 2IC6A 1UGOA 2CXLA 4YJ2E 2WQYA 5AQNB 4PJNA 2VWAA 1NENA 4IE5A 2AXDS 2C5JA 2BDEA 1VCTA 3KV9A 3AE6A 1XNQT 2LHRA 3BQLA 2RP4A 1MMDA 3SFDA 3AA0B 2N9DA 4COFA 3KVAA 3RQWA 1WYBA 2XQ5A 1D1BA 3ZPOA 4HFEA 4HWHA 4MHCA 3ZC0A 2NW8A 4EIWA 4YXDA 3E08A 2XTLA 1U4QA 5JDLA 3LBXB 3S4UA 3JAFA 5FNVE 3WAJA 1L0VA 4LF9T 2XQ4A 2XQ8A 3B57A 4IE0A 1O3XA 4H63V 2D9DA 4UR9A 3AE1A 3UU4A 4EYYR 3C64A 5LGTB 2D5UA 5FXZA 1FMWA 3PU3A 3UUXB 5LMUT 3UU3A 2LE8A 1ZOYA 3J9X1 1XNRT 3N9PA 3PUAA 4YJ3E 3FZFB 2B76A 2X9HA 2V6YA 3ZYMA 2VQET 2KWHA 1VRBA 4X62T 5KXJA 4GIWA 1QSDA 4EEDA 1FJGT 1HR0T 4E7SA 4QH5A 1KK7A 3RTRA 1SE7A 4Z91A 4CI2B 2H7OA 4DR2T 5ABGA 3K3QC 4O4IE 3L09A 3JCFA 1S94A 4V1Av 3CMLA 1EZ3A 4K0KT 2KINB 5JVDE 5CJ5A 4QX8B 3TLSA 4OK0A 4LMJA 2FJBA 2LKGA 4HWDA 2V6YB 5BR8T 3ZMTB 4F52A 2VURA 4KI0F 4DR1T 2FUPA 3QK6A 4H9NC 1IBLT 3P8CD 3OBVE 2MPKA 2BG9E 3BK9A 5FKYA 1FEWA 2WBLA 2K48A 4LF6T 4ZS2A 3HKDE 4UV9B 3MK7C 3UUBA 4WW0A 3EAMA 2KXPB 4AQGA 1Y64B 5A1LA 1UURA 5L47A 3DP7A 3ZLIA 2KNDA 4PFPA 1HNZT 4UV8B 3UULA 2K24A 2XUEA 4DMWA 4NPPA 5HYAA 3HA4A 2CXFA 5JDMA 3OVUA 1V9DA 1X9BA 2V7IA 3NRXA 2QYWA 2BG9C 2WMNA 4OYKA 1YXRA 4ISSA 3LSVA 3KBUA 1M62A 2UU9T 3LK42 3CKDA 4QWNB 4IDPA 4GOUA 2CPTA 5LOVE 1T72A 2MTQA 4ASKA 3P4SA 4U72A 5AQPB 2LKHA 2XY8B 3AE3A 3CX6B 3JAEA 3ZMZB 2DLRA 5CFBA 2ODVA 4TN7B 4AI6A 4JI1T 1LKXA 4JI7T 4ZS3A 3QNUA 2ACZA 4PNIA 3ZJ1A 5IUXA 2XU0A 4TWFA 5AQHB 2W61A 4TUYE 2H7VC 4P0AA 3VU7H 2HN2A 3FZLB 2JQ9A 5HWXA 3AE4A 5ABFA 2C5KT 1KFYA 3L3PA 4TNWA 3CX7B 2LLYA 2KT9A 1WYCA 3EDVA 3RHWA 1YD8G 1G8XA 3KFWX 2D0TA 3I0OA 1LVKA 5LMNT 1BR0A 2XAFB 2VKDA 1HG2A 3FXDB 4LFAT 5AQFB 3VRAA 2P9BA 1XDPA 4ILAA 2M6IA 4UVAB 1HF8A 1T7SA 1D0XA 3PV0F 4H9SE 4K0UA 1WR6A 3AEEA 4P1NA 4LF5T 4N78D 3CVRA 2XSAA 3KVBA 1J5WA 4ILUA 5ABFB 5LP6E 4I4TE 3Q5XA 2D0UA 2J1DG 4YSZA 2JIWA 4QH1A 3N2GE 4H9OC 5FVKA 4PAGA 3AEGA 2ZM6T 3FZHB 2FJEA 5FXWA 3T1YT 4NXMT 3UFEA 3DQVC 3NKZA 2W67A 4X20E 4JV5T 2J47A 1SA0E 4JEUB 4LFCT 4HWCA 5AQKB 5HWYA 4U2ZA 2VL0A 3FBZA 2C5IT 4IDZA 2CE7A 3ZYKA 2V8SV 3I9WA 2L9QA 3D0TA 2ODUA 3V5UA 4P09A 1UX5A 4AKGA 2I59A 1BR2A 2XHEB 3C98B 2BKOA 1SUMB 3PUXF 3HI2A 4TX5A 3N9LA 2D2SA 3SOLA 4HFDA 1IJ5A 2XAQB 3CK6A 1LRZA 2DWGA 2FJDA 1I94T 2Y6XA 2X66A 3KDSE 1N34T 4CXYA 4PK5A 1HS7A 3VKGA 4KHZF 2VKHA 3AA7B 1QLBA 2WU2A 2XPKA 5J1GA 4TV8E 4ZZBA 5FY0A 4GKJT 3ZJ2A 2WDVA 2LHNA 3FB2A 2VVNA 2YDQA 2YEVC 1W0AA 5L2LA 4A97A 2E2AA 2OLTA 3WI3A 1N36T 3NZPA 4YSYA 2PFVA 4YHHT 3PE0A 3ZT7A 3RLFF 5LNKA 2WS3A 4FI5A 3HKEE 4X1IE 1W09A 3IA3A 3Q2MA 3RC3A 2YN6A 3KV5A 3W15B 3RIUA 5JDNA 4AKRB 4U31A 4U3CA 2LOPA 2H3RA 1IBKT 4XZCA 4ZXLA 4J2CA 1BR4A 3E22E 1GQEA 2UXCT 2CBJA 2XJ7A 3I1AA 3HKBE 4P5OA 4IT4A 2QA7A 5L3BB 3VRBA 4O8SA 2JRKA 3RYFE 4HKAA 2CA5A 3RKGA 2IMLA 3E0ZA 5HEUA 4IL4A 3ONLC 4PW8A 4NIQA 2LEHA 4F8HA 2M67A 2FBWA 1XZYA 3HKCE 5F3JA 3ETVA 1W9RA 4C91A 2PJQA 2MOZA 3LDQB 1MIYA 4XAXB 4DR4T 2XQ9A 1T98A 4QHOA 4B3MT 1UUSA 3ZCIA 4YHJA 3WAKA 4EOZB 5EK4A 4GYRA 4PK4A 3OPCA 1Y01A 3RGLA 5JDFA 2YDSA 4BAYB 1R8IA 2IHR1 5AQJB 2VVSA 2DWKA 4JI3T 2XAGB 4ANJA 4A56A 4AQYT 3OTOT 2LRKA 3ZCJA 2BG9A 3ANWA 2XQ7A 4HFVA 2DHRA 4IDQA 4DV5T 1N33T 2CLYB 3G06A 3GN5A 4LF7T 2NP9A 4XBFB 4M1PA 4CXXA 2LM9A 5KDMC 3RYCE 1KNRA 5FY7A 2E8IA 3C4XA 3JADA 5FY1A 4L9IA 3RIUC 2A72A 2WU5A 5EZYE 5AQGB 2VB6A 2ZM2A 3FBLA 1M7KA 1ZV4X 2BG9B 3ANWB 4EEBA 4DIDB 3H3AA 3KBTA 4IL9A 3GN5B 3EDUA 4WBOA 2B1EA 1CHUA 3PUSA 3IHRA 2LJLA 3AEFA 3MA9A 1B7TA 2JQQA 1HNXT 2JMHA 2K5BB 1D0ZA 5AQSB 3N2KE 2MBGA 4UF0A 2VL8A 2UUAT 2WZIA 2E5LT 2X68A 5C3JA 3RYIE 2NW9A 2WDRA 2UXNB 2X0HA 1WRDA 4H9RC 3P4QA 5LCYA 3UUNA 3I0QA 5JQGE 2CLYC 4ZI2C 2CMRA 3PUGA 4DNDA 3EUHA 3ZC1A 2BKPA 1UCUA 5JTGA 3QUJA 1LVFA 4HFCA 1YKHB 5LG3A 4O2BE 2JPFA 2EHOC 4UF0B 4HFBA 3LFMA 2WY2A 5E0OA 2JJ9A 2WSSV 4ADZA 1HFAA 2X9WA 4HXIB 4I55E 3QB5K 4LMKA 4LF8T 3ZSSA 2BS3A 2DL1A 1MIWA 3CQXC 3IBPA 5L3EB 1KNZA 1DU2A 1AJ3A 2VQFT 2CEAA 5C8YE 4YY3T 3JC6C 4QKNA 4WBNE 3ZSTA 5FYMA 2X51A 3CPZA 3P50A 2WWUA 5HEJA 2W0GA 2RA1A 4IE7A 5J0ZA 4AP2B 5AQRB 3ONJA 2W4XA 3MXZA 4KUMB 2I6HA 5EK2A 4IE4A 2WZHA 3N9QA 2LM2A 2OA5A 2XQYA 4JI2T 3TLTA 5CA1E 2IDOB 3LJCA 2KLQA 3L39A 3DTOA 3H3MA 3TLUA 2NW7A 3UTKA 4EXTA 4NUUA 2X9XA 3KV6A 3IF8B 3O1IA 3U3IA 2YOEA 4DV7T 4P0BA 4U33A 3K8PC 4HWIB 2OV9A 3ZYLA 4DV4T 5KX5E 4KX6A 3A8YC 3BQKA 4KMCA 1ZEEA 5FXVA 1SHZC 4QXHB 2CCQA 2LRLA 2WM9A 5HEOA 4ZI3C 2FJAA 5H6QB 2CRBA 4YSXA 3QC9A 3RRWA 4A98A 5AQLB 3F31A 3ZT6A 1OEDE 3UT5E 3X1DA 2CWYA 4EB6E 5AQTB 5DABA 5HXHA 5CA0E 4TZ4C 4EV6A 1MNDA 4YFSA 2I0MA 3AA6B 3DJBA 3CWZB 2E5VA 4MALA 1IAPA 3DPLC 2W66A 3KV4A 1XMOT 5FL0A 5LHHB 4B3ST 5LYJE 2NWBA 1YW0A 3VKHA 4DUZT 2WCAA 4AQFC 3N5LA 3UUMA 4CZZB 2V5DA 2UXBT 2Y8DA 2HPLA 3AEBA 2LSJA 4F6RC 4PFOA 1OEDC 2BVLA 3CIRA 2J62A 4AKLA 1H7CA 4ILBA 1U6GA 3P4WA 1UK5A 3SWHA 2ZM0A 2R6GF 4ZI2D 4ZEYA 3RI5A 1W0BA 2XM1A 2E9XA 2CHNA 5LBMA 3PJAA 1XMQT 5TAOA 5JDHA 3AEDA 4BJMA 1YKEB 1MNEA 3OJAA 4IDOA 2UUCT 4B3RT 4EGWA 3OKQA 3RC8A 1MIVA 4JI8T 4I50E 2XQAA 4DUYT 5HEGA 4U74A 4HFHA 2EHOD 2L8KA 1BR1A 3K3NA 4X1KE 3AVSA 4TWHA 2MYSA 1CUNA 2PBIA 2BS2A 4KP3C 4PK6A 4O2AE 5L3GB 2YDRA 2X0LB 5LG4A 2ES0A 1UX4A 1MMNA 2E9XB 2XSBA 3FZKB 4DV3T 5JR9A 2N2NA 3EI0A 5AQUB 4DV1T 3JC6D 3Q9DA 2A3DA 3ZKRA 3EVYA 3MKDA 3K1SA 2KZ7B 3AE2A 4HEAA 3O4XE 5J2UE 3MZKB 2X67A 2YINA 3QOFA 4U7IA 2W00A 5LXTE 2DNXA 4DVDA 2KMFA 2V26A 5AQVB 5LGUB 4DR3T 4DMVA 2KSRA 2XAHB 3N9OA 2BKNA 1Z0PA 3V5SA 4QXCB 3U78A 4B6XA 2RPAA 3Q5DA 5JR9B 5DJQC 4OX9T 3GWHA 3TLWA 3PTRB 3SFEA 3UU8A 4APFB 4DBQA 2MAWA 4B3TT 5L4HA 5LA6E 3ABVA 5LGNB 4LFBT 1E7PA 1IJ6A 1HNWT 4YT0A 1HX1B 4BJNA 1US7B 1HG5A 3T1HT 1ZHCA 3AEAA 1X79A 2Q9QB 4DR6T 3HL6A 5JREA 2E9XC 4PJJA 2ZM8A 2V6XA 4DBRA 4ZI3D 3H37A 4LF4T 3PDYA 1IZNB 2EHOA 1D0YA 2V7LA 5CB4E 2UXDT 4UXNB 4FJOA 4MFRA 3HR0A 4PJMA 4KHPT 4PJLA 3F2EA 1YQ4A 2BBHA 5HAXA 3RIAA 5AFUL 4H9PC 2QGSA 3EHZA 4X1YE 4IGUA 4JI5T 4JI0T 4CXWA 4WZXA 1J1JA 3ZMSB 5HXSA 3C4WA 4DR7T 4JYAT 5L3CB 4ZOLE 5HEHA 4JUYA 5IYZE 5H6RB 4L5GA 4CI3B 3B5MA 4HGAA 1D1CA 4CQIA 2LSIA 3NBXX 5J2TE 1MMGA 4YTPA 1N32T 5JR9C 3RQUA 5L3DB 2WWVA 2EHOB 5HCJA 1OXZA 4DV2T 3AE5A 3AE9A 4JLEA 2DCFA 3SRZA 1U5PA 5JRCA 5ABHA 5HXEA 2IAKA 3CQGB 2PTFA 5LJMA 4DO0A 2V7KA 3RPUA 2LOSA 4L0RA 4UIGA 4AISA 5LHGB 4EYUA 3PUQA 3K3OA 5KMGP 4GK0E 2VASA 3Q5EA 3LK3B 4KBMB 2Q9QC 3ZN1B 4UELA 3Q5WA 3OYZA 2C0SA 2M6BA 4HTEA 3N2OA 4NUVA 2L3LA 3PUYF 3VR8A 5JDQA 2YU1A 5HXRA 2HPJA 4X65T 3NRYA 3OYXA 4OHFA 3QB5A 3UQ7A 5L3FB 2NTXA 2IUBA 2W63A 1I6ZA 2LSKA 4AKHA 1JNZA 5JRCB 4YTMA 1WLXA 4AXPA 4JBWF 3R84B 2BBJA 3PJAJ 3RH3A 4BA9A 3PURA 2LSYA 3RYHE 2DI4A 2XAJB 2V5CA 2WMOA 2QRXA 1MMAA 4U2YA 3MJXA 4AIUA 4EAHA 4DR5T 2VK9A 2A9UA 4ISTA 2VKOA 5GONE 3EABA 4JGHD 4IDNA 2Y48B 1KNPA 2PG8A 3AB3B 2NOXA 1WCRA 3C4ZA 4H63H 4ZI7E 2K3WA 3F57A 4TNVA 3M65A 2YKSA 5FXXA
chains in the Genus database with same CATH topology
2D5UA 5FXZA 5DABA 5HXHA 1FMWA 3PU3A 3T8OA 4TZ4C 5CA0E 1MNDA 2CWOA 3Q2MA 4MLKA 3RC3A 4AQFA 3UUXB 2HH7A 4YFSA 3KV5A 3W15B 5JDNA 2LE8A 3AA6B 5LGTB 4AKRB 5JH7E 1E1HB 3DJBA 3NZQA 2UXXB 3CWZB 3J9X1 4MALA 1IAPA 3N9PA 2LOPA 4IIJE 3PUAA 2H3RA 3KV4A 4YJ3E 2X9HA 3ZYMA 5M4YA 5LHHB 2KWHA 5LYJE 2NWBA 1VRBA 4XZCA 1YW0A 3RX6A 3VKHA 4J2CA 4AQFC 4GIWA 3N5LA 1QSDA 3MACA 1FIOA 1BR4A 4E7SA 2YU2A 3E22E 1KK7A 3UUMA 4CZZB 3A5XA 1ZKEA 3I1AA 4CI2B 2H7OA 3HKBE 4Z8XA 2QA7A 2Y8DA 5L3BB 2HPLA 3K3QC 4O4IE 4O8SA 2JRKA 3L09A 3RYFE 2LSJA 4F6RC 4PFOA 4HKAA 2CA5A 1S94A 3ZMVB 3E0ZA 4V1Av 3CMLA 1EZ3A 4MBQA 1S35A 2BZBA 1HX8A 4PW8A 4GK5E 2LEHA 2ZLYA 3LK2B 2BVLA 1NWMX 2KINB 2A2FX 4OYJA 2YK0A 4AKLA 5JVDE 1H7CA 4O4JE 4QX8B 3J7Yq 2M67A 2IC9A 3HKCE 5F3JA 3ETVA 3N9MA 4OK0A 3SWHA 3VHLA 3ZMTB 2ZM0A 4C91A 3CQCB 2PJQA 2MOZA 4ZI2D 2E9XD 2BVMA 3QK6A 4H9NC 4CI1B 1MIYA 2E9XA 4HE8A 5LBMA 4XAXB 3P8CD 5TAOA 4EZHA 5JDHA 2CM0A 1T98A 3OBVE 4QHOA 4BJMA 3BK9A 1FEWA 2WBLA 3ZCIA 1YKEB 1MNEA 3OJAA 2K48A 1FMVA 4YHJA 3WAKA 2CXDA 4ZS2A 4EOZB 5EK4A 3HKDE 3C50A 3OKQA 4GYRA 3RC8A 4UV9B 1OWAA 3MK7C 1MIVA 4PK4A 2IW5B 4WW0A 4I50E 2KXPB 5JDFA 3B13A 4U74A 4AQGA 1Y64B 4BAYB 2EHOD 2L8KA 1BR1A 3KINB 5A1LA 3K3NA 4X1KE 3AVSA 3DP7A 2DWKA 3ZLIA 2KNDA 4PFPA 2MYSA 1CUNA 2PBIA 4WNKA 4KP3C 2V7JA 4JEHB 2XAGB 4UEMA 4UV8B 3UULA 2K24A 2XUEA 4PK6A 4ANJA 5FP3A 4DMWA 4O2AE 4A56A 3CX8B 5L3GB 3ZCJA 2X0LB 3ANWA 5LG4A 4HFVA 2DHRA 2WAUA 2ES0A 5HYAA 5LJNA 3HA4A 1UX4A 1MMNA 2CLYB 5EK3A 4TV9E 2CXFA 2E9XB 3GN5A 3TKLB 2NP9A 4HN9A 4XBFB 5JR9A 2N2NA 5JDMA 1V9DA 3JC6D 4M1PA 2V7IA 1HTJF 3NRXA 3Q9DA 4I43B 4ERRA 2A3DA 4CXXA 2WMNA 4OYKA 3EVYA 2LM9A 1HCIA 4ISSA 3MKDA 5KDMC 2XASB 3RYCE 3KBUA 3R6NA 5FY7A 2E8IA 2LT3A 3AAEB 3LK42 3C4XA 5LBQB 2KZ7B 3CKDA 5FY1A 4QWNB 4HEAA 2W62A 4L9IA 3O4XE 4GOUA 3GA8A 5J2UE 3MZKB 2X67A 2A72A 4E7ZA 2ACXA 5LOVE 2YINA 5EZYE 4C90A 2MTQA 1NAFA 4IE6A 2VKJA 2Q9QD 4G63A 4ASKA 5LXTE 2W00A 4U72A 2DNXA 4DVDA 2VB6A 4QX7B 3ONXA 3CX6B 1D1AA 5ADXL 2ZM2A 3FBLA 2KMFA 2LSGA 2V26A 5LGUB 1ZV4X 3ZMZB 4DMVA 2SPCA 2DLRA 3ANWB 2XAHB 2ODVA 3N9OA 4TN7B 4AI6A 5BMVE 2GK9A 3H3AA 3KBTA 1Z0PA 3O1JA 3V5SA 1LKXA 4QXCB 3GN5B 3EDUA 4WBOA 2B1EA 3U78A 4ZS3A 4B6XA 5JR9B 4PNIA 3ZJ1A 4UVBB 2XU0A 3ETUA 5DJQC 3PUSA 2W61A 3GWHA 3IHRA 4TUYE 2H7VC 4P0AA 2LJLA 3PTRB 3VU7H 3FHNA 3MA9A 4DBQA 1B7TA 2JQQA 5HWXA 2JMHA 2K5BB 1D0ZA 3N2KE 2MBGA 4G2AA 5LA6E 2C5KT 4OFZA 4UF0A 2VL8A 3L3PA 5LGNB 3CX7B 1IJ6A 4O4LE 2KT9A 1WYCA 2X68A 2JMKA 3EDVA 1YD8G 3RYIE 1G8XA 2NW9A 4BJNA 3AA1B 1US7B 1HG5A 4QXBB 2UXNB 1ZHCA 2D0TA 3I0OA 3KFWX 1G73A 1LVKA 2V1DB 1WRDA 1X79A 1VOMA 2Q9QB 3HL6A 4H9RC 2XAFB 2NTYA 2VKDA 1HG2A 3FXDB 5LCYA 5JREA 3C51A 1BR0A 3UUNA 3I0QA 5JQGE 2CLYC 4ZI2C 2CMRA 2E9XC 3PUGA 4PJJA 2P9BA 2ZM8A 3N9NA 4DBRA 5DQWA 4DNDA 3EUHA 3H37A 4ZI3D 3PDYA 3ZC1A 1IZNB 4UVAB 4YLHA 2EHOA 2X9YA 1D0YA 3O1HA 2V7LA 1HF8A 1D0XA 1UCUA 5FMNA 3I9YA 3QUJA 4H9SE 5CB4E 4UXNB 4K0UA 5IHYA 2V7MA 4FJOA 1WR6A 4MFRA 5HXCA 3HR0A 1LVFA 3RRCA 1YKHB 3IEEA 4N78D 4PJMA 3CVRA 4PJLA 4O2BE 3F2EA 3KVBA 5HAXA 2N1GA 4ILUA 5AFUL 4H9PC 5LP6E 4I4TE 3FXEB 2D0UA 3Q5XA 3O9XA 2QGSA 4AKIA 2J1DG 2JPFA 4X1YE 4IGUA 2EHOC 3AVRA 4UF0B 3SS1A 4CXWA 3N2GE 4H9OC 3LFMA 4PAGA 3ZMSB 5HXSA 5E0OA 2JJ9A 2KWIB 2ZMAA 3C4WA 2WSSV 4ADZA 1HFAA 5L3CB 4ZOLE 4ZHQE 4JUYA 5DQVA 2X9WA 5IYZE 5FXWA 5F8PA 5LHIB 3UFEA 5H6RB 4L5GA 4I55E 3AAIA 4CI3B 3ZEFB 4X20E 4HGAA 1MIWA 3CQXC 1D1CA 4CQIA 2LSIA 3NBXX 5J2TE 3IBPA 1MMGA 5L3EB 5JR9C 1KNZA 5L3DB 1SA0E 4JEUB 1AJ3A 2EHOB 1OXZA 4JLEA 3BQIA 2DCFA 2CEAA 3SRZA 5C8YE 1U5PA 5HWYA 3JC6C 4QKNA 4WBNE 4UVCB 2Q9QA 5JRCA 5HXEA 5FYMA 2IAKA 3CQGB 2X51A 3CPZA 3P7IA 3RKOA 3FBZA 2C5IT 3ESLA 5LJMA 2WWUA 4IDZA 3ZN0B 4EZ4A 2G0UA 4DO0A 2V7KA 2W0GA 3RPUA 2LOSA 2RA1A 4IHJE 4IE7A 2CE7A 3PU8A 1QUUA 3I9WA 3ZYKA 4L0RA 2L9QA 4H9QC 4UIGA 5LHGB 4EYUA 3PUQA 3K3OA 5KMGP 2K9AA 3D0TA 4GK0E 2VASA 2ODUA 3MXZA 4KUMB 2Z6EA 3V5UA 5EK2A 3LK3B 4P09A 1UX5A 4KBMB 4AKGA 3ZMUB 3GMIA 2I59A 4IE4A 2Q9QC 3ZN1B 1BR2A 5ETWA 3N9QA 3Q5WA 4UELA 3C98B 2XHEB 2C0SA 3OYZA 4HTEA 2OA5A 2XQYA 3N2OA 4O4HE 4GYSA 3LBXA 3HI2A 3AAAB 4TX5A 3N9LA 4NUVA 5CA1E 2D2SA 2L3LA 3LG7A 5JDQA 3SOLA 2YU1A 5JDGA 5HXRA 1IJ5A 2HPJA 2XAQB 3LJCA 2IC6A 2KLQA 2CXLA 4YJ2E 1LRZA 2DWGA 4PJNA 2VWAA 3DTOA 3NRYA 3OYXA 2Y6XA 4OHFA 4IE5A 2X66A 2NW7A 5L3FB 2NTXA 3UTKA 3KDSE 4EXTA 2W63A 2C5JA 2BDEA 4NUUA 2LSKA 2X9XA 4PK5A 4CXYA 3KV9A 5JRCB 1HS7A 4AKHA 3KV6A 3IF8B 3O1IA 1WLXA 3U3IA 2LHRA 3BQLA 2RP4A 4AXPA 3VKGA 3R84B 2VKHA 3AA7B 1MMDA 3RH3A 4BA9A 3PURA 5J1GA 4TV8E 4P0BA 5FY0A 3AA0B 3ZJ2A 2N9DA 2LHNA 3FB2A 3K8PC 2LSYA 3KVAA 2DI4A 2XAJB 3RYHE 1WYBA 2WMOA 1MMAA 1D1BA 3ZYLA 5KX5E 2YEVC 3ZPOA 3MJXA 4EAHA 2VK9A 4MHCA 3BQKA 3ZC0A 2NW8A 5L2LA 4EIWA 4KMCA 1ZEEA 3E08A 2XTLA 4ISTA 1U4QA 2VKOA 1SHZC 3LBXB 5FXVA 5GONE 4QXHB 3S4UA 5JDLA 5FNVE 2CCQA 3WAJA 3WI3A 2WM9A 2Y48B 4ZI3C 3NZPA 2PG8A 3AB3B 2NOXA 3B57A 5H6QB 4IE0A 1O3XA 4H63V 2PFVA 3PE0A 3C4ZA 4H63H 3QC9A 3RRWA 4ZI7E 3F57A 5LNKA 3F31A 4FI5A 3HKEE 3UT5E 2CWYA 4X1IE 4EYYR 4EB6E 3C64A 3M65A 5FXXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YFS A;  2YK0 A;  3BQL A;  2XU0 A;  3BQK A;  4NUU A;  3RRC A;  3BQI A;  3CPZ A;  2Y8D A;  4NUV A;  3CML A;  2WAU A;  3C64 A;  5F3J A; 
#chains in the Genus database with same CATH topology
 3T8O A;  2CWO A;  4MLK A;  4AQF A;  2HH7 A;  3M3Z B;  5JH7 E;  1E1H B;  3NZQ A;  2UXX B;  3VR9 A;  4IIJ E;  3AEC A;  5M4Y A;  4CN6 A;  3RX6 A;  3AE8 A;  3MAC A;  2WB5 A;  1FIO A;  1OED A;  2YU2 A;  1XDO A;  3A5X A;  2XQ3 A;  3RIF A;  1ZKE A;  5LB7 B;  4Z8X A;  4GKK T;  4N9F 3;  2AE9 A;  5AQQ B;  3ZMV B;  5C2T A;  4MBQ A;  4QH4 A;  1NEK A;  1S35 A;  1HX8 A;  2BZB A;  3PUV F;  4GK5 E;  2ZLY A;  3LK2 B;  1NWM X;  1T8B A;  2A2F X;  2CHO A;  3NVO A;  4OYJ A;  2YK0 A;  4HWF A;  4O4J E;  2CBI A;  3J7Y q;  3L8R A;  2IC9 A;  2H89 A;  2IIU A;  3N9M A;  3VHL A;  4ILC A;  3CQC B;  2E9X D;  2BVM A;  4CI1 B;  4HE8 A;  5F5W A;  4EZH A;  2CM0 A;  1OED B;  1FMV A;  5FVL A;  4X5T A;  2CXD A;  3C50 A;  3AE7 A;  1OWA A;  2IW5 B;  4X64 T;  4JI6 T;  5ABE A;  2UUB T;  2BS4 A;  3B13 A;  5AQM B;  3KIN B;  3A7M A;  2F4V T;  4YTN A;  3ZT5 A;  4WNK A;  2V7J A;  4JEH B;  4UEM A;  5FP3 A;  5IWA T;  3CX8 B;  2WAU A;  2WP9 A;  5LJN A;  1WR0 A;  4DV6 T;  5EK3 A;  2X0Y A;  4TV9 E;  3TKL B;  2W2U A;  4HN9 A;  3PUW F;  4I43 B;  1HTJ F;  4ERR A;  1HCI A;  2XAS B;  2J4G A;  5AQO B;  1KF6 A;  3R6N A;  2LT3 A;  3AAE B;  5LBQ B;  1LDJ A;  4WYV A;  2W62 A;  3GA8 A;  4E7Z A;  2ACX A;  4C90 A;  1NAF A;  2QVA A;  4IE6 A;  2VKJ A;  2Q9Q D;  4G63 A;  4WQO D;  1KEY A;  4QX7 B;  3ONX A;  1D1A A;  5ADX L;  2LSG A;  2XM2 A;  2SPC A;  2XQ6 A;  5BMV E;  3UU6 A;  2GK9 A;  4LML A;  3O1J A;  3P4R A;  2HN1 A;  1ZP0 A;  4DV0 T;  4UVB B;  3ETU A;  5HCM A;  3FHN A;  5L4E A;  4CN1 A;  1YQ3 A;  5FL1 A;  3UQ4 A;  4G2A A;  4OFZ A;  2JQK A;  1LDK A;  3NWI A;  4O4L E;  4IRE A;  3AXJ A;  2JMK A;  4CN4 A;  4Q25 A;  2NR4 A;  1IBM T;  3AA1 B;  4QXB B;  1G73 A;  2V1D B;  1VOM A;  2JQH A;  2NTY A;  3C51 A;  4A64 A;  4TWD A;  3N9N A;  3PUZ F;  5DQW A;  4I0U A;  1J5E T;  4YLH A;  2X9Y A;  3O1H A;  4Z90 A;  5FMN A;  3UFG A;  3I9Y A;  4ZZC A;  5IHY A;  2V7M A;  5HXC A;  3UU5 A;  2HHH T;  3TLV A;  3RRC A;  3IEE A;  2N1G A;  3FXE B;  3O9X A;  4AKI A;  3AVR A;  3SS1 A;  1VCS A;  1LDK B;  4HFI A;  2KWI B;  2ZMA A;  3AXJ B;  4ZHQ E;  5DQV A;  5F8P A;  5LHI B;  3AAI A;  1JNR A;  4NXN T;  3ZEF B;  1XWM A;  3P4P A;  1E2A A;  3BQI A;  5CGM A;  4UVC B;  2Q9Q A;  3RF1 A;  3P7I A;  3RKO A;  1Z8U A;  3ESL A;  3ZN0 B;  4EZ4 A;  2G0U A;  2WZK A;  2WDQ A;  4IHJ E;  3PU8 A;  1QUU A;  5AQI B;  3FZM B;  4X66 T;  4H9Q C;  2K9A A;  4JI4 T;  2Z6E A;  2H88 A;  3ZMU B;  3GMI A;  5ETW A;  4A5X A;  4O4H E;  4GYS A;  3LBX A;  4U7Y A;  3AAA B;  3LG7 A;  5JDG A;  1WFD A;  2XZE A;  2IC6 A;  1UGO A;  2CXL A;  4YJ2 E;  2WQY A;  5AQN B;  4PJN A;  2VWA A;  1NEN A;  4IE5 A;  2AXD S;  2C5J A;  2BDE A;  1VCT A;  3KV9 A;  3AE6 A;  1XNQ T;  2LHR A;  3BQL A;  2RP4 A;  1MMD A;  3SFD A;  3AA0 B;  2N9D A;  4COF A;  3KVA A;  3RQW A;  1WYB A;  2XQ5 A;  1D1B A;  3ZPO A;  4HFE A;  4HWH A;  4MHC A;  3ZC0 A;  2NW8 A;  4EIW A;  4YXD A;  3E08 A;  2XTL A;  1U4Q A;  5JDL A;  3LBX B;  3S4U A;  3JAF A;  5FNV E;  3WAJ A;  1L0V A;  4LF9 T;  2XQ4 A;  2XQ8 A;  3B57 A;  4IE0 A;  1O3X A;  4H63 V;  2D9D A;  4UR9 A;  3AE1 A;  3UU4 A;  4EYY R;  3C64 A;  5LGT B;  2D5U A;  5FXZ A;  1FMW A;  3PU3 A;  3UUX B;  5LMU T;  3UU3 A;  2LE8 A;  1ZOY A;  3J9X 1;  1XNR T;  3N9P A;  3PUA A;  4YJ3 E;  3FZF B;  2B76 A;  2X9H A;  2V6Y A;  3ZYM A;  2VQE T;  2KWH A;  1VRB A;  4X62 T;  5KXJ A;  4GIW A;  1QSD A;  4EED A;  1FJG T;  1HR0 T;  4E7S A;  4QH5 A;  1KK7 A;  3RTR A;  1SE7 A;  4Z91 A;  4CI2 B;  2H7O A;  4DR2 T;  5ABG A;  3K3Q C;  4O4I E;  3L09 A;  3JCF A;  1S94 A;  4V1A v;  3CML A;  1EZ3 A;  4K0K T;  2KIN B;  5JVD E;  5CJ5 A;  4QX8 B;  3TLS A;  4OK0 A;  4LMJ A;  2FJB A;  2LKG A;  4HWD A;  2V6Y B;  5BR8 T;  3ZMT B;  4F52 A;  2VUR A;  4KI0 F;  4DR1 T;  2FUP A;  3QK6 A;  4H9N C;  1IBL T;  3P8C D;  3OBV E;  2MPK A;  2BG9 E;  3BK9 A;  5FKY A;  1FEW A;  2WBL A;  2K48 A;  4LF6 T;  4ZS2 A;  3HKD E;  4UV9 B;  3MK7 C;  3UUB A;  4WW0 A;  3EAM A;  2KXP B;  4AQG A;  1Y64 B;  5A1L A;  1UUR A;  5L47 A;  3DP7 A;  3ZLI A;  2KND A;  4PFP A;  1HNZ T;  4UV8 B;  3UUL A;  2K24 A;  2XUE A;  4DMW A;  4NPP A;  5HYA A;  3HA4 A;  2CXF A;  5JDM A;  3OVU A;  1V9D A;  1X9B A;  2V7I A;  3NRX A;  2QYW A;  2BG9 C;  2WMN A;  4OYK A;  1YXR A;  4ISS A;  3LSV A;  3KBU A;  1M62 A;  2UU9 T;  3LK4 2;  3CKD A;  4QWN B;  4IDP A;  4GOU A;  2CPT A;  5LOV E;  1T72 A;  2MTQ A;  4ASK A;  3P4S A;  4U72 A;  5AQP B;  2LKH A;  2XY8 B;  3AE3 A;  3CX6 B;  3JAE A;  3ZMZ B;  2DLR A;  5CFB A;  2ODV A;  4TN7 B;  4AI6 A;  4JI1 T;  1LKX A;  4JI7 T;  4ZS3 A;  3QNU A;  2ACZ A;  4PNI A;  3ZJ1 A;  5IUX A;  2XU0 A;  4TWF A;  5AQH B;  2W61 A;  4TUY E;  2H7V C;  4P0A A;  3VU7 H;  2HN2 A;  3FZL B;  2JQ9 A;  5HWX A;  3AE4 A;  5ABF A;  2C5K T;  1KFY A;  3L3P A;  4TNW A;  3CX7 B;  2LLY A;  2KT9 A;  1WYC A;  3EDV A;  3RHW A;  1YD8 G;  1G8X A;  3KFW X;  2D0T A;  3I0O A;  1LVK A;  5LMN T;  1BR0 A;  2XAF B;  2VKD A;  1HG2 A;  3FXD B;  4LFA T;  5AQF B;  3VRA A;  2P9B A;  1XDP A;  4ILA A;  2M6I A;  4UVA B;  1HF8 A;  1T7S A;  1D0X A;  3PV0 F;  4H9S E;  4K0U A;  1WR6 A;  3AEE A;  4P1N A;  4LF5 T;  4N78 D;  3CVR A;  2XSA A;  3KVB A;  1J5W A;  4ILU A;  5ABF B;  5LP6 E;  4I4T E;  3Q5X A;  2D0U A;  2J1D G;  4YSZ A;  2JIW A;  4QH1 A;  3N2G E;  4H9O C;  5FVK A;  4PAG A;  3AEG A;  2ZM6 T;  3FZH B;  2FJE A;  5FXW A;  3T1Y T;  4NXM T;  3UFE A;  3DQV C;  3NKZ A;  2W67 A;  4X20 E;  4JV5 T;  2J47 A;  1SA0 E;  4JEU B;  4LFC T;  4HWC A;  5AQK B;  5HWY A;  4U2Z A;  2VL0 A;  3FBZ A;  2C5I T;  4IDZ A;  2CE7 A;  3ZYK A;  2V8S V;  3I9W A;  2L9Q A;  3D0T A;  2ODU A;  3V5U A;  4P09 A;  1UX5 A;  4AKG A;  2I59 A;  1BR2 A;  2XHE B;  3C98 B;  2BKO A;  1SUM B;  3PUX F;  3HI2 A;  4TX5 A;  3N9L A;  2D2S A;  3SOL A;  4HFD A;  1IJ5 A;  2XAQ B;  3CK6 A;  1LRZ A;  2DWG A;  2FJD A;  1I94 T;  2Y6X A;  2X66 A;  3KDS E;  1N34 T;  4CXY A;  4PK5 A;  1HS7 A;  3VKG A;  4KHZ F;  2VKH A;  3AA7 B;  1QLB A;  2WU2 A;  2XPK A;  5J1G A;  4TV8 E;  4ZZB A;  5FY0 A;  4GKJ T;  3ZJ2 A;  2WDV A;  2LHN A;  3FB2 A;  2VVN A;  2YDQ A;  2YEV C;  1W0A A;  5L2L A;  4A97 A;  2E2A A;  2OLT A;  3WI3 A;  1N36 T;  3NZP A;  4YSY A;  2PFV A;  4YHH T;  3PE0 A;  3ZT7 A;  3RLF F;  5LNK A;  2WS3 A;  4FI5 A;  3HKE E;  4X1I E;  1W09 A;  3IA3 A;  3Q2M A;  3RC3 A;  2YN6 A;  3KV5 A;  3W15 B;  3RIU A;  5JDN A;  4AKR B;  4U31 A;  4U3C A;  2LOP A;  2H3R A;  1IBK T;  4XZC A;  4ZXL A;  4J2C A;  1BR4 A;  3E22 E;  1GQE A;  2UXC T;  2CBJ A;  2XJ7 A;  3I1A A;  3HKB E;  4P5O A;  4IT4 A;  2QA7 A;  5L3B B;  3VRB A;  4O8S A;  2JRK A;  3RYF E;  4HKA A;  2CA5 A;  3RKG A;  2IML A;  3E0Z A;  5HEU A;  4IL4 A;  3ONL C;  4PW8 A;  4NIQ A;  2LEH A;  4F8H A;  2M67 A;  2FBW A;  1XZY A;  3HKC E;  5F3J A;  3ETV A;  1W9R A;  4C91 A;  2PJQ A;  2MOZ A;  3LDQ B;  1MIY A;  4XAX B;  4DR4 T;  2XQ9 A;  1T98 A;  4QHO A;  4B3M T;  1UUS A;  3ZCI A;  4YHJ A;  3WAK A;  4EOZ B;  5EK4 A;  4GYR A;  4PK4 A;  3OPC A;  1Y01 A;  3RGL A;  5JDF A;  2YDS A;  4BAY B;  1R8I A;  2IHR 1;  5AQJ B;  2VVS A;  2DWK A;  4JI3 T;  2XAG B;  4ANJ A;  4A56 A;  4AQY T;  3OTO T;  2LRK A;  3ZCJ A;  2BG9 A;  3ANW A;  2XQ7 A;  4HFV A;  2DHR A;  4IDQ A;  4DV5 T;  1N33 T;  2CLY B;  3G06 A;  3GN5 A;  4LF7 T;  2NP9 A;  4XBF B;  4M1P A;  4CXX A;  2LM9 A;  5KDM C;  3RYC E;  1KNR A;  5FY7 A;  2E8I A;  3C4X A;  3JAD A;  5FY1 A;  4L9I A;  3RIU C;  2A72 A;  2WU5 A;  5EZY E;  5AQG B;  2VB6 A;  2ZM2 A;  3FBL A;  1M7K A;  1ZV4 X;  2BG9 B;  3ANW B;  4EEB A;  4DID B;  3H3A A;  3KBT A;  4IL9 A;  3GN5 B;  3EDU A;  4WBO A;  2B1E A;  1CHU A;  3PUS A;  3IHR A;  2LJL A;  3AEF A;  3MA9 A;  1B7T A;  2JQQ A;  1HNX T;  2JMH A;  2K5B B;  1D0Z A;  5AQS B;  3N2K E;  2MBG A;  4UF0 A;  2VL8 A;  2UUA T;  2WZI A;  2E5L T;  2X68 A;  5C3J A;  3RYI E;  2NW9 A;  2WDR A;  2UXN B;  2X0H A;  1WRD A;  4H9R C;  3P4Q A;  5LCY A;  3UUN A;  3I0Q A;  5JQG E;  2CLY C;  4ZI2 C;  2CMR A;  3PUG A;  4DND A;  3EUH A;  3ZC1 A;  2BKP A;  1UCU A;  5JTG A;  3QUJ A;  1LVF A;  4HFC A;  1YKH B;  5LG3 A;  4O2B E;  2JPF A;  2EHO C;  4UF0 B;  4HFB A;  3LFM A;  2WY2 A;  5E0O A;  2JJ9 A;  2WSS V;  4ADZ A;  1HFA A;  2X9W A;  4HXI B;  4I55 E;  3QB5 K;  4LMK A;  4LF8 T;  3ZSS A;  2BS3 A;  2DL1 A;  1MIW A;  3CQX C;  3IBP A;  5L3E B;  1KNZ A;  1DU2 A;  1AJ3 A;  2VQF T;  2CEA A;  5C8Y E;  4YY3 T;  3JC6 C;  4QKN A;  4WBN E;  3ZST A;  5FYM A;  2X51 A;  3CPZ A;  3P50 A;  2WWU A;  5HEJ A;  2W0G A;  2RA1 A;  4IE7 A;  5J0Z A;  4AP2 B;  5AQR B;  3ONJ A;  2W4X A;  3MXZ A;  4KUM B;  2I6H A;  5EK2 A;  4IE4 A;  2WZH A;  3N9Q A;  2LM2 A;  2OA5 A;  2XQY A;  4JI2 T;  3TLT A;  5CA1 E;  2IDO B;  3LJC A;  2KLQ A;  3L39 A;  3DTO A;  3H3M A;  3TLU A;  2NW7 A;  3UTK A;  4EXT A;  4NUU A;  2X9X A;  3KV6 A;  3IF8 B;  3O1I A;  3U3I A;  2YOE A;  4DV7 T;  4P0B A;  4U33 A;  3K8P C;  4HWI B;  2OV9 A;  3ZYL A;  4DV4 T;  5KX5 E;  4KX6 A;  3A8Y C;  3BQK A;  4KMC A;  1ZEE A;  5FXV A;  1SHZ C;  4QXH B;  2CCQ A;  2LRL A;  2WM9 A;  5HEO A;  4ZI3 C;  2FJA A;  5H6Q B;  2CRB A;  4YSX A;  3QC9 A;  3RRW A;  4A98 A;  5AQL B;  3F31 A;  3ZT6 A;  1OED E;  3UT5 E;  3X1D A;  2CWY A;  4EB6 E;  5AQT B;  5DAB A;  5HXH A;  5CA0 E;  4TZ4 C;  4EV6 A;  1MND A;  4YFS A;  2I0M A;  3AA6 B;  3DJB A;  3CWZ B;  2E5V A;  4MAL A;  1IAP A;  3DPL C;  2W66 A;  3KV4 A;  1XMO T;  5FL0 A;  5LHH B;  4B3S T;  5LYJ E;  2NWB A;  1YW0 A;  3VKH A;  4DUZ T;  2WCA A;  4AQF C;  3N5L A;  3UUM A;  4CZZ B;  2V5D A;  2UXB T;  2Y8D A;  2HPL A;  3AEB A;  2LSJ A;  4F6R C;  4PFO A;  1OED C;  2BVL A;  3CIR A;  2J62 A;  4AKL A;  1H7C A;  4ILB A;  1U6G A;  3P4W A;  1UK5 A;  3SWH A;  2ZM0 A;  2R6G F;  4ZI2 D;  4ZEY A;  3RI5 A;  1W0B A;  2XM1 A;  2E9X A;  2CHN A;  5LBM A;  3PJA A;  1XMQ T;  5TAO A;  5JDH A;  3AED A;  4BJM A;  1YKE B;  1MNE A;  3OJA A;  4IDO A;  2UUC T;  4B3R T;  4EGW A;  3OKQ A;  3RC8 A;  1MIV A;  4JI8 T;  4I50 E;  2XQA A;  4DUY T;  5HEG A;  4U74 A;  4HFH A;  2EHO D;  2L8K A;  1BR1 A;  3K3N A;  4X1K E;  3AVS A;  4TWH A;  2MYS A;  1CUN A;  2PBI A;  2BS2 A;  4KP3 C;  4PK6 A;  4O2A E;  5L3G B;  2YDR A;  2X0L B;  5LG4 A;  2ES0 A;  1UX4 A;  1MMN A;  2E9X B;  2XSB A;  3FZK B;  4DV3 T;  5JR9 A;  2N2N A;  3EI0 A;  5AQU B;  4DV1 T;  3JC6 D;  3Q9D A;  2A3D A;  3ZKR A;  3EVY A;  3MKD A;  3K1S A;  2KZ7 B;  3AE2 A;  4HEA A;  3O4X E;  5J2U E;  3MZK B;  2X67 A;  2YIN A;  3QOF A;  4U7I A;  2W00 A;  5LXT E;  2DNX A;  4DVD A;  2KMF A;  2V26 A;  5AQV B;  5LGU B;  4DR3 T;  4DMV A;  2KSR A;  2XAH B;  3N9O A;  2BKN A;  1Z0P A;  3V5S A;  4QXC B;  3U78 A;  4B6X A;  2RPA A;  3Q5D A;  5JR9 B;  5DJQ C;  4OX9 T;  3GWH A;  3TLW A;  3PTR B;  3SFE A;  3UU8 A;  4APF B;  4DBQ A;  2MAW A;  4B3T T;  5L4H A;  5LA6 E;  3ABV A;  5LGN B;  4LFB T;  1E7P A;  1IJ6 A;  1HNW T;  4YT0 A;  1HX1 B;  4BJN A;  1US7 B;  1HG5 A;  3T1H T;  1ZHC A;  3AEA A;  1X79 A;  2Q9Q B;  4DR6 T;  3HL6 A;  5JRE A;  2E9X C;  4PJJ A;  2ZM8 A;  2V6X A;  4DBR A;  4ZI3 D;  3H37 A;  4LF4 T;  3PDY A;  1IZN B;  2EHO A;  1D0Y A;  2V7L A;  5CB4 E;  2UXD T;  4UXN B;  4FJO A;  4MFR A;  3HR0 A;  4PJM A;  4KHP T;  4PJL A;  3F2E A;  1YQ4 A;  2BBH A;  5HAX A;  3RIA A;  5AFU L;  4H9P C;  2QGS A;  3EHZ A;  4X1Y E;  4IGU A;  4JI5 T;  4JI0 T;  4CXW A;  4WZX A;  1J1J A;  3ZMS B;  5HXS A;  3C4W A;  4DR7 T;  4JYA T;  5L3C B;  4ZOL E;  5HEH A;  4JUY A;  5IYZ E;  5H6R B;  4L5G A;  4CI3 B;  3B5M A;  4HGA A;  1D1C A;  4CQI A;  2LSI A;  3NBX X;  5J2T E;  1MMG A;  4YTP A;  1N32 T;  5JR9 C;  3RQU A;  5L3D B;  2WWV A;  2EHO B;  5HCJ A;  1OXZ A;  4DV2 T;  3AE5 A;  3AE9 A;  4JLE A;  2DCF A;  3SRZ A;  1U5P A;  5JRC A;  5ABH A;  5HXE A;  2IAK A;  3CQG B;  2PTF A;  5LJM A;  4DO0 A;  2V7K A;  3RPU A;  2LOS A;  4L0R A;  4UIG A;  4AIS A;  5LHG B;  4EYU A;  3PUQ A;  3K3O A;  5KMG P;  4GK0 E;  2VAS A;  3Q5E A;  3LK3 B;  4KBM B;  2Q9Q C;  3ZN1 B;  4UEL A;  3Q5W A;  3OYZ A;  2C0S A;  2M6B A;  4HTE A;  3N2O A;  4NUV A;  2L3L A;  3PUY F;  3VR8 A;  5JDQ A;  2YU1 A;  5HXR A;  2HPJ A;  4X65 T;  3NRY A;  3OYX A;  4OHF A;  3QB5 A;  3UQ7 A;  5L3F B;  2NTX A;  2IUB A;  2W63 A;  1I6Z A;  2LSK A;  4AKH A;  1JNZ A;  5JRC B;  4YTM A;  1WLX A;  4AXP A;  4JBW F;  3R84 B;  2BBJ A;  3PJA J;  3RH3 A;  4BA9 A;  3PUR A;  2LSY A;  3RYH E;  2DI4 A;  2XAJ B;  2V5C A;  2WMO A;  2QRX A;  1MMA A;  4U2Y A;  3MJX A;  4AIU A;  4EAH A;  4DR5 T;  2VK9 A;  2A9U A;  4IST A;  2VKO A;  5GON E;  3EAB A;  4JGH D;  4IDN A;  2Y48 B;  1KNP A;  2PG8 A;  3AB3 B;  2NOX A;  1WCR A;  3C4Z A;  4H63 H;  4ZI7 E;  2K3W A;  3F57 A;  4TNV A;  3M65 A;  2YKS A;  5FXX A; 
#chains in the Genus database with same CATH homology
 2D5U A;  5FXZ A;  5DAB A;  5HXH A;  1FMW A;  3PU3 A;  3T8O A;  4TZ4 C;  5CA0 E;  1MND A;  2CWO A;  3Q2M A;  4MLK A;  3RC3 A;  4AQF A;  3UUX B;  2HH7 A;  4YFS A;  3KV5 A;  3W15 B;  5JDN A;  2LE8 A;  3AA6 B;  5LGT B;  4AKR B;  5JH7 E;  1E1H B;  3DJB A;  3NZQ A;  2UXX B;  3CWZ B;  3J9X 1;  4MAL A;  1IAP A;  3N9P A;  2LOP A;  4IIJ E;  3PUA A;  2H3R A;  3KV4 A;  4YJ3 E;  2X9H A;  3ZYM A;  5M4Y A;  5LHH B;  2KWH A;  5LYJ E;  2NWB A;  1VRB A;  4XZC A;  1YW0 A;  3RX6 A;  3VKH A;  4J2C A;  4AQF C;  4GIW A;  3N5L A;  1QSD A;  3MAC A;  1FIO A;  1BR4 A;  4E7S A;  2YU2 A;  3E22 E;  1KK7 A;  3UUM A;  4CZZ B;  3A5X A;  1ZKE A;  3I1A A;  4CI2 B;  2H7O A;  3HKB E;  4Z8X A;  2QA7 A;  2Y8D A;  5L3B B;  2HPL A;  3K3Q C;  4O4I E;  4O8S A;  2JRK A;  3L09 A;  3RYF E;  2LSJ A;  4F6R C;  4PFO A;  4HKA A;  2CA5 A;  1S94 A;  3ZMV B;  3E0Z A;  4V1A v;  3CML A;  1EZ3 A;  4MBQ A;  1S35 A;  2BZB A;  1HX8 A;  4PW8 A;  4GK5 E;  2LEH A;  2ZLY A;  3LK2 B;  2BVL A;  1NWM X;  2KIN B;  2A2F X;  4OYJ A;  2YK0 A;  4AKL A;  5JVD E;  1H7C A;  4O4J E;  4QX8 B;  3J7Y q;  2M67 A;  2IC9 A;  3HKC E;  5F3J A;  3ETV A;  3N9M A;  4OK0 A;  3SWH A;  3VHL A;  3ZMT B;  2ZM0 A;  4C91 A;  3CQC B;  2PJQ A;  2MOZ A;  4ZI2 D;  2E9X D;  2BVM A;  3QK6 A;  4H9N C;  4CI1 B;  1MIY A;  2E9X A;  4HE8 A;  5LBM A;  4XAX B;  3P8C D;  5TAO A;  4EZH A;  5JDH A;  2CM0 A;  1T98 A;  3OBV E;  4QHO A;  4BJM A;  3BK9 A;  1FEW A;  2WBL A;  3ZCI A;  1YKE B;  1MNE A;  3OJA A;  2K48 A;  1FMV A;  4YHJ A;  3WAK A;  2CXD A;  4ZS2 A;  4EOZ B;  5EK4 A;  3HKD E;  3C50 A;  3OKQ A;  4GYR A;  3RC8 A;  4UV9 B;  1OWA A;  3MK7 C;  1MIV A;  4PK4 A;  2IW5 B;  4WW0 A;  4I50 E;  2KXP B;  5JDF A;  3B13 A;  4U74 A;  4AQG A;  1Y64 B;  4BAY B;  2EHO D;  2L8K A;  1BR1 A;  3KIN B;  5A1L A;  3K3N A;  4X1K E;  3AVS A;  3DP7 A;  2DWK A;  3ZLI A;  2KND A;  4PFP A;  2MYS A;  1CUN A;  2PBI A;  4WNK A;  4KP3 C;  2V7J A;  4JEH B;  2XAG B;  4UEM A;  4UV8 B;  3UUL A;  2K24 A;  2XUE A;  4PK6 A;  4ANJ A;  5FP3 A;  4DMW A;  4O2A E;  4A56 A;  3CX8 B;  5L3G B;  3ZCJ A;  2X0L B;  3ANW A;  5LG4 A;  4HFV A;  2DHR A;  2WAU A;  2ES0 A;  5HYA A;  5LJN A;  3HA4 A;  1UX4 A;  1MMN A;  2CLY B;  5EK3 A;  4TV9 E;  2CXF A;  2E9X B;  3GN5 A;  3TKL B;  2NP9 A;  4HN9 A;  4XBF B;  5JR9 A;  2N2N A;  5JDM A;  1V9D A;  3JC6 D;  4M1P A;  2V7I A;  1HTJ F;  3NRX A;  3Q9D A;  4I43 B;  4ERR A;  2A3D A;  4CXX A;  2WMN A;  4OYK A;  3EVY A;  2LM9 A;  1HCI A;  4ISS A;  3MKD A;  5KDM C;  2XAS B;  3RYC E;  3KBU A;  3R6N A;  5FY7 A;  2E8I A;  2LT3 A;  3AAE B;  3LK4 2;  3C4X A;  5LBQ B;  2KZ7 B;  3CKD A;  5FY1 A;  4QWN B;  4HEA A;  2W62 A;  4L9I A;  3O4X E;  4GOU A;  3GA8 A;  5J2U E;  3MZK B;  2X67 A;  2A72 A;  4E7Z A;  2ACX A;  5LOV E;  2YIN A;  5EZY E;  4C90 A;  2MTQ A;  1NAF A;  4IE6 A;  2VKJ A;  2Q9Q D;  4G63 A;  4ASK A;  5LXT E;  2W00 A;  4U72 A;  2DNX A;  4DVD A;  2VB6 A;  4QX7 B;  3ONX A;  3CX6 B;  1D1A A;  5ADX L;  2ZM2 A;  3FBL A;  2KMF A;  2LSG A;  2V26 A;  5LGU B;  1ZV4 X;  3ZMZ B;  4DMV A;  2SPC A;  2DLR A;  3ANW B;  2XAH B;  2ODV A;  3N9O A;  4TN7 B;  4AI6 A;  5BMV E;  2GK9 A;  3H3A A;  3KBT A;  1Z0P A;  3O1J A;  3V5S A;  1LKX A;  4QXC B;  3GN5 B;  3EDU A;  4WBO A;  2B1E A;  3U78 A;  4ZS3 A;  4B6X A;  5JR9 B;  4PNI A;  3ZJ1 A;  4UVB B;  2XU0 A;  3ETU A;  5DJQ C;  3PUS A;  2W61 A;  3GWH A;  3IHR A;  4TUY E;  2H7V C;  4P0A A;  2LJL A;  3PTR B;  3VU7 H;  3FHN A;  3MA9 A;  4DBQ A;  1B7T A;  2JQQ A;  5HWX A;  2JMH A;  2K5B B;  1D0Z A;  3N2K E;  2MBG A;  4G2A A;  5LA6 E;  2C5K T;  4OFZ A;  4UF0 A;  2VL8 A;  3L3P A;  5LGN B;  3CX7 B;  1IJ6 A;  4O4L E;  2KT9 A;  1WYC A;  2X68 A;  2JMK A;  3EDV A;  1YD8 G;  3RYI E;  1G8X A;  2NW9 A;  4BJN A;  3AA1 B;  1US7 B;  1HG5 A;  4QXB B;  2UXN B;  1ZHC A;  2D0T A;  3I0O A;  3KFW X;  1G73 A;  1LVK A;  2V1D B;  1WRD A;  1X79 A;  1VOM A;  2Q9Q B;  3HL6 A;  4H9R C;  2XAF B;  2NTY A;  2VKD A;  1HG2 A;  3FXD B;  5LCY A;  5JRE A;  3C51 A;  1BR0 A;  3UUN A;  3I0Q A;  5JQG E;  2CLY C;  4ZI2 C;  2CMR A;  2E9X C;  3PUG A;  4PJJ A;  2P9B A;  2ZM8 A;  3N9N A;  4DBR A;  5DQW A;  4DND A;  3EUH A;  3H37 A;  4ZI3 D;  3PDY A;  3ZC1 A;  1IZN B;  4UVA B;  4YLH A;  2EHO A;  2X9Y A;  1D0Y A;  3O1H A;  2V7L A;  1HF8 A;  1D0X A;  1UCU A;  5FMN A;  3I9Y A;  3QUJ A;  4H9S E;  5CB4 E;  4UXN B;  4K0U A;  5IHY A;  2V7M A;  4FJO A;  1WR6 A;  4MFR A;  5HXC A;  3HR0 A;  1LVF A;  3RRC A;  1YKH B;  3IEE A;  4N78 D;  4PJM A;  3CVR A;  4PJL A;  4O2B E;  3F2E A;  3KVB A;  5HAX A;  2N1G A;  4ILU A;  5AFU L;  4H9P C;  5LP6 E;  4I4T E;  3FXE B;  2D0U A;  3Q5X A;  3O9X A;  2QGS A;  4AKI A;  2J1D G;  2JPF A;  4X1Y E;  4IGU A;  2EHO C;  3AVR A;  4UF0 B;  3SS1 A;  4CXW A;  3N2G E;  4H9O C;  3LFM A;  4PAG A;  3ZMS B;  5HXS A;  5E0O A;  2JJ9 A;  2KWI B;  2ZMA A;  3C4W A;  2WSS V;  4ADZ A;  1HFA A;  5L3C B;  4ZOL E;  4ZHQ E;  4JUY A;  5DQV A;  2X9W A;  5IYZ E;  5FXW A;  5F8P A;  5LHI B;  3UFE A;  5H6R B;  4L5G A;  4I55 E;  3AAI A;  4CI3 B;  3ZEF B;  4X20 E;  4HGA A;  1MIW A;  3CQX C;  1D1C A;  4CQI A;  2LSI A;  3NBX X;  5J2T E;  3IBP A;  1MMG A;  5L3E B;  5JR9 C;  1KNZ A;  5L3D B;  1SA0 E;  4JEU B;  1AJ3 A;  2EHO B;  1OXZ A;  4JLE A;  3BQI A;  2DCF A;  2CEA A;  3SRZ A;  5C8Y E;  1U5P A;  5HWY A;  3JC6 C;  4QKN A;  4WBN E;  4UVC B;  2Q9Q A;  5JRC A;  5HXE A;  5FYM A;  2IAK A;  3CQG B;  2X51 A;  3CPZ A;  3P7I A;  3RKO A;  3FBZ A;  2C5I T;  3ESL A;  5LJM A;  2WWU A;  4IDZ A;  3ZN0 B;  4EZ4 A;  2G0U A;  4DO0 A;  2V7K A;  2W0G A;  3RPU A;  2LOS A;  2RA1 A;  4IHJ E;  4IE7 A;  2CE7 A;  3PU8 A;  1QUU A;  3I9W A;  3ZYK A;  4L0R A;  2L9Q A;  4H9Q C;  4UIG A;  5LHG B;  4EYU A;  3PUQ A;  3K3O A;  5KMG P;  2K9A A;  3D0T A;  4GK0 E;  2VAS A;  2ODU A;  3MXZ A;  4KUM B;  2Z6E A;  3V5U A;  5EK2 A;  3LK3 B;  4P09 A;  1UX5 A;  4KBM B;  4AKG A;  3ZMU B;  3GMI A;  2I59 A;  4IE4 A;  2Q9Q C;  3ZN1 B;  1BR2 A;  5ETW A;  3N9Q A;  3Q5W A;  4UEL A;  3C98 B;  2XHE B;  2C0S A;  3OYZ A;  4HTE A;  2OA5 A;  2XQY A;  3N2O A;  4O4H E;  4GYS A;  3LBX A;  3HI2 A;  3AAA B;  4TX5 A;  3N9L A;  4NUV A;  5CA1 E;  2D2S A;  2L3L A;  3LG7 A;  5JDQ A;  3SOL A;  2YU1 A;  5JDG A;  5HXR A;  1IJ5 A;  2HPJ A;  2XAQ B;  3LJC A;  2IC6 A;  2KLQ A;  2CXL A;  4YJ2 E;  1LRZ A;  2DWG A;  4PJN A;  2VWA A;  3DTO A;  3NRY A;  3OYX A;  2Y6X A;  4OHF A;  4IE5 A;  2X66 A;  2NW7 A;  5L3F B;  2NTX A;  3UTK A;  3KDS E;  4EXT A;  2W63 A;  2C5J A;  2BDE A;  4NUU A;  2LSK A;  2X9X A;  4PK5 A;  4CXY A;  3KV9 A;  5JRC B;  1HS7 A;  4AKH A;  3KV6 A;  3IF8 B;  3O1I A;  1WLX A;  3U3I A;  2LHR A;  3BQL A;  2RP4 A;  4AXP A;  3VKG A;  3R84 B;  2VKH A;  3AA7 B;  1MMD A;  3RH3 A;  4BA9 A;  3PUR A;  5J1G A;  4TV8 E;  4P0B A;  5FY0 A;  3AA0 B;  3ZJ2 A;  2N9D A;  2LHN A;  3FB2 A;  3K8P C;  2LSY A;  3KVA A;  2DI4 A;  2XAJ B;  3RYH E;  1WYB A;  2WMO A;  1MMA A;  1D1B A;  3ZYL A;  5KX5 E;  2YEV C;  3ZPO A;  3MJX A;  4EAH A;  2VK9 A;  4MHC A;  3BQK A;  3ZC0 A;  2NW8 A;  5L2L A;  4EIW A;  4KMC A;  1ZEE A;  3E08 A;  2XTL A;  4IST A;  1U4Q A;  2VKO A;  1SHZ C;  3LBX B;  5FXV A;  5GON E;  4QXH B;  3S4U A;  5JDL A;  5FNV E;  2CCQ A;  3WAJ A;  3WI3 A;  2WM9 A;  2Y48 B;  4ZI3 C;  3NZP A;  2PG8 A;  3AB3 B;  2NOX A;  3B57 A;  5H6Q B;  4IE0 A;  1O3X A;  4H63 V;  2PFV A;  3PE0 A;  3C4Z A;  4H63 H;  3QC9 A;  3RRW A;  4ZI7 E;  3F57 A;  5LNK A;  3F31 A;  4FI5 A;  3HKE E;  3UT5 E;  2CWY A;  4X1I E;  4EYY R;  4EB6 E;  3C64 A;  3M65 A;  5FXX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...