3BQKA

Structure of a chondroitin sulphate binding dbl3x from a var2csa encoded pfemp1 protein in complex with sulphate
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
360
structure length
338
Chain Sequence
SCDLNATNYIRGCQSKTYDGKIFPGKGGEKQWICKDTIIHGDTNGACIPPRTQNLCVGELWDKSYGGRSNIKNDTKELLKEKIKNAIHKETELLYEYHDTGTAIISKNDKKGQKGKNDPNGLPKGFCHAVQRSFIDYKNMILGTSVNIYEHIGKLQEDIKKIIEKGTPQQSTENVNAWWKGIEREMWDAVRCAITKINKKNNNSIFNGDECGVSPPTDQSVSWFKEWGEQFCIERLRYEQNIREACTEKKCINSGDKIQGACKRKCEKYKKYISEKKQEWDKQKTKYENKYVGKSASDLLKENYPECISANFDFIFNDNIEYKTYYPYGDYSSICSCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords Erythrocyte membrane protein 1
publication title The structure of a chondroitin sulfate-binding domain important in placental malaria.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 119
structure length 338
sequence length 360
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05424 Duffy_binding Duffy binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.830 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3bqkA01
1.20.1310.20 Mainly Alpha Up-down Bundle 5 helical Cullin repeat like 5 helical Cullin repeat like 3bqkA02
3CPZA 2WAUA 4YFSA 3BQLA 4NUVA 2XU0A 3CMLA 4NUUA 3BQIA 3BQKA 2YK0A 2Y8DA 5F3JA 3RRCA 3C64A
chains in the Genus database with same CATH superfamily
3AEGA 4DV1T 5LJMA 4LF6T 1NEKA 3I9YA 4I4TE 1M7KA 2Q9QA 2GK9A 1US7B 1MMDA 4ILAA 3NBXX 3AE6A 3ZMUB 4OYKA 1J5WA 2W61A 4TV9E 2X66A 4AP2B 3F31A 2CPTA 1HR0T 3RIFA 3AEBA 4X64T 1J5ET 4I0UA 3AE7A 4ZOLE 3A5XA 5HEGA 3N5LA 2LSJA 2MPKA 3P7IA 1OEDA 4NXMT 2ZMAA 1KNRA 4O4JE 2XAJB 4LF4T 3K1SA 2KZ7B 3PUZF 2CBJA 3RGLA 2DCFA 4QH5A 2LOPA 4OX9T 3ONJA 2E8IA 4PW8A 3NZQA 3OYXA 4GIWA 4DBQA 2NW8A 2ACXA 3ETUA 2XY8B 2ODUA 3PDYA 5L3EB 4H9PC 1NAFA 4QKNA 2R6GF 5LJNA 1E1HB 1MIYA 4C90A 3KFWX 5AQSB 2LT3A 1Z8UA 4U2YA 4GKKT 3ZYKA 3R6NA 2J47A 5LHIB 1W9RA 1S94A 3B13A 4KX6A 3ZCIA 2B76A 3OYZA 2WS3A 2UXCT 3JAFA 2WDVA 5HXRA 4BJNA 4TV8E 4MHCA 3MA9A 4PNIA 4PJMA 2LSKA 2XQ7A 5J2TE 3EVYA 2L3LA 2LM9A 1Z0PA 5JTGA 1LKXA 2UUAT 4L0RA 2X9HA 3P4SA 2N2NA 3N9OA 3T1HT 5DQWA 2FJAA 2H7OA 5JDNA 4ZZCA 2VKOA 2J62A 2IC9A 2E9XC 3AE5A 3LSVA 1IBMT 3ZKRA 3FHNA 1D1AA 4YTMA 4H9QC 4O4IE 5JH7E 5KXJA 3I0OA 2WU2A 3NVOA 3TLWA 5DQVA 1XWMA 3ZMVB 3BK9A 1CUNA 3A7MA 2YK0A 4PK6A 2FJBA 3MKDA 4AXPA 1CHUA 2FBWA 1IBKT 3RYHE 2CCQA 3TLTA 5JVDE 3AAEB 5HEHA 3RC3A 2VKDA 3ZN0B 4DV6T 1XZYA 2N1GA 2ZM6T 4N9F3 5LGUB 1UCUA 4HEAA 4ANJA 3Q9DA 4HN9A 3MZKB 4IE4A 4PJNA 2MYSA 3RYFE 1BR0A 2W0GA 2KMFA 4DV7T 1LDKB 1OWAA 3C4XA 2NTXA 3CKDA 4U2ZA 5CGMA 4EGWA 4LF5T 2I59A 2BKPA 3AE1A 1WLXA 3VHLA 4OK0A 2NTYA 4QX7B 1KK7A 3AAAB 4YHHT 4JI3T 3IEEA 4APFB 4H9NC 2V1DB 4AI6A 2V6YA 2LSGA 2CHNA 1HF8A 5KMGP 5H6QB 1YQ4A 4HWFA 2BZBA 4JEUB 3HKEE 4L5GA 4DNDA 3DQVC 3AVSA 4QH1A 4IREA 2W00A 3LFMA 2LSIA 4LMLA 5LMNT 3RRCA 3ABVA 1HNWT 3AA7B 3KBUA 2M6BA 5LHHB 5L4EA 4DIDB 1HX8A 5IWAT 2G0UA 2KLQA 3SFDA 4EIWA 3LK42 3N9LA 3ZJ2A 1Y64B 2JIWA 2YU1A 4IHJE 1JNRA 3ZC0A 5FY0A 3AE4A 3SOLA 3EI0A 5FY7A 4KBMB 5FMNA 3RIAA 2KWIB 2W63A 3WAJA 2C5IT 3C98B 2XQ3A 1T7SA 2CLYB 3AA1B 5JREA 2EHOC 1NWMX 4UEMA 2XQAA 2SPCA 3PUVF 4DBRA 5JRCB 3KV9A 3E08A 4ZI2C 2DNXA 3HI2A 1U4QA 2HH7A 3L39A 4WBNE 4UF0B 3VR8A 1WRDA 2BG9E 2YINA 3UQ7A 4HFIA 5EK3A 4PK4A 2XPKA 4YXDA 4PJLA 4NUVA 3CQGB 3CIRA 3LK3B 3NKZA 4U72A 5BR8T 4DV5T 2WB5A 3RYIE 2WZHA 4BAYB 3QUJA 3C51A 4G2AA 4YSZA 3FZHB 4DR1T 3QB5K 3H3MA 4QXCB 3P4RA 5HCMA 3JAEA 5LB7B 3O1IA 5LP6E 4X66T 2QVAA 3VU7H 5HYAA 1SE7A 1HG5A 2X51A 3P50A 3X1DA 4KHZF 4UXNB 2CE7A 4DR7T 5ABFA 4LFCT 1LRZA 4I43B 3CMLA 2CLYC 5J2UE 3K3OA 2CA5A 2XM1A 4IIJE 2WMOA 1DU2A 4IDPA 3DP7A 4Z90A 1XMQT 3LBXA 4GK5E 2XQ5A 5FXWA 3CVRA 1XDOA 4HXIB 4DR5T 1VOMA 3U3IA 3VRBA 5JR9A 5AQPB 4IL4A 3TKLB 4A98A 3Q5XA 2NWBA 4WZXA 3TLSA 4JI0T 2XSBA 3RQUA 3JC6D 3I1AA 2BG9A 4P09A 2X0YA 4AQGA 2MOZA 4JI2T 2XUEA 3EABA 3GN5B 2X0LB 1D1CA 2XAFB 4HGAA 3T1YT 2LRKA 3AVRA 2XTLA 3L3PA 4UELA 2MAWA 3ZT7A 2KXPB 1HNZT 2BBHA 1QSDA 3RLFF 2XQ9A 4JYAT 4GKJT 2UXDT 2VL0A 3TLVA 3NZPA 3AA0B 1N32T 4AQFC 5AQTB 3CQXC 2E2AA 1I6ZA 4IDOA 2DLRA 1YKHB 4U7IA 2Q9QB 4DR2T 4CI1B 5L3CB 4ISTA 4BJMA 4KHPT 3ZT6A 4CZZB 2XAHB 3UU5A 4DMWA 3AA6B 3UFGA 2YU2A 2BS4A 3C50A 4DUZT 3EUHA 4HWHA 5FL0A 3PV0F 5EK4A 1S35A 4DV4T 1UUSA 3Q5WA 3SFEA 1OEDB 3C4WA 4HKAA 1UX5A 2Y48B 1HCIA 5F5WA 4Q25A 3ZCJA 2YKSA 2XJ7A 4YLHA 2V5DA 4LFAT 4ZI7E 3UTKA 4YSYA 4H63H 4JEHB 2C0SA 3RKGA 4DV3T 1YXRA 1HS7A 2VKHA 4E7ZA 5H6RB 5C8YE 2BDEA 2WSSV 2IHR1 4DO0A 2H3RA 3WAKA 4CXXA 1WR6A 1O3XA 3UU4A 3VRAA 1XMOT 4AKLA 1ZP0A 4YTPA 2IIUA 2P9BA 3WI3A 4KI0F 3TLUA 3PUSA 5C2TA 1WFDA 4ZS3A 2IDOB 4JUYA 4X5TA 5KDMC 3RIUC 2E5VA 5LBMA 1D0XA 3GA8A 1MNDA 3VKHA 1IJ6A 4ZS2A 2CWOA 2CRBA 5J0ZA 1SA0E 1OXZA 1OEDC 1ZHCA 5EK2A 4EAHA 3LK2B 5A1LA 2WDRA 3ZPOA 3B57A 2BKNA 3K3QC 1T98A 5JQGE 2VASA 4I55E 2D2SA 2FJEA 2HPLA 2E9XA 4EEDA 3UQ4A 5IHYA 1H7CA 4B3ST 4PAGA 3CK6A 2QRXA 3RX6A 4QXBB 4IDZA 2H88A 3BQIA 2A3DA 3P4QA 5FNVE 3UULA 2NW9A 2A2FX 5AQLB 3SRZA 2MBGA 2Q9QD 5HXSA 3RQWA 3ZC1A 3VR9A 1V9DA 3RRWA 3PUQA 2PG8A 3UT5E 5AQNB 1U5PA 2Y6XA 4ERRA 5L2LA 2LOSA 3NRYA 4EYYR 5FXZA 2X9WA 4IL9A 4YY3T 4TNWA 3JADA 2CXLA 4EV6A 3FXDB 5AQKB 3PUXF 1YW0A 2PTFA 5EZYE 4ZZBA 4HE8A 4OFZA 3PE0A 4IE7A 2WWUA 3C4ZA 4WYVA 3R84B 5M4YA 2MTQA 3KINB 2V6YB 5ABEA 2XQ6A 2BVLA 3O1HA 4UV8B 1ZV4X 4IT4A 3K3NA 3AEDA 3ONLC 5L3DB 2KWHA 3ZJ1A 4C91A 4QH4A 2PFVA 3OPCA 4ZI3C 2L9QA 1MIVA 2ODVA 1IBLT 4O4HE 4GYSA 4YFSA 4XBFB 4AQYT 4PFPA 4X1KE 2CHOA 4TN7B 2X68A 3ETVA 5LCYA 4I50E 1UURA 1XDPA 2LHNA 3ZT5A 3VKGA 5FXXA 5FXVA 3PU3A 5F8PA 2EHOA 5CB4E 4XAXB 5FVKA 2VL8A 3AE9A 2VURA 2V7KA 3FB2A 3N2OA 4HTEA 4JLEA 4IE5A 5KX5E 3SWHA 5AQUB 5TAOA 4CI2B 4JBWF 4JI4T 3HKBE 1N34T 2BS2A 4ZI3D 2YDRA 2XASB 3CX8B 3GMIA 2D9DA 2NW7A 4QWNB 2V7LA 4B3RT 2VVNA 4HFDA 5JDMA 4F8HA 5AFUL 2K24A 4LF8T 3OJAA 3H37A 3OTOT 2FJDA 5ABFB 1KNZA 3JC6C 2ZLYA 5LNKA 4NIQA 4A5XA 4HWIB 5FKYA 3HR0A 3UU6A 1NENA 1T8BA 4ILUA 4CXYA 4DVDA 5JDLA 1MIWA 3LBXB 2M6IA 3UUNA 2DWKA 4AKRB 3OBVE 5JR9B 3DPLC 2WDQA 2HHHT 1VRBA 3KVBA 3AAIA 4A97A 5HWXA 3KV5A 2XAGB 4WNKA 2WU5A 3J7Yq 5LXTE 2IC6A 3ZLIA 2OLTA 3ZMSB 5IYZE 2VQET 2BG9B 1UX4A 1XNQT 1N33T 1FMWA 4HFCA 3RI5A 4PFOA 2L8KA 5FVLA 3RH3A 2W62A 4DR4T 4GOUA 4ILBA 3O1JA 3HA4A 2UXNB 4H9OC 4UVAB 4HFBA 4HFVA 3QC9A 1KNPA 3QNUA 4IGUA 2QA7A 4YJ2E 3ANWA 5FP3A 4O4LE 3K8PC 2JMKA 1MMAA 3ZMTB 4IE0A 3FZFB 2VWAA 1KEYA 4CN6A 4E7SA 3H3AA 3AECA 4X1YE 2KSRA 1HFAA 4PJJA 4ILCA 4AQFA 4B3MT 2RA1A 3AE8A 4A56A 3CWZB 5JR9C 4GK0E 4U31A 3UFEA 2WP9A 5JDHA 3SS1A 4AKGA 2JQQA 2ZM8A 4AKHA 4UVBB 4LF9T 2V7JA 3IA3A 2WM9A 3L8RA 1LVKA 4G63A 4WBOA 2BVMA 5JDGA 4ZEYA 4U7YA 1ZOYA 5FL1A 3PJAA 4AISA 2QGSA 3RF1A 3ZSSA 2CEAA 2UU9T 4V1Av 3CX6B 4P0AA 5CFBA 3NWIA 2LSYA 3ZMZB 3PUYF 2VQFT 2XAQB 3N9NA 2BKOA 3LG7A 3ZYMA 3Q5EA 4O2AE 1L0VA 1QLBA 3AEFA 4DV0T 5ETWA 3IBPA 4L9IA 5AQHB 5E0OA 4ZHQE 2LM2A 2CM0A 3A8YC 5LG3A 3AB3B 3QOFA 4F6RC 5LGNB 3J9X1 1D0YA 2DL1A 4KP3C 5ADXL 3L09A 2X67A 2LLYA 2UXBT 3HKCE 4K0UA 4ZXLA 2K9AA 2K48A 2X9XA 2V7IA 3AXJA 3KDSE 1KF6A 3AEAA 4JI7T 1QUUA 3N2KE 4HFHA 3UU3A 2OV9A 1SUMB 2HN1A 3N9PA 2J1DG 2WWVA 3RIUA 5AQGB 2X0HA 3Q2MA 4AIUA 1HG2A 2W67A 4JI8T 5AQVB 3GWHA 2Q9QC 3FZKB 1MMGA 3NRXA 4N78D 3ZEFB 3PURA 4X62T 2AE9A 2I6HA 3E0ZA 5BMVE 3LJCA 1YQ3A 4O8SA 3DJBA 3AE2A 4UR9A 5C3JA 4DR6T 2E9XB 3RPUA 1MMNA 5L3BB 2VKJA 3EAMA 4B6XA 2JQHA 3M65A 5AQIB 4LF7T 2XHEB 4XZCA 1HNXT 2JRKA 1FEWA 2W2UA 2Z6EA 2Y8DA 3ZYLA 2D0TA 5HXEA 3EDUA 2A9UA 2JMHA 3B5MA 1WYBA 3P4PA 4GYRA 2CXFA 4KMCA 4WW0A 3OVUA 4YT0A 2ZM0A 4JGHD 1IJ5A 2YOEA 3JCFA 1W09A 2KINB 2VK9A 2HPJA 2KNDA 4PK5A 3F57A 3FZMB 2DI4A 1IZNB 1ZKEA 1WCRA 4EYUA 2LHRA 5FY1A 4P1NA 1ZEEA 3RYCE 2B1EA 1GQEA 2CBIA 3KBTA 1B7TA 1UK5A 2WZIA 3RHWA 3OKQA 3KV4A 2V6XA 2OA5A 5CA1E 2XQYA 5HXHA 4H9SE 5HXCA 4HWCA 2I0MA 4DR3T 3F2EA 3CQCB 2M67A 2X9YA 4QXHB 3UU8A 2WMNA 2LE8A 4O2BE 3MXZA 2NOXA 5L47A 1BR1A 4TWDA 2UUBT 1YKEB 4TWHA 3V5UA 4EXTA 4JI5T 2WQYA 3ZSTA 1R8IA 5DABA 2WZKA 2CMRA 4HWDA 3W15B 2V8SV 4X65T 4H9RC 3E22E 3T8OA 2IW5B 2UUCT 5FYMA 2LKHA 4LMKA 4JV5T 2J4GA 1JNZA 2A72A 3IF8B 4NUUA 2ES0A 4EOZB 2IMLA 2EHOB 3IHRA 3FZLB 4OYJA 4Z8XA 2V5CA 4ADZA 4LMJA 4U74A 5AQRB 2E5LT 2CXDA 5HEOA 1FJGT 1I94T 3UUBA 3M3ZB 2E9XD 2WAUA 4DUYT 4X1IE 1X79A 2LEHA 3DTOA 2XM2A 4H63V 2K3WA 4FI5A 2PBIA 4CI3B 1LDKA 1D0ZA 4TUYE 4WQOD 3ZN1B 2WY2A 4U3CA 4COFA 5CA0E 3ESLA 2PJQA 1FIOA 2JQKA 3BQKA 3EDVA 1AJ3A 1X9BA 3O4XE 1BR2A 4FJOA 2D0UA 5LYJE 4B3TT 3LDQB 4YTNA 4ASKA 1E7PA 1EZ3A 3ONXA 3PUGA 4YHJA 3Q5DA 1D1BA 1U6GA 4Z91A 1W0BA 3AE3A 3CPZA 4TWFA 2IUBA 2XQ4A 4TZ4C 2YN6A 5HCJA 5LBQB 4U33A 2LKGA 2N9DA 5L4HA 3RKOA 5HWYA 4UV9B 4QHOA 4NXNT 2D5UA 3UUMA 3KV6A 5LG4A 1J1JA 4MLKA 4QX8B 2UXXB 5L3GB 3D0TA 3MJXA 3N9QA 3BQLA 3FBLA 5F3JA 1BR4A 3PUAA 2W66A 3PTRB 4EB6E 3KVAA 5ABGA 3UUXB 4J2CA 3O9XA 2AXDS 5JRCA 2RPAA 1N36T 4UVCB 2ACZA 2XQ8A 5DJQC 4UF0A 3QK6A 1WYCA 4TNVA 5GONE 5CJ5A 4JI1T 3RC8A 4JI6T 5LA6E 2H7VC 4HFEA 5L3FB 4OHFA 1LVFA 4MFRA 3HL6A 3CX7B 1MNEA 3C64A 5HEUA 4BA9A 3PJAJ 1YD8G 3ANWB 1VCSA 2JJ9A 2YDQA 2WBLA 2BS3A 2EHOD 4ISSA 2DWGA 2KT9A 3V5SA 5ABHA 2LJLA 3EHZA 2H89A 1G8XA 5LGTB 2QYWA 3FXEB 1Y01A 4CN4A 3MACA 2WCAA 2ZM2A 3QB5A 4ZI2D 2W4XA 1G73A 1IAPA 2JPFA 5JDFA 5IUXA 3I0QA 4EZHA 3G06A 4LFBT 2RP4A 2YEVC 5HAXA 3P4WA 2NR4A 1WR0A 2CWYA 2FUPA 1E2AA 1UGOA 3FBZA 5AQFB 1M62A 1T72A 1XNRT 4DMVA 2IAKA 2K5BB 5AQQB 1FMVA 4P5OA 4P0BA 5LOVE 3AEEA 1OEDE 1VCTA 4NPPA 2F4VT 5LHGB 2BG9C 2YDSA 3HKDE 2V7MA 2DHRA 4CN1A 1W0AA 1SHZC 3I9WA 4M1PA 2C5KT 2NP9A 5AQMB 4DV2T 2LRLA 3MK7C 2XZEA 4A64A 4EEBA 4MBQA 4F52A 5AQJB 2C5JA 4UIGA 5AQOB 5LMUT 3GN5A 1HTJF 4YJ3E 4YSXA 3RTRA 2VB6A 4IDNA 2V26A 4AKIA 4TX5A 2XU0A 4K0KT 4X20E 3AXJB 3PUWF 3U78A 2JQ9A 1HX1B 5J1GA 4IE6A 5JDQA 2XSAA 4IDQA 4EZ4A 3P8CD 1LDJA 3PU8A 2HN2A 2VVSA 3N2GE 4KUMB 4CQIA 4MALA 5HEJA 3S4UA 4CXWA 1KFYA 2BBJA 3N9MA
chains in the Genus database with same CATH topology
5LJMA 3LBXA 4GK5E 3KV4A 3I9YA 4I4TE 5FXWA 2Q9QA 3CVRA 2GK9A 2OA5A 5CA1E 1US7B 2VL8A 1VOMA 3U3IA 1MMDA 2XQYA 5JR9A 3NBXX 5HXHA 3ZMUB 4H9SE 4OYKA 5HXCA 2V7KA 3TKLB 2W61A 4TV9E 2X66A 3F2EA 3Q5XA 3CQCB 2NWBA 2M67A 3FB2A 3N2OA 2X9YA 4HTEA 4QXHB 3F31A 4JLEA 4IE5A 5KX5E 3SWHA 2WMNA 2LE8A 4O2BE 3MXZA 5TAOA 4CI2B 2NOXA 3JC6D 4ZOLE 3I1AA 1BR1A 3A5XA 1YKEB 3HKBE 4P09A 3V5UA 4ZI3D 4AQGA 3N5LA 2LSJA 2MOZA 3P7IA 2XASB 2XUEA 4EXTA 3CX8B 3GMIA 5DABA 2ZMAA 2NW7A 4QWNB 2CMRA 2XAJB 3GN5B 2X0LB 4O4JE 2KZ7B 1D1CA 2XAFB 4HGAA 3W15B 3AVRA 2V7LA 2XTLA 3L3PA 4UELA 5JDMA 5AFUL 2KXPB 2DCFA 2LOPA 2K24A 2E8IA 4PW8A 3OJAA 3H37A 3NZQA 3OYXA 4GIWA 1QSDA 4H9RC 4DBQA 3E22E 1KNZA 2NW8A 2ACXA 3T8OA 3ETUA 2IW5B 3JC6C 2ODUA 2ZLYA 3PDYA 5FYMA 5LNKA 5L3EB 3HR0A 4H9PC 2A72A 1NAFA 3IF8B 3NZPA 4NUUA 4QKNA 5LJNA 3AA0B 1E1HB 2ES0A 1MIYA 4ILUA 4AQFC 4EOZB 3CQXC 2EHOB 3IHRA 4C90A 3KFWX 4CXYA 2LT3A 4OYJA 4Z8XA 4DVDA 4ADZA 5JDLA 1MIWA 3LBXB 4U74A 3ZYKA 2CXDA 3R6NA 2DLRA 1YKHB 2Q9QB 4CI1B 5L3CB 4ISTA 5LHIB 4BJMA 3B13A 1S94A 3ZCIA 4CZZB 3OYZA 2DWKA 3UUNA 3OBVE 4AKRB 2XAHB 5JR9B 4DMWA 5HXRA 2E9XD 1VRBA 3AA6B 4TV8E 3KVBA 4MHCA 4BJNA 2WAUA 3AAIA 5HWXA 3KV5A 4X1IE 3MA9A 1X79A 2LEHA 4PNIA 4PJMA 3DTOA 2XAGB 4WNKA 2YU2A 3J7Yq 4H63V 2LSKA 5LXTE 2IC6A 3C50A 3ZLIA 5J2TE 3EVYA 4FI5A 2L3LA 3ZMSB 2LM9A 2PBIA 3EUHA 4CI3B 5IYZE 1D0ZA 1Z0PA 4TUYE 3ZN1B 1LKXA 5EK4A 1UX4A 4L0RA 1S35A 5CA0E 2X9HA 2N2NA 3ESLA 3N9OA 3Q5WA 5DQWA 2H7OA 2PJQA 3C4WA 1FIOA 4HKAA 1FMWA 5JDNA 1UX5A 2Y48B 2VKOA 4PFOA 3BQKA 1HCIA 3EDVA 2L8KA 1AJ3A 3O4XE 3ZCJA 2IC9A 3RH3A 2W62A 1BR2A 4GOUA 4FJOA 2E9XC 3O1JA 2D0UA 5LYJE 3HA4A 2UXNB 4YLHA 3FHNA 4H9OC 4ZI7E 4UVAB 3UTKA 4H63H 4JEHB 4ASKA 1D1AA 1EZ3A 3ONXA 2C0SA 4H9QC 3PUGA 3QC9A 4HFVA 4YHJA 4IGUA 4O4IE 5JH7E 1HS7A 2QA7A 2VKHA 3I0OA 3ZMVB 5DQVA 3BK9A 1CUNA 1D1BA 4E7ZA 5H6RB 4YJ2E 3ANWA 5FP3A 2YK0A 5C8YE 3CPZA 4O4LE 2BDEA 4PK6A 2WSSV 3K8PC 2JMKA 1MMAA 3MKDA 3ZMTB 4AXPA 4IE0A 4TZ4C 4DO0A 2H3RA 3RYHE 2VWAA 4E7SA 3H3AA 5LBQB 4X1YE 3WAKA 2CCQA 4CXXA 2N9DA 5JVDE 3AAEB 1HFAA 3RKOA 4PJJA 1WR6A 4AQFA 2RA1A 1O3XA 5HWYA 3RC3A 4UV9B 2VKDA 3ZN0B 4QHOA 2N1GA 4A56A 2D5UA 5LGUB 1UCUA 3UUMA 3KV6A 3CWZB 5JR9C 4GK0E 4HEAA 4ANJA 3Q9DA 4AKLA 3UFEA 4HN9A 5LG4A 3MZKB 4MLKA 4IE4A 2P9BA 4PJNA 2UXXB 4QX8B 3SS1A 2MYSA 2JQQA 3RYFE 5JDHA 5L3GB 1BR0A 3WI3A 4AKGA 2ZM8A 3D0TA 3MJXA 4AKHA 4UVBB 2W0GA 2V7JA 3PUSA 3N9QA 3BQLA 2KMFA 4ZS3A 3FBLA 4JUYA 5F3JA 5KDMC 1BR4A 3PUAA 1OWAA 3C4XA 2NTXA 3CKDA 5LBMA 2WM9A 1D0XA 3PTRB 3GA8A 1MNDA 1LVKA 4G63A 2I59A 3VKHA 1IJ6A 2BVMA 4WBOA 1WLXA 4EB6E 5JDGA 3KVAA 4ZS2A 3VHLA 4OK0A 2CWOA 3UUXB 2NTYA 4J2CA 4QX7B 1SA0E 1OXZA 1ZHCA 5EK2A 4EAHA 3O9XA 3LK2B 5A1LA 5JRCA 1KK7A 3AAAB 3B57A 3ZPOA 2QGSA 4UVCB 3K3QC 1T98A 5JQGE 2CEAA 3IEEA 4V1Av 4H9NC 2V1DB 4AI6A 5DJQC 2VASA 4UF0A 2LSGA 3QK6A 1HF8A 3CX6B 4I55E 1WYCA 5GONE 4P0AA 2D2SA 5KMGP 2HPLA 5H6QB 3RC8A 2E9XA 2BZBA 4JEUB 5LA6E 2H7VC 3HKEE 4L5GA 2LSYA 5L3FB 3ZMZB 4OHFA 4DNDA 1LVFA 3AVSA 4MFRA 3HL6A 5IHYA 2W00A 3CX7B 1H7CA 2XAQB 3N9NA 1MNEA 3C64A 4BA9A 3LG7A 2LSIA 3LFMA 4PAGA 3ZYMA 1YD8G 3RX6A 3ANWB 4QXBB 3RRCA 4IDZA 3AA7B 4O2AE 3KBUA 2JJ9A 5LHHB 2WBLA 2EHOD 3BQIA 2DWGA 2A3DA 3IBPA 4ISSA 4L9IA 2KT9A 5E0OA 5ETWA 1HX8A 3V5SA 4ZHQE 2CM0A 5FNVE 2LJLA 2G0UA 2KLQA 3UULA 4EIWA 3LK42 2NW9A 2A2FX 3N9LA 3AB3B 3SRZA 3ZJ2A 1G8XA 2MBGA 4F6RC 1Y64B 5LGNB 3J9X1 5LGTB 1D0YA 2Q9QD 2YU1A 5HXSA 3FXEB 4IHJE 3ZC1A 1V9DA 3MACA 3RRWA 3PUQA 2ZM2A 2PG8A 3ZC0A 3UT5E 4KP3C 4ZI2D 5ADXL 1G73A 1U5PA 2X67A 2Y6XA 3L09A 5FY0A 4ERRA 1IAPA 2JPFA 5L2LA 3SOLA 3HKCE 4K0UA 2LOSA 5FY7A 2K9AA 2K48A 4KBMB 2X9XA 5JDFA 2V7IA 3KDSE 3NRYA 2KWIB 2W63A 5FMNA 4EYYR 3WAJA 1QUUA 5FXZA 2C5IT 3C98B 2X9WA 3I0QA 3N2KE 2CLYB 4EZHA 2RP4A 2YEVC 5HAXA 3AA1B 2CWYA 2CXLA 2EHOC 5JREA 3FXDB 1NWMX 1YW0A 3N9PA 2J1DG 4UEMA 5EZYE 3Q2MA 2SPCA 3FBZA 4HE8A 3PE0A 4OFZA 1HG2A 4IE7A 3GWHA 2Q9QC 4DBRA 2WWUA 5JRCB 3KV9A 3C4ZA 3E08A 4DMVA 1MMGA 2IAKA 3NRXA 4N78D 3ZEFB 3PURA 4ZI2C 2DNXA 2K5BB 3HI2A 1U4QA 2HH7A 3R84B 5M4YA 1FMVA 4WBNE 2MTQA 3E0ZA 3KINB 4UF0B 5BMVE 3LJCA 1WRDA 2YINA 5EK3A 4O8SA 3DJBA 4P0BA 4PK4A 2BVLA 5LOVE 3O1HA 4PJLA 2E9XB 4NUVA 3CQGB 4UV8B 3RPUA 1ZV4X 3LK3B 1MMNA 4U72A 5L3BB 2VKJA 4B6XA 3K3NA 5LHGB 3RYIE 3HKDE 4BAYB 2V7MA 3QUJA 5L3DB 2KWHA 2DHRA 1SHZC 3C51A 3ZJ1A 3M65A 3I9WA 4G2AA 4M1PA 2C5KT 2NP9A 2XHEB 4XZCA 4C91A 2JRKA 1FEWA 3MK7C 2PFVA 4ZI3C 2L9QA 4QXCB 1MIVA 2ODVA 2Z6EA 2Y8DA 4MBQA 3O1IA 4O4HE 2C5JA 4GYSA 3ZYLA 4UIGA 4YFSA 5LP6E 4XBFB 2D0TA 4PFPA 3GN5A 5HXEA 3EDUA 1HTJF 3VU7H 4YJ3E 5HYAA 2JMHA 1WYBA 4X1KE 4GYRA 2CXFA 1HG5A 4KMCA 4WW0A 2VB6A 2V26A 4AKIA 2X51A 2ZM0A 4TN7B 2X68A 3ETVA 4TX5A 5LCYA 2XU0A 1IJ5A 4X20E 2KINB 4I50E 2VK9A 2HPJA 2KNDA 4PK5A 3U78A 4UXNB 3F57A 2CE7A 2LHNA 5J1GA 1LRZA 2DI4A 4I43B 3CMLA 3VKGA 1IZNB 2CLYC 1ZKEA 4IE6A 5J2UE 4EYUA 2LHRA 5FY1A 5FXXA 5JDQA 3K3OA 2CA5A 4EZ4A 3P8CD 1ZEEA 3PU8A 3RYCE 2B1EA 4IIJE 2WMOA 3N2GE 4KUMB 4CQIA 4MALA 5FXVA 3PU3A 3S4UA 4CXWA 3DP7A 3KBTA 5F8PA 1B7TA 2EHOA 5CB4E 3N9MA 4XAXB 3OKQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPZ A;  2WAU A;  4YFS A;  3BQL A;  4NUV A;  2XU0 A;  3CML A;  4NUU A;  3BQI A;  3BQK A;  2YK0 A;  2Y8D A;  5F3J A;  3RRC A;  3C64 A; 
#chains in the Genus database with same CATH topology
 3AEG A;  4DV1 T;  5LJM A;  4LF6 T;  1NEK A;  3I9Y A;  4I4T E;  1M7K A;  2Q9Q A;  2GK9 A;  1US7 B;  1MMD A;  4ILA A;  3NBX X;  3AE6 A;  3ZMU B;  4OYK A;  1J5W A;  2W61 A;  4TV9 E;  2X66 A;  4AP2 B;  3F31 A;  2CPT A;  1HR0 T;  3RIF A;  3AEB A;  4X64 T;  1J5E T;  4I0U A;  3AE7 A;  4ZOL E;  3A5X A;  5HEG A;  3N5L A;  2LSJ A;  2MPK A;  3P7I A;  1OED A;  4NXM T;  2ZMA A;  1KNR A;  4O4J E;  2XAJ B;  4LF4 T;  3K1S A;  2KZ7 B;  3PUZ F;  2CBJ A;  3RGL A;  2DCF A;  4QH5 A;  2LOP A;  4OX9 T;  3ONJ A;  2E8I A;  4PW8 A;  3NZQ A;  3OYX A;  4GIW A;  4DBQ A;  2NW8 A;  2ACX A;  3ETU A;  2XY8 B;  2ODU A;  3PDY A;  5L3E B;  4H9P C;  1NAF A;  4QKN A;  2R6G F;  5LJN A;  1E1H B;  1MIY A;  4C90 A;  3KFW X;  5AQS B;  2LT3 A;  1Z8U A;  4U2Y A;  4GKK T;  3ZYK A;  3R6N A;  2J47 A;  5LHI B;  1W9R A;  1S94 A;  3B13 A;  4KX6 A;  3ZCI A;  2B76 A;  3OYZ A;  2WS3 A;  2UXC T;  3JAF A;  2WDV A;  5HXR A;  4BJN A;  4TV8 E;  4MHC A;  3MA9 A;  4PNI A;  4PJM A;  2LSK A;  2XQ7 A;  5J2T E;  3EVY A;  2L3L A;  2LM9 A;  1Z0P A;  5JTG A;  1LKX A;  2UUA T;  4L0R A;  2X9H A;  3P4S A;  2N2N A;  3N9O A;  3T1H T;  5DQW A;  2FJA A;  2H7O A;  5JDN A;  4ZZC A;  2VKO A;  2J62 A;  2IC9 A;  2E9X C;  3AE5 A;  3LSV A;  1IBM T;  3ZKR A;  3FHN A;  1D1A A;  4YTM A;  4H9Q C;  4O4I E;  5JH7 E;  5KXJ A;  3I0O A;  2WU2 A;  3NVO A;  3TLW A;  5DQV A;  1XWM A;  3ZMV B;  3BK9 A;  1CUN A;  3A7M A;  2YK0 A;  4PK6 A;  2FJB A;  3MKD A;  4AXP A;  1CHU A;  2FBW A;  1IBK T;  3RYH E;  2CCQ A;  3TLT A;  5JVD E;  3AAE B;  5HEH A;  3RC3 A;  2VKD A;  3ZN0 B;  4DV6 T;  1XZY A;  2N1G A;  2ZM6 T;  4N9F 3;  5LGU B;  1UCU A;  4HEA A;  4ANJ A;  3Q9D A;  4HN9 A;  3MZK B;  4IE4 A;  4PJN A;  2MYS A;  3RYF E;  1BR0 A;  2W0G A;  2KMF A;  4DV7 T;  1LDK B;  1OWA A;  3C4X A;  2NTX A;  3CKD A;  4U2Z A;  5CGM A;  4EGW A;  4LF5 T;  2I59 A;  2BKP A;  3AE1 A;  1WLX A;  3VHL A;  4OK0 A;  2NTY A;  4QX7 B;  1KK7 A;  3AAA B;  4YHH T;  4JI3 T;  3IEE A;  4APF B;  4H9N C;  2V1D B;  4AI6 A;  2V6Y A;  2LSG A;  2CHN A;  1HF8 A;  5KMG P;  5H6Q B;  1YQ4 A;  4HWF A;  2BZB A;  4JEU B;  3HKE E;  4L5G A;  4DND A;  3DQV C;  3AVS A;  4QH1 A;  4IRE A;  2W00 A;  3LFM A;  2LSI A;  4LML A;  5LMN T;  3RRC A;  3ABV A;  1HNW T;  3AA7 B;  3KBU A;  2M6B A;  5LHH B;  5L4E A;  4DID B;  1HX8 A;  5IWA T;  2G0U A;  2KLQ A;  3SFD A;  4EIW A;  3LK4 2;  3N9L A;  3ZJ2 A;  1Y64 B;  2JIW A;  2YU1 A;  4IHJ E;  1JNR A;  3ZC0 A;  5FY0 A;  3AE4 A;  3SOL A;  3EI0 A;  5FY7 A;  4KBM B;  5FMN A;  3RIA A;  2KWI B;  2W63 A;  3WAJ A;  2C5I T;  3C98 B;  2XQ3 A;  1T7S A;  2CLY B;  3AA1 B;  5JRE A;  2EHO C;  1NWM X;  4UEM A;  2XQA A;  2SPC A;  3PUV F;  4DBR A;  5JRC B;  3KV9 A;  3E08 A;  4ZI2 C;  2DNX A;  3HI2 A;  1U4Q A;  2HH7 A;  3L39 A;  4WBN E;  4UF0 B;  3VR8 A;  1WRD A;  2BG9 E;  2YIN A;  3UQ7 A;  4HFI A;  5EK3 A;  4PK4 A;  2XPK A;  4YXD A;  4PJL A;  4NUV A;  3CQG B;  3CIR A;  3LK3 B;  3NKZ A;  4U72 A;  5BR8 T;  4DV5 T;  2WB5 A;  3RYI E;  2WZH A;  4BAY B;  3QUJ A;  3C51 A;  4G2A A;  4YSZ A;  3FZH B;  4DR1 T;  3QB5 K;  3H3M A;  4QXC B;  3P4R A;  5HCM A;  3JAE A;  5LB7 B;  3O1I A;  5LP6 E;  4X66 T;  2QVA A;  3VU7 H;  5HYA A;  1SE7 A;  1HG5 A;  2X51 A;  3P50 A;  3X1D A;  4KHZ F;  4UXN B;  2CE7 A;  4DR7 T;  5ABF A;  4LFC T;  1LRZ A;  4I43 B;  3CML A;  2CLY C;  5J2U E;  3K3O A;  2CA5 A;  2XM1 A;  4IIJ E;  2WMO A;  1DU2 A;  4IDP A;  3DP7 A;  4Z90 A;  1XMQ T;  3LBX A;  4GK5 E;  2XQ5 A;  5FXW A;  3CVR A;  1XDO A;  4HXI B;  4DR5 T;  1VOM A;  3U3I A;  3VRB A;  5JR9 A;  5AQP B;  4IL4 A;  3TKL B;  4A98 A;  3Q5X A;  2NWB A;  4WZX A;  3TLS A;  4JI0 T;  2XSB A;  3RQU A;  3JC6 D;  3I1A A;  2BG9 A;  4P09 A;  2X0Y A;  4AQG A;  2MOZ A;  4JI2 T;  2XUE A;  3EAB A;  3GN5 B;  2X0L B;  1D1C A;  2XAF B;  4HGA A;  3T1Y T;  2LRK A;  3AVR A;  2XTL A;  3L3P A;  4UEL A;  2MAW A;  3ZT7 A;  2KXP B;  1HNZ T;  2BBH A;  1QSD A;  3RLF F;  2XQ9 A;  4JYA T;  4GKJ T;  2UXD T;  2VL0 A;  3TLV A;  3NZP A;  3AA0 B;  1N32 T;  4AQF C;  5AQT B;  3CQX C;  2E2A A;  1I6Z A;  4IDO A;  2DLR A;  1YKH B;  4U7I A;  2Q9Q B;  4DR2 T;  4CI1 B;  5L3C B;  4IST A;  4BJM A;  4KHP T;  3ZT6 A;  4CZZ B;  2XAH B;  3UU5 A;  4DMW A;  3AA6 B;  3UFG A;  2YU2 A;  2BS4 A;  3C50 A;  4DUZ T;  3EUH A;  4HWH A;  5FL0 A;  3PV0 F;  5EK4 A;  1S35 A;  4DV4 T;  1UUS A;  3Q5W A;  3SFE A;  1OED B;  3C4W A;  4HKA A;  1UX5 A;  2Y48 B;  1HCI A;  5F5W A;  4Q25 A;  3ZCJ A;  2YKS A;  2XJ7 A;  4YLH A;  2V5D A;  4LFA T;  4ZI7 E;  3UTK A;  4YSY A;  4H63 H;  4JEH B;  2C0S A;  3RKG A;  4DV3 T;  1YXR A;  1HS7 A;  2VKH A;  4E7Z A;  5H6R B;  5C8Y E;  2BDE A;  2WSS V;  2IHR 1;  4DO0 A;  2H3R A;  3WAK A;  4CXX A;  1WR6 A;  1O3X A;  3UU4 A;  3VRA A;  1XMO T;  4AKL A;  1ZP0 A;  4YTP A;  2IIU A;  2P9B A;  3WI3 A;  4KI0 F;  3TLU A;  3PUS A;  5C2T A;  1WFD A;  4ZS3 A;  2IDO B;  4JUY A;  4X5T A;  5KDM C;  3RIU C;  2E5V A;  5LBM A;  1D0X A;  3GA8 A;  1MND A;  3VKH A;  1IJ6 A;  4ZS2 A;  2CWO A;  2CRB A;  5J0Z A;  1SA0 E;  1OXZ A;  1OED C;  1ZHC A;  5EK2 A;  4EAH A;  3LK2 B;  5A1L A;  2WDR A;  3ZPO A;  3B57 A;  2BKN A;  3K3Q C;  1T98 A;  5JQG E;  2VAS A;  4I55 E;  2D2S A;  2FJE A;  2HPL A;  2E9X A;  4EED A;  3UQ4 A;  5IHY A;  1H7C A;  4B3S T;  4PAG A;  3CK6 A;  2QRX A;  3RX6 A;  4QXB B;  4IDZ A;  2H88 A;  3BQI A;  2A3D A;  3P4Q A;  5FNV E;  3UUL A;  2NW9 A;  2A2F X;  5AQL B;  3SRZ A;  2MBG A;  2Q9Q D;  5HXS A;  3RQW A;  3ZC1 A;  3VR9 A;  1V9D A;  3RRW A;  3PUQ A;  2PG8 A;  3UT5 E;  5AQN B;  1U5P A;  2Y6X A;  4ERR A;  5L2L A;  2LOS A;  3NRY A;  4EYY R;  5FXZ A;  2X9W A;  4IL9 A;  4YY3 T;  4TNW A;  3JAD A;  2CXL A;  4EV6 A;  3FXD B;  5AQK B;  3PUX F;  1YW0 A;  2PTF A;  5EZY E;  4ZZB A;  4HE8 A;  4OFZ A;  3PE0 A;  4IE7 A;  2WWU A;  3C4Z A;  4WYV A;  3R84 B;  5M4Y A;  2MTQ A;  3KIN B;  2V6Y B;  5ABE A;  2XQ6 A;  2BVL A;  3O1H A;  4UV8 B;  1ZV4 X;  4IT4 A;  3K3N A;  3AED A;  3ONL C;  5L3D B;  2KWH A;  3ZJ1 A;  4C91 A;  4QH4 A;  2PFV A;  3OPC A;  4ZI3 C;  2L9Q A;  1MIV A;  2ODV A;  1IBL T;  4O4H E;  4GYS A;  4YFS A;  4XBF B;  4AQY T;  4PFP A;  4X1K E;  2CHO A;  4TN7 B;  2X68 A;  3ETV A;  5LCY A;  4I50 E;  1UUR A;  1XDP A;  2LHN A;  3ZT5 A;  3VKG A;  5FXX A;  5FXV A;  3PU3 A;  5F8P A;  2EHO A;  5CB4 E;  4XAX B;  5FVK A;  2VL8 A;  3AE9 A;  2VUR A;  2V7K A;  3FB2 A;  3N2O A;  4HTE A;  4JLE A;  4IE5 A;  5KX5 E;  3SWH A;  5AQU B;  5TAO A;  4CI2 B;  4JBW F;  4JI4 T;  3HKB E;  1N34 T;  2BS2 A;  4ZI3 D;  2YDR A;  2XAS B;  3CX8 B;  3GMI A;  2D9D A;  2NW7 A;  4QWN B;  2V7L A;  4B3R T;  2VVN A;  4HFD A;  5JDM A;  4F8H A;  5AFU L;  2K24 A;  4LF8 T;  3OJA A;  3H37 A;  3OTO T;  2FJD A;  5ABF B;  1KNZ A;  3JC6 C;  2ZLY A;  5LNK A;  4NIQ A;  4A5X A;  4HWI B;  5FKY A;  3HR0 A;  3UU6 A;  1NEN A;  1T8B A;  4ILU A;  4CXY A;  4DVD A;  5JDL A;  1MIW A;  3LBX B;  2M6I A;  3UUN A;  2DWK A;  4AKR B;  3OBV E;  5JR9 B;  3DPL C;  2WDQ A;  2HHH T;  1VRB A;  3KVB A;  3AAI A;  4A97 A;  5HWX A;  3KV5 A;  2XAG B;  4WNK A;  2WU5 A;  3J7Y q;  5LXT E;  2IC6 A;  3ZLI A;  2OLT A;  3ZMS B;  5IYZ E;  2VQE T;  2BG9 B;  1UX4 A;  1XNQ T;  1N33 T;  1FMW A;  4HFC A;  3RI5 A;  4PFO A;  2L8K A;  5FVL A;  3RH3 A;  2W62 A;  4DR4 T;  4GOU A;  4ILB A;  3O1J A;  3HA4 A;  2UXN B;  4H9O C;  4UVA B;  4HFB A;  4HFV A;  3QC9 A;  1KNP A;  3QNU A;  4IGU A;  2QA7 A;  4YJ2 E;  3ANW A;  5FP3 A;  4O4L E;  3K8P C;  2JMK A;  1MMA A;  3ZMT B;  4IE0 A;  3FZF B;  2VWA A;  1KEY A;  4CN6 A;  4E7S A;  3H3A A;  3AEC A;  4X1Y E;  2KSR A;  1HFA A;  4PJJ A;  4ILC A;  4AQF A;  4B3M T;  2RA1 A;  3AE8 A;  4A56 A;  3CWZ B;  5JR9 C;  4GK0 E;  4U31 A;  3UFE A;  2WP9 A;  5JDH A;  3SS1 A;  4AKG A;  2JQQ A;  2ZM8 A;  4AKH A;  4UVB B;  4LF9 T;  2V7J A;  3IA3 A;  2WM9 A;  3L8R A;  1LVK A;  4G63 A;  4WBO A;  2BVM A;  5JDG A;  4ZEY A;  4U7Y A;  1ZOY A;  5FL1 A;  3PJA A;  4AIS A;  2QGS A;  3RF1 A;  3ZSS A;  2CEA A;  2UU9 T;  4V1A v;  3CX6 B;  4P0A A;  5CFB A;  3NWI A;  2LSY A;  3ZMZ B;  3PUY F;  2VQF T;  2XAQ B;  3N9N A;  2BKO A;  3LG7 A;  3ZYM A;  3Q5E A;  4O2A E;  1L0V A;  1QLB A;  3AEF A;  4DV0 T;  5ETW A;  3IBP A;  4L9I A;  5AQH B;  5E0O A;  4ZHQ E;  2LM2 A;  2CM0 A;  3A8Y C;  5LG3 A;  3AB3 B;  3QOF A;  4F6R C;  5LGN B;  3J9X 1;  1D0Y A;  2DL1 A;  4KP3 C;  5ADX L;  3L09 A;  2X67 A;  2LLY A;  2UXB T;  3HKC E;  4K0U A;  4ZXL A;  2K9A A;  2K48 A;  2X9X A;  2V7I A;  3AXJ A;  3KDS E;  1KF6 A;  3AEA A;  4JI7 T;  1QUU A;  3N2K E;  4HFH A;  3UU3 A;  2OV9 A;  1SUM B;  2HN1 A;  3N9P A;  2J1D G;  2WWV A;  3RIU A;  5AQG B;  2X0H A;  3Q2M A;  4AIU A;  1HG2 A;  2W67 A;  4JI8 T;  5AQV B;  3GWH A;  2Q9Q C;  3FZK B;  1MMG A;  3NRX A;  4N78 D;  3ZEF B;  3PUR A;  4X62 T;  2AE9 A;  2I6H A;  3E0Z A;  5BMV E;  3LJC A;  1YQ3 A;  4O8S A;  3DJB A;  3AE2 A;  4UR9 A;  5C3J A;  4DR6 T;  2E9X B;  3RPU A;  1MMN A;  5L3B B;  2VKJ A;  3EAM A;  4B6X A;  2JQH A;  3M65 A;  5AQI B;  4LF7 T;  2XHE B;  4XZC A;  1HNX T;  2JRK A;  1FEW A;  2W2U A;  2Z6E A;  2Y8D A;  3ZYL A;  2D0T A;  5HXE A;  3EDU A;  2A9U A;  2JMH A;  3B5M A;  1WYB A;  3P4P A;  4GYR A;  2CXF A;  4KMC A;  4WW0 A;  3OVU A;  4YT0 A;  2ZM0 A;  4JGH D;  1IJ5 A;  2YOE A;  3JCF A;  1W09 A;  2KIN B;  2VK9 A;  2HPJ A;  2KND A;  4PK5 A;  3F57 A;  3FZM B;  2DI4 A;  1IZN B;  1ZKE A;  1WCR A;  4EYU A;  2LHR A;  5FY1 A;  4P1N A;  1ZEE A;  3RYC E;  2B1E A;  1GQE A;  2CBI A;  3KBT A;  1B7T A;  1UK5 A;  2WZI A;  3RHW A;  3OKQ A;  3KV4 A;  2V6X A;  2OA5 A;  5CA1 E;  2XQY A;  5HXH A;  4H9S E;  5HXC A;  4HWC A;  2I0M A;  4DR3 T;  3F2E A;  3CQC B;  2M67 A;  2X9Y A;  4QXH B;  3UU8 A;  2WMN A;  2LE8 A;  4O2B E;  3MXZ A;  2NOX A;  5L47 A;  1BR1 A;  4TWD A;  2UUB T;  1YKE B;  4TWH A;  3V5U A;  4EXT A;  4JI5 T;  2WQY A;  3ZST A;  1R8I A;  5DAB A;  2WZK A;  2CMR A;  4HWD A;  3W15 B;  2V8S V;  4X65 T;  4H9R C;  3E22 E;  3T8O A;  2IW5 B;  2UUC T;  5FYM A;  2LKH A;  4LMK A;  4JV5 T;  2J4G A;  1JNZ A;  2A72 A;  3IF8 B;  4NUU A;  2ES0 A;  4EOZ B;  2IML A;  2EHO B;  3IHR A;  3FZL B;  4OYJ A;  4Z8X A;  2V5C A;  4ADZ A;  4LMJ A;  4U74 A;  5AQR B;  2E5L T;  2CXD A;  5HEO A;  1FJG T;  1I94 T;  3UUB A;  3M3Z B;  2E9X D;  2WAU A;  4DUY T;  4X1I E;  1X79 A;  2LEH A;  3DTO A;  2XM2 A;  4H63 V;  2K3W A;  4FI5 A;  2PBI A;  4CI3 B;  1LDK A;  1D0Z A;  4TUY E;  4WQO D;  3ZN1 B;  2WY2 A;  4U3C A;  4COF A;  5CA0 E;  3ESL A;  2PJQ A;  1FIO A;  2JQK A;  3BQK A;  3EDV A;  1AJ3 A;  1X9B A;  3O4X E;  1BR2 A;  4FJO A;  2D0U A;  5LYJ E;  4B3T T;  3LDQ B;  4YTN A;  4ASK A;  1E7P A;  1EZ3 A;  3ONX A;  3PUG A;  4YHJ A;  3Q5D A;  1D1B A;  1U6G A;  4Z91 A;  1W0B A;  3AE3 A;  3CPZ A;  4TWF A;  2IUB A;  2XQ4 A;  4TZ4 C;  2YN6 A;  5HCJ A;  5LBQ B;  4U33 A;  2LKG A;  2N9D A;  5L4H A;  3RKO A;  5HWY A;  4UV9 B;  4QHO A;  4NXN T;  2D5U A;  3UUM A;  3KV6 A;  5LG4 A;  1J1J A;  4MLK A;  4QX8 B;  2UXX B;  5L3G B;  3D0T A;  3MJX A;  3N9Q A;  3BQL A;  3FBL A;  5F3J A;  1BR4 A;  3PUA A;  2W66 A;  3PTR B;  4EB6 E;  3KVA A;  5ABG A;  3UUX B;  4J2C A;  3O9X A;  2AXD S;  5JRC A;  2RPA A;  1N36 T;  4UVC B;  2ACZ A;  2XQ8 A;  5DJQ C;  4UF0 A;  3QK6 A;  1WYC A;  4TNV A;  5GON E;  5CJ5 A;  4JI1 T;  3RC8 A;  4JI6 T;  5LA6 E;  2H7V C;  4HFE A;  5L3F B;  4OHF A;  1LVF A;  4MFR A;  3HL6 A;  3CX7 B;  1MNE A;  3C64 A;  5HEU A;  4BA9 A;  3PJA J;  1YD8 G;  3ANW B;  1VCS A;  2JJ9 A;  2YDQ A;  2WBL A;  2BS3 A;  2EHO D;  4ISS A;  2DWG A;  2KT9 A;  3V5S A;  5ABH A;  2LJL A;  3EHZ A;  2H89 A;  1G8X A;  5LGT B;  2QYW A;  3FXE B;  1Y01 A;  4CN4 A;  3MAC A;  2WCA A;  2ZM2 A;  3QB5 A;  4ZI2 D;  2W4X A;  1G73 A;  1IAP A;  2JPF A;  5JDF A;  5IUX A;  3I0Q A;  4EZH A;  3G06 A;  4LFB T;  2RP4 A;  2YEV C;  5HAX A;  3P4W A;  2NR4 A;  1WR0 A;  2CWY A;  2FUP A;  1E2A A;  1UGO A;  3FBZ A;  5AQF B;  1M62 A;  1T72 A;  1XNR T;  4DMV A;  2IAK A;  2K5B B;  5AQQ B;  1FMV A;  4P5O A;  4P0B A;  5LOV E;  3AEE A;  1OED E;  1VCT A;  4NPP A;  2F4V T;  5LHG B;  2BG9 C;  2YDS A;  3HKD E;  2V7M A;  2DHR A;  4CN1 A;  1W0A A;  1SHZ C;  3I9W A;  4M1P A;  2C5K T;  2NP9 A;  5AQM B;  4DV2 T;  2LRL A;  3MK7 C;  2XZE A;  4A64 A;  4EEB A;  4MBQ A;  4F52 A;  5AQJ B;  2C5J A;  4UIG A;  5AQO B;  5LMU T;  3GN5 A;  1HTJ F;  4YJ3 E;  4YSX A;  3RTR A;  2VB6 A;  4IDN A;  2V26 A;  4AKI A;  4TX5 A;  2XU0 A;  4K0K T;  4X20 E;  3AXJ B;  3PUW F;  3U78 A;  2JQ9 A;  1HX1 B;  5J1G A;  4IE6 A;  5JDQ A;  2XSA A;  4IDQ A;  4EZ4 A;  3P8C D;  1LDJ A;  3PU8 A;  2HN2 A;  2VVS A;  3N2G E;  4KUM B;  4CQI A;  4MAL A;  5HEJ A;  3S4U A;  4CXW A;  1KFY A;  2BBJ A;  3N9M A; 
#chains in the Genus database with same CATH homology
 5LJM A;  3LBX A;  4GK5 E;  3KV4 A;  3I9Y A;  4I4T E;  5FXW A;  2Q9Q A;  3CVR A;  2GK9 A;  2OA5 A;  5CA1 E;  1US7 B;  2VL8 A;  1VOM A;  3U3I A;  1MMD A;  2XQY A;  5JR9 A;  3NBX X;  5HXH A;  3ZMU B;  4H9S E;  4OYK A;  5HXC A;  2V7K A;  3TKL B;  2W61 A;  4TV9 E;  2X66 A;  3F2E A;  3Q5X A;  3CQC B;  2NWB A;  2M67 A;  3FB2 A;  3N2O A;  2X9Y A;  4HTE A;  4QXH B;  3F31 A;  4JLE A;  4IE5 A;  5KX5 E;  3SWH A;  2WMN A;  2LE8 A;  4O2B E;  3MXZ A;  5TAO A;  4CI2 B;  2NOX A;  3JC6 D;  4ZOL E;  3I1A A;  1BR1 A;  3A5X A;  1YKE B;  3HKB E;  4P09 A;  3V5U A;  4ZI3 D;  4AQG A;  3N5L A;  2LSJ A;  2MOZ A;  3P7I A;  2XAS B;  2XUE A;  4EXT A;  3CX8 B;  3GMI A;  5DAB A;  2ZMA A;  2NW7 A;  4QWN B;  2CMR A;  2XAJ B;  3GN5 B;  2X0L B;  4O4J E;  2KZ7 B;  1D1C A;  2XAF B;  4HGA A;  3W15 B;  3AVR A;  2V7L A;  2XTL A;  3L3P A;  4UEL A;  5JDM A;  5AFU L;  2KXP B;  2DCF A;  2LOP A;  2K24 A;  2E8I A;  4PW8 A;  3OJA A;  3H37 A;  3NZQ A;  3OYX A;  4GIW A;  1QSD A;  4H9R C;  4DBQ A;  3E22 E;  1KNZ A;  2NW8 A;  2ACX A;  3T8O A;  3ETU A;  2IW5 B;  3JC6 C;  2ODU A;  2ZLY A;  3PDY A;  5FYM A;  5LNK A;  5L3E B;  3HR0 A;  4H9P C;  2A72 A;  1NAF A;  3IF8 B;  3NZP A;  4NUU A;  4QKN A;  5LJN A;  3AA0 B;  1E1H B;  2ES0 A;  1MIY A;  4ILU A;  4AQF C;  4EOZ B;  3CQX C;  2EHO B;  3IHR A;  4C90 A;  3KFW X;  4CXY A;  2LT3 A;  4OYJ A;  4Z8X A;  4DVD A;  4ADZ A;  5JDL A;  1MIW A;  3LBX B;  4U74 A;  3ZYK A;  2CXD A;  3R6N A;  2DLR A;  1YKH B;  2Q9Q B;  4CI1 B;  5L3C B;  4IST A;  5LHI B;  4BJM A;  3B13 A;  1S94 A;  3ZCI A;  4CZZ B;  3OYZ A;  2DWK A;  3UUN A;  3OBV E;  4AKR B;  2XAH B;  5JR9 B;  4DMW A;  5HXR A;  2E9X D;  1VRB A;  3AA6 B;  4TV8 E;  3KVB A;  4MHC A;  4BJN A;  2WAU A;  3AAI A;  5HWX A;  3KV5 A;  4X1I E;  3MA9 A;  1X79 A;  2LEH A;  4PNI A;  4PJM A;  3DTO A;  2XAG B;  4WNK A;  2YU2 A;  3J7Y q;  4H63 V;  2LSK A;  5LXT E;  2IC6 A;  3C50 A;  3ZLI A;  5J2T E;  3EVY A;  4FI5 A;  2L3L A;  3ZMS B;  2LM9 A;  2PBI A;  3EUH A;  4CI3 B;  5IYZ E;  1D0Z A;  1Z0P A;  4TUY E;  3ZN1 B;  1LKX A;  5EK4 A;  1UX4 A;  4L0R A;  1S35 A;  5CA0 E;  2X9H A;  2N2N A;  3ESL A;  3N9O A;  3Q5W A;  5DQW A;  2H7O A;  2PJQ A;  3C4W A;  1FIO A;  4HKA A;  1FMW A;  5JDN A;  1UX5 A;  2Y48 B;  2VKO A;  4PFO A;  3BQK A;  1HCI A;  3EDV A;  2L8K A;  1AJ3 A;  3O4X E;  3ZCJ A;  2IC9 A;  3RH3 A;  2W62 A;  1BR2 A;  4GOU A;  4FJO A;  2E9X C;  3O1J A;  2D0U A;  5LYJ E;  3HA4 A;  2UXN B;  4YLH A;  3FHN A;  4H9O C;  4ZI7 E;  4UVA B;  3UTK A;  4H63 H;  4JEH B;  4ASK A;  1D1A A;  1EZ3 A;  3ONX A;  2C0S A;  4H9Q C;  3PUG A;  3QC9 A;  4HFV A;  4YHJ A;  4IGU A;  4O4I E;  5JH7 E;  1HS7 A;  2QA7 A;  2VKH A;  3I0O A;  3ZMV B;  5DQV A;  3BK9 A;  1CUN A;  1D1B A;  4E7Z A;  5H6R B;  4YJ2 E;  3ANW A;  5FP3 A;  2YK0 A;  5C8Y E;  3CPZ A;  4O4L E;  2BDE A;  4PK6 A;  2WSS V;  3K8P C;  2JMK A;  1MMA A;  3MKD A;  3ZMT B;  4AXP A;  4IE0 A;  4TZ4 C;  4DO0 A;  2H3R A;  3RYH E;  2VWA A;  4E7S A;  3H3A A;  5LBQ B;  4X1Y E;  3WAK A;  2CCQ A;  4CXX A;  2N9D A;  5JVD E;  3AAE B;  1HFA A;  3RKO A;  4PJJ A;  1WR6 A;  4AQF A;  2RA1 A;  1O3X A;  5HWY A;  3RC3 A;  4UV9 B;  2VKD A;  3ZN0 B;  4QHO A;  2N1G A;  4A56 A;  2D5U A;  5LGU B;  1UCU A;  3UUM A;  3KV6 A;  3CWZ B;  5JR9 C;  4GK0 E;  4HEA A;  4ANJ A;  3Q9D A;  4AKL A;  3UFE A;  4HN9 A;  5LG4 A;  3MZK B;  4MLK A;  4IE4 A;  2P9B A;  4PJN A;  2UXX B;  4QX8 B;  3SS1 A;  2MYS A;  2JQQ A;  3RYF E;  5JDH A;  5L3G B;  1BR0 A;  3WI3 A;  4AKG A;  2ZM8 A;  3D0T A;  3MJX A;  4AKH A;  4UVB B;  2W0G A;  2V7J A;  3PUS A;  3N9Q A;  3BQL A;  2KMF A;  4ZS3 A;  3FBL A;  4JUY A;  5F3J A;  5KDM C;  1BR4 A;  3PUA A;  1OWA A;  3C4X A;  2NTX A;  3CKD A;  5LBM A;  2WM9 A;  1D0X A;  3PTR B;  3GA8 A;  1MND A;  1LVK A;  4G63 A;  2I59 A;  3VKH A;  1IJ6 A;  2BVM A;  4WBO A;  1WLX A;  4EB6 E;  5JDG A;  3KVA A;  4ZS2 A;  3VHL A;  4OK0 A;  2CWO A;  3UUX B;  2NTY A;  4J2C A;  4QX7 B;  1SA0 E;  1OXZ A;  1ZHC A;  5EK2 A;  4EAH A;  3O9X A;  3LK2 B;  5A1L A;  5JRC A;  1KK7 A;  3AAA B;  3B57 A;  3ZPO A;  2QGS A;  4UVC B;  3K3Q C;  1T98 A;  5JQG E;  2CEA A;  3IEE A;  4V1A v;  4H9N C;  2V1D B;  4AI6 A;  5DJQ C;  2VAS A;  4UF0 A;  2LSG A;  3QK6 A;  1HF8 A;  3CX6 B;  4I55 E;  1WYC A;  5GON E;  4P0A A;  2D2S A;  5KMG P;  2HPL A;  5H6Q B;  3RC8 A;  2E9X A;  2BZB A;  4JEU B;  5LA6 E;  2H7V C;  3HKE E;  4L5G A;  2LSY A;  5L3F B;  3ZMZ B;  4OHF A;  4DND A;  1LVF A;  3AVS A;  4MFR A;  3HL6 A;  5IHY A;  2W00 A;  3CX7 B;  1H7C A;  2XAQ B;  3N9N A;  1MNE A;  3C64 A;  4BA9 A;  3LG7 A;  2LSI A;  3LFM A;  4PAG A;  3ZYM A;  1YD8 G;  3RX6 A;  3ANW B;  4QXB B;  3RRC A;  4IDZ A;  3AA7 B;  4O2A E;  3KBU A;  2JJ9 A;  5LHH B;  2WBL A;  2EHO D;  3BQI A;  2DWG A;  2A3D A;  3IBP A;  4ISS A;  4L9I A;  2KT9 A;  5E0O A;  5ETW A;  1HX8 A;  3V5S A;  4ZHQ E;  2CM0 A;  5FNV E;  2LJL A;  2G0U A;  2KLQ A;  3UUL A;  4EIW A;  3LK4 2;  2NW9 A;  2A2F X;  3N9L A;  3AB3 B;  3SRZ A;  3ZJ2 A;  1G8X A;  2MBG A;  4F6R C;  1Y64 B;  5LGN B;  3J9X 1;  5LGT B;  1D0Y A;  2Q9Q D;  2YU1 A;  5HXS A;  3FXE B;  4IHJ E;  3ZC1 A;  1V9D A;  3MAC A;  3RRW A;  3PUQ A;  2ZM2 A;  2PG8 A;  3ZC0 A;  3UT5 E;  4KP3 C;  4ZI2 D;  5ADX L;  1G73 A;  1U5P A;  2X67 A;  2Y6X A;  3L09 A;  5FY0 A;  4ERR A;  1IAP A;  2JPF A;  5L2L A;  3SOL A;  3HKC E;  4K0U A;  2LOS A;  5FY7 A;  2K9A A;  2K48 A;  4KBM B;  2X9X A;  5JDF A;  2V7I A;  3KDS E;  3NRY A;  2KWI B;  2W63 A;  5FMN A;  4EYY R;  3WAJ A;  1QUU A;  5FXZ A;  2C5I T;  3C98 B;  2X9W A;  3I0Q A;  3N2K E;  2CLY B;  4EZH A;  2RP4 A;  2YEV C;  5HAX A;  3AA1 B;  2CWY A;  2CXL A;  2EHO C;  5JRE A;  3FXD B;  1NWM X;  1YW0 A;  3N9P A;  2J1D G;  4UEM A;  5EZY E;  3Q2M A;  2SPC A;  3FBZ A;  4HE8 A;  3PE0 A;  4OFZ A;  1HG2 A;  4IE7 A;  3GWH A;  2Q9Q C;  4DBR A;  2WWU A;  5JRC B;  3KV9 A;  3C4Z A;  3E08 A;  4DMV A;  1MMG A;  2IAK A;  3NRX A;  4N78 D;  3ZEF B;  3PUR A;  4ZI2 C;  2DNX A;  2K5B B;  3HI2 A;  1U4Q A;  2HH7 A;  3R84 B;  5M4Y A;  1FMV A;  4WBN E;  2MTQ A;  3E0Z A;  3KIN B;  4UF0 B;  5BMV E;  3LJC A;  1WRD A;  2YIN A;  5EK3 A;  4O8S A;  3DJB A;  4P0B A;  4PK4 A;  2BVL A;  5LOV E;  3O1H A;  4PJL A;  2E9X B;  4NUV A;  3CQG B;  4UV8 B;  3RPU A;  1ZV4 X;  3LK3 B;  1MMN A;  4U72 A;  5L3B B;  2VKJ A;  4B6X A;  3K3N A;  5LHG B;  3RYI E;  3HKD E;  4BAY B;  2V7M A;  3QUJ A;  5L3D B;  2KWH A;  2DHR A;  1SHZ C;  3C51 A;  3ZJ1 A;  3M65 A;  3I9W A;  4G2A A;  4M1P A;  2C5K T;  2NP9 A;  2XHE B;  4XZC A;  4C91 A;  2JRK A;  1FEW A;  3MK7 C;  2PFV A;  4ZI3 C;  2L9Q A;  4QXC B;  1MIV A;  2ODV A;  2Z6E A;  2Y8D A;  4MBQ A;  3O1I A;  4O4H E;  2C5J A;  4GYS A;  3ZYL A;  4UIG A;  4YFS A;  5LP6 E;  4XBF B;  2D0T A;  4PFP A;  3GN5 A;  5HXE A;  3EDU A;  1HTJ F;  3VU7 H;  4YJ3 E;  5HYA A;  2JMH A;  1WYB A;  4X1K E;  4GYR A;  2CXF A;  1HG5 A;  4KMC A;  4WW0 A;  2VB6 A;  2V26 A;  4AKI A;  2X51 A;  2ZM0 A;  4TN7 B;  2X68 A;  3ETV A;  4TX5 A;  5LCY A;  2XU0 A;  1IJ5 A;  4X20 E;  2KIN B;  4I50 E;  2VK9 A;  2HPJ A;  2KND A;  4PK5 A;  3U78 A;  4UXN B;  3F57 A;  2CE7 A;  2LHN A;  5J1G A;  1LRZ A;  2DI4 A;  4I43 B;  3CML A;  3VKG A;  1IZN B;  2CLY C;  1ZKE A;  4IE6 A;  5J2U E;  4EYU A;  2LHR A;  5FY1 A;  5FXX A;  5JDQ A;  3K3O A;  2CA5 A;  4EZ4 A;  3P8C D;  1ZEE A;  3PU8 A;  3RYC E;  2B1E A;  4IIJ E;  2WMO A;  3N2G E;  4KUM B;  4CQI A;  4MAL A;  5FXV A;  3PU3 A;  3S4U A;  4CXW A;  3DP7 A;  3KBT A;  5F8P A;  1B7T A;  2EHO A;  5CB4 E;  3N9M A;  4XAX B;  3OKQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...