5LMNT

Structure of bacterial 30s-if1-if3-mrna translation pre-initiation complex (state-1a)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 5lmnT00
4DV6T 4LFAT 4GKKT 4B3TT 4JV5T 4AQYT 4X62T 2UU9T 4JI3T 1IBKT 1HNZT 2UUBT 4JI7T 4DV0T 2E5LT 4DR2T 2UUCT 2F4VT 4NXMT 1HNXT 4YHHT 3T1HT 3OTOT 4DUZT 4JI8T 1HNWT 2VQFT 4JI5T 4LF4T 1I94T 1N33T 2VQET 4LF8T 1XMOT 4NXNT 4B3RT 4JI1T 4DR4T 4GKJT 4LF7T 1IBMT 2ZM6T 2UXCT 4KHPT 4DUYT 4LF6T 2UUAT 4B3ST 1XMQT 4DV2T 5LMNT 4LF9T 4YY3T 4DR3T 4DR7T 1N32T 1IBLT 1FJGT 1XNQT 3T1YT 4JYAT 4DV3T 1N34T 5BR8T 4DV5T 2UXDT 1J5ET 4B3MT 4JI0T 4JI4T 4DR1T 4OX9T 5LMUT 4DV4T 4X66T 4X65T 4DV1T 4LF5T 1HR0T 5IWAT 4DR6T 4DV7T 4LFCT 4DR5T 2HHHT 4K0KT 1N36T 4LFBT 1XNRT 4JI2T 2UXBT 4X64T 4JI6T
chains in the Genus database with same CATH superfamily
5CA0E 2XUEA 4DV6T 4GKKT 4TWHA 5JDHA 3BK9A 4ZI3C 1BR1A 4AQFC 2LSGA 4I43B 4GYSA 4YHJA 3RKGA 1UK5A 5JR9C 3ABVA 1G73A 2X67A 1FJGT 4OX9T 2UUBT 2XAHB 2W00A 3PUQA 4IREA 5AQSB 2JRKA 3RIUC 3ZCIA 4ZI7E 3ZYMA 2KWHA 2WY2A 4ZZCA 2E5LT 4UEMA 5AQLB 5LP6E 2LRKA 3EHZA 3Q9DA 5HEOA 3UTKA 2IC9A 4AKRB 4H63H 2HPJA 5LG4A 4GK0E 5LGUB 2XQAA 3ZMUB 3AA7B 1Y64B 4F8HA 4ADZA 2X66A 3KFWX 1BR0A 4AKHA 4U2ZA 4O4HE 2JPFA 2KWIB 4XZCA 2CBJA 4TX5A 4IE6A 2BS2A 1FIOA 3JC6C 4GK5E 5HEGA 1T8BA 1NEKA 1J1JA 2E9XC 3CQGB 3PJAA 4I50E 1X79A 4UV9B 3NKZA 4JEHB 3C4WA 3UUBA 2W66A 4BJNA 5LJMA 5L2LA 1D0YA 1OEDB 2EHOC 4HWDA 3V5UA 3ZMSB 1N33T 2EHOA 3TLWA 3N9PA 3FBLA 3PJAJ 4LF8T 5HWXA 4AKGA 4WBNE 3A5XA 4H9NC 4EAHA 1T72A 1FMWA 2CLYB 2XQ4A 4ILCA 5AQJB 3UULA 4NXNT 2V5DA 4B3RT 2SPCA 4A5XA 3VR8A 2X0YA 1KNRA 4PK5A 2LJLA 3FXDB 3Q5DA 4QXBB 4H9PC 5KXJA 1BR4A 5JQGE 4TUYE 2L3LA 2BS3A 2CA5A 2Y8DA 2UUAT 2IAKA 4EOZB 1KEYA 1CHUA 2MBGA 4O4LE 4XAXB 1XMQT 4Z91A 2X51A 4ZS3A 1N34T 2X0LB 5LMNT 4LF9T 4YY3T 1LVKA 2X68A 2DNXA 4U72A 1YD8G 5FXZA 3F57A 3UUMA 3H3MA 3ZT5A 5LJNA 5AQVB 4HFHA 4O4JE 3PUAA 4EIWA 1MNEA 4WYVA 2NR4A 1VCTA 2VKJA 4DV5T 3T8OA 1IBLT 2CWYA 2ODUA 3K3QC 4HN9A 4JLEA 1UX4A 5ADXL 5JVDE 2X0HA 2BKPA 2WWVA 4KBMB 3W15B 1KNPA 4QHOA 4P1NA 4PJJA 4ZS2A 4QH4A 3SWHA 4DVDA 2YINA 1YKEB 5HAXA 3CVRA 5FMNA 3UQ4A 4QX7B 3AVRA 4KMCA 2FJBA 3RPUA 4MHCA 4HFEA 1U5PA 5JREA 5J0ZA 3JAFA 5ABHA 4WNKA 3D0TA 3AE1A 2LOSA 4TNWA 4AXPA 5CA1E 3RIUA 3FZHB 4UV8B 3TKLB 2XY8B 3CX7B 4ILBA 4JI0T 4LMLA 4IDPA 1CUNA 2H3RA 3UU8A 2VURA 4HFBA 1HF8A 5KX5E 5AQGB 5LMUT 2BG9B 3P4RA 1Z0PA 2BBJA 4Z8XA 3E22E 3VU7H 2LSJA 4X66T 5L3DB 5LOVE 2Q9QA 2W63A 3AAAB 3C51A 5HWYA 5DQVA 2XTLA 5FKYA 4AISA 4M1PA 1YKHB 1W0BA 3CWZB 4P0BA 4PJNA 4UIGA 2NW8A 2ZM8A 4HFIA 4UXNB 5HXCA 3O9XA 3QB5A 5JDGA 3UUXB 4PK6A 2WMOA 4V1Av 2BS4A 2WU2A 4HGAA 5LYJE 3OVUA 4ERRA 2WDRA 4TV9E 3NZQA 3SFDA 3FBZA 5IYZE 5EK4A 3JADA 2CLYC 2V7KA 3H37A 3O1HA 5LB7B 3VKHA 1Y01A 1XNRT 2CM0A 1VCSA 2IHR1 2YU2A 4K0UA 5ETWA 3AEEA 4CI2B 5BR8T 4KI0F 4LFAT 2XHEB 2LSKA 4FJOA 4NUVA 3P4WA 4OYKA 4HWFA 3QB5K 2IIUA 4GYRA 4AQYT 3C50A 4MALA 3L8RA 4EEBA 2N1GA 2BG9A 1HX8A 5F8PA 1VRBA 4LMJA 2J4GA 2NTXA 5AQFB 1IAPA 3IBPA 4NIQA 4PFPA 2IW5B 4TZ4C 2JQQA 5JH7E 4JI7T 2WZHA 3KVAA 3VKGA 4QXCB 5C2TA 4A97A 2XQYA 5AQIB 1IJ5A 5CFBA 4NXMT 2EHOD 2RPAA 2VWAA 1D0ZA 2WQYA 3OPCA 4ZZBA 3EAMA 2E9XD 5HEUA 2K24A 2LKHA 4GIWA 4ASKA 4JI3T 1XDPA 3AE8A 4DBRA 3RI5A 5AQPB 3BQLA 1W09A 3AA0B 2K9AA 3PURA 4KHZF 4H9OC 2VL8A 2BG9E 2OLTA 4LF4T 2MYSA 2CXFA 4CXWA 2K3WA 3HKCE 2LOPA 3AXJA 5HXRA 5AQHB 5HYAA 3LSVA 3UU4A 2HH7A 3RYCE 1HFAA 4ZXLA 1XMOT 4ISSA 2W0GA 4O2BE 2VL0A 2BVLA 5FNVE 3IF8B 4YSZA 3RLFF 4JI1T 3AECA 3P4SA 3O1JA 4LF7T 1IJ6A 3FZFB 5AQTB 3AEDA 2PTFA 3NZPA 1O3XA 3Q5XA 5JDNA 4I4TE 2KLQA 3P8CD 5TAOA 3PU8A 3DTOA 3J7Yq 4KHPT 4B6XA 4YLHA 4LF6T 2DI4A 3F31A 1IZNB 2J62A 2V6XA 4HWIB 1HX1B 2PG8A 3RYIE 3TLVA 4PJLA 4PFOA 2BDEA 2JMKA 3B57A 3FB2A 4DV2T 3C98B 1EZ3A 2VKDA 4A98A 3U78A 3UT5E 2DCFA 2LM9A 2EHOB 2B1EA 2BZBA 5JDLA 4DR7T 3PUXF 2KT9A 4PK4A 4X62T 3HKBE 5J2TE 3NBXX 2I59A 2LSYA 3H3AA 3K3NA 3QUJA 3ZMVB 5JRCA 3AE2A 3ONXA 3ZMZB 4IGUA 1KK7A 2NWBA 3L09A 4YSYA 3Q5WA 3AXJB 2VB6A 3FHNA 4ZOLE 4UVAB 3RF1A 5CGMA 2XQ9A 4EYUA 1S94A 3T1YT 2DWGA 2ACXA 2LKGA 2WZIA 4ZI2C 4HWHA 3ZSSA 4H63V 2V7MA 3JC6D 3RGLA 5AFUL 3KVBA 3PUGA 1MMDA 1WR0A 3MA9A 2V26A 4PNIA 3ZLIA 3N9OA 5KDMC 1D0XA 2XQ3A 2UXNB 2WM9A 4IDQA 2W61A 4AIUA 3WAJA 4B3MT 4BA9A 5LHHB 1QSDA 1UURA 1WR6A 2BG9C 3AEAA 3I9WA 4X5TA 4F6RC 5LGNB 4H9SE 3I1AA 4DR1T 1JNZA 2K48A 2YOEA 2LLYA 3HI2A 3LG7A 2CBIA 4IDNA 4TN7B 4YFSA 2HN2A 1YQ4A 2LM2A 3SS1A 2Y6XA 3CQCB 3FXEB 3ESLA 1M7KA 2I0MA 2IUBA 2YK0A 4NUUA 4UELA 4X1KE 3TLSA 5EK2A 3ZC0A 2PFVA 4DIDB 4EZHA 5L3CB 2RA1A 1I6ZA 1OEDC 3P50A 3RQUA 3ZT7A 3NVOA 2BBHA 1NAFA 2C5JA 3VHLA 2YDRA 2VVNA 4QX8B 2CXLA 1D1BA 5ABGA 4MLKA 4DV1T 3UUNA 2V7IA 5L3GB 1UX5A 1YQ3A 2WAUA 4MBQA 4EEDA 2JQHA 2XAFB 4O8SA 3EI0A 2CPTA 2PJQA 1D1AA 3UFGA 1HR0T 1G8XA 2XAQB 3AB3B 3IEEA 4H9QC 4DV7T 4DR6T 4K0KT 4LFBT 2WMNA 4P09A 4UF0A 2ZLYA 5ABFB 1E7PA 3VR9A 4TWDA 2GK9A 4U33A 4DBQA 5M4YA 2XQ6A 2QGSA 3R6NA 2HN1A 2XSBA 3AEBA 2I6HA 3IHRA 2WS3A 2H88A 1J5WA 1S35A 2AE9A 3ANWB 5AQRB 4IIJE 2R6GF 3CX6B 5AQMB 3R84B 2UU9T 1NENA 1Z8UA 2JIWA 5BMVE 3GN5B 4GOUA 3F2EA 5JDFA 3KBUA 2LHNA 3FZMB 4U7YA 3ZJ1A 5L3FB 3LBXB 4TWFA 4C90A 4YT0A 2W2UA 4DV0T 3CQXC 4DR2T 2UUCT 3M65A 2XAGB 3EVYA 2F4VT 2KMFA 4XBFB 4HFDA 5L3BB 3RIAA 1HNXT 5IHYA 3I0OA 3P7IA 3OTOT 1MIVA 2FBWA 3K3OA 3OBVE 3RC3A 1M62A 2XQ5A 4IDOA 4CN4A 4TV8E 2HPLA 5H6RB 4ZEYA 1HNWT 4EYYR 2PBIA 2C5KT 5DQWA 1B7TA 4TNVA 1HCIA 1QLBA 5FVKA 5FXXA 2Y48B 4EGWA 1I94T 3MXZA 5LHGB 3VRAA 1MIWA 4UF0B 3SFEA 2CXDA 2XAJB 1W9RA 2L8KA 5L47A 5L3EB 5H6QB 5HXEA 2VQET 1V9DA 2V5CA 3EUHA 2YEVC 2CHNA 5FXVA 3SRZA 3B5MA 3MKDA 3N9QA 4N78D 4DMVA 2X9YA 4DR4T 1OEDE 2CEAA 3ANWA 3PUWF 3UFEA 1ZHCA 4DO0A 4GKJT 3AE3A 1OXZA 1US7B 4U31A 3DJBA 3HL6A 1HTJF 2B76A 3LK2B 4KX6A 1D1CA 3ZCJA 3AA1B 2H89A 3QC9A 4CI1B 1XDOA 3CK6A 2V8SV 3LBXA 1GQEA 1T7SA 2NP9A 1T98A 2LHRA 5JTGA 4L0RA 3PUVF 2KZ7B 1YW0A 1OWAA 2M6BA 4Q25A 4HTEA 2BKOA 2MOZA 1SE7A 4YTNA 1BR2A 1LVFA 2WP9A 2WDQA 1SHZC 2XZEA 5E0OA 5HXSA 3KV6A 5LNKA 3KDSE 3BQKA 5L4EA 2N2NA 2C0SA 5JR9A 1N32T 4QH5A 2VKOA 3ZPOA 2D0TA 2VKHA 2D5UA 2NW7A 2ODVA 4OYJA 1ZKEA 4I55E 3N2KE 3B13A 3NWIA 4IE7A 3EDVA 3HKDE 2FJDA 3RHWA 4L9IA 1UGOA 2D0UA 1XNQT 2LRLA 5FVLA 4X65T 2X9XA 2A2FX 4U74A 3EABA 3RH3A 1ZP0A 2DLRA 1YXRA 4U7IA 4YJ2E 4CI3B 3P4PA 1KFYA 2NTYA 1SUMB 2E2AA 2M67A 2J47A 2QYWA 2FJEA 4HWCA 3ZSTA 5AQUB 2A3DA 3UU6A 5CJ5A 3ETVA 3OKQA 4O4IE 3ZC1A 2UXDT 3O1IA 2XPKA 3CPZA 3TLUA 5A1LA 5C3JA 1J5ET 3AE5A 2X9WA 3I0QA 5JRCB 3MZKB 5HEJA 2KINB 2XM1A 2L9QA 2NOXA 3AE6A 1MMNA 2YN6A 3CX8B 5L4HA 4IE5A 4JI4T 4YXDA 1XZYA 4AQFA 2ZM2A 4DV4T 3NRYA 1MMAA 3GA8A 3C64A 5LCYA 1E2AA 3AEGA 3S4UA 4WZXA 3OJAA 4KP3C 2QVAA 3AE7A 3BQIA 4IL9A 2E8IA 4ZHQE 2A9UA 3PU3A 3MJXA 3M3ZB 4HFCA 4QWNB 4Z90A 5FL0A 5KMGP 1KNZA 2H7VC 3RYFE 3VRBA 3ZYKA 2YKSA 4IE4A 3A7MA 3IA3A 2Z6EA 4U3CA 4X1YE 1DU2A 4X1IE 5F3JA 3ONLC 3N9MA 2V7JA 1ZEEA 3U3IA 2LEHA 3LDQB 5HXHA 1E1HB 4YJ3E 3ZKRA 3N9NA 2NW9A 5J1GA 4DR5T 5J2UE 1N36T 2VVSA 3HR0A 5FY0A 4QXHB 3G06A 4JI2T 4EV6A 4EXTA 2UXBT 3PDYA 5FL1A 2P9BA 3DP7A 5HEHA 2V1DB 2Q9QC 4COFA 3N5LA 4X64T 5F5WA 1LRZA 2JQ9A 4OFZA 4B3TT 4JV5T 2JMHA 1U4QA 4ISTA 5IUXA 3UQ7A 2D9DA 2IDOB 2MPKA 3ZMTB 3X1DA 1IBKT 4EZ4A 1HNZT 3AAEB 3K1SA 2WSSV 4CN6A 3AE4A 5GONE 3ZJ2A 2DWKA 3UU3A 3I9YA 5LXTE 2KNDA 4G2AA 1R8IA 2MTQA 4IDZA 1ZOYA 1XWMA 5FYMA 3ONJA 2VK9A 2WCAA 3NRXA 1WFDA 3AE9A 4YTMA 2QA7A 3J9X1 4IE0A 4ANJA 4YHHT 4CXXA 3T1HT 3PUYF 1HS7A 1L0VA 2VASA 4HFVA 4E7ZA 5ABFA 4DUZT 2OA5A 3AVSA 3ZT6A 3A8YC 5JDMA 4JI8T 1MNDA 5FY1A 2VQFT 3LK3B 3Q2MA 1UUSA 3KV4A 2YDQA 3GWHA 4JI5T 3C4XA 5LGTB 3L39A 1MIYA 2CHOA 3PUSA 3UU5A 4ZI2D 3PTRB 2E9XB 2W67A 3KV5A 3GN5A 4YSXA 2E5VA 3HKEE 3MK7C 2RP4A 5DJQC 2J1DG 1H7CA 4HE8A 4DNDA 2CE7A 2KSRA 3QK6A 5EK3A 3FZLB 1WCRA 1HG2A 4WBOA 4IT4A 4AKLA 1HG5A 1IBMT 5ABEA 1ZV4X 2ZM6T 4PJMA 2CMRA 2WU5A 4ZI3D 1W0AA 1WYBA 2UXCT 4OK0A 3ETUA 3P4QA 4DUYT 3OYXA 3PUZF 3FZKB 3KINB 4B3ST 2X9HA 2OV9A 2MAWA 2WWUA 3EDUA 4JBWF 1FMVA 5LA6E 3RX6A 2WB5A 3ZN1B 3RYHE 5JDQA 4CXYA 3CMLA 2ZMAA 2BKNA 5AQNB 1MMGA 4ILUA 1QUUA 2QRXA 2JQKA 4FI5A 4DR3T 2XQ8A 3QNUA 4I0UA 2KXPB 3OYZA 1VOMA 1UCUA 4KUMB 4IL4A 1X9BA 3QOFA 5CB4E 2CRBA 3PV0F 1NWMX 2XASB 4PW8A 4X20E 4CN1A 4NPPA 2CWOA 5EZYE 5LHIB 1WYCA 5HCMA 3WI3A 3AAIA 3CKDA 5DABA 4QH1A 3SOLA 1FEWA 4J2CA 4DMWA 2DHRA 4E7SA 2E9XA 4C91A 2JJ9A 3RRWA 4EB6E 4AKIA 1KF6A 2Q9QB 4BAYB 4YTPA 3JCFA 2LE8A 3L3PA 3RKOA 2IMLA 2C5IT 4HKAA 5AQOB 3CIRA 3WAKA 2YDSA 2V6YB 5AQQB 4JYAT 2AXDS 1WRDA 5FY7A 4CZZB 4DV3T 2WBLA 2XQ7A 1SA0E 3HA4A 3N9LA 3N2OA 5HCJA 2UXXB 3AA6B 3ZYLA 2W62A 3C4ZA 2BVMA 2LSIA 3N2GE 4G63A 4AQGA 4BJMA 5JR9B 2ZM0A 4JUYA 5FP3A 5AQKB 1JNRA 4LMKA 4A56A 2LT3A 3E08A 3JAEA 4UR9A 3RIFA 2XJ7A 4UVCB 4UVBB 2K5BB 5LBMA 4MFRA 4IHJE 4WW0A 3RQWA 2FUPA 2WDVA 4OHFA 3TLTA 2DL1A 4QKNA 2M6IA 5C8YE 3KBTA 3ZEFB 4JEUB 3O4XE 4U2YA 2H7OA 3LJCA 3ZN0B 3MACA 3V5SA 4CQIA 2A72A 1AJ3A 4HEAA 4ILAA 5FXWA 3E0ZA 4H9RC 4P0AA 4L5GA 1WLXA 4O2AE 3KV9A 5LBQB 2CCQA 2ACZA 2XSAA 2V7LA 1LKXA 2D2SA 2FJAA 2YU1A 4LF5T 3PE0A 5LG3A 5IWAT 2ES0A 2V6YA 3Q5EA 4PAGA 2Q9QD 2HHHT 3AEFA 3K8PC 4LFCT 3RC8A 4AI6A 3RRCA 1OEDA 2G0UA 3LK42 2IC6A 2N9DA 2XM2A 3GMIA 3LFMA 2W4XA 4JI6T
chains in the Genus database with same CATH topology
4DV6T 4LFAT 4GKKT 4B3TT 4JV5T 4AQYT 4X62T 2UU9T 4JI3T 1IBKT 1HNZT 2UUBT 4JI7T 4DV0T 2E5LT 4DR2T 2UUCT 2F4VT 4NXMT 1HNXT 4YHHT 3T1HT 3OTOT 4DUZT 4JI8T 1HNWT 2VQFT 4JI5T 4LF4T 1I94T 1N33T 2VQET 4LF8T 1XMOT 4NXNT 4B3RT 4JI1T 4DR4T 4GKJT 4LF7T 1IBMT 2ZM6T 2UXCT 4KHPT 4DUYT 4LF6T 2UUAT 4B3ST 1XMQT 4DV2T 5LMNT 4LF9T 4YY3T 4DR3T 4DR7T 1N32T 1IBLT 1FJGT 1XNQT 3T1YT 4JYAT 4DV3T 1N34T 5BR8T 4DV5T 2UXDT 1J5ET 4B3MT 4JI0T 4JI4T 4DR1T 4OX9T 5LMUT 4DV4T 4X66T 4X65T 4DV1T 4LF5T 1HR0T 5IWAT 4DR6T 4DV7T 4LFCT 4DR5T 2HHHT 4K0KT 1N36T 4LFBT 1XNRT 4JI2T 2UXBT 4X64T 4JI6T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV6 T;  4LFA T;  4GKK T;  4B3T T;  4JV5 T;  4AQY T;  4X62 T;  2UU9 T;  4JI3 T;  1IBK T;  1HNZ T;  2UUB T;  4JI7 T;  4DV0 T;  2E5L T;  4DR2 T;  2UUC T;  2F4V T;  4NXM T;  1HNX T;  4YHH T;  3T1H T;  3OTO T;  4DUZ T;  4JI8 T;  1HNW T;  2VQF T;  4JI5 T;  4LF4 T;  1I94 T;  1N33 T;  2VQE T;  4LF8 T;  1XMO T;  4NXN T;  4B3R T;  4JI1 T;  4DR4 T;  4GKJ T;  4LF7 T;  1IBM T;  2ZM6 T;  2UXC T;  4KHP T;  4DUY T;  4LF6 T;  2UUA T;  4B3S T;  1XMQ T;  4DV2 T;  5LMN T;  4LF9 T;  4YY3 T;  4DR3 T;  4DR7 T;  1N32 T;  1IBL T;  1FJG T;  1XNQ T;  3T1Y T;  4JYA T;  4DV3 T;  1N34 T;  5BR8 T;  4DV5 T;  2UXD T;  1J5E T;  4B3M T;  4JI0 T;  4JI4 T;  4DR1 T;  4OX9 T;  5LMU T;  4DV4 T;  4X66 T;  4X65 T;  4DV1 T;  4LF5 T;  1HR0 T;  5IWA T;  4DR6 T;  4DV7 T;  4LFC T;  4DR5 T;  2HHH T;  4K0K T;  1N36 T;  4LFB T;  1XNR T;  4JI2 T;  2UXB T;  4X64 T;  4JI6 T; 
#chains in the Genus database with same CATH topology
 5CA0 E;  2XUE A;  4DV6 T;  4GKK T;  4TWH A;  5JDH A;  3BK9 A;  4ZI3 C;  1BR1 A;  4AQF C;  2LSG A;  4I43 B;  4GYS A;  4YHJ A;  3RKG A;  1UK5 A;  5JR9 C;  3ABV A;  1G73 A;  2X67 A;  1FJG T;  4OX9 T;  2UUB T;  2XAH B;  2W00 A;  3PUQ A;  4IRE A;  5AQS B;  2JRK A;  3RIU C;  3ZCI A;  4ZI7 E;  3ZYM A;  2KWH A;  2WY2 A;  4ZZC A;  2E5L T;  4UEM A;  5AQL B;  5LP6 E;  2LRK A;  3EHZ A;  3Q9D A;  5HEO A;  3UTK A;  2IC9 A;  4AKR B;  4H63 H;  2HPJ A;  5LG4 A;  4GK0 E;  5LGU B;  2XQA A;  3ZMU B;  3AA7 B;  1Y64 B;  4F8H A;  4ADZ A;  2X66 A;  3KFW X;  1BR0 A;  4AKH A;  4U2Z A;  4O4H E;  2JPF A;  2KWI B;  4XZC A;  2CBJ A;  4TX5 A;  4IE6 A;  2BS2 A;  1FIO A;  3JC6 C;  4GK5 E;  5HEG A;  1T8B A;  1NEK A;  1J1J A;  2E9X C;  3CQG B;  3PJA A;  4I50 E;  1X79 A;  4UV9 B;  3NKZ A;  4JEH B;  3C4W A;  3UUB A;  2W66 A;  4BJN A;  5LJM A;  5L2L A;  1D0Y A;  1OED B;  2EHO C;  4HWD A;  3V5U A;  3ZMS B;  1N33 T;  2EHO A;  3TLW A;  3N9P A;  3FBL A;  3PJA J;  4LF8 T;  5HWX A;  4AKG A;  4WBN E;  3A5X A;  4H9N C;  4EAH A;  1T72 A;  1FMW A;  2CLY B;  2XQ4 A;  4ILC A;  5AQJ B;  3UUL A;  4NXN T;  2V5D A;  4B3R T;  2SPC A;  4A5X A;  3VR8 A;  2X0Y A;  1KNR A;  4PK5 A;  2LJL A;  3FXD B;  3Q5D A;  4QXB B;  4H9P C;  5KXJ A;  1BR4 A;  5JQG E;  4TUY E;  2L3L A;  2BS3 A;  2CA5 A;  2Y8D A;  2UUA T;  2IAK A;  4EOZ B;  1KEY A;  1CHU A;  2MBG A;  4O4L E;  4XAX B;  1XMQ T;  4Z91 A;  2X51 A;  4ZS3 A;  1N34 T;  2X0L B;  5LMN T;  4LF9 T;  4YY3 T;  1LVK A;  2X68 A;  2DNX A;  4U72 A;  1YD8 G;  5FXZ A;  3F57 A;  3UUM A;  3H3M A;  3ZT5 A;  5LJN A;  5AQV B;  4HFH A;  4O4J E;  3PUA A;  4EIW A;  1MNE A;  4WYV A;  2NR4 A;  1VCT A;  2VKJ A;  4DV5 T;  3T8O A;  1IBL T;  2CWY A;  2ODU A;  3K3Q C;  4HN9 A;  4JLE A;  1UX4 A;  5ADX L;  5JVD E;  2X0H A;  2BKP A;  2WWV A;  4KBM B;  3W15 B;  1KNP A;  4QHO A;  4P1N A;  4PJJ A;  4ZS2 A;  4QH4 A;  3SWH A;  4DVD A;  2YIN A;  1YKE B;  5HAX A;  3CVR A;  5FMN A;  3UQ4 A;  4QX7 B;  3AVR A;  4KMC A;  2FJB A;  3RPU A;  4MHC A;  4HFE A;  1U5P A;  5JRE A;  5J0Z A;  3JAF A;  5ABH A;  4WNK A;  3D0T A;  3AE1 A;  2LOS A;  4TNW A;  4AXP A;  5CA1 E;  3RIU A;  3FZH B;  4UV8 B;  3TKL B;  2XY8 B;  3CX7 B;  4ILB A;  4JI0 T;  4LML A;  4IDP A;  1CUN A;  2H3R A;  3UU8 A;  2VUR A;  4HFB A;  1HF8 A;  5KX5 E;  5AQG B;  5LMU T;  2BG9 B;  3P4R A;  1Z0P A;  2BBJ A;  4Z8X A;  3E22 E;  3VU7 H;  2LSJ A;  4X66 T;  5L3D B;  5LOV E;  2Q9Q A;  2W63 A;  3AAA B;  3C51 A;  5HWY A;  5DQV A;  2XTL A;  5FKY A;  4AIS A;  4M1P A;  1YKH B;  1W0B A;  3CWZ B;  4P0B A;  4PJN A;  4UIG A;  2NW8 A;  2ZM8 A;  4HFI A;  4UXN B;  5HXC A;  3O9X A;  3QB5 A;  5JDG A;  3UUX B;  4PK6 A;  2WMO A;  4V1A v;  2BS4 A;  2WU2 A;  4HGA A;  5LYJ E;  3OVU A;  4ERR A;  2WDR A;  4TV9 E;  3NZQ A;  3SFD A;  3FBZ A;  5IYZ E;  5EK4 A;  3JAD A;  2CLY C;  2V7K A;  3H37 A;  3O1H A;  5LB7 B;  3VKH A;  1Y01 A;  1XNR T;  2CM0 A;  1VCS A;  2IHR 1;  2YU2 A;  4K0U A;  5ETW A;  3AEE A;  4CI2 B;  5BR8 T;  4KI0 F;  4LFA T;  2XHE B;  2LSK A;  4FJO A;  4NUV A;  3P4W A;  4OYK A;  4HWF A;  3QB5 K;  2IIU A;  4GYR A;  4AQY T;  3C50 A;  4MAL A;  3L8R A;  4EEB A;  2N1G A;  2BG9 A;  1HX8 A;  5F8P A;  1VRB A;  4LMJ A;  2J4G A;  2NTX A;  5AQF B;  1IAP A;  3IBP A;  4NIQ A;  4PFP A;  2IW5 B;  4TZ4 C;  2JQQ A;  5JH7 E;  4JI7 T;  2WZH A;  3KVA A;  3VKG A;  4QXC B;  5C2T A;  4A97 A;  2XQY A;  5AQI B;  1IJ5 A;  5CFB A;  4NXM T;  2EHO D;  2RPA A;  2VWA A;  1D0Z A;  2WQY A;  3OPC A;  4ZZB A;  3EAM A;  2E9X D;  5HEU A;  2K24 A;  2LKH A;  4GIW A;  4ASK A;  4JI3 T;  1XDP A;  3AE8 A;  4DBR A;  3RI5 A;  5AQP B;  3BQL A;  1W09 A;  3AA0 B;  2K9A A;  3PUR A;  4KHZ F;  4H9O C;  2VL8 A;  2BG9 E;  2OLT A;  4LF4 T;  2MYS A;  2CXF A;  4CXW A;  2K3W A;  3HKC E;  2LOP A;  3AXJ A;  5HXR A;  5AQH B;  5HYA A;  3LSV A;  3UU4 A;  2HH7 A;  3RYC E;  1HFA A;  4ZXL A;  1XMO T;  4ISS A;  2W0G A;  4O2B E;  2VL0 A;  2BVL A;  5FNV E;  3IF8 B;  4YSZ A;  3RLF F;  4JI1 T;  3AEC A;  3P4S A;  3O1J A;  4LF7 T;  1IJ6 A;  3FZF B;  5AQT B;  3AED A;  2PTF A;  3NZP A;  1O3X A;  3Q5X A;  5JDN A;  4I4T E;  2KLQ A;  3P8C D;  5TAO A;  3PU8 A;  3DTO A;  3J7Y q;  4KHP T;  4B6X A;  4YLH A;  4LF6 T;  2DI4 A;  3F31 A;  1IZN B;  2J62 A;  2V6X A;  4HWI B;  1HX1 B;  2PG8 A;  3RYI E;  3TLV A;  4PJL A;  4PFO A;  2BDE A;  2JMK A;  3B57 A;  3FB2 A;  4DV2 T;  3C98 B;  1EZ3 A;  2VKD A;  4A98 A;  3U78 A;  3UT5 E;  2DCF A;  2LM9 A;  2EHO B;  2B1E A;  2BZB A;  5JDL A;  4DR7 T;  3PUX F;  2KT9 A;  4PK4 A;  4X62 T;  3HKB E;  5J2T E;  3NBX X;  2I59 A;  2LSY A;  3H3A A;  3K3N A;  3QUJ A;  3ZMV B;  5JRC A;  3AE2 A;  3ONX A;  3ZMZ B;  4IGU A;  1KK7 A;  2NWB A;  3L09 A;  4YSY A;  3Q5W A;  3AXJ B;  2VB6 A;  3FHN A;  4ZOL E;  4UVA B;  3RF1 A;  5CGM A;  2XQ9 A;  4EYU A;  1S94 A;  3T1Y T;  2DWG A;  2ACX A;  2LKG A;  2WZI A;  4ZI2 C;  4HWH A;  3ZSS A;  4H63 V;  2V7M A;  3JC6 D;  3RGL A;  5AFU L;  3KVB A;  3PUG A;  1MMD A;  1WR0 A;  3MA9 A;  2V26 A;  4PNI A;  3ZLI A;  3N9O A;  5KDM C;  1D0X A;  2XQ3 A;  2UXN B;  2WM9 A;  4IDQ A;  2W61 A;  4AIU A;  3WAJ A;  4B3M T;  4BA9 A;  5LHH B;  1QSD A;  1UUR A;  1WR6 A;  2BG9 C;  3AEA A;  3I9W A;  4X5T A;  4F6R C;  5LGN B;  4H9S E;  3I1A A;  4DR1 T;  1JNZ A;  2K48 A;  2YOE A;  2LLY A;  3HI2 A;  3LG7 A;  2CBI A;  4IDN A;  4TN7 B;  4YFS A;  2HN2 A;  1YQ4 A;  2LM2 A;  3SS1 A;  2Y6X A;  3CQC B;  3FXE B;  3ESL A;  1M7K A;  2I0M A;  2IUB A;  2YK0 A;  4NUU A;  4UEL A;  4X1K E;  3TLS A;  5EK2 A;  3ZC0 A;  2PFV A;  4DID B;  4EZH A;  5L3C B;  2RA1 A;  1I6Z A;  1OED C;  3P50 A;  3RQU A;  3ZT7 A;  3NVO A;  2BBH A;  1NAF A;  2C5J A;  3VHL A;  2YDR A;  2VVN A;  4QX8 B;  2CXL A;  1D1B A;  5ABG A;  4MLK A;  4DV1 T;  3UUN A;  2V7I A;  5L3G B;  1UX5 A;  1YQ3 A;  2WAU A;  4MBQ A;  4EED A;  2JQH A;  2XAF B;  4O8S A;  3EI0 A;  2CPT A;  2PJQ A;  1D1A A;  3UFG A;  1HR0 T;  1G8X A;  2XAQ B;  3AB3 B;  3IEE A;  4H9Q C;  4DV7 T;  4DR6 T;  4K0K T;  4LFB T;  2WMN A;  4P09 A;  4UF0 A;  2ZLY A;  5ABF B;  1E7P A;  3VR9 A;  4TWD A;  2GK9 A;  4U33 A;  4DBQ A;  5M4Y A;  2XQ6 A;  2QGS A;  3R6N A;  2HN1 A;  2XSB A;  3AEB A;  2I6H A;  3IHR A;  2WS3 A;  2H88 A;  1J5W A;  1S35 A;  2AE9 A;  3ANW B;  5AQR B;  4IIJ E;  2R6G F;  3CX6 B;  5AQM B;  3R84 B;  2UU9 T;  1NEN A;  1Z8U A;  2JIW A;  5BMV E;  3GN5 B;  4GOU A;  3F2E A;  5JDF A;  3KBU A;  2LHN A;  3FZM B;  4U7Y A;  3ZJ1 A;  5L3F B;  3LBX B;  4TWF A;  4C90 A;  4YT0 A;  2W2U A;  4DV0 T;  3CQX C;  4DR2 T;  2UUC T;  3M65 A;  2XAG B;  3EVY A;  2F4V T;  2KMF A;  4XBF B;  4HFD A;  5L3B B;  3RIA A;  1HNX T;  5IHY A;  3I0O A;  3P7I A;  3OTO T;  1MIV A;  2FBW A;  3K3O A;  3OBV E;  3RC3 A;  1M62 A;  2XQ5 A;  4IDO A;  4CN4 A;  4TV8 E;  2HPL A;  5H6R B;  4ZEY A;  1HNW T;  4EYY R;  2PBI A;  2C5K T;  5DQW A;  1B7T A;  4TNV A;  1HCI A;  1QLB A;  5FVK A;  5FXX A;  2Y48 B;  4EGW A;  1I94 T;  3MXZ A;  5LHG B;  3VRA A;  1MIW A;  4UF0 B;  3SFE A;  2CXD A;  2XAJ B;  1W9R A;  2L8K A;  5L47 A;  5L3E B;  5H6Q B;  5HXE A;  2VQE T;  1V9D A;  2V5C A;  3EUH A;  2YEV C;  2CHN A;  5FXV A;  3SRZ A;  3B5M A;  3MKD A;  3N9Q A;  4N78 D;  4DMV A;  2X9Y A;  4DR4 T;  1OED E;  2CEA A;  3ANW A;  3PUW F;  3UFE A;  1ZHC A;  4DO0 A;  4GKJ T;  3AE3 A;  1OXZ A;  1US7 B;  4U31 A;  3DJB A;  3HL6 A;  1HTJ F;  2B76 A;  3LK2 B;  4KX6 A;  1D1C A;  3ZCJ A;  3AA1 B;  2H89 A;  3QC9 A;  4CI1 B;  1XDO A;  3CK6 A;  2V8S V;  3LBX A;  1GQE A;  1T7S A;  2NP9 A;  1T98 A;  2LHR A;  5JTG A;  4L0R A;  3PUV F;  2KZ7 B;  1YW0 A;  1OWA A;  2M6B A;  4Q25 A;  4HTE A;  2BKO A;  2MOZ A;  1SE7 A;  4YTN A;  1BR2 A;  1LVF A;  2WP9 A;  2WDQ A;  1SHZ C;  2XZE A;  5E0O A;  5HXS A;  3KV6 A;  5LNK A;  3KDS E;  3BQK A;  5L4E A;  2N2N A;  2C0S A;  5JR9 A;  1N32 T;  4QH5 A;  2VKO A;  3ZPO A;  2D0T A;  2VKH A;  2D5U A;  2NW7 A;  2ODV A;  4OYJ A;  1ZKE A;  4I55 E;  3N2K E;  3B13 A;  3NWI A;  4IE7 A;  3EDV A;  3HKD E;  2FJD A;  3RHW A;  4L9I A;  1UGO A;  2D0U A;  1XNQ T;  2LRL A;  5FVL A;  4X65 T;  2X9X A;  2A2F X;  4U74 A;  3EAB A;  3RH3 A;  1ZP0 A;  2DLR A;  1YXR A;  4U7I A;  4YJ2 E;  4CI3 B;  3P4P A;  1KFY A;  2NTY A;  1SUM B;  2E2A A;  2M67 A;  2J47 A;  2QYW A;  2FJE A;  4HWC A;  3ZST A;  5AQU B;  2A3D A;  3UU6 A;  5CJ5 A;  3ETV A;  3OKQ A;  4O4I E;  3ZC1 A;  2UXD T;  3O1I A;  2XPK A;  3CPZ A;  3TLU A;  5A1L A;  5C3J A;  1J5E T;  3AE5 A;  2X9W A;  3I0Q A;  5JRC B;  3MZK B;  5HEJ A;  2KIN B;  2XM1 A;  2L9Q A;  2NOX A;  3AE6 A;  1MMN A;  2YN6 A;  3CX8 B;  5L4H A;  4IE5 A;  4JI4 T;  4YXD A;  1XZY A;  4AQF A;  2ZM2 A;  4DV4 T;  3NRY A;  1MMA A;  3GA8 A;  3C64 A;  5LCY A;  1E2A A;  3AEG A;  3S4U A;  4WZX A;  3OJA A;  4KP3 C;  2QVA A;  3AE7 A;  3BQI A;  4IL9 A;  2E8I A;  4ZHQ E;  2A9U A;  3PU3 A;  3MJX A;  3M3Z B;  4HFC A;  4QWN B;  4Z90 A;  5FL0 A;  5KMG P;  1KNZ A;  2H7V C;  3RYF E;  3VRB A;  3ZYK A;  2YKS A;  4IE4 A;  3A7M A;  3IA3 A;  2Z6E A;  4U3C A;  4X1Y E;  1DU2 A;  4X1I E;  5F3J A;  3ONL C;  3N9M A;  2V7J A;  1ZEE A;  3U3I A;  2LEH A;  3LDQ B;  5HXH A;  1E1H B;  4YJ3 E;  3ZKR A;  3N9N A;  2NW9 A;  5J1G A;  4DR5 T;  5J2U E;  1N36 T;  2VVS A;  3HR0 A;  5FY0 A;  4QXH B;  3G06 A;  4JI2 T;  4EV6 A;  4EXT A;  2UXB T;  3PDY A;  5FL1 A;  2P9B A;  3DP7 A;  5HEH A;  2V1D B;  2Q9Q C;  4COF A;  3N5L A;  4X64 T;  5F5W A;  1LRZ A;  2JQ9 A;  4OFZ A;  4B3T T;  4JV5 T;  2JMH A;  1U4Q A;  4IST A;  5IUX A;  3UQ7 A;  2D9D A;  2IDO B;  2MPK A;  3ZMT B;  3X1D A;  1IBK T;  4EZ4 A;  1HNZ T;  3AAE B;  3K1S A;  2WSS V;  4CN6 A;  3AE4 A;  5GON E;  3ZJ2 A;  2DWK A;  3UU3 A;  3I9Y A;  5LXT E;  2KND A;  4G2A A;  1R8I A;  2MTQ A;  4IDZ A;  1ZOY A;  1XWM A;  5FYM A;  3ONJ A;  2VK9 A;  2WCA A;  3NRX A;  1WFD A;  3AE9 A;  4YTM A;  2QA7 A;  3J9X 1;  4IE0 A;  4ANJ A;  4YHH T;  4CXX A;  3T1H T;  3PUY F;  1HS7 A;  1L0V A;  2VAS A;  4HFV A;  4E7Z A;  5ABF A;  4DUZ T;  2OA5 A;  3AVS A;  3ZT6 A;  3A8Y C;  5JDM A;  4JI8 T;  1MND A;  5FY1 A;  2VQF T;  3LK3 B;  3Q2M A;  1UUS A;  3KV4 A;  2YDQ A;  3GWH A;  4JI5 T;  3C4X A;  5LGT B;  3L39 A;  1MIY A;  2CHO A;  3PUS A;  3UU5 A;  4ZI2 D;  3PTR B;  2E9X B;  2W67 A;  3KV5 A;  3GN5 A;  4YSX A;  2E5V A;  3HKE E;  3MK7 C;  2RP4 A;  5DJQ C;  2J1D G;  1H7C A;  4HE8 A;  4DND A;  2CE7 A;  2KSR A;  3QK6 A;  5EK3 A;  3FZL B;  1WCR A;  1HG2 A;  4WBO A;  4IT4 A;  4AKL A;  1HG5 A;  1IBM T;  5ABE A;  1ZV4 X;  2ZM6 T;  4PJM A;  2CMR A;  2WU5 A;  4ZI3 D;  1W0A A;  1WYB A;  2UXC T;  4OK0 A;  3ETU A;  3P4Q A;  4DUY T;  3OYX A;  3PUZ F;  3FZK B;  3KIN B;  4B3S T;  2X9H A;  2OV9 A;  2MAW A;  2WWU A;  3EDU A;  4JBW F;  1FMV A;  5LA6 E;  3RX6 A;  2WB5 A;  3ZN1 B;  3RYH E;  5JDQ A;  4CXY A;  3CML A;  2ZMA A;  2BKN A;  5AQN B;  1MMG A;  4ILU A;  1QUU A;  2QRX A;  2JQK A;  4FI5 A;  4DR3 T;  2XQ8 A;  3QNU A;  4I0U A;  2KXP B;  3OYZ A;  1VOM A;  1UCU A;  4KUM B;  4IL4 A;  1X9B A;  3QOF A;  5CB4 E;  2CRB A;  3PV0 F;  1NWM X;  2XAS B;  4PW8 A;  4X20 E;  4CN1 A;  4NPP A;  2CWO A;  5EZY E;  5LHI B;  1WYC A;  5HCM A;  3WI3 A;  3AAI A;  3CKD A;  5DAB A;  4QH1 A;  3SOL A;  1FEW A;  4J2C A;  4DMW A;  2DHR A;  4E7S A;  2E9X A;  4C91 A;  2JJ9 A;  3RRW A;  4EB6 E;  4AKI A;  1KF6 A;  2Q9Q B;  4BAY B;  4YTP A;  3JCF A;  2LE8 A;  3L3P A;  3RKO A;  2IML A;  2C5I T;  4HKA A;  5AQO B;  3CIR A;  3WAK A;  2YDS A;  2V6Y B;  5AQQ B;  4JYA T;  2AXD S;  1WRD A;  5FY7 A;  4CZZ B;  4DV3 T;  2WBL A;  2XQ7 A;  1SA0 E;  3HA4 A;  3N9L A;  3N2O A;  5HCJ A;  2UXX B;  3AA6 B;  3ZYL A;  2W62 A;  3C4Z A;  2BVM A;  2LSI A;  3N2G E;  4G63 A;  4AQG A;  4BJM A;  5JR9 B;  2ZM0 A;  4JUY A;  5FP3 A;  5AQK B;  1JNR A;  4LMK A;  4A56 A;  2LT3 A;  3E08 A;  3JAE A;  4UR9 A;  3RIF A;  2XJ7 A;  4UVC B;  4UVB B;  2K5B B;  5LBM A;  4MFR A;  4IHJ E;  4WW0 A;  3RQW A;  2FUP A;  2WDV A;  4OHF A;  3TLT A;  2DL1 A;  4QKN A;  2M6I A;  5C8Y E;  3KBT A;  3ZEF B;  4JEU B;  3O4X E;  4U2Y A;  2H7O A;  3LJC A;  3ZN0 B;  3MAC A;  3V5S A;  4CQI A;  2A72 A;  1AJ3 A;  4HEA A;  4ILA A;  5FXW A;  3E0Z A;  4H9R C;  4P0A A;  4L5G A;  1WLX A;  4O2A E;  3KV9 A;  5LBQ B;  2CCQ A;  2ACZ A;  2XSA A;  2V7L A;  1LKX A;  2D2S A;  2FJA A;  2YU1 A;  4LF5 T;  3PE0 A;  5LG3 A;  5IWA T;  2ES0 A;  2V6Y A;  3Q5E A;  4PAG A;  2Q9Q D;  2HHH T;  3AEF A;  3K8P C;  4LFC T;  3RC8 A;  4AI6 A;  3RRC A;  1OED A;  2G0U A;  3LK4 2;  2IC6 A;  2N9D A;  2XM2 A;  3GMI A;  3LFM A;  2W4X A;  4JI6 T; 
#chains in the Genus database with same CATH homology
 4DV6 T;  4LFA T;  4GKK T;  4B3T T;  4JV5 T;  4AQY T;  4X62 T;  2UU9 T;  4JI3 T;  1IBK T;  1HNZ T;  2UUB T;  4JI7 T;  4DV0 T;  2E5L T;  4DR2 T;  2UUC T;  2F4V T;  4NXM T;  1HNX T;  4YHH T;  3T1H T;  3OTO T;  4DUZ T;  4JI8 T;  1HNW T;  2VQF T;  4JI5 T;  4LF4 T;  1I94 T;  1N33 T;  2VQE T;  4LF8 T;  1XMO T;  4NXN T;  4B3R T;  4JI1 T;  4DR4 T;  4GKJ T;  4LF7 T;  1IBM T;  2ZM6 T;  2UXC T;  4KHP T;  4DUY T;  4LF6 T;  2UUA T;  4B3S T;  1XMQ T;  4DV2 T;  5LMN T;  4LF9 T;  4YY3 T;  4DR3 T;  4DR7 T;  1N32 T;  1IBL T;  1FJG T;  1XNQ T;  3T1Y T;  4JYA T;  4DV3 T;  1N34 T;  5BR8 T;  4DV5 T;  2UXD T;  1J5E T;  4B3M T;  4JI0 T;  4JI4 T;  4DR1 T;  4OX9 T;  5LMU T;  4DV4 T;  4X66 T;  4X65 T;  4DV1 T;  4LF5 T;  1HR0 T;  5IWA T;  4DR6 T;  4DV7 T;  4LFC T;  4DR5 T;  2HHH T;  4K0K T;  1N36 T;  4LFB T;  1XNR T;  4JI2 T;  2UXB T;  4X64 T;  4JI6 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...