5LMNT

Structure of bacterial 30s-if1-if3-mrna translation pre-initiation complex (state-1a)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 5lmnT00
4DUYT 4X65T 1HNWT 4B3TT 4DR7T 4JI0T 1HR0T 4LF5T 2ZM6T 2UXBT 4YY3T 2UUAT 5IWAT 1HNZT 4JI6T 1XNRT 1IBKT 4DV2T 1HNXT 4DV0T 1I94T 2UUBT 4DR5T 4LF7T 3T1HT 4K0KT 4OX9T 4X62T 4JI4T 3OTOT 4X66T 4DV1T 4JI8T 4LFBT 4GKJT 4DR3T 1J5ET 2VQFT 4JV5T 2VQET 4AQYT 4DV7T 4DR2T 1N32T 4DR1T 1IBLT 1IBMT 4NXMT 4YHHT 4DV6T 4X64T 4LF9T 3T1YT 4DV4T 2UUCT 4LF8T 4DR6T 4KHPT 5LMNT 1XMQT 1N36T 1FJGT 4JYAT 4B3RT 4LFAT 4DUZT 4LFCT 5LMUT 2UXDT 4JI7T 4JI2T 4B3ST 4DV5T 1N33T 5BR8T 4LF6T 1XMOT 1XNQT 4JI3T 4B3MT 4JI5T 1N34T 2HHHT 4LF4T 4JI1T 4DR4T 4GKKT 2E5LT 4DV3T 2UU9T 4NXNT 2F4VT 2UXCT
chains in the Genus database with same CATH superfamily
3QB5A 3Q5XA 4L0RA 2NWBA 3H3MA 4IT4A 5AQOB 2BVMA 2OA5A 4Q25A 5LOVE 5CJ5A 1B7TA 2VL0A 4ZI3D 3C64A 2V6YA 5LBQB 4CN1A 3GMIA 5JREA 2MYSA 2N2NA 3M3ZB 2DCFA 3ZCJA 3PTRB 3HA4A 4ZS3A 2X0YA 1MNDA 5JDMA 4O2AE 4ZI2D 3RIUA 3ONXA 2HH7A 2XSBA 5FMNA 1D0ZA 3RPUA 2W62A 2JJ9A 3NKZA 2HN2A 1MMGA 4CXXA 2I59A 3C51A 5IWAT 3ZJ2A 2LE8A 4ILCA 1MIVA 5HCJA 2CHOA 5E0OA 3WAKA 5L3GB 2MPKA 4DV2T 5JTGA 1XNRT 1HNXT 2JQ9A 2XASB 4IE5A 5IHYA 4GIWA 4DV0T 5FVKA 3UUNA 1I94T 4X1IE 2J4GA 1UK5A 2KMFA 3KBUA 4ZI2C 4DUZT 3CQGB 2BKPA 3DTOA 5JR9A 2IDOB 5BR8T 4OYJA 3KV4A 2Q9QD 3EAMA 2FJAA 4DV1T 1X79A 2WDRA 1R8IA 2H7VC 2UXNB 2X66A 3C4XA 4X1YE 3JAFA 2AE9A 5F5WA 3AVRA 4JI8T 3O1HA 3P4PA 1CHUA 3LDQB 5ABFA 5AQSB 1J5ET 1QLBA 4LFCT 2NTXA 4ASKA 5KXJA 1T98A 2KWHA 3AE2A 5ADXL 4JV5T 1UX5A 1M7KA 2WZIA 3HI2A 4LMJA 4X1KE 4AQYT 4UR9A 4DV7T 2LSYA 2W63A 3I9YA 1KF6A 3PURA 3R84B 4DR2T 3RX6A 2H3RA 1IAPA 2WQYA 3BQLA 4P0AA 3UQ4A 2XQ8A 2YINA 3FZHB 4F8HA 2X0LB 5AQQB 3D0TA 5FXVA 1BR2A 1WR0A 2XQ5A 3LBXA 1YD8G 2WS3A 4PK4A 2HPJA 4TN7B 4TWFA 5AQUB 2YN6A 3MACA 2FJDA 1Z0PA 2KZ7B 3AXJA 4NXMT 4TUYE 4YHHT 3ZC0A 5L47A 5C8YE 5LNKA 2YEVC 4LF9T 1AJ3A 2LRLA 1E1HB 1T7SA 2XY8B 5HCMA 2X9XA 4MFRA 2FJEA 2WMOA 3RQUA 2A3DA 2C5JA 1MIYA 2KNDA 1EZ3A 4ZEYA 1D1CA 2CRBA 4PK6A 5HXSA 4C90A 3RLFF 3VR8A 1KFYA 2C5IT 3PUYF 4DO0A 4B3RT 3P4QA 3RI5A 4AQFC 4CXYA 4AKIA 3SFDA 4QH5A 5LYJE 1W0AA 1LVKA 1E2AA 4EZ4A 2PJQA 5KMGP 1UX4A 2WM9A 4DV5T 2QRXA 3JC6D 3QB5K 4IE0A 5L4HA 4UEMA 2DWKA 2JMHA 3FHNA 3ZYMA 4LF6T 2XQ7A 3K3OA 4U33A 2Z6EA 3IEEA 4LMLA 4YT0A 2HN1A 1OEDA 1SE7A 4JI5T 4EZHA 3SS1A 4HFVA 1UCUA 3CX6B 5LGTB 2Y8DA 3MA9A 3KV9A 3RYCE 3KDSE 5F8PA 2CM0A 2V7IA 3ESLA 3ZMSB 3CIRA 3ZT6A 2E8IA 2WCAA 5AQLB 2CMRA 3RIUC 2MTQA 4M1PA 3F57A 4I4TE 4OK0A 2WB5A 2FUPA 3OYZA 4PJMA 4YSXA 2D2SA 3ZCIA 2XQ4A 3P4SA 3UUMA 3AE3A 2UU9T 1Y64B 4OHFA 3B13A 3EI0A 4JUYA 3GN5B 2BKOA 2PFVA 3AEEA 3C4ZA 3ETVA 4JEHB 5LP6E 4IL9A 4XBFB 2NP9A 3CMLA 5A1LA 1YKHB 2LJLA 3LG7A 1HNWT 5J2TE 2GK9A 4B3TT 4IDQA 2IMLA 2LHRA 3A5XA 3UU4A 2AXDS 2IC9A 4ZZBA 5FL1A 2H89A 4QXBB 3E08A 4WBOA 2CXLA 1OXZA 3PU3A 4V1Av 3RC8A 3AE8A 4DR7T 3ZJ1A 3IBPA 5LG3A 2Q9QA 3MZKB 4JI0T 3RKGA 1WLXA 5JDNA 4TV9E 2X9HA 3RYIE 2IAKA 3M65A 4O4IE 2KXPB 5LCYA 4XAXB 3BK9A 3Q2MA 4N78D 2ZM6T 3PV0F 2UXBT 3TLTA 2JPFA 2WP9A 5CA1E 5LBMA 4A5XA 2ZLYA 4PAGA 4OFZA 4YTMA 2M67A 4JLEA 4HWIB 4DMVA 4UVAB 1MIWA 4CN6A 3AE5A 4GK5E 1WYBA 2FJBA 2WSSV 3ZKRA 3ZMUB 4ILAA 3SRZA 3ZN0B 1W9RA 4HWFA 5ABHA 3UFGA 2WBLA 3IA3A 2CWOA 2WZHA 3PUSA 4O8SA 3PUXF 4U72A 4U31A 4EYUA 4PNIA 5C2TA 2N9DA 2UUBT 4DR5T 1LRZA 3UUBA 3CX8B 2D0UA 4NPPA 5LA6E 3B57A 4KMCA 2CE7A 3T1HT 3OBVE 4K0KT 1MMAA 4HKAA 1WRDA 4ZXLA 4OX9T 5JRCB 2FBWA 3AEFA 4X66T 4QXHB 4QX8B 2L9QA 1IJ5A 2LOPA 2XM1A 4U3CA 4UF0A 2I0MA 3PUWF 3RYHE 4YTPA 3J7Yq 1LVFA 1UGOA 4GK0E 4PJJA 3JC6C 3CVRA 3N9MA 2K3WA 2NOXA 4GKJT 1ZV4X 1UURA 4G2AA 3NBXX 5H6RB 3ZT5A 2WWVA 2LKHA 1XWMA 4CI1B 2MAWA 2MBGA 1S94A 5JH7E 4IDZA 5AQKB 3Q5WA 2CLYB 2WU2A 5KDMC 1W09A 4COFA 3CWZB 2H7OA 2XPKA 3AE6A 3DP7A 1JNRA 2W61A 1U4QA 4HN9A 3UT5E 1N32T 3K3QC 3F31A 2BG9E 3P50A 2BS3A 3O4XE 3PUAA 3AAAB 4QKNA 4ANJA 5JR9C 2VKJA 3PU8A 3IF8B 4NIQA 2WY2A 1FIOA 3ONJA 3WAJA 4DV6T 3EVYA 2V7MA 3T8OA 4I0UA 3PDYA 3T1YT 1I6ZA 4EEBA 4DV4T 2VASA 3EABA 5DJQC 4P0BA 2UUCT 1D0XA 2E2AA 1WR6A 4HWHA 3DJBA 4IE4A 1E7PA 3RHWA 5LHHB 3QUJA 2JQHA 2UXXB 3AEAA 2V7JA 5AQPB 3ABVA 3LK42 1FJGT 3ZYKA 1SUMB 1YKEB 4DVDA 5LXTE 2CA5A 2I6HA 3PE0A 3Q9DA 2X9WA 1OEDE 2LSGA 3AEDA 4TWHA 4P1NA 3IHRA 4PW8A 1HX1B 5FXWA 2NW9A 4BA9A 3LFMA 2VB6A 2WMNA 3AA0B 5GONE 5LMUT 4JI7T 2UXDT 2B76A 4L9IA 5HEHA 5CGMA 1T8BA 2G0UA 2XZEA 3P4WA 3H3AA 3P4RA 4K0UA 3VRAA 4MHCA 4YSZA 3NVOA 5FVLA 4I50E 2CBIA 2A72A 5FY7A 1ZEEA 2PG8A 1FMWA 4HE8A 3SOLA 4EXTA 3I1AA 2WU5A 4ZOLE 1NAFA 3N9OA 2CEAA 3NWIA 4IGUA 4YLHA 4ILBA 2VL8A 2XAFB 2DI4A 5HEUA 3A7MA 4C91A 3CPZA 3O1IA 5HXHA 3UQ7A 4J2CA 5JVDE 2XQ3A 4KHZF 5EK4A 2X9YA 2LEHA 2E9XC 3OYXA 4HFBA 5ABFB 3KBTA 3AE9A 2V5CA 2VVSA 2IHR1 2E5LT 3ZPOA 4WYVA 3AEGA 2VK9A 4NXNT 2UXCT 2NW7A 5AQJB 5JQGE 4YHJA 2VVNA 3AA6B 4QH4A 4X20E 2BBHA 4IREA 3UU6A 5ABGA 4YJ2E 2QYWA 3A8YC 3AE7A 1LKXA 4GYSA 1HTJF 5FXXA 4YXDA 1WCRA 1KNZA 2VKDA 2ZM2A 3TLVA 4AKRB 1WYCA 3W15B 1D0YA 1WFDA 2HPLA 3NZQA 2JMKA 2XAJB 4EGWA 2A2FX 5L3EB 3TKLB 2QA7A 4I43B 2E5VA 2W2UA 4BAYB 4PFPA 2LM2A 2EHOB 2SPCA 1T72A 4IDNA 2L8KA 2D5UA 1YQ3A 3P7IA 5LHGB 1Z8UA 1HR0T 2RPAA 2BG9C 4ERRA 2MOZA 5L3BB 2ODUA 4YY3T 4B3MT 5JDGA 2XQ9A 1HCIA 2UUAT 3QC9A 5FNVE 4H9OC 4AKLA 2EHOA 3L09A 1MNEA 3ETUA 4L5GA 4TX5A 4Z91A 3TLSA 3VRBA 5HXRA 2X68A 2YK0A 4EIWA 1ZHCA 4HFCA 4WW0A 2H88A 4JI6T 3VKGA 3C50A 1G73A 4IDOA 1IBKT 5J1GA 2LSIA 3AA7B 4CI3B 5M4YA 3FZLB 3EDVA 5FY0A 5LJNA 3JCFA 2P9BA 1VRBA 2OLTA 2BS4A 1M62A 2J1DG 4UVBB 4AISA 4CZZB 2DLRA 1NEKA 4DMWA 4UV8B 5C3JA 2CXDA 4LF7T 2LM9A 4AKHA 2YU1A 2XAQB 2KWIB 2QGSA 1VCTA 4EV6A 3K8PC 4H63V 4JI4T 2OV9A 3HR0A 1YW0A 5IUXA 3CKDA 4I55E 3RKOA 4FI5A 1ZP0A 2BDEA 2CLYC 4TWDA 3UUXB 3N5LA 3V5UA 3NZPA 4ZS2A 2PTFA 3PJAJ 3ZT7A 3CQXC 3Q5DA 1HF8A 3KFWX 4DR3T 1GQEA 1HX8A 4O4JE 4F6RC 1MMDA 4EYYR 2Y6XA 4QWNB 5HWXA 4YJ3E 2YDRA 2N1GA 2ODVA 5LB7B 3RH3A 3VU7H 3TLUA 5L3FB 2C5KT 3K3NA 3AB3B 3MXZA 2BG9A 1BR0A 2LOSA 5JDHA 3RYFE 3LBXB 3AA1B 4UF0B 5JDFA 3UU5A 1D1BA 1W0BA 4NUUA 2CPTA 3PUZF 2X51A 5BMVE 2VKOA 1IBLT 4DBRA 4IIJE 4QXCB 1VOMA 4HFHA 4TZ4C 4EB6E 4IL4A 4AIUA 1UUSA 2WDQA 3AAIA 3OVUA 3N2GE 4U7YA 2K48A 4CQIA 2V6YB 4MALA 2W66A 4X64T 1DU2A 4NUVA 4WZXA 5LHIB 3H37A 2K9AA 2LSKA 3OJAA 4E7ZA 4AI6A 2IC6A 3N9PA 1YQ4A 3G06A 2YOEA 4X5TA 3FB2A 2D9DA 2QVAA 4HWDA 4CI2B 4KHPT 5LMNT 2V1DB 3FXDB 3MKDA 4GYRA 1XMQT 1N36T 5HAXA 3RC3A 2CHNA 2LSJA 1KEYA 4ISSA 1XDPA 4B6XA 3FZKB 4UVCB 3ANWB 2M6BA 5H6QB 1YXRA 3AAEB 4JI2T 2W4XA 3FBLA 2BZBA 4O4LE 4U7IA 3SWHA 3ZC1A 1FMVA 4AQGA 1N33T 2PBIA 2YDSA 4FJOA 2W0GA 4CXWA 2IUBA 2XAHB 2Y48B 4O4HE 2LKGA 2V7LA 3OPCA 2J47A 2ES0A 3KV6A 5J0ZA 3HKCE 1BR4A 4H9NC 2VURA 3UFEA 2HHHT 4LF4T 2NR4A 3BQIA 2XTLA 3FZMB 3B5MA 5IYZE 3RRWA 4QHOA 1H7CA 3LJCA 4JI1T 3UTKA 4E7SA 4DR4T 3LK3B 4PJLA 3RRCA 2RA1A 3TLWA 4XZCA 1IJ6A 2KSRA 3FBZA 4QX7B 2ACXA 3GWHA 1L0VA 2ZMAA 3EHZA 2XJ7A 2V8SV 1CUNA 3CK6A 3LK2B 3VR9A 4DV3T 2K24A 5HXEA 2YDQA 3MK7C 3PUGA 4MBQA 2C0SA 4UIGA 5FY1A 4CN4A 5F3JA 2F4VT 3JADA 3ZSTA 2BVLA 4IE7A 1KK7A 3RF1A 4DUYT 4X65T 1Y01A 3I9WA 5AQNB 3HKDE 4EAHA 2IW5B 3K1SA 3X1DA 2IIUA 2V26A 4JEUB 2KINB 4JBWF 3J9X1 3L3PA 4Z8XA 1KNRA 2V5DA 4PJNA 3VKHA 1QSDA 3QK6A 2XQAA 2XSAA 3E0ZA 4KBMB 4U74A 3HKBE 4ZZCA 4A56A 2B1EA 3KVAA 5AQGB 4G63A 5CFBA 3RIFA 3ZMTB 3QNUA 4IDPA 2DNXA 3AXJB 2K5BB 4TNVA 3E22E 4ZI3C 3UU3A 2JQKA 3R6NA 3CX7B 5CB4E 3RIAA 4LF5T 5HEGA 5AQFB 2DHRA 1VCSA 4H9SE 5AQTB 1HG2A 3RGLA 2W00A 4PFOA 2LLYA 2VWAA 3EUHA 1J5WA 3HKEE 3MJXA 5L3DB 2V6XA 2ZM8A 5LG4A 1IZNB 1HNZT 1US7B 3GA8A 2YKSA 2V7KA 1JNZA 3AECA 3V5SA 4GOUA 2NW8A 3VHLA 2XAGB 1V9DA 3I0OA 4BJNA 1MMNA 2M6IA 5AQIB 4KX6A 2WWUA 3WI3A 1S35A 1BR1A 4MLKA 4ADZA 1ZKEA 3NRYA 1X9BA 5ETWA 4EOZB 3Q5EA 2BBJA 5L3CB 2XM2A 3GN5A 5JR9B 1NENA 2JRKA 3FZFB 4YFSA 5EK3A 3CQCB 3KVBA 2BKNA 4H63H 3QOFA 4IE6A 4O2BE 5DQWA 5AQVB 5FP3A 4HEAA 5FKYA 5TAOA 3L39A 3ZYLA 4X62T 3U3IA 3OTOT 4DNDA 5LGNB 3ZMZB 3SFEA 2X0HA 3AE4A 4DIDB 1J1JA 4LFBT 4UELA 5CA0E 1XZYA 3NRXA 2Q9QB 3HL6A 3L8RA 2JQQA 2VQFT 4U2ZA 3AVSA 4TV8E 1OEDB 3EDUA 2DL1A 5JDLA 2VQET 4KI0F 5LJMA 2R6GF 3JAEA 4P09A 4AXPA 4IHJE 4Z90A 5ABEA 2BS2A 4HGAA 3O9XA 2A9UA 1ZOYA 2WAUA 4H9QC 2DWGA 4DR1T 1O3XA 5AQRB 4ZHQE 1SA0E 2Q9QC 3N9LA 4KP3C 1XDOA 1OWAA 1KNPA 4ISTA 5FYMA 3ZEFB 1IBMT 2LRKA 4HFIA 3ZSSA 2LT3A 2NTYA 3ZN1B 2E9XB 3OKQA 5L4EA 2D0TA 1HS7A 4UXNB 1XNQT 4AQFA 1D1AA 2KT9A 3AE1A 3N9NA 2XUEA 2JIWA 2VKHA 4LF8T 3S4UA 5J2UE 2EHOD 3PJAA 5HEJA 4DR6T 5HYAA 2ACZA 2E9XA 3ZLIA 1HFAA 1G8XA 5JDQA 5HEOA 1U5PA 3N2OA 3BQKA 4A98A 3N9QA 4TNWA 1QUUA 5EZYE 4WNKA 4BJMA 3I0QA 5KX5E 4LFAT 4JYAT 5JRCA 2XHEB 3KV5A 4PK5A 5HWYA 2EHOC 4YSYA 5LGUB 3ONLC 4HFEA 4H9PC 4ILUA 4KUMB 3ZMVB 4B3ST 4HFDA 3ANWA 5AQMB 1SHZC 3FXEB 4OYKA 5EK2A 1XMOT 2E9XD 4DBQA 2XQYA 2W67A 5FXZA 4JI3T 4A97A 3C4WA 4HTEA 2BG9B 5FL0A 4YTNA 5L2LA 4H9RC 2CBJA 3RQWA 4ZI7E 5AQHB 1N34T 2CCQA 5DABA 3PUQA 3P8CD 2KLQA 4QH1A 4LMKA 1OEDC 2XQ6A 1HG5A 3KINB 3O1JA 4HWCA 2ZM0A 4GKKT 1NWMX 3AEBA 2J62A 2LHNA 3C98B 4WBNE 5AFUL 3UU8A 2CWYA 4UV9B 5HXCA 2CXFA 2WDVA 4AKGA 2YU2A 2L3LA 2RP4A 3UULA 5DQVA 3F2EA 1FEWA 3N2KE 2X67A 4U2YA 3U78A 3PUVF 4EEDA 3LSVA
chains in the Genus database with same CATH topology
4DUYT 4X65T 1HNWT 4B3TT 4DR7T 4JI0T 1HR0T 4LF5T 2ZM6T 2UXBT 4YY3T 2UUAT 5IWAT 1HNZT 4JI6T 1XNRT 1IBKT 4DV2T 1HNXT 4DV0T 1I94T 2UUBT 4DR5T 4LF7T 3T1HT 4K0KT 4OX9T 4X62T 4JI4T 3OTOT 4X66T 4DV1T 4JI8T 4LFBT 4GKJT 4DR3T 1J5ET 2VQFT 4JV5T 2VQET 4AQYT 4DV7T 4DR2T 1N32T 4DR1T 1IBLT 1IBMT 4NXMT 4YHHT 4DV6T 4X64T 4LF9T 3T1YT 4DV4T 2UUCT 4LF8T 4DR6T 4KHPT 5LMNT 1XMQT 1N36T 1FJGT 4JYAT 4B3RT 4LFAT 4DUZT 4LFCT 5LMUT 2UXDT 4JI7T 4JI2T 4B3ST 4DV5T 1N33T 5BR8T 4LF6T 1XMOT 1XNQT 4JI3T 4B3MT 4JI5T 1N34T 2HHHT 4LF4T 4JI1T 4DR4T 4GKKT 2E5LT 4DV3T 2UU9T 4NXNT 2F4VT 2UXCT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUY T;  4X65 T;  1HNW T;  4B3T T;  4DR7 T;  4JI0 T;  1HR0 T;  4LF5 T;  2ZM6 T;  2UXB T;  4YY3 T;  2UUA T;  5IWA T;  1HNZ T;  4JI6 T;  1XNR T;  1IBK T;  4DV2 T;  1HNX T;  4DV0 T;  1I94 T;  2UUB T;  4DR5 T;  4LF7 T;  3T1H T;  4K0K T;  4OX9 T;  4X62 T;  4JI4 T;  3OTO T;  4X66 T;  4DV1 T;  4JI8 T;  4LFB T;  4GKJ T;  4DR3 T;  1J5E T;  2VQF T;  4JV5 T;  2VQE T;  4AQY T;  4DV7 T;  4DR2 T;  1N32 T;  4DR1 T;  1IBL T;  1IBM T;  4NXM T;  4YHH T;  4DV6 T;  4X64 T;  4LF9 T;  3T1Y T;  4DV4 T;  2UUC T;  4LF8 T;  4DR6 T;  4KHP T;  5LMN T;  1XMQ T;  1N36 T;  1FJG T;  4JYA T;  4B3R T;  4LFA T;  4DUZ T;  4LFC T;  5LMU T;  2UXD T;  4JI7 T;  4JI2 T;  4B3S T;  4DV5 T;  1N33 T;  5BR8 T;  4LF6 T;  1XMO T;  1XNQ T;  4JI3 T;  4B3M T;  4JI5 T;  1N34 T;  2HHH T;  4LF4 T;  4JI1 T;  4DR4 T;  4GKK T;  2E5L T;  4DV3 T;  2UU9 T;  4NXN T;  2F4V T;  2UXC T; 
#chains in the Genus database with same CATH topology
 3QB5 A;  3Q5X A;  4L0R A;  2NWB A;  3H3M A;  4IT4 A;  5AQO B;  2BVM A;  2OA5 A;  4Q25 A;  5LOV E;  5CJ5 A;  1B7T A;  2VL0 A;  4ZI3 D;  3C64 A;  2V6Y A;  5LBQ B;  4CN1 A;  3GMI A;  5JRE A;  2MYS A;  2N2N A;  3M3Z B;  2DCF A;  3ZCJ A;  3PTR B;  3HA4 A;  4ZS3 A;  2X0Y A;  1MND A;  5JDM A;  4O2A E;  4ZI2 D;  3RIU A;  3ONX A;  2HH7 A;  2XSB A;  5FMN A;  1D0Z A;  3RPU A;  2W62 A;  2JJ9 A;  3NKZ A;  2HN2 A;  1MMG A;  4CXX A;  2I59 A;  3C51 A;  5IWA T;  3ZJ2 A;  2LE8 A;  4ILC A;  1MIV A;  5HCJ A;  2CHO A;  5E0O A;  3WAK A;  5L3G B;  2MPK A;  4DV2 T;  5JTG A;  1XNR T;  1HNX T;  2JQ9 A;  2XAS B;  4IE5 A;  5IHY A;  4GIW A;  4DV0 T;  5FVK A;  3UUN A;  1I94 T;  4X1I E;  2J4G A;  1UK5 A;  2KMF A;  3KBU A;  4ZI2 C;  4DUZ T;  3CQG B;  2BKP A;  3DTO A;  5JR9 A;  2IDO B;  5BR8 T;  4OYJ A;  3KV4 A;  2Q9Q D;  3EAM A;  2FJA A;  4DV1 T;  1X79 A;  2WDR A;  1R8I A;  2H7V C;  2UXN B;  2X66 A;  3C4X A;  4X1Y E;  3JAF A;  2AE9 A;  5F5W A;  3AVR A;  4JI8 T;  3O1H A;  3P4P A;  1CHU A;  3LDQ B;  5ABF A;  5AQS B;  1J5E T;  1QLB A;  4LFC T;  2NTX A;  4ASK A;  5KXJ A;  1T98 A;  2KWH A;  3AE2 A;  5ADX L;  4JV5 T;  1UX5 A;  1M7K A;  2WZI A;  3HI2 A;  4LMJ A;  4X1K E;  4AQY T;  4UR9 A;  4DV7 T;  2LSY A;  2W63 A;  3I9Y A;  1KF6 A;  3PUR A;  3R84 B;  4DR2 T;  3RX6 A;  2H3R A;  1IAP A;  2WQY A;  3BQL A;  4P0A A;  3UQ4 A;  2XQ8 A;  2YIN A;  3FZH B;  4F8H A;  2X0L B;  5AQQ B;  3D0T A;  5FXV A;  1BR2 A;  1WR0 A;  2XQ5 A;  3LBX A;  1YD8 G;  2WS3 A;  4PK4 A;  2HPJ A;  4TN7 B;  4TWF A;  5AQU B;  2YN6 A;  3MAC A;  2FJD A;  1Z0P A;  2KZ7 B;  3AXJ A;  4NXM T;  4TUY E;  4YHH T;  3ZC0 A;  5L47 A;  5C8Y E;  5LNK A;  2YEV C;  4LF9 T;  1AJ3 A;  2LRL A;  1E1H B;  1T7S A;  2XY8 B;  5HCM A;  2X9X A;  4MFR A;  2FJE A;  2WMO A;  3RQU A;  2A3D A;  2C5J A;  1MIY A;  2KND A;  1EZ3 A;  4ZEY A;  1D1C A;  2CRB A;  4PK6 A;  5HXS A;  4C90 A;  3RLF F;  3VR8 A;  1KFY A;  2C5I T;  3PUY F;  4DO0 A;  4B3R T;  3P4Q A;  3RI5 A;  4AQF C;  4CXY A;  4AKI A;  3SFD A;  4QH5 A;  5LYJ E;  1W0A A;  1LVK A;  1E2A A;  4EZ4 A;  2PJQ A;  5KMG P;  1UX4 A;  2WM9 A;  4DV5 T;  2QRX A;  3JC6 D;  3QB5 K;  4IE0 A;  5L4H A;  4UEM A;  2DWK A;  2JMH A;  3FHN A;  3ZYM A;  4LF6 T;  2XQ7 A;  3K3O A;  4U33 A;  2Z6E A;  3IEE A;  4LML A;  4YT0 A;  2HN1 A;  1OED A;  1SE7 A;  4JI5 T;  4EZH A;  3SS1 A;  4HFV A;  1UCU A;  3CX6 B;  5LGT B;  2Y8D A;  3MA9 A;  3KV9 A;  3RYC E;  3KDS E;  5F8P A;  2CM0 A;  2V7I A;  3ESL A;  3ZMS B;  3CIR A;  3ZT6 A;  2E8I A;  2WCA A;  5AQL B;  2CMR A;  3RIU C;  2MTQ A;  4M1P A;  3F57 A;  4I4T E;  4OK0 A;  2WB5 A;  2FUP A;  3OYZ A;  4PJM A;  4YSX A;  2D2S A;  3ZCI A;  2XQ4 A;  3P4S A;  3UUM A;  3AE3 A;  2UU9 T;  1Y64 B;  4OHF A;  3B13 A;  3EI0 A;  4JUY A;  3GN5 B;  2BKO A;  2PFV A;  3AEE A;  3C4Z A;  3ETV A;  4JEH B;  5LP6 E;  4IL9 A;  4XBF B;  2NP9 A;  3CML A;  5A1L A;  1YKH B;  2LJL A;  3LG7 A;  1HNW T;  5J2T E;  2GK9 A;  4B3T T;  4IDQ A;  2IML A;  2LHR A;  3A5X A;  3UU4 A;  2AXD S;  2IC9 A;  4ZZB A;  5FL1 A;  2H89 A;  4QXB B;  3E08 A;  4WBO A;  2CXL A;  1OXZ A;  3PU3 A;  4V1A v;  3RC8 A;  3AE8 A;  4DR7 T;  3ZJ1 A;  3IBP A;  5LG3 A;  2Q9Q A;  3MZK B;  4JI0 T;  3RKG A;  1WLX A;  5JDN A;  4TV9 E;  2X9H A;  3RYI E;  2IAK A;  3M65 A;  4O4I E;  2KXP B;  5LCY A;  4XAX B;  3BK9 A;  3Q2M A;  4N78 D;  2ZM6 T;  3PV0 F;  2UXB T;  3TLT A;  2JPF A;  2WP9 A;  5CA1 E;  5LBM A;  4A5X A;  2ZLY A;  4PAG A;  4OFZ A;  4YTM A;  2M67 A;  4JLE A;  4HWI B;  4DMV A;  4UVA B;  1MIW A;  4CN6 A;  3AE5 A;  4GK5 E;  1WYB A;  2FJB A;  2WSS V;  3ZKR A;  3ZMU B;  4ILA A;  3SRZ A;  3ZN0 B;  1W9R A;  4HWF A;  5ABH A;  3UFG A;  2WBL A;  3IA3 A;  2CWO A;  2WZH A;  3PUS A;  4O8S A;  3PUX F;  4U72 A;  4U31 A;  4EYU A;  4PNI A;  5C2T A;  2N9D A;  2UUB T;  4DR5 T;  1LRZ A;  3UUB A;  3CX8 B;  2D0U A;  4NPP A;  5LA6 E;  3B57 A;  4KMC A;  2CE7 A;  3T1H T;  3OBV E;  4K0K T;  1MMA A;  4HKA A;  1WRD A;  4ZXL A;  4OX9 T;  5JRC B;  2FBW A;  3AEF A;  4X66 T;  4QXH B;  4QX8 B;  2L9Q A;  1IJ5 A;  2LOP A;  2XM1 A;  4U3C A;  4UF0 A;  2I0M A;  3PUW F;  3RYH E;  4YTP A;  3J7Y q;  1LVF A;  1UGO A;  4GK0 E;  4PJJ A;  3JC6 C;  3CVR A;  3N9M A;  2K3W A;  2NOX A;  4GKJ T;  1ZV4 X;  1UUR A;  4G2A A;  3NBX X;  5H6R B;  3ZT5 A;  2WWV A;  2LKH A;  1XWM A;  4CI1 B;  2MAW A;  2MBG A;  1S94 A;  5JH7 E;  4IDZ A;  5AQK B;  3Q5W A;  2CLY B;  2WU2 A;  5KDM C;  1W09 A;  4COF A;  3CWZ B;  2H7O A;  2XPK A;  3AE6 A;  3DP7 A;  1JNR A;  2W61 A;  1U4Q A;  4HN9 A;  3UT5 E;  1N32 T;  3K3Q C;  3F31 A;  2BG9 E;  3P50 A;  2BS3 A;  3O4X E;  3PUA A;  3AAA B;  4QKN A;  4ANJ A;  5JR9 C;  2VKJ A;  3PU8 A;  3IF8 B;  4NIQ A;  2WY2 A;  1FIO A;  3ONJ A;  3WAJ A;  4DV6 T;  3EVY A;  2V7M A;  3T8O A;  4I0U A;  3PDY A;  3T1Y T;  1I6Z A;  4EEB A;  4DV4 T;  2VAS A;  3EAB A;  5DJQ C;  4P0B A;  2UUC T;  1D0X A;  2E2A A;  1WR6 A;  4HWH A;  3DJB A;  4IE4 A;  1E7P A;  3RHW A;  5LHH B;  3QUJ A;  2JQH A;  2UXX B;  3AEA A;  2V7J A;  5AQP B;  3ABV A;  3LK4 2;  1FJG T;  3ZYK A;  1SUM B;  1YKE B;  4DVD A;  5LXT E;  2CA5 A;  2I6H A;  3PE0 A;  3Q9D A;  2X9W A;  1OED E;  2LSG A;  3AED A;  4TWH A;  4P1N A;  3IHR A;  4PW8 A;  1HX1 B;  5FXW A;  2NW9 A;  4BA9 A;  3LFM A;  2VB6 A;  2WMN A;  3AA0 B;  5GON E;  5LMU T;  4JI7 T;  2UXD T;  2B76 A;  4L9I A;  5HEH A;  5CGM A;  1T8B A;  2G0U A;  2XZE A;  3P4W A;  3H3A A;  3P4R A;  4K0U A;  3VRA A;  4MHC A;  4YSZ A;  3NVO A;  5FVL A;  4I50 E;  2CBI A;  2A72 A;  5FY7 A;  1ZEE A;  2PG8 A;  1FMW A;  4HE8 A;  3SOL A;  4EXT A;  3I1A A;  2WU5 A;  4ZOL E;  1NAF A;  3N9O A;  2CEA A;  3NWI A;  4IGU A;  4YLH A;  4ILB A;  2VL8 A;  2XAF B;  2DI4 A;  5HEU A;  3A7M A;  4C91 A;  3CPZ A;  3O1I A;  5HXH A;  3UQ7 A;  4J2C A;  5JVD E;  2XQ3 A;  4KHZ F;  5EK4 A;  2X9Y A;  2LEH A;  2E9X C;  3OYX A;  4HFB A;  5ABF B;  3KBT A;  3AE9 A;  2V5C A;  2VVS A;  2IHR 1;  2E5L T;  3ZPO A;  4WYV A;  3AEG A;  2VK9 A;  4NXN T;  2UXC T;  2NW7 A;  5AQJ B;  5JQG E;  4YHJ A;  2VVN A;  3AA6 B;  4QH4 A;  4X20 E;  2BBH A;  4IRE A;  3UU6 A;  5ABG A;  4YJ2 E;  2QYW A;  3A8Y C;  3AE7 A;  1LKX A;  4GYS A;  1HTJ F;  5FXX A;  4YXD A;  1WCR A;  1KNZ A;  2VKD A;  2ZM2 A;  3TLV A;  4AKR B;  1WYC A;  3W15 B;  1D0Y A;  1WFD A;  2HPL A;  3NZQ A;  2JMK A;  2XAJ B;  4EGW A;  2A2F X;  5L3E B;  3TKL B;  2QA7 A;  4I43 B;  2E5V A;  2W2U A;  4BAY B;  4PFP A;  2LM2 A;  2EHO B;  2SPC A;  1T72 A;  4IDN A;  2L8K A;  2D5U A;  1YQ3 A;  3P7I A;  5LHG B;  1Z8U A;  1HR0 T;  2RPA A;  2BG9 C;  4ERR A;  2MOZ A;  5L3B B;  2ODU A;  4YY3 T;  4B3M T;  5JDG A;  2XQ9 A;  1HCI A;  2UUA T;  3QC9 A;  5FNV E;  4H9O C;  4AKL A;  2EHO A;  3L09 A;  1MNE A;  3ETU A;  4L5G A;  4TX5 A;  4Z91 A;  3TLS A;  3VRB A;  5HXR A;  2X68 A;  2YK0 A;  4EIW A;  1ZHC A;  4HFC A;  4WW0 A;  2H88 A;  4JI6 T;  3VKG A;  3C50 A;  1G73 A;  4IDO A;  1IBK T;  5J1G A;  2LSI A;  3AA7 B;  4CI3 B;  5M4Y A;  3FZL B;  3EDV A;  5FY0 A;  5LJN A;  3JCF A;  2P9B A;  1VRB A;  2OLT A;  2BS4 A;  1M62 A;  2J1D G;  4UVB B;  4AIS A;  4CZZ B;  2DLR A;  1NEK A;  4DMW A;  4UV8 B;  5C3J A;  2CXD A;  4LF7 T;  2LM9 A;  4AKH A;  2YU1 A;  2XAQ B;  2KWI B;  2QGS A;  1VCT A;  4EV6 A;  3K8P C;  4H63 V;  4JI4 T;  2OV9 A;  3HR0 A;  1YW0 A;  5IUX A;  3CKD A;  4I55 E;  3RKO A;  4FI5 A;  1ZP0 A;  2BDE A;  2CLY C;  4TWD A;  3UUX B;  3N5L A;  3V5U A;  3NZP A;  4ZS2 A;  2PTF A;  3PJA J;  3ZT7 A;  3CQX C;  3Q5D A;  1HF8 A;  3KFW X;  4DR3 T;  1GQE A;  1HX8 A;  4O4J E;  4F6R C;  1MMD A;  4EYY R;  2Y6X A;  4QWN B;  5HWX A;  4YJ3 E;  2YDR A;  2N1G A;  2ODV A;  5LB7 B;  3RH3 A;  3VU7 H;  3TLU A;  5L3F B;  2C5K T;  3K3N A;  3AB3 B;  3MXZ A;  2BG9 A;  1BR0 A;  2LOS A;  5JDH A;  3RYF E;  3LBX B;  3AA1 B;  4UF0 B;  5JDF A;  3UU5 A;  1D1B A;  1W0B A;  4NUU A;  2CPT A;  3PUZ F;  2X51 A;  5BMV E;  2VKO A;  1IBL T;  4DBR A;  4IIJ E;  4QXC B;  1VOM A;  4HFH A;  4TZ4 C;  4EB6 E;  4IL4 A;  4AIU A;  1UUS A;  2WDQ A;  3AAI A;  3OVU A;  3N2G E;  4U7Y A;  2K48 A;  4CQI A;  2V6Y B;  4MAL A;  2W66 A;  4X64 T;  1DU2 A;  4NUV A;  4WZX A;  5LHI B;  3H37 A;  2K9A A;  2LSK A;  3OJA A;  4E7Z A;  4AI6 A;  2IC6 A;  3N9P A;  1YQ4 A;  3G06 A;  2YOE A;  4X5T A;  3FB2 A;  2D9D A;  2QVA A;  4HWD A;  4CI2 B;  4KHP T;  5LMN T;  2V1D B;  3FXD B;  3MKD A;  4GYR A;  1XMQ T;  1N36 T;  5HAX A;  3RC3 A;  2CHN A;  2LSJ A;  1KEY A;  4ISS A;  1XDP A;  4B6X A;  3FZK B;  4UVC B;  3ANW B;  2M6B A;  5H6Q B;  1YXR A;  3AAE B;  4JI2 T;  2W4X A;  3FBL A;  2BZB A;  4O4L E;  4U7I A;  3SWH A;  3ZC1 A;  1FMV A;  4AQG A;  1N33 T;  2PBI A;  2YDS A;  4FJO A;  2W0G A;  4CXW A;  2IUB A;  2XAH B;  2Y48 B;  4O4H E;  2LKG A;  2V7L A;  3OPC A;  2J47 A;  2ES0 A;  3KV6 A;  5J0Z A;  3HKC E;  1BR4 A;  4H9N C;  2VUR A;  3UFE A;  2HHH T;  4LF4 T;  2NR4 A;  3BQI A;  2XTL A;  3FZM B;  3B5M A;  5IYZ E;  3RRW A;  4QHO A;  1H7C A;  3LJC A;  4JI1 T;  3UTK A;  4E7S A;  4DR4 T;  3LK3 B;  4PJL A;  3RRC A;  2RA1 A;  3TLW A;  4XZC A;  1IJ6 A;  2KSR A;  3FBZ A;  4QX7 B;  2ACX A;  3GWH A;  1L0V A;  2ZMA A;  3EHZ A;  2XJ7 A;  2V8S V;  1CUN A;  3CK6 A;  3LK2 B;  3VR9 A;  4DV3 T;  2K24 A;  5HXE A;  2YDQ A;  3MK7 C;  3PUG A;  4MBQ A;  2C0S A;  4UIG A;  5FY1 A;  4CN4 A;  5F3J A;  2F4V T;  3JAD A;  3ZST A;  2BVL A;  4IE7 A;  1KK7 A;  3RF1 A;  4DUY T;  4X65 T;  1Y01 A;  3I9W A;  5AQN B;  3HKD E;  4EAH A;  2IW5 B;  3K1S A;  3X1D A;  2IIU A;  2V26 A;  4JEU B;  2KIN B;  4JBW F;  3J9X 1;  3L3P A;  4Z8X A;  1KNR A;  2V5D A;  4PJN A;  3VKH A;  1QSD A;  3QK6 A;  2XQA A;  2XSA A;  3E0Z A;  4KBM B;  4U74 A;  3HKB E;  4ZZC A;  4A56 A;  2B1E A;  3KVA A;  5AQG B;  4G63 A;  5CFB A;  3RIF A;  3ZMT B;  3QNU A;  4IDP A;  2DNX A;  3AXJ B;  2K5B B;  4TNV A;  3E22 E;  4ZI3 C;  3UU3 A;  2JQK A;  3R6N A;  3CX7 B;  5CB4 E;  3RIA A;  4LF5 T;  5HEG A;  5AQF B;  2DHR A;  1VCS A;  4H9S E;  5AQT B;  1HG2 A;  3RGL A;  2W00 A;  4PFO A;  2LLY A;  2VWA A;  3EUH A;  1J5W A;  3HKE E;  3MJX A;  5L3D B;  2V6X A;  2ZM8 A;  5LG4 A;  1IZN B;  1HNZ T;  1US7 B;  3GA8 A;  2YKS A;  2V7K A;  1JNZ A;  3AEC A;  3V5S A;  4GOU A;  2NW8 A;  3VHL A;  2XAG B;  1V9D A;  3I0O A;  4BJN A;  1MMN A;  2M6I A;  5AQI B;  4KX6 A;  2WWU A;  3WI3 A;  1S35 A;  1BR1 A;  4MLK A;  4ADZ A;  1ZKE A;  3NRY A;  1X9B A;  5ETW A;  4EOZ B;  3Q5E A;  2BBJ A;  5L3C B;  2XM2 A;  3GN5 A;  5JR9 B;  1NEN A;  2JRK A;  3FZF B;  4YFS A;  5EK3 A;  3CQC B;  3KVB A;  2BKN A;  4H63 H;  3QOF A;  4IE6 A;  4O2B E;  5DQW A;  5AQV B;  5FP3 A;  4HEA A;  5FKY A;  5TAO A;  3L39 A;  3ZYL A;  4X62 T;  3U3I A;  3OTO T;  4DND A;  5LGN B;  3ZMZ B;  3SFE A;  2X0H A;  3AE4 A;  4DID B;  1J1J A;  4LFB T;  4UEL A;  5CA0 E;  1XZY A;  3NRX A;  2Q9Q B;  3HL6 A;  3L8R A;  2JQQ A;  2VQF T;  4U2Z A;  3AVS A;  4TV8 E;  1OED B;  3EDU A;  2DL1 A;  5JDL A;  2VQE T;  4KI0 F;  5LJM A;  2R6G F;  3JAE A;  4P09 A;  4AXP A;  4IHJ E;  4Z90 A;  5ABE A;  2BS2 A;  4HGA A;  3O9X A;  2A9U A;  1ZOY A;  2WAU A;  4H9Q C;  2DWG A;  4DR1 T;  1O3X A;  5AQR B;  4ZHQ E;  1SA0 E;  2Q9Q C;  3N9L A;  4KP3 C;  1XDO A;  1OWA A;  1KNP A;  4IST A;  5FYM A;  3ZEF B;  1IBM T;  2LRK A;  4HFI A;  3ZSS A;  2LT3 A;  2NTY A;  3ZN1 B;  2E9X B;  3OKQ A;  5L4E A;  2D0T A;  1HS7 A;  4UXN B;  1XNQ T;  4AQF A;  1D1A A;  2KT9 A;  3AE1 A;  3N9N A;  2XUE A;  2JIW A;  2VKH A;  4LF8 T;  3S4U A;  5J2U E;  2EHO D;  3PJA A;  5HEJ A;  4DR6 T;  5HYA A;  2ACZ A;  2E9X A;  3ZLI A;  1HFA A;  1G8X A;  5JDQ A;  5HEO A;  1U5P A;  3N2O A;  3BQK A;  4A98 A;  3N9Q A;  4TNW A;  1QUU A;  5EZY E;  4WNK A;  4BJM A;  3I0Q A;  5KX5 E;  4LFA T;  4JYA T;  5JRC A;  2XHE B;  3KV5 A;  4PK5 A;  5HWY A;  2EHO C;  4YSY A;  5LGU B;  3ONL C;  4HFE A;  4H9P C;  4ILU A;  4KUM B;  3ZMV B;  4B3S T;  4HFD A;  3ANW A;  5AQM B;  1SHZ C;  3FXE B;  4OYK A;  5EK2 A;  1XMO T;  2E9X D;  4DBQ A;  2XQY A;  2W67 A;  5FXZ A;  4JI3 T;  4A97 A;  3C4W A;  4HTE A;  2BG9 B;  5FL0 A;  4YTN A;  5L2L A;  4H9R C;  2CBJ A;  3RQW A;  4ZI7 E;  5AQH B;  1N34 T;  2CCQ A;  5DAB A;  3PUQ A;  3P8C D;  2KLQ A;  4QH1 A;  4LMK A;  1OED C;  2XQ6 A;  1HG5 A;  3KIN B;  3O1J A;  4HWC A;  2ZM0 A;  4GKK T;  1NWM X;  3AEB A;  2J62 A;  2LHN A;  3C98 B;  4WBN E;  5AFU L;  3UU8 A;  2CWY A;  4UV9 B;  5HXC A;  2CXF A;  2WDV A;  4AKG A;  2YU2 A;  2L3L A;  2RP4 A;  3UUL A;  5DQV A;  3F2E A;  1FEW A;  3N2K E;  2X67 A;  4U2Y A;  3U78 A;  3PUV F;  4EED A;  3LSV A; 
#chains in the Genus database with same CATH homology
 4DUY T;  4X65 T;  1HNW T;  4B3T T;  4DR7 T;  4JI0 T;  1HR0 T;  4LF5 T;  2ZM6 T;  2UXB T;  4YY3 T;  2UUA T;  5IWA T;  1HNZ T;  4JI6 T;  1XNR T;  1IBK T;  4DV2 T;  1HNX T;  4DV0 T;  1I94 T;  2UUB T;  4DR5 T;  4LF7 T;  3T1H T;  4K0K T;  4OX9 T;  4X62 T;  4JI4 T;  3OTO T;  4X66 T;  4DV1 T;  4JI8 T;  4LFB T;  4GKJ T;  4DR3 T;  1J5E T;  2VQF T;  4JV5 T;  2VQE T;  4AQY T;  4DV7 T;  4DR2 T;  1N32 T;  4DR1 T;  1IBL T;  1IBM T;  4NXM T;  4YHH T;  4DV6 T;  4X64 T;  4LF9 T;  3T1Y T;  4DV4 T;  2UUC T;  4LF8 T;  4DR6 T;  4KHP T;  5LMN T;  1XMQ T;  1N36 T;  1FJG T;  4JYA T;  4B3R T;  4LFA T;  4DUZ T;  4LFC T;  5LMU T;  2UXD T;  4JI7 T;  4JI2 T;  4B3S T;  4DV5 T;  1N33 T;  5BR8 T;  4LF6 T;  1XMO T;  1XNQ T;  4JI3 T;  4B3M T;  4JI5 T;  1N34 T;  2HHH T;  4LF4 T;  4JI1 T;  4DR4 T;  4GKK T;  2E5L T;  4DV3 T;  2UU9 T;  4NXN T;  2F4V T;  2UXC T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...