3P7IA

Crystal structure of escherichia coli phnd in complex with 2-aminoethyl phosphonate
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
300
structure length
300
Chain Sequence
KALNFGIISTESQQNLKPQWTPFLQDMEKKLGVKVNAFFAPDYAGIIQGMRFNKVDIAWYGNLSAMEAVDRANGQVFAQTVAADGSPGYWSVLIVNKDSPINNLNDLLAKRKDLTFGNGDPNSTSGFLVPGYYVFAKNNISASDFKRTVNAGHETNALAVANKQVDVATNNTENLDKLKTSAPEKLKELKVIWKSPLIPGDPIVWRKNLSETTKDKIYDFFMNYGKTPEEKAVLERLGWAPFRASSDLQLVPIRQLALFKEMQSVKDNKGLNEQDKLAKTTAIQAQLDDLDRLNNALSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PhnD, subunit of alkylphosphonate ABC transporter
publication title Structure of the Escherichia coli Phosphonate Binding Protein PhnD and Rationally Optimized Phosphonate Biosensors.
pubmed doi rcsb
source organism Escherichia coli uti89
molecule tags Transport protein
total genus 119
structure length 300
sequence length 300
ec nomenclature
pdb deposition date 2010-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12974 Phosphonate-bd ABC transporter, phosphonate, periplasmic substrate-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3p7iA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3p7iA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3p7iA02
2ZNTA 5EYFA 2E0SA 4OVJA 2QL3A 4ZZAA 1BIYA 3FV1A 4HCYA 3V5AA 4FAJA 3H6VA 3IJOB 3VLUA 5I2KA 3K6UA 2DE4A 3MVXA 3TODA 4NWCA 4QSDA 3RQTA 3IOWA 3JYRA 4YU0A 3C35A 3B6TA 5BUUA 1F9BA 3TTMA 1S7YA 4KHZE 4PFYA 3KN7A 3LUYA 1HSJA 4JSOA 2Y84A 1B5HA 3TEPA 1MXXA 2H9BA 3PUYE 4DIGA 5CBSA 3IB1A 1B1XA 2F7CA 2X26A 2R6GE 1LBBA 1MH4A 3FUZA 4GL8A 1OLCA 5FTHA 4XTCQ 4EQBA 3MZ9A 1XHYA 1MH3A 4DXCA 4PFUA 2QS4A 3FXQA 1Z0PA 3U94A 2I4BA 2QJEA 3FD3A 1MM6A 3VFJA 2I3WA 2FYIA 4RXLA 1MPCA 3KEIA 4RYAA 2YLNA 1N84A 3KSXA 4H5GA 3EQ1A 3WAEA 3EHTA 5CI5A 2FA7A 1A8FA 2D3IA 4F29A 3ODBA 1FQBA 2H98A 3CG3A 4EDPA 4IO6A 4F1UA 4QFPA 4ZS9A 2X7QA 3EPEA 1MQIA 4DDDA 1MXWA 2F36A 4LA9A 4G68A 3D4CA 5H8NA 4OFJA 2XXIA 2XXYA 3C33A 4G2ZA 4FI5A 1P1OA 3CG1A 1NNTA 4NF5B 4P11A 4RPOA 4GOTA 2Z8FA 1UQWA 3S9MC 1DTZA 1DMBA 3SEVA 3TCFA 1IJ5A 5HPQA 1SI1A 1MY0A 4TOZA 2P1SA 5M2VA 5KDTB 2Q9TA 1QSDA 5AA1A 3N6TA 1OVTA 5F7VA 3U92A 1QKAA 5J1DA 3MUQA 1B3EA 4PETA 4AB6A 2KWHA 1CB6A 1VFDA 4NEDA 1P1QA 1N04A 1B46A 2Z8EA 2HAVA 5KCJA 3Q26A 1QKBA 2QMXA 5DYHA 1FCKA 2ANJA 3MP1A 4GQOA 2V84A 3VLVA 4NWDA 5K2YA 1GVCA 4OEVA 1QUIA 1LAXA 4TLMB 1MY2A 2A5TA 1YCJA 1SYHA 3MAMA 4GWOA 1B1HA 2ZNUA 4NMYA 5HBCA 3VXBA 4BLAA 1I6AA 1ZKBA 2C5IT 3DELB 1I69A 4LZ5A 3V8XB 4O3AA 2GH9A 1POTA 4I8CA 4YB6A 2ONSA 1DPEA 5I56A 3SKPA 4NF4B 2DXRA 1JQFA 5DEXA 1URSA 4R2FA 3MW0A 5H8FB 2Z22A 4QF9A 3LC8A 1P99A 1BTJA 4KR5A 4PP0A 2LAOA 5B7DA 4BDMA 2HAUA 1NL5A 3Q29A 4R2BA 3MVYA 3MPLA 4EF2A 3CFXA 3MP6A 5H8QB 1IEJA 3UGWA 2DYXA 3DP6A 1S9TA 5FHOA 4YKPA 4Z0IA 3S9NC 2NVUB 4R75A 1B4HA 1IITA 1M5CA 1D9YA 1TFDA 3SDFA 5FHNA 5L9SA 1SDXA 1PB9A 4IY5A 4ZEKA 5AA2D 1MS7A 3G3JA 3TMGA 4JDFA 2XXUA 3N5LA 3T22A 1B3HA 2AL4A 2C5KT 3C32A 4BDLA 1M5FA 4LVQA 4PQJA 4IO5A 3K02A 1AL3A 1OIBA 3R6UA 5AA2B 3MP8A 3OO8A 1A40A 1ZLQA 3PPOA 3PUZE 5DVIA 3I3VA 2DP8A 4KCDA 2MBGA 3OENA 4ZEFA 2REJA 4BDNA 1UTHB 5DVFA 2Q88A 2B65A 3OO6A 5CMBA 4NF6B 4LQ2A 1OLAA 1QUJA 2AL5A 4R6KA 1P1NA 3ZSFA 3OMBA 3MC2A 1VE4A 4ZEBA 5I57B 3IO4A 4FECA 1MY3A 4GXSB 2DOJA 4K3FA 3TELA 2XX8A 1NNPA 2H4IA 3RY3A 4H67A 5I2KB 3UP9A 1PDAA 2V3UA 4DCXA 5CM6A 1A55A 4Q8RA 2OCUA 3S2VA 3PPQA 1MXUA 3FJ7A 2VHAA 3TYHA 4U23A 1OVBA 3FZVA 1FQFA 3C31A 4DLDA 1MXVA 4KQPA 4WXJA 1WODA 4OMBA 3H7MA 1JVXA 2DQVA 2P2AA 4DZ1A 1M5DA 1N3WA 2IEEA 2ZXTA 2UYEA 3CKDA 3TQWA 1Y3QA 4H5FA 4Q5TA 1BP5A 3PUWE 1B0LA 1B58A 1FW0A 1LLSA 3BFUA 3ZKLA 3K6VA 1N7WA 2KWIB 2HCAA 1YAEA 3HO7A 3V83A 3TFLA 2RF1A 4H1XA 2DWIA 1Y20A 4KFQA 2O1LA 2OLBA 1OQHA 3RUMA 1RYOA 3CIJA 5FTIA 3R7XA 1IUDA 4MFIA 3ECRA 1URDA 2ZYKA 4ZECA 1LVFA 2PT1A 2PYYA 4RK9A 3LSFB 2UXAA 3WAFA 1EZPA 4E0WA 4BDRA 4F1VA 1USYE 2XXXA 5H8NB 1SI0A 3AXFA 3MBPA 4N13A 2UVJA 4ELPA 3KJTA 2I49A 3JV9A 3O29A 3S9EA 3JZJA 3C34A 2THIA 4PE5B 2DVCA 1VFEA 1Z7ME 4QFKA 4U4SA 1MG1A 3TZAA 4OHNA 1UIVA 1DTGA 1D4NA 3PMXA 4LQ5A 1CE2A 4F2QA 3OEMA 3K4UA 2CZLA 5DTBA 2QPQA 2CA5A 3SEXA 4M1VA 1POY1 2NOOA 1QW0A 3DP8A 5TP9A 1Q1KA 2GRVA 3K1NA 1S50A 4H65A 1SVXB 2G93A 5KCJB 3BFTA 5JTYA 4F3GA 4FATA 1H44A 3L6GA 3TCHA 1ANFA 4R9GA 4H8IA 2B3BA 3FXRA 1XOCA 2VD2A 2A5TB 2H25A 4Q30B 2I0BA 2QS1A 3PV0E 4KYEA 4KPTA 4NTLA 4LZ7A 2M8CA 3N26A 2Y7RA 4FORA 1Y1ZA 1SW5A 4HCWA 4U1OA 1Y3PA 5EHSA 5I56B 3IOVA 3ZS6A 1AIVA 3QSLA 1JEVA 3VDFA 5DEXB 4G8MA 1OMPA 1BLFA 3TDJA 2C5JA 4F22A 3KSJA 2HZKA 5IAIA 1QUKA 3KN3A 4KI0E 3VLWA 3ZKKA 4YKIA 1JEUA 1MXZA 4U2RA 1PC3A 1SD3A 2XXTA 1N0TA 1EZ9A 3TCGA 3EHUA 2IC6A 3GBBA 1IJ6A 2V25A 2F34A 2CMOA 2XXHA 3FATA 3MXZA 3H3GA 1GR2A 4KD5A 2V3QA 3G7WA 1IXHA 1KWHA 3QAXA 1LSTA 2O68A 1MPBA 3F11A 2IA4A 3LSXA 1D3KA 1O63A 2QS2A 4XKQA 4GRKA 3GXAA 2O7UA 2OK2A 1FQEA 3RNNA 2O6AA 4G8HA 5TU0A 3CR9A 4JSDA 4MH5A 3T9VA 3ILUB 3SETA 2Y7WA 2HFBA 3U72A 3K6WA 3PUVE 5ISUA 1MY4A 4L0RA 2QSXA 1TFAA 4FIMA 1R1NA 4F3SA 1GTKA 1NMUA 3OOAA 1Z7NE 2XD3A 5CBRA 3UN6A 5F1QA 1ZBMA 2PT2A 5IKBA 1N76A 2V93A 3H4ZA 3M3KA 1P1WA 1RKMA 4YB7A 3T9XB 4QRZA 4UACA 2YJPA 5B70A 4OESA 4N6PA 1JVYA 3EHSA 3H03A 3KZGA 4U4XA 3T93B 2O51A 3K00A 3G3IA 5L9OA 1VR5A 1MXYA 1XVXA 2NUVA 3TTLA 1LB9A 4O3CA 3IOUA 1NH7A 4U21A 5I59A 5DVJA 3T9UA 4QFOA 1IZ1A 4MBPA 2GHAA 2OBGA 2PVUA 3CSBA 2Q8JA 3TKLB 1FQAA 3H06B 1Y4TA 2OZZA 1H7CA 4B6XA 1B40A 2B3FA 2V3TA 1FQDA 4OFOA 4XXUA 2HZLA 4OZ9A 1US4A 2DS9A 1EH3A 2XX9A 3W9WA 2D5WA 3E4RA 3IAZA 1HSLA 3PPRA 1LB8A 4EXKA 3RT6B 1YPNA 2Q89A 5EHMA 3TTKA 5LOMA 1FTKA 2VP1A 1MQHA 1QVSA 4PFWA 3B6QA 4ELOA 4EUOA 1JW1A 1AH5A 3SESA 1P1UA 4IO4A 1FTOA 2QRYA 3VE1B 2O84X 4F3BA 4ESWA 1T0KA 2X9XA 2F7BA 1IQ7A 2O7IA 4BDQA 4UA8A 1XT8A 1GGGA 3W9VA 4RNSA 3A3UA 2X7PA 3CVRA 3MQ9A 3QUJA 4YZZA 4NE4A 4AB5A 1TT1A 2RC9A 4ONYA 2F5XA 4R73A 2UYFA 3MZBA 2Y7IA 1YTVA 3FV2A 1XVYA 1I6QA 4M4GA 1B0HA 2F78A 3S4UA 3TAJA 4R6YA 4GD5A 1SBPA 4P0GA 1ZJLA 5K2XA 3FXUA 2ZMBA 2RKMA 5FHMA 1XS5A 2WKYA 2ABHA 1DOTA 4XKNA 4YAHX 4QSCA 4OXVA 4JBZA 1Y1MA 4POWA 1LFGA 4RA1A 4QHQA 2RINA 4IY6A 3KGCA 3IB0A 1B05A 1FTMA 1ZMGA 5TP9B 4YICA 3SEYA 5ELVA 1ZKEA 4YB5A 2HXWA 2R9JA 3U1OA 5JTYB 1J1NA 2DXYA 1LFIA 2RCBA 3OD7A 4FE8A 1MQJA 4MLVA 5TPAA 4HW8A 2I58A 3USDA 3ONMA 4ZZEA 1NNFA 4AQ4A 3HN0A 2F7AA 1O7TA 4Z7EA 1H45A 3IX1A 3MWBA 2DWAA 1UTBA 4C0RA 3FXDB 1JW4A 3TQLA 3FJGA 1IXIA 4DXUA 3PMVA 3M3FA 1B3FA 3L3PA 1NH8A 4G77A 3FVGA 3IOTA 3IORA 4F2OA 3FXEB 3M3LA 3SEUA 3KN8A 3HHFA 3E3KA 4ISUA 5JK4A 2K48A 3V89B 2ALUA 3RPWA 4R6HA 3PU5A 3K01A 3QIMA 5AE4A 2ZNSA 3KFMA 1R9LA 3I6VA 3K2DA 2XHDA 4PFTA 4THIA 1A7LA 5HM4B 5H8SA 3K1PA 2KLFA 3CSGA 1GV8A 5CRYA 4U22A 4OTEA 3O6GA 2O69A 5CMMA 3KG2A 1HSEA 3C4MA 3UK4A 4RY1A 2RC8A 4JWXA 3FIRA 4HS7A 3E9XA 1LFHA 1TWYA 2I6EA 1SYIA 1Y3NA 3TTRA 1O64A 4I62A 3LSWA 5I58A 1Y9UA 1L5TA 4E0XA 3IO6A 3DM0A 2NXOA 3H6TA 3HPIA 2VOZA 1JW5A 3RT8A 1NKXA 4MLQA 4OETA 1IXCA 2X9WA 1ATGA 5A5XA 4F3PA 5CMCA 2ONRA 3A09A 3CFZA 2OJTA 2I4CA 5I2NA 4GIZA 4DNDA 3KBRA 4POXA 4IO3A 4GVOA 2O1MA 4X1BA 2OWSA 1B4ZA 1TXFA 1Y4CA 1NFTA 1N7XA 2PBWA 3CFLA 4FEBA 2PX1A 4ND9A 1B3GA 2W7YA 4RJZA 4QSEA 1MQDA 3B6WA 3BKIB 4OERA 2A5SA 3QXMA 1MQGA 5CMKA 3VV5A 4DE8A 5AA4A 2G29A 1LAHE 1M5BA 2XTLA 4TQUQ 4WKMA 4GXAA 3VVFA 4WEPA 4ECFA 4EYYR 3ILTB 1B9JA 1B6HA 5H8HA 4NF8A 1PBPA 2XXQA 2D21A 4EF1A 3OSQA 3THIA 2AYSA 5I59B 3CRBA 3O28A 3HCQA 4ZEIA 2YPNA 1ZIUA 3T66A 4OENA 4YKJA 3MVZA 1AOVA 2G0UA 2OWTA 2VD3A 4JXIA 3DLNA 3O2AA 4G68C 1SW2A 4FEDA 4LZ8A 4KCCA 1N3XA 3N94A 3C36A 3HHGA 3MJNA 4HTGA 4Q0CA 2REGA 2PMSA 3O66A 3T9HB 3PD8A 1R6ZA 2DWHA 2BJJX 5L8DA 4JWOA 4F19A 4ELRA 1LGBC 3IK6B 3N6UA 4R9FA 3LSLA 2E1SA 4X48A 4TLLB 2VGQA 1LCTA 1FTJA 1A54A 2FNCA 3PUXE 2P0SA 3OO7A 3M8UA 2I48A 2DE3A 1BKAA 3OO9A 1UIUA 1B5IA 1LAGE 2UVIA 3RLFE 1IIWA 1JNFA 2ZYMA 3FVOA 1URGA 3G3FA 5ITPA 3EN3A 1XC1A 3UIFA 5CC2A 3DP4A 2DVZA 3BBRA 4MF3A 3OEKA 5I84A 4I9DA 4ESXA 4XIGQ 1SW1A 4QFNA 3E13X 2R71A 1B7HA 1A99A 4R74A 3O97A 4OWDA 1R9QA 1B32A 3S9LC 3K6XA 3GLBA 1H43A 4EXLA 4IO7A 1LBCA 1USYH 1QJMA 3KOTA 4C1UA 3U93A 4QFLA 3IL1B 3U8QA 3I5OA 2QS3A 4LONB 4J2CA 2F8DA 4OEUA 3PGFA 1WVJA 3QYTA 1ELJA 4JB7A 4ELQA 4YKKA 4NF5A 4IO2A 4OYVA 3RN8A 3PPNA 1PB7A 3VXCA 4GL0A 4DXBA 1I6BA 2DE2A 4F31B 3OELA 3G3HA 4LATA 1MM7A 4F1YA 2RCAA 2ONKE 1DPPA 3O6IA 4ZDMA 5KDTA 3TKDA 3Q27A 2DWJA 1LAFE 4F39A 4DCYA 2I0CA 4YMAA 5TPAB 1MDQA 4O3BA 1D9VA 4IB2A 3B7DA 2UVHA 1B2HA 4EQ7A 1MY1A 3PPPA 3O6HA 4GLIA 5DT6A 1QULA 5ITOA 3Q28A 1ZU0A 1EU8A 2Y7PA 1MRPA 4OFLA 1UTBB 4GF8A 1H76A 3TUSA 4H6DA 1B52A 3KOSA 2XXWA 3R26A 4LUBA 3HSTA 2DSFA 3K0VA 3CVGA 3FASA 1PEBA 2HEUA 4EQ9A 3PD9A 4LP2B 2QMWA 3EF7A 2Z23A 4RK2A 1FQCA 4L17A 3SEWA 5L9MA 3G3GA 2F6GA 3PMWA 4X9TA 1B7ZA 4KYSA 3RTFB 4F18A 3HV1A 3UA8A 3IR1A 4NF4A 4ZE9A 1RYXA 3LBSA 1II5A 2ZYOA 3OXNA 5H8FA 2UVGA 1US5A 1A8EA 4XKPA 4H0WA 3FGSA 4G4PA 1PB8A 2IC9A 3CI8A 3SERA 2Z8DA 3OSRA 3VVEA 1FTLA 2ZYNA 4R72A 3GZGA 4X1DA 3TPAA 2H99A 2GHBA 5H8QA 3MZ1A 1LRZA 3FVNA 3RGYA 1EZOA 3FVKA 4IGRA 4FJPA 1B3LA 3K1MA 3QUFA 4GFRA 1JETA 1Q35A 2Y7KA 2Q2AA 3RTWB 3W15C 5I58B 4CQIA 3QK6A 2H5YA 2Q2CA 3H6UA 3FJMA 1SQYA 1IXGA 2X9YA 2XD2A 2XX7A 1MDP1 2HQ0A 4RPNA 1OQGA 3MVWA 3C9HA 1MPDA 5A5XB 1ZTYA 2NWJA 3H6WA 2F35A 2AIXA 3GBAA 3L6HA 3G3KA 1LCFA 4ZE8A 4ZEDA 4JWYA 4U1ZA 5I2NB 2XXVA 4WEDA 4KYDA 3IB2A 3P7IA 1PBQA 1AMFA 5JEIA 3IJXB 5KZTA 2RC7A 3UORA 1H3DA 1NNKA 4P0IA 3Q25A 3LR1A 5AA4B 4OQOA 5AA2A 1B51A 2F97A 2XXPA 5AA3A 2GFEA 5ICTA 2ESNA 1SW4A 5H8HB 5ICQA 4XKRA 1M5EA 4N07A 3T96B 4NF8B 4I1DA 1UTHA 3KJ7A 1VSOA 5BWJA 3O9PA 3TTNA 4NF6A 2XXRA 3D4GA 4YMBA 1WDNA 3MPKA 4C1TA 4H8JA 2I3VA 5I57A 4G68B 3A3CA 4IGTA 4G8NA 1B7UA 1B5JA 3VVDA 4BDOA 2F6PA 1DSNA
chains in the Genus database with same CATH superfamily
2ZNTA 2VB6A 5EYFA 2E0SA 4OVJA 2QL3A 4ZZAA 1BIYA 2A9UA 4IE5A 4GWWA 3FV1A 4HCYA 2MPKA 5AQGB 3V5AA 4FAJA 3H6VA 3IJOB 3VLUA 5I2KA 4CN4A 4H9SE 4X20E 4UXNB 3K6UA 2DE4A 1WYCA 2N2NA 5JH7E 2J1DG 1CHUA 3GA8A 1FJ9A 2YDSA 3MVXA 2CM0A 3TODA 4NWCA 4QSDA 3RQTA 3IOWA 3JYRA 1HTJF 2VASA 5BMVE 5IZ1A 2PG8A 4YU0A 1YZ0A 3C35A 2JJ9A 2CEXA 3B6TA 5BUUA 3ZN1B 1F9BA 3TTMA 3HKCE 1LBXA 3ISPA 1S7YA 5J0ZA 4KHZE 4PFYA 4AIUA 5EK2A 3KN7A 3LUYA 1HSJA 5IZZA 4PFRA 4JSOA 2Y84A 4HWFA 2W62A 1B5HA 3TEPA 1MXXA 2H9BA 3PUYE 2Y5KA 4DIGA 2MKZA 4TV8E 1XMOT 4H9QC 5CBSA 3AVSA 2ES0A 3IB1A 1MMNA 2XHEB 1B1XA 4I4TE 2F7CA 2BBHA 2X26A 3E22E 2R6GE 1LBBA 2XQ8A 1IAPA 2FBWA 4GYRA 5J1GA 1FBGA 1MH4A 4ZI3C 3CHGA 4PAKA 5AQQB 3C51A 3FUZA 3ZJ1A 2HPJA 3P4SA 2YDRA 4N15A 4GL8A 1IBLT 1OLCA 2DLRA 4CXYA 5FTHA 4XTCQ 5HAXA 4EEBA 4EQBA 2NOXA 3MZ9A 1XHYA 1MH3A 4PJMA 3PDYA 4DXCA 1JP4A 2A72A 4PFUA 2QS4A 4NF0A 2LRKA 2WEFA 3FXQA 1Z0PA 3U94A 2I4BA 2CEYA 2QJEA 3FD3A 1MM6A 1HX8A 1IMBA 3VFJA 4P3LA 2I3WA 3FHNA 3PUWF 1KNZA 2FYIA 1VCTA 2F3BA 4RXLA 1MPCA 3KEIA 1N33T 4RYAA 1XMQT 2YLNA 3IEEA 1N84A 3KSXA 4H5GA 3EQ1A 3WAEA 4H9RC 3EHTA 5AQPB 4G61A 3QB5A 5CI5A 2FA7A 3HA4A 4IR8A 4A5XA 4MX6A 1A8FA 2D3IA 2BZBA 4F29A 1LBZA 3ODBA 2LOSA 1FQBA 2H98A 3CG3A 4EDPA 2E9XC 2UUCT 1R8IA 4IO6A 2FJBA 2JQQA 4F1UA 4AS4A 4I3EA 5C8YE 4QFPA 4ZS9A 3MACA 4E7SA 4PAGA 5L47A 2X7QA 3EPEA 4LMJA 1MQIA 4DDDA 1XZYA 1MXWA 2F36A 5JDHA 4LA9A 4G68A 3D4CA 5H8NA 1LBWA 4OFJA 5FXWA 2XXYA 2XXIA 2BS3A 3C33A 2VURA 4G2ZA 3RKGA 4FI5A 1P1OA 3CG1A 1NNTA 4NF5B 2XWVA 4PFIA 4P11A 4OHFA 4RPOA 2CE7A 2EHOA 4OK0A 1DU2A 4GOTA 2Z8FA 1UQWA 3S9MC 1DTZA 1T7SA 1DMBA 3SEVA 1DCUA 1KNRA 3TCFA 1IJ5A 4UF0B 4COFA 1N36T 3ETVA 4MNPA 5HPQA 2CBIA 1SI1A 1MY0A 4Q25A 5JRCA 3TLUA 4TOZA 2P1SA 3VU7H 5M2VA 5KDTB 1E7PA 4DMWA 2LHNA 4YTMA 5HEOA 2Q9TA 4TNVA 2FJEA 5HEHA 3AE4A 4ZHQE 1QSDA 5AA1A 3N6TA 1OVTA 3QC9A 3CMLA 4PTKA 5F7VA 3U92A 3VRBA 1QKAA 5J1DA 3MUQA 5A5LA 2PFVA 3UTKA 1HNWT 1B3EA 4PETA 3CQGB 1UX4A 5KXJA 2XAQB 4AB6A 5LA6E 4NIQA 2KWHA 1CB6A 1VFDA 4NEDA 1P1QA 1N04A 4HFEA 4B3MT 4EB6E 5LDZA 2LRLA 3P4RA 1B46A 2CXFA 2RPAA 2Z8EA 3M65A 2HAVA 5KCJA 4NX1A 3N2KE 3Q26A 1QKBA 2QMXA 3ZPOA 5DYHA 4LF7T 1FCKA 2ANJA 4LFCT 3HFUA 3RQWA 3MP1A 4GQOA 2V84A 5JR9B 3VLVA 4NWDA 5K2YA 1GVCA 4OEVA 1QUIA 2M67A 4U2ZA 5AQUB 1LAXA 4TLMB 1MY2A 2V7JA 4TWDA 4HWHA 3UU8A 1SYHA 1YCJA 2A5TA 1B1HA 2ZNUA 3MAMA 4GWOA 1NV2A 4OYKA 4CI3B 2V7LA 3LBXB 4NMYA 2D5UA 4PAFA 5HBCA 3VXBA 5LG3A 1OEDA 4BLAA 3DJBA 2FUPA 1I6AA 1ZKBA 2C5IT 3DELB 4JI3T 1I69A 4LZ5A 4PF8A 3V8XB 2UXDT 2CZKA 1WR6A 4O3AA 5JDLA 4U72A 2GH9A 5AQLB 5ABFB 1POTA 4I8CA 4YB6A 2ONSA 1DPEA 4DIDB 3UQ7A 1UURA 3K3QC 4HWDA 5I56A 5JQGE 4B3ST 3SKPA 4NF4B 2DXRA 4XBFB 4KMCA 1JQFA 5DEXA 1URSA 3T8OA 2ZZXA 4R2FA 2L8KA 3MW0A 5H8FB 2Z22A 4QF9A 2WSSV 2M6IA 3LC8A 1P99A 1S94A 1BTJA 2XWIA 4X64T 4KR5A 4PP0A 4DV7T 2LAOA 2VK9A 2BG9A 3LSVA 1M62A 4DR4T 5B7DA 3HR0A 4GIWA 4BDMA 2HAUA 1NL5A 3Q29A 1FPFA 4R2BA 3EAMA 4NGUA 1INPA 3A7MA 3LK42 3MPLA 3MVYA 1WFDA 4EF2A 4ASKA 3EABA 4LF9T 2HN2A 3CFXA 4C90A 1N32T 3MP6A 1FMWA 5FBPA 1YKEB 5H8QB 4O4JE 4O4LE 1IEJA 4PK4A 3UGWA 2DYXA 2K3WA 5LHHB 2QVUA 5HWXA 2WU5A 2D0UA 3DP6A 4WNKA 3L39A 3VKHA 1S9TA 5EQ9A 3RYCE 4JLEA 4NAPA 5FHOA 4YKPA 1MNEA 4H63H 2J4GA 4Z0IA 3S9NC 2NVUB 2XQAA 4R75A 2IUBA 1B4HA 4IE4A 5DABA 3UFEA 3ETUA 2SPCA 2LJLA 1RDYA 4TX5A 1D0XA 2UU9T 1IITA 1UGOA 5LJMA 4ANJA 1M5CA 4TWFA 3ZMZB 1D9YA 1TFDA 4HE0A 2UXBT 3SDFA 4WBOA 5FHNA 5L9SA 2C0SA 3WAKA 5JDMA 1SDXA 1PB9A 4IY5A 2WBLA 4O7MA 4ZEKA 3KC1A 3N9NA 5AA2D 5ABEA 4ZZBA 1MS7A 2X0LB 1XDOA 3G3JA 4O94A 4Z90A 3TMGA 3K8PC 2X67A 4HN9A 4JDFA 2Q9QC 2XXUA 3ZJ2A 5LJNA 3MYUA 3N5LA 3T22A 1UCUA 1B3HA 2AL4A 2C5KT 3PTRB 3C32A 2PTFA 4PCDA 1YQ3A 4X66T 4BDLA 1N34T 1M5FA 4LVQA 4PQJA 5J2TE 4IO5A 3AA6B 3K02A 1AL3A 4QWNB 4QHOA 1OIBA 2I6HA 3R6UA 5LP6E 5AA2B 3MP8A 3OO8A 5KDMC 1A40A 1ZLQA 3MJXA 3OYZA 4JI1T 3PPOA 5JREA 3PUZE 5DVIA 3I3VA 2DP8A 2V6YB 4IDPA 4KCDA 2MBGA 4BJNA 3OENA 4X65T 2V7KA 2VWAA 4Z91A 4ZEFA 2ODVA 2REJA 1ZV4X 4BDNA 3PUVF 1UTHB 4H45A 5DVFA 4QH1A 2B65A 2Q88A 1FPEA 3OO6A 3FZLB 3PUXF 4I50E 5CMBA 4NF6B 4LQ2A 1OLAA 1QUJA 2AL5A 4AKHA 2CCQA 4R6KA 5FVKA 1P1NA 2WDQA 1NWMX 4PDDA 4PC9A 3ZSFA 2XQ7A 2HHMA 3A8YC 3OMBA 1YKHB 4TZ4C 1JNZA 1K9YA 3MC2A 2XA5A 4I3YA 2YOEA 2LSIA 1VE4A 5LNKA 1IBMT 2VKJA 3EKIA 4ZEBA 5JDNA 1NV4A 4ZI2C 4N81A 2VQET 5I57B 4UVBB 3AA0B 4PK5A 3UFGA 3IO4A 4FECA 4BAYB 3ANWA 1MY3A 2CZHA 4GXSB 2MTQA 2DOJA 4K3FA 2XX8A 3TELA 1NNPA 3VR8A 4CN6A 1KF6A 2H4IA 3RY3A 4YFSA 4H67A 5I2KB 3TLSA 2JMHA 3UP9A 3B57A 1PDAA 2V3UA 4DCXA 4BJMA 5CM6A 1A55A 3WAJA 4OYJA 4Q8RA 2OCUA 3S2VA 3ZMTB 2J47A 4X1IE 5HCJA 1BR4A 3SWHA 3PPQA 3CQCB 4U7YA 3L8RA 1MXUA 3FJ7A 4UIGA 2WDVA 3C98B 5EQ8A 2VHAA 1KK7A 4WYVA 3TYHA 3OTOT 3ABVA 4U23A 5EQ7A 1OVBA 4GKKT 4X5TA 3FZVA 4OVTA 5I7IA 4E7ZA 1FQFA 2B4LA 3NZQA 3C31A 4DLDA 2W61A 1MXVA 5A1LA 4QXHB 4KQPA 3CX7B 4WXJA 1WODA 1FBHA 3CK6A 3UU3A 4PBQA 1W0BA 4OMBA 3H7MA 3NRYA 2BS4A 3ZCIA 5AQNB 1JVXA 2DQVA 2W4XA 4DUYT 2P2AA 4DZ1A 5KX5E 1M5DA 1N3WA 4HFVA 2IEEA 5C2TA 2UYEA 3EHZA 2ZXTA 3N9OA 3CKDA 4GYSA 4JI6T 4OA4A 3TQWA 5AQOB 3AE1A 1Y3QA 4H5FA 3TLWA 1J1JA 3AE3A 4Q5TA 1BP5A 3PUWE 3ZEFB 4PAIA 2KXPB 1B0LA 1B58A 4PGPA 2CXDA 5FY0A 2WWVA 4UABA 1FW0A 4PGNA 1E1HB 2QRXA 3H3MA 1LLSA 2WM9A 3BFUA 3ZKRA 3JAFA 1DK4A 5DJQC 3ZKLA 3K6VA 1N7WA 2KWIB 3RIFA 3PUGA 2E2AA 3TLTA 2HCAA 1YAEA 2LKGA 4NUUA 3ZT7A 3AAEB 3HO7A 4CZZB 3V83A 5C3JA 3F57A 2AE9A 3TFLA 2RF1A 4H1XA 4HXVA 2DWIA 4MMPA 1KEYA 2WMNA 1Y20A 4ISTA 4KFQA 4HFCA 5IUXA 2O1LA 2V1DB 1ZOYA 1G73A 2YEVC 2YKSA 4DV6T 5L4EA 4MNCA 3LUZA 2OLBA 1OQHA 2OLTA 2V6YA 4HEAA 3RUMA 1D1CA 3JADA 1RYOA 3CIJA 4DR1T 4IDNA 5IGAA 2Y6XA 3UUBA 3NVOA 2WZIA 3CX8B 5FTIA 3R7XA 1IUDA 3QOFA 4MFIA 3VHLA 3ECRA 1NUXA 1NV5A 2EHOD 2XPKA 5E0OA 4U2YA 1URDA 2ZYKA 4ZECA 1LVFA 2PT1A 3HI2A 4JVCA 2PYYA 4YJ2E 4GK5E 4DVDA 4RK9A 4IL4A 3LSFB 4I55E 4DV0T 2UXAA 1V9DA 4KP3C 3FBPA 3WAFA 3VR9A 1EZPA 4E0WA 3ZT6A 3OPCA 3N9LA 4UV8B 4BDRA 1USYE 2XXXA 4F1VA 4OVPA 1SI0A 3AXFA 5H8NB 3MBPA 4N13A 3EVYA 2UVJA 2IIUA 2CZIA 4ELPA 5FKYA 3KJTA 2I49A 3UU4A 3JV9A 3O29A 3S9EA 3JZJA 2CRBA 2GK9A 3C34A 2THIA 4PE5B 2DVCA 2EHOB 1VFEA 1Z7ME 4PFOA 4QFKA 4U4SA 1MG1A 4DV5T 5HWYA 1NV1A 3TZAA 3ZSTA 4OHNA 3RIUC 2DCFA 3AVRA 1UIVA 1DTGA 3C4WA 2Y8DA 1D4NA 5JRCB 4H9NC 3PMXA 1CE2A 4LQ5A 1NV3A 4F2QA 3SZPA 2A2FX 3OEMA 4P1EA 3K4UA 2CZLA 4ZS2A 5DTBA 2QPQA 2CA5A 2LEHA 3M3ZB 3SEXA 1YXRA 1KA0A 4M1VA 1POY1 2NOOA 1QW0A 2WMOA 3DP8A 5TP9A 3RYDA 4U3CA 1Q1KA 3KVBA 1QGXA 2GRVA 3K1NA 4IE6A 4JI0T 4YSYA 1S50A 5I3SA 3RHWA 4Z8XA 2VPNA 1SVXB 4H65A 2G93A 2W66A 2XZEA 4LF5T 5TAOA 2CWYA 1MMDA 3IHRA 3BFTA 5KCJB 5JTYA 2JQKA 4F3GA 3UU6A 3P8CD 5HCMA 3K1SA 4HE8A 4FATA 5LG4A 1Y64B 4HWCA 1H44A 3L6GA 3TCHA 1ANFA 2ZZWA 3LFMA 1W9RA 4R9GA 3RYFE 4YY3T 4H8IA 4EAHA 2XM1A 5L3EB 2B3BA 1L0VA 4N17A 1HNZT 3FXRA 1XOCA 2VD2A 2A5TB 2H25A 4Q30B 3N9PA 2I0BA 2QS1A 3PV0E 4MAGA 4KYEA 5ET5A 1OEDB 5LXTE 4KPTA 4NTLA 4LZ7A 1D1AA 2M8CA 3N26A 2Y7RA 3N9QA 5EYGA 3BQKA 4FORA 1Y1ZA 1SW5A 4HCWA 4U1OA 5EQAA 2BBJA 1LKXA 3OVUA 1Y3PA 2E8IA 5EHSA 3IOVA 5I56B 4GBVA 3ZS6A 1AIVA 2E9XA 3QSLA 2NWBA 4O7IA 1JEVA 4UVAB 2XXKA 5DEXB 4NG7A 4G8MA 3VDFA 4IE0A 2YU1A 3ZLIA 4G63A 4EZ4A 1OMPA 1BLFA 3TDJA 2XQ3A 3MSTA 2C5JA 2V8SV 4F22A 3KSJA 2HZKA 5IAIA 1T98A 1QUKA 2N1GA 2BG9B 1HS7A 3AE7A 3ONJA 3UULA 3KN3A 4GX4A 4KI0E 3VLWA 3ZKKA 1YYZA 1JEUA 4YKIA 4UEMA 1MXZA 1T72A 1W09A 4U2RA 4N4UA 1PC3A 1SD3A 2XXTA 1N0TA 1EZ9A 2N9DA 3ONXA 3TCGA 3EHUA 2IC6A 2LLYA 3GBBA 1IJ6A 3NZPA 2CLYC 2V25A 1HCIA 4XEQA 2F34A 2CMOA 2XXHA 3FATA 3J9X1 3MXZA 4HFHA 3H3GA 1GR2A 4OVRA 3V5UA 4KD5A 2V3QA 3AEEA 3G7WA 1WCRA 5FVLA 1IXHA 1KWHA 2VKOA 3QAXA 1LSTA 2NTXA 5JDQA 4MJOA 2B1EA 2O68A 1MPBA 3F11A 1XNQT 2IA4A 3LSXA 2NP9A 3PUAA 2X0YA 1D3KA 3OJAA 1HG2A 4XFEA 5LB7B 3I9WA 1MMGA 1O63A 3A5XA 3KV6A 2QS2A 4XKQA 1WRDA 1KA1A 2LKHA 4GRKA 3GXAA 3FBLA 2O7UA 2WS3A 1YXIA 1KFYA 2OK2A 1FQEA 2ZMAA 3PUQA 2Q9QB 3H3AA 1BK4A 4MLKA 4V1Av 4PBHA 3O9XA 4JI4T 2O6AA 4G8HA 2UXNB 5TU0A 3RNNA 3CR9A 2PBIA 1LVKA 4X62T 4JSDA 4A97A 4MH5A 4AQYT 3T9VA 4AQGA 3ILUB 1QUUA 2DNXA 3KVAA 3SETA 1CNQA 2Y7WA 2HFBA 3U72A 4MNIA 3I0OA 1SHZC 3K6WA 4MHFA 3PUVE 1UX5A 4JBWF 3LK2B 5ISUA 5HXHA 1MY4A 1IMDA 1NUZA 4L0RA 2QSXA 4MCOA 5AQMB 5HXRA 4N8GA 1TFAA 4FIMA 1R1NA 2ODUA 4DV4T 4KHZF 1GTKA 1NMUA 4F3SA 2IAKA 3OOAA 1Z7NE 4NUVA 5ADXL 5LBMA 2XD3A 3SOLA 5CBRA 4DUZT 3UN6A 5F1QA 1ZBMA 2PT2A 5IKBA 3O1JA 4H63V 1N76A 3PUYF 1FBDA 3N2GE 2V93A 2WCAA 3H4ZA 3M3KA 3ESLA 1P1WA 2MYSA 1RKMA 2NW7A 3ZC1A 2OX3A 4YB7A 3T9XB 2F4VT 4QRZA 2R6GF 2VT5A 4UACA 5T3JA 3AEDA 2YJPA 5B70A 4TUYE 4DR7T 1NAFA 3RQUA 4OESA 3DTOA 4GWXA 4N6PA 2ZM2A 3MZKB 1JVYA 3EHSA 3H03A 4EYUA 3KZGA 3OBVE 4JVIA 3EUHA 4U4XA 4AS5A 3AE5A 3T93B 5AQKB 2O51A 3ANWB 4UELA 3K00A 3G3IA 5L9OA 1VR5A 1BR1A 5AQTB 5FXVA 1MXYA 5H6RB 1XVXA 2H3RA 2NUVA 3TTLA 1LB9A 4O3CA 4DV3T 3IOUA 1NH7A 4U21A 1FPJA 1XWMA 4P56A 2FIXA 5I59A 5DVJA 2KLQA 4ILAA 3JCFA 3W15B 3T9UA 4QFOA 1IZ1A 2GQ1A 4MBPA 2GHAA 2OBGA 2V5CA 4U33A 3UUXB 2PVUA 2WDRA 4IREA 3ZT5A 5HXSA 3CSBA 2Q8JA 3N2OA 3PUSA 3TKLB 5L2LA 1FQAA 3H06B 5EZYE 1Y4TA 2PFZA 3P4PA 2OZZA 4GBWA 1H7CA 4B6XA 1B40A 2B3FA 2V3TA 1AJ3A 3X1DA 3UT5E 4MIJA 2V7IA 3E0ZA 1FQDA 5ET8A 4OFOA 4PFBA 4XXUA 2H7VC 2HZLA 3JC6D 2LE8A 4DBRA 4OZ9A 2UXCT 4PDHA 1US4A 1WLXA 5BR8T 2DS9A 1EH3A 2XX9A 3W9WA 2D5WA 3E4RA 5EK3A 3Q5XA 2BVLA 4UVCB 3IAZA 2Q9QA 1HSLA 3BIHA 3PPRA 1LB8A 1Q9DA 4EXKA 2L9QA 3SFDA 2AXDS 3RYHE 1YPNA 3RT6B 4YTNA 2Q89A 5EHMA 3TTKA 5LOMA 2QA7A 4YLHA 5LMUT 2JRKA 3N9MA 1FTKA 2VP1A 1MQHA 4C91A 1NENA 1QVSA 4PFWA 2LSJA 3B6QA 2JQHA 2H89A 4ELOA 4EUOA 2XQYA 2XQ4A 2WYKA 5FY7A 1JW1A 2XAHB 4QX8B 2V6XA 3ZYMA 4EZHA 3KBZA 1AH5A 4GX6A 3SESA 2XY8B 1P1UA 2P3NA 2ACXA 4IO4A 3RKOA 3CX6B 4OVQA 1FTOA 2QRYA 2Q74A 4NPPA 4N6KA 3VE1B 2O84X 4F3BA 4JUYA 4ESWA 1T0KA 5F5WA 3NWIA 2X9XA 2MAWA 2F7BA 1IQ7A 2O7IA 1BR0A 1T8BA 4UA8A 4BDQA 4HGAA 4NQ8A 3ZCJA 2KSRA 1XT8A 1GGGA 3W9VA 2WYPA 3B50A 4RNSA 3A3UA 2X7PA 3CVRA 3MQ9A 4JI7T 2IW5B 3AA1B 3QUJA 4YZZA 4NE4A 5HXEA 3LDQB 4AB5A 3KV4A 1TT1A 2RC9A 4ONYA 2F5XA 2K9AA 2BKOA 2UYFA 4R73A 3MZBA 1FSAA 2Y7IA 1YTVA 3FV2A 2DL1A 1HX1B 5JR9C 1XVYA 5L3CB 5LTCA 1I6QA 4OFZA 1HG5A 3RLFF 4DR2T 4M4GA 4GOUA 1B0HA 3HL6A 2VPOA 3IA3A 2F78A 5FMNA 3NBXX 2LSGA 4H9PC 3HKEE 3I0QA 4G2AA 2K24A 3S4UA 3TAJA 1FIOA 4PE3A 4F8HA 3PJAJ 4R6YA 4AISA 4GD5A 3T1YT 2X0HA 4JVDA 1SBPA 3IFAA 4P0GA 1FPBA 2M6BA 2BDEA 4EEDA 1ZJLA 1BR2A 2VL0A 5K2XA 3KBUA 3P4QA 4IE7A 3RYIE 3FXUA 5AFUL 4YHJA 3LV0A 4FJOA 2ZMBA 2RKMA 2BS2A 5CA0E 1XS5A 5FHMA 2WY2A 4IDQA 4B3TT 2WP9A 5DQWA 2WKYA 4M1PA 4JI2T 1NV7A 2P3VA 4ZI3D 3OKQA 3IFCA 2VVSA 2ABHA 1M7KA 1DOTA 3RH3A 4XKNA 2BVMA 4YAHX 4QSCA 4OXVA 4JBZA 3RRCA 3H37A 1Y1MA 1YD8G 4POWA 1LFGA 4RA1A 4QHQA 2RINA 3AEGA 4IY6A 1LBYA 3KGCA 4ZEYA 5AQRB 1LEVA 3IB0A 1B05A 3CQXC 3D1RA 1FTMA 4WW0A 1ZMGA 5TP9B 2DDKA 3PU3A 4YICA 2K5BB 1XNRT 4I40A 3SEYA 4ZZCA 5ELVA 1ZKEA 4EV6A 2HXWA 4YB5A 1OXZA 3T0JA 2R9JA 3U1OA 4KX6A 1VCSA 5JTYB 1J1NA 4YTPA 1NUYA 2DXYA 1LFIA 3KC0A 2RCBA 1X9BA 3OD7A 4B3RT 5FP3A 4QXDA 4FE8A 1NV6A 3LK3B 3HKBE 2W00A 4ZXLA 1MQJA 1FTAA 4DBQA 4AKIA 4MLVA 4LMLA 3BK9A 5TPAA 1YW0A 3RI5A 4HW8A 3C64A 2I58A 3QMFA 3USDA 1HNXT 3ZMUB 2OWZA 2W2UA 3KDSE 3ONMA 5L3GB 1NNFA 4ZZEA 4I0UA 2X68A 2P9BA 4AQ4A 3HN0A 2F7AA 3IBPA 1O7TA 2L3LA 4MEVA 4Z7EA 1H45A 5CFBA 1EYJA 3IX1A 1D9QA 3MWBA 2BKNA 2DWAA 1UTBA 4C0RA 5LMNT 2KR0A 4OANA 2FJDA 4QBAA 3FXDB 5DQVA 2HHHT 4GK0E 1EYIA 1JW4A 4ILUA 1OEDE 3TQLA 3FJGA 1OWAA 5L4HA 2RA1A 1IXIA 4DXUA 2JJKA 2E9XB 3PMVA 3M3FA 1LBVA 3MK7C 4O8SA 1MIWA 5L3FB 1B3FA 3L3PA 1NH8A 4G77A 3FVGA 3SRZA 5L3BB 1SE7A 3IOTA 3IORA 4X1KE 1IMAA 4JV5T 1G0IA 5ETWA 4F2OA 1FMVA 3FXEB 3M3LA 4KUMB 5LGTB 1SPIA 2JMKA 2XAJB 3SEUA 3KN8A 1QLBA 3HHFA 2I59A 3E3KA 2LT3A 4ISUA 5AQJB 5JK4A 1FBEA 2K48A 4ILBA 3AECA 3V89B 3FZHB 2ALUA 2FIEA 1FPLA 4R6HA 3RPWA 4WZXA 3PU5A 3K01A 3QIMA 5AE4A 3QB5K 4EGWA 2ZNSA 3KFMA 2NW9A 2BG9E 1FPGA 1R9LA 3I6VA 3U65A 3C50A 2CMRA 4AKGA 3K2DA 2XHDA 2FVZA 4PFTA 3FZMB 4THIA 3RIUA 1A7LA 2V4CA 5HM4B 5H8SA 3PUZF 4YT0A 4DMVA 1SUMB 3NOHA 3K1PA 2JQ9A 2KLFA 3UUMA 3CSGA 1GV8A 3GN5A 4YXDA 5CRYA 4U22A 3SFEA 2Q8MA 4OTEA 3BQLA 4ZI7E 5LHGB 3O6GA 2UUBT 3UU5A 2O69A 5CMMA 3KG2A 1HSEA 3C4MA 3UK4A 1WR0A 4RY1A 2RC8A 2LSKA 1RDXA 4JWXA 3LG7A 1GQEA 1J5ET 3NRXA 1KNPA 3J7Yq 3FIRA 4HS7A 3E9XA 1LFHA 1K9ZA 1TWYA 4A98A 4HTEA 2I6EA 3E79A 3RPLA 2VVNA 4DI4B 4MBQA 2JPFA 2LM9A 1SYIA 1Y3NA 3TTRA 1O64A 3RC3A 5HEJA 1FJ6A 5IYZE 3LSWA 4I62A 5I58A 3P50A 4L5GA 3RC8A 4LFBT 1Y9UA 1L5TA 3ONLC 4E0XA 3IO6A 3DM0A 3AE9A 3FB2A 2QVVA 3C4XA 2XSBA 2NXOA 3H6TA 4HFBA 2VOZA 3HPIA 4O8MA 1JW5A 5IWAT 2UXXB 2YINA 2XAFB 2I0MA 4LF8T 3RT8A 3FXBA 1NKXA 4HFDA 4MLQA 5KMGP 2F3DA 4TN7B 3AB3B 3Q5WA 4OETA 4CI2B 3EDUA 4EXTA 1IXCA 2X9WA 3E08A 1ATGA 5A5XA 4F3PA 4WBNE 5CMCA 3L09A 1US7B 2ONRA 3PTYA 3UQ4A 3A09A 3CFZA 2OJTA 2QVAA 4QH5A 2I4CA 3AE2A 3B13A 1KZ8A 5I2NA 3U3IA 2E5LT 2X51A 4P0AA 4GIZA 1AWBA 3AE8A 4P09A 4DNDA 4GX3A 3KBRA 3EI0A 5H6QB 3R6NA 4O2AE 1Z8UA 2KT9A 4IGUA 4POXA 2KINB 1RDZA 3F2EA 4ZOLE 1IMCA 4IO3A 4DO0A 4GVOA 2O1MA 4X1BA 4AKLA 1B4ZA 1TXFA 2OWSA 2W0GA 1Y4CA 1NFTA 1N7XA 3ROJA 2PBWA 3CFLA 4ERRA 4TWHA 5HEGA 4FEBA 2PX1A 4ND9A 3MA9A 1B3GA 2W7YA 4RJZA 4QSEA 1MQDA 2X66A 4IT4A 3B6WA 2XQ5A 3BKIB 4OERA 2A5SA 3QXMA 3C4ZA 4QXBB 1MQGA 5FYMA 5CMKA 3VV5A 4YHHT 4DE8A 5AA4A 5I5PA 2G29A 1LAHE 1M5BA 2XTLA 4TQUQ 4WKMA 4OX9T 4GXAA 3VVFA 2CBJA 4WEPA 4U74A 4ECFA 4EYYR 3ILTB 1B9JA 2X9HA 2BJIA 1B6HA 3A29A 5H8HA 1JNRA 4NF8A 5IZ3A 2PCRA 1PBPA 2XXQA 3KV9A 2NR4A 3KFWX 2D21A 1I94T 4EF1A 3OSQA 3JAEA 4A56A 2YDQA 5F3JA 3THIA 2AYSA 5I59B 3CRBA 4GWSA 5FXXA 4AQFA 1U4QA 3Q5DA 3O28A 3HCQA 4QXCB 4ZEIA 5EK4A 2B4MA 1NUWA 2YPNA 1ZIUA 3T66A 4OENA 4YKJA 3AXJA 1IBKT 3MVZA 4AQFC 2Q9QD 5CGMA 1AOVA 5FXZA 1U5PA 2G0UA 2OWTA 2VD3A 4JXIA 3DLNA 4P8BA 3O2AA 4G68C 1SW2A 4UV9B 3MKDA 4FEDA 4LZ8A 5LBQB 1HR0T 4KCCA 2ZM8A 5HXCA 1N3XA 2QGSA 4X1YE 3UUNA 3N94A 3C36A 3HHGA 4O2BE 3MJNA 4HTGA 4Q0CA 2VKDA 3QNUA 2EHOC 2H88A 2REGA 2OA5A 5F8PA 2WAUA 2ACZA 2PMSA 2E5VA 2WBBA 2XSAA 2LHRA 1FJGT 3FBZA 3O66A 3T9HB 3PD8A 3PE0A 4IHJE 1R6ZA 2DWHA 2YU2A 5CJ5A 2BJJX 5DW8A 5L3DB 2HPLA 1O3XA 2FHYA 5LCYA 5HYAA 5JVDE 3OYXA 5L8DA 4JWOA 4F19A 1FBFA 4ELRA 5AQFB 5LGNB 1LGBC 3IK6B 3G06A 4EOZB 3U78A 3LSLA 3N6UA 4R9FA 2E1SA 4TLLB 4X48A 2VGQA 1LCTA 3PU8A 2XQ6A 2XUEA 1FTJA 3D0TA 1A54A 4GWZA 2FNCA 5JDGA 3PUXE 1FEWA 4ADZA 3ZYKA 5AQSB 2P0SA 4ZI2D 4X8RA 2PFYA 2XJ7A 3OO7A 2VQFT 2L5VA 3M8UA 2XWOA 2I48A 2DE3A 1BKAA 4KBMB 3OO9A 1UIUA 1B5IA 1LAGE 1X79A 3T1HT 2UVIA 3RLFE 5JDFA 1ZEEA 2UUAT 4NXMT 1IIWA 4L9IA 5ET7A 1JNFA 4HWIB 1MIYA 2ZYMA 3FZKB 1URGA 3FVOA 3G3FA 5ITPA 5IHYA 3EN3A 1XC1A 3UIFA 5CC2A 4AKRB 1UUSA 4JI8T 1NI9A 3DP4A 2DVZA 1DBZA 4BA9A 3BBRA 4MF3A 3OEKA 5I84A 4I9DA 3BIGA 4QH4A 1FBPA 4ESXA 4XIGQ 5LYJE 1SW1A 4QFNA 3E13X 5CA1E 1VRBA 2R71A 2RP4A 1OEDC 3P4WA 4QKNA 1B7HA 1A99A 4AXPA 4P1NA 4KHPT 3DP7A 2QYWA 3GWHA 4R74A 3O97A 4OVSA 4OWDA 5M4YA 1R9QA 1B32A 4PW8A 3S9LC 3PV0F 2YN6A 4ZS3A 1W0AA 3K6XA 5AQHB 5AQVB 3GLBA 3KINB 4PJNA 1H43A 4EXLA 1MIVA 4LMKA 4IO7A 2WU2A 3BQIA 4DV1T 1LBCA 1USYH 1QJMA 2V5DA 3KOTA 4C1UA 1ZHCA 3KBTA 4K0UA 3U93A 4QFLA 5JTGA 3T1BA 4NXNT 3PURA 4UR9A 2KNDA 3IL1B 3I5OA 3U8QA 2QS3A 4LONB 1XDPA 4J2CA 4ISSA 2F8DA 4OEUA 2BG9C 2XQ9A 5CB4E 3PGFA 1WVJA 4IDZA 4YJ3E 3QYTA 4EIWA 1ELJA 3ZSSA 4JB7A 4ELQA 4MFRA 4YKKA 1FPIA 3LJCA 4NF5A 4IO2A 4DI3D 2IMLA 4OYVA 3RN8A 3PPNA 1PB7A 3VXCA 2HN1A 4GL0A 4DXBA 3TLVA 3O4XE 2VL8A 1I6BA 2ZLYA 4KI0F 2DE2A 4H46A 4UF0A 4F31B 3OELA 3G3HA 4LATA 1MM7A 2WX9A 4F1YA 2DHRA 2RCAA 4O4IE 2ONKE 1DPPA 3O6IA 4ZDMA 3AEBA 3SS1A 3TKDA 5KDTA 4JEHB 3ZYLA 3Q27A 2DWJA 2WBDA 1LAFE 2A3DA 4F39A 2XAGB 1FRPA 4DCYA 4LF4T 2H7OA 2I0CA 2KQZA 4YMAA 4NN3A 5TPAB 1MDQA 4O3BA 1D9VA 5IM2A 2ZZVA 4IB2A 3B7DA 2UVHA 3PJAA 1B2HA 4EQ7A 2WWUA 1MY1A 1MNDA 3PPPA 1XI6A 3O6HA 4GLIA 3IF8B 5DT6A 1QULA 5GONE 5ITOA 3Q28A 1EZ3A 1VOMA 3CIRA 5FL0A 1ZU0A 4LN5A 1FBCA 1EU8A 2WB5A 2Y7PA 1MRPA 4CXWA 1UTBB 4OFLA 1HF8A 4GF8A 4DR6T 4GWUA 3RRWA 3FZFB 2KZ7B 1H76A 3TUSA 4H6DA 1B52A 4CI1B 4XAXB 3KOSA 3K3NA 2LM2A 2XXWA 1FPKA 3R26A 4LUBA 3HSTA 1J5WA 5JR9A 2DSFA 3K0VA 2DWGA 3R84B 3CVGA 3FASA 1PEBA 4HFIA 2HEUA 4EQ9A 3AA7B 3PD9A 4LP2B 4JEUB 3ZMSB 1B7TA 2QMWA 3LBXA 3EF7A 4KXPA 2Z23A 5AQIB 1FQCA 4RK2A 2CWOA 4NHBA 3VKGA 3Q9DA 4GWYA 1D1BA 3RF1A 5LOVE 4L17A 3SEWA 4YSZA 5L9MA 3G3GA 5ET6A 2DWKA 3ZC0A 1IMEA 2F6GA 2V26A 3PMWA 5ABHA 5ABFA 1IMFA 1B7ZA 4KYSA 4X9TA 1NV0A 3RTFB 2IDOB 3HKDE 2Y5LA 4F18A 3HV1A 4N8YA 3B5MA 3UA8A 3IR1A 1WYBA 4TNWA 2HPGA 4MHCA 2XM2A 4NF4A 3KV5A 4LFAT 1S35A 4ZE9A 1RYXA 3LBSA 1II5A 2ZYOA 3OXNA 1SA0E 1IZNB 3RIAA 2UVGA 4IIJE 1A8EA 1US5A 2WZHA 5H8FA 4XKPA 4H0WA 3FGSA 3AAAB 4G4PA 4H9OC 3VRAA 2W67A 3GN5B 1PB8A 4TV9E 5HEUA 5J16A 2IC9A 4JI5T 3K3OA 3CI8A 3CPZA 4PK6A 3SERA 3GYYA 2J62A 3RX6A 2Z8DA 2V7MA 1CUNA 4DR3T 3WI3A 2QVRA 4XF5A 3OSRA 3VVEA 1FTLA 3RGLA 3B8BA 4LF6T 2ZYNA 4R72A 3GZGA 4X1DA 3TPAA 2H99A 2GHBA 1YQ4A 5H8QA 2IHR1 3MZ1A 1LRZA 3NKZA 3O1IA 2QFLA 3AEFA 2FBPA 3FVNA 3RGYA 1EZOA 5J2UE 3FVKA 2D2SA 2PJQA 4IGRA 4FJPA 3RPLB 1Y01A 1B3LA 3K1MA 2Y48B 3QUFA 1NEKA 2CXLA 2R8TA 4GFRA 1JETA 3Q2MA 4P0BA 4DV2T 4AI6A 1Q35A 2Y7KA 2Q2AA 2FJAA 3RTWB 3W15C 5I58B 4CQIA 4QX7B 3QK6A 2CPTA 2H5YA 2Q2CA 4PJJA 4JYAT 3H6UA 3FJMA 1SQYA 1IXGA 2CHNA 2X9YA 3ZN0B 2XD2A 3Q5EA 1MMAA 2XX7A 1MDP1 2HQ0A 4K0KT 1D0ZA 4RPNA 5EYHA 3EDVA 2WQYA 1OQGA 3MVWA 3C9HA 2DI4A 1MPDA 5A5XB 2CEAA 1ZTYA 2NWJA 3H6WA 2B76A 1G0HA 2E9XD 2F35A 4DR5T 2AIXA 1HFAA 3GBAA 3L6HA 1I6ZA 3G3KA 1LCFA 4ZE8A 4ZEDA 4JWYA 2ZM0A 4U1ZA 5I2NB 4HKAA 2LOPA 4GKJT 2XXVA 4P47A 2JIWA 4WEDA 4KYDA 2XASB 3E78A 2OV9A 3AE6A 2D9DA 4U7IA 3IB2A 1ZP0A 4N6DA 4X04A 4PJLA 3P7IA 4XZCA 1AMFA 1PBQA 2CHOA 4YSXA 4F6RC 5JEIA 4MALA 3IJXB 5KZTA 2VKHA 2RC7A 4ILCA 1VDWA 3UORA 4CXXA 3GMIA 1H3DA 1NNKA 4IL9A 4N91A 4P0IA 2MOZA 2YK0A 3Q25A 3LR1A 5ABGA 3I1AA 3JC6C 2NTYA 5AA4B 4OQOA 5AA2A 5LGUB 1B51A 2F97A 2LSYA 4U31A 4N78D 4IDOA 4O4HE 2XXPA 5AA3A 2GFEA 3RPUA 2HH7A 5ICTA 2ESNA 1SW4A 5H8HB 5ICQA 1E2AA 5FL1A 4XKRA 3I9YA 1M5EA 4N07A 4HE2A 2W63A 3T96B 4NF8B 4I1DA 1UTHA 5IZ3B 2ZM6T 3KJ7A 1VSOA 1FPDA 4P9KA 5BWJA 4PF6A 3O1HA 3ZMVB 3O9PA 3TTNA 4I43B 4NF6A 2CLYB 2XXRA 2HXRA 3D4GA 5ESYA 3F31A 3AEAA 4YMBA 4PFPA 1EYKA 2XWKA 2NW8A 1WDNA 5FY1A 3CWZB 5LHIB 3MPKA 4P1LA 2KMFA 1D0YA 1G8XA 4FBPA 3AXJB 2BKPA 4C1TA 4H8JA 2I3VA 5F24A 4G68B 5I57A 3A3CA 4PNIA 4IGTA 2D0TA 4G8NA 1B7UA 5FNVE 1UK5A 1B5JA 4HE1A 3VVDA 4BDOA 2F6PA 3AAIA 3V5SA 1DSNA 4CN1A 2Z6EA
chains in the Genus database with same CATH topology
2ZNTA 2VB6A 5EYFA 2E0SA 4OVJA 2QL3A 4ZZAA 1BIYA 4IE5A 3FV1A 4HCYA 3V5AA 4FAJA 3H6VA 3IJOB 3VLUA 5I2KA 4H9SE 4X20E 4UXNB 3K6UA 2DE4A 1WYCA 2N2NA 5JH7E 2J1DG 3GA8A 3MVXA 2CM0A 3TODA 4NWCA 4QSDA 3RQTA 3IOWA 3JYRA 1HTJF 2VASA 5BMVE 2PG8A 4YU0A 3C35A 2JJ9A 3B6TA 5BUUA 3ZN1B 1F9BA 3TTMA 3HKCE 1S7YA 4KHZE 4PFYA 5EK2A 3KN7A 3LUYA 1HSJA 4JSOA 2Y84A 2W62A 1B5HA 3TEPA 1MXXA 2H9BA 3PUYE 4DIGA 4TV8E 4H9QC 5CBSA 3AVSA 2ES0A 3IB1A 1MMNA 2XHEB 1B1XA 4I4TE 2F7CA 2X26A 3E22E 2R6GE 1LBBA 1IAPA 4GYRA 5J1GA 1MH4A 4ZI3C 3C51A 3FUZA 3ZJ1A 2HPJA 4GL8A 1OLCA 2DLRA 4CXYA 5FTHA 4XTCQ 5HAXA 4EQBA 2NOXA 3MZ9A 1XHYA 1MH3A 4PJMA 3PDYA 4DXCA 2A72A 4PFUA 2QS4A 3FXQA 1Z0PA 3U94A 2I4BA 2QJEA 3FD3A 1MM6A 1HX8A 3VFJA 2I3WA 3FHNA 1KNZA 2FYIA 4RXLA 1MPCA 3KEIA 4RYAA 2YLNA 3IEEA 1N84A 3KSXA 4H5GA 3EQ1A 3WAEA 4H9RC 3EHTA 5CI5A 2FA7A 3HA4A 1A8FA 2D3IA 2BZBA 4F29A 3ODBA 2LOSA 1FQBA 2H98A 3CG3A 4EDPA 2E9XC 4IO6A 2JQQA 4F1UA 5C8YE 4QFPA 4ZS9A 3MACA 4E7SA 4PAGA 2X7QA 3EPEA 1MQIA 4DDDA 1MXWA 2F36A 5JDHA 4LA9A 4G68A 3D4CA 5H8NA 4OFJA 5FXWA 2XXYA 2XXIA 3C33A 4G2ZA 4FI5A 1P1OA 3CG1A 1NNTA 4NF5B 4P11A 4OHFA 4RPOA 2CE7A 2EHOA 4OK0A 4GOTA 2Z8FA 1UQWA 3S9MC 1DTZA 1DMBA 3SEVA 3TCFA 1IJ5A 4UF0B 3ETVA 5HPQA 1SI1A 1MY0A 5JRCA 4TOZA 2P1SA 3VU7H 5M2VA 5KDTB 4DMWA 2LHNA 2Q9TA 4ZHQE 1QSDA 5AA1A 3N6TA 1OVTA 3QC9A 3CMLA 5F7VA 3U92A 1QKAA 5J1DA 3MUQA 2PFVA 3UTKA 1B3EA 4PETA 3CQGB 1UX4A 2XAQB 4AB6A 5LA6E 2KWHA 1CB6A 1VFDA 4NEDA 1P1QA 1N04A 4EB6E 1B46A 2CXFA 2Z8EA 3M65A 2HAVA 5KCJA 3N2KE 3Q26A 1QKBA 2QMXA 3ZPOA 5DYHA 1FCKA 2ANJA 3MP1A 4GQOA 2V84A 5JR9B 3VLVA 4NWDA 5K2YA 1GVCA 4OEVA 1QUIA 2M67A 1LAXA 4TLMB 1MY2A 2V7JA 2A5TA 1YCJA 1SYHA 3MAMA 4GWOA 1B1HA 2ZNUA 4OYKA 4CI3B 2V7LA 3LBXB 4NMYA 2D5UA 5HBCA 3VXBA 4BLAA 3DJBA 1I6AA 1ZKBA 2C5IT 3DELB 1I69A 4LZ5A 3V8XB 1WR6A 4O3AA 5JDLA 4U72A 2GH9A 1POTA 4I8CA 4YB6A 2ONSA 1DPEA 3K3QC 5I56A 5JQGE 3SKPA 4NF4B 2DXRA 4XBFB 4KMCA 1JQFA 5DEXA 1URSA 3T8OA 4R2FA 2L8KA 3MW0A 5H8FB 2Z22A 4QF9A 2WSSV 3LC8A 1P99A 1S94A 1BTJA 4KR5A 4PP0A 2LAOA 2VK9A 5B7DA 3HR0A 4GIWA 4BDMA 2HAUA 1NL5A 3Q29A 4R2BA 3MVYA 3LK42 3MPLA 4EF2A 4ASKA 3CFXA 4C90A 3MP6A 1FMWA 1YKEB 5H8QB 4O4JE 4O4LE 1IEJA 4PK4A 3UGWA 2DYXA 5LHHB 5HWXA 2D0UA 3DP6A 4WNKA 3VKHA 1S9TA 3RYCE 4JLEA 5FHOA 4YKPA 1MNEA 4H63H 4Z0IA 3S9NC 2NVUB 4R75A 1B4HA 4IE4A 5DABA 3UFEA 3ETUA 2SPCA 2LJLA 4TX5A 1D0XA 1IITA 5LJMA 4ANJA 1M5CA 3ZMZB 1D9YA 1TFDA 3SDFA 4WBOA 5FHNA 5L9SA 2C0SA 3WAKA 5JDMA 1SDXA 1PB9A 4IY5A 2WBLA 4ZEKA 3N9NA 5AA2D 1MS7A 2X0LB 3G3JA 3TMGA 3K8PC 2X67A 4HN9A 4JDFA 2Q9QC 2XXUA 3ZJ2A 5LJNA 3N5LA 3T22A 1UCUA 1B3HA 2AL4A 2C5KT 3PTRB 3C32A 4BDLA 1M5FA 4LVQA 4PQJA 5J2TE 4IO5A 3AA6B 3K02A 1AL3A 4QWNB 4QHOA 1OIBA 3R6UA 5AA2B 5LP6E 3MP8A 3OO8A 5KDMC 1A40A 1ZLQA 3MJXA 3OYZA 3PPOA 5JREA 3PUZE 5DVIA 3I3VA 2DP8A 4KCDA 2MBGA 4BJNA 3OENA 2V7KA 2VWAA 4ZEFA 2ODVA 2REJA 1ZV4X 4BDNA 1UTHB 5DVFA 2Q88A 2B65A 3OO6A 4I50E 5CMBA 4NF6B 4LQ2A 1OLAA 1QUJA 2AL5A 4AKHA 2CCQA 4R6KA 1P1NA 1NWMX 3ZSFA 3OMBA 1YKHB 4TZ4C 3MC2A 2LSIA 1VE4A 5LNKA 2VKJA 4ZEBA 5JDNA 4ZI2C 5I57B 4UVBB 3AA0B 4PK5A 3IO4A 4FECA 4BAYB 3ANWA 1MY3A 4GXSB 2MTQA 2DOJA 4K3FA 2XX8A 3TELA 1NNPA 2H4IA 3RY3A 4YFSA 4H67A 5I2KB 2JMHA 3UP9A 3B57A 1PDAA 2V3UA 4DCXA 4BJMA 5CM6A 1A55A 3WAJA 4OYJA 4Q8RA 2OCUA 3S2VA 3ZMTB 4X1IE 1BR4A 3SWHA 3PPQA 3CQCB 1MXUA 3FJ7A 4UIGA 3C98B 2VHAA 1KK7A 3TYHA 4U23A 1OVBA 3FZVA 4E7ZA 1FQFA 3C31A 3NZQA 4DLDA 2W61A 1MXVA 5A1LA 4QXHB 4KQPA 3CX7B 4WXJA 1WODA 4OMBA 3H7MA 3NRYA 3ZCIA 1JVXA 2DQVA 2P2AA 4DZ1A 5KX5E 1M5DA 1N3WA 4HFVA 2IEEA 2ZXTA 2UYEA 3N9OA 3CKDA 4GYSA 3TQWA 1Y3QA 4H5FA 4Q5TA 1BP5A 3PUWE 3ZEFB 2KXPB 1B0LA 1B58A 2CXDA 5FY0A 1FW0A 1E1HB 1LLSA 2WM9A 3BFUA 5DJQC 3ZKLA 3K6VA 1N7WA 2KWIB 3PUGA 2HCAA 1YAEA 4NUUA 3AAEB 3HO7A 4CZZB 3V83A 3F57A 3TFLA 2RF1A 4H1XA 2DWIA 2WMNA 1Y20A 4ISTA 4KFQA 2O1LA 2V1DB 2YEVC 1G73A 2OLBA 1OQHA 4HEAA 3RUMA 1D1CA 1RYOA 3CIJA 2Y6XA 3CX8B 5FTIA 3R7XA 1IUDA 4MFIA 3VHLA 3ECRA 2EHOD 5E0OA 1URDA 2ZYKA 4ZECA 1LVFA 2PT1A 3HI2A 2PYYA 4YJ2E 4GK5E 4DVDA 4RK9A 3LSFB 4I55E 2UXAA 1V9DA 4KP3C 3WAFA 1EZPA 4E0WA 4UV8B 3N9LA 4BDRA 4F1VA 1USYE 2XXXA 5H8NB 1SI0A 3AXFA 3MBPA 4N13A 3EVYA 2UVJA 4ELPA 3KJTA 2I49A 3JV9A 3O29A 3S9EA 3JZJA 2GK9A 3C34A 2THIA 4PE5B 2DVCA 2EHOB 1VFEA 1Z7ME 4PFOA 4QFKA 4U4SA 1MG1A 5HWYA 3TZAA 4OHNA 2DCFA 3AVRA 1UIVA 1DTGA 3C4WA 2Y8DA 1D4NA 5JRCB 4H9NC 3PMXA 1CE2A 4LQ5A 4F2QA 2A2FX 3OEMA 3K4UA 2CZLA 4ZS2A 5DTBA 2QPQA 2CA5A 2LEHA 3SEXA 4M1VA 1POY1 2NOOA 1QW0A 2WMOA 3DP8A 5TP9A 1Q1KA 3KVBA 2GRVA 3K1NA 4IE6A 1S50A 4Z8XA 4H65A 1SVXB 2G93A 5TAOA 2CWYA 1MMDA 3IHRA 3BFTA 5KCJB 5JTYA 4F3GA 3P8CD 4HE8A 4FATA 5LG4A 1Y64B 1H44A 3L6GA 3TCHA 1ANFA 3LFMA 4R9GA 3RYFE 4H8IA 4EAHA 5L3EB 2B3BA 3FXRA 1XOCA 2VD2A 2A5TB 2H25A 4Q30B 3N9PA 2I0BA 2QS1A 3PV0E 4KYEA 5LXTE 4KPTA 4NTLA 4LZ7A 1D1AA 2M8CA 3N26A 2Y7RA 3N9QA 3BQKA 4FORA 1Y1ZA 1SW5A 4HCWA 4U1OA 1LKXA 1Y3PA 2E8IA 5EHSA 3IOVA 5I56B 3ZS6A 1AIVA 2E9XA 3QSLA 2NWBA 1JEVA 4UVAB 3VDFA 5DEXB 4G8MA 4IE0A 2YU1A 3ZLIA 4G63A 4EZ4A 1OMPA 1BLFA 3TDJA 2C5JA 4F22A 3KSJA 2HZKA 5IAIA 1T98A 1QUKA 2N1GA 1HS7A 3UULA 3KN3A 4KI0E 3VLWA 3ZKKA 4YKIA 1JEUA 4UEMA 1MXZA 4U2RA 1PC3A 1SD3A 2XXTA 1N0TA 1EZ9A 2N9DA 3ONXA 3TCGA 3EHUA 2IC6A 3GBBA 1IJ6A 3NZPA 2CLYC 2V25A 1HCIA 2F34A 2CMOA 2XXHA 3FATA 3J9X1 3MXZA 3H3GA 1GR2A 3V5UA 4KD5A 2V3QA 3G7WA 1IXHA 1KWHA 2VKOA 3QAXA 1LSTA 2NTXA 5JDQA 2B1EA 2O68A 1MPBA 3F11A 2IA4A 3LSXA 2NP9A 3PUAA 1D3KA 3OJAA 1HG2A 3I9WA 1MMGA 1O63A 3A5XA 3KV6A 2QS2A 4XKQA 1WRDA 4GRKA 3GXAA 3FBLA 2O7UA 2OK2A 1FQEA 2ZMAA 3PUQA 2Q9QB 3H3AA 4MLKA 4V1Av 3O9XA 3RNNA 2O6AA 4G8HA 2UXNB 5TU0A 3CR9A 2PBIA 1LVKA 4JSDA 4MH5A 3T9VA 4AQGA 3ILUB 1QUUA 2DNXA 3KVAA 3SETA 2Y7WA 2HFBA 3U72A 3I0OA 1SHZC 3K6WA 3PUVE 1UX5A 3LK2B 5ISUA 5HXHA 1MY4A 4L0RA 2QSXA 5HXRA 1TFAA 4FIMA 1R1NA 2ODUA 4F3SA 1GTKA 1NMUA 2IAKA 3OOAA 1Z7NE 4NUVA 5ADXL 5LBMA 2XD3A 3SOLA 5CBRA 3UN6A 5F1QA 2PT2A 1ZBMA 5IKBA 3O1JA 4H63V 1N76A 3N2GE 2V93A 3H4ZA 3M3KA 3ESLA 1P1WA 2MYSA 1RKMA 2NW7A 3ZC1A 4YB7A 3T9XB 4QRZA 4UACA 2YJPA 5B70A 4TUYE 1NAFA 4OESA 3DTOA 4N6PA 2ZM2A 3MZKB 1JVYA 3EHSA 3H03A 4EYUA 3KZGA 3OBVE 3EUHA 4U4XA 3T93B 2O51A 3K00A 3ANWB 4UELA 3G3IA 5L9OA 1VR5A 1BR1A 5FXVA 1MXYA 5H6RB 1XVXA 2H3RA 2NUVA 3TTLA 1LB9A 4O3CA 3IOUA 1NH7A 4U21A 5I59A 5DVJA 2KLQA 3W15B 3T9UA 4QFOA 1IZ1A 4MBPA 2GHAA 2OBGA 2PVUA 3UUXB 5HXSA 3CSBA 2Q8JA 3N2OA 3PUSA 3TKLB 5L2LA 1FQAA 3H06B 5EZYE 1Y4TA 2OZZA 1H7CA 4B6XA 1B40A 2B3FA 2V3TA 1AJ3A 3UT5E 2V7IA 3E0ZA 1FQDA 4OFOA 4XXUA 2H7VC 2HZLA 3JC6D 2LE8A 4DBRA 4OZ9A 1US4A 1WLXA 2DS9A 1EH3A 2XX9A 3W9WA 2D5WA 3E4RA 5EK3A 3Q5XA 2BVLA 4UVCB 3IAZA 2Q9QA 1HSLA 3PPRA 1LB8A 4EXKA 2L9QA 3RYHE 1YPNA 3RT6B 2Q89A 5EHMA 3TTKA 5LOMA 2QA7A 4YLHA 2JRKA 3N9MA 1FTKA 2VP1A 1MQHA 4C91A 1QVSA 4PFWA 2LSJA 3B6QA 4ELOA 4EUOA 2XQYA 5FY7A 1JW1A 2XAHB 4QX8B 4EZHA 3ZYMA 1AH5A 3SESA 1P1UA 2ACXA 4IO4A 3RKOA 3CX6B 1FTOA 2QRYA 3VE1B 2O84X 4F3BA 4JUYA 4ESWA 1T0KA 2X9XA 2F7BA 1IQ7A 2O7IA 1BR0A 4UA8A 4BDQA 4HGAA 3ZCJA 1XT8A 1GGGA 3W9VA 4RNSA 3A3UA 2X7PA 3CVRA 3MQ9A 2IW5B 3AA1B 3QUJA 4YZZA 4NE4A 5HXEA 4AB5A 3KV4A 1TT1A 2RC9A 4ONYA 2F5XA 2K9AA 4R73A 2UYFA 3MZBA 2Y7IA 1YTVA 3FV2A 5JR9C 1XVYA 5L3CB 1I6QA 4OFZA 1HG5A 4M4GA 4GOUA 1B0HA 3HL6A 2F78A 5FMNA 3NBXX 2LSGA 4H9PC 3HKEE 3I0QA 4G2AA 2K24A 3S4UA 3TAJA 1FIOA 4R6YA 4GD5A 1SBPA 4P0GA 2BDEA 1ZJLA 1BR2A 5K2XA 3KBUA 4IE7A 3RYIE 3FXUA 5AFUL 4YHJA 4FJOA 2ZMBA 2RKMA 5CA0E 1XS5A 5FHMA 5DQWA 2WKYA 4M1PA 4ZI3D 3OKQA 2ABHA 1DOTA 3RH3A 4XKNA 2BVMA 4YAHX 4QSCA 4OXVA 4JBZA 3RRCA 3H37A 1Y1MA 1YD8G 4POWA 1LFGA 4RA1A 4QHQA 2RINA 4IY6A 3KGCA 3IB0A 1B05A 3CQXC 1FTMA 4WW0A 1ZMGA 5TP9B 3PU3A 4YICA 2K5BB 3SEYA 5ELVA 1ZKEA 4YB5A 2HXWA 1OXZA 2R9JA 3U1OA 5JTYB 1J1NA 2DXYA 1LFIA 2RCBA 3OD7A 5FP3A 4FE8A 3LK3B 3HKBE 2W00A 1MQJA 4MLVA 4DBQA 4AKIA 3BK9A 5TPAA 1YW0A 4HW8A 3C64A 2I58A 3USDA 3ONMA 3ZMUB 4ZZEA 3KDSE 5L3GB 1NNFA 2X68A 2P9BA 4AQ4A 3HN0A 2F7AA 3IBPA 1O7TA 2L3LA 4Z7EA 1H45A 3IX1A 3MWBA 2DWAA 1UTBA 4C0RA 3FXDB 5DQVA 1JW4A 4GK0E 4ILUA 3TQLA 3FJGA 1OWAA 2RA1A 1IXIA 4DXUA 2E9XB 3PMVA 3M3FA 3MK7C 4O8SA 1MIWA 5L3FB 1B3FA 3L3PA 1NH8A 4G77A 3FVGA 3SRZA 5L3BB 3IOTA 3IORA 4X1KE 4F2OA 5ETWA 1FMVA 3FXEB 3M3LA 4KUMB 5LGTB 2JMKA 2XAJB 3SEUA 3KN8A 3HHFA 2I59A 3E3KA 2LT3A 4ISUA 5JK4A 2K48A 3V89B 2ALUA 3RPWA 4R6HA 3PU5A 3K01A 3QIMA 5AE4A 2ZNSA 3KFMA 2NW9A 1R9LA 3I6VA 3C50A 2CMRA 4AKGA 3K2DA 2XHDA 4PFTA 4THIA 1A7LA 5HM4B 5H8SA 4DMVA 3K1PA 2KLFA 3UUMA 3CSGA 1GV8A 3GN5A 5CRYA 4U22A 4OTEA 3BQLA 4ZI7E 5LHGB 3O6GA 2O69A 5CMMA 3KG2A 1HSEA 3C4MA 3UK4A 4RY1A 2RC8A 2LSKA 4JWXA 3LG7A 3NRXA 3J7Yq 3FIRA 4HS7A 3E9XA 1LFHA 1TWYA 4HTEA 2I6EA 4MBQA 2JPFA 2LM9A 1SYIA 1Y3NA 3TTRA 1O64A 3RC3A 4I62A 5IYZE 3LSWA 5I58A 4L5GA 3RC8A 1Y9UA 1L5TA 4E0XA 3IO6A 3DM0A 3FB2A 3C4XA 2NXOA 3H6TA 3HPIA 2VOZA 1JW5A 2UXXB 2YINA 2XAFB 3RT8A 1NKXA 4MLQA 5KMGP 4TN7B 3AB3B 3Q5WA 4OETA 4CI2B 3EDUA 4EXTA 1IXCA 2X9WA 3E08A 1ATGA 5A5XA 4F3PA 4WBNE 5CMCA 3L09A 1US7B 2ONRA 3A09A 3CFZA 2OJTA 2I4CA 3B13A 5I2NA 3U3IA 2X51A 4P0AA 4GIZA 4DNDA 4P09A 3KBRA 5H6QB 3R6NA 4O2AE 2KT9A 4IGUA 4POXA 2KINB 3F2EA 4ZOLE 4IO3A 4DO0A 4GVOA 2O1MA 4X1BA 2OWSA 4AKLA 1B4ZA 1TXFA 2W0GA 1Y4CA 1NFTA 1N7XA 2PBWA 3CFLA 4ERRA 4FEBA 2PX1A 4ND9A 3MA9A 1B3GA 2W7YA 4RJZA 4QSEA 1MQDA 2X66A 3B6WA 3BKIB 4OERA 2A5SA 3QXMA 3C4ZA 4QXBB 1MQGA 5FYMA 5CMKA 3VV5A 4DE8A 5AA4A 2G29A 1LAHE 1M5BA 2XTLA 4TQUQ 4WKMA 4GXAA 3VVFA 4WEPA 4U74A 4ECFA 4EYYR 3ILTB 1B9JA 2X9HA 1B6HA 5H8HA 4NF8A 1PBPA 2XXQA 3KV9A 3KFWX 2D21A 4EF1A 3OSQA 5F3JA 4A56A 3THIA 2AYSA 5I59B 3CRBA 5FXXA 4AQFA 1U4QA 3O28A 3HCQA 4QXCB 4ZEIA 5EK4A 2YPNA 1ZIUA 3T66A 4OENA 4YKJA 3MVZA 4AQFC 2Q9QD 1AOVA 5FXZA 1U5PA 2G0UA 2OWTA 2VD3A 4JXIA 3DLNA 3O2AA 4G68C 1SW2A 4UV9B 3MKDA 4FEDA 4LZ8A 5LBQB 4KCCA 2ZM8A 5HXCA 1N3XA 2QGSA 4X1YE 3UUNA 3N94A 3C36A 3HHGA 4O2BE 3MJNA 4HTGA 4Q0CA 2VKDA 2EHOC 2REGA 2OA5A 5F8PA 2WAUA 2PMSA 2LHRA 3FBZA 3O66A 3T9HB 3PD8A 3PE0A 4IHJE 1R6ZA 2DWHA 2YU2A 2BJJX 5L3DB 2HPLA 1O3XA 5LCYA 5HYAA 5JVDE 3OYXA 5L8DA 4JWOA 4F19A 4ELRA 5LGNB 1LGBC 3IK6B 3U78A 4EOZB 3LSLA 3N6UA 4R9FA 2E1SA 4TLLB 4X48A 2VGQA 1LCTA 3PU8A 2XUEA 1FTJA 3D0TA 1A54A 2FNCA 5JDGA 3PUXE 1FEWA 4ADZA 3ZYKA 2P0SA 4ZI2D 3OO7A 3M8UA 2I48A 2DE3A 1BKAA 4KBMB 3OO9A 1UIUA 1B5IA 1LAGE 1X79A 2UVIA 3RLFE 5JDFA 1ZEEA 1IIWA 4L9IA 1JNFA 1MIYA 2ZYMA 3FVOA 1URGA 3G3FA 5ITPA 5IHYA 3EN3A 1XC1A 3UIFA 5CC2A 4AKRB 3DP4A 2DVZA 4BA9A 3BBRA 4MF3A 3OEKA 5I84A 4I9DA 4ESXA 4XIGQ 5LYJE 1SW1A 4QFNA 3E13X 5CA1E 1VRBA 2R71A 2RP4A 4QKNA 1B7HA 1A99A 4AXPA 3DP7A 3GWHA 4R74A 3O97A 4OWDA 5M4YA 1R9QA 1B32A 4PW8A 3S9LC 4ZS3A 3K6XA 3GLBA 3KINB 4PJNA 1H43A 4EXLA 1MIVA 4IO7A 3BQIA 1LBCA 1USYH 1QJMA 3KOTA 4C1UA 1ZHCA 3KBTA 4K0UA 3U93A 4QFLA 3PURA 3IL1B 2KNDA 3U8QA 3I5OA 2QS3A 4LONB 4J2CA 4ISSA 2F8DA 4OEUA 5CB4E 3PGFA 1WVJA 4IDZA 4YJ3E 3QYTA 4EIWA 1ELJA 4JB7A 4ELQA 4MFRA 4YKKA 3LJCA 4NF5A 4IO2A 4OYVA 3RN8A 3PPNA 1PB7A 3VXCA 4GL0A 4DXBA 3O4XE 2VL8A 1I6BA 2ZLYA 2DE2A 4UF0A 4F31B 3OELA 3G3HA 4LATA 1MM7A 4F1YA 2DHRA 2RCAA 4O4IE 2ONKE 1DPPA 3O6IA 4ZDMA 3SS1A 3TKDA 5KDTA 4JEHB 3ZYLA 3Q27A 2DWJA 1LAFE 2A3DA 4F39A 2XAGB 4DCYA 2H7OA 2I0CA 4YMAA 5TPAB 1MDQA 4O3BA 1D9VA 4IB2A 3B7DA 2UVHA 1B2HA 4EQ7A 2WWUA 1MY1A 1MNDA 3PPPA 3O6HA 4GLIA 3IF8B 5DT6A 1QULA 5GONE 5ITOA 3Q28A 1EZ3A 1VOMA 1ZU0A 1EU8A 2Y7PA 1MRPA 4CXWA 1UTBB 4OFLA 1HF8A 4GF8A 3RRWA 2KZ7B 1H76A 3TUSA 4H6DA 1B52A 4CI1B 4XAXB 3KOSA 3K3NA 2XXWA 3R26A 4LUBA 3HSTA 5JR9A 2DSFA 3K0VA 2DWGA 3R84B 3CVGA 3FASA 1PEBA 2HEUA 4EQ9A 3AA7B 3PD9A 4LP2B 4JEUB 3ZMSB 1B7TA 2QMWA 3LBXA 3EF7A 2Z23A 4RK2A 1FQCA 2CWOA 3VKGA 3Q9DA 1D1BA 5LOVE 4L17A 3SEWA 5L9MA 3G3GA 2DWKA 3ZC0A 2F6GA 2V26A 3PMWA 4X9TA 1B7ZA 4KYSA 3RTFB 3HKDE 4F18A 3HV1A 3UA8A 3IR1A 1WYBA 4MHCA 4NF4A 3KV5A 1S35A 4ZE9A 1RYXA 3LBSA 1II5A 2ZYOA 3OXNA 1SA0E 1IZNB 5H8FA 2UVGA 4IIJE 1A8EA 1US5A 4XKPA 4H0WA 3FGSA 3AAAB 4G4PA 4H9OC 3GN5B 1PB8A 4TV9E 2IC9A 3K3OA 3CI8A 3CPZA 4PK6A 3SERA 3RX6A 2Z8DA 2V7MA 1CUNA 3WI3A 3OSRA 3VVEA 1FTLA 2ZYNA 4R72A 3GZGA 4X1DA 3TPAA 2H99A 2GHBA 5H8QA 3MZ1A 1LRZA 3O1IA 3FVNA 3RGYA 1EZOA 5J2UE 3FVKA 2D2SA 2PJQA 4IGRA 4FJPA 1B3LA 3K1MA 3QUFA 2Y48B 2CXLA 4GFRA 1JETA 3Q2MA 4P0BA 4AI6A 1Q35A 2Y7KA 2Q2AA 3RTWB 3W15C 5I58B 4CQIA 4QX7B 3QK6A 2H5YA 2Q2CA 4PJJA 3H6UA 3FJMA 1SQYA 1IXGA 2X9YA 3ZN0B 2XD2A 1MMAA 2XX7A 1MDP1 2HQ0A 1D0ZA 4RPNA 3EDVA 1OQGA 3MVWA 3C9HA 2DI4A 1MPDA 5A5XB 2CEAA 1ZTYA 2NWJA 3H6WA 2E9XD 2F35A 2AIXA 1HFAA 3GBAA 3L6HA 3G3KA 1LCFA 4ZE8A 4ZEDA 4JWYA 2ZM0A 4U1ZA 5I2NB 4HKAA 2LOPA 2XXVA 4WEDA 4KYDA 2XASB 3IB2A 4PJLA 3P7IA 4XZCA 1AMFA 1PBQA 4F6RC 5JEIA 4MALA 3IJXB 5KZTA 2VKHA 2RC7A 3UORA 4CXXA 3GMIA 1H3DA 1NNKA 4P0IA 2MOZA 2YK0A 3Q25A 3LR1A 3I1AA 3JC6C 2NTYA 5AA4B 4OQOA 5AA2A 5LGUB 1B51A 2F97A 2LSYA 4N78D 2XXPA 4O4HE 5AA3A 2GFEA 3RPUA 2HH7A 5ICTA 2ESNA 1SW4A 5H8HB 5ICQA 4XKRA 3I9YA 1M5EA 4N07A 2W63A 3T96B 4NF8B 4I1DA 1UTHA 3KJ7A 1VSOA 5BWJA 3O1HA 3ZMVB 3O9PA 3TTNA 4I43B 4NF6A 2CLYB 2XXRA 3D4GA 3F31A 4YMBA 4PFPA 2NW8A 1WDNA 5FY1A 3CWZB 5LHIB 3MPKA 2KMFA 1D0YA 1G8XA 4C1TA 4H8JA 2I3VA 5I57A 4G68B 3A3CA 4PNIA 4IGTA 2D0TA 4G8NA 1B7UA 5FNVE 1B5JA 3VVDA 4BDOA 2F6PA 3AAIA 3V5SA 1DSNA 2Z6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZNT A;  5EYF A;  2E0S A;  4OVJ A;  2QL3 A;  4ZZA A;  1BIY A;  3FV1 A;  4HCY A;  3V5A A;  4FAJ A;  3H6V A;  3IJO B;  3VLU A;  5I2K A;  3K6U A;  2DE4 A;  3MVX A;  3TOD A;  4NWC A;  4QSD A;  3RQT A;  3IOW A;  3JYR A;  4YU0 A;  3C35 A;  3B6T A;  5BUU A;  1F9B A;  3TTM A;  1S7Y A;  4KHZ E;  4PFY A;  3KN7 A;  3LUY A;  1HSJ A;  4JSO A;  2Y84 A;  1B5H A;  3TEP A;  1MXX A;  2H9B A;  3PUY E;  4DIG A;  5CBS A;  3IB1 A;  1B1X A;  2F7C A;  2X26 A;  2R6G E;  1LBB A;  1MH4 A;  3FUZ A;  4GL8 A;  1OLC A;  5FTH A;  4XTC Q;  4EQB A;  3MZ9 A;  1XHY A;  1MH3 A;  4DXC A;  4PFU A;  2QS4 A;  3FXQ A;  1Z0P A;  3U94 A;  2I4B A;  2QJE A;  3FD3 A;  1MM6 A;  3VFJ A;  2I3W A;  2FYI A;  4RXL A;  1MPC A;  3KEI A;  4RYA A;  2YLN A;  1N84 A;  3KSX A;  4H5G A;  3EQ1 A;  3WAE A;  3EHT A;  5CI5 A;  2FA7 A;  1A8F A;  2D3I A;  4F29 A;  3ODB A;  1FQB A;  2H98 A;  3CG3 A;  4EDP A;  4IO6 A;  4F1U A;  4QFP A;  4ZS9 A;  2X7Q A;  3EPE A;  1MQI A;  4DDD A;  1MXW A;  2F36 A;  4LA9 A;  4G68 A;  3D4C A;  5H8N A;  4OFJ A;  2XXI A;  2XXY A;  3C33 A;  4G2Z A;  4FI5 A;  1P1O A;  3CG1 A;  1NNT A;  4NF5 B;  4P11 A;  4RPO A;  4GOT A;  2Z8F A;  1UQW A;  3S9M C;  1DTZ A;  1DMB A;  3SEV A;  3TCF A;  1IJ5 A;  5HPQ A;  1SI1 A;  1MY0 A;  4TOZ A;  2P1S A;  5M2V A;  5KDT B;  2Q9T A;  1QSD A;  5AA1 A;  3N6T A;  1OVT A;  5F7V A;  3U92 A;  1QKA A;  5J1D A;  3MUQ A;  1B3E A;  4PET A;  4AB6 A;  2KWH A;  1CB6 A;  1VFD A;  4NED A;  1P1Q A;  1N04 A;  1B46 A;  2Z8E A;  2HAV A;  5KCJ A;  3Q26 A;  1QKB A;  2QMX A;  5DYH A;  1FCK A;  2ANJ A;  3MP1 A;  4GQO A;  2V84 A;  3VLV A;  4NWD A;  5K2Y A;  1GVC A;  4OEV A;  1QUI A;  1LAX A;  4TLM B;  1MY2 A;  2A5T A;  1YCJ A;  1SYH A;  3MAM A;  4GWO A;  1B1H A;  2ZNU A;  4NMY A;  5HBC A;  3VXB A;  4BLA A;  1I6A A;  1ZKB A;  2C5I T;  3DEL B;  1I69 A;  4LZ5 A;  3V8X B;  4O3A A;  2GH9 A;  1POT A;  4I8C A;  4YB6 A;  2ONS A;  1DPE A;  5I56 A;  3SKP A;  4NF4 B;  2DXR A;  1JQF A;  5DEX A;  1URS A;  4R2F A;  3MW0 A;  5H8F B;  2Z22 A;  4QF9 A;  3LC8 A;  1P99 A;  1BTJ A;  4KR5 A;  4PP0 A;  2LAO A;  5B7D A;  4BDM A;  2HAU A;  1NL5 A;  3Q29 A;  4R2B A;  3MVY A;  3MPL A;  4EF2 A;  3CFX A;  3MP6 A;  5H8Q B;  1IEJ A;  3UGW A;  2DYX A;  3DP6 A;  1S9T A;  5FHO A;  4YKP A;  4Z0I A;  3S9N C;  2NVU B;  4R75 A;  1B4H A;  1IIT A;  1M5C A;  1D9Y A;  1TFD A;  3SDF A;  5FHN A;  5L9S A;  1SDX A;  1PB9 A;  4IY5 A;  4ZEK A;  5AA2 D;  1MS7 A;  3G3J A;  3TMG A;  4JDF A;  2XXU A;  3N5L A;  3T22 A;  1B3H A;  2AL4 A;  2C5K T;  3C32 A;  4BDL A;  1M5F A;  4LVQ A;  4PQJ A;  4IO5 A;  3K02 A;  1AL3 A;  1OIB A;  3R6U A;  5AA2 B;  3MP8 A;  3OO8 A;  1A40 A;  1ZLQ A;  3PPO A;  3PUZ E;  5DVI A;  3I3V A;  2DP8 A;  4KCD A;  2MBG A;  3OEN A;  4ZEF A;  2REJ A;  4BDN A;  1UTH B;  5DVF A;  2Q88 A;  2B65 A;  3OO6 A;  5CMB A;  4NF6 B;  4LQ2 A;  1OLA A;  1QUJ A;  2AL5 A;  4R6K A;  1P1N A;  3ZSF A;  3OMB A;  3MC2 A;  1VE4 A;  4ZEB A;  5I57 B;  3IO4 A;  4FEC A;  1MY3 A;  4GXS B;  2DOJ A;  4K3F A;  3TEL A;  2XX8 A;  1NNP A;  2H4I A;  3RY3 A;  4H67 A;  5I2K B;  3UP9 A;  1PDA A;  2V3U A;  4DCX A;  5CM6 A;  1A55 A;  4Q8R A;  2OCU A;  3S2V A;  3PPQ A;  1MXU A;  3FJ7 A;  2VHA A;  3TYH A;  4U23 A;  1OVB A;  3FZV A;  1FQF A;  3C31 A;  4DLD A;  1MXV A;  4KQP A;  4WXJ A;  1WOD A;  4OMB A;  3H7M A;  1JVX A;  2DQV A;  2P2A A;  4DZ1 A;  1M5D A;  1N3W A;  2IEE A;  2ZXT A;  2UYE A;  3CKD A;  3TQW A;  1Y3Q A;  4H5F A;  4Q5T A;  1BP5 A;  3PUW E;  1B0L A;  1B58 A;  1FW0 A;  1LLS A;  3BFU A;  3ZKL A;  3K6V A;  1N7W A;  2KWI B;  2HCA A;  1YAE A;  3HO7 A;  3V83 A;  3TFL A;  2RF1 A;  4H1X A;  2DWI A;  1Y20 A;  4KFQ A;  2O1L A;  2OLB A;  1OQH A;  3RUM A;  1RYO A;  3CIJ A;  5FTI A;  3R7X A;  1IUD A;  4MFI A;  3ECR A;  1URD A;  2ZYK A;  4ZEC A;  1LVF A;  2PT1 A;  2PYY A;  4RK9 A;  3LSF B;  2UXA A;  3WAF A;  1EZP A;  4E0W A;  4BDR A;  4F1V A;  1USY E;  2XXX A;  5H8N B;  1SI0 A;  3AXF A;  3MBP A;  4N13 A;  2UVJ A;  4ELP A;  3KJT A;  2I49 A;  3JV9 A;  3O29 A;  3S9E A;  3JZJ A;  3C34 A;  2THI A;  4PE5 B;  2DVC A;  1VFE A;  1Z7M E;  4QFK A;  4U4S A;  1MG1 A;  3TZA A;  4OHN A;  1UIV A;  1DTG A;  1D4N A;  3PMX A;  4LQ5 A;  1CE2 A;  4F2Q A;  3OEM A;  3K4U A;  2CZL A;  5DTB A;  2QPQ A;  2CA5 A;  3SEX A;  4M1V A;  1POY 1;  2NOO A;  1QW0 A;  3DP8 A;  5TP9 A;  1Q1K A;  2GRV A;  3K1N A;  1S50 A;  4H65 A;  1SVX B;  2G93 A;  5KCJ B;  3BFT A;  5JTY A;  4F3G A;  4FAT A;  1H44 A;  3L6G A;  3TCH A;  1ANF A;  4R9G A;  4H8I A;  2B3B A;  3FXR A;  1XOC A;  2VD2 A;  2A5T B;  2H25 A;  4Q30 B;  2I0B A;  2QS1 A;  3PV0 E;  4KYE A;  4KPT A;  4NTL A;  4LZ7 A;  2M8C A;  3N26 A;  2Y7R A;  4FOR A;  1Y1Z A;  1SW5 A;  4HCW A;  4U1O A;  1Y3P A;  5EHS A;  5I56 B;  3IOV A;  3ZS6 A;  1AIV A;  3QSL A;  1JEV A;  3VDF A;  5DEX B;  4G8M A;  1OMP A;  1BLF A;  3TDJ A;  2C5J A;  4F22 A;  3KSJ A;  2HZK A;  5IAI A;  1QUK A;  3KN3 A;  4KI0 E;  3VLW A;  3ZKK A;  4YKI A;  1JEU A;  1MXZ A;  4U2R A;  1PC3 A;  1SD3 A;  2XXT A;  1N0T A;  1EZ9 A;  3TCG A;  3EHU A;  2IC6 A;  3GBB A;  1IJ6 A;  2V25 A;  2F34 A;  2CMO A;  2XXH A;  3FAT A;  3MXZ A;  3H3G A;  1GR2 A;  4KD5 A;  2V3Q A;  3G7W A;  1IXH A;  1KWH A;  3QAX A;  1LST A;  2O68 A;  1MPB A;  3F11 A;  2IA4 A;  3LSX A;  1D3K A;  1O63 A;  2QS2 A;  4XKQ A;  4GRK A;  3GXA A;  2O7U A;  2OK2 A;  1FQE A;  3RNN A;  2O6A A;  4G8H A;  5TU0 A;  3CR9 A;  4JSD A;  4MH5 A;  3T9V A;  3ILU B;  3SET A;  2Y7W A;  2HFB A;  3U72 A;  3K6W A;  3PUV E;  5ISU A;  1MY4 A;  4L0R A;  2QSX A;  1TFA A;  4FIM A;  1R1N A;  4F3S A;  1GTK A;  1NMU A;  3OOA A;  1Z7N E;  2XD3 A;  5CBR A;  3UN6 A;  5F1Q A;  1ZBM A;  2PT2 A;  5IKB A;  1N76 A;  2V93 A;  3H4Z A;  3M3K A;  1P1W A;  1RKM A;  4YB7 A;  3T9X B;  4QRZ A;  4UAC A;  2YJP A;  5B70 A;  4OES A;  4N6P A;  1JVY A;  3EHS A;  3H03 A;  3KZG A;  4U4X A;  3T93 B;  2O51 A;  3K00 A;  3G3I A;  5L9O A;  1VR5 A;  1MXY A;  1XVX A;  2NUV A;  3TTL A;  1LB9 A;  4O3C A;  3IOU A;  1NH7 A;  4U21 A;  5I59 A;  5DVJ A;  3T9U A;  4QFO A;  1IZ1 A;  4MBP A;  2GHA A;  2OBG A;  2PVU A;  3CSB A;  2Q8J A;  3TKL B;  1FQA A;  3H06 B;  1Y4T A;  2OZZ A;  1H7C A;  4B6X A;  1B40 A;  2B3F A;  2V3T A;  1FQD A;  4OFO A;  4XXU A;  2HZL A;  4OZ9 A;  1US4 A;  2DS9 A;  1EH3 A;  2XX9 A;  3W9W A;  2D5W A;  3E4R A;  3IAZ A;  1HSL A;  3PPR A;  1LB8 A;  4EXK A;  3RT6 B;  1YPN A;  2Q89 A;  5EHM A;  3TTK A;  5LOM A;  1FTK A;  2VP1 A;  1MQH A;  1QVS A;  4PFW A;  3B6Q A;  4ELO A;  4EUO A;  1JW1 A;  1AH5 A;  3SES A;  1P1U A;  4IO4 A;  1FTO A;  2QRY A;  3VE1 B;  2O84 X;  4F3B A;  4ESW A;  1T0K A;  2X9X A;  2F7B A;  1IQ7 A;  2O7