5LMNT

Structure of bacterial 30s-if1-if3-mrna translation pre-initiation complex (state-1a)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
molecule tags Ribosome
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 5lmnT00
4DV1T 5LMNT 1HR0T 2UUBT 5IWAT 4DV0T 4DR1T 2VQET 4DV3T 4B3MT 5LMUT 4YHHT 4KHPT 1N34T 4DUZT 2UXBT 4JI2T 2HHHT 1HNXT 4X62T 4DV4T 3OTOT 4GKJT 3T1HT 4DV2T 1HNWT 1FJGT 4X64T 2UUAT 4LF7T 5BR8T 4DR6T 4JI3T 4DR2T 1IBKT 4JI8T 1HNZT 4JI0T 1J5ET 4DV6T 4GKKT 2UUCT 4DR3T 1XNRT 4DR4T 1N36T 4DV5T 4DR5T 2E5LT 4JI6T 2UXCT 4K0KT 4LFBT 4YY3T 4LF9T 3T1YT 4AQYT 4OX9T 4JV5T 2UXDT 2ZM6T 4B3RT 4NXNT 2UU9T 4JI4T 1XMQT 4JI7T 4LF4T 1N33T 1IBMT 4JI5T 4B3TT 4LF8T 4DUYT 4DR7T 4LFCT 4NXMT 4B3ST 1XNQT 4LFAT 4JI1T 1N32T 4X66T 1IBLT 4LF5T 4LF6T 2VQFT 1XMOT 4JYAT 4X65T 2F4VT 4DV7T 1I94T
chains in the Genus database with same CATH superfamily
5JDFA 4JBWF 5CJ5A 3O1IA 4E7ZA 2LSIA 5LXTE 1WLXA 5ABFA 4WBNE 5FXXA 2DI4A 2WU2A 3FB2A 3KBTA 2CBJA 2W0GA 2XPKA 4Z8XA 4CQIA 5KXJA 3SFEA 5AQUB 2XY8B 4GKJT 3AEBA 1Y64B 5EK3A 2VKJA 4MBQA 3NBXX 1W09A 2LSGA 4HFBA 4O4LE 4PNIA 4U31A 3EHZA 1J5WA 4IL9A 4DR4T 2SPCA 2WZIA 3FXDB 3VRBA 4PJLA 3SS1A 2NWBA 2JIWA 3J7Yq 4X1YE 2LSYA 3N2KE 3B5MA 2CCQA 5HEHA 4OK0A 2JMHA 4U3CA 2KSRA 3P7IA 2DHRA 3EUHA 5HAXA 5LP6E 3VR8A 4P09A 1MIYA 2X66A 4U2YA 3ZSSA 4KMCA 2CXDA 4CXXA 2LOPA 1WR6A 2EHOA 4ILCA 3I0QA 1IAPA 4HWCA 3RRCA 2ZM2A 4EZ4A 2BZBA 2E9XD 2JQQA 2NW7A 3SFDA 4DV7T 2HN2A 2KNDA 4YFSA 4DV1T 3RF1A 4J2CA 2UUBT 1M62A 2CWYA 2P9BA 5LOVE 2XAGB 4WNKA 4BAYB 3B13A 1T7SA 2LHRA 4HEAA 3PUQA 2X0YA 5LBMA 4GKKT 3ZYLA 4ZI3D 1D0ZA 3CX8B 5LG3A 2D0UA 2HN1A 5L3BB 3HR0A 1I6ZA 2XHEB 2LM9A 1HTJF 2CLYB 1BR4A 2VL0A 2VASA 1D1AA 4AQFA 3AVRA 3OBVE 4TWHA 1WYCA 3T1YT 2BS4A 2XAFB 3UQ7A 3KDSE 4UIGA 2H7VC 4L9IA 1W0AA 2MTQA 3ETUA 4TV8E 4DR7T 3ZMUB 5FL1A 3AXJA 3PUGA 4TV9E 1HG5A 2XTLA 3M3ZB 4DMVA 2K5BB 2IMLA 3UUXB 5HEUA 4LF5T 5FKYA 1X9BA 3O4XE 2M67A 2V7JA 2XQ7A 2WP9A 4AQGA 5AQJB 2JJ9A 2XAHB 4PK4A 4QKNA 2W63A 3ZMVB 3N9OA 3C50A 2JRKA 3RHWA 4X1KE 2I6HA 5C2TA 3ZCIA 2L3LA 2UXBT 3GN5A 4X62T 3RI5A 3PV0F 5C3JA 1FJGT 2DCFA 5HXHA 3N9NA 4HWFA 2G0UA 3MZKB 1YD8G 1VCSA 2N2NA 5JDMA 3AEEA 1J5ET 1KFYA 2FJDA 2W62A 2I59A 2XASB 4ZXLA 3C4ZA 4IREA 3RYHE 3O1JA 2UXCT 4TN7B 3ABVA 4KBMB 2PFVA 4XAXB 4LF9T 3QB5K 2E9XA 4QH4A 3NVOA 3H37A 5CGMA 5HXSA 1LRZA 4YXDA 4EEBA 5LB7B 5DJQC 4JI4T 2PG8A 4JI5T 2RP4A 3RQWA 3JCFA 3PUZF 4ZOLE 4JEHB 3JC6D 4ZS2A 3QUJA 5HXCA 1LKXA 4QXCB 3AEAA 3ONLC 4F8HA 4DBRA 4MALA 4HWIB 2J62A 3N2OA 5HEOA 3FZKB 4CI1B 1D1BA 2YDQA 3CQGB 1BR1A 4P1NA 3IF8B 4I4TE 5DQWA 3ZT7A 4CZZB 3AEDA 5JTGA 3BQLA 2BG9E 2CWOA 5JRCB 3RKOA 5LMUT 1KNZA 4ZI7E 4KUMB 5JR9B 2J1DG 5J0ZA 1IJ6A 3DTOA 2UXXB 3CKDA 4DR2T 2XQ8A 3H3MA 5J1GA 3LJCA 4DR3T 1XNRT 2UXNB 2YU1A 4QH1A 1CUNA 2DL1A 3IBPA 3FBLA 3KBUA 3KVBA 5JH7E 5L3DB 3GMIA 1ZHCA 4B3RT 2CLYC 3BQKA 3E22E 5H6QB 2PJQA 2MYSA 2XSBA 3RIAA 5L3GB 2Q9QB 1HX1B 5EZYE 2XM2A 4NIQA 1G8XA 3AE8A 5AQRB 3Q5EA 1NENA 4JEUB 3PJAJ 4EEDA 5H6RB 2X9WA 2V5DA 2XQ4A 3FZMB 2KWHA 5JDGA 3ETVA 2J47A 2GK9A 3C51A 3RIUA 4DV0T 2EHOB 4JUYA 2CRBA 4DV3T 4IDOA 4KX6A 4B3MT 5AQPB 4WYVA 4JI2T 1NWMX 1T8BA 1OEDA 3L3PA 3CVRA 5CB4E 2A2FX 3AE4A 3JC6C 2V6YA 5KMGP 4YTPA 3RH3A 3V5SA 5FXZA 5JREA 2KT9A 5AQTB 2LKGA 3N2GE 4IDNA 5L3CB 3ONJA 3J9X1 4AKGA 4U7IA 5LGTB 3LDQB 4XZCA 4ISSA 4M1PA 3QOFA 4H9NC 1FMVA 3MACA 2AE9A 3EDVA 3QNUA 2BS2A 3TLWA 1OWAA 3AE5A 4IT4A 3ZMZB 3PDYA 1IBMT 2C0SA 2ZM8A 4UF0A 2W66A 5FYMA 3VR9A 4ANJA 4A5XA 1FIOA 1SHZC 5AQMB 3LK3B 5L47A 1UURA 2C5KT 4X66T 2XQ9A 3NRYA 2IIUA 1XMOT 4X65T 3ZC1A 3ZN1B 3P4QA 4H9QC 3UUBA 3RPUA 2XQ3A 5AQSB 4E7SA 1D0YA 5GONE 3AXJB 3AA7B 3AB3B 2QGSA 3W15B 2CM0A 2H3RA 2XQAA 2LE8A 4GOUA 2Y48B 1YXRA 2L8KA 3ANWA 4EZHA 2QA7A 4ASKA 5JR9C 1T72A 4DV6T 4MFRA 3CMLA 1UK5A 2XSAA 2YKSA 1S94A 5F5WA 4ADZA 1DU2A 2MOZA 2YINA 4UEMA 4LMKA 5IUXA 1EZ3A 5L4EA 2W67A 5JDNA 3K3OA 3ZLIA 2JQKA 2KWIB 2UXDT 3PUWF 3NZQA 3ZT5A 4NXNT 3I0OA 1XMQT 4PJNA 5EK4A 4LF8T 2NP9A 2E5VA 4YT0A 3EAMA 4PJJA 3ESLA 2DWGA 5JQGE 5AQHB 2FUPA 2Q9QC 2N9DA 2KLQA 3WI3A 4WBOA 3EVYA 4H63H 2F4VT 5FXVA 1US7B 2WWUA 3AAIA 1IZNB 2L9QA 3HI2A 4EYYR 2PTFA 4TUYE 4Z91A 4ZHQE 2WQYA 2V5CA 4DVDA 1MMDA 3Q5WA 4NUVA 2VKHA 4B6XA 3L8RA 2UUAT 4PFPA 5AQVB 4JLEA 4JI8T 2XQ5A 1MNEA 2UUCT 4ZS3A 4H9PC 2DNXA 2X67A 1NAFA 3PUYF 3C4WA 4K0KT 4JI6T 3L09A 1XZYA 2ZLYA 3P50A 4PJMA 4YSXA 3T8OA 1XWMA 5HWXA 1CHUA 1ZEEA 2WBLA 4X20E 4AXPA 3N9QA 3LG7A 1Y01A 2XQYA 3KFWX 1BR0A 1U4QA 1UUSA 1LVFA 4IDZA 4AKRB 4GIWA 3ZJ2A 4I43B 2V7IA 4QWNB 2BG9C 3SWHA 1N32T 1X79A 2VQFT 4JYAT 3AAAB 5FL0A 2BG9A 3P4RA 2VVNA 4TNVA 1W9RA 2M6BA 2VB6A 5AQFB 4BJNA 1Z0PA 4YHHT 4DIDB 5JVDE 3T1HT 3QB5A 5HCJA 4YTNA 3R84B 3CK6A 1WYBA 5E0OA 3HKCE 4DR6T 4P0AA 4EB6E 3JADA 2K24A 1N36T 4MHCA 1OEDB 4HWHA 3MKDA 2AXDS 1GQEA 2CE7A 2RPAA 5LHHB 2JPFA 4ISTA 2H7OA 2LOSA 4OX9T 4P0BA 4COFA 2DLRA 2LLYA 5CA0E 4B3TT 4ERRA 1YW0A 2VWAA 1HG2A 3I9YA 4DMWA 2W00A 3K3QC 3CPZA 1HFAA 2ZMAA 4GK0E 3HA4A 2Z6EA 3AE1A 4LMLA 1XNQT 4HFVA 2ACXA 4ILBA 4PK5A 3MA9A 3CWZB 2LSJA 1UX5A 2OLTA 3LBXB 3N9MA 4UF0B 3TLSA 1MIWA 3PE0A 3A8YC 4UV8B 1KK7A 4UVCB 3FZHB 5KX5E 4MLKA 4DUZT 2HHHT 5F3JA 5AQLB 2WS3A 4O2BE 4I0UA 4OFZA 1FMWA 4CXWA 4V1Av 3OYZA 4UVAB 2IW5B 1HNZT 3OPCA 2V8SV 3ONXA 3CX6B 2A9UA 3AVSA 2N1GA 3EDUA 3HKEE 2K9AA 3CIRA 4GYSA 4DV5T 4YLHA 4YJ2E 5C8YE 4IE5A 3A5XA 4DR5T 2K48A 4KP3C 4F6RC 5ABFB 2B1EA 4HE8A 5FMNA 3OJAA 3C64A 4HFCA 3AEGA 4QX8B 4G63A 2BDEA 3JAFA 1B7TA 5LNKA 2XM1A 2WU5A 1YQ3A 4Z90A 4NXMT 5FVKA 2LEHA 2YDSA 2X0HA 4B3ST 1JNRA 5HWYA 2J4GA 4IDPA 3AE9A 3ZMSB 2VKDA 2NTYA 2IHR1 2XZEA 3PU3A 3U3IA 5LMNT 2VQET 1E2AA 1SA0E 3DP7A 3ZEFB 4PK6A 1ZV4X 3PTRB 1JNZA 2X9YA 2CHNA 4O8SA 4AKLA 4DV2T 3NRXA 3VU7H 3KV4A 5HCMA 2V7KA 3QK6A 3SOLA 2BVLA 3AE3A 4QX7B 3MJXA 1QLBA 3UFGA 3EABA 2ACZA 3ZKRA 2ZM0A 2YEVC 1AJ3A 5J2UE 2E8IA 4CI3B 2FBWA 2LKHA 2NOXA 5AQNB 2HPJA 1KNPA 1ZKEA 2IC6A 2Q9QD 3VRAA 5FNVE 4PFOA 3KVAA 2CMRA 2OA5A 3A7MA 4UR9A 3AE6A 1WFDA 2A72A 2BBJA 3ZSTA 4H63V 4JI1T 3ZMTB 4BJMA 5L4HA 5AQQB 2CHOA 2D0TA 3OVUA 2EHOD 4NPPA 1ZP0A 3RQUA 4TZ4C 3MXZA 3N5LA 5FY0A 3ZT6A 4ZZCA 5CA1E 3VKHA 1VCTA 4HTEA 4KHPT 1UCUA 3LK2B 3O1HA 1KEYA 1HNWT 4IDQA 4LF7T 4EV6A 3R6NA 1U5PA 5TAOA 3LFMA 2VKOA 3UFEA 2NW9A 3RC8A 2V7LA 5L2LA 3PUAA 1E1HB 2WWVA 5J2TE 4ILUA 2W4XA 2E5LT 2BBHA 4ZZBA 4X1IE 1QUUA 4YSZA 2M6IA 4N78D 2CPTA 2X68A 3Q5XA 5JRCA 1SUMB 5DQVA 4ILAA 5L3EB 2YDRA 4FJOA 3KV9A 2V6XA 2WSSV 4LF4T 5JR9A 1N33T 3WAKA 3GN5B 4LFCT 3GA8A 1UGOA 3KV5A 4PAGA 4A98A 1UX4A 3B57A 5LA6E 1M7KA 4YHJA 4O4JE 2BS3A 3IHRA 1MNDA 1XDOA 2IDOB 2LJLA 3QC9A 4G2AA 3FHNA 2NTXA 2E9XB 5FVLA 3UU8A 4GK5E 1OEDE 2WDRA 4U2ZA 2V7MA 1N34T 3HKBE 1YKEB 3RYCE 3CQCB 2QYWA 5ETWA 2XQ6A 2X51A 3P4SA 1T98A 2Q9QA 4XBFB 4AKHA 2FJBA 4K0UA 3TLTA 4JI3T 4TNWA 3AECA 4OYJA 1L0VA 3V5UA 3ZCJA 3LK42 4UV9B 2XAQB 3IA3A 4BA9A 2QRXA 3RYIE 3I9WA 5AQOB 2YK0A 4UVBB 2PBIA 3EI0A 2WB5A 2X9XA 2EHOC 4LFBT 2FJAA 4AI6A 4IE4A 4QH5A 1O3XA 1WCRA 2KZ7B 3UTKA 1HF8A 1XDPA 4JI7T 3LSVA 5AFUL 3TLUA 4AKIA 4YSYA 2FJEA 2LRKA 1WRDA 2Y8DA 4H9RC 2LM2A 2BKNA 3HL6A 1HCIA 5AQIB 1VOMA 3UUMA 2WCAA 3IEEA 4QXBB 4KI0F 1Z8UA 2LHNA 3PUSA 2VURA 4DR1T 3FXEB 1HX8A 3HKDE 4I50E 3GWHA 3AE2A 2IC9A 4DO0A 3PU8A 2B76A 3TKLB 2IUBA 4AQFC 3Q5DA 3SRZA 5LG4A 5F8PA 3ZPOA 2W61A 2QVAA 3C98B 3U78A 3K1SA 5LHIB 3Q2MA 3RC3A 5JDHA 5LGUB 2KINB 1R8IA 4O4IE 4U74A 2LT3A 2ES0A 3X1DA 4JV5T 2XAJB 4A56A 2HPLA 3NWIA 4IHJE 2UU9T 3MK7C 2JQ9A 5LBQB 1D1CA 4ZI2D 3PUXF 2ODVA 2V6YB 4CN4A 4H9OC 2H89A 4C90A 2YOEA 5ABGA 1HS7A 1OXZA 3AAEB 4IIJE 5M4YA 4CI2B 3E08A 3RRWA 5EK2A 4KHZF 3DJBA 5IWAT 2E2AA 1E7PA 5LGNB 4IGUA 2R6GF 3S4UA 3ZN0B 2E9XC 3BQIA 4IE7A 1HNXT 4IL4A 3ZYKA 3P8CD 3OTOT 3OYXA 1ZOYA 3RIFA 2CA5A 4AISA 5BR8T 3PUVF 1IBKT 1LVKA 4U72A 4CN6A 4EGWA 4JI0T 3E0ZA 3AEFA 1VRBA 4ZEYA 5FY7A 4O2AE 4EIWA 2YU2A 2LRLA 2DWKA 4TX5A 5HXEA 4ZI3C 5HXRA 2ZM6T 3OKQA 5LJMA 4EAHA 4H9SE 2V1DB 4FI5A 2WZHA 2WAUA 3Q9DA 4DUYT 2XJ7A 2BKPA 2WMNA 2MBGA 3NKZA 4HFEA 4QHOA 2KXPB 3I1AA 3UT5E 3ANWB 2K3WA 2X0LB 5A1LA 3UULA 5LYJE 2LSKA 3F57A 1IBLT 4LF6T 5L3FB 5AQKB 3D0TA 2H88A 2IAKA 2WY2A 5ABHA 3AA1B 1W0BA 3UU4A 3L39A 1S35A 2XUEA 1HR0T 5DABA 1MMAA 2RA1A 4U7YA 5JDQA 3N9LA 3K3NA 5LJNA 1SE7A 3PURA 3TLVA 3F31A 2X9HA 4IE0A 1QSDA 3RKGA 3UU5A 4GYRA 2NW8A 3FBZA 3WAJA 4OHFA 5KDMC 4ZI2C 4PW8A 2OV9A 2D5UA 3G06A 4C91A 5ADXL 2VL8A 4U33A 2ODUA 1V9DA 4EOZB 2W2UA 5FY1A 4X5TA 1MIVA 3RYFE 3K8PC 5LHGB 2MAWA 1D0XA 3UU3A 2C5JA 2CXLA 4HKAA 2CEAA 3FZLB 2WMOA 1H7CA 5FXWA 4AIUA 4DNDA 3VHLA 4O4HE 3RIUC 3JAEA 4DBQA 3AA0B 1J1JA 4TWDA 4HFDA 1KF6A 3RX6A 1OEDC 3P4WA 2V26A 5IHYA 3CQXC 3P4PA 1MMNA 3CX7B 3FZFB 1BR2A 2KMFA 4HN9A 1YKHB 1YQ4A 1I94T 4YJ3E 4HFHA 3ZJ1A 5AQGB 1NEKA 2WM9A 4IE6A 3UQ4A 4Q25A 4A97A 2I0MA 4WW0A 1WR0A 2A3DA 5BMVE 4YTMA 2Y6XA 3AA6B 4UELA 2JQHA 4UXNB 3C4XA 3F2EA 5JDLA 4DV4T 3KV6A 3RGLA 2CXFA 4X64T 2C5IT 4TWFA 3N9PA 4NUUA 2D2SA 2VK9A 2NR4A 2YN6A 1G73A 2BG9B 3LBXA 4YY3T 3O9XA 1IJ5A 5HYAA 1MMGA 2BKOA 4QXHB 3NZPA 5FP3A 5HEJA 5LCYA 4AQYT 2BVMA 5HEGA 4L0RA 3AE7A 4HGAA 2VVSA 4CXYA 2HH7A 3BK9A 3UUNA 3KINB 5ABEA 4EXTA 3PJAA 3RLFF 2MPKA 4OYKA 1KNRA 4LMJA 5CFBA 3ZYMA 4I55E 4HFIA 2CBIA 3M65A 4WZXA 4CN1A 4HWDA 4LFAT 2WDVA 4L5GA 2D9DA 1FEWA 5IYZE 4EYUA 3H3AA 2JMKA 3ZC0A 3UU6A 2WDQA 3VKGA
chains in the Genus database with same CATH topology
4DV1T 5LMNT 1HR0T 2UUBT 5IWAT 4DV0T 4DR1T 2VQET 4DV3T 4B3MT 5LMUT 4YHHT 4KHPT 1N34T 4DUZT 2UXBT 4JI2T 2HHHT 1HNXT 4X62T 4DV4T 3OTOT 4GKJT 3T1HT 4DV2T 1HNWT 1FJGT 4X64T 2UUAT 4LF7T 5BR8T 4DR6T 4JI3T 4DR2T 1IBKT 4JI8T 1HNZT 4JI0T 1J5ET 4DV6T 4GKKT 2UUCT 4DR3T 1XNRT 4DR4T 1N36T 4DV5T 4DR5T 2E5LT 4JI6T 2UXCT 4K0KT 4LFBT 4YY3T 4LF9T 3T1YT 4AQYT 4OX9T 4JV5T 2UXDT 2ZM6T 4B3RT 4NXNT 2UU9T 4JI4T 1XMQT 4JI7T 4LF4T 1N33T 1IBMT 4JI5T 4B3TT 4LF8T 4DUYT 4DR7T 4LFCT 4NXMT 4B3ST 1XNQT 4LFAT 4JI1T 1N32T 4X66T 1IBLT 4LF5T 4LF6T 2VQFT 1XMOT 4JYAT 4X65T 2F4VT 4DV7T 1I94T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV1 T;  5LMN T;  1HR0 T;  2UUB T;  5IWA T;  4DV0 T;  4DR1 T;  2VQE T;  4DV3 T;  4B3M T;  5LMU T;  4YHH T;  4KHP T;  1N34 T;  4DUZ T;  2UXB T;  4JI2 T;  2HHH T;  1HNX T;  4X62 T;  4DV4 T;  3OTO T;  4GKJ T;  3T1H T;  4DV2 T;  1HNW T;  1FJG T;  4X64 T;  2UUA T;  4LF7 T;  5BR8 T;  4DR6 T;  4JI3 T;  4DR2 T;  1IBK T;  4JI8 T;  1HNZ T;  4JI0 T;  1J5E T;  4DV6 T;  4GKK T;  2UUC T;  4DR3 T;  1XNR T;  4DR4 T;  1N36 T;  4DV5 T;  4DR5 T;  2E5L T;  4JI6 T;  2UXC T;  4K0K T;  4LFB T;  4YY3 T;  4LF9 T;  3T1Y T;  4AQY T;  4OX9 T;  4JV5 T;  2UXD T;  2ZM6 T;  4B3R T;  4NXN T;  2UU9 T;  4JI4 T;  1XMQ T;  4JI7 T;  4LF4 T;  1N33 T;  1IBM T;  4JI5 T;  4B3T T;  4LF8 T;  4DUY T;  4DR7 T;  4LFC T;  4NXM T;  4B3S T;  1XNQ T;  4LFA T;  4JI1 T;  1N32 T;  4X66 T;  1IBL T;  4LF5 T;  4LF6 T;  2VQF T;  1XMO T;  4JYA T;  4X65 T;  2F4V T;  4DV7 T;  1I94 T; 
#chains in the Genus database with same CATH topology
 5JDF A;  4JBW F;  5CJ5 A;  3O1I A;  4E7Z A;  2LSI A;  5LXT E;  1WLX A;  5ABF A;  4WBN E;  5FXX A;  2DI4 A;  2WU2 A;  3FB2 A;  3KBT A;  2CBJ A;  2W0G A;  2XPK A;  4Z8X A;  4CQI A;  5KXJ A;  3SFE A;  5AQU B;  2XY8 B;  4GKJ T;  3AEB A;  1Y64 B;  5EK3 A;  2VKJ A;  4MBQ A;  3NBX X;  1W09 A;  2LSG A;  4HFB A;  4O4L E;  4PNI A;  4U31 A;  3EHZ A;  1J5W A;  4IL9 A;  4DR4 T;  2SPC A;  2WZI A;  3FXD B;  3VRB A;  4PJL A;  3SS1 A;  2NWB A;  2JIW A;  3J7Y q;  4X1Y E;  2LSY A;  3N2K E;  3B5M A;  2CCQ A;  5HEH A;  4OK0 A;  2JMH A;  4U3C A;  2KSR A;  3P7I A;  2DHR A;  3EUH A;  5HAX A;  5LP6 E;  3VR8 A;  4P09 A;  1MIY A;  2X66 A;  4U2Y A;  3ZSS A;  4KMC A;  2CXD A;  4CXX A;  2LOP A;  1WR6 A;  2EHO A;  4ILC A;  3I0Q A;  1IAP A;  4HWC A;  3RRC A;  2ZM2 A;  4EZ4 A;  2BZB A;  2E9X D;  2JQQ A;  2NW7 A;  3SFD A;  4DV7 T;  2HN2 A;  2KND A;  4YFS A;  4DV1 T;  3RF1 A;  4J2C A;  2UUB T;  1M62 A;  2CWY A;  2P9B A;  5LOV E;  2XAG B;  4WNK A;  4BAY B;  3B13 A;  1T7S A;  2LHR A;  4HEA A;  3PUQ A;  2X0Y A;  5LBM A;  4GKK T;  3ZYL A;  4ZI3 D;  1D0Z A;  3CX8 B;  5LG3 A;  2D0U A;  2HN1 A;  5L3B B;  3HR0 A;  1I6Z A;  2XHE B;  2LM9 A;  1HTJ F;  2CLY B;  1BR4 A;  2VL0 A;  2VAS A;  1D1A A;  4AQF A;  3AVR A;  3OBV E;  4TWH A;  1WYC A;  3T1Y T;  2BS4 A;  2XAF B;  3UQ7 A;  3KDS E;  4UIG A;  2H7V C;  4L9I A;  1W0A A;  2MTQ A;  3ETU A;  4TV8 E;  4DR7 T;  3ZMU B;  5FL1 A;  3AXJ A;  3PUG A;  4TV9 E;  1HG5 A;  2XTL A;  3M3Z B;  4DMV A;  2K5B B;  2IML A;  3UUX B;  5HEU A;  4LF5 T;  5FKY A;  1X9B A;  3O4X E;  2M67 A;  2V7J A;  2XQ7 A;  2WP9 A;  4AQG A;  5AQJ B;  2JJ9 A;  2XAH B;  4PK4 A;  4QKN A;  2W63 A;  3ZMV B;  3N9O A;  3C50 A;  2JRK A;  3RHW A;  4X1K E;  2I6H A;  5C2T A;  3ZCI A;  2L3L A;  2UXB T;  3GN5 A;  4X62 T;  3RI5 A;  3PV0 F;  5C3J A;  1FJG T;  2DCF A;  5HXH A;  3N9N A;  4HWF A;  2G0U A;  3MZK B;  1YD8 G;  1VCS A;  2N2N A;  5JDM A;  3AEE A;  1J5E T;  1KFY A;  2FJD A;  2W62 A;  2I59 A;  2XAS B;  4ZXL A;  3C4Z A;  4IRE A;  3RYH E;  3O1J A;  2UXC T;  4TN7 B;  3ABV A;  4KBM B;  2PFV A;  4XAX B;  4LF9 T;  3QB5 K;  2E9X A;  4QH4 A;  3NVO A;  3H37 A;  5CGM A;  5HXS A;  1LRZ A;  4YXD A;  4EEB A;  5LB7 B;  5DJQ C;  4JI4 T;  2PG8 A;  4JI5 T;  2RP4 A;  3RQW A;  3JCF A;  3PUZ F;  4ZOL E;  4JEH B;  3JC6 D;  4ZS2 A;  3QUJ A;  5HXC A;  1LKX A;  4QXC B;  3AEA A;  3ONL C;  4F8H A;  4DBR A;  4MAL A;  4HWI B;  2J62 A;  3N2O A;  5HEO A;  3FZK B;  4CI1 B;  1D1B A;  2YDQ A;  3CQG B;  1BR1 A;  4P1N A;  3IF8 B;  4I4T E;  5DQW A;  3ZT7 A;  4CZZ B;  3AED A;  5JTG A;  3BQL A;  2BG9 E;  2CWO A;  5JRC B;  3RKO A;  5LMU T;  1KNZ A;  4ZI7 E;  4KUM B;  5JR9 B;  2J1D G;  5J0Z A;  1IJ6 A;  3DTO A;  2UXX B;  3CKD A;  4DR2 T;  2XQ8 A;  3H3M A;  5J1G A;  3LJC A;  4DR3 T;  1XNR T;  2UXN B;  2YU1 A;  4QH1 A;  1CUN A;  2DL1 A;  3IBP A;  3FBL A;  3KBU A;  3KVB A;  5JH7 E;  5L3D B;  3GMI A;  1ZHC A;  4B3R T;  2CLY C;  3BQK A;  3E22 E;  5H6Q B;  2PJQ A;  2MYS A;  2XSB A;  3RIA A;  5L3G B;  2Q9Q B;  1HX1 B;  5EZY E;  2XM2 A;  4NIQ A;  1G8X A;  3AE8 A;  5AQR B;  3Q5E A;  1NEN A;  4JEU B;  3PJA J;  4EED A;  5H6R B;  2X9W A;  2V5D A;  2XQ4 A;  3FZM B;  2KWH A;  5JDG A;  3ETV A;  2J47 A;  2GK9 A;  3C51 A;  3RIU A;  4DV0 T;  2EHO B;  4JUY A;  2CRB A;  4DV3 T;  4IDO A;  4KX6 A;  4B3M T;  5AQP B;  4WYV A;  4JI2 T;  1NWM X;  1T8B A;  1OED A;  3L3P A;  3CVR A;  5CB4 E;  2A2F X;  3AE4 A;  3JC6 C;  2V6Y A;  5KMG P;  4YTP A;  3RH3 A;  3V5S A;  5FXZ A;  5JRE A;  2KT9 A;  5AQT B;  2LKG A;  3N2G E;  4IDN A;  5L3C B;  3ONJ A;  3J9X 1;  4AKG A;  4U7I A;  5LGT B;  3LDQ B;  4XZC A;  4ISS A;  4M1P A;  3QOF A;  4H9N C;  1FMV A;  3MAC A;  2AE9 A;  3EDV A;  3QNU A;  2BS2 A;  3TLW A;  1OWA A;  3AE5 A;  4IT4 A;  3ZMZ B;  3PDY A;  1IBM T;  2C0S A;  2ZM8 A;  4UF0 A;  2W66 A;  5FYM A;  3VR9 A;  4ANJ A;  4A5X A;  1FIO A;  1SHZ C;  5AQM B;  3LK3 B;  5L47 A;  1UUR A;  2C5K T;  4X66 T;  2XQ9 A;  3NRY A;  2IIU A;  1XMO T;  4X65 T;  3ZC1 A;  3ZN1 B;  3P4Q A;  4H9Q C;  3UUB A;  3RPU A;  2XQ3 A;  5AQS B;  4E7S A;  1D0Y A;  5GON E;  3AXJ B;  3AA7 B;  3AB3 B;  2QGS A;  3W15 B;  2CM0 A;  2H3R A;  2XQA A;  2LE8 A;  4GOU A;  2Y48 B;  1YXR A;  2L8K A;  3ANW A;  4EZH A;  2QA7 A;  4ASK A;  5JR9 C;  1T72 A;  4DV6 T;  4MFR A;  3CML A;  1UK5 A;  2XSA A;  2YKS A;  1S94 A;  5F5W A;  4ADZ A;  1DU2 A;  2MOZ A;  2YIN A;  4UEM A;  4LMK A;  5IUX A;  1EZ3 A;  5L4E A;  2W67 A;  5JDN A;  3K3O A;  3ZLI A;  2JQK A;  2KWI B;  2UXD T;  3PUW F;  3NZQ A;  3ZT5 A;  4NXN T;  3I0O A;  1XMQ T;  4PJN A;  5EK4 A;  4LF8 T;  2NP9 A;  2E5V A;  4YT0 A;  3EAM A;  4PJJ A;  3ESL A;  2DWG A;  5JQG E;  5AQH B;  2FUP A;  2Q9Q C;  2N9D A;  2KLQ A;  3WI3 A;  4WBO A;  3EVY A;  4H63 H;  2F4V T;  5FXV A;  1US7 B;  2WWU A;  3AAI A;  1IZN B;  2L9Q A;  3HI2 A;  4EYY R;  2PTF A;  4TUY E;  4Z91 A;  4ZHQ E;  2WQY A;  2V5C A;  4DVD A;  1MMD A;  3Q5W A;  4NUV A;  2VKH A;  4B6X A;  3L8R A;  2UUA T;  4PFP A;  5AQV B;  4JLE A;  4JI8 T;  2XQ5 A;  1MNE A;  2UUC T;  4ZS3 A;  4H9P C;  2DNX A;  2X67 A;  1NAF A;  3PUY F;  3C4W A;  4K0K T;  4JI6 T;  3L09 A;  1XZY A;  2ZLY A;  3P50 A;  4PJM A;  4YSX A;  3T8O A;  1XWM A;  5HWX A;  1CHU A;  1ZEE A;  2WBL A;  4X20 E;  4AXP A;  3N9Q A;  3LG7 A;  1Y01 A;  2XQY A;  3KFW X;  1BR0 A;  1U4Q A;  1UUS A;  1LVF A;  4IDZ A;  4AKR B;  4GIW A;  3ZJ2 A;  4I43 B;  2V7I A;  4QWN B;  2BG9 C;  3SWH A;  1N32 T;  1X79 A;  2VQF T;  4JYA T;  3AAA B;  5FL0 A;  2BG9 A;  3P4R A;  2VVN A;  4TNV A;  1W9R A;  2M6B A;  2VB6 A;  5AQF B;  4BJN A;  1Z0P A;  4YHH T;  4DID B;  5JVD E;  3T1H T;  3QB5 A;  5HCJ A;  4YTN A;  3R84 B;  3CK6 A;  1WYB A;  5E0O A;  3HKC E;  4DR6 T;  4P0A A;  4EB6 E;  3JAD A;  2K24 A;  1N36 T;  4MHC A;  1OED B;  4HWH A;  3MKD A;  2AXD S;  1GQE A;  2CE7 A;  2RPA A;  5LHH B;  2JPF A;  4IST A;  2H7O A;  2LOS A;  4OX9 T;  4P0B A;  4COF A;  2DLR A;  2LLY A;  5CA0 E;  4B3T T;  4ERR A;  1YW0 A;  2VWA A;  1HG2 A;  3I9Y A;  4DMW A;  2W00 A;  3K3Q C;  3CPZ A;  1HFA A;  2ZMA A;  4GK0 E;  3HA4 A;  2Z6E A;  3AE1 A;  4LML A;  1XNQ T;  4HFV A;  2ACX A;  4ILB A;  4PK5 A;  3MA9 A;  3CWZ B;  2LSJ A;  1UX5 A;  2OLT A;  3LBX B;  3N9M A;  4UF0 B;  3TLS A;  1MIW A;  3PE0 A;  3A8Y C;  4UV8 B;  1KK7 A;  4UVC B;  3FZH B;  5KX5 E;  4MLK A;  4DUZ T;  2HHH T;  5F3J A;  5AQL B;  2WS3 A;  4O2B E;  4I0U A;  4OFZ A;  1FMW A;  4CXW A;  4V1A v;  3OYZ A;  4UVA B;  2IW5 B;  1HNZ T;  3OPC A;  2V8S V;  3ONX A;  3CX6 B;  2A9U A;  3AVS A;  2N1G A;  3EDU A;  3HKE E;  2K9A A;  3CIR A;  4GYS A;  4DV5 T;  4YLH A;  4YJ2 E;  5C8Y E;  4IE5 A;  3A5X A;  4DR5 T;  2K48 A;  4KP3 C;  4F6R C;  5ABF B;  2B1E A;  4HE8 A;  5FMN A;  3OJA A;  3C64 A;  4HFC A;  3AEG A;  4QX8 B;  4G63 A;  2BDE A;  3JAF A;  1B7T A;  5LNK A;  2XM1 A;  2WU5 A;  1YQ3 A;  4Z90 A;  4NXM T;  5FVK A;  2LEH A;  2YDS A;  2X0H A;  4B3S T;  1JNR A;  5HWY A;  2J4G A;  4IDP A;  3AE9 A;  3ZMS B;  2VKD A;  2NTY A;  2IHR 1;  2XZE A;  3PU3 A;  3U3I A;  5LMN T;  2VQE T;  1E2A A;  1SA0 E;  3DP7 A;  3ZEF B;  4PK6 A;  1ZV4 X;  3PTR B;  1JNZ A;  2X9Y A;  2CHN A;  4O8S A;  4AKL A;  4DV2 T;  3NRX A;  3VU7 H;  3KV4 A;  5HCM A;  2V7K A;  3QK6 A;  3SOL A;  2BVL A;  3AE3 A;  4QX7 B;  3MJX A;  1QLB A;  3UFG A;  3EAB A;  2ACZ A;  3ZKR A;  2ZM0 A;  2YEV C;  1AJ3 A;  5J2U E;  2E8I A;  4CI3 B;  2FBW A;  2LKH A;  2NOX A;  5AQN B;  2HPJ A;  1KNP A;  1ZKE A;  2IC6 A;  2Q9Q D;  3VRA A;  5FNV E;  4PFO A;  3KVA A;  2CMR A;  2OA5 A;  3A7M A;  4UR9 A;  3AE6 A;  1WFD A;  2A72 A;  2BBJ A;  3ZST A;  4H63 V;  4JI1 T;  3ZMT B;  4BJM A;  5L4H A;  5AQQ B;  2CHO A;  2D0T A;  3OVU A;  2EHO D;  4NPP A;  1ZP0 A;  3RQU A;  4TZ4 C;  3MXZ A;  3N5L A;  5FY0 A;  3ZT6 A;  4ZZC A;  5CA1 E;  3VKH A;  1VCT A;  4HTE A;  4KHP T;  1UCU A;  3LK2 B;  3O1H A;  1KEY A;  1HNW T;  4IDQ A;  4LF7 T;  4EV6 A;  3R6N A;  1U5P A;  5TAO A;  3LFM A;  2VKO A;  3UFE A;  2NW9 A;  3RC8 A;  2V7L A;  5L2L A;  3PUA A;  1E1H B;  2WWV A;  5J2T E;  4ILU A;  2W4X A;  2E5L T;  2BBH A;  4ZZB A;  4X1I E;  1QUU A;  4YSZ A;  2M6I A;  4N78 D;  2CPT A;  2X68 A;  3Q5X A;  5JRC A;  1SUM B;  5DQV A;  4ILA A;  5L3E B;  2YDR A;  4FJO A;  3KV9 A;  2V6X A;  2WSS V;  4LF4 T;  5JR9 A;  1N33 T;  3WAK A;  3GN5 B;  4LFC T;  3GA8 A;  1UGO A;  3KV5 A;  4PAG A;  4A98 A;  1UX4 A;  3B57 A;  5LA6 E;  1M7K A;  4YHJ A;  4O4J E;  2BS3 A;  3IHR A;  1MND A;  1XDO A;  2IDO B;  2LJL A;  3QC9 A;  4G2A A;  3FHN A;  2NTX A;  2E9X B;  5FVL A;  3UU8 A;  4GK5 E;  1OED E;  2WDR A;  4U2Z A;  2V7M A;  1N34 T;  3HKB E;  1YKE B;  3RYC E;  3CQC B;  2QYW A;  5ETW A;  2XQ6 A;  2X51 A;  3P4S A;  1T98 A;  2Q9Q A;  4XBF B;  4AKH A;  2FJB A;  4K0U A;  3TLT A;  4JI3 T;  4TNW A;  3AEC A;  4OYJ A;  1L0V A;  3V5U A;  3ZCJ A;  3LK4 2;  4UV9 B;  2XAQ B;  3IA3 A;  4BA9 A;  2QRX A;  3RYI E;  3I9W A;  5AQO B;  2YK0 A;  4UVB B;  2PBI A;  3EI0 A;  2WB5 A;  2X9X A;  2EHO C;  4LFB T;  2FJA A;  4AI6 A;  4IE4 A;  4QH5 A;  1O3X A;  1WCR A;  2KZ7 B;  3UTK A;  1HF8 A;  1XDP A;  4JI7 T;  3LSV A;  5AFU L;  3TLU A;  4AKI A;  4YSY A;  2FJE A;  2LRK A;  1WRD A;  2Y8D A;  4H9R C;  2LM2 A;  2BKN A;  3HL6 A;  1HCI A;  5AQI B;  1VOM A;  3UUM A;  2WCA A;  3IEE A;  4QXB B;  4KI0 F;  1Z8U A;  2LHN A;  3PUS A;  2VUR A;  4DR1 T;  3FXE B;  1HX8 A;  3HKD E;  4I50 E;  3GWH A;  3AE2 A;  2IC9 A;  4DO0 A;  3PU8 A;  2B76 A;  3TKL B;  2IUB A;  4AQF C;  3Q5D A;  3SRZ A;  5LG4 A;  5F8P A;  3ZPO A;  2W61 A;  2QVA A;  3C98 B;  3U78 A;  3K1S A;  5LHI B;  3Q2M A;  3RC3 A;  5JDH A;  5LGU B;  2KIN B;  1R8I A;  4O4I E;  4U74 A;  2LT3 A;  2ES0 A;  3X1D A;  4JV5 T;  2XAJ B;  4A56 A;  2HPL A;  3NWI A;  4IHJ E;  2UU9 T;  3MK7 C;  2JQ9 A;  5LBQ B;  1D1C A;  4ZI2 D;  3PUX F;  2ODV A;  2V6Y B;  4CN4 A;  4H9O C;  2H89 A;  4C90 A;  2YOE A;  5ABG A;  1HS7 A;  1OXZ A;  3AAE B;  4IIJ E;  5M4Y A;  4CI2 B;  3E08 A;  3RRW A;  5EK2 A;  4KHZ F;  3DJB A;  5IWA T;  2E2A A;  1E7P A;  5LGN B;  4IGU A;  2R6G F;  3S4U A;  3ZN0 B;  2E9X C;  3BQI A;  4IE7 A;  1HNX T;  4IL4 A;  3ZYK A;  3P8C D;  3OTO T;  3OYX A;  1ZOY A;  3RIF A;  2CA5 A;  4AIS A;  5BR8 T;  3PUV F;  1IBK T;  1LVK A;  4U72 A;  4CN6 A;  4EGW A;  4JI0 T;  3E0Z A;  3AEF A;  1VRB A;  4ZEY A;  5FY7 A;  4O2A E;  4EIW A;  2YU2 A;  2LRL A;  2DWK A;  4TX5 A;  5HXE A;  4ZI3 C;  5HXR A;  2ZM6 T;  3OKQ A;  5LJM A;  4EAH A;  4H9S E;  2V1D B;  4FI5 A;  2WZH A;  2WAU A;  3Q9D A;  4DUY T;  2XJ7 A;  2BKP A;  2WMN A;  2MBG A;  3NKZ A;  4HFE A;  4QHO A;  2KXP B;  3I1A A;  3UT5 E;  3ANW B;  2K3W A;  2X0L B;  5A1L A;  3UUL A;  5LYJ E;  2LSK A;  3F57 A;  1IBL T;  4LF6 T;  5L3F B;  5AQK B;  3D0T A;  2H88 A;  2IAK A;  2WY2 A;  5ABH A;  3AA1 B;  1W0B A;  3UU4 A;  3L39 A;  1S35 A;  2XUE A;  1HR0 T;  5DAB A;  1MMA A;  2RA1 A;  4U7Y A;  5JDQ A;  3N9L A;  3K3N A;  5LJN A;  1SE7 A;  3PUR A;  3TLV A;  3F31 A;  2X9H A;  4IE0 A;  1QSD A;  3RKG A;  3UU5 A;  4GYR A;  2NW8 A;  3FBZ A;  3WAJ A;  4OHF A;  5KDM C;  4ZI2 C;  4PW8 A;  2OV9 A;  2D5U A;  3G06 A;  4C91 A;  5ADX L;  2VL8 A;  4U33 A;  2ODU A;  1V9D A;  4EOZ B;  2W2U A;  5FY1 A;  4X5T A;  1MIV A;  3RYF E;  3K8P C;  5LHG B;  2MAW A;  1D0X A;  3UU3 A;  2C5J A;  2CXL A;  4HKA A;  2CEA A;  3FZL B;  2WMO A;  1H7C A;  5FXW A;  4AIU A;  4DND A;  3VHL A;  4O4H E;  3RIU C;  3JAE A;  4DBQ A;  3AA0 B;  1J1J A;  4TWD A;  4HFD A;  1KF6 A;  3RX6 A;  1OED C;  3P4W A;  2V26 A;  5IHY A;  3CQX C;  3P4P A;  1MMN A;  3CX7 B;  3FZF B;  1BR2 A;  2KMF A;  4HN9 A;  1YKH B;  1YQ4 A;  1I94 T;  4YJ3 E;  4HFH A;  3ZJ1 A;  5AQG B;  1NEK A;  2WM9 A;  4IE6 A;  3UQ4 A;  4Q25 A;  4A97 A;  2I0M A;  4WW0 A;  1WR0 A;  2A3D A;  5BMV E;  4YTM A;  2Y6X A;  3AA6 B;  4UEL A;  2JQH A;  4UXN B;  3C4X A;  3F2E A;  5JDL A;  4DV4 T;  3KV6 A;  3RGL A;  2CXF A;  4X64 T;  2C5I T;  4TWF A;  3N9P A;  4NUU A;  2D2S A;  2VK9 A;  2NR4 A;  2YN6 A;  1G73 A;  2BG9 B;  3LBX A;  4YY3 T;  3O9X A;  1IJ5 A;  5HYA A;  1MMG A;  2BKO A;  4QXH B;  3NZP A;  5FP3 A;  5HEJ A;  5LCY A;  4AQY T;  2BVM A;  5HEG A;  4L0R A;  3AE7 A;  4HGA A;  2VVS A;  4CXY A;  2HH7 A;  3BK9 A;  3UUN A;  3KIN B;  5ABE A;  4EXT A;  3PJA A;  3RLF F;  2MPK A;  4OYK A;  1KNR A;  4LMJ A;  5CFB A;  3ZYM A;  4I55 E;  4HFI A;  2CBI A;  3M65 A;  4WZX A;  4CN1 A;  4HWD A;  4LFA T;  2WDV A;  4L5G A;  2D9D A;  1FEW A;  5IYZ E;  4EYU A;  3H3A A;  2JMK A;  3ZC0 A;  3UU6 A;  2WDQ A;  3VKG A; 
#chains in the Genus database with same CATH homology
 4DV1 T;  5LMN T;  1HR0 T;  2UUB T;  5IWA T;  4DV0 T;  4DR1 T;  2VQE T;  4DV3 T;  4B3M T;  5LMU T;  4YHH T;  4KHP T;  1N34 T;  4DUZ T;  2UXB T;  4JI2 T;  2HHH T;  1HNX T;  4X62 T;  4DV4 T;  3OTO T;  4GKJ T;  3T1H T;  4DV2 T;  1HNW T;  1FJG T;  4X64 T;  2UUA T;  4LF7 T;  5BR8 T;  4DR6 T;  4JI3 T;  4DR2 T;  1IBK T;  4JI8 T;  1HNZ T;  4JI0 T;  1J5E T;  4DV6 T;  4GKK T;  2UUC T;  4DR3 T;  1XNR T;  4DR4 T;  1N36 T;  4DV5 T;  4DR5 T;  2E5L T;  4JI6 T;  2UXC T;  4K0K T;  4LFB T;  4YY3 T;  4LF9 T;  3T1Y T;  4AQY T;  4OX9 T;  4JV5 T;  2UXD T;  2ZM6 T;  4B3R T;  4NXN T;  2UU9 T;  4JI4 T;  1XMQ T;  4JI7 T;  4LF4 T;  1N33 T;  1IBM T;  4JI5 T;  4B3T T;  4LF8 T;  4DUY T;  4DR7 T;  4LFC T;  4NXM T;  4B3S T;  1XNQ T;  4LFA T;  4JI1 T;  1N32 T;  4X66 T;  1IBL T;  4LF5 T;  4LF6 T;  2VQF T;  1XMO T;  4JYA T;  4X65 T;  2F4V T;  4DV7 T;  1I94 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...