5LMNT

Structure of bacterial 30s-if1-if3-mrna translation pre-initiation complex (state-1a)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
molecule tags Ribosome
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 5lmnT00
4YHHT 1IBLT 2UUBT 2F4VT 4DR4T 4DR2T 1N32T 4LF5T 2UUAT 1N36T 4LFCT 4JI6T 4JI1T 4LFBT 1XNQT 3T1YT 4OX9T 1FJGT 4DR6T 4DV1T 4DV6T 4DR5T 4JI3T 4JI0T 4GKKT 2UUCT 2UXBT 4JYAT 4X62T 1J5ET 1XNRT 1N34T 4LF6T 4YY3T 2E5LT 4NXMT 4DV4T 4DR7T 1XMQT 4GKJT 4LFAT 4JI7T 3T1HT 4LF9T 4LF4T 4B3RT 2HHHT 4JI4T 2UU9T 4X64T 3OTOT 4DUYT 4DV3T 1HR0T 4DV7T 2UXDT 1XMOT 5LMNT 4DUZT 1HNZT 4LF8T 1HNXT 4JI8T 4NXNT 1IBMT 4JI2T 4X65T 2UXCT 4DV5T 5LMUT 4K0KT 4X66T 1N33T 2VQFT 1HNWT 2ZM6T 1I94T 4AQYT 4DV2T 1IBKT 4B3ST 5BR8T 4DV0T 4JV5T 4DR1T 4LF7T 4DR3T 4JI5T 4KHPT 2VQET 4B3TT 5IWAT 4B3MT
chains in the Genus database with same CATH superfamily
2LJLA 3P50A 1DU2A 4UF0B 4CI3B 3RYCE 3FZFB 5DQWA 3AA1B 4IL9A 4U7IA 3QUJA 4P0BA 2DLRA 2IC9A 4IDPA 2WDQA 1ZKEA 4GYSA 5L3BB 2CLYB 4QH1A 4TWFA 3KV6A 2UXXB 2FUPA 5EK2A 1J5ET 3OKQA 3EABA 3I0QA 2LSKA 4FI5A 5FVKA 4BA9A 2VKJA 2VK9A 1T8BA 5JR9B 3RHWA 2X68A 3SRZA 2C5KT 4YTMA 2XQ7A 5J1GA 5AQKB 5JR9A 5E0OA 5J0ZA 2M6IA 1E7PA 5ADXL 2CHNA 3I9YA 4O8SA 3T8OA 2RA1A 2WWUA 2BS2A 4ILBA 1HNXT 3P4RA 2XSBA 2WBLA 2CLYC 2VKOA 2XAGB 3ZKRA 4JBWF 4X20E 2CRBA 4ZHQE 5L3EB 5EK3A 3PU3A 2Y6XA 3NZQA 4DV2T 5AQVB 2W63A 1SUMB 1WLXA 4HFIA 2Y8DA 5JR9C 3ONLC 1OEDE 3AEBA 3GWHA 2N1GA 1JNZA 2BBJA 3AE6A 2LRKA 5A1LA 2QVAA 3RKOA 4EXTA 3PJAA 4E7SA 4OYJA 1SA0E 4DR6T 1KFYA 2DCFA 4JI3T 2X51A 5HXRA 5LA6E 3CQXC 3UQ7A 1KF6A 1WRDA 1G8XA 4TWHA 2MOZA 3ZT6A 3UUXB 4DMVA 4UELA 1ZHCA 4GKJT 2W0GA 1O3XA 2CMRA 4ZI2D 1VCTA 2WP9A 2JQHA 3TLSA 3HKCE 4DUYT 2WWVA 2EHOB 2XJ7A 4H9PC 5L4EA 3J9X1 3UU6A 2V7MA 4AKGA 4HEAA 2YINA 4YSXA 5JREA 1XZYA 2NWBA 5JH7E 3UFEA 5LNKA 3AECA 5AQMB 3PUYF 3WAKA 3AE2A 2C5JA 4ISTA 4BAYB 3UU8A 2LE8A 3ZYKA 4DBQA 1MMDA 2IIUA 4UV8B 4L9IA 1ZP0A 3K1SA 4GK0E 2LSGA 3Q5EA 4DR2T 1MMNA 5EK4A 5FVLA 2NW8A 1UK5A 4WZXA 2W67A 2CXLA 3T1YT 2KT9A 3AA6B 3CX6B 2Q9QB 5L3CB 1Y64B 2AXDS 3Q9DA 4EZ4A 4YSZA 2KSRA 3AAAB 3UU5A 2IC6A 3RLFF 2XQ3A 1BR1A 2YKSA 4TV9E 4LFAT 4X1YE 1HFAA 1WR0A 1AJ3A 4ILCA 1FIOA 3RX6A 2DI4A 3RI5A 4GYRA 3FZMB 2BS4A 3CQCB 3AEEA 2IDOB 4YXDA 3KVAA 2QRXA 4CN6A 1IJ5A 5AQTB 2A3DA 1WR6A 1M7KA 2BZBA 5EZYE 3NVOA 4MLKA 4A98A 2KLQA 3ZC0A 3O4XE 5HYAA 3LBXA 3K3QC 4IT4A 5L3FB 4HKAA 1LKXA 3PV0F 4TWDA 2NW9A 1D1AA 3BQLA 2H7VC 3JAEA 3CPZA 3NZPA 4NPPA 2ZM2A 4QH5A 5JQGE 4DR4T 1WYBA 5LGUB 2I6HA 3J7Yq 2LRLA 4Z91A 5FP3A 5LG4A 4U2YA 2I0MA 3H37A 4MHCA 4OYKA 5IUXA 2JJ9A 3A8YC 2ZMAA 3C51A 2IW5B 5HCJA 4O2BE 4LF6T 4NIQA 3WI3A 1WFDA 4PNIA 4N78D 5LHIB 5H6QB 2M6BA 4U3CA 2HHHT 3RC3A 4AQFA 2D5UA 4X1KE 3MA9A 2RPAA 2XM2A 2WY2A 4O2AE 3A7MA 4ANJA 3CVRA 4K0KT 4DIDB 3FXDB 3ZYLA 4IE6A 2VKDA 3ESLA 1I94T 2X66A 3O1IA 3RYHE 5ABFA 4AQFC 5AFUL 3C4WA 3LJCA 4KP3C 3VHLA 3P4WA 2JRKA 2CWOA 4B3MT 3CQGB 3MXZA 1VOMA 2D0TA 2V7LA 4P09A 5F5WA 3HKEE 4QH4A 1Z8UA 4OX9T 3FB2A 4XAXB 3F31A 1E2AA 2LSYA 3BQKA 3I9WA 5AQGB 3OVUA 3ETUA 4HFBA 4UXNB 5ABGA 2X0LB 2W00A 1HCIA 5M4YA 1FEWA 3CMLA 3TKLB 4YY3T 4KUMB 3EAMA 3KV5A 3AE5A 3ZCIA 3NBXX 3PUXF 4CI1B 4QHOA 5CA1E 2JPFA 2WM9A 2PG8A 5KX5E 3P4QA 2BKOA 4X64T 2ACZA 4JLEA 1OWAA 3KFWX 3SFEA 3JC6D 1D0ZA 2X9WA 4PAGA 1FMVA 1MNEA 5CJ5A 2A2FX 2UXCT 4DV5T 4P0AA 5JDMA 1MIYA 2LSIA 1NENA 3KBTA 5LXTE 2ZM6T 4EEDA 2PBIA 5ABHA 2KNDA 2E5VA 3AEDA 4F6RC 2NP9A 3ZLIA 2LOSA 5FL1A 3C98B 3EI0A 3Q5WA 3N2KE 3Q5DA 4I4TE 2FJEA 3K8PC 3L3PA 1N32T 2N9DA 3ZPOA 3TLTA 3P4SA 2VL8A 2XUEA 3FBLA 4AIUA 3AVRA 4ASKA 2V7KA 2D9DA 3S4UA 2E9XB 5HXSA 4G2AA 3UUMA 2XAQB 3NRYA 5FNVE 2A9UA 3AE7A 3JAFA 5LJMA 3RQUA 1MIWA 2VURA 2E9XA 2LHRA 2MPKA 2FJDA 4UF0A 3L09A 1YXRA 5JDFA 5CA0E 2KMFA 2C0SA 5LGNB 1XMQT 4X1IE 5JVDE 3B5MA 2CCQA 3PE0A 1HG5A 5FKYA 2E2AA 2WU5A 4H63V 4L0RA 2FJBA 4YT0A 5IYZE 3IBPA 2E9XC 2XPKA 4ILAA 4V1Av 1XWMA 2K9AA 5JDHA 5KXJA 1WYCA 4BJNA 3V5UA 4G63A 4DV0T 3GN5B 5HWXA 4LF7T 5AQLB 5JDGA 2CXDA 2ODUA 2GK9A 2H88A 3AVSA 2CEAA 4IREA 2N2NA 3EHZA 2MBGA 3NRXA 4LFBT 2V8SV 2DHRA 5FY0A 1L0VA 4IDZA 4ERRA 4DR5T 4BJMA 5JDQA 3H3MA 5DJQC 2UXBT 1NEKA 2J4GA 4CXXA 1B7TA 2BG9B 4HWDA 2CM0A 3OJAA 1XNRT 2HH7A 3GA8A 1CHUA 4K0UA 2IAKA 3U3IA 2XAFB 4YHJA 3FXEB 3EDVA 3RIFA 3JADA 4ADZA 4KX6A 4TNWA 1VRBA 4HFCA 4H63H 3SOLA 3ZC1A 4PK6A 4DUZT 5J2TE 4JI8T 4LF8T 3SFDA 1UGOA 4H9NC 4ZI7E 3BQIA 3KDSE 4C90A 1MMAA 4DO0A 5CB4E 2WDVA 4ZOLE 2P9BA 2WSSV 3FHNA 4AISA 2LM2A 3CIRA 3HA4A 1IBLT 2EHOA 1XDOA 3O1JA 5AQPB 5HXCA 3RF1A 3OBVE 2XQ4A 2ZM8A 4EB6E 2FJAA 2LSJA 3MJXA 3KV4A 4PJMA 5FMNA 2Z6EA 4KI0F 2YOEA 1SE7A 3HKBE 1N34T 2XY8B 2WMOA 2EHOC 1UUSA 2MYSA 1BR2A 4WBOA 2LT3A 3O1HA 4IL4A 5L2LA 5H6RB 4YSYA 3RRWA 4LF9T 2LEHA 1H7CA 4H9OC 5AQHB 2XAJB 3M3ZB 4IDQA 5FY7A 5DABA 1MMGA 3QK6A 2CBJA 2Q9QA 4HFVA 4QXHB 5FXXA 3RYFE 2VB6A 2CA5A 2MTQA 3CX8B 3AE3A 2VQFT 3FZLB 2WZIA 1HNWT 4X5TA 2V26A 3R84B 2FBWA 5HEOA 4TNVA 4B3TT 2VL0A 5IWAT 2NW7A 2Q9QC 2DL1A 5AQSB 3LK3B 4U7YA 4IHJE 4EZHA 3PURA 2WCAA 4A97A 1KNZA 4IE5A 3MK7C 2BDEA 3E08A 5HEUA 4J2CA 4U72A 1YKHB 2HPLA 1S35A 3UULA 5AQJB 2BKPA 4CN4A 4WBNE 3PUSA 4MBQA 5HEJA 3NWIA 1OXZA 3EDUA 3MZKB 4NUUA 4ZS2A 3L8RA 2NTXA 3KV9A 3PUZF 3UUBA 4IIJE 4MFRA 2XM1A 3D0TA 3G06A 3OTOT 5ABEA 2L3LA 3ZMZB 1S94A 4QKNA 1XMOT 5LMNT 2KWIB 2YU1A 4NXNT 3ZMSB 1T72A 5HAXA 2HN2A 3ONJA 3KBUA 4EEBA 1W9RA 1ZV4X 3UFGA 4IE7A 5C2TA 3RGLA 3A5XA 2WS3A 4JEHB 1E1HB 4AKRB 4IE0A 3VRBA 3ZCJA 2WB5A 3FBZA 3N9LA 3PUWF 1HX8A 4AI6A 4AQGA 3PUQA 4PJLA 4YHHT 1U5PA 4CI2B 3QB5A 2OV9A 1J1JA 2XQYA 2KXPB 5AQRB 2B76A 4LFCT 1HF8A 3ZMUB 3P7IA 5LBMA 1T7SA 2HN1A 1J5WA 2UUCT 1W09A 4EGWA 4GIWA 4OK0A 3DJBA 2XQ5A 4PJNA 1UURA 3AEGA 4IGUA 4ZI3D 2JMHA 5FXVA 4DV4T 1KNRA 3ZSSA 3LK2B 4JI4T 3AAEB 3RKGA 2YDQA 1HR0T 4CN1A 2UXDT 5CGMA 1LVKA 3DTOA 2QYWA 2I59A 1IBMT 2V6YB 4F8HA 3OYXA 2H3RA 1YD8G 5LMUT 3PJAJ 3RIUA 4YLHA 2WU2A 4X66T 1EZ3A 3I1AA 3TLUA 2V6YA 1YW0A 2JQ9A 1YQ4A 4UIGA 3DP7A 1IBKT 3RRCA 4JI5T 3RH3A 2V7JA 5LB7B 4QXCB 2L8KA 3NKZA 4TV8E 1BR4A 3N9NA 1QSDA 3RIUC 2PFVA 4UVCB 3F57A 3LSVA 3AE9A 4C91A 2WZHA 3MKDA 5HWYA 2W2UA 5HEGA 5FXZA 2XQ6A 2LKHA 5FXWA 1HG2A 4JYAT 5AQIB 1HX1B 1G73A 1X9BA 5L47A 2A72A 5FY1A 2K5BB 2NTYA 3T1HT 5DQVA 2XSAA 5C3JA 3JC6C 4YJ3E 2PJQA 4IDOA 3MACA 4KBMB 3C50A 5FYMA 3RPUA 3ZT5A 5KDMC 3IF8B 2W4XA 4B6XA 1OEDB 2XQ8A 1M62A 5J2UE 2V6XA 4E7ZA 3ZYMA 2E8IA 3IA3A 4DMWA 3UTKA 3LDQB 3ABVA 4B3ST 4NUVA 1OEDA 4QWNB 3K3NA 4JV5T 2NOXA 5JTGA 4U33A 2L9QA 5HXHA 3LFMA 2XTLA 5LBQB 3PDYA 2OLTA 5C8YE 4AKLA 2WAUA 2W62A 3C4XA 3WAJA 2XQ9A 2B1EA 2WDRA 2Y48B 3AB3B 2BKNA 2JQQA 4EYYR 3HL6A 4PFOA 1OEDC 4KMCA 4ZZBA 3VR9A 3GN5A 3V5SA 3IHRA 3PUGA 3FZKB 3TLWA 4CXWA 3ZT7A 1US7B 4AXPA 5KMGP 5LYJE 4A5XA 3RC8A 3P8CD 4HWHA 2G0UA 2J62A 3F2EA 4H9SE 2UU9T 4O4JE 4WYVA 3QNUA 3BK9A 2CHOA 4HWCA 3N9QA 2UXNB 5F3JA 4DV3T 1Z0PA 2LOPA 1IZNB 3N9OA 2ODVA 4EIWA 5L3DB 3E0ZA 1YKEB 2BG9A 2BBHA 3UUNA 1D0XA 4PFPA 4WW0A 2KZ7B 3K3OA 4HWFA 2V5CA 1W0AA 1HTJF 2CXFA 3CX7B 3PU8A 2R6GF 2V5DA 4Z8XA 4KHPT 4YTPA 4QXBB 2IHR1 1ZEEA 4I50E 3AE1A 1YQ3A 2W66A 2BG9C 3EUHA 2VKHA 4DVDA 4UR9A 4JI6T 4JI1T 2OA5A 2ACXA 4CZZB 5AQQB 1HS7A 2EHOD 4DV1T 4TN7B 1BR0A 1X79A 4HWIB 2XHEB 4EAHA 4O4LE 2LHNA 3IEEA 3RYIE 1T98A 3QB5K 2KINB 1IJ6A 5LGTB 2E5LT 4NXMT 4JEUB 4LMKA 4AKIA 3TLVA 5GONE 5AQFB 2KWHA 2X0YA 3JCFA 2V7IA 2BG9E 4IDNA 4Q25A 2CBIA 3HKDE 3M65A 1I6ZA 3OYZA 1U4QA 4TUYE 3I0OA 5LOVE 3W15B 4ZI2C 1KEYA 4ZEYA 4JI2T 3UQ4A 4X65T 4ZXLA 3AEAA 4UEMA 2Q9QD 4TX5A 5JDNA 4ILUA 2ZM0A 2V1DB 4MALA 3ZJ2A 2X9YA 4DR1T 1GQEA 3CKDA 2AE9A 3AXJB 2CE7A 4O4HE 4TZ4C 5LHGB 1MIVA 1FMWA 2K24A 3H3AA 2F4VT 2VVSA 3CWZB 3AXJA 4LF5T 4HGAA 1N36T 4PK5A 2BVMA 4HE8A 5LHHB 2YDRA 4GK5E 4DNDA 2ZLYA 1FJGT 5TAOA 4UV9B 3UU4A 3N2OA 1CUNA 4JI0T 3UT5E 3AA7B 2XAHB 4FJOA 3RQWA 1Y01A 3N9MA 3N2GE 1UX5A 3ZEFB 1UX4A 3SWHA 4PJJA 1XDPA 1QLBA 3LBXB 5LG3A 4JI7T 5F8PA 2XZEA 2NR4A 2WQYA 3HI2A 4EYUA 3LK42 2IMLA 2LLYA 4IE4A 1VCSA 4XBFB 5AQOB 2YK0A 4DBRA 1D1CA 3LG7A 1MNDA 4KHZF 4YFSA 2RP4A 4I0UA 2QGSA 5HXEA 5L3GB 3AE8A 5IHYA 5LP6E 5BR8T 5CFBA 2MAWA 1R8IA 3KVBA 2VWAA 4HN9A 4EOZB 1D0YA 1UCUA 4U74A 2VVNA 4JUYA 4LMLA 4HFEA 3ZMTB 3AE4A 4H9RC 4PW8A 2UUAT 3R6NA 3ZJ1A 3N5LA 1ZOYA 3L39A 3O9XA 2H89A 3E22E 5AQNB 2CPTA 2BVLA 2SPCA 1D1BA 4P1NA 4X62T 3PUVF 2JIWA 2X67A 4YTNA 3CK6A 3ZN0B 4HTEA 3U78A 5FL0A 5ABFB 2YU2A 4QX7B 2DNXA 4OFZA 3B57A 3SS1A 4COFA 4H9QC 3UU3A 1LVFA 4ISSA 5HCMA 4DV7T 3ZN1B 4QX8B 2CWYA 2D0UA 3ANWB 4L5GA 5ETWA 1HNZT 3QOFA 3OPCA 3VKHA 3N9PA 2H7OA 3VRAA 2DWGA 2C5IT 2LM9A 4M1PA 3ANWA 4GOUA 1N33T 3PUAA 1KK7A 1IAPA 4HFDA 2XQAA 3HR0A 2YN6A 3KINB 4CXYA 4YJ2E 4WNKA 3GMIA 3B13A 3Q5XA 1NAFA 1WCRA 3ZSTA 3ONXA 2UUBT 1V9DA 2K3WA 3EVYA 3AAIA 4PK4A 4ZS3A 2IUBA 3Q2MA 1XNQT 2J1DG 4UVAB 2LKGA 3RIAA 1NWMX 2M67A 4DV6T 3ZMVB 2J47A 3PTRB 3FZHB 1QUUA 2X0HA 4GKKT 2ES0A 4ZI3C 5L4HA 4XZCA 1SHZC 5JRCB 2W61A 4ZZCA 2QA7A 2D2SA 4AKHA 2YDSA 1W0BA 4I43B 5JRCA 2PTFA 4I55E 2WMNA 5HEHA 4DR7T 1LRZA 3VR8A 2YEVC 4LF4T 4B3RT 3ETVA 3X1DA 3AA0B 2HPJA 3C64A 4HFHA 2XASB 3VU7H 4UVBB 3P4PA 5AQUB 3C4ZA 3QC9A 2BS3A 4A56A 5LJNA 2X9HA 4Z90A 1KNPA 5JDLA 2JMKA 5BMVE 4U2ZA 3VKGA 2E9XD 4AQYT 2JQKA 2K48A 4U31A 5LCYA 4DR3T 1JNRA 3AEFA 4EV6A 2DWKA 4O4IE 2VQET 2VASA 2X9XA 4LMJA 4CQIA 4OHFA
chains in the Genus database with same CATH topology
4YHHT 1IBLT 2UUBT 2F4VT 4DR4T 4DR2T 1N32T 4LF5T 2UUAT 1N36T 4LFCT 4JI6T 4JI1T 4LFBT 1XNQT 3T1YT 4OX9T 1FJGT 4DR6T 4DV1T 4DV6T 4DR5T 4JI3T 4JI0T 4GKKT 2UUCT 2UXBT 4JYAT 4X62T 1J5ET 1XNRT 1N34T 4LF6T 4YY3T 2E5LT 4NXMT 4DV4T 4DR7T 1XMQT 4GKJT 4LFAT 4JI7T 3T1HT 4LF9T 4LF4T 4B3RT 2HHHT 4JI4T 2UU9T 4X64T 3OTOT 4DUYT 4DV3T 1HR0T 4DV7T 2UXDT 1XMOT 5LMNT 4DUZT 1HNZT 4LF8T 1HNXT 4JI8T 4NXNT 1IBMT 4JI2T 4X65T 2UXCT 4DV5T 5LMUT 4K0KT 4X66T 1N33T 2VQFT 1HNWT 2ZM6T 1I94T 4AQYT 4DV2T 1IBKT 4B3ST 5BR8T 4DV0T 4JV5T 4DR1T 4LF7T 4DR3T 4JI5T 4KHPT 2VQET 4B3TT 5IWAT 4B3MT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YHH T;  1IBL T;  2UUB T;  2F4V T;  4DR4 T;  4DR2 T;  1N32 T;  4LF5 T;  2UUA T;  1N36 T;  4LFC T;  4JI6 T;  4JI1 T;  4LFB T;  1XNQ T;  3T1Y T;  4OX9 T;  1FJG T;  4DR6 T;  4DV1 T;  4DV6 T;  4DR5 T;  4JI3 T;  4JI0 T;  4GKK T;  2UUC T;  2UXB T;  4JYA T;  4X62 T;  1J5E T;  1XNR T;  1N34 T;  4LF6 T;  4YY3 T;  2E5L T;  4NXM T;  4DV4 T;  4DR7 T;  1XMQ T;  4GKJ T;  4LFA T;  4JI7 T;  3T1H T;  4LF9 T;  4LF4 T;  4B3R T;  2HHH T;  4JI4 T;  2UU9 T;  4X64 T;  3OTO T;  4DUY T;  4DV3 T;  1HR0 T;  4DV7 T;  2UXD T;  1XMO T;  5LMN T;  4DUZ T;  1HNZ T;  4LF8 T;  1HNX T;  4JI8 T;  4NXN T;  1IBM T;  4JI2 T;  4X65 T;  2UXC T;  4DV5 T;  5LMU T;  4K0K T;  4X66 T;  1N33 T;  2VQF T;  1HNW T;  2ZM6 T;  1I94 T;  4AQY T;  4DV2 T;  1IBK T;  4B3S T;  5BR8 T;  4DV0 T;  4JV5 T;  4DR1 T;  4LF7 T;  4DR3 T;  4JI5 T;  4KHP T;  2VQE T;  4B3T T;  5IWA T;  4B3M T; 
#chains in the Genus database with same CATH topology
 2LJL A;  3P50 A;  1DU2 A;  4UF0 B;  4CI3 B;  3RYC E;  3FZF B;  5DQW A;  3AA1 B;  4IL9 A;  4U7I A;  3QUJ A;  4P0B A;  2DLR A;  2IC9 A;  4IDP A;  2WDQ A;  1ZKE A;  4GYS A;  5L3B B;  2CLY B;  4QH1 A;  4TWF A;  3KV6 A;  2UXX B;  2FUP A;  5EK2 A;  1J5E T;  3OKQ A;  3EAB A;  3I0Q A;  2LSK A;  4FI5 A;  5FVK A;  4BA9 A;  2VKJ A;  2VK9 A;  1T8B A;  5JR9 B;  3RHW A;  2X68 A;  3SRZ A;  2C5K T;  4YTM A;  2XQ7 A;  5J1G A;  5AQK B;  5JR9 A;  5E0O A;  5J0Z A;  2M6I A;  1E7P A;  5ADX L;  2CHN A;  3I9Y A;  4O8S A;  3T8O A;  2RA1 A;  2WWU A;  2BS2 A;  4ILB A;  1HNX T;  3P4R A;  2XSB A;  2WBL A;  2CLY C;  2VKO A;  2XAG B;  3ZKR A;  4JBW F;  4X20 E;  2CRB A;  4ZHQ E;  5L3E B;  5EK3 A;  3PU3 A;  2Y6X A;  3NZQ A;  4DV2 T;  5AQV B;  2W63 A;  1SUM B;  1WLX A;  4HFI A;  2Y8D A;  5JR9 C;  3ONL C;  1OED E;  3AEB A;  3GWH A;  2N1G A;  1JNZ A;  2BBJ A;  3AE6 A;  2LRK A;  5A1L A;  2QVA A;  3RKO A;  4EXT A;  3PJA A;  4E7S A;  4OYJ A;  1SA0 E;  4DR6 T;  1KFY A;  2DCF A;  4JI3 T;  2X51 A;  5HXR A;  5LA6 E;  3CQX C;  3UQ7 A;  1KF6 A;  1WRD A;  1G8X A;  4TWH A;  2MOZ A;  3ZT6 A;  3UUX B;  4DMV A;  4UEL A;  1ZHC A;  4GKJ T;  2W0G A;  1O3X A;  2CMR A;  4ZI2 D;  1VCT A;  2WP9 A;  2JQH A;  3TLS A;  3HKC E;  4DUY T;  2WWV A;  2EHO B;  2XJ7 A;  4H9P C;  5L4E A;  3J9X 1;  3UU6 A;  2V7M A;  4AKG A;  4HEA A;  2YIN A;  4YSX A;  5JRE A;  1XZY A;  2NWB A;  5JH7 E;  3UFE A;  5LNK A;  3AEC A;  5AQM B;  3PUY F;  3WAK A;  3AE2 A;  2C5J A;  4IST A;  4BAY B;  3UU8 A;  2LE8 A;  3ZYK A;  4DBQ A;  1MMD A;  2IIU A;  4UV8 B;  4L9I A;  1ZP0 A;  3K1S A;  4GK0 E;  2LSG A;  3Q5E A;  4DR2 T;  1MMN A;  5EK4 A;  5FVL A;  2NW8 A;  1UK5 A;  4WZX A;  2W67 A;  2CXL A;  3T1Y T;  2KT9 A;  3AA6 B;  3CX6 B;  2Q9Q B;  5L3C B;  1Y64 B;  2AXD S;  3Q9D A;  4EZ4 A;  4YSZ A;  2KSR A;  3AAA B;  3UU5 A;  2IC6 A;  3RLF F;  2XQ3 A;  1BR1 A;  2YKS A;  4TV9 E;  4LFA T;  4X1Y E;  1HFA A;  1WR0 A;  1AJ3 A;  4ILC A;  1FIO A;  3RX6 A;  2DI4 A;  3RI5 A;  4GYR A;  3FZM B;  2BS4 A;  3CQC B;  3AEE A;  2IDO B;  4YXD A;  3KVA A;  2QRX A;  4CN6 A;  1IJ5 A;  5AQT B;  2A3D A;  1WR6 A;  1M7K A;  2BZB A;  5EZY E;  3NVO A;  4MLK A;  4A98 A;  2KLQ A;  3ZC0 A;  3O4X E;  5HYA A;  3LBX A;  3K3Q C;  4IT4 A;  5L3F B;  4HKA A;  1LKX A;  3PV0 F;  4TWD A;  2NW9 A;  1D1A A;  3BQL A;  2H7V C;  3JAE A;  3CPZ A;  3NZP A;  4NPP A;  2ZM2 A;  4QH5 A;  5JQG E;  4DR4 T;  1WYB A;  5LGU B;  2I6H A;  3J7Y q;  2LRL A;  4Z91 A;  5FP3 A;  5LG4 A;  4U2Y A;  2I0M A;  3H37 A;  4MHC A;  4OYK A;  5IUX A;  2JJ9 A;  3A8Y C;  2ZMA A;  3C51 A;  2IW5 B;  5HCJ A;  4O2B E;  4LF6 T;  4NIQ A;  3WI3 A;  1WFD A;  4PNI A;  4N78 D;  5LHI B;  5H6Q B;  2M6B A;  4U3C A;  2HHH T;  3RC3 A;  4AQF A;  2D5U A;  4X1K E;  3MA9 A;  2RPA A;  2XM2 A;  2WY2 A;  4O2A E;  3A7M A;  4ANJ A;  3CVR A;  4K0K T;  4DID B;  3FXD B;  3ZYL A;  4IE6 A;  2VKD A;  3ESL A;  1I94 T;  2X66 A;  3O1I A;  3RYH E;  5ABF A;  4AQF C;  5AFU L;  3C4W A;  3LJC A;  4KP3 C;  3VHL A;  3P4W A;  2JRK A;  2CWO A;  4B3M T;  3CQG B;  3MXZ A;  1VOM A;  2D0T A;  2V7L A;  4P09 A;  5F5W A;  3HKE E;  4QH4 A;  1Z8U A;  4OX9 T;  3FB2 A;  4XAX B;  3F31 A;  1E2A A;  2LSY A;  3BQK A;  3I9W A;  5AQG B;  3OVU A;  3ETU A;  4HFB A;  4UXN B;  5ABG A;  2X0L B;  2W00 A;  1HCI A;  5M4Y A;  1FEW A;  3CML A;  3TKL B;  4YY3 T;  4KUM B;  3EAM A;  3KV5 A;  3AE5 A;  3ZCI A;  3NBX X;  3PUX F;  4CI1 B;  4QHO A;  5CA1 E;  2JPF A;  2WM9 A;  2PG8 A;  5KX5 E;  3P4Q A;  2BKO A;  4X64 T;  2ACZ A;  4JLE A;  1OWA A;  3KFW X;  3SFE A;  3JC6 D;  1D0Z A;  2X9W A;  4PAG A;  1FMV A;  1MNE A;  5CJ5 A;  2A2F X;  2UXC T;  4DV5 T;  4P0A A;  5JDM A;  1MIY A;  2LSI A;  1NEN A;  3KBT A;  5LXT E;  2ZM6 T;  4EED A;  2PBI A;  5ABH A;  2KND A;  2E5V A;  3AED A;  4F6R C;  2NP9 A;  3ZLI A;  2LOS A;  5FL1 A;  3C98 B;  3EI0 A;  3Q5W A;  3N2K E;  3Q5D A;  4I4T E;  2FJE A;  3K8P C;  3L3P A;  1N32 T;  2N9D A;  3ZPO A;  3TLT A;  3P4S A;  2VL8 A;  2XUE A;  3FBL A;  4AIU A;  3AVR A;  4ASK A;  2V7K A;  2D9D A;  3S4U A;  2E9X B;  5HXS A;  4G2A A;  3UUM A;  2XAQ B;  3NRY A;  5FNV E;  2A9U A;  3AE7 A;  3JAF A;  5LJM A;  3RQU A;  1MIW A;  2VUR A;  2E9X A;  2LHR A;  2MPK A;  2FJD A;  4UF0 A;  3L09 A;  1YXR A;  5JDF A;  5CA0 E;  2KMF A;  2C0S A;  5LGN B;  1XMQ T;  4X1I E;  5JVD E;  3B5M A;  2CCQ A;  3PE0 A;  1HG5 A;  5FKY A;  2E2A A;  2WU5 A;  4H63 V;  4L0R A;  2FJB A;  4YT0 A;  5IYZ E;  3IBP A;  2E9X C;  2XPK A;  4ILA A;  4V1A v;  1XWM A;  2K9A A;  5JDH A;  5KXJ A;  1WYC A;  4BJN A;  3V5U A;  4G63 A;  4DV0 T;  3GN5 B;  5HWX A;  4LF7 T;  5AQL B;  5JDG A;  2CXD A;  2ODU A;  2GK9 A;  2H88 A;  3AVS A;  2CEA A;  4IRE A;  2N2N A;  3EHZ A;  2MBG A;  3NRX A;  4LFB T;  2V8S V;  2DHR A;  5FY0 A;  1L0V A;  4IDZ A;  4ERR A;  4DR5 T;  4BJM A;  5JDQ A;  3H3M A;  5DJQ C;  2UXB T;  1NEK A;  2J4G A;  4CXX A;  1B7T A;  2BG9 B;  4HWD A;  2CM0 A;  3OJA A;  1XNR T;  2HH7 A;  3GA8 A;  1CHU A;  4K0U A;  2IAK A;  3U3I A;  2XAF B;  4YHJ A;  3FXE B;  3EDV A;  3RIF A;  3JAD A;  4ADZ A;  4KX6 A;  4TNW A;  1VRB A;  4HFC A;  4H63 H;  3SOL A;  3ZC1 A;  4PK6 A;  4DUZ T;  5J2T E;  4JI8 T;  4LF8 T;  3SFD A;  1UGO A;  4H9N C;  4ZI7 E;  3BQI A;  3KDS E;  4C90 A;  1MMA A;  4DO0 A;  5CB4 E;  2WDV A;  4ZOL E;  2P9B A;  2WSS V;  3FHN A;  4AIS A;  2LM2 A;  3CIR A;  3HA4 A;  1IBL T;  2EHO A;  1XDO A;  3O1J A;  5AQP B;  5HXC A;  3RF1 A;  3OBV E;  2XQ4 A;  2ZM8 A;  4EB6 E;  2FJA A;  2LSJ A;  3MJX A;  3KV4 A;  4PJM A;  5FMN A;  2Z6E A;  4KI0 F;  2YOE A;  1SE7 A;  3HKB E;  1N34 T;  2XY8 B;  2WMO A;  2EHO C;  1UUS A;  2MYS A;  1BR2 A;  4WBO A;  2LT3 A;  3O1H A;  4IL4 A;  5L2L A;  5H6R B;  4YSY A;  3RRW A;  4LF9 T;  2LEH A;  1H7C A;  4H9O C;  5AQH B;  2XAJ B;  3M3Z B;  4IDQ A;  5FY7 A;  5DAB A;  1MMG A;  3QK6 A;  2CBJ A;  2Q9Q A;  4HFV A;  4QXH B;  5FXX A;  3RYF E;  2VB6 A;  2CA5 A;  2MTQ A;  3CX8 B;  3AE3 A;  2VQF T;  3FZL B;  2WZI A;  1HNW T;  4X5T A;  2V26 A;  3R84 B;  2FBW A;  5HEO A;  4TNV A;  4B3T T;  2VL0 A;  5IWA T;  2NW7 A;  2Q9Q C;  2DL1 A;  5AQS B;  3LK3 B;  4U7Y A;  4IHJ E;  4EZH A;  3PUR A;  2WCA A;  4A97 A;  1KNZ A;  4IE5 A;  3MK7 C;  2BDE A;  3E08 A;  5HEU A;  4J2C A;  4U72 A;  1YKH B;  2HPL A;  1S35 A;  3UUL A;  5AQJ B;  2BKP A;  4CN4 A;  4WBN E;  3PUS A;  4MBQ A;  5HEJ A;  3NWI A;  1OXZ A;  3EDU A;  3MZK B;  4NUU A;  4ZS2 A;  3L8R A;  2NTX A;  3KV9 A;  3PUZ F;  3UUB A;  4IIJ E;  4MFR A;  2XM1 A;  3D0T A;  3G06 A;  3OTO T;  5ABE A;  2L3L A;  3ZMZ B;  1S94 A;  4QKN A;  1XMO T;  5LMN T;  2KWI B;  2YU1 A;  4NXN T;  3ZMS B;  1T72 A;  5HAX A;  2HN2 A;  3ONJ A;  3KBU A;  4EEB A;  1W9R A;  1ZV4 X;  3UFG A;  4IE7 A;  5C2T A;  3RGL A;  3A5X A;  2WS3 A;  4JEH B;  1E1H B;  4AKR B;  4IE0 A;  3VRB A;  3ZCJ A;  2WB5 A;  3FBZ A;  3N9L A;  3PUW F;  1HX8 A;  4AI6 A;  4AQG A;  3PUQ A;  4PJL A;  4YHH T;  1U5P A;  4CI2 B;  3QB5 A;  2OV9 A;  1J1J A;  2XQY A;  2KXP B;  5AQR B;  2B76 A;  4LFC T;  1HF8 A;  3ZMU B;  3P7I A;  5LBM A;  1T7S A;  2HN1 A;  1J5W A;  2UUC T;  1W09 A;  4EGW A;  4GIW A;  4OK0 A;  3DJB A;  2XQ5 A;  4PJN A;  1UUR A;  3AEG A;  4IGU A;  4ZI3 D;  2JMH A;  5FXV A;  4DV4 T;  1KNR A;  3ZSS A;  3LK2 B;  4JI4 T;  3AAE B;  3RKG A;  2YDQ A;  1HR0 T;  4CN1 A;  2UXD T;  5CGM A;  1LVK A;  3DTO A;  2QYW A;  2I59 A;  1IBM T;  2V6Y B;  4F8H A;  3OYX A;  2H3R A;  1YD8 G;  5LMU T;  3PJA J;  3RIU A;  4YLH A;  2WU2 A;  4X66 T;  1EZ3 A;  3I1A A;  3TLU A;  2V6Y A;  1YW0 A;  2JQ9 A;  1YQ4 A;  4UIG A;  3DP7 A;  1IBK T;  3RRC A;  4JI5 T;  3RH3 A;  2V7J A;  5LB7 B;  4QXC B;  2L8K A;  3NKZ A;  4TV8 E;  1BR4 A;  3N9N A;  1QSD A;  3RIU C;  2PFV A;  4UVC B;  3F57 A;  3LSV A;  3AE9 A;  4C91 A;  2WZH A;  3MKD A;  5HWY A;  2W2U A;  5HEG A;  5FXZ A;  2XQ6 A;  2LKH A;  5FXW A;  1HG2 A;  4JYA T;  5AQI B;  1HX1 B;  1G73 A;  1X9B A;  5L47 A;  2A72 A;  5FY1 A;  2K5B B;  2NTY A;  3T1H T;  5DQV A;  2XSA A;  5C3J A;  3JC6 C;  4YJ3 E;  2PJQ A;  4IDO A;  3MAC A;  4KBM B;  3C50 A;  5FYM A;  3RPU A;  3ZT5 A;  5KDM C;  3IF8 B;  2W4X A;  4B6X A;  1OED B;  2XQ8 A;  1M62 A;  5J2U E;  2V6X A;  4E7Z A;  3ZYM A;  2E8I A;  3IA3 A;  4DMW A;  3UTK A;  3LDQ B;  3ABV A;  4B3S T;  4NUV A;  1OED A;  4QWN B;  3K3N A;  4JV5 T;  2NOX A;  5JTG A;  4U33 A;  2L9Q A;  5HXH A;  3LFM A;  2XTL A;  5LBQ B;  3PDY A;  2OLT A;  5C8Y E;  4AKL A;  2WAU A;  2W62 A;  3C4X A;  3WAJ A;  2XQ9 A;  2B1E A;  2WDR A;  2Y48 B;  3AB3 B;  2BKN A;  2JQQ A;  4EYY R;  3HL6 A;  4PFO A;  1OED C;  4KMC A;  4ZZB A;  3VR9 A;  3GN5 A;  3V5S A;  3IHR A;  3PUG A;  3FZK B;  3TLW A;  4CXW A;  3ZT7 A;  1US7 B;  4AXP A;  5KMG P;  5LYJ E;  4A5X A;  3RC8 A;  3P8C D;  4HWH A;  2G0U A;  2J62 A;  3F2E A;  4H9S E;  2UU9 T;  4O4J E;  4WYV A;  3QNU A;  3BK9 A;  2CHO A;  4HWC A;  3N9Q A;  2UXN B;  5F3J A;  4DV3 T;  1Z0P A;  2LOP A;  1IZN B;  3N9O A;  2ODV A;  4EIW A;  5L3D B;  3E0Z A;  1YKE B;  2BG9 A;  2BBH A;  3UUN A;  1D0X A;  4PFP A;  4WW0 A;  2KZ7 B;  3K3O A;  4HWF A;  2V5C A;  1W0A A;  1HTJ F;  2CXF A;  3CX7 B;  3PU8 A;  2R6G F;  2V5D A;  4Z8X A;  4KHP T;  4YTP A;  4QXB B;  2IHR 1;  1ZEE A;  4I50 E;  3AE1 A;  1YQ3 A;  2W66 A;  2BG9 C;  3EUH A;  2VKH A;  4DVD A;  4UR9 A;  4JI6 T;  4JI1 T;  2OA5 A;  2ACX A;  4CZZ B;  5AQQ B;  1HS7 A;  2EHO D;  4DV1 T;  4TN7 B;  1BR0 A;  1X79 A;  4HWI B;  2XHE B;  4EAH A;  4O4L E;  2LHN A;  3IEE A;  3RYI E;  1T98 A;  3QB5 K;  2KIN B;  1IJ6 A;  5LGT B;  2E5L T;  4NXM T;  4JEU B;  4LMK A;  4AKI A;  3TLV A;  5GON E;  5AQF B;  2KWH A;  2X0Y A;  3JCF A;  2V7I A;  2BG9 E;  4IDN A;  4Q25 A;  2CBI A;  3HKD E;  3M65 A;  1I6Z A;  3OYZ A;  1U4Q A;  4TUY E;  3I0O A;  5LOV E;  3W15 B;  4ZI2 C;  1KEY A;  4ZEY A;  4JI2 T;  3UQ4 A;  4X65 T;  4ZXL A;  3AEA A;  4UEM A;  2Q9Q D;  4TX5 A;  5JDN A;  4ILU A;  2ZM0 A;  2V1D B;  4MAL A;  3ZJ2 A;  2X9Y A;  4DR1 T;  1GQE A;  3CKD A;  2AE9 A;  3AXJ B;  2CE7 A;  4O4H E;  4TZ4 C;  5LHG B;  1MIV A;  1FMW A;  2K24 A;  3H3A A;  2F4V T;  2VVS A;  3CWZ B;  3AXJ A;  4LF5 T;  4HGA A;  1N36 T;  4PK5 A;  2BVM A;  4HE8 A;  5LHH B;  2YDR A;  4GK5 E;  4DND A;  2ZLY A;  1FJG T;  5TAO A;  4UV9 B;  3UU4 A;  3N2O A;  1CUN A;  4JI0 T;  3UT5 E;  3AA7 B;  2XAH B;  4FJO A;  3RQW A;  1Y01 A;  3N9M A;  3N2G E;  1UX5 A;  3ZEF B;  1UX4 A;  3SWH A;  4PJJ A;  1XDP A;  1QLB A;  3LBX B;  5LG3 A;  4JI7 T;  5F8P A;  2XZE A;  2NR4 A;  2WQY A;  3HI2 A;  4EYU A;  3LK4 2;  2IML A;  2LLY A;  4IE4 A;  1VCS A;  4XBF B;  5AQO B;  2YK0 A;  4DBR A;  1D1C A;  3LG7 A;  1MND A;  4KHZ F;  4YFS A;  2RP4 A;  4I0U A;  2QGS A;  5HXE A;  5L3G B;  3AE8 A;  5IHY A;  5LP6 E;  5BR8 T;  5CFB A;  2MAW A;  1R8I A;  3KVB A;  2VWA A;  4HN9 A;  4EOZ B;  1D0Y A;  1UCU A;  4U74 A;  2VVN A;  4JUY A;  4LML A;  4HFE A;  3ZMT B;  3AE4 A;  4H9R C;  4PW8 A;  2UUA T;  3R6N A;  3ZJ1 A;  3N5L A;  1ZOY A;  3L39 A;  3O9X A;  2H89 A;  3E22 E;  5AQN B;  2CPT A;  2BVL A;  2SPC A;  1D1B A;  4P1N A;  4X62 T;  3PUV F;  2JIW A;  2X67 A;  4YTN A;  3CK6 A;  3ZN0 B;  4HTE A;  3U78 A;  5FL0 A;  5ABF B;  2YU2 A;  4QX7 B;  2DNX A;  4OFZ A;  3B57 A;  3SS1 A;  4COF A;  4H9Q C;  3UU3 A;  1LVF A;  4ISS A;  5HCM A;  4DV7 T;  3ZN1 B;  4QX8 B;  2CWY A;  2D0U A;  3ANW B;  4L5G A;  5ETW A;  1HNZ T;  3QOF A;  3OPC A;  3VKH A;  3N9P A;  2H7O A;  3VRA A;  2DWG A;  2C5I T;  2LM9 A;  4M1P A;  3ANW A;  4GOU A;  1N33 T;  3PUA A;  1KK7 A;  1IAP A;  4HFD A;  2XQA A;  3HR0 A;  2YN6 A;  3KIN B;  4CXY A;  4YJ2 E;  4WNK A;  3GMI A;  3B13 A;  3Q5X A;  1NAF A;  1WCR A;  3ZST A;  3ONX A;  2UUB T;  1V9D A;  2K3W A;  3EVY A;  3AAI A;  4PK4 A;  4ZS3 A;  2IUB A;  3Q2M A;  1XNQ T;  2J1D G;  4UVA B;  2LKG A;  3RIA A;  1NWM X;  2M67 A;  4DV6 T;  3ZMV B;  2J47 A;  3PTR B;  3FZH B;  1QUU A;  2X0H A;  4GKK T;  2ES0 A;  4ZI3 C;  5L4H A;  4XZC A;  1SHZ C;  5JRC B;  2W61 A;  4ZZC A;  2QA7 A;  2D2S A;  4AKH A;  2YDS A;  1W0B A;  4I43 B;  5JRC A;  2PTF A;  4I55 E;  2WMN A;  5HEH A;  4DR7 T;  1LRZ A;  3VR8 A;  2YEV C;  4LF4 T;  4B3R T;  3ETV A;  3X1D A;  3AA0 B;  2HPJ A;  3C64 A;  4HFH A;  2XAS B;  3VU7 H;  4UVB B;  3P4P A;  5AQU B;  3C4Z A;  3QC9 A;  2BS3 A;  4A56 A;  5LJN A;  2X9H A;  4Z90 A;  1KNP A;  5JDL A;  2JMK A;  5BMV E;  4U2Z A;  3VKG A;  2E9X D;  4AQY T;  2JQK A;  2K48 A;  4U31 A;  5LCY A;  4DR3 T;  1JNR A;  3AEF A;  4EV6 A;  2DWK A;  4O4I E;  2VQE T;  2VAS A;  2X9X A;  4LMJ A;  4CQI A;  4OHF A; 
#chains in the Genus database with same CATH homology
 4YHH T;  1IBL T;  2UUB T;  2F4V T;  4DR4 T;  4DR2 T;  1N32 T;  4LF5 T;  2UUA T;  1N36 T;  4LFC T;  4JI6 T;  4JI1 T;  4LFB T;  1XNQ T;  3T1Y T;  4OX9 T;  1FJG T;  4DR6 T;  4DV1 T;  4DV6 T;  4DR5 T;  4JI3 T;  4JI0 T;  4GKK T;  2UUC T;  2UXB T;  4JYA T;  4X62 T;  1J5E T;  1XNR T;  1N34 T;  4LF6 T;  4YY3 T;  2E5L T;  4NXM T;  4DV4 T;  4DR7 T;  1XMQ T;  4GKJ T;  4LFA T;  4JI7 T;  3T1H T;  4LF9 T;  4LF4 T;  4B3R T;  2HHH T;  4JI4 T;  2UU9 T;  4X64 T;  3OTO T;  4DUY T;  4DV3 T;  1HR0 T;  4DV7 T;  2UXD T;  1XMO T;  5LMN T;  4DUZ T;  1HNZ T;  4LF8 T;  1HNX T;  4JI8 T;  4NXN T;  1IBM T;  4JI2 T;  4X65 T;  2UXC T;  4DV5 T;  5LMU T;  4K0K T;  4X66 T;  1N33 T;  2VQF T;  1HNW T;  2ZM6 T;  1I94 T;  4AQY T;  4DV2 T;  1IBK T;  4B3S T;  5BR8 T;  4DV0 T;  4JV5 T;  4DR1 T;  4LF7 T;  4DR3 T;  4JI5 T;  4KHP T;  2VQE T;  4B3T T;  5IWA T;  4B3M T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...