5LMNT

Structure of bacterial 30s-if1-if3-mrna translation pre-initiation complex (state-1a)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
molecule tags Ribosome
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 5lmnT00
1HR0T 1N34T 4DV3T 4DR6T 1HNXT 1N36T 4DR5T 2HHHT 2F4VT 4DR7T 4AQYT 1XMQT 1FJGT 4DR2T 3T1HT 4X65T 1N32T 4DV0T 1IBMT 2UU9T 2VQFT 4YY3T 4GKJT 4LF7T 4OX9T 3T1YT 4JI3T 4B3TT 4LF4T 5LMUT 2UXCT 4X66T 4DV5T 4NXNT 4JI6T 1J5ET 4K0KT 4YHHT 4JI4T 4LF5T 4DR1T 2E5LT 2UXDT 2UUCT 4B3ST 5LMNT 1IBLT 4LFAT 4GKKT 4JI1T 1HNWT 4JI8T 4LF6T 4LFCT 4DUYT 4JV5T 2ZM6T 4DUZT 4JI0T 2VQET 4JI2T 1XMOT 4DR4T 4X62T 1HNZT 4JI7T 4NXMT 3OTOT 1XNQT 4DV1T 2UUAT 4KHPT 1I94T 2UXBT 4B3MT 4DV6T 4LF9T 4LFBT 5BR8T 1N33T 4LF8T 4X64T 4DV2T 4DV7T 4DV4T 4JI5T 1XNRT 4B3RT 5IWAT 1IBKT 2UUBT 4DR3T 4JYAT
chains in the Genus database with same CATH superfamily
5LXTE 2VL0A 2UXXB 3P4RA 3T1HT 2BVMA 1MMGA 1IJ6A 2LM9A 5LG4A 3L3PA 5AFUL 4UVAB 5C3JA 2E9XB 3HL6A 1H7CA 5LBMA 4TX5A 4PW8A 2BG9C 4YHHT 2XQ9A 5CJ5A 2WM9A 3AVRA 3K3OA 3AAIA 2Y6XA 3MJXA 2H3RA 2X68A 2KINB 4Z91A 2LHRA 3NKZA 4TZ4C 3AXJB 2VQET 3LBXB 1SA0E 1S94A 4H9NC 4H63H 2LSGA 1XNQT 2AXDS 4UEMA 5JDLA 4A98A 2H7OA 1YKHB 4XZCA 2WU5A 4X20E 3PUQA 2BKOA 3P7IA 4IDZA 2V7IA 4X64T 3EVYA 1D0XA 3FZLB 5L4EA 5DQWA 5FXZA 3ZSSA 3FZHB 3JC6C 5IWAT 2EHOA 4JUYA 3H37A 3OYXA 4TWHA 4DMVA 4U2ZA 2NTYA 3KBTA 1OWAA 3LK3B 3LK42 3UQ7A 2X67A 1IZNB 3PUVF 3RYHE 5JRCA 4PFPA 2UXCT 3MACA 3A8YC 2MYSA 3LDQB 2FUPA 4JI4T 4LMJA 4LFAT 5JDHA 3OYZA 3C4XA 3ZKRA 2WMOA 1M62A 4MHCA 3CQGB 1E7PA 5HWYA 5J2TE 2M6IA 3FXDB 5JH7E 3ABVA 5AQNB 5L4HA 3RC3A 2XSBA 1T72A 5FXXA 5FMNA 3DJBA 4QX7B 3PUYF 2BBHA 2FJDA 4HFCA 4HWDA 2WBLA 4U2YA 1FIOA 5M4YA 4LFBT 4ILCA 3KV9A 4AKIA 2CA5A 2P9BA 2SPCA 4I0UA 3HKCE 5H6QB 4DV7T 3FZKB 2LRKA 3BQLA 4I43B 2V1DB 4N78D 3RKOA 1IBKT 2UUBT 4L5GA 3Q5DA 2KNDA 2DHRA 2K3WA 2RPAA 2NOXA 1B7TA 5C2TA 5L47A 3H3MA 3QOFA 4DR2T 3ESLA 2YDSA 2Z6EA 2XM2A 1NENA 3ZN1B 3PV0F 4BJNA 1NEKA 3AE9A 1WFDA 2EHOB 4XAXB 2WWVA 4C91A 1OEDC 3A5XA 5JDNA 4NPPA 2NWBA 2E5LT 2DI4A 4AQFC 2W63A 5LMNT 5KMGP 3ZYKA 4EEBA 5JDFA 5JRCB 2WS3A 1J5WA 2OLTA 2A2FX 4JI0T 4OYKA 3KVBA 4DR4T 2WP9A 4ZZCA 4DMWA 2BS4A 2VK9A 4HTEA 5DJQC 3PE0A 3V5SA 3N2GE 3NZQA 1M7KA 2CXFA 2V26A 5LHHB 5DABA 5LGNB 2BBJA 2DNXA 4I50E 3KV5A 2H7VC 3WI3A 3VRBA 1KNZA 4BAYB 1LVKA 3Q5WA 2JMKA 4GK5E 2D5UA 1OXZA 4HGAA 4ZI2D 3CX8B 2L8KA 3N9OA 3KINB 3TLWA 4JYAT 4DV3T 2YDQA 4IE4A 2CWYA 2ZM2A 3J7Yq 4UELA 2VURA 3OPCA 4JI3T 3NRYA 2V7LA 3EABA 5HYAA 4ISSA 3B5MA 4L9IA 5LJNA 1YQ4A 1J5ET 3AAEB 4LF5T 4DR1T 4H9RC 3KVAA 3RC8A 5LOVE 3DP7A 2ACXA 4DVDA 1HNWT 1I6ZA 4LFCT 2C5KT 5LB7B 1MIWA 3CIRA 4MLKA 4ZZBA 2K9AA 3AE8A 2X9YA 1XMOT 3PUSA 3W15B 4ZHQE 4PNIA 1XDOA 4NUUA 2UUAT 2UXBT 2IDOB 3CMLA 2RA1A 4WBOA 2VKHA 3PUXF 4KX6A 4GYSA 3UTKA 5JVDE 1N33T 3AA1B 2W00A 1UX4A 3ZEFB 2V5CA 3LJCA 3I9WA 2J62A 4JI5T 5FVLA 4YLHA 3AEFA 4ZXLA 5IYZE 4DR3T 3CKDA 1N34T 4EGWA 4IREA 3EHZA 1ZOYA 4QXBB 3ONJA 3R6NA 3EUHA 2K5BB 3SOLA 5E0OA 3QNUA 3C4ZA 3TKLB 1IBMT 4ZI2C 4HFDA 4KI0F 3K1SA 5AQTB 4YTNA 2ZM8A 3C51A 4JLEA 1O3XA 3VU7H 2BVLA 1W09A 4I4TE 5L2LA 4GKKT 2Q9QD 4A56A 4LF6T 2WSSV 3NBXX 3N2KE 4HN9A 2YEVC 3N2OA 3UUNA 3FXEB 2CRBA 4U33A 1XDPA 3ONLC 4JI7T 5LG3A 2V8SV 3P50A 4K0UA 3UU4A 2LKHA 4OK0A 4EEDA 2HN1A 2L9QA 2DCFA 2KZ7B 3UUXB 2I0MA 4EAHA 3M65A 3TLTA 2XQ3A 3ETUA 3RF1A 2N1GA 3FBZA 4CN4A 2EHOD 5FXWA 3PDYA 2LOPA 4DBRA 4HE8A 1JNRA 2V7JA 4ISTA 5LGUB 2XQ6A 2CHNA 4B6XA 3NVOA 2ES0A 3LK2B 5EK2A 1YXRA 2WAUA 3F57A 2M6BA 1D0YA 3P4SA 2XY8B 5FY0A 3OVUA 4O2BE 2BS2A 3AEEA 4WBNE 3AECA 3FB2A 5JTGA 4IL4A 1WYCA 5HCMA 2WDQA 5EK3A 1W9RA 1D1AA 3PUAA 5FVKA 1BR0A 2PBIA 3RI5A 2FJBA 4L0RA 3GN5A 2V6YA 2A72A 2H88A 1BR4A 5JQGE 1G73A 4C90A 5HEJA 5LP6E 3OBVE 1IAPA 3LFMA 3HKDE 3G06A 3ZN0B 5L3BB 3MK7C 1HG2A 3S4UA 5L3EB 5LHIB 2JQHA 3FBLA 2X51A 1DU2A 1QSDA 2Q9QA 4LF9T 3RYCE 5HXRA 3ZMZB 2MBGA 2MPKA 2J47A 3IBPA 2NW9A 4YTMA 1NAFA 5A1LA 1MMAA 4M1PA 3HA4A 5CFBA 2EHOC 4DR5T 4ZS3A 1U5PA 4DR7T 2XM1A 4TWDA 3Q5XA 3O1JA 1E2AA 2WWUA 1L0VA 2YINA 4U7YA 4LF7T 4FI5A 3T1YT 3P8CD 3CPZA 2E2AA 2KXPB 4IE5A 5AQHB 4YHJA 1T8BA 2WY2A 4ASKA 3AVSA 3UU5A 5AQIB 5JREA 4HWCA 2CM0A 3JADA 5GONE 5KX5E 3EI0A 1Y01A 2XQ4A 4O4IE 2XASB 5FYMA 1VRBA 4AXPA 2WDVA 3I0QA 4ZI7E 3IEEA 3AB3B 2XJ7A 3MZKB 4ILAA 4JI2T 3A7MA 1LVFA 4AKGA 3MXZA 4NXMT 2ACZA 2KMFA 1SHZC 4MBQA 2D9DA 3CK6A 4PAGA 2WB5A 2CHOA 3ZMUB 2JQ9A 4KHPT 3AE4A 3GN5B 4H9PC 3UULA 1KNRA 2V6YB 2R6GF 4HWHA 2BS3A 5L3FB 5AQPB 3AEAA 4IE0A 2DLRA 5AQQB 3ZMTB 3VR8A 3QB5A 5JR9A 5ABHA 3JCFA 2W67A 2Q9QB 4AKHA 3UT5E 5LGTB 1FJGT 1S35A 2CBJA 4V1Av 4DV0T 5HXSA 4ANJA 1D1CA 2QGSA 3K8PC 2VQFT 4IE6A 3B57A 2XQAA 4GKJT 4X1YE 4EZ4A 4LF4T 3E0ZA 3AE5A 3C50A 5KDMC 1HFAA 3K3QC 4NXNT 5KXJA 5BMVE 4UV9B 4KUMB 5AQFB 3TLVA 2UXDT 4OYJA 4BA9A 1IJ5A 3VKGA 4QXCB 2CBIA 4EYUA 1KFYA 3L8RA 4J2CA 4YSZA 3T8OA 1UURA 4A97A 1QLBA 3N9PA 4DIDB 4CQIA 4TWFA 3O1IA 3SFDA 4AI6A 5HEGA 1VCSA 3AEGA 2I6HA 2ZMAA 4KMCA 3PURA 3UU6A 3N9LA 4CXWA 3JAFA 2PJQA 3ZMSB 5HXCA 1VCTA 3L39A 3CVRA 3ZPOA 3PUWF 2JMHA 4TUYE 2BKPA 4CN1A 5F5WA 4EZHA 2IC9A 4PK4A 2YU1A 1YD8G 4EXTA 4PJMA 2KLQA 3J9X1 5IUXA 1X79A 3LG7A 3M3ZB 3ZSTA 4QKNA 4EIWA 5ETWA 3RPUA 2VVNA 3RX6A 4QXHB 4H9QC 2IUBA 4IHJE 4B3TT 2ZLYA 1U4QA 4HFEA 4PJNA 5JR9B 4ZEYA 4CI3B 2CE7A 2V5DA 3O1HA 4AISA 3N9NA 3PJAJ 4KBMB 1ZP0A 4YSXA 3Q2MA 2XQ7A 1R8IA 1AJ3A 5HAXA 4ZI3D 4NIQA 4AKRB 2ODVA 3B13A 3FHNA 2IAKA 3JAEA 4ERRA 4H9SE 3PJAA 3AA7B 3OTOT 5FL0A 4HKAA 3N9MA 2XAHB 2YOEA 2XPKA 1Z0PA 3AA6B 2CXLA 3PUGA 2MOZA 2LSIA 2A9UA 2QA7A 4DV4T 1LKXA 2XQ5A 1D0ZA 2WQYA 3IA3A 1XZYA 2J4GA 3EDUA 5LNKA 5AQOB 3X1DA 1WR0A 2VL8A 4YJ3E 1QUUA 2PG8A 4WZXA 1HX1B 2E8IA 5ABGA 3O9XA 3E08A 4TV8E 2X9WA 2C0SA 4DNDA 4YY3T 2BDEA 4IIJE 3RHWA 3AE3A 3ANWA 2AE9A 1W0BA 2ODUA 4JI6T 2YU2A 3KBUA 2DWGA 1MMDA 3CX6B 4ZOLE 4DUYT 3Q5EA 4QH4A 2KWIB 1GQEA 2QRXA 2YN6A 4UVBB 3AEBA 3ZLIA 4UF0A 2BKNA 2WZIA 3AA0B 3HR0A 5LBQB 4DV6T 2D0UA 4HEAA 2V7KA 4QHOA 1HX8A 3V5UA 4LF8T 2LLYA 5AQRB 2WMNA 4TNWA 1KNPA 1NWMX 2BZBA 2VASA 3ETVA 3ZYLA 2K24A 2LOSA 3ONXA 1Z8UA 5TAOA 2W2UA 2WCAA 1X9BA 3I9YA 4QX8B 4FJOA 3RYIE 3CQXC 3UQ4A 2F4VT 1XMQT 1T98A 2QVAA 4ZS2A 4MFRA 4YFSA 2W0GA 4CXYA 3U3IA 2GK9A 2YK0A 4HFBA 3RIAA 4EB6E 5LYJE 2HPJA 3L09A 4X66T 3RKGA 5AQKB 4BJMA 4KP3C 3RIFA 3UUMA 3GWHA 2HN2A 2LKGA 1HS7A 4G63A 1ZHCA 5CGMA 2NP9A 4NUVA 4JI8T 3KFWX 5JDMA 3KV4A 4JV5T 3TLUA 2ZM6T 3ANWB 3E22E 4AIUA 4E7SA 3KV6A 2X0LB 2OA5A 1YW0A 3UU8A 2HPLA 5L3CB 3P4WA 3ZC1A 1BR2A 1I94T 3RGLA 3QC9A 4U7IA 2LM2A 1V9DA 1T7SA 3ZJ1A 3BQIA 1FMWA 2Q9QC 1CHUA 5LHGB 3BK9A 4WW0A 5L3DB 1MNEA 3RLFF 5LA6E 4IL9A 4UF0B 2JQKA 2W61A 4LMLA 3RQWA 5F3JA 1HCIA 4ADZA 3SS1A 3RRCA 2CMRA 1HTJF 2X9HA 4AQYT 4Z90A 4JBWF 1UGOA 4GYRA 3RQUA 2UU9T 3UU3A 3AE1A 3OKQA 3ZJ2A 3O4XE 3N5LA 5LMUT 2N9DA 2BG9A 1HG5A 3QB5K 3Q9DA 2Y8DA 3RYFE 5J1GA 4X1IE 2MAWA 2VKDA 1ZEEA 4DO0A 1WYBA 5AQJB 1FEWA 4DUZT 3D0TA 4PK5A 5HEUA 5J2UE 2XQ8A 3FZFB 1CUNA 2CLYB 1BR1A 5DQVA 3ZYMA 2B76A 4EV6A 1G8XA 3VR9A 2PTFA 4TV9E 3AE2A 5H6RB 1D1BA 4DV2T 4TN7B 4HFHA 5HEHA 3NWIA 4Z8XA 1XNRT 4OHFA 2G0UA 2VKJA 1UCUA 4UV8B 2LSJA 4DR6T 2CPTA 2C5IT 3VRAA 4U72A 2HHHT 5JR9C 3PTRB 4UR9A 4CI2B 5HCJA 4X65T 3EDVA 2VB6A 4U74A 2K48A 4UVCB 1JNZA 3HKEE 2X0HA 1KEYA 5AQSB 2XZEA 2FJAA 2NTXA 4GIWA 4EYYR 3SRZA 5LJMA 2UUCT 4IDQA 3HI2A 1FMVA 4P0AA 4DBQA 2E5VA 3KDSE 3CX7B 1SUMB 3F31A 4HWFA 4U3CA 5JDQA 1WLXA 5LCYA 3VHLA 1SE7A 4IGUA 2IC6A 2OV9A 3NZPA 5ABFA 2BG9B 3R84B 2IHR1 1US7B 2CWOA 5FY7A 2XHEB 1Y64B 3ZMVB 4YSYA 3RH3A 3C64A 3CQCB 3TLSA 3PU3A 3C98B 3P4QA 2NR4A 4IDOA 5BR8T 1LRZA 5ABEA 5FL1A 3UUBA 2DWKA 5IHYA 2W66A 4PJLA 4GK0E 5J0ZA 3SFEA 2BG9E 4ILUA 4B3RT 4O8SA 2KT9A 3PUZF 3AE6A 4F8HA 2UXNB 1HNXT 5AQMB 2LHNA 2XAJB 2JPFA 5FP3A 2XAQB 2PFVA 2L3LA 2DL1A 3UFEA 1J1JA 3SWHA 1OEDA 3QUJA 2NW7A 2LSYA 4P0BA 4YXDA 4UXNB 2YKSA 4AQFA 2YDRA 2X66A 2WZHA 2X9XA 2W62A 4IDNA 1KK7A 4JI1T 4LMKA 2IMLA 1MNDA 2JRKA 4HWIB 2C5JA 4IT4A 2E9XD 1EZ3A 1HNZT 4P1NA 1MIVA 2V6XA 4ILBA 2JIWA 5CA0E 2LRLA 5ADXL 2X0YA 3NRXA 5AQGB 5FXVA 4XBFB 4TNVA 3WAJA 4GOUA 4P09A 5HEOA 4PK6A 3I1AA 2WU2A 3UFGA 3ZT6A 4B3MT 4WNKA 2D2SA 2M67A 4JEHB 3U78A 5ABFB 2LT3A 3H3AA 4H63V 2CXDA 2LEHA 4KHZF 2A3DA 3RRWA 2VWAA 2VVSA 5HWXA 3EAMA 5EK4A 2FJEA 3MA9A 1HR0T 2QYWA 1VOMA 3OJAA 3ZCIA 5L3GB 4PJJA 2WDRA 1N32T 3AEDA 5FKYA 1WCRA 4O4HE 4PFOA 3AAAB 5FY1A 4K0KT 3WAKA 1UK5A 1YKEB 4B3ST 3I0OA 2NW8A 1IBLT 3FZMB 4CXXA 2LSKA 5JDGA 4F6RC 3VKHA 1OEDB 4JEUB 4E7ZA 4IDPA 4WYVA 1ZV4X 2CEAA 4O4JE 4QH1A 5C8YE 4O4LE 2XAFB 4DV1T 4Q25A 5FNVE 3AE7A 2J1DG 1ZKEA 2E9XC 2I59A 1MIYA 2JQQA 1WRDA 3RIUC 3ZCJA 3C4WA 2D0TA 2XUEA 3ZC0A 1OEDE 4A5XA 2B1EA 2E9XA 4ZI3C 5CB4E 4EOZB 2LJLA 4QH5A 3BQKA 5HXHA 2RP4A 4YTPA 2FBWA 3RIUA 2IIUA 2JJ9A 5AQUB 1UUSA 2CCQA 1N36T 4MALA 1WR6A 5AQLB 1UX5A 5AQVB 3ZT5A 5CA1E 5EZYE 3PU8A 3P4PA 4YJ2E 4OX9T 3AXJA 2H89A 4HFIA 4G2AA 4U31A 4IE7A 4DV5T 4AKLA 2KSRA 1E1HB 3LBXA 3ZT7A 2KWHA 3HKBE 4AQGA 4OFZA 2XTLA 2CLYC 2V7MA 2ZM0A 3F2EA 1XWMA 4QWNB 3DTOA 4X1KE 4CN6A 2Y48B 4X62T 2XAGB 3MKDA 2HH7A 5F8PA 2MTQA 5HXEA 4H9OC 3IHRA 3CWZB 1HF8A 2VKOA 4CI1B 2LE8A 3N9QA 2XSAA 4CZZB 1W0AA 2W4XA 3JC6D 4HFVA 4UIGA 1KF6A 2N2NA 3GA8A 1MMNA 3LSVA 3IF8B 4COFA 1YQ3A 2XQYA 4YT0A 3K3NA 4O2AE 3GMIA 2IW5B 4X5TA 4I55E 3QK6A
chains in the Genus database with same CATH topology
1HR0T 1N34T 4DV3T 4DR6T 1HNXT 1N36T 4DR5T 2HHHT 2F4VT 4DR7T 4AQYT 1XMQT 1FJGT 4DR2T 3T1HT 4X65T 1N32T 4DV0T 1IBMT 2UU9T 2VQFT 4YY3T 4GKJT 4LF7T 4OX9T 3T1YT 4JI3T 4B3TT 4LF4T 5LMUT 2UXCT 4X66T 4DV5T 4NXNT 4JI6T 1J5ET 4K0KT 4YHHT 4JI4T 4LF5T 4DR1T 2E5LT 2UXDT 2UUCT 4B3ST 5LMNT 1IBLT 4LFAT 4GKKT 4JI1T 1HNWT 4JI8T 4LF6T 4LFCT 4DUYT 4JV5T 2ZM6T 4DUZT 4JI0T 2VQET 4JI2T 1XMOT 4DR4T 4X62T 1HNZT 4JI7T 4NXMT 3OTOT 1XNQT 4DV1T 2UUAT 4KHPT 1I94T 2UXBT 4B3MT 4DV6T 4LF9T 4LFBT 5BR8T 1N33T 4LF8T 4X64T 4DV2T 4DV7T 4DV4T 4JI5T 1XNRT 4B3RT 5IWAT 1IBKT 2UUBT 4DR3T 4JYAT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HR0 T;  1N34 T;  4DV3 T;  4DR6 T;  1HNX T;  1N36 T;  4DR5 T;  2HHH T;  2F4V T;  4DR7 T;  4AQY T;  1XMQ T;  1FJG T;  4DR2 T;  3T1H T;  4X65 T;  1N32 T;  4DV0 T;  1IBM T;  2UU9 T;  2VQF T;  4YY3 T;  4GKJ T;  4LF7 T;  4OX9 T;  3T1Y T;  4JI3 T;  4B3T T;  4LF4 T;  5LMU T;  2UXC T;  4X66 T;  4DV5 T;  4NXN T;  4JI6 T;  1J5E T;  4K0K T;  4YHH T;  4JI4 T;  4LF5 T;  4DR1 T;  2E5L T;  2UXD T;  2UUC T;  4B3S T;  5LMN T;  1IBL T;  4LFA T;  4GKK T;  4JI1 T;  1HNW T;  4JI8 T;  4LF6 T;  4LFC T;  4DUY T;  4JV5 T;  2ZM6 T;  4DUZ T;  4JI0 T;  2VQE T;  4JI2 T;  1XMO T;  4DR4 T;  4X62 T;  1HNZ T;  4JI7 T;  4NXM T;  3OTO T;  1XNQ T;  4DV1 T;  2UUA T;  4KHP T;  1I94 T;  2UXB T;  4B3M T;  4DV6 T;  4LF9 T;  4LFB T;  5BR8 T;  1N33 T;  4LF8 T;  4X64 T;  4DV2 T;  4DV7 T;  4DV4 T;  4JI5 T;  1XNR T;  4B3R T;  5IWA T;  1IBK T;  2UUB T;  4DR3 T;  4JYA T; 
#chains in the Genus database with same CATH topology
 5LXT E;  2VL0 A;  2UXX B;  3P4R A;  3T1H T;  2BVM A;  1MMG A;  1IJ6 A;  2LM9 A;  5LG4 A;  3L3P A;  5AFU L;  4UVA B;  5C3J A;  2E9X B;  3HL6 A;  1H7C A;  5LBM A;  4TX5 A;  4PW8 A;  2BG9 C;  4YHH T;  2XQ9 A;  5CJ5 A;  2WM9 A;  3AVR A;  3K3O A;  3AAI A;  2Y6X A;  3MJX A;  2H3R A;  2X68 A;  2KIN B;  4Z91 A;  2LHR A;  3NKZ A;  4TZ4 C;  3AXJ B;  2VQE T;  3LBX B;  1SA0 E;  1S94 A;  4H9N C;  4H63 H;  2LSG A;  1XNQ T;  2AXD S;  4UEM A;  5JDL A;  4A98 A;  2H7O A;  1YKH B;  4XZC A;  2WU5 A;  4X20 E;  3PUQ A;  2BKO A;  3P7I A;  4IDZ A;  2V7I A;  4X64 T;  3EVY A;  1D0X A;  3FZL B;  5L4E A;  5DQW A;  5FXZ A;  3ZSS A;  3FZH B;  3JC6 C;  5IWA T;  2EHO A;  4JUY A;  3H37 A;  3OYX A;  4TWH A;  4DMV A;  4U2Z A;  2NTY A;  3KBT A;  1OWA A;  3LK3 B;  3LK4 2;  3UQ7 A;  2X67 A;  1IZN B;  3PUV F;  3RYH E;  5JRC A;  4PFP A;  2UXC T;  3MAC A;  3A8Y C;  2MYS A;  3LDQ B;  2FUP A;  4JI4 T;  4LMJ A;  4LFA T;  5JDH A;  3OYZ A;  3C4X A;  3ZKR A;  2WMO A;  1M62 A;  4MHC A;  3CQG B;  1E7P A;  5HWY A;  5J2T E;  2M6I A;  3FXD B;  5JH7 E;  3ABV A;  5AQN B;  5L4H A;  3RC3 A;  2XSB A;  1T72 A;  5FXX A;  5FMN A;  3DJB A;  4QX7 B;  3PUY F;  2BBH A;  2FJD A;  4HFC A;  4HWD A;  2WBL A;  4U2Y A;  1FIO A;  5M4Y A;  4LFB T;  4ILC A;  3KV9 A;  4AKI A;  2CA5 A;  2P9B A;  2SPC A;  4I0U A;  3HKC E;  5H6Q B;  4DV7 T;  3FZK B;  2LRK A;  3BQL A;  4I43 B;  2V1D B;  4N78 D;  3RKO A;  1IBK T;  2UUB T;  4L5G A;  3Q5D A;  2KND A;  2DHR A;  2K3W A;  2RPA A;  2NOX A;  1B7T A;  5C2T A;  5L47 A;  3H3M A;  3QOF A;  4DR2 T;  3ESL A;  2YDS A;  2Z6E A;  2XM2 A;  1NEN A;  3ZN1 B;  3PV0 F;  4BJN A;  1NEK A;  3AE9 A;  1WFD A;  2EHO B;  4XAX B;  2WWV A;  4C91 A;  1OED C;  3A5X A;  5JDN A;  4NPP A;  2NWB A;  2E5L T;  2DI4 A;  4AQF C;  2W63 A;  5LMN T;  5KMG P;  3ZYK A;  4EEB A;  5JDF A;  5JRC B;  2WS3 A;  1J5W A;  2OLT A;  2A2F X;  4JI0 T;  4OYK A;  3KVB A;  4DR4 T;  2WP9 A;  4ZZC A;  4DMW A;  2BS4 A;  2VK9 A;  4HTE A;  5DJQ C;  3PE0 A;  3V5S A;  3N2G E;  3NZQ A;  1M7K A;  2CXF A;  2V26 A;  5LHH B;  5DAB A;  5LGN B;  2BBJ A;  2DNX A;  4I50 E;  3KV5 A;  2H7V C;  3WI3 A;  3VRB A;  1KNZ A;  4BAY B;  1LVK A;  3Q5W A;  2JMK A;  4GK5 E;  2D5U A;  1OXZ A;  4HGA A;  4ZI2 D;  3CX8 B;  2L8K A;  3N9O A;  3KIN B;  3TLW A;  4JYA T;  4DV3 T;  2YDQ A;  4IE4 A;  2CWY A;  2ZM2 A;  3J7Y q;  4UEL A;  2VUR A;  3OPC A;  4JI3 T;  3NRY A;  2V7L A;  3EAB A;  5HYA A;  4ISS A;  3B5M A;  4L9I A;  5LJN A;  1YQ4 A;  1J5E T;  3AAE B;  4LF5 T;  4DR1 T;  4H9R C;  3KVA A;  3RC8 A;  5LOV E;  3DP7 A;  2ACX A;  4DVD A;  1HNW T;  1I6Z A;  4LFC T;  2C5K T;  5LB7 B;  1MIW A;  3CIR A;  4MLK A;  4ZZB A;  2K9A A;  3AE8 A;  2X9Y A;  1XMO T;  3PUS A;  3W15 B;  4ZHQ E;  4PNI A;  1XDO A;  4NUU A;  2UUA T;  2UXB T;  2IDO B;  3CML A;  2RA1 A;  4WBO A;  2VKH A;  3PUX F;  4KX6 A;  4GYS A;  3UTK A;  5JVD E;  1N33 T;  3AA1 B;  2W00 A;  1UX4 A;  3ZEF B;  2V5C A;  3LJC A;  3I9W A;  2J62 A;  4JI5 T;  5FVL A;  4YLH A;  3AEF A;  4ZXL A;  5IYZ E;  4DR3 T;  3CKD A;  1N34 T;  4EGW A;  4IRE A;  3EHZ A;  1ZOY A;  4QXB B;  3ONJ A;  3R6N A;  3EUH A;  2K5B B;  3SOL A;  5E0O A;  3QNU A;  3C4Z A;  3TKL B;  1IBM T;  4ZI2 C;  4HFD A;  4KI0 F;  3K1S A;  5AQT B;  4YTN A;  2ZM8 A;  3C51 A;  4JLE A;  1O3X A;  3VU7 H;  2BVL A;  1W09 A;  4I4T E;  5L2L A;  4GKK T;  2Q9Q D;  4A56 A;  4LF6 T;  2WSS V;  3NBX X;  3N2K E;  4HN9 A;  2YEV C;  3N2O A;  3UUN A;  3FXE B;  2CRB A;  4U33 A;  1XDP A;  3ONL C;  4JI7 T;  5LG3 A;  2V8S V;  3P50 A;  4K0U A;  3UU4 A;  2LKH A;  4OK0 A;  4EED A;  2HN1 A;  2L9Q A;  2DCF A;  2KZ7 B;  3UUX B;  2I0M A;  4EAH A;  3M65 A;  3TLT A;  2XQ3 A;  3ETU A;  3RF1 A;  2N1G A;  3FBZ A;  4CN4 A;  2EHO D;  5FXW A;  3PDY A;  2LOP A;  4DBR A;  4HE8 A;  1JNR A;  2V7J A;  4IST A;  5LGU B;  2XQ6 A;  2CHN A;  4B6X A;  3NVO A;  2ES0 A;  3LK2 B;  5EK2 A;  1YXR A;  2WAU A;  3F57 A;  2M6B A;  1D0Y A;  3P4S A;  2XY8 B;  5FY0 A;  3OVU A;  4O2B E;  2BS2 A;  3AEE A;  4WBN E;  3AEC A;  3FB2 A;  5JTG A;  4IL4 A;  1WYC A;  5HCM A;  2WDQ A;  5EK3 A;  1W9R A;  1D1A A;  3PUA A;  5FVK A;  1BR0 A;  2PBI A;  3RI5 A;  2FJB A;  4L0R A;  3GN5 A;  2V6Y A;  2A72 A;  2H88 A;  1BR4 A;  5JQG E;  1G73 A;  4C90 A;  5HEJ A;  5LP6 E;  3OBV E;  1IAP A;  3LFM A;  3HKD E;  3G06 A;  3ZN0 B;  5L3B B;  3MK7 C;  1HG2 A;  3S4U A;  5L3E B;  5LHI B;  2JQH A;  3FBL A;  2X51 A;  1DU2 A;  1QSD A;  2Q9Q A;  4LF9 T;  3RYC E;  5HXR A;  3ZMZ B;  2MBG A;  2MPK A;  2J47 A;  3IBP A;  2NW9 A;  4YTM A;  1NAF A;  5A1L A;  1MMA A;  4M1P A;  3HA4 A;  5CFB A;  2EHO C;  4DR5 T;  4ZS3 A;  1U5P A;  4DR7 T;  2XM1 A;  4TWD A;  3Q5X A;  3O1J A;  1E2A A;  2WWU A;  1L0V A;  2YIN A;  4U7Y A;  4LF7 T;  4FI5 A;  3T1Y T;  3P8C D;  3CPZ A;  2E2A A;  2KXP B;  4IE5 A;  5AQH B;  4YHJ A;  1T8B A;  2WY2 A;  4ASK A;  3AVS A;  3UU5 A;  5AQI B;  5JRE A;  4HWC A;  2CM0 A;  3JAD A;  5GON E;  5KX5 E;  3EI0 A;  1Y01 A;  2XQ4 A;  4O4I E;  2XAS B;  5FYM A;  1VRB A;  4AXP A;  2WDV A;  3I0Q A;  4ZI7 E;  3IEE A;  3AB3 B;  2XJ7 A;  3MZK B;  4ILA A;  4JI2 T;  3A7M A;  1LVF A;  4AKG A;  3MXZ A;  4NXM T;  2ACZ A;  2KMF A;  1SHZ C;  4MBQ A;  2D9D A;  3CK6 A;  4PAG A;  2WB5 A;  2CHO A;  3ZMU B;  2JQ9 A;  4KHP T;  3AE4 A;  3GN5 B;  4H9P C;  3UUL A;  1KNR A;  2V6Y B;  2R6G F;  4HWH A;  2BS3 A;  5L3F B;  5AQP B;  3AEA A;  4IE0 A;  2DLR A;  5AQQ B;  3ZMT B;  3VR8 A;  3QB5 A;  5JR9 A;  5ABH A;  3JCF A;  2W67 A;  2Q9Q B;  4AKH A;  3UT5 E;  5LGT B;  1FJG T;  1S35 A;  2CBJ A;  4V1A v;  4DV0 T;  5HXS A;  4ANJ A;  1D1C A;  2QGS A;  3K8P C;  2VQF T;  4IE6 A;  3B57 A;  2XQA A;  4GKJ T;  4X1Y E;  4EZ4 A;  4LF4 T;  3E0Z A;  3AE5 A;  3C50 A;  5KDM C;  1HFA A;  3K3Q C;  4NXN T;  5KXJ A;  5BMV E;  4UV9 B;  4KUM B;  5AQF B;  3TLV A;  2UXD T;  4OYJ A;  4BA9 A;  1IJ5 A;  3VKG A;  4QXC B;  2CBI A;  4EYU A;  1KFY A;  3L8R A;  4J2C A;  4YSZ A;  3T8O A;  1UUR A;  4A97 A;  1QLB A;  3N9P A;  4DID B;  4CQI A;  4TWF A;  3O1I A;  3SFD A;  4AI6 A;  5HEG A;  1VCS A;  3AEG A;  2I6H A;  2ZMA A;  4KMC A;  3PUR A;  3UU6 A;  3N9L A;  4CXW A;  3JAF A;  2PJQ A;  3ZMS B;  5HXC A;  1VCT A;  3L39 A;  3CVR A;  3ZPO A;  3PUW F;  2JMH A;  4TUY E;  2BKP A;  4CN1 A;  5F5W A;  4EZH A;  2IC9 A;  4PK4 A;  2YU1 A;  1YD8 G;  4EXT A;  4PJM A;  2KLQ A;  3J9X 1;  5IUX A;  1X79 A;  3LG7 A;  3M3Z B;  3ZST A;  4QKN A;  4EIW A;  5ETW A;  3RPU A;  2VVN A;  3RX6 A;  4QXH B;  4H9Q C;  2IUB A;  4IHJ E;  4B3T T;  2ZLY A;  1U4Q A;  4HFE A;  4PJN A;  5JR9 B;  4ZEY A;  4CI3 B;  2CE7 A;  2V5D A;  3O1H A;  4AIS A;  3N9N A;  3PJA J;  4KBM B;  1ZP0 A;  4YSX A;  3Q2M A;  2XQ7 A;  1R8I A;  1AJ3 A;  5HAX A;  4ZI3 D;  4NIQ A;  4AKR B;  2ODV A;  3B13 A;  3FHN A;  2IAK A;  3JAE A;  4ERR A;  4H9S E;  3PJA A;  3AA7 B;  3OTO T;  5FL0 A;  4HKA A;  3N9M A;  2XAH B;  2YOE A;  2XPK A;  1Z0P A;  3AA6 B;  2CXL A;  3PUG A;  2MOZ A;  2LSI A;  2A9U A;  2QA7 A;  4DV4 T;  1LKX A;  2XQ5 A;  1D0Z A;  2WQY A;  3IA3 A;  1XZY A;  2J4G A;  3EDU A;  5LNK A;  5AQO B;  3X1D A;  1WR0 A;  2VL8 A;  4YJ3 E;  1QUU A;  2PG8 A;  4WZX A;  1HX1 B;  2E8I A;  5ABG A;  3O9X A;  3E08 A;  4TV8 E;  2X9W A;  2C0S A;  4DND A;  4YY3 T;  2BDE A;  4IIJ E;  3RHW A;  3AE3 A;  3ANW A;  2AE9 A;  1W0B A;  2ODU A;  4JI6 T;  2YU2 A;  3KBU A;  2DWG A;  1MMD A;  3CX6 B;  4ZOL E;  4DUY T;  3Q5E A;  4QH4 A;  2KWI B;  1GQE A;  2QRX A;  2YN6 A;  4UVB B;  3AEB A;  3ZLI A;  4UF0 A;  2BKN A;  2WZI A;  3AA0 B;  3HR0 A;  5LBQ B;  4DV6 T;  2D0U A;  4HEA A;  2V7K A;  4QHO A;  1HX8 A;  3V5U A;  4LF8 T;  2LLY A;  5AQR B;  2WMN A;  4TNW A;  1KNP A;  1NWM X;  2BZB A;  2VAS A;  3ETV A;  3ZYL A;  2K24 A;  2LOS A;  3ONX A;  1Z8U A;  5TAO A;  2W2U A;  2WCA A;  1X9B A;  3I9Y A;  4QX8 B;  4FJO A;  3RYI E;  3CQX C;  3UQ4 A;  2F4V T;  1XMQ T;  1T98 A;  2QVA A;  4ZS2 A;  4MFR A;  4YFS A;  2W0G A;  4CXY A;  3U3I A;  2GK9 A;  2YK0 A;  4HFB A;  3RIA A;  4EB6 E;  5LYJ E;  2HPJ A;  3L09 A;  4X66 T;  3RKG A;  5AQK B;  4BJM A;  4KP3 C;  3RIF A;  3UUM A;  3GWH A;  2HN2 A;  2LKG A;  1HS7 A;  4G63 A;  1ZHC A;  5CGM A;  2NP9 A;  4NUV A;  4JI8 T;  3KFW X;  5JDM A;  3KV4 A;  4JV5 T;  3TLU A;  2ZM6 T;  3ANW B;  3E22 E;  4AIU A;  4E7S A;  3KV6 A;  2X0L B;  2OA5 A;  1YW0 A;  3UU8 A;  2HPL A;  5L3C B;  3P4W A;  3ZC1 A;  1BR2 A;  1I94 T;  3RGL A;  3QC9 A;  4U7I A;  2LM2 A;  1V9D A;  1T7S A;  3ZJ1 A;  3BQI A;  1FMW A;  2Q9Q C;  1CHU A;  5LHG B;  3BK9 A;  4WW0 A;  5L3D B;  1MNE A;  3RLF F;  5LA6 E;  4IL9 A;  4UF0 B;  2JQK A;  2W61 A;  4LML A;  3RQW A;  5F3J A;  1HCI A;  4ADZ A;  3SS1 A;  3RRC A;  2CMR A;  1HTJ F;  2X9H A;  4AQY T;  4Z90 A;  4JBW F;  1UGO A;  4GYR A;  3RQU A;  2UU9 T;  3UU3 A;  3AE1 A;  3OKQ A;  3ZJ2 A;  3O4X E;  3N5L A;  5LMU T;  2N9D A;  2BG9 A;  1HG5 A;  3QB5 K;  3Q9D A;  2Y8D A;  3RYF E;  5J1G A;  4X1I E;  2MAW A;  2VKD A;  1ZEE A;  4DO0 A;  1WYB A;  5AQJ B;  1FEW A;  4DUZ T;  3D0T A;  4PK5 A;  5HEU A;  5J2U E;  2XQ8 A;  3FZF B;  1CUN A;  2CLY B;  1BR1 A;  5DQV A;  3ZYM A;  2B76 A;  4EV6 A;  1G8X A;  3VR9 A;  2PTF A;  4TV9 E;  3AE2 A;  5H6R B;  1D1B A;  4DV2 T;  4TN7 B;  4HFH A;  5HEH A;  3NWI A;  4Z8X A;  1XNR T;  4OHF A;  2G0U A;  2VKJ A;  1UCU A;  4UV8 B;  2LSJ A;  4DR6 T;  2CPT A;  2C5I T;  3VRA A;  4U72 A;  2HHH T;  5JR9 C;  3PTR B;  4UR9 A;  4CI2 B;  5HCJ A;  4X65 T;  3EDV A;  2VB6 A;  4U74 A;  2K48 A;  4UVC B;  1JNZ A;  3HKE E;  2X0H A;  1KEY A;  5AQS B;  2XZE A;  2FJA A;  2NTX A;  4GIW A;  4EYY R;  3SRZ A;  5LJM A;  2UUC T;  4IDQ A;  3HI2 A;  1FMV A;  4P0A A;  4DBQ A;  2E5V A;  3KDS E;  3CX7 B;  1SUM B;  3F31 A;  4HWF A;  4U3C A;  5JDQ A;  1WLX A;  5LCY A;  3VHL A;  1SE7 A;  4IGU A;  2IC6 A;  2OV9 A;  3NZP A;  5ABF A;  2BG9 B;  3R84 B;  2IHR 1;  1US7 B;  2CWO A;  5FY7 A;  2XHE B;  1Y64 B;  3ZMV B;  4YSY A;  3RH3 A;  3C64 A;  3CQC B;  3TLS A;  3PU3 A;  3C98 B;  3P4Q A;  2NR4 A;  4IDO A;  5BR8 T;  1LRZ A;  5ABE A;  5FL1 A;  3UUB A;  2DWK A;  5IHY A;  2W66 A;  4PJL A;  4GK0 E;  5J0Z A;  3SFE A;  2BG9 E;  4ILU A;  4B3R T;  4O8S A;  2KT9 A;  3PUZ F;  3AE6 A;  4F8H A;  2UXN B;  1HNX T;  5AQM B;  2LHN A;  2XAJ B;  2JPF A;  5FP3 A;  2XAQ B;  2PFV A;  2L3L A;  2DL1 A;  3UFE A;  1J1J A;  3SWH A;  1OED A;  3QUJ A;  2NW7 A;  2LSY A;  4P0B A;  4YXD A;  4UXN B;  2YKS A;  4AQF A;  2YDR A;  2X66 A;  2WZH A;  2X9X A;  2W62 A;  4IDN A;  1KK7 A;  4JI1 T;  4LMK A;  2IML A;  1MND A;  2JRK A;  4HWI B;  2C5J A;  4IT4 A;  2E9X D;  1EZ3 A;  1HNZ T;  4P1N A;  1MIV A;  2V6X A;  4ILB A;  2JIW A;  5CA0 E;  2LRL A;  5ADX L;  2X0Y A;  3NRX A;  5AQG B;  5FXV A;  4XBF B;  4TNV A;  3WAJ A;  4GOU A;  4P09 A;  5HEO A;  4PK6 A;  3I1A A;  2WU2 A;  3UFG A;  3ZT6 A;  4B3M T;  4WNK A;  2D2S A;  2M67 A;  4JEH B;  3U78 A;  5ABF B;  2LT3 A;  3H3A A;  4H63 V;  2CXD A;  2LEH A;  4KHZ F;  2A3D A;  3RRW A;  2VWA A;  2VVS A;  5HWX A;  3EAM A;  5EK4 A;  2FJE A;  3MA9 A;  1HR0 T;  2QYW A;  1VOM A;  3OJA A;  3ZCI A;  5L3G B;  4PJJ A;  2WDR A;  1N32 T;  3AED A;  5FKY A;  1WCR A;  4O4H E;  4PFO A;  3AAA B;  5FY1 A;  4K0K T;  3WAK A;  1UK5 A;  1YKE B;  4B3S T;  3I0O A;  2NW8 A;  1IBL T;  3FZM B;  4CXX A;  2LSK A;  5JDG A;  4F6R C;  3VKH A;  1OED B;  4JEU B;  4E7Z A;  4IDP A;  4WYV A;  1ZV4 X;  2CEA A;  4O4J E;  4QH1 A;  5C8Y E;  4O4L E;  2XAF B;  4DV1 T;  4Q25 A;  5FNV E;  3AE7 A;  2J1D G;  1ZKE A;  2E9X C;  2I59 A;  1MIY A;  2JQQ A;  1WRD A;  3RIU C;  3ZCJ A;  3C4W A;  2D0T A;  2XUE A;  3ZC0 A;  1OED E;  4A5X A;  2B1E A;  2E9X A;  4ZI3 C;  5CB4 E;  4EOZ B;  2LJL A;  4QH5 A;  3BQK A;  5HXH A;  2RP4 A;  4YTP A;  2FBW A;  3RIU A;  2IIU A;  2JJ9 A;  5AQU B;  1UUS A;  2CCQ A;  1N36 T;  4MAL A;  1WR6 A;  5AQL B;  1UX5 A;  5AQV B;  3ZT5 A;  5CA1 E;  5EZY E;  3PU8 A;  3P4P A;  4YJ2 E;  4OX9 T;  3AXJ A;  2H89 A;  4HFI A;  4G2A A;  4U31 A;  4IE7 A;  4DV5 T;  4AKL A;  2KSR A;  1E1H B;  3LBX A;  3ZT7 A;  2KWH A;  3HKB E;  4AQG A;  4OFZ A;  2XTL A;  2CLY C;  2V7M A;  2ZM0 A;  3F2E A;  1XWM A;  4QWN B;  3DTO A;  4X1K E;  4CN6 A;  2Y48 B;  4X62 T;  2XAG B;  3MKD A;  2HH7 A;  5F8P A;  2MTQ A;  5HXE A;  4H9O C;  3IHR A;  3CWZ B;  1HF8 A;  2VKO A;  4CI1 B;  2LE8 A;  3N9Q A;  2XSA A;  4CZZ B;  1W0A A;  2W4X A;  3JC6 D;  4HFV A;  4UIG A;  1KF6 A;  2N2N A;  3GA8 A;  1MMN A;  3LSV A;  3IF8 B;  4COF A;  1YQ3 A;  2XQY A;  4YT0 A;  3K3N A;  4O2A E;  3GMI A;  2IW5 B;  4X5T A;  4I55 E;  3QK6 A; 
#chains in the Genus database with same CATH homology
 1HR0 T;  1N34 T;  4DV3 T;  4DR6 T;  1HNX T;  1N36 T;  4DR5 T;  2HHH T;  2F4V T;  4DR7 T;  4AQY T;  1XMQ T;  1FJG T;  4DR2 T;  3T1H T;  4X65 T;  1N32 T;  4DV0 T;  1IBM T;  2UU9 T;  2VQF T;  4YY3 T;  4GKJ T;  4LF7 T;  4OX9 T;  3T1Y T;  4JI3 T;  4B3T T;  4LF4 T;  5LMU T;  2UXC T;  4X66 T;  4DV5 T;  4NXN T;  4JI6 T;  1J5E T;  4K0K T;  4YHH T;  4JI4 T;  4LF5 T;  4DR1 T;  2E5L T;  2UXD T;  2UUC T;  4B3S T;  5LMN T;  1IBL T;  4LFA T;  4GKK T;  4JI1 T;  1HNW T;  4JI8 T;  4LF6 T;  4LFC T;  4DUY T;  4JV5 T;  2ZM6 T;  4DUZ T;  4JI0 T;  2VQE T;  4JI2 T;  1XMO T;  4DR4 T;  4X62 T;  1HNZ T;  4JI7 T;  4NXM T;  3OTO T;  1XNQ T;  4DV1 T;  2UUA T;  4KHP T;  1I94 T;  2UXB T;  4B3M T;  4DV6 T;  4LF9 T;  4LFB T;  5BR8 T;  1N33 T;  4LF8 T;  4X64 T;  4DV2 T;  4DV7 T;  4DV4 T;  4JI5 T;  1XNR T;  4B3R T;  5IWA T;  1IBK T;  2UUB T;  4DR3 T;  4JYA T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...