3P7IA

Crystal structure of escherichia coli phnd in complex with 2-aminoethyl phosphonate
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
300
structure length
300
Chain Sequence
KALNFGIISTESQQNLKPQWTPFLQDMEKKLGVKVNAFFAPDYAGIIQGMRFNKVDIAWYGNLSAMEAVDRANGQVFAQTVAADGSPGYWSVLIVNKDSPINNLNDLLAKRKDLTFGNGDPNSTSGFLVPGYYVFAKNNISASDFKRTVNAGHETNALAVANKQVDVATNNTENLDKLKTSAPEKLKELKVIWKSPLIPGDPIVWRKNLSETTKDKIYDFFMNYGKTPEEKAVLERLGWAPFRASSDLQLVPIRQLALFKEMQSVKDNKGLNEQDKLAKTTAIQAQLDDLDRLNNALSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PhnD, subunit of alkylphosphonate ABC transporter
publication title Structure of the Escherichia coli Phosphonate Binding Protein PhnD and Rationally Optimized Phosphonate Biosensors.
pubmed doi rcsb
source organism Escherichia coli uti89
molecule tags Transport protein
total genus 119
structure length 300
sequence length 300
ec nomenclature
pdb deposition date 2010-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12974 Phosphonate-bd ABC transporter, phosphonate, periplasmic substrate-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3p7iA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3p7iA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3p7iA02
4FJPA 4ZZEA 1J1NA 2GH9A 5CI5A 3PUZE 4YKJA 2XXPA 1UTBB 3QIMA 2H9BA 1ZMGA 1MM7A 2XXRA 2Q8JA 1JW4A 3CRBA 5J1DA 1DTZA 3PUVE 5I57B 3TCFA 1XS5A 3T22A 1MQIA 3DP8A 1IEJA 1NFTA 3KJTA 3SDFA 1B3FA 2V93A 3PUYE 1B3EA 1WDNA 5H8NB 4PFYA 5I59A 1ZU0A 2O68A 1MDQA 3R7XA 5L9SA 4LUBA 3DM0A 1I69A 2MBGA 4F3SA 1M5BA 2C5IT 3K01A 3H6WA 4BDOA 3VV5A 1LAXA 1B7HA 3MZBA 4O3AA 1XC1A 1Z0PA 4QSEA 2I0BA 3FGSA 1CB6A 4RPOA 4ZECA 4ZEKA 4G8NA 4QF9A 5TU0A 2XXIA 1LCFA 2PBWA 4EUOA 2B65A 4LQ5A 3TFLA 1USYH 4R2FA 1FCKA 4OTEA 3FIRA 1SW1A 5FHNA 5KCJA 2VD3A 1I6QA 4FEBA 3KN7A 1LGBC 3FV1A 4FIMA 3O6GA 5I84A 3HPIA 3FASA 4ELRA 2Y7IA 2XXWA 2UVIA 4XKNA 1FQAA 3O2AA 3MPKA 3RGYA 3P7IA 3TEPA 3MP6A 2RC8A 5ISUA 1MY0A 3TZAA 4WKMA 1LBBA 1B7ZA 4IO5A 5CMMA 3CG1A 2ONKE 3R6UA 3C9HA 4U1OA 3S9NC 4KFQA 4GLIA 2GRVA 2DXRA 5H8QA 2Y84A 3L6GA 4O3CA 3VVEA 3UK4A 1IXGA 3MUQA 3MVZA 4PFTA 5ICTA 1BLFA 4C1TA 3MPLA 4RNSA 2P0SA 4AQ4A 3OSQA 3RTFB 1LLSA 4YZZA 3Q29A 1D3KA 1P99A 4CQIA 4POXA 4ZEDA 1UIVA 3ZSFA 2F36A 3Q26A 1QSDA 1SI0A 1B6HA 2ZYKA 2PVUA 1ZKEA 2RINA 3GLBA 3QUFA 4F2OA 2Y7PA 3QK6A 3MP8A 3TQLA 3OOAA 2H98A 3A09A 4XIGQ 3K0VA 2F6PA 2I4CA 1N7WA 4YB5A 2B3FA 4NMYA 5ICQA 2O84X 2F6GA 1LAHE 4G8HA 3OXNA 4OZ9A 4NWDA 3KOTA 2XXTA 2V3TA 4G68A 3AXFA 4Q5TA 1AIVA 4KI0E 1EH3A 1WODA 3G3JA 4Q0CA 3MQ9A 1RYXA 3I3VA 2AL4A 2X7QA 1FTJA 3W9VA 1IZ1A 1MQJA 4OENA 5IKBA 3O66A 2KWHA 4OFOA 1PBQA 2UVGA 3CFLA 1GVCA 3RN8A 4KYSA 4G2ZA 3FVOA 2I48A 4QFNA 3HCQA 3K2DA 2CA5A 2M8CA 1SDXA 2DYXA 4OYVA 3CFZA 1IUDA 3G3HA 4N07A 4C0RA 2RCAA 4R9FA 4BLAA 1B1XA 1FTKA 3FZVA 4RA1A 3H6VA 1AL3A 1SI1A 2G29A 4EQ9A 2XX9A 3N6UA 1URSA 4I8CA 2H25A 3HHGA 1S9TA 2XX7A 4YICA 3IB1A 4FATA 3B6QA 4R74A 3A3CA 3CVRA 4N13A 4G68C 2QSXA 2QS3A 3H4ZA 4OESA 3A3UA 5K2XA 3OO8A 3FD3A 3OEMA 1DPPA 1EU8A 1FQBA 3FXEB 3LBSA 2F34A 4JXIA 5H8HA 3RNNA 2VGQA 5L9OA 2UXAA 1NNKA 1MPBA 3IJOB 1XVYA 3N5LA 1XOCA 2ESNA 3VDFA 1US4A 4YKKA 3KFMA 3IX1A 3B6WA 3N26A 5I2KA 2I58A 2KWIB 4KQPA 1BIYA 5CBRA 3QAXA 5AA2A 3E13X 1P1UA 5TPAB 3BFTA 1NH8A 3GXAA 4EF2A 4FE8A 2Y7KA 3MZ1A 4UACA 1MY4A 3MC2A 3PPRA 1MRPA 1Y1MA 3PV0E 3CSGA 2DQVA 2V3QA 4KYEA 4MLQA 2HAUA 1O63A 4EQ7A 3IR1A 2I6EA 3PUXE 3FUZA 4QSCA 5I56A 3KEIA 3UP9A 4R75A 1JVYA 1NNFA 1A55A 2QS4A 4ZEIA 1SVXB 1QKBA 1B46A 4U21A 3GBBA 3HN0A 5FHOA 3U8QA 1UQWA 1HSJA 1MQDA 3U72A 1TT1A 1BTJA 3Q28A 3PPQA 2VD2A 1MG1A 5DTBA 1IXHA 3C32A 4R6HA 2UVJA 1O64A 3FXRA 1PB8A 5FTIA 3E3KA 4OETA 1S7YA 4NF6B 4NF8A 4U1ZA 1B9JA 4HCWA 1B1HA 1ZLQA 4OEUA 2CZLA 1OIBA 3IAZA 2DWAA 4OQOA 2OCUA 3MJNA 1Z7ME 4X1BA 3T9UA 4ECFA 3PPPA 1N84A 3M3LA 3U92A 3FXDB 1JETA 4IO3A 1P1QA 4JBZA 2VOZA 2XXVA 4P0GA 3SESA 1FQFA 1SW2A 4EDPA 4Q8RA 2O1LA 3IK6B 4YB6A 3M8UA 5A5XB 1HSEA 5HBCA 5AA2D 3RTWB 3S4UA 2R9JA 2NOOA 3B7DA 3IOVA 5H8FB 4NF5A 1P1WA 3CI8A 4GL8A 2F5XA 3K6UA 4DCYA 1UIUA 2A5TA 2Q2AA 2P2AA 3TYHA 3ILTB 3TDJA 1B3HA 3SERA 2GHBA 4QSDA 2QRYA 2PYYA 2Z8EA 1UTBA 3GZGA 2YLNA 1QVSA 1FQEA 4OFLA 4IY5A 1B5HA 5I57A 5DEXB 4EXLA 3IOTA 1B0HA 3C36A 2P1SA 3JZJA 4R73A 4LP2B 3K00A 3MP1A 5EHSA 3K6WA 5H8NA 2R71A 4OHNA 4I9DA 4ELQA 4DDDA 4H65A 4ND9A 4YKIA 4JWXA 2XXUA 2Z23A 2QMWA 1IQ7A 2X9XA 3OSRA 2O51A 3JV9A 1FTLA 3E9XA 4R6KA 1BKAA 3HO7A 3K6VA 1P1OA 2UYEA 4JB7A 4U2RA 1XHYA 4EYYR 2V84A 5ITOA 3HSTA 4X9TA 4F3GA 1GGGA 1N3WA 3N6TA 1NKXA 3S9LC 4ZS9A 1POY1 1SQYA 1D9YA 1B58A 3K1MA 3IOUA 1GR2A 2ZYOA 1II5A 3TTLA 3PMVA 1MXZA 3VXCA 2OK2A 4C1UA 2XX8A 3ILUB 4F18A 2F97A 3MVXA 4ESWA 2G0UA 3F11A 2OZZA 3IB0A 3KSJA 3KG2A 2F35A 1FTOA 1JQFA 4E0XA 1Y3PA 2F7CA 2OWSA 1Y4CA 4KR5A 1MPDA 1HSLA 1DPEA 1ZJLA 2Q89A 2ZNUA 2DWHA 4H5FA 3H06B 3FVGA 3IO4A 2ZXTA 2RC9A 4J2CA 3SEVA 1H76A 2QPQA 2DXYA 1MM6A 5CMBA 4LVQA 1JNFA 1OQHA 2G93A 1ELJA 2VHAA 2H5YA 4LZ8A 4EXKA 4OWDA 2KLFA 1LFIA 1AMFA 1GTKA 4OXVA 4TLLB 2HFBA 5AA3A 3QYTA 1T0KA 1DSNA 3LR1A 3RQTA 3K6XA 3L6HA 1MH4A 1YTVA 3FXUA 5TP9B 1MXXA 5JEIA 2DWJA 1UTHB 2B3BA 2HZKA 1ZBMA 3FV2A 2VP1A 3V8XB 1I6AA 4X1DA 4JDFA 4ELOA 1OMPA 3TMGA 4JSOA 2BJJX 1FTMA 2NUVA 3RLFE 2DVZA 1N7XA 2HQ0A 3EQ1A 2E0SA 2F78A 3O9PA 5KDTB 3G3IA 3K4UA 1A8FA 4P11A 3TAJA 2O69A 1MXVA 1MDP1 1OVTA 1ZTYA 4F2QA 4G68B 4YB7A 1VFDA 2ZNTA 4DNDA 4H8JA 2XXYA 3OMBA 2DE3A 1A8EA 3LC8A 1A99A 2Z22A 2ALUA 3PD8A 1LRZA 2OBGA 5I58A 5CRYA 4IGTA 2X7PA 4YU0A 2DS9A 3ONMA 1D4NA 4FAJA 1XT8A 3BBRA 1B4ZA 5L8DA 1ANFA 5M2VA 4R6YA 2THIA 1MY3A 1IJ6A 2I0CA 1LBCA 3VLVA 1R6ZA 3MVYA 3ZS6A 4LZ7A 1Y9UA 4GWOA 3LSLA 2HZLA 1YPNA 1H44A 3SETA 3FXQA 3MZ9A 4PETA 3EF7A 4QRZA 2QS1A 4E0WA 1LAGE 3ZKLA 4YMBA 3E4RA 4K3FA 3OO9A 4ONYA 2AL5A 1EZPA 3IORA 4LA9A 2PT1A 3VVFA 4IO7A 1B05A 3HHFA 5L9MA 4ESXA 4G4PA 2ONSA 5H8HB 3SEUA 4IO4A 1LSTA 4LZ5A 4MBPA 1MPCA 4M4GA 4YAHX 5B7DA 3UORA 5LOMA 2Y7WA 3UA8A 4UA8A 3THIA 3RT8A 3D4CA 2XTLA 3C4MA 2HAVA 2IC6A 1TFDA 1H7CA 5BUUA 3C34A 3QSLA 2E1SA 1Q35A 1SW5A 5FTHA 3TCGA 1SW4A 4BDMA 4NF4B 4NE4A 4GXAA 4DZ1A 4THIA 2RF1A 4GF8A 2OWTA 4LATA 2O7UA 3T9VA 1NMUA 2CMOA 2QL3A 5DYHA 1NH7A 3U94A 1O7TA 5CM6A 3OENA 4H67A 1WVJA 5AA1A 3TTRA 1MH3A 3SKPA 5TPAA 1URDA 4ELPA 4FECA 2AYSA 3TUSA 1MXUA 1LCTA 4JWYA 1DTGA 5AA4A 3N94A 2PX1A 3G3KA 3TELA 1QULA 4ZDMA 3RT6B 4O3BA 3CFXA 2FNCA 1US5A 1QJMA 3IOWA 3RPWA 4H0WA 3BFUA 4DCXA 4NWCA 4XXUA 4KPTA 4G77A 5F7VA 5I2NB 2UVHA 3CR9A 3PPNA 4HCYA 3TKLB 2YPNA 2V25A 2OJTA 3QUJA 1MXYA 1IXCA 2H99A 3M3FA 3MAMA 2O7IA 1LB8A 5JTYB 4B6XA 4JSDA 4NF6A 2NXOA 4FORA 4RY1A 3MWBA 3Q27A 3TCHA 4BDLA 4GD5A 4KCCA 1B40A 1Q1KA 3T9XB 3CIJA 4PQJA 4XTCQ 4BDRA 2RKMA 1CE2A 4GL0A 3FJMA 1Y1ZA 3SEXA 2D5WA 4I62A 4NEDA 4FI5A 3TTNA 1POTA 2O6AA 4DIGA 2X9YA 2GHAA 2UYFA 2Z8FA 2HEUA 4X48A 5DT6A 4DE8A 4QFOA 1LFGA 3M3KA 4NF5B 1QUKA 2Q2CA 4WEPA 5A5XA 4R2BA 5EYFA 2PMSA 2IC9A 1P1NA 1KWHA 2A5TB 1IIWA 1MY1A 1OQGA 3O97A 2NWJA 3Q25A 3G3FA 3H3GA 1B32A 2AIXA 2O1MA 2DP8A 5K2YA 1QUJA 4OVJA 3K1NA 3DP6A 5H8FA 3O29A 3VLWA 4PE5B 4POWA 4XKQA 4F39A 3KSXA 1VFEA 1NL5A 4HW8A 5I59B 1JEUA 3IO6A 3EHTA 4G8MA 2Y7RA 4U4SA 2K48A 4F1YA 3H6TA 1M5EA 4F1UA 3VE1B 1JEVA 3LSFB 1JVXA 1D9VA 2DOJA 3PD9A 4F1VA 3R26A 4DXUA 5DEXA 2A5SA 2R6GE 3OD7A 1PB9A 2I3WA 5B70A 4Q30B 3GBAA 2I3VA 4IGRA 2REGA 3RY3A 2GFEA 3G3GA 1N04A 2ZNSA 3W15C 1LFHA 1B4HA 1XVXA 1B7UA 1N0TA 3CKDA 3LUYA 5KCJB 1LVFA 4QFKA 4F3BA 5ELVA 4KD5A 2C5JA 3D4GA 3FVKA 4DXCA 1OLAA 4H1XA 1H43A 3KGCA 2RC7A 3I5OA 1RYOA 1TXFA 3T96B 3EPEA 3DLNA 4ISUA 2XXHA 2Q9TA 3B6TA 4IO2A 1Y3NA 2RCBA 4QFLA 2PT2A 4LONB 3SEWA 3IL1B 1SBPA 3FJGA 1PC3A 5FHMA 2H4IA 1B51A 5CMCA 4M1VA 4WEDA 1JW5A 4RYAA 3TPAA 3MW0A 5EHMA 3CG3A 4U22A 5H8SA 4BDNA 1RKMA 3VLUA 5H8QB 2OLBA 3S2VA 3UGWA 5F1QA 2XXQA 1Y20A 4KHZE 4H8IA 1PBPA 1L5TA 3ZKKA 1A54A 1B2HA 2IEEA 2X9WA 4U23A 1AOVA 2FYIA 2D3IA 1OLCA 1B3LA 4H6DA 4TLMB 1EZOA 1A7LA 4ZZAA 1TFAA 2QJEA 3QXMA 2ZMBA 3C35A 2F7AA 1MS7A 1VR5A 4MF3A 2NVUB 1R1NA 3UIFA 1R9LA 4PFUA 2ZYNA 3V5AA 3WAEA 4ZE9A 5DVIA 3O6HA 4LQ2A 4GXSB 4DXBA 5AE4A 4ZE8A 3TODA 3EN3A 1DOTA 5TP9A 4F22A 1QUIA 4KCDA 1N3XA 3S9MC 4YKPA 3KN8A 4F31B 3PUWE 1UTHA 2X26A 4L17A 1MY2A 3ECRA 4I1DA 3W9WA 1B5JA 1IXIA 3T9HB 1PDAA 2ONRA 5HPQA 3S9EA 2REJA 3O28A 4DLDA 1DMBA 3DP4A 3TQWA 3G7WA 3V83A 4L0RA 4GIZA 1YCJA 3MVWA 4H5GA 1ZIUA 3K02A 5KDTA 3U93A 5I58B 1F9BA 3C33A 3SEYA 3KZGA 3VFJA 1URGA 4OFJA 4RXLA 1FW0A 3MXZA 3PU5A 2DSFA 3T66A 3OELA 3TTMA 5DVFA 3OO6A 3PMWA 3V89B 4KYDA 3WAFA 2HCAA 1N76A 5CBSA 3ODBA 1I6BA 5IAIA 1VSOA 3O6IA 2V3UA 2DE2A 1S50A 3KOSA 4U4XA 1B5IA 1SYHA 4XKPA 4BDQA 1LB9A 3H03A 5BWJA 3TKDA 3H6UA 4RK2A 3LSWA 4FEDA 4Z7EA 4F19A 3EHSA 4YMAA 3C31A 1SYIA 4Z0IA 2XD3A 3JYRA 4PFWA 1M5FA 3PGFA 4OERA 1ZKBA 2HXWA 3BKIB 3L3PA 4P0IA 4TQUQ 5JK4A 4OMBA 3FATA 1LAFE 3VXBA 2C5KT 1Y4TA 1OVBA 4EF1A 1IITA 4RJZA 4AB6A 3HV1A 5I2KB 4F3PA 4JWOA 1Z7NE 2QMXA 1MQHA 5AA2B 3KN3A 4N6PA 4R9GA 3OO7A 4MLVA 3H7MA 4OEVA 4F29A 1B3GA 4RPNA 1PB7A 5CC2A 4WXJA 2W7YA 2WKYA 5DVJA 4NF4A 2Z8DA 4NTLA 3KJ7A 4IO6A 3FJ7A 3KBRA 1AH5A 5I56B 4ZEBA 1JW1A 3USDA 3T93B 2ABHA 1B52A 4MH5A 5AA4B 4RK9A 1QKAA 1M5DA 4QFPA 4GQOA 3CVGA 3MBPA 4TOZA 3K1PA 3I6VA 4AB5A 1Y3QA 4GOTA 4GRKA 3RUMA 3LSXA 2YJPA 3IJXB 1MXWA 2F8DA 4IY6A 4GFRA 1FQDA 3VVDA 1A40A 3PMXA 1R9QA 2DWIA 1QW0A 4IB2A 4NF8B 2XXXA 5KZTA 3PPOA 2I49A 2XHDA 3UN6A 2FA7A 5I2NA 5HM4B 3IB2A 2D21A 1NNPA 1FQCA 1SD3A 5ITPA 1H3DA 3CSBA 2XD2A 3U1OA 4PP0A 4XKRA 2QS2A 4ZEFA 3FVNA 2F7BA 5JTYA 1GV8A 3DELB 1ATGA 1VE4A 1H45A 1M5CA 1USYE 4HTGA 2IA4A 3OEKA 1EZ9A 5CMKA 4QHQA 1IJ5A 1B0LA 3EHUA 2LAOA 2DVCA 1TWYA 4MFIA 4EQBA 1MQGA 4R72A 2ZYMA 3TTKA 2ANJA 1NNTA 1BP5A 1YAEA 2DE4A 4HS7A 2Q88A 1PEBA 4GVOA 2I4BA
chains in the Genus database with same CATH superfamily
3LK42 1W0BA 2D0UA 4FJPA 4YLHA 2XQ6A 3UUXB 3RIUC 4ZZEA 1J1NA 2GH9A 5CI5A 3PUZE 4YKJA 2XXPA 4HTEA 1OWAA 1UTBB 3QIMA 2H9BA 2X51A 1OEDB 1YKHB 3M3ZB 3VR9A 1ZMGA 3R84B 1MM7A 2XXRA 1WYCA 1T98A 2Q8JA 1JW4A 3CRBA 2SPCA 2D9DA 3N2GE 3RYHE 3E22E 5J1DA 1DTZA 3PUVE 4A5XA 5I57B 3TCFA 3K3QC 1XZYA 3RIFA 1XS5A 5FL0A 2CM0A 1OXZA 4U33A 3T22A 2A72A 1MQIA 3DP8A 4ANJA 2XQ3A 1IEJA 3CK6A 1NFTA 3KJTA 3SDFA 2XAJB 1YXIA 1MNEA 3EABA 1B3FA 2V93A 3PUYE 5L3GB 3IFCA 3AE2A 1B3EA 4EYUA 1WDNA 5H8NB 2YDRA 3H3MA 4PFYA 2XPKA 5I59A 4LN5A 1HG2A 1ZU0A 2O68A 1MDQA 2BG9A 5H6RB 1DU2A 4KX6A 3R7XA 5L3EB 5JDQA 5L9SA 1VCTA 5AQOB 4I43B 4LUBA 3DM0A 3NWIA 1FSAA 5AQQB 1I69A 2MBGA 4P09A 4F3SA 1M5BA 5FY7A 1HR0T 2WDQA 2FIEA 2A2FX 2LKGA 2C5IT 3K01A 4U2YA 3H6WA 3SZPA 4BDOA 3NZPA 2UXXB 3VV5A 4H63V 1LAXA 3PJAA 1B7HA 3MZBA 4O3AA 1FPGA 4KUMB 4I50E 5AQFB 1XC1A 1Z0PA 4QSEA 4PFIA 2I0BA 3FGSA 1CB6A 5EK2A 4RPOA 4ZECA 3RC8A 1XMQT 1JNZA 4U31A 2DI4A 2NP9A 3Q5EA 2QVRA 4CI3B 2QVVA 4WZXA 4ZEKA 3UUNA 2PFVA 3FZKB 4G8NA 4YTPA 4QBAA 4IR8A 2IUBA 4QF9A 5TU0A 2XXIA 1LCFA 2PBWA 4EUOA 4TV8E 5IZ3A 2B65A 4LQ5A 1FMWA 5IUXA 4QKNA 4DMWA 5JTGA 1KK7A 2VL0A 3TFLA 1HS7A 1USYH 4R2FA 3ZMVB 4GKKT 1FCKA 4OTEA 3FIRA 1SW1A 5FHNA 5KCJA 4GWXA 2VD3A 2BBHA 1I6QA 4FEBA 3KN7A 1LGBC 1XNQT 4PF6A 3FV1A 4FIMA 3UTKA 3O6GA 5HEOA 5HEHA 5I84A 4LFBT 3HPIA 2WZHA 3OKQA 3ZSTA 3FASA 4ELRA 3P4WA 2Y7IA 4MBQA 1YD8G 2XXWA 5F5WA 2UVIA 4XKNA 2BG9C 1FQAA 3O2AA 3MPKA 1WFDA 3RGYA 1I94T 3P7IA 3B5MA 3ZT7A 3TEPA 2QYWA 3MP6A 2RC8A 5ISUA 4IE7A 4KBMB 4MLKA 2XAQB 1MY0A 1S94A 3B13A 3AAEB 3TZAA 3FZHB 4UIGA 4WKMA 5AQJB 2BKOA 2JJ9A 4LF6T 1LBBA 3KVBA 1FBCA 1B7ZA 3KBZA 3BK9A 3J9X1 4IO5A 5CMMA 2JMKA 3ROJA 3CG1A 2JMHA 2LHRA 3LK2B 3NRYA 1KNPA 1HG5A 3SOLA 2ONKE 5LP6E 3R6UA 2PTFA 4MFRA 5DQWA 3C9HA 4U1OA 3S9NC 2XQ4A 4KFQA 4ZI2C 2XXKA 1LBVA 5HXHA 3N2KE 2GRVA 4GLIA 2E5VA 2DXRA 4UABA 5EYGA 3QC9A 5H8QA 3ZJ1A 2Y84A 3L6GA 4O3CA 3VVEA 2HPLA 3UK4A 1IXGA 3MUQA 4ZEYA 1FRPA 4HKAA 3MVZA 3VRBA 3RYFE 4PFTA 4JI8T 2CE7A 4PCDA 1G0IA 3T1BA 5ICTA 5LBQB 5FL1A 2PFZA 4GK0E 1BLFA 4C1TA 4ADZA 3MPLA 4RNSA 3AE6A 2P0SA 2OX3A 4PDHA 2DHRA 1IMCA 4WNKA 4AQ4A 3OSQA 3ZEFB 3RTFB 4ZS3A 5LGTB 1LLSA 5TAOA 2UUBT 4YZZA 3ONXA 4BA9A 3LUZA 3Q29A 1D3KA 1P99A 4CQIA 4POXA 5JDHA 4ZEDA 1UIVA 1BR4A 3C4XA 5KX5E 1RDXA 4DR2T 3QNUA 4OVQA 4JUYA 5J2UE 3ZSFA 2F36A 3Q26A 3PUGA 4QXHB 1QSDA 5EK3A 1ZHCA 4YTMA 2E2AA 4IDZA 1SI0A 1B6HA 4UELA 3T0JA 3CX6B 2ZYKA 5ABGA 3PUAA 2ACXA 5FXXA 1BK4A 2PVUA 1ZKEA 3AE9A 2RINA 4UVBB 4F6RC 1FPFA 3GLBA 2GQ1A 2XQYA 3QUFA 4IL9A 4ISTA 4NIQA 4F2OA 2Y7PA 4O2AE 2ODUA 3I0QA 3E0ZA 3QK6A 3MP8A 3VRAA 2XAGB 3TQLA 3OOAA 4NHBA 1RDYA 2H98A 3A09A 4XIGQ 4QH1A 5AQKB 1KA0A 2WBDA 2F6PA 3K0VA 2BVMA 2JQHA 5ABFB 2I4CA 1N7WA 4YB5A 2B3FA 3OBVE 2QA7A 2VPNA 5JH7E 4NMYA 4MIJA 5ICQA 2O84X 5FXWA 1US7B 3HKDE 1LAHE 2F6GA 5FYMA 3OXNA 4G8HA 4GX6A 4NWDA 4OZ9A 4DUZT 4PBHA 3KOTA 2XXTA 1UUSA 4JVDA 1YKEB 2V3TA 4G68A 3AXFA 4N17A 4Q5TA 3AB3B 1IZNB 4MMPA 1AIVA 4KI0E 2B76A 1EH3A 1WODA 5AQTB 3G3JA 4Q0CA 2Q9QA 3A7MA 3MQ9A 1RYXA 1Y01A 3PUZF 2FJDA 3I3VA 4NF0A 4I3EA 2V6YB 1KF6A 3IF8B 2AL4A 2X7QA 2F4VT 1FTJA 2MTQA 1WCRA 3U3IA 1IZ1A 3W9VA 1MQJA 4PJLA 4OENA 3QMFA 4A56A 1X9BA 2K9AA 3M65A 1FPLA 4IHJE 4H45A 5IKBA 3O66A 3NZQA 2CEXA 2KWHA 4OFOA 1YYZA 1PBQA 2UVGA 2BZBA 2H7OA 3CFLA 4PC9A 1GVCA 3RN8A 4KYSA 3K1SA 4IE0A 4G2ZA 3FVOA 4IDQA 3C4ZA 2XSBA 2CBIA 2I48A 4QFNA 5HAXA 2K5BB 3HCQA 3OYZA 3K2DA 4N81A 2Q74A 1UX4A 2CA5A 2M8CA 1SDXA 2DYXA 4UV8B 4OYVA 3CFZA 4EZ4A 1IUDA 3G3HA 4N07A 4C0RA 5L3DB 2RCAA 2ZM2A 3UU4A 4R9FA 4BLAA 2V26A 1B1XA 2WS3A 1FTKA 3FZVA 4RA1A 3FBPA 3H6VA 1AL3A 1SI1A 2G29A 4EQ9A 2XX9A 3N6UA 1URSA 3RYCE 2CZIA 4I8CA 4O7MA 3AVRA 4OVSA 2L5VA 2H25A 2JJKA 3HHGA 1S9TA 2XX7A 4YICA 3IB1A 4N78D 5ET5A 4FATA 2DNXA 3ZMSB 3B6QA 3GN5A 3A3CA 4R74A 3CVRA 4N13A 2MPKA 4G68C 2QSXA 2Q8MA 2QS3A 3H4ZA 4CN1A 4OESA 1G0HA 4AKRB 3A3UA 5K2XA 3OO8A 3FD3A 3OEMA 3D0TA 4LF7T 1DPPA 5FXVA 4FBPA 2WWVA 2PBIA 1EU8A 4AIUA 1FQBA 3FXEB 3LBSA 3KVAA 2UXDT 2F34A 3RIAA 4JXIA 2D5UA 5H8HA 2E9XA 1FPKA 3RNNA 2VGQA 3KFWX 5L9OA 5FP3A 3RQWA 2A9UA 2UXAA 4HE8A 4QXDA 1NNKA 3MA9A 1MPBA 2LLYA 3IJOB 1XVYA 3N5LA 5EQ8A 1W09A 4HFIA 3UU5A 1XOCA 2ESNA 3VDFA 1US4A 2N2NA 3VHLA 5ABEA 1J1JA 4YKKA 3AXJA 1VDWA 3KFMA 3IX1A 3B6WA 5F8PA 3N26A 5I2KA 3KC0A 3IA3A 3A29A 2I58A 4NN3A 2KWIB 3MYUA 4KQPA 1G73A 2PG8A 1BIYA 5CBRA 2DL1A 1KEYA 2XQ9A 4P0AA 3QAXA 5AA2A 3E13X 2PCRA 1P1UA 3EKIA 2NW8A 5TPAB 3BFTA 3KC1A 3IEEA 1FBGA 1NH8A 1KZ8A 3GXAA 4U2ZA 4EF2A 4FE8A 4MX6A 4B3ST 2Y7KA 2BS2A 4ZI3C 3CX7B 3MZ1A 2B1EA 4UACA 3ZT6A 1NV5A 5ET7A 3I9YA 1MY4A 4X1YE 2IDOB 3MC2A 4GWYA 3RPUA 3PPRA 4BJMA 1MRPA 1X79A 2Q9QD 1Y1MA 3PV0E 3CSGA 2DQVA 4HWDA 2Y5LA 3ETUA 1FJ9A 2V3QA 4KYEA 4MLQA 2HAUA 1O63A 3IR1A 4EQ7A 2I6EA 3I9WA 2OWZA 3PUXE 3FUZA 4QSCA 5I56A 3RQUA 3KEIA 3UP9A 4R75A 1JVYA 3K8PC 1NNFA 2KMFA 2LSIA 3A5XA 1A55A 2QS4A 4FJOA 4ZEIA 3PUQA 2E5LT 5HXEA 5AFUL 1SVXB 2E9XC 1QKBA 1B46A 4ZZBA 3JAFA 3FBLA 1MMDA 3HI2A 4U21A 3GBBA 4GX4A 3HN0A 5FHOA 3U8QA 1UQWA 1HSJA 2OV9A 4K0KT 5EYHA 4DUYT 1MQDA 4UF0A 4U7IA 3U72A 1TT1A 1BTJA 2KSRA 3ZN1B 3Q28A 3PPQA 2VD2A 5KXJA 5HYAA 1MG1A 2WBLA 1MMGA 5DTBA 2IHR1 1IXHA 3C32A 4R6HA 2UVJA 3HA4A 2LM9A 2RPAA 5CA0E 5M4YA 1O64A 3FXRA 4PTKA 1PB8A 1KA1A 5FTIA 4XAXB 3E3KA 4TUYE 4OETA 4TZ4C 3BIHA 4V1Av 1NV2A 1S7YA 4NF6B 4NGUA 4I4TE 3RX6A 4NF8A 4U1ZA 1B9JA 2VB6A 4HCWA 1UCUA 2HHMA 3AE8A 3P4QA 1B1HA 1ZLQA 5C8YE 4P1NA 4OEUA 5EK4A 2Y8DA 2CZLA 4QX8B 1OIBA 3IAZA 2DWAA 4OQOA 2OCUA 3MJNA 1Z7ME 2LT3A 5LGUB 1KNZA 4X1BA 2XJ7A 2JIWA 2HPJA 3T9UA 1SE7A 2V1DB 3GYYA 3V5SA 4ECFA 1LBZA 3KBUA 1T7SA 3PPPA 3JC6D 5LG3A 1N84A 3M3LA 3U92A 3FXDB 2VK9A 3AEGA 4I3YA 4P47A 4AISA 2N1GA 1JETA 2CWOA 3CPZA 4IO3A 1P1QA 4AKHA 4JBZA 2VOZA 3EI0A 2QVUA 2XXVA 4KI0F 4P0GA 3SESA 1FQFA 2V5DA 4QXBB 1ZP0A 4OA4A 2H7VC 1SW2A 2VKJA 4EDPA 4Q8RA 3EAMA 2O1LA 1FMVA 2FJAA 3IK6B 5IYZE 3PTYA 4YB6A 2EHOA 3M8UA 3LV0A 5A5XB 1HSEA 1O3XA 4IE4A 4MALA 5HBCA 5AA2D 3RTWB 1W9RA 4TN7B 3S4UA 2R9JA 4JI6T 2BKPA 2NOOA 4XF5A 3MZKB 4JI2T 1HNZT 4CI1B 2X9HA 3B7DA 1D1BA 2YK0A 3L09A 3IOVA 2LRLA 4PFBA 1MMAA 3WAKA 5H8FB 2L9QA 4YFSA 1J5WA 4NF5A 1P1WA 3CI8A 3FB2A 2F5XA 4GL8A 3K6UA 4DCYA 3MACA 1QGXA 1UIUA 4MHFA 2WP9A 4PAKA 2VKDA 4H9SE 2A5TA 5FXZA 5JRCB 4NQ8A 2Q2AA 4HWHA 2P2AA 3TYHA 4AKGA 3ILTB 1G8XA 2NTYA 3SS1A 4QH5A 4LF5T 3TDJA 1B3HA 3SERA 3P4SA 2GHBA 2B4MA 3SFEA 3ZYKA 4QSDA 2QRYA 1D1CA 2LE8A 2PYYA 2Z8EA 2XM2A 1UTBA 4WW0A 3ZMUB 3GZGA 1OEDA 5HXRA 2YLNA 5HXSA 1QVSA 1FQEA 2BG9B 3GA8A 3ZMZB 4OFLA 2BBJA 1NENA 4IY5A 1B5HA 3U78A 2A3DA 5I57A 2KLQA 5DEXB 2WY2A 4EXLA 3C50A 3IOTA 4HFDA 4O4IE 1B0HA 3C4WA 2Y5KA 1FTAA 2UU9T 3VU7H 1T72A 3C36A 2P1SA 3P4PA 3JZJA 1ZV4X 4R73A 4H9NC 4DMVA 4LP2B 4YSYA 4AS5A 4LF9T 4PGPA 3K00A 3MP1A 4JEUB 3EVYA 5EHSA 3K6WA 5H8NA 2R71A 2XQ8A 2CXLA 4OHNA 4I9DA 4PF8A 4ELQA 2WX9A 4AQYT 1DBZA 4DDDA 4H65A 2V8SV 5J0ZA 1K9YA 4ND9A 4YKIA 2BDEA 4JWXA 2UUCT 2XXUA 2Z23A 2QMWA 1NEKA 1IQ7A 2X9XA 3OSRA 2O51A 5EQ7A 3V5UA 3JV9A 3UFEA 3ESLA 1FTLA 3E9XA 4MNCA 4R6KA 1BKAA 2XWIA 5DQVA 3HO7A 1P1OA 3Q5DA 3K6VA 2W61A 5LCYA 2J62A 3TLSA 2UYEA 4JB7A 4U2RA 2Y48B 1XHYA 4EYYR 2V84A 5ITOA 3HSTA 5HCMA 1D0XA 4X9TA 4ASKA 1XMOT 1IAPA 3DJBA 4F3GA 5IGAA 1GGGA 1N3WA 3N6TA 1NKXA 3S9LC 3QB5A 4ZS9A 1POY1 2FUPA 3N9LA 1SQYA 1D9YA 3PDYA 1B58A 3K1MA 3IOUA 4HFBA 1XI6A 4IDNA 1GR2A 2ZYOA 4MHCA 1II5A 4XZCA 3PMVA 1MXZA 3TTLA 2OK2A 3VXCA 4C1UA 1MIYA 4YT0A 5L4HA 3PV0F 2XX8A 3ILUB 4F18A 1GQEA 2F97A 2LOSA 4KP3C 3MVXA 4ESWA 1LEVA 2G0UA 2BKNA 2EHOD 3F11A 4KMCA 2OLTA 1SPIA 3R6NA 2HPGA 4JVCA 2XA5A 2OZZA 1N32T 3IB0A 3KSJA 3KG2A 2F35A 2YINA 4TWHA 2CLYC 1FTOA 1JQFA 4E0XA 1Y3PA 3RI5A 2F7CA 2OWSA 5JDNA 1Y4CA 4KR5A 4N8GA 1MPDA 3RPLB 1HSLA 3AE7A 3CQCB 4XBFB 1UK5A 1KFYA 1DPEA 2J47A 1ZJLA 3BQIA 2JQKA 2Q89A 2ZNUA 3N9NA 2QFLA 2DWHA 4H5FA 3H06B 3FVGA 3IO4A 1IBKT 5F3JA 1VCSA 4MEVA 2ZXTA 2RC9A 2L3LA 3AE1A 4EIWA 1SHZC 4J2CA 4NXNT 1H76A 3SEVA 2QPQA 4DVDA 1NV6A 2DXYA 4H9QC 1NUXA 2VQET 3UULA 1MM6A 5CMBA 3RF1A 4JLEA 4LVQA 4DI3D 4PNIA 2ODVA 5DJQC 4K0UA 1JNFA 1OQHA 3C98B 1ELJA 2G93A 5KMGP 2VHAA 4P9KA 2NTXA 2H5YA 2X0HA 3ZCIA 4LZ8A 4EXKA 4OWDA 2KLFA 1JNRA 4DV6T 5E0OA 1LFIA 4JVIA 4O4HE 3N2OA 1AMFA 1GTKA 4OXVA 4TLLB 2HFBA 5AA3A 4G2AA 3QYTA 4UVCB 5EQ9A 3LG7A 1DSNA 1T0KA 3FZFB 2CHOA 3LR1A 4AQGA 3UFGA 3ZC0A 4NPPA 1CHUA 2N9DA 4ZS2A 5LOVE 3K6XA 3L6HA 3RQTA 1MH4A 1NV1A 1YTVA 4A98A 5LA6E 3ZN0B 1WR0A 3FXUA 5TP9B 1MXXA 1AWBA 1LVKA 2WZIA 1U4QA 4GWWA 2DWJA 2C0SA 5JEIA 5C2TA 1UTHB 2B3BA 3B50A 2HZKA 1ZBMA 4TV9E 3FV2A 2VP1A 4IE6A 3V8XB 3SWHA 1I6AA 4X1DA 4JDFA 4ELOA 1T8BA 1OMPA 3N9MA 3TMGA 2V7MA 4JBWF 4JSOA 1UX5A 5AQIB 4PW8A 2BJJX 5JR9B 4PAIA 4ZHQE 1YQ3A 3B57A 1FTMA 2NUVA 3RLFE 2DVZA 4F8HA 1N7XA 1IMFA 4DV5T 4P1LA 1HNWT 4ILAA 2HQ0A 3EQ1A 4JEHB 2KZ7B 3PU3A 5H6QB 2E0SA 2F78A 3O9PA 2VQFT 4L5GA 5KDTB 3EUHA 3G3IA 3K4UA 4O8MA 1A8FA 4P11A 3TAJA 5LTCA 3AEDA 4DBRA 4AI6A 2O69A 5FY0A 1MXVA 4H46A 1MDP1 1OVTA 1ZTYA 4AKIA 4F2QA 3AEAA 4G68B 4UEMA 1N33T 4YB7A 2BS3A 1VFDA 2ZNTA 4DNDA 4H8JA 4MNPA 2XXYA 4B3RT 3OMBA 3GMIA 2DE3A 1A8EA 3LC8A 1YQ4A 5DABA 2H88A 1R8IA 4P8BA 4PAGA 1A99A 3CQGB 2D0TA 3F57A 1NV4A 4XFEA 5ABFA 2Z22A 2XY8B 4N15A 2ALUA 3PD8A 4DR3T 1LRZA 2X66A 2OBGA 5I58A 1EYIA 5CRYA 1IBLT 4IGTA 4JI1T 3PUVF 4E7ZA 2X7PA 3RYDA 4YU0A 3BIGA 2W00A 3KV6A 2DS9A 2FVZA 3ONMA 1D4NA 4OFZA 2CPTA 3ONLC 1XT8A 2K24A 4FAJA 3BBRA 3O1JA 3I1AA 3CWZB 1B4ZA 5L8DA 1ANFA 5M2VA 3PUYF 2V6YA 4DV2T 4R6YA 3RKOA 2THIA 1MY3A 4AS4A 1IJ6A 2I0CA 2WB5A 1LBCA 4LMKA 3VLVA 1R6ZA 3MVYA 3ZS6A 4LZ7A 4NG7A 4MCOA 4QWNB 5LB7B 4PE3A 1Y9UA 2CRBA 4GWOA 3LSLA 1M7KA 3EHZA 2HZLA 1YPNA 3ANWB 5I5PA 1NI9A 1J5ET 1H44A 4YSZA 3SETA 3FXQA 3MZ9A 4PETA 4X65T 3EF7A 4QRZA 2VVNA 4DR4T 2QS1A 2B4LA 4E0WA 1LAGE 3ZKLA 3HKEE 4YMBA 3E4RA 2XQ5A 4K3FA 3OO9A 4ONYA 2AL5A 1EZPA 4QHOA 3RKGA 4OHFA 3IORA 3IHRA 2ZM8A 4LA9A 2DCFA 2PT1A 1IBMT 1Z8UA 4IO7A 3VVFA 1B05A 4PGNA 3E79A 2I0MA 2J4GA 3HHFA 2CXDA 5L9MA 5LHHB 2X67A 5ABHA 2Q9QC 5BMVE 4ESXA 4LF4T 4PK4A 4OVRA 5JQGE 3NKZA 3AE3A 4G4PA 2ES0A 4LF8T 2ONSA 5LYJE 2HXRA 5H8HB 2E9XB 3SEUA 4IO4A 1LSTA 4ZOLE 2ZZWA 4LZ5A 2ZLYA 4HFVA 1MPCA 4MBPA 4M4GA 4YAHX 2NWBA 5B7DA 2FJBA 3UORA 5AQPB 5LOMA 2K3WA 4X1KE 2Y7WA 1FJ6A 3UA8A 3SFDA 4UA8A 3THIA 3RT8A 3D4CA 2XTLA 3C4MA 2HAVA 4IE5A 4IL4A 2IC6A 3AA0B 1TFDA 1H7CA 2R8TA 3AXJB 2DDKA 2MOZA 3SRZA 4N6DA 2CHNA 5BUUA 2HN2A 3C34A 5FBPA 2WWUA 3QSLA 2E1SA 2JQ9A 1Q35A 5LBMA 1SW5A 3C64A 2GK9A 5LHIB 5FTHA 3TCGA 1SW4A 4BDMA 4NF4B 2XUEA 4NE4A 4GXAA 2P3VA 3MKDA 2VURA 5HWXA 1DCUA 4LFCT 4DZ1A 2NW7A 4QX7B 4THIA 2RF1A 4GF8A 2XSAA 2OWTA 5ET6A 4LATA 2O7UA 3T9VA 4O2BE 5JDGA 5F24A 1NMUA 4EEBA 2CMOA 3FBZA 5FVLA 1YZ0A 3ISPA 2BG9E 2WMNA 1IMDA 2QL3A 1FPBA 5DYHA 1NH7A 2LM2A 2YDSA 3U94A 1CNQA 1O7TA 5CM6A 3OENA 2W0GA 4DR5T 4HFCA 4H67A 1WVJA 5AA1A 3TTRA 4I0UA 1MH3A 3SKPA 2W2UA 3HKCE 5TPAA 1ZOYA 5HCJA 3C51A 1URDA 4ELPA 2BS4A 2HHHT 4FECA 2AYSA 1D9QA 3TUSA 4EEDA 1KNRA 3UUBA 3ZYLA 3CQXC 4U74A 3LK3B 1DK4A 4LFAT 4IT4A 5JDLA 3AAIA 1MXUA 1ZEEA 4PK5A 1LCTA 1Q9DA 4HE2A 4JWYA 4IREA 1DTGA 4UV9B 5AA4A 3N94A 2PX1A 3G3KA 3TELA 4EXTA 1QULA 4OYKA 4ZDMA 3RT6B 4O3BA 2V7JA 3CFXA 4I55E 3HKBE 4ISSA 1US5A 3O1HA 1NV7A 2FNCA 4UF0B 1QJMA 4O4JE 4BAYB 3IOWA 3RPWA 5LNKA 1I6ZA 4H0WA 3BFUA 4DCXA 4UR9A 3N9OA 4NWCA 2KNDA 4XXUA 4DBQA 4KPTA 4ZI7E 3Q5WA 4G77A 5F7VA 1E1HB 5I2NB 3LBXB 2UVHA 3CR9A 2YN6A 3PPNA 4HCYA 4YJ2E 3TKLB 2XZEA 2YPNA 3RGLA 2V25A 3PTRB 2OJTA 2WCAA 3ZT5A 5IWAT 3FZMB 4GWUA 2KINB 3QUJA 5AQGB 1MMNA 1MXYA 4YXDA 4EOZB 5LHGB 1IXCA 1QUUA 5LGNB 2H99A 3M3FA 1FIOA 5AQHB 3RLFF 1EYJA 3MAMA 2O7IA 1LB8A 5JTYB 3ZMTB 2CBJA 4L9IA 2WDRA 3J7Yq 3RHWA 3KBTA 4HE1A 4B6XA 5CA1E 4GYSA 4JSDA 5AQLB 2DWKA 4NF6A 1VRBA 3RIUA 2NXOA 4FORA 4RY1A 3MWBA 3Q27A 3TCHA 4BDLA 2VPOA 2ZZVA 4GD5A 3QB5K 4GBVA 4O7IA 1HX1B 4HN9A 3ZYMA 4KCCA 1B40A 3ZC1A 1Q1KA 3T9XB 3CIJA 4PQJA 2IIUA 4XTCQ 4BDRA 2RKMA 1CE2A 1HF8A 1D0ZA 4GL0A 4HWFA 1CUNA 3TLUA 3FJMA 4ERRA 1Y1ZA 2CZHA 4N91A 4ILBA 3SEXA 5I7IA 4DV1T 3ABVA 2D5WA 4TNWA 4I62A 4NEDA 4FI5A 4LMLA 3Q5XA 4PFRA 1IMAA 5IHYA 3TTNA 1POTA 2O6AA 4WBNE 4DIGA 2LRKA 2CCQA 2X9YA 2GHAA 3E78A 2UYFA 2Z8FA 2HEUA 4X48A 3CHGA 3PJAJ 1XDPA 5DT6A 1YXRA 4MJOA 4DE8A 4PJJA 4TNVA 4QFOA 1LFGA 3M3KA 4NF5B 1QUKA 2Q2CA 2IAKA 2WU2A 4WEPA 4CN6A 5A5XA 2NR4A 4R2BA 5EYFA 2PMSA 2IC9A 2CEYA 1P1NA 1KWHA 2A5TB 1IIWA 1MY1A 1OQGA 3O97A 4N6KA 3OPCA 4O8SA 2NWJA 2WQYA 3Q25A 3G3FA 4GYRA 3D1RA 5AQSB 3H3GA 4TX5A 1B32A 2AIXA 2O1MA 2DP8A 4U72A 4JV5T 5K2YA 2VT5A 1QUJA 4OVJA 3K1NA 2IW5B 3DP6A 3K3NA 3N9PA 5H8FA 5HXCA 3O29A 5FNVE 3VLWA 1U5PA 4PE5B 2RP4A 4POWA 3LSVA 4XKQA 1E7PA 2YU2A 3N9QA 3KSXA 4IDOA 4F39A 5FY1A 1VFEA 1FEWA 1NL5A 4HW8A 4H9OC 4GIWA 5I59B 5JRCA 1JEUA 3L8RA 4HEAA 3IO6A 5IZ1A 5LMUT 1FBDA 4A97A 1NUZA 4CXYA 3EHTA 4G8MA 5DW8A 4HWIB 4UVAB 4KHPT 4MNIA 4DV3T 2Y7RA 4U4SA 2CLYB 2K48A 2LSJA 5FKYA 4F1YA 4HE0A 3H6TA 1M5EA 4F1UA 3VE1B 4CZZB 2EHOC 1JEVA 3LSFB 5EQAA 4UXNB 1JVXA 5I3SA 1D9VA 2WDVA 2DOJA 3T1YT 5HEGA 4YY3T 3PD9A 4F1VA 3R26A 1YW0A 2MKZA 3NRXA 3UU3A 5JREA 5ET8A 2VWAA 1HFAA 1K9ZA 2YDQA 4DXUA 1LBXA 2W4XA 5DEXA 2A5SA 3H37A 2R6GE 2P9BA 3OD7A 1PB9A 3IFAA 2I3WA 5B70A 4CI2B 1EYKA 3A8YC 4ZZCA 1IMEA 4Q30B 3GBAA 3OVUA 1VOMA 5JDFA 2I3VA 2REGA 4IGRA 2PFYA 3MSTA 3RY3A 3ZSSA 2H89A 4X1IE 5IZ3B 3X1DA 2GFEA 1FPJA 4JI5T 3G3GA 1N04A 2ZNSA 4H9PC 3W15C 3EDUA 1LFHA 2XASB 4HFHA 1B4HA 1XVXA 1B7UA 1N0TA 3B8BA 3CKDA 3LUYA 2HH7A 5KCJB 4NUUA 1LVFA 3IBPA 1HX8A 4QFKA 3AE4A 4JI4T 4F3BA 3AAAB 5LJNA 5EZYE 5ELVA 4KD5A 2JQQA 2C5JA 3D4GA 3FVKA 4DXCA 1OLAA 4YSXA 3WAJA 4H1XA 3UU8A 1OEDC 2HN1A 1H43A 2WYKA 2FJEA 3KGCA 2VKOA 2QGSA 2RC7A 3I5OA 1RYOA 1QLBA 3OTOT 1TXFA 3EPEA 3T96B 3DLNA 2M6BA 4HFEA 2XAFB 2BVLA 3AA6B 3PUXF 4ISUA 2LJLA 2CWYA 2NOXA 2XXHA 2Q9TA 3B6TA 4IO2A 4PFOA 5GONE 1Y3NA 3AECA 4P0BA 5L4EA 2W66A 1FBHA 2RCBA 4QFLA 2ACZA 2PT2A 4LONB 3SEWA 5J16A 2JPFA 3IL1B 2Y6XA 1FBFA 1SBPA 2F3DA 3FJGA 1PC3A 2LOPA 4GOUA 5FHMA 2H4IA 4OVPA 4JI0T 5HWYA 1B51A 5CMCA 4IDPA 5CJ5A 4M1VA 3LJCA 5KDMC 1JW5A 4WEDA 4RYAA 3TPAA 1EZ3A 3PURA 3MW0A 5EHMA 5ESYA 3CG3A 4U22A 5H8SA 4B3MT 4BDNA 3ZLIA 3T1HT 1RKMA 3VLUA 5A1LA 5H8QB 4H9RC 1B7TA 2OLBA 5CFBA 3S2VA 1UGOA 3UGWA 2AE9A 3RPLA 5F1QA 2XXQA 1Y20A 4NX1A 4KHZE 4Z91A 1NUWA 4H8IA 5LG4A 1PBPA 1L5TA 4U7YA 3ZKKA 1A54A 1B2HA 2IEEA 2QRXA 4LMJA 2X9WA 4OK0A 5L3BB 4P1EA 4U23A 2LSGA 1AOVA 2FYIA 2D3IA 5AQUB 1OLCA 2XQ7A 4CN4A 1B3LA 1RDZA 2E8IA 4H6DA 4TLMB 1EZOA 2ZMAA 1A7LA 4ZZAA 5L2LA 2KXPB 3VR8A 3AEFA 1NAFA 1TFAA 3OYXA 5AQVB 2XWKA 2KQZA 2QJEA 2VASA 4DR1T 1BR2A 4QXCB 3RRWA 3RYIE 4PJMA 5LJMA 3JADA 3QXMA 2ZMBA 3C35A 2FHYA 5T3JA 2F7AA 4OANA 1MS7A 1VR5A 2UXCT 2D2SA 4MF3A 2NVUB 4HGAA 1BR1A 1R1NA 3BQKA 4DIDB 3UIFA 1R9LA 4PFUA 2ZYNA 2X68A 4X8RA 3V5AA 1FPDA 3WAEA 4ZE9A 5DVIA 3DP7A 3O6HA 2ZZXA 4LQ2A 4GXSB 4DXBA 5AE4A 4ZE8A 3HR0A 2CXFA 3O1IA 3MK7C 3TODA 4X20E 3EN3A 4NAPA 5L3FB 1DOTA 5TP9A 4PDDA 4F22A 2XWOA 1QUIA 3F31A 4NXMT 4KCDA 1N3XA 3S9MC 4YKPA 3KN8A 4GK5E 4F31B 3PUWE 4E7SA 1UTHA 2X26A 3O9XA 4L17A 1UURA 1MY2A 3ECRA 4I1DA 3W9WA 1MNDA 1B5JA 1FPEA 1IXIA 3T9HB 1PDAA 4WYVA 2ONRA 5HEUA 5HPQA 1LBYA 3S9EA 2REJA 3O28A 4JI3T 4DLDA 4ZI2D 1DMBA 1WYBA 1FPIA 5JR9A 3DP4A 3TQWA 2KT9A 4HXVA 3G7WA 1HTJF 3VKHA 3V83A 4L0RA 4GIZA 1YCJA 3NBXX 5JDMA 2Q9QB 5CGMA 2VL8A 5L47A 3MVWA 2W67A 1ZIUA 4H5GA 4AQFA 4O4LE 2FBPA 1XDOA 2W63A 4I40A 3UQ7A 2X0LB 2OA5A 3F2EA 3K02A 5KDTA 3U93A 5I58B 1F9BA 4TWFA 3KV5A 1D0YA 3RRCA 3C33A 3SEYA 2UXBT 3KZGA 3VFJA 1URGA 1AJ3A 4OFJA 4OYJA 5LDZA 4RXLA 4P3LA 1FW0A 3MXZA 2YEVC 5FVKA 1SUMB 4G61A 3PU5A 4ZXLA 2DSFA 3T66A 2DLRA 2LEHA 2FBWA 2V7IA 4G63A 3OELA 3TTMA 3NOHA 4EAHA 5DVFA 4PAFA 3OO6A 3PMWA 4GWSA 3TLTA 3V89B 4KYDA 3WAFA 2HCAA 1N76A 2AXDS 3JAEA 5CBSA 3ODBA 1I6BA 3DTOA 5IAIA 1VSOA 4KXPA 4Z8XA 3O6IA 4DR6T 4X04A 4IGUA 5ADXL 1JP4A 2V3UA 2DE2A 1S50A 3KOSA 1FJGT 3UUMA 4U4XA 3VKGA 2WAUA 1B5IA 4ILUA 1SYHA 4XKPA 3ZKRA 4BDQA 2BJIA 1LB9A 3H03A 2VKHA 1NV3A 5BWJA 3TKDA 3TLVA 3H6UA 4N8YA 4EB6E 3HL6A 4RK2A 3LSWA 4FEDA 3KV4A 4QH4A 4Z7EA 2R6GF 2LKHA 4F19A 3GN5B 4X64T 2L8KA 2WU5A 5JR9C 2XHEB 1M62A 3ANWA 3EHSA 4O94A 2LSKA 4YMAA 3C31A 1MIVA 1SYIA 4Z0IA 4EZHA 4AQFC 2XD3A 4AKLA 1HCIA 3JYRA 4PFWA 4PBQA 4ILCA 5C3JA 1N36T 1FBPA 1M5FA 3PGFA 4OERA 1ZKBA 2HXWA 3BKIB 4GBWA 1HNXT 3L3PA 3OJAA 4P0IA 3QOFA 2XM1A 4TQUQ 5JK4A 4OMBA 4GX3A 4NUVA 3FATA 1LAFE 4YHHT 3VXBA 2C5KT 4P56A 1Y4TA 1OVBA 4EF1A 1IITA 3PE0A 2XWVA 4RJZA 4U3CA 4AB6A 3UT5E 2XAHB 3KV9A 4DO0A 5ETWA 2DWGA 2WBBA 3O4XE 1SA0E 3HV1A 3Q2MA 5I2KB 3T8OA 4GWZA 4F3PA 4X62T 4JWOA 1Z7NE 4IIJE 2YKSA 2QMXA 4DR7T 1MQHA 5AA2B 2YU1A 3KN3A 5IM2A 4N6PA 4R9GA 1NV0A 3OO7A 3FHNA 3FXBA 4MLVA 2FIXA 3H7MA 1WLXA 1OEDE 3H3AA 4OEVA 4F29A 5HEJA 3P8CD 1B3GA 3RC3A 4RPNA 3P4RA 1PB7A 3CIRA 4C90A 4MAGA 3P50A 5CC2A 1XWMA 4WXJA 2W7YA 1N34T 2WKYA 5DVJA 2LSYA 3NVOA 3KINB 4WBOA 4NF4A 2Z8DA 1D1AA 3AE5A 3EDVA 4NTLA 4COFA 3KJ7A 2PJQA 4IO6A 3FJ7A 4H63H 3KBRA 1AH5A 4B3TT 3KDSE 3CMLA 5I56B 5AQMB 1LBWA 4ZEBA 2LHNA 4HWCA 1JW1A 2KR0A 3USDA 3T93B 4KHZF 2ABHA 5LMNT 4GKJT 1B52A 2V6XA 2W62A 2YOEA 4MH5A 1V9DA 2Z6EA 3JC6C 2M6IA 4JI7T 4RK9A 5AA4B 3ETVA 4CXWA 4XEQA 5A5LA 2V4CA 3K3OA 4Q25A 2ZM6T 1QKAA 1M5DA 2ZM0A 1E2AA 2M67A 4CXXA 4QFPA 4DI4B 4GQOA 3CVGA 1NUYA 1W0AA 2WEFA 3MBPA 4TOZA 3K1PA 5FMNA 3I6VA 4AB5A 1Y3QA 4GOTA 4C91A 2WSSV 4GRKA 3TLWA 2MAWA 3ZCJA 3RUMA 5BR8T 1S35A 4YTNA 3AEEA 3LSXA 3ONJA 2YJPA 3IJXB 1MXWA 3MJXA 1L0VA 4X5TA 2F8DA 5IZZA 4IY6A 3AA1B 3JCFA 4PK6A 4JYAT 4GFRA 3U65A 1FQDA 3VVDA 3Q9DA 1A40A 3UU6A 3PMXA 1R9QA 2DWIA 2CMRA 3UQ4A 3ZPOA 1QW0A 2I59A 4IB2A 2MYSA 3G06A 2F3BA 4NF8B 3WI3A 4BJNA 2XXXA 4Z90A 5KZTA 4DV7T 1MIWA 4EGWA 2WMOA 3PPOA 2UUAT 2I49A 2XHDA 3UN6A 2FA7A 5I2NA 3PU8A 4YJ3E 1BR0A 3LBXA 5HM4B 3PUWF 3IB2A 2D21A 4ZI3D 2JRKA 4EV6A 1NNPA 1FQCA 1SD3A 4DV0T 3AEBA 4PJNA 3HFUA 5ITPA 1H3DA 3ZJ2A 3CSBA 4DV4T 2XD2A 1WRDA 3U1OA 3LDQB 3PUSA 4PP0A 4XKRA 2QS2A 4OVTA 2CEAA 3LFMA 1Y64B 1FBEA 5AQRB 4ZEFA 3FVNA 5LXTE 2F7BA 5AQNB 5J2TE 5JTYA 2WM9A 1GV8A 4TWDA 2CZKA 3DELB 1ATGA 1VE4A 2I6HA 4X66T 4YHJA 1H45A 2H3RA 2NW9A 1M5CA 2QVAA 3RH3A 1USYE 2E9XD 5L3CB 2EHOB 4HTGA 2RA1A 2IA4A 3OEKA 1EZ9A 3GWHA 3CX8B 5CMKA 1IMBA 1XNRT 4QHQA 3E08A 1INPA 1IJ5A 2V7LA 5JVDE 2J1DG 4AXPA 1B0LA 3EHUA 2LAOA 1WR6A 1LKXA 2DVCA 1TWYA 4MFIA 2P3NA 2XQAA 4N4UA 4EQBA 2V7KA 1MQGA 4R72A 2V5CA 2ZYMA 3I0OA 3TTKA 4M1PA 2X0YA 2ANJA 5CB4E 5J1GA 4OX9T 1BP5A 3L39A 3BQLA 1NNTA 1YAEA 2UXNB 2DE4A 3FZLB 3W15B 2WYPA 3AVSA 4HS7A 2IMLA 4PFPA 2Q88A 1NWMX 2VVSA 1PEBA 4GVOA 2I4BA 3AA7B
chains in the Genus database with same CATH topology
3LK42 2D0UA 4FJPA 4YLHA 3UUXB 4ZZEA 1J1NA 2GH9A 5CI5A 3PUZE 4YKJA 2XXPA 4HTEA 1OWAA 1UTBB 3QIMA 2H9BA 2X51A 1YKHB 1ZMGA 3R84B 1MM7A 2XXRA 1WYCA 1T98A 2Q8JA 1JW4A 3CRBA 2SPCA 3N2GE 3RYHE 3E22E 5J1DA 1DTZA 3PUVE 5I57B 3TCFA 3K3QC 1XS5A 2CM0A 1OXZA 3T22A 2A72A 1MQIA 3DP8A 4ANJA 1IEJA 1NFTA 3KJTA 3SDFA 2XAJB 1MNEA 1B3FA 2V93A 3PUYE 5L3GB 1B3EA 4EYUA 1WDNA 5H8NB 4PFYA 5I59A 1HG2A 1ZU0A 2O68A 1MDQA 5H6RB 3R7XA 5L3EB 5JDQA 5L9SA 4LUBA 4I43B 3DM0A 1I69A 2MBGA 4P09A 4F3SA 1M5BA 5FY7A 2A2FX 2C5IT 3K01A 3H6WA 4BDOA 3NZPA 2UXXB 3VV5A 4H63V 1LAXA 1B7HA 3MZBA 4O3AA 4KUMB 4I50E 1XC1A 1Z0PA 4QSEA 2I0BA 3FGSA 1CB6A 5EK2A 4RPOA 4ZECA 3RC8A 2DI4A 2NP9A 4CI3B 4ZEKA 3UUNA 2PFVA 4G8NA 4QF9A 5TU0A 2XXIA 1LCFA 2PBWA 4EUOA 4TV8E 2B65A 4LQ5A 1FMWA 4QKNA 4DMWA 1KK7A 3TFLA 1HS7A 1USYH 4R2FA 3ZMVB 1FCKA 4OTEA 3FIRA 1SW1A 5FHNA 5KCJA 2VD3A 1I6QA 4FEBA 3KN7A 1LGBC 3FV1A 4FIMA 3UTKA 3O6GA 5I84A 3HPIA 3OKQA 3FASA 4ELRA 2Y7IA 4MBQA 1YD8G 2XXWA 2UVIA 4XKNA 1FQAA 3O2AA 3MPKA 3RGYA 3P7IA 3TEPA 3MP6A 2RC8A 5ISUA 4IE7A 4KBMB 4MLKA 2XAQB 1MY0A 1S94A 3B13A 3AAEB 3TZAA 4UIGA 4WKMA 2JJ9A 1LBBA 3KVBA 1B7ZA 4IO5A 3BK9A 3J9X1 5CMMA 2JMKA 3CG1A 2JMHA 2LHRA 3LK2B 3NRYA 1HG5A 3SOLA 2ONKE 5LP6E 3R6UA 4MFRA 5DQWA 3C9HA 4U1OA 3S9NC 4KFQA 4ZI2C 5HXHA 3N2KE 2GRVA 4GLIA 2DXRA 5H8QA 3QC9A 3ZJ1A 2Y84A 3L6GA 4O3CA 3VVEA 2HPLA 3UK4A 1IXGA 3MUQA 4HKAA 3MVZA 3RYFE 4PFTA 2CE7A 5ICTA 5LBQB 4GK0E 1BLFA 4C1TA 4ADZA 3MPLA 4RNSA 2P0SA 2DHRA 4WNKA 4AQ4A 3OSQA 3ZEFB 3RTFB 4ZS3A 5LGTB 1LLSA 5TAOA 4YZZA 3ONXA 4BA9A 3Q29A 1D3KA 1P99A 4CQIA 4POXA 5JDHA 4ZEDA 1UIVA 1BR4A 3C4XA 5KX5E 4JUYA 5J2UE 3ZSFA 2F36A 3Q26A 3PUGA 4QXHB 1QSDA 5EK3A 1ZHCA 4IDZA 1SI0A 1B6HA 4UELA 3CX6B 2ZYKA 3PUAA 2ACXA 5FXXA 2PVUA 1ZKEA 2RINA 4UVBB 4F6RC 3GLBA 2XQYA 3QUFA 4ISTA 4F2OA 2Y7PA 4O2AE 2ODUA 3I0QA 3E0ZA 3QK6A 3MP8A 2XAGB 3TQLA 3OOAA 2H98A 3A09A 4XIGQ 3K0VA 2F6PA 2BVMA 2I4CA 1N7WA 4YB5A 2B3FA 3OBVE 2QA7A 5JH7E 4NMYA 5ICQA 2O84X 5FXWA 1LAHE 1US7B 3HKDE 2F6GA 5FYMA 3OXNA 4G8HA 4OZ9A 4NWDA 3KOTA 2XXTA 1YKEB 2V3TA 4G68A 3AXFA 4Q5TA 3AB3B 1IZNB 1AIVA 4KI0E 1EH3A 1WODA 3G3JA 4Q0CA 2Q9QA 3MQ9A 1RYXA 3I3VA 3IF8B 2AL4A 2X7QA 1FTJA 2MTQA 3U3IA 1IZ1A 3W9VA 1MQJA 4PJLA 4OENA 4A56A 2K9AA 3M65A 4IHJE 5IKBA 3O66A 3NZQA 2KWHA 4OFOA 1PBQA 2UVGA 2BZBA 2H7OA 3CFLA 1GVCA 3RN8A 4KYSA 4IE0A 4G2ZA 3FVOA 3C4ZA 2I48A 4QFNA 5HAXA 2K5BB 3HCQA 3OYZA 3K2DA 1UX4A 2CA5A 2M8CA 1SDXA 2DYXA 4UV8B 4OYVA 3CFZA 4EZ4A 1IUDA 3G3HA 4N07A 4C0RA 5L3DB 2RCAA 2ZM2A 4R9FA 4BLAA 2V26A 1B1XA 1FTKA 3FZVA 4RA1A 3H6VA 1AL3A 1SI1A 2G29A 4EQ9A 2XX9A 3N6UA 1URSA 3RYCE 4I8CA 3AVRA 2H25A 3HHGA 1S9TA 2XX7A 4YICA 3IB1A 4N78D 4FATA 2DNXA 3ZMSB 3B6QA 3GN5A 3A3CA 4R74A 3CVRA 4N13A 4G68C 2QSXA 2QS3A 3H4ZA 4OESA 4AKRB 3A3UA 5K2XA 3OO8A 3FD3A 3OEMA 3D0TA 1DPPA 5FXVA 2PBIA 1EU8A 1FQBA 3FXEB 3LBSA 3KVAA 2F34A 4JXIA 2D5UA 5H8HA 2E9XA 3RNNA 2VGQA 3KFWX 5L9OA 5FP3A 2UXAA 4HE8A 1NNKA 3MA9A 1MPBA 3IJOB 1XVYA 3N5LA 1XOCA 2ESNA 3VDFA 1US4A 2N2NA 3VHLA 4YKKA 3KFMA 3IX1A 3B6WA 5F8PA 3N26A 5I2KA 2I58A 2KWIB 4KQPA 1G73A 2PG8A 1BIYA 5CBRA 4P0AA 3QAXA 5AA2A 3E13X 1P1UA 2NW8A 5TPAB 3BFTA 3IEEA 1NH8A 3GXAA 4EF2A 4FE8A 2Y7KA 4ZI3C 3CX7B 3MZ1A 2B1EA 4UACA 3I9YA 1MY4A 4X1YE 3MC2A 3RPUA 3PPRA 4BJMA 1MRPA 1X79A 2Q9QD 1Y1MA 3PV0E 3CSGA 2DQVA 3ETUA 2V3QA 4KYEA 4MLQA 2HAUA 1O63A 3IR1A 4EQ7A 2I6EA 3I9WA 3PUXE 3FUZA 4QSCA 5I56A 3KEIA 3UP9A 4R75A 1JVYA 3K8PC 1NNFA 2KMFA 2LSIA 3A5XA 1A55A 2QS4A 4FJOA 4ZEIA 3PUQA 5HXEA 5AFUL 1SVXB 2E9XC 1QKBA 1B46A 3FBLA 1MMDA 3HI2A 4U21A 3GBBA 3HN0A 5FHOA 3U8QA 1UQWA 1HSJA 1MQDA 4UF0A 3U72A 1TT1A 1BTJA 3ZN1B 3Q28A 3PPQA 2VD2A 5HYAA 1MG1A 2WBLA 1MMGA 5DTBA 1IXHA 3C32A 4R6HA 2UVJA 3HA4A 2LM9A 5CA0E 5M4YA 1O64A 3FXRA 1PB8A 5FTIA 4XAXB 3E3KA 4TUYE 4OETA 4TZ4C 4V1Av 1S7YA 4NF6B 4I4TE 3RX6A 4NF8A 4U1ZA 1B9JA 2VB6A 4HCWA 1UCUA 1B1HA 1ZLQA 5C8YE 4OEUA 5EK4A 2Y8DA 2CZLA 4QX8B 1OIBA 3IAZA 2DWAA 4OQOA 2OCUA 3MJNA 1Z7ME 2LT3A 5LGUB 1KNZA 4X1BA 3T9UA 2HPJA 4ECFA 2V1DB 3V5SA 3KBUA 3PPPA 3JC6D 1N84A 3M3LA 3U92A 3FXDB 2VK9A 2N1GA 1JETA 2CWOA 3CPZA 4IO3A 1P1QA 4AKHA 4JBZA 2VOZA 2XXVA 4P0GA 3SESA 1FQFA 4QXBB 2H7VC 1SW2A 2VKJA 4EDPA 4Q8RA 2O1LA 1FMVA 3IK6B 5IYZE 4YB6A 2EHOA 3M8UA 5A5XB 1HSEA 1O3XA 4IE4A 4MALA 5HBCA 5AA2D 3RTWB 4TN7B 3S4UA 2R9JA 2NOOA 3MZKB 4CI1B 2X9HA 3B7DA 1D1BA 2YK0A 3L09A 3IOVA 1MMAA 3WAKA 5H8FB 2L9QA 4YFSA 4NF5A 1P1WA 3CI8A 3FB2A 2F5XA 4GL8A 3K6UA 4DCYA 3MACA 1UIUA 2VKDA 4H9SE 2A5TA 5FXZA 5JRCB 2Q2AA 2P2AA 3TYHA 4AKGA 3ILTB 1G8XA 2NTYA 3SS1A 3TDJA 1B3HA 3SERA 2GHBA 3ZYKA 4QSDA 2QRYA 1D1CA 2LE8A 2PYYA 2Z8EA 1UTBA 4WW0A 3ZMUB 3GZGA 5HXRA 2YLNA 5HXSA 1QVSA 1FQEA 3GA8A 3ZMZB 4OFLA 4IY5A 1B5HA 3U78A 2A3DA 5I57A 2KLQA 5DEXB 4EXLA 3C50A 3IOTA 4O4IE 1B0HA 3C4WA 3VU7H 3C36A 2P1SA 3JZJA 1ZV4X 4R73A 4H9NC 4DMVA 4LP2B 3K00A 3MP1A 4JEUB 3EVYA 5EHSA 3K6WA 5H8NA 2R71A 2CXLA 4OHNA 4I9DA 4ELQA 4DDDA 4H65A 4ND9A 4YKIA 2BDEA 4JWXA 2XXUA 2Z23A 2QMWA 1IQ7A 2X9XA 3OSRA 2O51A 3V5UA 3JV9A 3UFEA 3ESLA 1FTLA 3E9XA 4R6KA 1BKAA 3HO7A 5DQVA 3K6VA 1P1OA 2W61A 5LCYA 2UYEA 4JB7A 4U2RA 2Y48B 1XHYA 4EYYR 2V84A 5ITOA 3HSTA 1D0XA 4X9TA 4ASKA 4F3GA 1IAPA 3DJBA 1GGGA 1N3WA 3N6TA 1NKXA 3S9LC 4ZS9A 1POY1 3N9LA 1SQYA 1D9YA 3PDYA 1B58A 3K1MA 3IOUA 1GR2A 2ZYOA 4MHCA 1II5A 4XZCA 3PMVA 1MXZA 3TTLA 2OK2A 3VXCA 4C1UA 1MIYA 2XX8A 3ILUB 4F18A 2F97A 2LOSA 4KP3C 3MVXA 4ESWA 2G0UA 2EHOD 3F11A 4KMCA 3R6NA 2OZZA 3IB0A 3KSJA 3KG2A 2F35A 2YINA 2CLYC 1FTOA 1JQFA 4E0XA 1Y3PA 2F7CA 2OWSA 5JDNA 1Y4CA 4KR5A 1MPDA 1HSLA 3CQCB 4XBFB 1DPEA 1ZJLA 3BQIA 2Q89A 2ZNUA 3N9NA 2DWHA 4H5FA 3H06B 3FVGA 3IO4A 5F3JA 2ZXTA 2RC9A 2L3LA 4EIWA 1SHZC 4J2CA 1H76A 3SEVA 2QPQA 4DVDA 2DXYA 4H9QC 3UULA 1MM6A 5CMBA 4JLEA 4LVQA 4PNIA 2ODVA 5DJQC 4K0UA 1JNFA 1OQHA 3C98B 1ELJA 2G93A 5KMGP 2VHAA 2NTXA 2H5YA 3ZCIA 4LZ8A 4EXKA 4OWDA 2KLFA 5E0OA 1LFIA 4O4HE 3N2OA 1AMFA 1GTKA 4OXVA 4TLLB 2HFBA 5AA3A 4G2AA 3QYTA 4UVCB 1T0KA 3LG7A 1DSNA 3LR1A 4AQGA 3ZC0A 2N9DA 4ZS2A 3RQTA 5LOVE 3K6XA 3L6HA 1MH4A 1YTVA 5LA6E 3ZN0B 3FXUA 5TP9B 1MXXA 1LVKA 1U4QA 5JEIA 2DWJA 2C0SA 1UTHB 2B3BA 2HZKA 1ZBMA 4TV9E 3FV2A 2VP1A 4IE6A 3V8XB 3SWHA 1I6AA 4X1DA 4JDFA 4ELOA 1OMPA 3N9MA 3TMGA 2V7MA 4JSOA 1UX5A 4PW8A 2BJJX 5JR9B 4ZHQE 3B57A 1FTMA 2NUVA 3RLFE 2DVZA 1N7XA 2HQ0A 3EQ1A 4JEHB 2KZ7B 3PU3A 5H6QB 2E0SA 2F78A 3O9PA 4L5GA 5KDTB 3EUHA 3G3IA 3K4UA 1A8FA 4P11A 3TAJA 4DBRA 4AI6A 2O69A 5FY0A 1MXVA 1MDP1 1OVTA 1ZTYA 4AKIA 4F2QA 4G68B 4UEMA 4YB7A 1VFDA 2ZNTA 4DNDA 4H8JA 2XXYA 3OMBA 3GMIA 2DE3A 1A8EA 3LC8A 5DABA 4PAGA 1A99A 3CQGB 2D0TA 3F57A 2Z22A 2ALUA 3PD8A 1LRZA 2X66A 2OBGA 5I58A 5CRYA 4IGTA 4E7ZA 2X7PA 4YU0A 2W00A 3KV6A 2DS9A 3ONMA 1D4NA 4OFZA 4FAJA 1XT8A 2K24A 3BBRA 3O1JA 3I1AA 3CWZB 1B4ZA 5L8DA 1ANFA 5M2VA 4R6YA 3RKOA 2THIA 1MY3A 1IJ6A 2I0CA 1LBCA 3VLVA 1R6ZA 3MVYA 3ZS6A 4LZ7A 4QWNB 1Y9UA 4GWOA 3LSLA 2HZLA 1YPNA 3ANWB 1H44A 3SETA 3FXQA 3MZ9A 4PETA 3EF7A 4QRZA 2QS1A 4E0WA 1LAGE 3ZKLA 3HKEE 4YMBA 3E4RA 4K3FA 3OO9A 4ONYA 2AL5A 1EZPA 4QHOA 3IORA 4OHFA 3IHRA 2ZM8A 4LA9A 2DCFA 2PT1A 3VVFA 4IO7A 1B05A 3HHFA 2CXDA 5L9MA 5LHHB 2X67A 2Q9QC 5BMVE 4ESXA 4PK4A 5JQGE 4G4PA 2ES0A 2ONSA 5LYJE 5H8HB 2E9XB 3SEUA 4IO4A 1LSTA 4ZOLE 4LZ5A 2ZLYA 4HFVA 1MPCA 4MBPA 4M4GA 4YAHX 2NWBA 5B7DA 3UORA 5LOMA 4X1KE 2Y7WA 3UA8A 4UA8A 3THIA 3RT8A 3D4CA 2XTLA 3C4MA 2HAVA 4IE5A 2IC6A 3AA0B 1TFDA 1H7CA 2MOZA 3SRZA 5BUUA 3C34A 2WWUA 3QSLA 2E1SA 1Q35A 5LBMA 1SW5A 3C64A 2GK9A 5LHIB 5FTHA 3TCGA 1SW4A 4BDMA 4NF4B 2XUEA 4NE4A 4GXAA 3MKDA 5HWXA 4DZ1A 2NW7A 4QX7B 4THIA 2RF1A 4GF8A 2OWTA 4LATA 2O7UA 3T9VA 4O2BE 5JDGA 1NMUA 2CMOA 3FBZA 2WMNA 2QL3A 5DYHA 1NH7A 3U94A 1O7TA 5CM6A 3OENA 2W0GA 4H67A 1WVJA 5AA1A 3TTRA 1MH3A 3SKPA 3HKCE 5TPAA 3C51A 1URDA 4ELPA 4FECA 2AYSA 3TUSA 3ZYLA 3CQXC 4U74A 3LK3B 5JDLA 3AAIA 1MXUA 1ZEEA 4PK5A 1LCTA 4JWYA 1DTGA 4UV9B 5AA4A 3N94A 2PX1A 3G3KA 3TELA 4EXTA 1QULA 4OYKA 4ZDMA 3RT6B 4O3BA 2V7JA 3CFXA 4I55E 3HKBE 4ISSA 1US5A 3O1HA 2FNCA 4UF0B 1QJMA 4O4JE 4BAYB 3IOWA 3RPWA 5LNKA 4H0WA 3BFUA 4DCXA 4NWCA 3N9OA 2KNDA 4XXUA 4DBQA 4KPTA 4ZI7E 3Q5WA 4G77A 5F7VA 1E1HB 5I2NB 3LBXB 2UVHA 3CR9A 3PPNA 4HCYA 4YJ2E 3TKLB 2YPNA 2V25A 3PTRB 2OJTA 2KINB 3QUJA 1MMNA 1MXYA 4EOZB 5LHGB 1IXCA 1QUUA 5LGNB 2H99A 3M3FA 1FIOA 3MAMA 2O7IA 1LB8A 5JTYB 3ZMTB 4L9IA 3J7Yq 3KBTA 4B6XA 5CA1E 4GYSA 4JSDA 2DWKA 4NF6A 1VRBA 2NXOA 4FORA 4RY1A 3MWBA 3Q27A 3TCHA 4BDLA 4GD5A 4HN9A 3ZYMA 4KCCA 1B40A 3ZC1A 1Q1KA 3T9XB 3CIJA 4PQJA 4XTCQ 4BDRA 2RKMA 1CE2A 1HF8A 1D0ZA 4GL0A 1CUNA 3FJMA 4ERRA 1Y1ZA 3SEXA 2D5WA 4I62A 4NEDA 4FI5A 3Q5XA 5IHYA 3TTNA 1POTA 2O6AA 4WBNE 4DIGA 2CCQA 2X9YA 2GHAA 2UYFA 2Z8FA 2HEUA 4X48A 5DT6A 4DE8A 4PJJA 4QFOA 1LFGA 3M3KA 4NF5B 1QUKA 2Q2CA 2IAKA 4WEPA 5A5XA 4R2BA 5EYFA 2PMSA 2IC9A 1P1NA 1KWHA 2A5TB 1IIWA 1MY1A 1OQGA 3O97A 4O8SA 2NWJA 3Q25A 3G3FA 4GYRA 3H3GA 4TX5A 1B32A 2O1MA 2AIXA 2DP8A 4U72A 5K2YA 1QUJA 4OVJA 3K1NA 2IW5B 3DP6A 3K3NA 3N9PA 5H8FA 5HXCA 3O29A 5FNVE 3VLWA 1U5PA 4PE5B 2RP4A 4POWA 4XKQA 2YU2A 3N9QA 3KSXA 4F39A 5FY1A 1VFEA 1FEWA 1NL5A 4HW8A 4H9OC 4GIWA 5I59B 5JRCA 1JEUA 4HEAA 3IO6A 4CXYA 3EHTA 4G8MA 4UVAB 2Y7RA 4U4SA 2CLYB 2K48A 2LSJA 4F1YA 3H6TA 1M5EA 4F1UA 3VE1B 4CZZB 2EHOC 1JEVA 3LSFB 4UXNB 1JVXA 1D9VA 2DOJA 3PD9A 4F1VA 3R26A 1YW0A 3NRXA 5JREA 2VWAA 1HFAA 4DXUA 5DEXA 2A5SA 3H37A 2R6GE 2P9BA 3OD7A 1PB9A 2I3WA 5B70A 4CI2B 4Q30B 3GBAA 1VOMA 5JDFA 2I3VA 2REGA 4IGRA 3RY3A 4X1IE 2GFEA 3G3GA 1N04A 2ZNSA 4H9PC 3W15C 3EDUA 1LFHA 2XASB 1B4HA 1XVXA 1B7UA 1N0TA 3CKDA 3LUYA 2HH7A 5KCJB 4NUUA 1LVFA 3IBPA 1HX8A 4QFKA 4F3BA 3AAAB 5EZYE 5LJNA 5ELVA 4KD5A 2JQQA 2C5JA 3D4GA 3FVKA 4DXCA 1OLAA 3WAJA 4H1XA 1H43A 3KGCA 2VKOA 2QGSA 2RC7A 3I5OA 1RYOA 1TXFA 3T96B 3EPEA 3DLNA 2XAFB 2BVLA 3AA6B 4ISUA 2LJLA 2CWYA 2NOXA 2XXHA 2Q9TA 3B6TA 4IO2A 4PFOA 5GONE 1Y3NA 4P0BA 2RCBA 4QFLA 2PT2A 4LONB 3SEWA 2JPFA 3IL1B 2Y6XA 1SBPA 3FJGA 1PC3A 2LOPA 4GOUA 5FHMA 2H4IA 5HWYA 1B51A 5CMCA 4M1VA 3LJCA 5KDMC 1JW5A 4WEDA 4RYAA 3TPAA 1EZ3A 3PURA 3MW0A 5EHMA 3CG3A 4U22A 5H8SA 4BDNA 3ZLIA 1RKMA 3VLUA 5A1LA 5H8QB 4H9RC 1B7TA 2OLBA 3S2VA 3UGWA 5F1QA 2XXQA 1Y20A 4KHZE 4H8IA 5LG4A 1PBPA 1L5TA 3ZKKA 1A54A 1B2HA 2IEEA 2X9WA 4OK0A 5L3BB 4U23A 2LSGA 1AOVA 2FYIA 2D3IA 1OLCA 1B3LA 2E8IA 4H6DA 4TLMB 1EZOA 2ZMAA 1A7LA 4ZZAA 5L2LA 2KXPB 1TFAA 1NAFA 3OYXA 2QJEA 2VASA 1BR2A 4QXCB 3RRWA 3RYIE 4PJMA 5LJMA 3QXMA 2ZMBA 3C35A 2F7AA 1MS7A 1VR5A 2D2SA 4MF3A 2NVUB 4HGAA 1BR1A 1R1NA 3BQKA 3UIFA 1R9LA 4PFUA 2ZYNA 2X68A 3V5AA 3WAEA 4ZE9A 5DVIA 3DP7A 3O6HA 4LQ2A 4GXSB 4DXBA 5AE4A 4ZE8A 3HR0A 2CXFA 3O1IA 3MK7C 3TODA 4X20E 3EN3A 5L3FB 1DOTA 5TP9A 4F22A 1QUIA 3F31A 4KCDA 1N3XA 3S9MC 4YKPA 3KN8A 4GK5E 4F31B 3PUWE 4E7SA 1UTHA 2X26A 3O9XA 4L17A 1MY2A 3ECRA 4I1DA 3W9WA 1MNDA 1B5JA 1IXIA 3T9HB 1PDAA 2ONRA 5HPQA 3S9EA 2REJA 3O28A 4DLDA 4ZI2D 1DMBA 1WYBA 5JR9A 3DP4A 3TQWA 2KT9A 3G7WA 1HTJF 3VKHA 3V83A 4L0RA 4GIZA 1YCJA 3NBXX 5JDMA 2Q9QB 2VL8A 3MVWA 4H5GA 1ZIUA 4AQFA 4O4LE 2W63A 2X0LB 2OA5A 3F2EA 3K02A 5KDTA 3U93A 5I58B 1F9BA 3KV5A 1D0YA 3RRCA 3C33A 3SEYA 3KZGA 3VFJA 1URGA 1AJ3A 4OFJA 4OYJA 4RXLA 1FW0A 3MXZA 2YEVC 3PU5A 2DSFA 3T66A 2DLRA 2LEHA 2V7IA 4G63A 3OELA 3TTMA 5DVFA 4EAHA 3OO6A 3PMWA 3V89B 4KYDA 3WAFA 2HCAA 1N76A 5CBSA 3ODBA 1I6BA 3DTOA 5IAIA 1VSOA 4Z8XA 3O6IA 4IGUA 5ADXL 2V3UA 2DE2A 1S50A 3KOSA 3UUMA 4U4XA 3VKGA 2WAUA 1B5IA 4ILUA 1SYHA 4XKPA 4BDQA 1LB9A 3H03A 2VKHA 5BWJA 3TKDA 3H6UA 4EB6E 3HL6A 4RK2A 3LSWA 4FEDA 3KV4A 4Z7EA 4F19A 3GN5B 2L8KA 5JR9C 2XHEB 3ANWA 3EHSA 2LSKA 4YMAA 3C31A 1MIVA 1SYIA 4Z0IA 4EZHA 4AQFC 2XD3A 4AKLA 1HCIA 3JYRA 4PFWA 1M5FA 3PGFA 4OERA 1ZKBA 2HXWA 3BKIB 3L3PA 3OJAA 4P0IA 4TQUQ 5JK4A 4OMBA 4NUVA 3FATA 1LAFE 3VXBA 2C5KT 1Y4TA 1OVBA 4EF1A 1IITA 3PE0A 4RJZA 4AB6A 3UT5E 2XAHB 3KV9A 4DO0A 5ETWA 2DWGA 3O4XE 1SA0E 3HV1A 3Q2MA 5I2KB 3T8OA 4F3PA 4JWOA 1Z7NE 4IIJE 2QMXA 1MQHA 5AA2B 2YU1A 3KN3A 4N6PA 4R9GA 3OO7A 3FHNA 4MLVA 3H7MA 1WLXA 3H3AA 4OEVA 4F29A 3P8CD 1B3GA 3RC3A 4RPNA 1PB7A 4C90A 5CC2A 4WXJA 2W7YA 2WKYA 5DVJA 2LSYA 3KINB 4WBOA 4NF4A 2Z8DA 1D1AA 3EDVA 4NTLA 3KJ7A 2PJQA 4IO6A 3FJ7A 4H63H 3KBRA 1AH5A 3KDSE 3CMLA 5I56B 4ZEBA 2LHNA 1JW1A 3USDA 3T93B 2ABHA 1B52A 2W62A 4MH5A 1V9DA 2Z6EA 3JC6C 4RK9A 5AA4B 3ETVA 4CXWA 3K3OA 1QKAA 1M5DA 2ZM0A 2M67A 4CXXA 4QFPA 4GQOA 3CVGA 3MBPA 4TOZA 3K1PA 5FMNA 3I6VA 4AB5A 1Y3QA 4GOTA 4C91A 2WSSV 4GRKA 3ZCJA 3RUMA 1S35A 3LSXA 2YJPA 3IJXB 1MXWA 3MJXA 2F8DA 4IY6A 3AA1B 4PK6A 4GFRA 1FQDA 3VVDA 3Q9DA 1A40A 3PMXA 1R9QA 2DWIA 2CMRA 3ZPOA 1QW0A 2I59A 4IB2A 2MYSA 4NF8B 3WI3A 4BJNA 2XXXA 5KZTA 1MIWA 2WMOA 3PPOA 2I49A 2XHDA 3UN6A 2FA7A 5I2NA 3PU8A 4YJ3E 1BR0A 3LBXA 5HM4B 3IB2A 2D21A 4ZI3D 2JRKA 1NNPA 1FQCA 1SD3A 4PJNA 5ITPA 1H3DA 3ZJ2A 3CSBA 2XD2A 1WRDA 3U1OA 3PUSA 4PP0A 4XKRA 2QS2A 2CEAA 3LFMA 1Y64B 4ZEFA 3FVNA 5LXTE 2F7BA 5J2TE 5JTYA 2WM9A 1GV8A 3DELB 1ATGA 1VE4A 4YHJA 1H45A 2H3RA 2NW9A 1M5CA 3RH3A 1USYE 2E9XD 5L3CB 2EHOB 4HTGA 2RA1A 2IA4A 3OEKA 1EZ9A 3GWHA 3CX8B 5CMKA 4QHQA 3E08A 1IJ5A 2V7LA 5JVDE 2J1DG 4AXPA 1B0LA 3EHUA 2LAOA 1WR6A 1LKXA 2DVCA 1TWYA 4MFIA 4EQBA 2V7KA 1MQGA 4R72A 2ZYMA 3I0OA 3TTKA 4M1PA 2ANJA 5CB4E 5J1GA 1BP5A 1NNTA 3BQLA 1YAEA 2UXNB 2DE4A 3W15B 3AVSA 4HS7A 4PFPA 2Q88A 1NWMX 1PEBA 4GVOA 2I4BA 3AA7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FJP A;  4ZZE A;  1J1N A;  2GH9 A;  5CI5 A;  3PUZ E;  4YKJ A;  2XXP A;  1UTB B;  3QIM A;  2H9B A;  1ZMG A;  1MM7 A;  2XXR A;  2Q8J A;  1JW4 A;  3CRB A;  5J1D A;  1DTZ A;  3PUV E;  5I57 B;  3TCF A;  1XS5 A;  3T22 A;  1MQI A;  3DP8 A;  1IEJ A;  1NFT A;  3KJT A;  3SDF A;  1B3F A;  2V93 A;  3PUY E;  1B3E A;  1WDN A;  5H8N B;  4PFY A;  5I59 A;  1ZU0 A;  2O68 A;  1MDQ A;  3R7X A;  5L9S A;  4LUB A;  3DM0 A;  1I69 A;  2MBG A;  4F3S A;  1M5B A;  2C5I T;  3K01 A;  3H6W A;  4BDO A;  3VV5 A;  1LAX A;  1B7H A;  3MZB A;  4O3A A;  1XC1 A;  1Z0P A;  4QSE A;  2I0B A;  3FGS A;  1CB6 A;  4RPO A;  4ZEC A;  4ZEK A;  4G8N A;  4QF9 A;  5TU0 A;  2XXI A;  1LCF A;  2PBW A;  4EUO A;  2B65 A;  4LQ5 A;  3TFL A;  1USY H;  4R2F A;  1FCK A;  4OTE A;  3FIR A;  1SW1 A;  5FHN A;  5KCJ A;  2VD3 A;  1I6Q A;  4FEB A;  3KN7 A;  1LGB C;  3FV1 A;  4FIM A;  3O6G A;  5I84 A;  3HPI A;  3FAS A;  4ELR A;  2Y7I A;  2XXW A;  2UVI A;  4XKN A;  1FQA A;  3O2A A;  3MPK A;  3RGY A;  3P7I A;  3TEP A;  3MP6 A;  2RC8 A;  5ISU A;  1MY0 A;  3TZA A;  4WKM A;  1LBB A;  1B7Z A;  4IO5 A;  5CMM A;  3CG1 A;  2ONK E;  3R6U A;  3C9H A;  4U1O A;  3S9N C;  4KFQ A;  4GLI A;  2GRV A;  2DXR A;  5H8Q A;  2Y84 A;  3L6G A;  4O3C A;  3VVE A;  3UK4 A;  1IXG A;  3MUQ A;  3MVZ A;  4PFT A;  5ICT A;  1BLF A;  4C1T A;  3MPL A;  4RNS A;  2P0S A;  4AQ4 A;  3OSQ A;  3RTF B;  1LLS A;  4YZZ A;  3Q29 A;  1D3K A;  1P99 A;  4CQI A;  4POX A;  4ZED A;  1UIV A;  3ZSF A;  2F36 A;  3Q26 A;  1QSD A;  1SI0 A;  1B6H A;  2ZYK A;  2PVU A;  1ZKE A;  2RIN A;  3GLB A;  3QUF A;  4F2O A;  2Y7P A;  3QK6 A;  3MP8 A;  3TQL A;  3OOA A;  2H98 A;  3A09 A;  4XIG Q;  3K0V A;  2F6P A;  2I4C A;  1N7W A;  4YB5 A;  2B3F A;  4NMY A;  5ICQ A;  2O84 X;  2F6G A;  1LAH E;  4G8H A;  3OXN A;  4OZ9 A;  4NWD A;  3KOT A;  2XXT A;  2V3T A;  4G68 A;  3AXF A;  4Q5T A;  1AIV A;  4KI0 E;  1EH3 A;  1WOD A;  3G3J A;  4Q0C A;  3MQ9 A;  1RYX A;  3I3V A;  2AL4 A;  2X7Q A;  1FTJ A;  3W9V A;  1IZ1 A;  1MQJ A;  4OEN A;  5IKB A;  3O66 A;  2KWH A;  4OFO A;  1PBQ A;  2UVG A;  3CFL A;  1GVC A;  3RN8 A;  4KYS A;  4G2Z A;  3FVO A;  2I48 A;  4QFN A;  3HCQ A;  3K2D A;  2CA5 A;  2M8C A;  1SDX A;  2DYX A;  4OYV A;  3CFZ A;  1IUD A;  3G3H A;  4N07 A;  4C0R A;  2RCA A;  4R9F A;  4BLA A;  1B1X A;  1FTK A;  3FZV A;  4RA1 A;  3H6V A;  1AL3 A;  1SI1 A;  2G29 A;  4EQ9 A;  2XX9 A;  3N6U A;  1URS A;  4I8C A;  2H25 A;  3HHG A;  1S9T A;  2XX7 A;  4YIC A;  3IB1 A;  4FAT A;  3B6Q A;  4R74 A;  3A3C A;  3CVR A;  4N13 A;  4G68 C;  2QSX A;  2QS3 A;  3H4Z A;  4OES A;  3A3U A;  5K2X A;  3OO8 A;  3FD3 A;  3OEM A;  1DPP A;  1EU8 A;  1FQB A;  3FXE B;  3LBS A;  2F34 A;  4JXI A;  5H8H A;  3RNN A;  2VGQ A;  5L9O A;  2UXA A;  1NNK A;  1MPB A;  3IJO B;  1XVY A;  3N5L A;  1XOC A;  2ESN A;  3VDF A;  1US4 A;  4YKK A;  3KFM A;  3IX1 A;  3B6W A;  3N26 A;  5I2K A;  2I58 A;  2KWI B;  4KQP A;  1BIY A;  5CBR A;  3QAX A;  5AA2 A;  3E13 X;  1P1U A;  5TPA B;  3BFT A;  1NH8 A;  3GXA A;  4EF2 A;  4FE8 A;  2Y7K A;  3MZ1 A;  4UAC A;  1MY4 A;  3MC2 A;  3PPR A;  1MRP A;  1Y1M A;  3PV0 E;  3CSG A;  2DQV A;  2V3Q A;  4KYE A;  4MLQ A;  2HAU A;  1O63 A;  4EQ7 A;  3IR1 A;  2I6E A;  3PUX E;  3FUZ A;  4QSC A;  5I56 A;  3KEI A;  3UP9 A;  4R75 A;  1JVY A;  1NNF A;  1A55 A;  2QS4 A;  4ZEI A;  1SVX B;  1QKB A;  1B46 A;  4U21 A;  3GBB A;  3HN0 A;  5FHO A;  3U8Q A;  1UQW A;  1HSJ A;  1MQD A;  3U72 A;  1TT1 A;  1BTJ A;  3Q28 A;  3PPQ A;  2VD2 A;  1MG1 A;  5DTB A;  1IXH A;  3C32 A;  4R6H A;  2UVJ A;  1O64 A;  3FXR A;  1PB8 A;  5FTI A;  3E3K A;  4OET A;  1S7Y A;  4NF6 B;  4NF8 A;  4U1Z A;  1B9J A;  4HCW A;  1B1H A;  1ZLQ A;  4OEU A;  2CZL A;  1OIB A;  3IAZ A;  2DWA A;  4OQO A;  2OCU A;  3MJN A;  1Z7M E;  4X1B A;  3T9U A;  4ECF A;  3PPP A;  1N84 A;  3M3L A;  3U92 A;  3FXD B;  1JET A;  4IO3 A;  1P1Q A;  4JBZ A;  2VOZ A;  2XXV A;  4P0G A;  3SES A;  1FQF A;  1SW2 A;  4EDP A;  4Q8R A;  2O1L A;  3IK6 B;  4YB6 A;  3M8U A;  5A5X B;  1HSE A;  5HBC A;  5AA2 D;  3RTW B;  3S4U A;  2R9J A;  2NOO A;  3B7D A;  3IOV A;  5H8F B;  4NF5 A;  1P1W A;  3CI8 A;  4GL8 A;  2F5X A;  3K6U A;  4DCY A;  1UIU A;  2A5T A;  2Q2A A;  2P2A A;  3TYH A;  3ILT B;  3TDJ A;  1B3H A;  3SER A;  2GHB A;  4QSD A;  2QRY A;  2PYY A;  2Z8E A;  1UTB A;  3GZG A;  2YLN A;  1QVS A;  1FQE A;  4OFL A;  4IY5 A;  1B5H A;  5I57 A;  5DEX B;  4EXL A;  3IOT A;  1B0H A;  3C36 A;  2P1S A;  3JZJ A;  4R73 A;  4LP2 B;  3K00 A;  3MP1 A;  5EHS A;  3K6W A;  5H8N A;  2R71 A;  4OHN A;  4I9D A;  4ELQ A;  4DDD A;  4H65 A;  4ND9 A;  4YKI A;  4JWX A;  2XXU A;  2Z23 A;  2QMW A;  1IQ7 A;  2X9X A;  3OSR A;  2O51 A;  3JV9 A;  1FTL A;  3E9X A;  4R6K A;  1BKA A;  3HO7 A;  3K6V A;  1P1O A;  2UYE A;  4JB7 A;  4U2R A;  1XHY A;  4EYY R;  2V84 A;  5ITO A;  3HST A;  4X9T A;  4F3G A;  1GGG A;  1N3W A;  3N6T A;  1NKX A;  3S9L C;  4ZS9 A;  1POY 1;  1SQY A;  1D9Y A;  1B58 A;  3K1M A;  3IOU A;  1GR2 A;  2ZYO A;  1II5 A;  3TTL A;  3PMV A;  1MXZ A;  3VXC A;  2OK2 A;  4C1U A;  2XX8 A;  3ILU B;  4F18 A;  2F97 A;  3MVX A;  4ESW A;  2G0U A;  3F11 A;  2OZZ A;  3IB0 A;  3KSJ A;  3KG2 A;  2F35 A;  1FTO A;  1JQF A;  4E0X A;  1Y3P A;  2F7C A;  2OWS A;  1Y4C A;  4KR5 A;  1MPD A;  1HSL A;  1DPE A;  1ZJL A;  2Q89 A;  2ZNU A;  2DWH A;  4H5F A;  3H06 B;  3FVG A;  3IO4 A;  2ZXT A;  2RC9 A;  4J2C A;  3SEV A;  1H76 A;  2QPQ A;  2DXY A;  1MM6 A;  5CMB A;  4LVQ A;  1JNF A;  1OQH A;  2G93 A;  1ELJ A;  2VHA A;  2H5Y A;  4LZ8 A;  4EXK A;  4OWD A;  2KLF A;  1LFI A;  1AMF A;  1GTK A;  4OXV A;  4TLL B;  2HFB A;  5AA3 A;  3QYT A;  1T0K A;  1DSN A;  3LR1 A;  3RQT A;  3K6X A;  3L6H A;  1MH4 A;  1YTV A;  3FXU A;  5TP9 B;  1MXX A;  5JEI A;  2DWJ A;  1UTH B;  2B3B A;  2HZK A;  1ZBM A;  3FV2 A;  2VP1 A;  3V8X B;  1I6A A;  4X1D A;  4JDF A;  4ELO A;  1OMP A;  3TMG A;  4JSO A;  2BJJ X;  1FTM A;  2NUV A;  3RLF E;  2DVZ A;  1N7X A;  2HQ0 A;  3EQ1 A;  2E0S A;  2F78 A;  3O9P A;  5KDT B;  3G3I A;  3K4U A;  1A8F A;  4P11 A;  3TAJ A;  2O69 A;  1MXV A;  1MDP 1;  1OVT A;  1ZTY A;  4F2Q A;  4G68 B;  4YB7 A;  1VFD A;  2ZNT A;  4DND A;  4H8J A;  2XXY A;  3OMB A;  2DE3 A;  1A8E A;  3LC8 A;  1A99 A;  2Z22 A;  2ALU A;  3PD8 A;  1LRZ A;  2OBG A;  5I58 A;  5CRY A;  4IGT A;  2X7P A;  4YU0 A;  2DS9 A;  3ONM A;  1D4N A;  4FAJ A;  1XT8 A;  3BBR A;  1B4Z A;  5L8D A;  1ANF A;  5M2V A;  4R6Y A;  2THI A;  1MY3 A;  1IJ6 A;  2I0C A;  1LBC A;  3VLV A;  1R6Z A;  3MVY A;  3ZS6 A;  4LZ7 A;  1Y9U A;  4GWO A;  3LSL A;  2HZL A;  1YPN A;  1H44 A;  3SET A;  3FXQ A;  3MZ9 A;  4PET A;  3EF7 A;  4QRZ A;  2QS1 A;  4E0W A;  1LAG E;  3ZKL A;  4YM