5LMNT

Structure of bacterial 30s-if1-if3-mrna translation pre-initiation complex (state-1a)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 5lmnT00
4LFAT 4B3RT 4LF6T 4X64T 4LF4T 3T1HT 4DUZT 1XMOT 4LF7T 4JI7T 2UUCT 4DR4T 1XNQT 1HNXT 4DR5T 4X66T 4DR2T 4JV5T 4LF9T 1N32T 2VQFT 4JI4T 1IBKT 4YHHT 4LF8T 5LMNT 2UXBT 4JI8T 2VQET 2F4VT 4KHPT 4DR6T 4DV5T 2E5LT 1XMQT 1N33T 1J5ET 4JI0T 4DV7T 4OX9T 1XNRT 4DV3T 4DV1T 4B3MT 4NXMT 2HHHT 4B3TT 4JI2T 1IBLT 4JI1T 3OTOT 4DR7T 3T1YT 4JI5T 4NXNT 5IWAT 4JI3T 4DR3T 4DV6T 4YY3T 4DUYT 1HNWT 1HR0T 4X62T 1IBMT 2ZM6T 1HNZT 4JI6T 4LFBT 4K0KT 1N34T 1FJGT 2UUAT 4JYAT 2UUBT 1I94T 5LMUT 2UXCT 4DV0T 4DR1T 4DV2T 4LFCT 4AQYT 4B3ST 4LF5T 2UU9T 5BR8T 4GKKT 1N36T 4DV4T 2UXDT 4GKJT 4X65T
chains in the Genus database with same CATH superfamily
3M3ZB 2W67A 3OPCA 4LF7T 4HFCA 2XHEB 2W66A 2K3WA 3NWIA 4J2CA 3R84B 3MZKB 4MLKA 4U31A 4YLHA 4CN4A 3ZMZB 4EAHA 4AKGA 1YW0A 4GK5E 3P4QA 4QH4A 1ZKEA 1WR6A 4AQGA 2JMKA 4JI8T 3KV5A 3LG7A 5LGUB 3AA1B 3AE3A 2V6XA 2ZM8A 3ZPOA 3AVSA 3Q5DA 3IBPA 4JBWF 2ACZA 3JADA 5ABFA 2LSJA 3UFEA 2AE9A 4PK5A 5AFUL 5KXJA 3O1IA 3ANWB 2WCAA 5EK3A 2B76A 2QRXA 4EZHA 1T98A 5JDMA 4YY3T 2IMLA 2JMHA 5J0ZA 5AQTB 5HXRA 2YKSA 3KV6A 2CEAA 3LFMA 3QOFA 3FZFB 2NR4A 1N34T 4FJOA 4PK4A 2JQKA 4JYAT 5LBMA 2CXLA 1D0YA 3RC3A 3PU8A 2V7LA 2V6YA 3UUXB 5BMVE 2XQ8A 2J4GA 2WU5A 5GONE 3H3AA 3AE5A 2CBIA 2JQQA 1LVFA 2QVAA 3PUQA 2BVLA 4OFZA 4EIWA 2CMRA 5HCMA 3RI5A 4PNIA 3AXJB 2YDRA 4WBNE 5ETWA 2PFVA 3UU8A 3ZJ2A 4YFSA 3ETUA 3C4WA 5ABHA 3AE8A 2ZM2A 1D0XA 3I1AA 2WAUA 4H9OC 2FBWA 3ZN0B 4NIQA 1DU2A 2JRKA 5HCJA 3AEDA 3TLUA 2LSGA 5ADXL 5TAOA 3DTOA 3ZCJA 4B3MT 3KVBA 3ZN1B 4KI0F 2V7JA 1Y01A 4M1PA 4NXNT 3E08A 2QGSA 3ESLA 4ZI3C 4EXTA 1HX8A 1HCIA 1Z8UA 2VURA 2J62A 2E9XC 2DCFA 3KBTA 2ODVA 4UELA 2WDVA 2KLQA 4GYSA 4XZCA 4Z8XA 3ZYKA 4TNWA 3ZMSB 4H9QC 3KV4A 2A9UA 3KBUA 3QK6A 4E7ZA 3FHNA 4TZ4C 4AQYT 1MMGA 3CX8B 2J1DG 2D0UA 2DNXA 2HPJA 1N36T 2JJ9A 3P4RA 2YK0A 2P9BA 4LF4T 3RF1A 2UUCT 4C90A 5JQGE 2NTXA 2VWAA 2D5UA 5HEUA 4U2YA 4AXPA 1G8XA 5FXZA 1JNRA 3SFDA 2EHOA 2QA7A 4QKNA 5H6RB 2YDQA 4YSYA 2BS4A 2KINB 2D2SA 2DI4A 2D0TA 2K48A 4HN9A 2X51A 4ADZA 2EHOD 5E0OA 4IL4A 4DR7T 4HFIA 3MKDA 1HX1B 4AQFC 3PUZF 4HE8A 1YD8G 2XZEA 4PJMA 4UV9B 3ZKRA 4IDQA 4O2AE 4UF0A 1HNZT 2YINA 5AQOB 3RHWA 2D9DA 3I9WA 3PTRB 2MAWA 3PUAA 3PURA 1VCSA 4DV2T 2ZM0A 5KDMC 4C91A 5AQRB 3AAEB 5IYZE 4QWNB 3DJBA 5FXWA 2LT3A 4ERRA 2YU2A 2R6GF 4PFPA 3PV0F 3GA8A 2J47A 5LP6E 2XQ7A 2LLYA 2JQHA 3EDUA 4IE4A 3CIRA 4BJMA 3RIFA 4ZEYA 1KNRA 4G63A 2LHNA 3UU6A 4U3CA 5LA6E 3PUVF 4B6XA 4H63H 5FY7A 4QXBB 4QH1A 2XAQB 3U78A 4OX9T 2MBGA 2NW9A 1XDOA 4DIDB 3LBXA 5FVLA 4ILBA 3RC8A 2WY2A 5L47A 2CHNA 4P0AA 3C64A 5AQVB 3H3MA 5HWXA 3NRYA 3BQIA 2XQ3A 2SPCA 3HKDE 5AQKB 4OHFA 5LJNA 3LK2B 3ZT5A 2V26A 2FJBA 2DHRA 3EI0A 4OK0A 2BBJA 3AEFA 1G73A 5HXSA 3F31A 5AQHB 2CXDA 5L4HA 5JDGA 4WYVA 5LHIB 2YDSA 2NW7A 2AXDS 1WLXA 4ISSA 5JVDE 2WM9A 1V9DA 4ILAA 5AQMB 2GK9A 4DR6T 1LVKA 4CN6A 1N33T 1E1HB 4HWIB 5IUXA 3K3OA 4COFA 5L3FB 3MXZA 4B3TT 4L9IA 4IREA 5AQJB 2CLYC 5L3GB 5JR9C 2HPLA 3N2KE 2X9YA 4UVCB 4HFDA 3MACA 2CWOA 4O8SA 3KFWX 2BG9A 1ZOYA 2YEVC 5FXXA 3FBZA 4K0KT 1OEDA 3ZT6A 3ZMVB 4QX8B 5H6QB 5FY0A 3VHLA 3AECA 5LHHB 2Y48B 3CQCB 3HL6A 3ABVA 2VKJA 5FL1A 4KP3C 1GQEA 3RIAA 3Q5EA 1WCRA 3N9QA 4HGAA 3RYHE 4TV9E 4HKAA 2JIWA 4BAYB 3FZMB 2CHOA 4JI7T 3H37A 5AQFB 1HNXT 1QUUA 4DR2T 1N32T 2CPTA 2BKNA 2XAJB 2ZMAA 3MK7C 4H9RC 3AEEA 4JI4T 5C3JA 3S4UA 3AB3B 2MTQA 4QX7B 4IE7A 1J5WA 3SWHA 3BK9A 4MFRA 3BQLA 2LKGA 3I0QA 5CA0E 2RPAA 5LB7B 2RP4A 1WYBA 2DWKA 4JI1T 2XAHB 2VL8A 3V5SA 3ZT7A 4EEDA 4EV6A 5C8YE 4LMLA 4DV6T 1L0VA 3RYFE 3ZSSA 5FY1A 1YQ3A 1IBMT 2WMNA 3VRBA 4LFBT 3CKDA 3SS1A 2XQAA 2Q9QB 3ZYLA 4AI6A 4ANJA 3AVRA 2RA1A 2H7OA 1T8BA 2V8SV 1ZHCA 5L4EA 4HWFA 3VKGA 1UUSA 5BR8T 1W09A 1FMWA 2I0MA 2M6IA 4YSZA 1XZYA 3CQGB 3AE7A 2CA5A 5LHGB 2CE7A 2YN6A 2WZHA 4UVBB 1MIWA 3LK3B 2KT9A 3K1SA 3VKHA 4X1YE 2V7MA 2WMOA 2LE8A 4P1NA 2XM1A 4NPPA 3UUBA 3GN5B 2M67A 1SHZC 4CXXA 2EHOC 1S35A 1KEYA 5F5WA 4LF8T 2VQET 5AQSB 5F3JA 3CPZA 4DV5T 5FL0A 1IJ5A 3PJAJ 1BR2A 3OYXA 4DV1T 4X1IE 4H9SE 2UXXB 3ZCIA 3JAFA 1XDPA 5FMNA 4PJJA 3ANWA 3HI2A 3RIUA 3N9OA 1HS7A 3C4ZA 1CUNA 4IGUA 2VASA 3OVUA 3A7MA 4YXDA 3SOLA 4PJNA 1SA0E 2IDOB 2LM9A 1WRDA 4A97A 5FNVE 2BKPA 5M4YA 4IDPA 3NBXX 5LGNB 3WAJA 3GMIA 1LKXA 4HEAA 2X9XA 4U33A 3IHRA 3ZEFB 5EZYE 3P8CD 4CI3B 3Q5XA 3PE0A 4MBQA 3VR8A 4ZXLA 2B1EA 1WR0A 3IEEA 1IJ6A 2NP9A 2W4XA 4KMCA 2KSRA 4EGWA 2PJQA 4UR9A 3HKEE 4U7IA 4JV5T 3FB2A 2OA5A 3AXJA 1W0BA 4ILCA 4GK0E 3PU3A 5HEOA 2WB5A 1MIYA 4O4IE 4JI0T 2V1DB 3EVYA 4DMWA 2XQ9A 4LMJA 3PDYA 5JH7E 4PK6A 3VU7H 1IBLT 3OTOT 2E9XB 3B5MA 3UTKA 3SFEA 4DR3T 3N2OA 3MA9A 5CGMA 3LDQB 1HNWT 2X0LB 2X68A 2BS3A 2XUEA 2HN2A 3B13A 1YXRA 4A98A 4PAGA 4IDOA 5AQQB 2BDEA 4X1KE 2E2AA 4HTEA 3AAAB 4ASKA 2XQ6A 2V7KA 5JDLA 3ONLC 3TLWA 2LRLA 1E2AA 2UU9T 2MOZA 3FXEB 5LCYA 4CQIA 2H3RA 3CK6A 3ZMUB 5HWYA 5L3EB 2UXNB 4XBFB 3JCFA 3B57A 2NOXA 5LGTB 4JEHB 5LXTE 3LSVA 3C50A 2JPFA 3CX6B 1M62A 3RRCA 2UXBT 3ZJ1A 3O1JA 2XAFB 1QLBA 3C51A 1XNRT 2Y6XA 4L5GA 2OLTA 2Z6EA 3JC6C 3PUXF 1HFAA 2XASB 1UGOA 3T1YT 4ZI3D 3TLTA 2XPKA 5J2UE 2YU1A 5JDFA 1KNZA 4K0UA 5FVKA 1M7KA 2BG9C 4UVAB 5HEGA 2DLRA 3U3IA 1NWMX 2C5KT 1OEDC 3OKQA 4ZZBA 5L3DB 2ZM6T 2IHR1 2IUBA 5HEHA 3ZLIA 5LYJE 2UUAT 3EHZA 2C5JA 1UX4A 3RQWA 4UIGA 2XTLA 3UUNA 3F2EA 2XAGB 1CHUA 3KV9A 1VCTA 3O1HA 4AKHA 2M6BA 3AE1A 4DV0T 5FKYA 4CZZB 1X9BA 3PUSA 4MALA 5JRCB 1T72A 4X64T 4IDZA 2W63A 2K9AA 1XMOT 3PUGA 3T8OA 1MMNA 2OV9A 3BQKA 3FXDB 4TV8E 2XJ7A 4L0RA 3UFGA 2MPKA 2LKHA 2E8IA 1BR0A 1IBKT 4YHHT 1HTJF 5J2TE 5L2LA 3UUMA 3FBLA 5J1GA 4DV7T 4EYYR 3EDVA 3L09A 3WI3A 4KUMB 2WSSV 4NXMT 4HFHA 3L8RA 4JI2T 1O3XA 5DQWA 2X66A 2L9QA 2MYSA 3UT5E 4JEUB 3RGLA 2LSIA 2PBIA 2WDQA 4UV8B 2L3LA 3J9X1 5L3BB 2XM2A 4AKIA 3OJAA 5JTGA 1XWMA 4DO0A 3QNUA 4I55E 1Y64B 2KMFA 2LEHA 2ES0A 4Q25A 4EOZB 4U2ZA 3X1DA 5AQLB 2UXCT 4F8HA 1ZEEA 5HAXA 5ABGA 3L3PA 5JDQA 3LJCA 5DQVA 2PG8A 4OYJA 3QUJA 4DV4T 5JDNA 4X65T 1KF6A 4BJNA 2DWGA 3W15B 3N9MA 2WS3A 3ETVA 3AE9A 4ZS2A 3EAMA 1H7CA 2X9WA 4DR5T 4MHCA 4WBOA 3RRWA 5FXVA 3ZC1A 1AJ3A 1VRBA 5ABFB 1UX5A 1HG2A 3LK42 3V5UA 2WDRA 1XMQT 1WFDA 1MMAA 1FEWA 3Q2MA 2CLYB 1JNZA 3E22E 4TNVA 2HHHT 4TN7B 5JR9B 3Q9DA 2HN1A 3NZPA 2X9HA 5HYAA 4O2BE 3ONJA 2XQYA 2FUPA 5DJQC 4HWDA 2K24A 4EB6E 3K3NA 4YT0A 4DNDA 3UU5A 2BS2A 4YTPA 4PFOA 4AKRB 3F57A 3KVAA 2K5BB 1HG5A 2L8KA 4JLEA 1KFYA 4ZOLE 1B7TA 2CWYA 4I50E 2IAKA 4QH5A 3D0TA 3OBVE 3HKBE 4UEMA 3C98B 4EZ4A 2W62A 3UQ4A 5HXHA 2FJDA 4A56A 5HXCA 3QB5K 2ACXA 4ILUA 3EABA 4IE0A 3TLVA 2F4VT 4I4TE 1T7SA 4I0UA 2CM0A 3UU4A 2C0SA 5AQGB 2Y8DA 3GWHA 4HFBA 5JR9A 4CXYA 1J5ET 4DBQA 5LNKA 2XQ5A 1UK5A 4KX6A 2BBHA 4AKLA 5AQUB 2XSAA 3HKCE 2BVMA 5KMGP 1NENA 3RLFF 4I43B 5DABA 4DVDA 3I9YA 2WWUA 5CB4E 1IAPA 3KDSE 1SE7A 3UULA 4U74A 4IDNA 1HF8A 2BG9E 4JI6T 1OEDE 3CQXC 1WYCA 2CRBA 3QC9A 2WBLA 3VR9A 4N78D 4CI1B 2G0UA 3AEAA 1IZNB 4ZI2D 1J1JA 4UXNB 2Q9QA 2H89A 2WQYA 1EZ3A 4PW8A 2XQ4A 1UURA 3ZSTA 4HFVA 3JAEA 3OYZA 2A3DA 2IC6A 2Q9QD 5EK2A 2FJEA 3T1HT 4OYKA 3DP7A 2W00A 4NUUA 1D1BA 3AA6B 2XY8B 4GIWA 4H9PC 2N1GA 3J7Yq 2EHOB 2A72A 4TWDA 2YOEA 4O4LE 5CJ5A 3ZC0A 4TWHA 2LM2A 3NVOA 4F6RC 3MJXA 5AQPB 5CA1E 3GN5A 2N2NA 3A5XA 3RQUA 4P0BA 5LJMA 1MIVA 1VOMA 2LSYA 2LJLA 5EK4A 4AIUA 4YHJA 4UF0B 3ZYMA 5IWAT 5LG3A 4JI3T 5ABEA 4TX5A 1HR0T 4X5TA 5L3CB 3CWZB 3FZKB 4P09A 1YKHB 2I6HA 3TKLB 5HXEA 3PJAA 1FJGT 3L39A 1ZV4X 4H9NC 4KBMB 3N5LA 3ONXA 5LOVE 1YKEB 3R6NA 4ISTA 1NEKA 4GYRA 3AE6A 2V5CA 4CN1A 2WU2A 3P7IA 1US7B 4Z91A 3KINB 3I0OA 1U5PA 3N9NA 4LF5T 3RKGA 4NUVA 2VB6A 4GKKT 1QSDA 4TUYE 4ZZCA 2X0HA 3O9XA 5A1LA 4LFAT 3NRXA 2CCQA 4LF6T 4DUZT 3FZLB 2H7VC 2I59A 4HWCA 2V5DA 2E5VA 2V7IA 4EYUA 2LOPA 3N9PA 4KHZF 4HFEA 4U7YA 3AA0B 4U72A 3EUHA 2LRKA 1S94A 5AQNB 3HA4A 3RKOA 5LMNT 5FP3A 4CI2B 3LBXB 2DL1A 4KHPT 3CX7B 2E5LT 1R8IA 1BR4A 3O4XE 4A5XA 2KXPB 4DV3T 2WWVA 2XSBA 2PTFA 3RYCE 4CXWA 1MNEA 4TWFA 2VVSA 4JI5T 4IL9A 3N9LA 4H63V 2KZ7B 5F8PA 2E9XA 5LG4A 4IHJE 4ZHQE 4E7SA 4QXCB 3RX6A 5C2TA 1D1CA 3AE4A 4O4HE 1U4QA 4EEBA 3UQ7A 2BZBA 2X0YA 5LMUT 2E9XD 4YTNA 2LHRA 5FYMA 1ZP0A 3A8YC 1KNPA 5JREA 3RYIE 1E7PA 3WAKA 4ZI7E 2UXDT 4GOUA 1W9RA 2VKHA 4GKJT 2IW5B 3K8PC 2H88A 4B3RT 4IT4A 3NZQA 1Z0PA 1OXZA 2KNDA 1KK7A 1XNQT 1D1AA 4LMKA 4YJ3E 4ZS3A 1SUMB 4IIJE 3G06A 3TLSA 4WW0A 1I6ZA 4IE6A 3SRZA 4V1Av 2HH7A 2NW8A 2WZIA 1NAFA 3FZHB 5AQIB 3NKZA 4JUYA 1YQ4A 3CVRA 1FIOA 3AEGA 2BG9B 2W61A 1OEDB 2ZLYA 2QYWA 4DUYT 4G2AA 4YTMA 4HWHA 4DBRA 4AQFA 2IC9A 3VRAA 3C4XA 3K3QC 1W0AA 1MNDA 2C5IT 4IE5A 4BA9A 2CBJA 3PUWF 3AAIA 2X67A 3IA3A 2UUBT 5IHYA 1I94T 2W2UA 2IIUA 4QHOA 4DR1T 5CFBA 1X79A 5JDHA 2VKDA 2JQ9A 2WP9A 1OWAA 2W0GA 3P4PA 4QXHB 2A2FX 3HR0A 4DR4T 5JRCA 4X66T 4WNKA 3Q5WA 3ZMTB 4LF9T 2VQFT 2CXFA 1MMDA 3P4WA 3PUYF 4X20E 4PJLA 4WZXA 3AEBA 3N2GE 2KWIB 3E0ZA 2LOSA 2VK9A 3JC6D 3RH3A 3IF8B 2ODUA 4O4JE 2FJAA 1FMVA 4ZI2C 4X62T 1LRZA 3UU3A 5HEJA 2N9DA 3QB5A 4YJ2E 4DMVA 3P4SA 3M65A 2VVNA 4Z90A 1BR1A 5LBQB 3AE2A 1D0ZA 2Q9QC 2VKOA 3RIUC 3AA7B 2BKOA 4AISA 3P50A 4LFCT 2NWBA 4YSXA 4B3ST 3CMLA 4FI5A 2VL0A 1UCUA 2V6YB 3RPUA 2KWHA 2LSKA 4XAXB 5KX5E 2NTYA
chains in the Genus database with same CATH topology
4LFAT 4B3RT 4LF6T 4X64T 4LF4T 3T1HT 4DUZT 1XMOT 4LF7T 4JI7T 2UUCT 4DR4T 1XNQT 1HNXT 4DR5T 4X66T 4DR2T 4JV5T 4LF9T 1N32T 2VQFT 4JI4T 1IBKT 4YHHT 4LF8T 5LMNT 2UXBT 4JI8T 2VQET 2F4VT 4KHPT 4DR6T 4DV5T 2E5LT 1XMQT 1N33T 1J5ET 4JI0T 4DV7T 4OX9T 1XNRT 4DV3T 4DV1T 4B3MT 4NXMT 2HHHT 4B3TT 4JI2T 1IBLT 4JI1T 3OTOT 4DR7T 3T1YT 4JI5T 4NXNT 5IWAT 4JI3T 4DR3T 4DV6T 4YY3T 4DUYT 1HNWT 1HR0T 4X62T 1IBMT 2ZM6T 1HNZT 4JI6T 4LFBT 4K0KT 1N34T 1FJGT 2UUAT 4JYAT 2UUBT 1I94T 5LMUT 2UXCT 4DV0T 4DR1T 4DV2T 4LFCT 4AQYT 4B3ST 4LF5T 2UU9T 5BR8T 4GKKT 1N36T 4DV4T 2UXDT 4GKJT 4X65T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFA T;  4B3R T;  4LF6 T;  4X64 T;  4LF4 T;  3T1H T;  4DUZ T;  1XMO T;  4LF7 T;  4JI7 T;  2UUC T;  4DR4 T;  1XNQ T;  1HNX T;  4DR5 T;  4X66 T;  4DR2 T;  4JV5 T;  4LF9 T;  1N32 T;  2VQF T;  4JI4 T;  1IBK T;  4YHH T;  4LF8 T;  5LMN T;  2UXB T;  4JI8 T;  2VQE T;  2F4V T;  4KHP T;  4DR6 T;  4DV5 T;  2E5L T;  1XMQ T;  1N33 T;  1J5E T;  4JI0 T;  4DV7 T;  4OX9 T;  1XNR T;  4DV3 T;  4DV1 T;  4B3M T;  4NXM T;  2HHH T;  4B3T T;  4JI2 T;  1IBL T;  4JI1 T;  3OTO T;  4DR7 T;  3T1Y T;  4JI5 T;  4NXN T;  5IWA T;  4JI3 T;  4DR3 T;  4DV6 T;  4YY3 T;  4DUY T;  1HNW T;  1HR0 T;  4X62 T;  1IBM T;  2ZM6 T;  1HNZ T;  4JI6 T;  4LFB T;  4K0K T;  1N34 T;  1FJG T;  2UUA T;  4JYA T;  2UUB T;  1I94 T;  5LMU T;  2UXC T;  4DV0 T;  4DR1 T;  4DV2 T;  4LFC T;  4AQY T;  4B3S T;  4LF5 T;  2UU9 T;  5BR8 T;  4GKK T;  1N36 T;  4DV4 T;  2UXD T;  4GKJ T;  4X65 T; 
#chains in the Genus database with same CATH topology
 3M3Z B;  2W67 A;  3OPC A;  4LF7 T;  4HFC A;  2XHE B;  2W66 A;  2K3W A;  3NWI A;  4J2C A;  3R84 B;  3MZK B;  4MLK A;  4U31 A;  4YLH A;  4CN4 A;  3ZMZ B;  4EAH A;  4AKG A;  1YW0 A;  4GK5 E;  3P4Q A;  4QH4 A;  1ZKE A;  1WR6 A;  4AQG A;  2JMK A;  4JI8 T;  3KV5 A;  3LG7 A;  5LGU B;  3AA1 B;  3AE3 A;  2V6X A;  2ZM8 A;  3ZPO A;  3AVS A;  3Q5D A;  3IBP A;  4JBW F;  2ACZ A;  3JAD A;  5ABF A;  2LSJ A;  3UFE A;  2AE9 A;  4PK5 A;  5AFU L;  5KXJ A;  3O1I A;  3ANW B;  2WCA A;  5EK3 A;  2B76 A;  2QRX A;  4EZH A;  1T98 A;  5JDM A;  4YY3 T;  2IML A;  2JMH A;  5J0Z A;  5AQT B;  5HXR A;  2YKS A;  3KV6 A;  2CEA A;  3LFM A;  3QOF A;  3FZF B;  2NR4 A;  1N34 T;  4FJO A;  4PK4 A;  2JQK A;  4JYA T;  5LBM A;  2CXL A;  1D0Y A;  3RC3 A;  3PU8 A;  2V7L A;  2V6Y A;  3UUX B;  5BMV E;  2XQ8 A;  2J4G A;  2WU5 A;  5GON E;  3H3A A;  3AE5 A;  2CBI A;  2JQQ A;  1LVF A;  2QVA A;  3PUQ A;  2BVL A;  4OFZ A;  4EIW A;  2CMR A;  5HCM A;  3RI5 A;  4PNI A;  3AXJ B;  2YDR A;  4WBN E;  5ETW A;  2PFV A;  3UU8 A;  3ZJ2 A;  4YFS A;  3ETU A;  3C4W A;  5ABH A;  3AE8 A;  2ZM2 A;  1D0X A;  3I1A A;  2WAU A;  4H9O C;  2FBW A;  3ZN0 B;  4NIQ A;  1DU2 A;  2JRK A;  5HCJ A;  3AED A;  3TLU A;  2LSG A;  5ADX L;  5TAO A;  3DTO A;  3ZCJ A;  4B3M T;  3KVB A;  3ZN1 B;  4KI0 F;  2V7J A;  1Y01 A;  4M1P A;  4NXN T;  3E08 A;  2QGS A;  3ESL A;  4ZI3 C;  4EXT A;  1HX8 A;  1HCI A;  1Z8U A;  2VUR A;  2J62 A;  2E9X C;  2DCF A;  3KBT A;  2ODV A;  4UEL A;  2WDV A;  2KLQ A;  4GYS A;  4XZC A;  4Z8X A;  3ZYK A;  4TNW A;  3ZMS B;  4H9Q C;  3KV4 A;  2A9U A;  3KBU A;  3QK6 A;  4E7Z A;  3FHN A;  4TZ4 C;  4AQY T;  1MMG A;  3CX8 B;  2J1D G;  2D0U A;  2DNX A;  2HPJ A;  1N36 T;  2JJ9 A;  3P4R A;  2YK0 A;  2P9B A;  4LF4 T;  3RF1 A;  2UUC T;  4C90 A;  5JQG E;  2NTX A;  2VWA A;  2D5U A;  5HEU A;  4U2Y A;  4AXP A;  1G8X A;  5FXZ A;  1JNR A;  3SFD A;  2EHO A;  2QA7 A;  4QKN A;  5H6R B;  2YDQ A;  4YSY A;  2BS4 A;  2KIN B;  2D2S A;  2DI4 A;  2D0T A;  2K48 A;  4HN9 A;  2X51 A;  4ADZ A;  2EHO D;  5E0O A;  4IL4 A;  4DR7 T;  4HFI A;  3MKD A;  1HX1 B;  4AQF C;  3PUZ F;  4HE8 A;  1YD8 G;  2XZE A;  4PJM A;  4UV9 B;  3ZKR A;  4IDQ A;  4O2A E;  4UF0 A;  1HNZ T;  2YIN A;  5AQO B;  3RHW A;  2D9D A;  3I9W A;  3PTR B;  2MAW A;  3PUA A;  3PUR A;  1VCS A;  4DV2 T;  2ZM0 A;  5KDM C;  4C91 A;  5AQR B;  3AAE B;  5IYZ E;  4QWN B;  3DJB A;  5FXW A;  2LT3 A;  4ERR A;  2YU2 A;  2R6G F;  4PFP A;  3PV0 F;  3GA8 A;  2J47 A;  5LP6 E;  2XQ7 A;  2LLY A;  2JQH A;  3EDU A;  4IE4 A;  3CIR A;  4BJM A;  3RIF A;  4ZEY A;  1KNR A;  4G63 A;  2LHN A;  3UU6 A;  4U3C A;  5LA6 E;  3PUV F;  4B6X A;  4H63 H;  5FY7 A;  4QXB B;  4QH1 A;  2XAQ B;  3U78 A;  4OX9 T;  2MBG A;  2NW9 A;  1XDO A;  4DID B;  3LBX A;  5FVL A;  4ILB A;  3RC8 A;  2WY2 A;  5L47 A;  2CHN A;  4P0A A;  3C64 A;  5AQV B;  3H3M A;  5HWX A;  3NRY A;  3BQI A;  2XQ3 A;  2SPC A;  3HKD E;  5AQK B;  4OHF A;  5LJN A;  3LK2 B;  3ZT5 A;  2V26 A;  2FJB A;  2DHR A;  3EI0 A;  4OK0 A;  2BBJ A;  3AEF A;  1G73 A;  5HXS A;  3F31 A;  5AQH B;  2CXD A;  5L4H A;  5JDG A;  4WYV A;  5LHI B;  2YDS A;  2NW7 A;  2AXD S;  1WLX A;  4ISS A;  5JVD E;  2WM9 A;  1V9D A;  4ILA A;  5AQM B;  2GK9 A;  4DR6 T;  1LVK A;  4CN6 A;  1N33 T;  1E1H B;  4HWI B;  5IUX A;  3K3O A;  4COF A;  5L3F B;  3MXZ A;  4B3T T;  4L9I A;  4IRE A;  5AQJ B;  2CLY C;  5L3G B;  5JR9 C;  2HPL A;  3N2K E;  2X9Y A;  4UVC B;  4HFD A;  3MAC A;  2CWO A;  4O8S A;  3KFW X;  2BG9 A;  1ZOY A;  2YEV C;  5FXX A;  3FBZ A;  4K0K T;  1OED A;  3ZT6 A;  3ZMV B;  4QX8 B;  5H6Q B;  5FY0 A;  3VHL A;  3AEC A;  5LHH B;  2Y48 B;  3CQC B;  3HL6 A;  3ABV A;  2VKJ A;  5FL1 A;  4KP3 C;  1GQE A;  3RIA A;  3Q5E A;  1WCR A;  3N9Q A;  4HGA A;  3RYH E;  4TV9 E;  4HKA A;  2JIW A;  4BAY B;  3FZM B;  2CHO A;  4JI7 T;  3H37 A;  5AQF B;  1HNX T;  1QUU A;  4DR2 T;  1N32 T;  2CPT A;  2BKN A;  2XAJ B;  2ZMA A;  3MK7 C;  4H9R C;  3AEE A;  4JI4 T;  5C3J A;  3S4U A;  3AB3 B;  2MTQ A;  4QX7 B;  4IE7 A;  1J5W A;  3SWH A;  3BK9 A;  4MFR A;  3BQL A;  2LKG A;  3I0Q A;  5CA0 E;  2RPA A;  5LB7 B;  2RP4 A;  1WYB A;  2DWK A;  4JI1 T;  2XAH B;  2VL8 A;  3V5S A;  3ZT7 A;  4EED A;  4EV6 A;  5C8Y E;  4LML A;  4DV6 T;  1L0V A;  3RYF E;  3ZSS A;  5FY1 A;  1YQ3 A;  1IBM T;  2WMN A;  3VRB A;  4LFB T;  3CKD A;  3SS1 A;  2XQA A;  2Q9Q B;  3ZYL A;  4AI6 A;  4ANJ A;  3AVR A;  2RA1 A;  2H7O A;  1T8B A;  2V8S V;  1ZHC A;  5L4E A;  4HWF A;  3VKG A;  1UUS A;  5BR8 T;  1W09 A;  1FMW A;  2I0M A;  2M6I A;  4YSZ A;  1XZY A;  3CQG B;  3AE7 A;  2CA5 A;  5LHG B;  2CE7 A;  2YN6 A;  2WZH A;  4UVB B;  1MIW A;  3LK3 B;  2KT9 A;  3K1S A;  3VKH A;  4X1Y E;  2V7M A;  2WMO A;  2LE8 A;  4P1N A;  2XM1 A;  4NPP A;  3UUB A;  3GN5 B;  2M67 A;  1SHZ C;  4CXX A;  2EHO C;  1S35 A;  1KEY A;  5F5W A;  4LF8 T;  2VQE T;  5AQS B;  5F3J A;  3CPZ A;  4DV5 T;  5FL0 A;  1IJ5 A;  3PJA J;  1BR2 A;  3OYX A;  4DV1 T;  4X1I E;  4H9S E;  2UXX B;  3ZCI A;  3JAF A;  1XDP A;  5FMN A;  4PJJ A;  3ANW A;  3HI2 A;  3RIU A;  3N9O A;  1HS7 A;  3C4Z A;  1CUN A;  4IGU A;  2VAS A;  3OVU A;  3A7M A;  4YXD A;  3SOL A;  4PJN A;  1SA0 E;  2IDO B;  2LM9 A;  1WRD A;  4A97 A;  5FNV E;  2BKP A;  5M4Y A;  4IDP A;  3NBX X;  5LGN B;  3WAJ A;  3GMI A;  1LKX A;  4HEA A;  2X9X A;  4U33 A;  3IHR A;  3ZEF B;  5EZY E;  3P8C D;  4CI3 B;  3Q5X A;  3PE0 A;  4MBQ A;  3VR8 A;  4ZXL A;  2B1E A;  1WR0 A;  3IEE A;  1IJ6 A;  2NP9 A;  2W4X A;  4KMC A;  2KSR A;  4EGW A;  2PJQ A;  4UR9 A;  3HKE E;  4U7I A;  4JV5 T;  3FB2 A;  2OA5 A;  3AXJ A;  1W0B A;  4ILC A;  4GK0 E;  3PU3 A;  5HEO A;  2WB5 A;  1MIY A;  4O4I E;  4JI0 T;  2V1D B;  3EVY A;  4DMW A;  2XQ9 A;  4LMJ A;  3PDY A;  5JH7 E;  4PK6 A;  3VU7 H;  1IBL T;  3OTO T;  2E9X B;  3B5M A;  3UTK A;  3SFE A;  4DR3 T;  3N2O A;  3MA9 A;  5CGM A;  3LDQ B;  1HNW T;  2X0L B;  2X68 A;  2BS3 A;  2XUE A;  2HN2 A;  3B13 A;  1YXR A;  4A98 A;  4PAG A;  4IDO A;  5AQQ B;  2BDE A;  4X1K E;  2E2A A;  4HTE A;  3AAA B;  4ASK A;  2XQ6 A;  2V7K A;  5JDL A;  3ONL C;  3TLW A;  2LRL A;  1E2A A;  2UU9 T;  2MOZ A;  3FXE B;  5LCY A;  4CQI A;  2H3R A;  3CK6 A;  3ZMU B;  5HWY A;  5L3E B;  2UXN B;  4XBF B;  3JCF A;  3B57 A;  2NOX A;  5LGT B;  4JEH B;  5LXT E;  3LSV A;  3C50 A;  2JPF A;  3CX6 B;  1M62 A;  3RRC A;  2UXB T;  3ZJ1 A;  3O1J A;  2XAF B;  1QLB A;  3C51 A;  1XNR T;  2Y6X A;  4L5G A;  2OLT A;  2Z6E A;  3JC6 C;  3PUX F;  1HFA A;  2XAS B;  1UGO A;  3T1Y T;  4ZI3 D;  3TLT A;  2XPK A;  5J2U E;  2YU1 A;  5JDF A;  1KNZ A;  4K0U A;  5FVK A;  1M7K A;  2BG9 C;  4UVA B;  5HEG A;  2DLR A;  3U3I A;  1NWM X;  2C5K T;  1OED C;  3OKQ A;  4ZZB A;  5L3D B;  2ZM6 T;  2IHR 1;  2IUB A;  5HEH A;  3ZLI A;  5LYJ E;  2UUA T;  3EHZ A;  2C5J A;  1UX4 A;  3RQW A;  4UIG A;  2XTL A;  3UUN A;  3F2E A;  2XAG B;  1CHU A;  3KV9 A;  1VCT A;  3O1H A;  4AKH A;  2M6B A;  3AE1 A;  4DV0 T;  5FKY A;  4CZZ B;  1X9B A;  3PUS A;  4MAL A;  5JRC B;  1T72 A;  4X64 T;  4IDZ A;  2W63 A;  2K9A A;  1XMO T;  3PUG A;  3T8O A;  1MMN A;  2OV9 A;  3BQK A;  3FXD B;  4TV8 E;  2XJ7 A;  4L0R A;  3UFG A;  2MPK A;  2LKH A;  2E8I A;  1BR0 A;  1IBK T;  4YHH T;  1HTJ F;  5J2T E;  5L2L A;  3UUM A;  3FBL A;  5J1G A;  4DV7 T;  4EYY R;  3EDV A;  3L09 A;  3WI3 A;  4KUM B;  2WSS V;  4NXM T;  4HFH A;  3L8R A;  4JI2 T;  1O3X A;  5DQW A;  2X66 A;  2L9Q A;  2MYS A;  3UT5 E;  4JEU B;  3RGL A;  2LSI A;  2PBI A;  2WDQ A;  4UV8 B;  2L3L A;  3J9X 1;  5L3B B;  2XM2 A;  4AKI A;  3OJA A;  5JTG A;  1XWM A;  4DO0 A;  3QNU A;  4I55 E;  1Y64 B;  2KMF A;  2LEH A;  2ES0 A;  4Q25 A;  4EOZ B;  4U2Z A;  3X1D A;  5AQL B;  2UXC T;  4F8H A;  1ZEE A;  5HAX A;  5ABG A;  3L3P A;  5JDQ A;  3LJC A;  5DQV A;  2PG8 A;  4OYJ A;  3QUJ A;  4DV4 T;  5JDN A;  4X65 T;  1KF6 A;  4BJN A;  2DWG A;  3W15 B;  3N9M A;  2WS3 A;  3ETV A;  3AE9 A;  4ZS2 A;  3EAM A;  1H7C A;  2X9W A;  4DR5 T;  4MHC A;  4WBO A;  3RRW A;  5FXV A;  3ZC1 A;  1AJ3 A;  1VRB A;  5ABF B;  1UX5 A;  1HG2 A;  3LK4 2;  3V5U A;  2WDR A;  1XMQ T;  1WFD A;  1MMA A;  1FEW A;  3Q2M A;  2CLY B;  1JNZ A;  3E22 E;  4TNV A;  2HHH T;  4TN7 B;  5JR9 B;  3Q9D A;  2HN1 A;  3NZP A;  2X9H A;  5HYA A;  4O2B E;  3ONJ A;  2XQY A;  2FUP A;  5DJQ C;  4HWD A;  2K24 A;  4EB6 E;  3K3N A;  4YT0 A;  4DND A;  3UU5 A;  2BS2 A;  4YTP A;  4PFO A;  4AKR B;  3F57 A;  3KVA A;  2K5B B;  1HG5 A;  2L8K A;  4JLE A;  1KFY A;  4ZOL E;  1B7T A;  2CWY A;  4I50 E;  2IAK A;  4QH5 A;  3D0T A;  3OBV E;  3HKB E;  4UEM A;  3C98 B;  4EZ4 A;  2W62 A;  3UQ4 A;  5HXH A;  2FJD A;  4A56 A;  5HXC A;  3QB5 K;  2ACX A;  4ILU A;  3EAB A;  4IE0 A;  3TLV A;  2F4V T;  4I4T E;  1T7S A;  4I0U A;  2CM0 A;  3UU4 A;  2C0S A;  5AQG B;  2Y8D A;  3GWH A;  4HFB A;  5JR9 A;  4CXY A;  1J5E T;  4DBQ A;  5LNK A;  2XQ5 A;  1UK5 A;  4KX6 A;  2BBH A;  4AKL A;  5AQU B;  2XSA A;  3HKC E;  2BVM A;  5KMG P;  1NEN A;  3RLF F;  4I43 B;  5DAB A;  4DVD A;  3I9Y A;  2WWU A;  5CB4 E;  1IAP A;  3KDS E;  1SE7 A;  3UUL A;  4U74 A;  4IDN A;  1HF8 A;  2BG9 E;  4JI6 T;  1OED E;  3CQX C;  1WYC A;  2CRB A;  3QC9 A;  2WBL A;  3VR9 A;  4N78 D;  4CI1 B;  2G0U A;  3AEA A;  1IZN B;  4ZI2 D;  1J1J A;  4UXN B;  2Q9Q A;  2H89 A;  2WQY A;  1EZ3 A;  4PW8 A;  2XQ4 A;  1UUR A;  3ZST A;  4HFV A;  3JAE A;  3OYZ A;  2A3D A;  2IC6 A;  2Q9Q D;  5EK2 A;  2FJE A;  3T1H T;  4OYK A;  3DP7 A;  2W00 A;  4NUU A;  1D1B A;  3AA6 B;  2XY8 B;  4GIW A;  4H9P C;  2N1G A;  3J7Y q;  2EHO B;  2A72 A;  4TWD A;  2YOE A;  4O4L E;  5CJ5 A;  3ZC0 A;  4TWH A;  2LM2 A;  3NVO A;  4F6R C;  3MJX A;  5AQP B;  5CA1 E;  3GN5 A;  2N2N A;  3A5X A;  3RQU A;  4P0B A;  5LJM A;  1MIV A;  1VOM A;  2LSY A;  2LJL A;  5EK4 A;  4AIU A;  4YHJ A;  4UF0 B;  3ZYM A;  5IWA T;  5LG3 A;  4JI3 T;  5ABE A;  4TX5 A;  1HR0 T;  4X5T A;  5L3C B;  3CWZ B;  3FZK B;  4P09 A;  1YKH B;  2I6H A;  3TKL B;  5HXE A;  3PJA A;  1FJG T;  3L39 A;  1ZV4 X;  4H9N C;  4KBM B;  3N5L A;  3ONX A;  5LOV E;  1YKE B;  3R6N A;  4IST A;  1NEK A;  4GYR A;  3AE6 A;  2V5C A;  4CN1 A;  2WU2 A;  3P7I A;  1US7 B;  4Z91 A;  3KIN B;  3I0O A;  1U5P A;  3N9N A;  4LF5 T;  3RKG A;  4NUV A;  2VB6 A;  4GKK T;  1QSD A;  4TUY E;  4ZZC A;  2X0H A;  3O9X A;  5A1L A;  4LFA T;  3NRX A;  2CCQ A;  4LF6 T;  4DUZ T;  3FZL B;  2H7V C;  2I59 A;  4HWC A;  2V5D A;  2E5V A;  2V7I A;  4EYU A;  2LOP A;  3N9P A;  4KHZ F;  4HFE A;  4U7Y A;  3AA0 B;  4U72 A;  3EUH A;  2LRK A;  1S94 A;  5AQN B;  3HA4 A;  3RKO A;  5LMN T;  5FP3 A;  4CI2 B;  3LBX B;  2DL1 A;  4KHP T;  3CX7 B;  2E5L T;  1R8I A;  1BR4 A;  3O4X E;  4A5X A;  2KXP B;  4DV3 T;  2WWV A;  2XSB A;  2PTF A;  3RYC E;  4CXW A;  1MNE A;  4TWF A;  2VVS A;  4JI5 T;  4IL9 A;  3N9L A;  4H63 V;  2KZ7 B;  5F8P A;  2E9X A;  5LG4 A;  4IHJ E;  4ZHQ E;  4E7S A;  4QXC B;  3RX6 A;  5C2T A;  1D1C A;  3AE4 A;  4O4H E;  1U4Q A;  4EEB A;  3UQ7 A;  2BZB A;  2X0Y A;  5LMU T;  2E9X D;  4YTN A;  2LHR A;  5FYM A;  1ZP0 A;  3A8Y C;  1KNP A;  5JRE A;  3RYI E;  1E7P A;  3WAK A;  4ZI7 E;  2UXD T;  4GOU A;  1W9R A;  2VKH A;  4GKJ T;  2IW5 B;  3K8P C;  2H88 A;  4B3R T;  4IT4 A;  3NZQ A;  1Z0P A;  1OXZ A;  2KND A;  1KK7 A;  1XNQ T;  1D1A A;  4LMK A;  4YJ3 E;  4ZS3 A;  1SUM B;  4IIJ E;  3G06 A;  3TLS A;  4WW0 A;  1I6Z A;  4IE6 A;  3SRZ A;  4V1A v;  2HH7 A;  2NW8 A;  2WZI A;  1NAF A;  3FZH B;  5AQI B;  3NKZ A;  4JUY A;  1YQ4 A;  3CVR A;  1FIO A;  3AEG A;  2BG9 B;  2W61 A;  1OED B;  2ZLY A;  2QYW A;  4DUY T;  4G2A A;  4YTM A;  4HWH A;  4DBR A;  4AQF A;  2IC9 A;  3VRA A;  3C4X A;  3K3Q C;  1W0A A;  1MND A;  2C5I T;  4IE5 A;  4BA9 A;  2CBJ A;  3PUW F;  3AAI A;  2X67 A;  3IA3 A;  2UUB T;  5IHY A;  1I94 T;  2W2U A;  2IIU A;  4QHO A;  4DR1 T;  5CFB A;  1X79 A;  5JDH A;  2VKD A;  2JQ9 A;  2WP9 A;  1OWA A;  2W0G A;  3P4P A;  4QXH B;  2A2F X;  3HR0 A;  4DR4 T;  5JRC A;  4X66 T;  4WNK A;  3Q5W A;  3ZMT B;  4LF9 T;  2VQF T;  2CXF A;  1MMD A;  3P4W A;  3PUY F;  4X20 E;  4PJL A;  4WZX A;  3AEB A;  3N2G E;  2KWI B;  3E0Z A;  2LOS A;  2VK9 A;  3JC6 D;  3RH3 A;  3IF8 B;  2ODU A;  4O4J E;  2FJA A;  1FMV A;  4ZI2 C;  4X62 T;  1LRZ A;  3UU3 A;  5HEJ A;  2N9D A;  3QB5 A;  4YJ2 E;  4DMV A;  3P4S A;  3M65 A;  2VVN A;  4Z90 A;  1BR1 A;  5LBQ B;  3AE2 A;  1D0Z A;  2Q9Q C;  2VKO A;  3RIU C;  3AA7 B;  2BKO A;  4AIS A;  3P50 A;  4LFC T;  2NWB A;  4YSX A;  4B3S T;  3CML A;  4FI5 A;  2VL0 A;  1UCU A;  2V6Y B;  3RPU A;  2KWH A;  2LSK A;  4XAX B;  5KX5 E;  2NTY A; 
#chains in the Genus database with same CATH homology
 4LFA T;  4B3R T;  4LF6 T;  4X64 T;  4LF4 T;  3T1H T;  4DUZ T;  1XMO T;  4LF7 T;  4JI7 T;  2UUC T;  4DR4 T;  1XNQ T;  1HNX T;  4DR5 T;  4X66 T;  4DR2 T;  4JV5 T;  4LF9 T;  1N32 T;  2VQF T;  4JI4 T;  1IBK T;  4YHH T;  4LF8 T;  5LMN T;  2UXB T;  4JI8 T;  2VQE T;  2F4V T;  4KHP T;  4DR6 T;  4DV5 T;  2E5L T;  1XMQ T;  1N33 T;  1J5E T;  4JI0 T;  4DV7 T;  4OX9 T;  1XNR T;  4DV3 T;  4DV1 T;  4B3M T;  4NXM T;  2HHH T;  4B3T T;  4JI2 T;  1IBL T;  4JI1 T;  3OTO T;  4DR7 T;  3T1Y T;  4JI5 T;  4NXN T;  5IWA T;  4JI3 T;  4DR3 T;  4DV6 T;  4YY3 T;  4DUY T;  1HNW T;  1HR0 T;  4X62 T;  1IBM T;  2ZM6 T;  1HNZ T;  4JI6 T;  4LFB T;  4K0K T;  1N34 T;  1FJG T;  2UUA T;  4JYA T;  2UUB T;  1I94 T;  5LMU T;  2UXC T;  4DV0 T;  4DR1 T;  4DV2 T;  4LFC T;  4AQY T;  4B3S T;  4LF5 T;  2UU9 T;  5BR8 T;  4GKK T;  1N36 T;  4DV4 T;  2UXD T;  4GKJ T;  4X65 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...