3P7IA

Crystal structure of escherichia coli phnd in complex with 2-aminoethyl phosphonate
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
300
structure length
300
Chain Sequence
KALNFGIISTESQQNLKPQWTPFLQDMEKKLGVKVNAFFAPDYAGIIQGMRFNKVDIAWYGNLSAMEAVDRANGQVFAQTVAADGSPGYWSVLIVNKDSPINNLNDLLAKRKDLTFGNGDPNSTSGFLVPGYYVFAKNNISASDFKRTVNAGHETNALAVANKQVDVATNNTENLDKLKTSAPEKLKELKVIWKSPLIPGDPIVWRKNLSETTKDKIYDFFMNYGKTPEEKAVLERLGWAPFRASSDLQLVPIRQLALFKEMQSVKDNKGLNEQDKLAKTTAIQAQLDDLDRLNNALSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Escherichia coli Phosphonate Binding Protein PhnD and Rationally Optimized Phosphonate Biosensors.
pubmed doi rcsb
source organism Escherichia coli uti89
molecule tags Transport protein
molecule keywords PhnD, subunit of alkylphosphonate ABC transporter
total genus 119
structure length 300
sequence length 300
ec nomenclature
pdb deposition date 2010-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12974 Phosphonate-bd ABC transporter, phosphonate, periplasmic substrate-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3p7iA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3p7iA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3p7iA02
4NF4B 4H5FA 4Z0IA 1SVXB 4LUBA 2OBGA 3SEUA 4RK9A 2D3IA 5AE4A 3ZS6A 5I2NB 1NFTA 1NNFA 1FQEA 1MXVA 3T93B 1Y3NA 4XKNA 3TFLA 1UIVA 4BDMA 3DP6A 1D9VA 2DWIA 3U93A 4OEUA 3T66A 2THIA 3OO9A 1DTGA 4YB6A 2NUVA 1US4A 3BBRA 4OERA 5AA2B 3ODBA 1MM7A 5HBCA 4LZ8A 5TU0A 4NF6A 4JWOA 3K0VA 1IXIA 1TFAA 2IEEA 4QSEA 2UYFA 3MPLA 2D5WA 2XHDA 2ZNSA 4B6XA 1MH4A 4G68C 1LB9A 3MWBA 3CVRA 1B3HA 4YB5A 4YKIA 4DLDA 1TT1A 3QIMA 4JB7A 3FXUA 3D4CA 1PB9A 1AMFA 4R9FA 2O1MA 1M5DA 4H6DA 3VLUA 4X1BA 4HW8A 5I57B 1MPBA 1IXCA 4G8NA 2I4BA 3H6VA 1OQHA 4NF6B 5EYFA 2V84A 5TP9B 2I0BA 1LAFE 5KDTB 3IB0A 2OLBA 3IX1A 1P1UA 4GL8A 3RNNA 3VXCA 3C36A 2QS1A 3CSBA 2RC8A 1UIUA 1B7HA 1IQ7A 2XXIA 1H7CA 1SW4A 2B3BA 5F7VA 3RQTA 3T9UA 4F19A 2ALUA 1B52A 1SYHA 1SYIA 2CMOA 4KCDA 4OFLA 4JBZA 4WXJA 1B1XA 4F39A 3T96B 5L9OA 2NWJA 2DS9A 1J1NA 1I6QA 3LSFB 1OMPA 2F6PA 3AXFA 3CKDA 1D3KA 2GRVA 1UTHA 2PT2A 3EQ1A 5EHSA 5H8QB 3O29A 4QFLA 1MM6A 3PD9A 3SESA 4MLQA 4GXAA 4EF2A 3KJ7A 2R6GE 3TODA 3B6WA 3O6IA 2FA7A 3S9EA 5FHOA 4F3SA 1FTLA 2C5JA 4HCWA 3LSXA 3CG3A 3MVZA 1WDNA 3Q25A 2REGA 1IEJA 3VV5A 3S9LC 1MQDA 3VVDA 3K1NA 5FHNA 4F22A 2Z8FA 3V89B 1QVSA 3EHUA 3DP4A 5DVJA 1NH8A 5TPAA 1MPCA 4H8IA 4RA1A 3FXDB 2RINA 5H8FA 2VP1A 1USYH 4R9GA 4EXKA 1ATGA 2ZYKA 4ZEDA 2OCUA 4DXBA 2GFEA 2O51A 3BFTA 3MP8A 4IO6A 1QKAA 2UXAA 3A09A 3M3LA 3PMVA 5DVIA 5F1QA 2R9JA 2XXQA 1Q35A 3TMGA 3TTRA 5KDTA 4R75A 4RYAA 1T0KA 4U22A 5I57A 1ZTYA 1NH7A 1ZIUA 5FTHA 1JQFA 1B5JA 1OIBA 4XXUA 5H8FB 1S9TA 2DXYA 3MP6A 3TELA 1DPEA 3TPAA 3VVFA 2F6GA 4F31B 2PT1A 3B6TA 5CRYA 3THIA 2HZLA 4OHNA 4GLIA 3OENA 1Y4CA 3RGYA 3SDFA 4C0RA 5IAIA 2DYXA 3HCQA 4GFRA 2QMXA 4X9TA 3TDJA 4F3BA 4ESWA 2F34A 3LUYA 3L6HA 4L0RA 4R74A 1MY3A 4P0IA 3SEWA 4PFYA 1QSDA 2DVCA 3FIRA 1EH3A 4ZDMA 2UVHA 5CC2A 2G0UA 2I6EA 1WODA 3KZGA 4FI5A 3RY3A 3SEYA 2YJPA 3K6WA 3TEPA 1R6ZA 1TWYA 2C5KT 1B4HA 3ECRA 3JZJA 3QAXA 4GQOA 4LVQA 4MFIA 2ZYNA 1ANFA 3K1PA 5I58B 3USDA 4U21A 5I84A 1MQGA 2V3TA 3GXAA 3Q26A 4FAJA 1BLFA 1JEVA 1LBBA 1H76A 1MY1A 1VFDA 1YAEA 3CFZA 3HV1A 3R6UA 3TQLA 3RPWA 4WEDA 1AOVA 1B0HA 1MRPA 2YPNA 1MQJA 3SERA 2A5TB 1GGGA 1N04A 5EHMA 3QUJA 2DWJA 4L17A 4QF9A 3CG1A 3H03A 3OO7A 4KI0E 4ZE8A 3O2AA 1PC3A 2F5XA 3JYRA 4YICA 3FVOA 3V5AA 5CBRA 4X1DA 4I8CA 4M4GA 5JTYA 3IL1B 2VOZA 4XIGQ 1BKAA 3FUZA 3V83A 4XKPA 2OZZA 2Q9TA 5CI5A 1P1WA 3ILUB 1ZU0A 3FV2A 4U1ZA 2F7BA 4MLVA 1GVCA 4R2BA 1EZOA 4U23A 2OWTA 3RT6B 5JEIA 2V3UA 4P0GA 4UA8A 2DE4A 3RN8A 3IK6B 4AQ4A 5ISUA 1URSA 2O69A 3MW0A 1PEBA 2DWAA 3KEIA 4JXIA 2UYEA 1M5FA 3IJOB 4R73A 4FATA 3B7DA 3N5LA 5I2KA 3G7WA 3N6UA 1PB7A 4OETA 4F29A 1QW0A 4O3CA 1B3GA 2I48A 1QUJA 4OXVA 1B46A 4DCXA 1SI1A 3PPNA 3PPOA 1LFIA 2V3QA 4G4PA 2ONRA 4GOTA 4NMYA 4OFJA 1KWHA 2QS4A 2Q89A 3FXRA 4ZS9A 1MG1A 4EXLA 5CMKA 3UN6A 2O1LA 1B2HA 4GD5A 2DSFA 2ZYMA 4PE5B 4QFPA 3UORA 1JW5A 3CSGA 5B70A 4YKKA 4NF5B 1NNPA 3A3UA 3PUWE 4H1XA 5AA2D 3PUVE 2ABHA 2XX9A 3MBPA 1P99A 3PPPA 4GF8A 5K2YA 3B6QA 4H0WA 3SEVA 1D4NA 2REJA 3G3HA 3OMBA 1B5HA 2PX1A 2Z22A 2Q8JA 3V8XB 1A55A 3K01A 1AIVA 1B1HA 2ESNA 5ITOA 1B9JA 4KQPA 1M5CA 3T9VA 4G68A 5TPAB 3P7IA 5CMBA 1FTJA 4IY5A 1YCJA 4KPTA 1GTKA 3OSRA 2XXUA 1LAGE 5DVFA 1OVBA 1A8EA 5I59B 1N76A 3VXBA 1NNTA 4OENA 4Z7EA 2QSXA 4HCYA 1A8FA 3T22A 3MVYA 2E0SA 3A3CA 4ZEIA 1ZJLA 4I62A 4C1TA 5L9SA 4EQBA 3S9NC 2UVGA 2KWHA 2DXRA 1ZLQA 1L5TA 1XS5A 3MPKA 3TTNA 4NTLA 5CBSA 2FYIA 3I6VA 4LZ5A 4TLMB 1XVXA 1HSLA 4EQ9A 2PVUA 2XXYA 4GXSB 3S4UA 1CE2A 3KFMA 1LRZA 4ELPA 5J1DA 4DXUA 1Y4TA 3D4GA 4G77A 5L9MA 1XOCA 3FXQA 2G93A 3K4UA 4F3GA 1LFGA 4E0WA 3K02A 4KHZE 3RLFE 1MDP1 3TTLA 2V93A 5H8SA 4MBPA 3K6UA 1DOTA 3FXEB 1R9QA 3CR9A 1S50A 1FQAA 4LP2B 3KN7A 3T9HB 1I6AA 2D21A 4TOZA 3C34A 3HO7A 2O84X 2I3WA 2RKMA 2DE3A 1MXWA 1MY4A 2Y7IA 3CVGA 3O97A 3CIJA 2I3VA 4XTCQ 1JEUA 4H65A 2Y7KA 1NKXA 3ZKKA 4YMBA 3TTKA 3PUYE 1YPNA 1O64A 2OJTA 1I6BA 3G3IA 1VR5A 4LATA 3KJTA 4F3PA 3MZ9A 1IXHA 2RC9A 2ZNUA 4OQOA 1A54A 2QMWA 1EZ9A 3OO8A 4ELOA 1N84A 4OESA 1B0LA 4KCCA 4QHQA 4PFUA 3KBRA 3KG2A 1MDQA 2XXWA 2F7CA 3FJ7A 3T9XB 3S9MC 2HEUA 1NNKA 1IZ1A 1ZBMA 4RY1A 1B05A 1LLSA 1N0TA 1VSOA 2B3FA 2QRYA 2XX7A 1XT8A 3G3FA 3TZAA 4ECFA 1BIYA 2PMSA 4BLAA 4XKRA 2XD3A 4CQIA 3E3KA 2XXRA 1ZKBA 4OVJA 2NXOA 4QFNA 3WAEA 3UK4A 2HQ0A 1ZMGA 3CI8A 3IO4A 3KGCA 3N94A 4Q0CA 4DIGA 1MH3A 1B3FA 3OEKA 2V25A 2QS3A 3FVNA 3N26A 1B40A 1B58A 1Q1KA 2KLFA 2VD3A 1A99A 3PMXA 3IORA 3M3KA 3RUMA 1LAXA 1MPDA 3E9XA 3DLNA 2Z8DA 4R6KA 3U72A 3VE1B 1A40A 3M8UA 5KCJA 2X9YA 1BP5A 4F2QA 4ISUA 3OO6A 2DE2A 5A5XB 1VE4A 2IC9A 1P1NA 3DP8A 2FNCA 2OK2A 4QFKA 2ONSA 4WEPA 5FHMA 3ZKLA 5I56B 4I1DA 2NOOA 1H45A 2AL5A 3IB2A 4KD5A 3FD3A 1SQYA 1GV8A 4N07A 1DPPA 5AA1A 4E0XA 1QUIA 2C5IT 4NF8A 2ZYOA 1PBQA 1URDA 2XXPA 3BFUA 1Y1MA 3HHGA 3Q28A 3MAMA 4RXLA 5AA4B 1ELJA 1S7YA 2QPQA 2O7IA 1LVFA 1HSJA 1M5BA 3VDFA 1B5IA 1YTVA 3PV0E 4POWA 1FTKA 5H8NB 2F36A 2WKYA 2Y7PA 3QK6A 3IB1A 4ZEKA 3L3PA 4IO5A 1FQBA 3I5OA 4MF3A 1A7LA 5BWJA 2IA4A 2XXHA 2CA5A 5FTIA 3ZSFA 4OFOA 2H4IA 4H67A 4HTGA 1B3LA 3EPEA 3L6GA 1PDAA 3TQWA 3EF7A 5H8HB 5HM4B 2F97A 4ONYA 5KCJB 4R2FA 4P11A 1OVTA 4YU0A 4NF5A 3H6WA 1US5A 4BDNA 2MBGA 2G29A 3GLBA 4Q5TA 1JVYA 1TXFA 4OZ9A 4GWOA 4QSDA 4KYSA 3HN0A 2PYYA 1UTBA 1LCFA 2O7UA 3LSLA 4IY6A 4PP0A 3VFJA 1OLAA 4G2ZA 4NF8B 4X48A 2GHBA 1PBPA 1Y20A 1DSNA 1MY0A 2Y7RA 3MUQA 4Q8RA 5KZTA 1VFEA 4BDOA 2VD2A 2W7YA 2I4CA 2ANJA 3HSTA 1I69A 3PPRA 3M3FA 4QRZA 5I2KB 2OWSA 3U8QA 3UA8A 1JETA 2F78A 2RCAA 2AL4A 3TCFA 5ICTA 2I0CA 2A5SA 3OELA 5LOMA 4LQ2A 3E4RA 3QUFA 3H7MA 2H98A 2Q2CA 4BDQA 4ELQA 3O9PA 3QXMA 3G3GA 1MY2A 1MXXA 3F11A 3IAZA 2DQVA 1MQHA 2XXVA 3K6VA 4LZ7A 4O3BA 3S2VA 3RT8A 5HPQA 3KSXA 2VGQA 1NL5A 2XXTA 2Y84A 3W9VA 4AB5A 3TKDA 2XD2A 3EHTA 3IJXB 3PU5A 4OMBA 2UVIA 4JWXA 1B7UA 5IKBA 4KYEA 1II5A 3FASA 1AH5A 2DWHA 4GVOA 5K2XA 1USYE 2H25A 1IJ6A 4RNSA 2RF1A 1SW5A 1UQWA 4F1YA 1NMUA 3C31A 2KWIB 5DT6A 3FJMA 2ONKE 1FTMA 1LAHE 4I9DA 1SW1A 2HAVA 2P1SA 3OEMA 4F1UA 5I58A 1IITA 3IO6A 4HS7A 4WKMA 1GR2A 3KOTA 4G8MA 4RPNA 3K1MA 1UTHB 5L8DA 1FQDA 4GIZA 4N13A 4EUOA 4R72A 3C4MA 4OEVA 1MXYA 3OOAA 4F18A 5CMMA 2X26A 2P0SA 3CRBA 4NF4A 4FORA 2UVJA 4NE4A 4YB7A 1FQFA 4YZZA 4ZEBA 2HZKA 2XX8A 3LC8A 3FVGA 4GL0A 1OLCA 1HSEA 4AB6A 2QL3A 3WAFA 2DVZA 1R9LA 3Q29A 5DEXA 1B7ZA 1PB8A 1Z7ME 3H3GA 3O28A 1TFDA 3HHFA 2F8DA 1O7TA 2HFBA 3IOUA 3OXNA 2XTLA 2K48A 3O66A 4ESXA 2X9WA 1QULA 1RYXA 2ZNTA 4YKPA 5AA4A 1UTBB 3H4ZA 2P2AA 3H6TA 3PUZE 1B6HA 1Z7NE 4H8JA 3U92A 3JV9A 3Q27A 4ZECA 1EZPA 3BKIB 3E13X 3HPIA 3MZ1A 1B32A 1N3WA 3PMWA 3MQ9A 5DYHA 4BDLA 1Z0PA 2RCBA 3LBSA 1Y3QA 3K2DA 4JSDA 1ZKEA 4J2CA 1B4ZA 3QYTA 4U1OA 3O6HA 4JSOA 4F1VA 5BUUA 1EU8A 4THIA 5H8HA 1DMBA 3EHSA 4LA9A 4Q30B 4F2OA 4XKQA 2ZMBA 3TYHA 1URGA 4ZZEA 4C1UA 3MC2A 1JW1A 3CFLA 4KFQA 3DM0A 3VLWA 1R1NA 3FJGA 4FECA 4ZEFA 3TUSA 4R6HA 2AYSA 3H6UA 4R6YA 3UGWA 4RJZA 3R26A 4O3AA 3CFXA 4DXCA 1MS7A 1H44A 2QJEA 3IOTA 1P1OA 3W9WA 1WVJA 2DOJA 3GBBA 1LBCA 4RPOA 1JVXA 4FEBA 5JTYB 3TTMA 2XXXA 1FCKA 4IGRA 5M2VA 3FVKA 3UIFA 3SETA 4DZ1A 4UACA 2F35A 2HCAA 4IO7A 3VVEA 5AA2A 1H3DA 2DP8A 1QJMA 2RC7A 1B3EA 3QSLA 2CZLA 2H99A 3IR1A 4ND9A 4TQUQ 1QUKA 4TLLB 1F9BA 1RKMA 2GH9A 1O63A 1Y1ZA 2LAOA 1QKBA 2PBWA 3GZGA 3K00A 3MZBA 4G8HA 3SKPA 1FQCA 1Y9UA 2E1SA 2VHAA 3PUXE 3R7XA 2BJJX 4YAHX 4DCYA 5TP9A 2Q2AA 4U4SA 3MVXA 3KN8A 3RTFB 1M5EA 4EQ7A 5I59A 4MH5A 4OYVA 4EYYR 1FW0A 4ZE9A 3U94A 1XVYA 2HXWA 1AL3A 3C32A 3DELB 3O6GA 4G68B 4PETA 3TCHA 1IJ5A 1XHYA 5DEXB 4ELRA 4NWDA 4FIMA 2YLNA 3MVWA 4QFOA 1LFHA 2H5YA 3TKLB 2A5TA 4GRKA 4JWYA 4YMAA 1P1QA 4LQ5A 3LSWA 2F7AA 3EN3A 5ITPA 3GBAA 4DNDA 1XC1A 2AIXA 1JNFA 1N3XA 3G3KA 2Z23A 1BTJA 2O68A 3G3JA 1POY1 1IUDA 1DTZA 3IOVA 4IB2A 4KYDA 4FE8A 3UP9A 1OQGA 4BDRA 3I3VA 4IO3A 3K6XA 1D9YA 3KN3A 2HAUA 1SDXA 4OTEA 4IO4A 1N7XA 1MXZA 4IGTA 1IIWA 1B51A 3OD7A 4NEDA 1SW2A 1CB6A 3IOWA 3ONMA 4FJPA 4EDPA 3LR1A 5ICQA 3PGFA 3KSJA 3N6TA 2Q88A 1Y3PA 2X7PA 1LB8A 1MQIA 1SBPA 3OSQA 1LCTA 3FV1A 4EF1A 3ILTB 4QSCA 3FATA 3H06B 4U2RA 5H8NA 3FGSA 4M1VA 4PFWA 4FEDA 4OWDA 2IC6A 1MXUA 4U4XA 3RTWB 3MJNA 4NWCA 3TCGA 5B7DA 4PQJA 2I58A 5ELVA 5I2NA 3KOSA 4KR5A 4N6PA 2H9BA 1LSTA 5DTBA 1H43A 3VLVA 1SD3A 2M8CA 3MP1A 4K3FA 4YKJA 4ZZAA 5AA3A 4RK2A 5CMCA 5CM6A 5I56A 3U1OA 3MXZA 1POTA 2Z8EA 3C9HA 4POXA 2X9XA 3TAJA 4JDFA 5A5XA 1SI0A 1RYOA 4LONB 4H5GA 2NVUB 4IO2A 2GHAA 3PD8A 1N7WA 1JW4A 3W15C 2R71A 3PPQA 4DE8A 5JK4A 1IXGA 2X7QA 3C35A 3C33A 1FTOA 1LGBC 3FZVA 2Y7WA 2QS2A 2ZXTA 3SEXA 4PFTA 2O6AA 5H8QA 4DDDA 2B65A 2I49A
chains in the Genus database with same CATH superfamily
3UU3A 4NF4B 3SEUA 4Z8XA 5HXEA 1LVKA 1MXVA 3T93B 3QMFA 4BDMA 1K9ZA 2K5BB 4EV6A 3OO9A 3BBRA 4TX5A 3ODBA 4WW0A 1MM7A 5BMVE 4LZ8A 2VL0A 4NF6A 2CPTA 3ONXA 3B13A 5LB7B 4YB5A 4YKIA 2SPCA 3RKOA 2ZM2A 2O1MA 1M5DA 3NKZA 2I4BA 1OQHA 1XI6A 3U3IA 2I0BA 3Q5DA 1LAFE 5KDTB 3IX1A 1P1UA 3RNNA 4AS4A 3FB2A 1B7HA 3BK9A 1IQ7A 2B3BA 3RQTA 5AQPB 3V5UA 2NOXA 5JDNA 1B52A 2CMOA 1FJ6A 4KCDA 1DU2A 2BJIA 3KC0A 2DS9A 1J1NA 2VK9A 1I6QA 3CKDA 2GRVA 1UTHA 2PT2A 5EHSA 4YHHT 2V6YB 3SESA 1MM6A 3PD9A 2RA1A 3RKGA 3TODA 5FHOA 3LSXA 2E9XA 4DIDB 3CG3A 3OYZA 2REGA 1MQDA 3VVDA 3K3QC 5FHNA 2Z8FA 2FJBA 4ILAA 4LF9T 4MJOA 2RINA 4EXKA 1KEYA 4F2QA 3MP8A 1YKHB 1HNZT 4R75A 5F8PA 4DBQA 2UXNB 1OIBA 2LLYA 1S9TA 4JI2T 5H8FB 3RLFF 5AQSB 3THIA 5LG3A 2HZLA 2KQZA 3OENA 4OA4A 1XDOA 4XEQA 3FZKB 4GFRA 4ZI2C 3JAFA 3QNUA 2KT9A 4ZEYA 4L0RA 5J2UE 3SEWA 1NUZA 1QSDA 2DVCA 3FIRA 5LG4A 4ZDMA 5IHYA 5CC2A 2I6EA 2LSGA 3KZGA 1HX1B 4RNSA 4MFIA 2XXKA 4GQOA 3AE4A 4PFRA 3K1PA 3UQ4A 4ASKA 4IDPA 2HN2A 3Q26A 5CGMA 3TTNA 1MY1A 4FAJA 4H63H 2OWZA 1VFDA 1L0VA 3CFZA 4EQ9A 2VKOA 4WEDA 2KNDA 1MQJA 2DWGA 2ZM6T 2A5TB 1GGGA 2F5XA 5HCJA 3FVOA 4ZI7E 4I8CA 5JTYA 2V1DB 4I50E 1VOMA 3CMLA 4HWDA 3FUZA 3LSVA 4XKPA 5CI5A 2XHEB 4UR9A 1ZU0A 3EABA 4KXPA 4MIJA 3RN8A 5ISUA 1X79A 1LBZA 3IK6B 2EHOB 4JXIA 1EZOA 4R73A 1M5FA 2XWOA 3B7DA 2OA5A 1PB7A 1QW0A 4GBVA 4G4PA 3PPOA 5JRCB 3FXRA 2QS4A 5CMKA 2XASB 4UXNB 3CPZA 1HG5A 4QH5A 2X0HA 1B2HA 2DSFA 4H45A 1JW5A 1CNQA 4YKKA 1NUXA 5B70A 4AQGA 1NNPA 4NF5B 4H1XA 4U7YA 3Q5EA 3B6QA 4I3EA 3F57A 4AXPA 2R6GF 3AAIA 3G3HA 2PX1A 3V5SA 3B5MA 1LBVA 4O4HE 1B9JA 4L5GA 4NG7A 1M5CA 4JI4T 4G68A 3P7IA 1FTJA 4CI2B 1LAGE 2F4VT 3AA7B 1QLBA 4P47A 3RQUA 3A3CA 4C1TA 2LHNA 4EQBA 4PJNA 2DXRA 4OK0A 3MPKA 5CBSA 4TLMB 1HSLA 2PVUA 4GXSB 4EGWA 5JQGE 3Q2MA 3D4GA 4FJOA 1N34T 5LOVE 3W15B 4F3GA 1NAFA 3AAEB 2YN6A 2J4GA 4E0WA 2MYSA 1MDP1 2V93A 5H8SA 1NV3A 3T9HB 4F6RC 1S50A 1I6AA 3SWHA 2X68A 2DE3A 5ET7A 1MY4A 3CVGA 3CIJA 2I3VA 4O8SA 3PUYE 1YPNA 1O64A 3PUSA 3G3IA 5JDFA 4IE6A 2NTYA 4LATA 1G73A 4PAGA 2RC9A 3NRYA 4OQOA 1A54A 1N84A 4OESA 4HE8A 4KCCA 2ACZA 3BIHA 2I0MA 5GONE 2CBIA 3KBRA 3N9MA 3KG2A 3AEDA 3FJ7A 4HGAA 1NNKA 4CI1B 1B05A 3G3FA 1BIYA 3TLWA 4GWWA 2LOSA 2NXOA 2R8TA 3UK4A 3EUHA 3KGCA 2CHOA 4DIGA 1MH3A 5JR9A 3FVNA 2YU2A 1A99A 3A5XA 3M3KA 1LAXA 1BR2A 3DLNA 1FBDA 1A40A 2CCQA 2DE2A 5I56B 2ONSA 3ZKLA 2IDOB 5F5WA 1SQYA 1GV8A 4N07A 1QUIA 3WI3A 2JJKA 3FBPA 4RXLA 3RX6A 2QPQA 1OWAA 1HSJA 2DNXA 4CXXA 5BWJA 5JH7E 2IA4A 1U4QA 2HPLA 1B3LA 5JDHA 1XZYA 5HM4B 4JEUB 2F97A 2PG8A 1ZEEA 4YU0A 2HN1A 5ET8A 2RP4A 4BDNA 4X66T 3GLBA 4O94A 3A8YC 1JVYA 4OZ9A 3AEBA 1ZHCA 2PYYA 3AE5A 5L3DB 1LCFA 1EYKA 2CZIA 2Y5LA 4IY6A 4PP0A 4G2ZA 5FXVA 2GHBA 5AQLB 1E1HB 1MY0A 3MUQA 1UCUA 1VFEA 4BDOA 3HSTA 2I4CA 3PPRA 4QRZA 5I5PA 4C91A 3M3FA 3UA8A 2OWSA 2A5SA 3OELA 1YQ4A 2Q2CA 4BDQA 3QXMA 1FBCA 1MXXA 3F11A 3K6VA 3S2VA 2WWVA 2CLYC 4CI3B 2XXTA 4AB5A 4YJ2E 4IL4A 3RPLA 4AIUA 4LF7T 2YOEA 5F3JA 4KYEA 1E7PA 1AH5A 1D0XA 4N8YA 2VURA 2RF1A 1UQWA 2V4CA 4DV1T 3C31A 3AEFA 2BBJA 3PUZF 5L47A 1SW1A 2HAVA 4GIWA 5FXXA 4YSZA 1XMOT 4YTPA 4HS7A 4RPNA 2B76A 1UTHB 3K1MA 1FQDA 1KNRA 4R72A 4OEVA 4F18A 3ISPA 3CRBA 4NF4A 3FVGA 5J16A 1HSEA 3MK7C 5ABHA 1R9LA 3Q29A 2M6IA 5DEXA 4DV6T 3H3GA 2HFBA 5FMNA 1QULA 4YKPA 3GYYA 1UTBB 1WR0A 3HI2A 1B6HA 2W67A 5KMGP 3MZ1A 2MTQA 5DYHA 1Z0PA 2RCBA 1V9DA 2D5UA 2VASA 4U1OA 5BUUA 1FPJA 4JSOA 3SFDA 4THIA 3D1RA 3OYXA 1FPFA 2ZMBA 4C1UA 4WBNE 4OYJA 4HFCA 4FECA 4B3RT 4R6HA 2QVAA 4N78D 1MS7A 4YTMA 5L9OA 3W9WA 3GBBA 1LBCA 4FEBA 3NOHA 2WAUA 3SETA 4UACA 2HCAA 5AA2A 1H3DA 2LKGA 4P0BA 4N91A 5DQVA 3QB5K 5AQKB 4O4LE 4TWDA 1QGXA 1QUKA 2WS3A 4AKRB 5CM6A 4G8HA 2ZM0A 4YT0A 3R7XA 4YAHX 1WYBA 5JDMA 4HFVA 2Q2AA 4U4SA 4DVDA 3MVXA 3KN8A 5I59A 3LJCA 1FW0A 5TAOA 4ZE9A 2WX9A 3ZCJA 4L9IA 4YJ3E 1XHYA 3UU8A 2VT5A 2XPKA 4HWIB 1LFHA 4H9NC 3TKLB 4I43B 2E2AA 2A5TA 4MCOA 2VKJA 2BBHA 3T1HT 3PTYA 1P1QA 3LSWA 3EN3A 4N8GA 4PJLA 4DNDA 5HEGA 3G3KA 3G3JA 4AKLA 5FXZA 5L3BB 2Z23A 5AA2B 1DTZA 5AQFB 4GWUA 1SDXA 1N7XA 3RYHE 2LSYA 1G0HA 4NEDA 2X66A 2BG9E 3IOWA 3ONMA 4EDPA 3LR1A 3PGFA 4UF0A 1Y3PA 3ZYLA 4H9PC 1SBPA 3OSQA 3UU5A 3ILTB 4QSCA 1UX5A 3FATA 4TWHA 1FRPA 4OWDA 2IC6A 3RTWB 5JVDE 4NWCA 3KV6A 3HR0A 5EZYE 3KOSA 2H9BA 2X51A 2E9XC 1LSTA 5DTBA 1H43A 4O7MA 4K3FA 4U7IA 3ZC1A 4NIQA 3KVAA 5I56A 3U1OA 5L3EB 4JDFA 1IMAA 4PW8A 5AQHB 4H5GA 4IO2A 3JAEA 3PD8A 2JQ9A 3ZN1B 2X7QA 4P9KA 2Y7WA 2ZXTA 4MMPA 4DDDA 2O6AA 4PFOA 2KXPB 2WY2A 2N2NA 4Z0IA 1SVXB 4PTKA 5AE4A 2K3WA 5CB4E 5I2NB 1NFTA 4HE0A 3DTOA 1Y3NA 2A72A 2DWIA 2THIA 4YB6A 4GWZA 3EAMA 5L3GB 1DK4A 5TU0A 3VKGA 2UU9T 3PU8A 4H9OC 4ISSA 4JWOA 2W4XA 1TFAA 3UUBA 1MH4A 4G68C 4HFHA 3MWBA 1IBLT 3FXUA 4CZZB 3D4CA 1PB9A 4I40A 4HW8A 2EHOD 4X1BA 3VU7H 3RRCA 1IXCA 4G8NA 1NV0A 3H6VA 4NF6B 1HCIA 2XQ3A 3IB0A 2OLBA 4H9SE 1UIUA 3JC6C 5F7VA 2X9HA 1INPA 2ALUA 4TNWA 2AXDS 1SYHA 1SYIA 4OFLA 4MEVA 4WXJA 4JV5T 1FEWA 2NWJA 4NXMT 1OMPA 1MIYA 1NI9A 1D3KA 4U74A 1B7TA 5HEUA 2R6GE 3B6WA 3S9EA 4F3SA 3P50A 2C5JA 1FTLA 1MMDA 5EK4A 1WDNA 4LFAT 2CEXA 4F22A 1T98A 1EYJA 1QVSA 3EHUA 5TPAA 3A7MA 3ZYKA 4CN4A 4FBPA 3FXDB 2LT3A 1USYH 1QKAA 3A09A 3FZMB 2WQYA 2V6XA 2H88A 1Q35A 2DL1A 1T0KA 4U22A 4JI3T 3PE0A 5FTHA 3P4SA 3ZN0B 3B6TA 4P0AA 2X0YA 1XWMA 4OHNA 4GLIA 5JR9C 3SDFA 3MACA 4ANJA 5LGNB 3HCQA 1N33T 2PFYA 3RPUA 2Q8MA 2KR0A 3ANWA 4PFYA 3G06A 1EH3A 1BK4A 2IUBA 2G0UA 5ET5A 3R84B 1WODA 5A1LA 3RY3A 1FBHA 3K6WA 3TEPA 2C5KT 1B4HA 1R6ZA 5LA6E 3JZJA 4PK4A 1O3XA 3QAXA 4ZEBA 2NVUB 1S94A 2Q9QC 4IREA 4U21A 2WBLA 4O2AE 3T8OA 1MQGA 3GXAA 1BLFA 4OVSA 1D0ZA 2LSIA 4GK5E 4U72A 1BR4A 3GA8A 4N15A 2YPNA 4P56A 3SERA 1IMCA 2JQHA 4MFRA 1N04A 2IMLA 3QUJA 5HAXA 3CG1A 3H03A 3OO7A 4KI0E 2QVUA 2IHR1 3GN5B 1JNZA 2WZIA 3N9LA 1D1AA 4M4GA 2QVRA 4WBOA 3V83A 5AQOB 1P1WA 2CXFA 2CXDA 3ILUB 2L3LA 4U23A 2OWTA 3RT6B 2V3UA 2BG9B 2XQ7A 4U33A 4O8MA 2V5DA 3MW0A 2WSSV 3RYCE 1FPDA 5IYZE 3IJOB 3OVUA 1HS7A 3N6UA 4O3CA 3HKDE 1T7SA 3IA3A 5JDLA 3NVOA 3KC1A 2V3QA 4GOTA 5KXJA 1KWHA 2QRXA 2O1LA 4TUYE 3A3UA 1J5WA 1NV4A 2XX9A 5FL0A 3PPPA 4GF8A 2BVLA 3MA9A 3U78A 2REJA 2V7MA 3V8XB 2UXDT 2ACXA 5DABA 5ITOA 5AQGB 4DO0A 4XZCA 1YCJA 2VKDA 2XXUA 4X5TA 1N76A 3VXBA 1NNTA 4OENA 4Z7EA 4LMJA 1A8FA 3LK3B 4HCYA 3T22A 3MVYA 2E0SA 5L9SA 2JMKA 2KWHA 4ZI2D 4O2BE 1ZLQA 5AQJB 5ET6A 3VKHA 3RI5A 3ZPOA 2XXYA 4QXHB 3S4UA 1FBPA 4OVTA 1Y4TA 5L9MA 2DLRA 3FXQA 3K4UA 3RIFA 3K02A 3RLFE 3NBXX 4MBPA 4LP2B 1DOTA 3FXEB 1R9QA 1FQAA 1NEKA 2D21A 3A29A 3N9PA 4TNVA 3AA6B 4JUYA 1LEVA 4MX6A 3AE9A 3ZKKA 2LEHA 1NKXA 4LF4T 4YMBA 4A97A 2NWBA 5HWYA 3KJTA 4F3PA 4E7SA 3MZ9A 1VDWA 3O1HA 5J2TE 1EZ9A 4PFBA 3OO8A 3RGLA 3HKBE 1YXRA 3P4PA 1MDQA 4KHZF 2F7CA 4X8RA 2HEUA 1IZ1A 2I59A 2W61A 1LLSA 2B3FA 2QRYA 4NXNT 2XX7A 1XT8A 1WYCA 4OVJA 4I55E 4QFNA 4IDOA 4MALA 3CI8A 3N94A 4GWSA 5I7IA 2BKPA 5DJQC 2V25A 4GX3A 1B40A 1B58A 2VD3A 2F3DA 2MPKA 3AA1B 2J62A 3UULA 2VWAA 3PMXA 2KMFA 5KCJA 2Z8DA 5LBQB 2HHHT 4ISUA 3OO6A 1VE4A 2VPNA 1P1NA 4WEPA 5FHMA 2CEYA 4Z91A 2ZMAA 2YDRA 1H45A 3IB2A 3FD3A 2VKHA 3MZKB 2XWVA 1DPPA 3TLSA 4G63A 4NF8A 4PBHA 1URDA 2XM2A 3HHGA 4LFCT 1T72A 3FZFB 1S7YA 4G2AA 5H8NB 1M5BA 1B5IA 1NV5A 1YTVA 4POWA 1FTKA 2PBIA 3QK6A 1RDZA 4IO5A 4MF3A 3I5OA 4ZS3A 2CA5A 2H4IA 4H67A 4ZOLE 2V7IA 1FIOA 1YYZA 3EPEA 4X1IE 3EF7A 3TQWA 2VQFT 4DBRA 2XA5A 3ZT7A 4P11A 4R2FA 4NF5A 2XAQB 5BR8T 2MBGA 2BDEA 4YY3T 1TXFA 4GWOA 4KYSA 4DUYT 4U3CA 1UTBA 4GKKT 2H7VC 4HE1A 4P1LA 3GMIA 5FVLA 1PBPA 1DSNA 1Y64B 5LNKA 1W9RA 2VD2A 2W7YA 1D1BA 1I69A 2IAKA 3TCFA 5ICTA 5EQAA 3H7MA 2H98A 4ELQA 1MY2A 4A56A 2XXVA 1MQHA 1IBMT 5HWXA 3RT8A 3KSXA 1NENA 5LJMA 3CX8B 3TKDA 3EHTA 3ZT5A 4PDHA 3IJXB 2NW7A 5FXWA 4DV4T 3PU5A 3VR9A 3ZEFB 1II5A 4H9RC 2JQQA 1USYE 1IMFA 2HH7A 4AKHA 4EEBA 5LMNT 1LAHE 4I9DA 3RPLB 4HE2A 5J0ZA 1IITA 4WKMA 1GR2A 3PUVF 3ZKRA 4GIZA 3C4MA 3TLVA 1MXYA 3KV9A 1BR0A 2P0SA 2GQ1A 1FQFA 1MIVA 3P4QA 1FJ9A 3LC8A 3ANWB 1OLCA 3D0TA 2W66A 4AB6A 3WAFA 2DVZA 1Z7ME 3ZC0A 3O28A 1TFDA 3HHFA 3IOUA 3OXNA 2XTLA 2K48A 3N9NA 2X9WA 1J5ET 2ODUA 2ZNTA 4IE7A 1SA0E 5CA1E 1I6ZA 4UV8B 3PUZE 3U92A 1EZPA 3E13X 3AEAA 3HPIA 3PUGA 3PMWA 1N3WA 4OANA 3MQ9A 4BDLA 4N4UA 1Y3QA 1SHZC 2XY8B 4TN7B 1IMBA 4F2OA 4XKQA 1OEDC 4ZZEA 3CIRA 3MC2A 3CFLA 3DM0A 3N2GE 2W62A 4NUUA 2KSRA 2AYSA 4RJZA 3CFXA 4MNCA 4RPOA 5JTYB 2GK9A 2XSBA 4ZXLA 2F35A 3VVEA 1WR6A 2DP8A 2RC7A 1B3EA 3QSLA 2L9QA 2CZLA 3L09A 3IR1A 1RKMA 2GH9A 4UIGA 3HL6A 4AKGA 2OX3A 3KVBA 4NF0A 5L4EA 3SKPA 1FQCA 3PUXE 4ZS2A 5TP9A 4P1EA 4EQ7A 1M5EA 2K9AA 1NV2A 4DV5T 1AL3A 3C32A 4PETA 4O7IA 5EQ8A 4QBAA 4FIMA 2YLNA 3MVWA 2B4MA 3C4ZA 3UUNA 3RH3A 5H6QB 3E79A 4JWYA 2XQAA 2F7AA 5HXHA 4XF5A 5ITPA 2WU5A 3GBAA 1IAPA 1XC1A 1N3XA 2WBDA 4IB2A 3IOVA 4HFBA 4UV9B 2DI4A 1UUSA 3FBLA 5LHGB 3I3VA 3K6XA 1D9YA 4I0UA 2HAUA 5EK3A 5KX5E 1WFDA 4NPPA 2Y8DA 1IIWA 3OD7A 4FJPA 5ICQA 1MMNA 3AE3A 3PTRB 4LFBT 1OEDE 1MQIA 3RYFE 2DWKA 2VVSA 4PFWA 1MXUA 5B7DA 5I2NA 4KR5A 4UELA 1SD3A 2M8CA 3MP1A 1ZOYA 2XSAA 3QOFA 3RIUA 3MXZA 4POXA 4WNKA 2Z8EA 3C9HA 2Z6EA 1M62A 5A5XA 2FJAA 4OHFA 2H89A 5M4YA 4OX9T 5JK4A 2R71A 3PPQA 1FTOA 5IZ3B 2QS2A 3SEXA 4PFIA 4OVRA 3EDVA 5HXRA 2I49A 5T3JA 4H5FA 4LUBA 4U2YA 4V1Av 2OBGA 4JVIA 5F24A 4ILUA 1FQEA 1US7B 2JIWA 4XKNA 1UIVA 4HEAA 1D9VA 3BIGA 4OEUA 5AQMB 2HHMA 4JEHB 3I0QA 4JVDA 1VRBA 3K0VA 1IXIA 4OYKA 2PJQA 2XQ9A 4QSEA 2UYFA 3CQXC 2XHDA 3TMGA 4B6XA 2XQ6A 3CVRA 5HXSA 3JADA 4DLDA 1TT1A 4MLKA 3CHGA 3ONJA 4N6KA 1W0AA 2YDQA 1AMFA 3VLUA 1KA1A 5I57B 2DHRA 1MPBA 4DI3D 4KUMB 3KDSE 5JREA 5TP9B 2V84A 2LOPA 4MNPA 4KP3C 2Q9QA 2CXLA 3ZMTB 2QS1A 3VXCA 5HCMA 2RC8A 5AQUB 2BG9A 3KINB 1H7CA 2XXIA 1NUYA 2E5VA 2KLQA 3LK2B 4QH4A 2RPAA 4JBZA 1B1XA 2ZZWA 4M1PA 5FKYA 1NV7A 2NP9A 1RDYA 3AXFA 2NW9A 4IE0A 2UUBT 5H8QB 3O29A 4DR5T 5FP3A 5L3CB 4TZ4C 2WM9A 2FA7A 4YSYA 2LSKA 5ETWA 4HCWA 3RHWA 1IEJA 2AE9A 3UFGA 4DMVA 5LXTE 3PV0F 3DP4A 3LBXA 1W0BA 2E9XD 5AQNB 4H8IA 4RA1A 3U65A 4GBWA 2VP1A 4R9GA 2ZYKA 4ZEDA 2OCUA 3BFTA 4UVAB 4IO6A 2UXAA 3PMVA 2JMHA 5F1QA 3IEEA 2R9JA 2BVMA 2LRKA 4U2ZA 3PURA 4RYAA 5I57A 1NH7A 1ZIUA 1JQFA 4XXUA 3NRXA 2DXYA 3MP6A 3TELA 3E08A 3VVFA 2IIUA 2F6GA 4F31B 5CRYA 4OFZA 5E0OA 5H6RB 1NV1A 2FBWA 3UT5E 2XQ8A 3E0ZA 3RGYA 3CWZB 1Y4CA 5IAIA 4C0RA 2DYXA 2FBPA 4PAIA 4DV7T 4F3BA 4ESWA 1G0IA 4PC9A 4R74A 1MY3A 1HNXT 2D0UA 4P0IA 4HN9A 4QHOA 2WMNA 2UVHA 1XDPA 4KMCA 4IDQA 3LK42 3SEYA 2YJPA 3OKQA 4DV0T 3O1IA 3ECRA 2QGSA 5LYJE 1ANFA 5FY1A 2ZYNA 5I84A 4YXDA 2IW5B 3C4XA 1LBBA 2EHOC 5C8YE 1H76A 3R6UA 5AFUL 3RPWA 3QB5A 3BQIA 5C3JA 2WBBA 3AVRA 5EHMA 3KFWX 4L17A 4QF9A 4CN6A 4LF5T 3LFMA 4ZE8A 1HG2A 4YICA 3V5AA 5CBRA 2BZBA 1CHUA 4UABA 3IL1B 2XM1A 2VOZA 1BKAA 4XIGQ 2CBJA 2OZZA 4IIJE 3FV2A 3E78A 2BKOA 4U1ZA 2F7BA 4MLVA 1GVCA 4R2BA 4QXBB 5JEIA 3J7Yq 4PCDA 1HX8A 4UF0B 4BA9A 1HR0T 1PEBA 2DWAA 2UYEA 1Z8UA 3N5LA 3G7WA 4OETA 1FPIA 4O4IE 1W09A 4DV3T 2I48A 4AS5A 1QUJA 4OXVA 1SI1A 1LFIA 3NWIA 5L8DA 4GYSA 4OFJA 4EXLA 2Q89A 4ZS9A 4IDNA 2HXRA 3UN6A 4GD5A 4PE5B 3CSGA 3RC8A 1OXZA 4AQFC 3PUVE 2ABHA 2WDQA 4IT4A 2K24A 3SEVA 2D0TA 3RF1A 3TLTA 4MHFA 1GQEA 2Q8JA 3OMBA 1B5HA 2Z22A 3SZPA 2WCAA 1A55A 1HF8A 4YHJA 1B1HA 2ESNA 4KQPA 4KPTA 4IY5A 1GTKA 3IBPA 5LGUB 4EEDA 1OVBA 5I59B 2PFZA 3EHZA 4YFSA 3SRZA 3OBVE 1ZJLA 4I62A 3LUZA 3S9NC 2UVGA 3UUMA 1EYIA 3C50A 1L5TA 1XS5A 4MHCA 4TV8E 1IMDA 2FYIA 3I6VA 4LZ5A 3MYUA 3FXBA 1CE2A 1LRZA 2VL8A 5J1DA 1MMGA 4KHZE 4GX4A 3K6UA 3CR9A 3AE1A 3KN7A 3PUQA 4EZ4A 4TOZA 3C34A 3HO7A 1SUMB 2O84X 4LMLA 2RKMA 3T1YT 1MXWA 2Y7IA 4DR2T 1JEUA 4PBQA 2Y7KA 2FHYA 2FVZA 3TTKA 4I3YA 3RRWA 2XUEA 3AA0B 2KZ7B 1VR5A 2XWIA 1E2AA 2X0LB 1LBXA 2ZNUA 5CFBA 2QMWA 1X9BA 4ELOA 4JYAT 1B0LA 2CLYB 4QHQA 1CUNA 5HXCA 1KNZA 1ZP0A 1MNEA 3EI0A 3M65A 1N0TA 4ECFA 3UTKA 1N36T 2P3VA 4IHJE 4EZHA 3HKCE 4JBWF 2YINA 2PMSA 4HWFA 4CQIA 2XD3A 2XXRA 1ZKBA 5EYGA 2B1EA 2N9DA 2HQ0A 2W63A 4X1KE 3OEKA 2KINB 4QXCB 1YD8G 2QS3A 5AQIB 4EOZB 3ZMSB 3N26A 1Q1KA 3PJAA 2V7JA 4BAYB 3RUMA 1MPDA 3U72A 1FBGA 1LBYA 4HKAA 1KFYA 1BP5A 2WYPA 5A5XB 2IC9A 3GN5A 2J47A 4N81A 4QFKA 3DP8A 2OK2A 5AQQB 2L8KA 1YQ3A 2NOOA 4KD5A 3RQWA 1M7KA 5AA1A 4E0XA 3OTOT 4H63V 3NZPA 2ZYOA 1PBQA 2XXPA 2MOZA 3BFUA 3Q28A 4K0KT 3MAMA 4X64T 3EVYA 3OPCA 4PK5A 2O7IA 5HYAA 3PV0E 4ZI3C 2F36A 2WKYA 3IB1A 3AXJA 3L3PA 1FQBA 3ROJA 4I4TE 3AEEA 4QX7B 2BS2A 3N9OA 4OFOA 4BJNA 2XWKA 4HTGA 2E5LT 3L6GA 4PF8A 2BS4A 4B3MT 3H6WA 3AXJB 1US5A 3O4XE 4Q5TA 5FL1A 3PJAJ 2O7UA 3CX6B 2C0SA 3VFJA 4NF8B 4X48A 3AVSA 1Y20A 2Y7RA 4X20E 3PDYA 2Y5KA 5KZTA 5ABFA 4GWYA 3AE7A 3U8QA 2RCAA 5LOMA 2I0CA 4OVPA 1IZNB 2NW8A 2VQET 3O9PA 3G3GA 2WWUA 3IAZA 4O3BA 4UEMA 1I94T 5HPQA 2VGQA 4OMBA 2UVIA 4JWXA 1B7UA 1ZV4X 3F2EA 2YU1A 2DWHA 2UXBT 2H25A 3CQCB 1SW5A 3H37A 4TV9E 1LBWA 5EQ7A 4F1YA 2KWIB 2XQ4A 4DMWA 5DT6A 1FTMA 3OEMA 2P1SA 1YXIA 1FBFA 3KOTA 4EUOA 4Q25A 4COFA 3ZMUB 5CMMA 4YB7A 3I0OA 3VRAA 2UVJA 1WCRA 3GWHA 4YZZA 1HFAA 2HZKA 2XX8A 3SOLA 4QWNB 4OVQA 4DUZT 5FYMA 3VRBA 2QL3A 1B7ZA 3H3AA 1PB8A 4F29A 5J1GA 2F8DA 1KA0A 1UGOA 3CK6A 2H3RA 4ESXA 4C90A 2WDRA 4CN1A 2XJ7A 3KBUA 1RYXA 1KF6A 1NWMX 1NV6A 3H4ZA 2P2AA 2FJDA 3H6TA 4H8JA 2FIEA 3JV9A 3Q27A 4ZECA 2DDKA 3P8CD 4AISA 1B4ZA 1ZKEA 4HTEA 4J2CA 2XQ5A 5LJNA 3QYTA 5HEHA 4KX6A 1DMBA 1SPIA 3EHSA 4NUVA 1URGA 1JW1A 3LG7A 5ESYA 3TUSA 3ZMVB 3ONLC 4JI8T 4O3AA 1KNPA 3I9YA 2QJEA 5L3FB 1P1OA 2DOJA 3TTMA 3VLWA 1JVXA 2XXXA 1FCKA 3UIFA 3FVKA 2LM2A 2V26A 4IO7A 4KI0F 3Q5XA 1QJMA 2H99A 2QVVA 4ND9A 4TLLB 2LAOA 1O63A 1Y1ZA 3GZGA 3MZBA 1Y9UA 2E1SA 2VHAA 4NQ8A 2LKHA 4UVBB 5IGAA 4IE4A 4OYVA 2V8SV 3U94A 1XVYA 2HXWA 3DELB 1G8XA 4LMKA 5DEXB 4NWDA 5ABFB 4NGUA 2ZZVA 5JDQA 2YDSA 4JI7T 3ZCIA 1AWBA 4U31A 4GRKA 2D2SA 3BQKA 3JC6D 2V7LA 2CZKA 4A5XA 3FZHB 1BTJA 4EIWA 1IUDA 3PUXF 1OQGA 2CZHA 3N2KE 4IO3A 3KN3A 2L5VA 4X1YE 1MXZA 4P09A 3WAJA 4IGTA 1B51A 1SW2A 3N2OA 1CB6A 3N6TA 2X7PA 5LBMA 1VCSA 3MJXA 1LCTA 3FV1A 4EF1A 3H06B 4ZZBA 5H8NA 4ELPA 4M1VA 4U4XA 5KDTA 4MBQA 3TCGA 4NHBA 3IFAA 4PQJA 4N6PA 4P1NA 3VLVA 4PAFA 3PUAA 5AA3A 3LBXB 5CMCA 5JDGA 1JP4A 4AI6A 3JCFA 3TAJA 3OJAA 3UQ7A 1RYOA 1FBEA 2OLTA 4MAGA 3C4WA 2GHAA 3SS1A 2MKZA 1JW4A 3W15C 4DE8A 4B3TT 1Y01A 4QKNA 2B65A 4XBFB 4F8HA 4AKIA 5L4HA 5FY0A 2D3IA 4RK9A 3ZS6A 2JJ9A 4KHPT 1NNFA 4DR1T 2WMOA 5KDMC 2M6BA 3TFLA 4JI0T 5ABGA 3DP6A 3U93A 3T66A 1DTGA 4JI1T 2NUVA 1US4A 4OERA 2P9BA 1KK7A 4NAPA 5HBCA 4IR8A 4LF6T 3CX7B 2LRLA 5IM2A 3AE2A 1FTAA 3ZJ2A 2IEEA 1D1CA 1OEDB 3MPLA 5LDZA 2D5WA 4N17A 2ZNSA 1MNDA 4AQYT 5LTCA 1LB9A 2CWOA 1B3HA 3H3MA 4JB7A 2VPOA 3QIMA 3BQLA 3FHNA 4HFEA 1FPLA 4DR4T 1IMEA 4R9FA 4H6DA 4QX8B 2XQYA 1YKEB 5EYFA 1UX4A 1FMWA 4GX6A 4GL8A 1YZ0A 3C36A 3CSBA 1SW4A 2LJLA 3T9UA 2YEVC 4X62T 4F19A 4PF6A 4JI5T 1FPBA 3Q5WA 4F39A 3T96B 5EK2A 3LSFB 4JLEA 2F6PA 2CHNA 3K8PC 3C98B 2D9DA 3EQ1A 4QFLA 4MLQA 4PGPA 4GXAA 1NUWA 3KJ7A 2I6HA 4EF2A 1FMVA 2M67A 2A9UA 3O6IA 3VV5A 3MVZA 3Q25A 3S9LC 3K1NA 3V89B 4NX1A 2JRKA 5DVJA 4ADZA 1NH8A 3RIUC 1MPCA 3B57A 5H8FA 5FVKA 1ATGA 3ZSSA 4DXBA 2LM9A 2GFEA 2O51A 4PK6A 2WEFA 5DVIA 3M3LA 2XAHB 4ERRA 2XXQA 3TTRA 3FZLB 4AQFA 1ZTYA 3UUXB 1B5JA 1DPEA 3TPAA 1R8IA 4EAHA 2LHRA 5IUXA 2PT1A 4IL9A 5LHIB 2HPGA 3F31A 4O4JE 2QMXA 4X9TA 3TDJA 2F34A 2CMRA 3LUYA 3L6HA 2CEAA 2XZEA 2PCRA 1DCUA 2VVNA 3N9QA 4FI5A 3ZSTA 4PJJA 1TWYA 2P3NA 4LVQA 4ILBA 5I58B 3USDA 2MAWA 2V3TA 2BG9C 1JEVA 3TZAA 1YAEA 3HV1A 3TQLA 4H46A 1B0HA 1MRPA 1XMQT 4HFDA 4DI4B 1UK5A 4K0UA 5EQ9A 2DWJA 4EYUA 2V6YA 2DCFA 2WZHA 3VR8A 3O2AA 1PC3A 3JYRA 4Z90A 4X1DA 3DP7A 2Q9TA 4HWCA 2WP9A 2JPFA 2PTFA 3J9X1 4P0GA 4UA8A 2DE4A 4AQ4A 4LF8T 1URSA 3ETUA 2O69A 3KEIA 5I2KA 4FATA 4XAXB 1FPKA 1B3GA 4DCXA 2A2FX 1B46A 3PPNA 2BKNA 2ONRA 4NMYA 5IWAT 1MG1A 2F3BA 3ESLA 4DV2T 2ZM8A 2ZYMA 4QFPA 3UORA 3RYDA 2QFLA 3PUWE 1U5PA 5AA2D 3MBPA 2OV9A 1P99A 5K2YA 5FNVE 4H0WA 3UU4A 2UUAT 1D4NA 4PAKA 1AIVA 4GK0E 1JNRA 3K01A 4P8BA 3T9VA 5TPAB 5CMBA 3OSRA 4PJMA 5DVFA 1YW0A 1A8EA 3AAAB 3IF8B 2QSXA 3P4WA 4ZEIA 5JR9B 3AE8A 3AE6A 3PUYF 2ES0A 4NTLA 3O1JA 1Q9DA 3RYIE 1XVXA 2Y48B 5FY7A 2A3DA 3KFMA 4DXUA 4G77A 3KV4A 1XOCA 1HNWT 2G93A 4BJMA 2ODVA 2QYWA 1LFGA 2WB5A 3TTLA 4WYVA 4E7ZA 3L39A 5CA0E 2W2UA 2CRBA 2Q9QD 3E22E 1D0YA 2V7KA 2Q9QB 4ZZCA 1IBKT 2I3WA 3O97A 4XTCQ 4H65A 2YKSA 3L8RA 2OJTA 1I6BA 3T0JA 5LMUT 1IXHA 2X67A 2UXCT 3WAKA 4PFUA 3S9MC 2XXWA 1FJGT 4RY1A 1ZBMA 5AQTB 1VSOA 3R6NA 1FPGA 5HEOA 4BLAA 5FBPA 4XKRA 3E3KA 2V5CA 3M3ZB 2BS3A 3WAEA 1SE7A 4IDZA 1D9QA 1ZMGA 3IO4A 4Q0CA 5I3SA 1B3FA 4G61A 1UURA 3IFCA 3AEGA 2KLFA 2ZLYA 2LE8A 3IORA 3E9XA 4R6KA 3VE1B 3M8UA 2X9YA 3ZYMA 3KBTA 4QH1A 1BR1A 4GWXA 2FNCA 4I1DA 2AL5A 5LGTB 4GYRA 2C5IT 4JI6T 1Y1MA 4HXVA 2LSJA 5AA4B 3O9XA 1ELJA 3RC3A 3VDFA 1LVFA 2Y7PA 3SFEA 4ZEKA 3QC9A 1A7LA 2XXHA 5FTIA 3ZSFA 4DR6T 1PDAA 4X65T 5H8HB 1VCTA 4ONYA 5KCJB 2Y6XA 1OVTA 2E8IA 3B8BA 4ISTA 2G29A 2Q74A 4QSDA 3HN0A 3AECA 1MMAA 2J1DG 3LSLA 1HTJF 1OLAA 1N32T 3RIAA 4Q8RA 1XNQT 5I2KB 2ANJA 3ABVA 2UXXB 1JETA 2F78A 2AL4A 1AJ3A 2CE7A 4LQ2A 3E4RA 3QUFA 4PFPA 4LZ7A 2DQVA 3UU6A 1S35A 3KBZA 2HPJA 2XAGB 2ZZXA 1DBZA 1NL5A 4ILCA 2Y84A 4PE3A 5IZ1A 3W9VA 2XD2A 2WYKA 2VB6A 2XAJB 5IKBA 1T8BA 3FASA 4A98A 4GVOA 5IZZA 5K2XA 1IJ6A 2E9XB 3K1SA 1NMUA 2UUCT 2PFVA 3FJMA 2ONKE 4XFEA 1KZ8A 2W0GA 4F1UA 5I58A 1EZ3A 3IO6A 4G8MA 1FPEA 4HFIA 3B50A 4N13A 3HA4A 3I1AA 3ZMZB 3OOAA 2X26A 4FORA 4NE4A 3I9WA 3ETVA 4GL0A 1K9YA 4YSXA 2WDVA 3C51A 3CQGB 4PNIA 3AB3B 3ZT6A 3IHRA 5AQRB 1RDXA 3EKIA 2FJEA 5ADXL 1QUUA 3Q9DA 4IGUA 1O7TA 4GKJT 3O66A 4EXTA 1MIWA 5AA4A 2XAFB 4GOUA 2CM0A 5CJ5A 5C2TA 1LKXA 3NZQA 1Z7NE 4H9QC 5AQVB 3X1DA 3BKIB 4JVCA 1B32A 5LHHB 2WU2A 4ZI3D 5EYHA 3LBSA 4JSDA 3K2DA 1AOVA 3O6HA 4F1VA 5DQWA 1EU8A 5H8HA 2FIXA 1WRDA 4LA9A 4Q30B 1J1JA 3TYHA 3PUWF 4B3ST 4KFQA 3LV0A 4NN3A 1R1NA 3K3OA 3FJGA 4ZEFA 4UVCB 5LCYA 4HWHA 5ABEA 2N1GA 3H6UA 4R6YA 3UGWA 3R26A 4DXCA 4DR3T 5JRCA 1H44A 3IOTA 4DR7T 1WVJA 4TWFA 3K3NA 4IGRA 5M2VA 5L2LA 4PDDA 4DZ1A 3ZLIA 2YK0A 2NTXA 3KV5A 4ZHQE 2B4LA 4TQUQ 1F9BA 1QKBA 2PBWA 3K00A 4LN5A 1FSAA 2BJJX 4DCYA 3HFUA 5DW8A 3RTFB 3VHLA 4MH5A 4EYYR 3O6GA 3FBZA 4G68B 3TCHA 1IJ5A 4ELRA 3P4RA 4QFOA 2H5YA 4PGNA 4YMAA 4LQ5A 2W00A 3TLUA 4N6DA 2JQKA 1WLXA 4WZXA 4QXDA 2AIXA 1JNFA 3T9XB 2O68A 4KYDA 1POY1 3UP9A 4FE8A 4CXWA 4BDRA 4OTEA 4IO4A 4KBMB 3HKEE 5LP6E 3PU3A 2QA7A 3UFEA 3KSJA 2EHOA 3DJBA 2Q88A 1LB8A 2H7OA 5A5LA 1XNRT 4U2RA 2FUPA 5JTGA 5HEJA 3FGSA 4FEDA 3MJNA 2NR4A 5ELVA 2I58A 4YTNA 4YKJA 4ZZAA 3MSTA 3EDUA 4RK2A 1OEDA 5IZ3A 4MNIA 4IE5A 3C64A 1POTA 4YLHA 2X9XA 3ZJ1A 1SI0A 4CXYA 4LONB 1N7WA 3T1BA 4X04A 4P3LA 1IXGA 3C35A 3C33A 1LGBC 3FZVA 3LDQB 3MKDA 4PFTA 5H8QA 4EB6E 2CWYA
chains in the Genus database with same CATH topology
4NF4B 3SEUA 4Z8XA 5HXEA 1LVKA 1MXVA 3T93B 4BDMA 3OO9A 2K5BB 3BBRA 4TX5A 3ODBA 4WW0A 1MM7A 5BMVE 4LZ8A 4NF6A 3ONXA 3B13A 4YB5A 4YKIA 2SPCA 3RKOA 2ZM2A 2O1MA 1M5DA 2I4BA 1OQHA 3U3IA 2I0BA 1LAFE 5KDTB 3IX1A 1P1UA 3RNNA 3FB2A 1B7HA 3BK9A 1IQ7A 2B3BA 3RQTA 3V5UA 2NOXA 5JDNA 1B52A 2CMOA 4KCDA 2DS9A 1J1NA 2VK9A 1I6QA 3CKDA 2GRVA 1UTHA 2PT2A 5EHSA 3SESA 1MM6A 3PD9A 2RA1A 3TODA 5FHOA 3LSXA 2E9XA 3CG3A 3OYZA 2REGA 1MQDA 3VVDA 3K3QC 5FHNA 2Z8FA 2RINA 4EXKA 4F2QA 3MP8A 1YKHB 4R75A 5F8PA 4DBQA 2UXNB 1OIBA 5H8FB 1S9TA 3THIA 2HZLA 3OENA 4GFRA 4ZI2C 2KT9A 4L0RA 5J2UE 3SEWA 1QSDA 2DVCA 3FIRA 5LG4A 4ZDMA 5IHYA 5CC2A 2I6EA 2LSGA 3KZGA 4RNSA 4MFIA 4GQOA 3K1PA 4ASKA 3Q26A 4FAJA 3TTNA 1MY1A 4H63H 4EQ9A 1VFDA 3CFZA 2VKOA 4WEDA 2KNDA 1MQJA 2DWGA 2A5TB 1GGGA 2F5XA 3FVOA 4ZI7E 4I8CA 5JTYA 2V1DB 4I50E 1VOMA 3CMLA 3FUZA 4XKPA 5CI5A 2XHEB 1ZU0A 3RN8A 5ISUA 1X79A 3IK6B 2EHOB 4JXIA 1EZOA 4R73A 1M5FA 3B7DA 2OA5A 1PB7A 1QW0A 4G4PA 3PPOA 5JRCB 3FXRA 2QS4A 5CMKA 2XASB 4UXNB 3CPZA 1HG5A 1B2HA 2DSFA 1JW5A 5B70A 4YKKA 4AQGA 1NNPA 4NF5B 4H1XA 3B6QA 3F57A 4AXPA 3AAIA 3G3HA 2PX1A 3V5SA 4O4HE 1B9JA 4L5GA 1M5CA 4G68A 3P7IA 1FTJA 4CI2B 1LAGE 3AA7B 3A3CA 4C1TA 2LHNA 4EQBA 4PJNA 2DXRA 4OK0A 3MPKA 5CBSA 4TLMB 1HSLA 2PVUA 4GXSB 5JQGE 3D4GA 3Q2MA 4FJOA 5LOVE 3W15B 4F3GA 1NAFA 3AAEB 4E0WA 2MYSA 1MDP1 2V93A 5H8SA 3T9HB 4F6RC 1S50A 1I6AA 3SWHA 2X68A 2DE3A 1MY4A 3CVGA 3CIJA 2I3VA 4O8SA 3PUYE 1YPNA 1O64A 3PUSA 3G3IA 5JDFA 4IE6A 2NTYA 4LATA 1G73A 4PAGA 2RC9A 3NRYA 4OQOA 1A54A 1N84A 4OESA 4HE8A 4KCCA 5GONE 3KBRA 3KG2A 3N9MA 3FJ7A 4HGAA 1NNKA 4CI1B 1B05A 3G3FA 1BIYA 2LOSA 2NXOA 3UK4A 3EUHA 3KGCA 4DIGA 1MH3A 5JR9A 3FVNA 2YU2A 1A99A 3A5XA 3M3KA 1LAXA 1BR2A 3DLNA 1A40A 2CCQA 2DE2A 5I56B 2ONSA 3ZKLA 1SQYA 1GV8A 4N07A 1QUIA 3WI3A 4RXLA 3RX6A 2QPQA 1OWAA 1HSJA 2DNXA 4CXXA 5BWJA 5JH7E 2IA4A 1U4QA 2HPLA 1B3LA 5JDHA 5HM4B 4JEUB 2F97A 2PG8A 1ZEEA 4YU0A 2RP4A 4BDNA 3GLBA 1JVYA 4OZ9A 1ZHCA 2PYYA 5L3DB 1LCFA 4IY6A 4PP0A 4G2ZA 5FXVA 2GHBA 1E1HB 1MY0A 3MUQA 1UCUA 1VFEA 4BDOA 3HSTA 2I4CA 3PPRA 4QRZA 4C91A 3M3FA 3UA8A 2OWSA 2A5SA 3OELA 2Q2CA 4BDQA 3QXMA 1MXXA 3F11A 3K6VA 3S2VA 2CLYC 4CI3B 2XXTA 4AB5A 4YJ2E 5F3JA 4KYEA 1AH5A 1D0XA 2RF1A 1UQWA 3C31A 1SW1A 2HAVA 4GIWA 5FXXA 4HS7A 4RPNA 3K1MA 1UTHB 1FQDA 4R72A 4OEVA 4F18A 3CRBA 4NF4A 3FVGA 1HSEA 3MK7C 1R9LA 3Q29A 5DEXA 3H3GA 2HFBA 5FMNA 1QULA 4YKPA 1UTBB 3HI2A 1B6HA 5KMGP 3MZ1A 2MTQA 5DYHA 1Z0PA 2RCBA 1V9DA 2D5UA 2VASA 4U1OA 5BUUA 4JSOA 4THIA 3OYXA 2ZMBA 4C1UA 4WBNE 4OYJA 4FECA 4R6HA 4N78D 1MS7A 5L9OA 3W9WA 3GBBA 1LBCA 4FEBA 2WAUA 3SETA 4UACA 2HCAA 5AA2A 1H3DA 4P0BA 5DQVA 4O4LE 1QUKA 5CM6A 4AKRB 4G8HA 2ZM0A 3R7XA 4YAHX 1WYBA 5JDMA 4HFVA 2Q2AA 4U4SA 4DVDA 3MVXA 3KN8A 5I59A 3LJCA 1FW0A 5TAOA 4ZE9A 3ZCJA 4L9IA 4YJ3E 1XHYA 1LFHA 4H9NC 3TKLB 4I43B 2A5TA 2VKJA 1P1QA 3LSWA 3EN3A 4PJLA 4DNDA 3G3KA 3G3JA 2Z23A 4AKLA 5FXZA 5L3BB 5AA2B 1DTZA 1SDXA 1N7XA 3RYHE 2LSYA 4NEDA 2X66A 3IOWA 3ONMA 4EDPA 3LR1A 3PGFA 4UF0A 1Y3PA 3ZYLA 4H9PC 1SBPA 3OSQA 3ILTB 4QSCA 1UX5A 3FATA 4OWDA 2IC6A 3RTWB 5JVDE 4NWCA 3KV6A 3HR0A 5EZYE 3KOSA 2H9BA 2X51A 2E9XC 1LSTA 5DTBA 1H43A 4K3FA 3ZC1A 3KVAA 5I56A 3U1OA 5L3EB 4JDFA 4PW8A 4H5GA 4IO2A 3PD8A 3ZN1B 2X7QA 2Y7WA 2ZXTA 4DDDA 2O6AA 4PFOA 2KXPB 2N2NA 4Z0IA 1SVXB 5AE4A 5CB4E 5I2NB 1NFTA 3DTOA 1Y3NA 2A72A 2DWIA 2THIA 4YB6A 5L3GB 5TU0A 3VKGA 3PU8A 4H9OC 4ISSA 4JWOA 1TFAA 1MH4A 4G68C 3MWBA 3FXUA 4CZZB 3D4CA 1PB9A 4HW8A 2EHOD 4X1BA 3VU7H 3RRCA 1IXCA 4G8NA 3H6VA 4NF6B 1HCIA 3IB0A 2OLBA 4H9SE 1UIUA 3JC6C 5F7VA 2X9HA 2ALUA 1SYHA 1SYIA 4OFLA 4WXJA 1FEWA 2NWJA 1OMPA 1MIYA 1D3KA 4U74A 1B7TA 2R6GE 3B6WA 3S9EA 4F3SA 1FTLA 2C5JA 1MMDA 5EK4A 1WDNA 4F22A 1T98A 1QVSA 3EHUA 5TPAA 3ZYKA 3FXDB 2LT3A 1USYH 1QKAA 3A09A 1Q35A 1T0KA 4U22A 3PE0A 5FTHA 3ZN0B 3B6TA 4P0AA 4OHNA 4GLIA 5JR9C 3SDFA 3MACA 4ANJA 5LGNB 3HCQA 3RPUA 3ANWA 4PFYA 1EH3A 2G0UA 3R84B 1WODA 5A1LA 3RY3A 3K6WA 3TEPA 2C5KT 1B4HA 1R6ZA 5LA6E 3JZJA 4PK4A 1O3XA 3QAXA 4ZEBA 2NVUB 1S94A 2Q9QC 4U21A 2WBLA 4O2AE 3T8OA 1MQGA 3GXAA 1BLFA 1D0ZA 2LSIA 4GK5E 4U72A 1BR4A 3GA8A 2YPNA 3SERA 4MFRA 1N04A 3QUJA 5HAXA 3CG1A 3H03A 3OO7A 4KI0E 3GN5B 3N9LA 1D1AA 4M4GA 4WBOA 3V83A 1P1WA 2CXFA 2CXDA 3ILUB 2L3LA 4U23A 2OWTA 3RT6B 2V3UA 3MW0A 2WSSV 3RYCE 5IYZE 3IJOB 1HS7A 3N6UA 4O3CA 3HKDE 5JDLA 4GOTA 2V3QA 1KWHA 2O1LA 4TUYE 3A3UA 2XX9A 3PPPA 4GF8A 2BVLA 3MA9A 3U78A 2REJA 2V7MA 3V8XB 2ACXA 5DABA 5ITOA 4DO0A 4XZCA 1YCJA 2VKDA 2XXUA 1N76A 3VXBA 1NNTA 4OENA 4Z7EA 4HCYA 1A8FA 3LK3B 3T22A 3MVYA 2E0SA 5L9SA 2JMKA 2KWHA 4ZI2D 4O2BE 1ZLQA 3VKHA 3ZPOA 2XXYA 4QXHB 3S4UA 1Y4TA 5L9MA 2DLRA 3FXQA 3K4UA 3K02A 3RLFE 3NBXX 4MBPA 4LP2B 1DOTA 3FXEB 1R9QA 1FQAA 2D21A 3N9PA 3AA6B 4JUYA 3ZKKA 2LEHA 1NKXA 4YMBA 2NWBA 5HWYA 3KJTA 4F3PA 4E7SA 3MZ9A 3O1HA 5J2TE 1EZ9A 3OO8A 3HKBE 1MDQA 2F7CA 2HEUA 1IZ1A 2I59A 2W61A 2QRYA 1LLSA 2B3FA 2XX7A 1XT8A 1WYCA 4OVJA 4I55E 4QFNA 4MALA 3CI8A 3N94A 5DJQC 2V25A 1B40A 1B58A 2VD3A 3AA1B 3UULA 2VWAA 3PMXA 2KMFA 5KCJA 2Z8DA 5LBQB 4ISUA 3OO6A 1VE4A 1P1NA 4WEPA 5FHMA 2ZMAA 1H45A 3IB2A 3FD3A 2VKHA 3MZKB 1DPPA 4G63A 4NF8A 1URDA 3HHGA 1S7YA 4G2AA 5H8NB 1M5BA 1B5IA 1YTVA 4POWA 1FTKA 2PBIA 3QK6A 4IO5A 4MF3A 3I5OA 4ZS3A 2CA5A 2H4IA 4H67A 4ZOLE 2V7IA 1FIOA 3EPEA 3TQWA 4X1IE 3EF7A 4DBRA 4R2FA 4P11A 4NF5A 2XAQB 2MBGA 2BDEA 1TXFA 4GWOA 4KYSA 1UTBA 2H7VC 3GMIA 1PBPA 1DSNA 1Y64B 5LNKA 2VD2A 2W7YA 1D1BA 1I69A 2IAKA 3TCFA 5ICTA 3H7MA 2H98A 4ELQA 1MY2A 4A56A 2XXVA 1MQHA 5HWXA 3RT8A 3KSXA 5LJMA 3CX8B 3TKDA 3EHTA 3IJXB 2NW7A 5FXWA 3PU5A 3ZEFB 1II5A 4H9RC 2JQQA 1USYE 2HH7A 4AKHA 1LAHE 4I9DA 1IITA 4WKMA 1GR2A 4GIZA 3C4MA 1MXYA 3KV9A 1BR0A 2P0SA 1FQFA 1MIVA 3LC8A 3ANWB 1OLCA 3D0TA 4AB6A 3WAFA 2DVZA 1Z7ME 3ZC0A 3O28A 1TFDA 3HHFA 3IOUA 3OXNA 2XTLA 2K48A 3N9NA 2X9WA 2ODUA 2ZNTA 4IE7A 1SA0E 5CA1E 4UV8B 3PUZE 3U92A 1EZPA 3E13X 3HPIA 3PUGA 3PMWA 1N3WA 4BDLA 3MQ9A 1Y3QA 1SHZC 4TN7B 4F2OA 4XKQA 4ZZEA 3MC2A 3CFLA 3DM0A 3N2GE 2W62A 4NUUA 2AYSA 4RJZA 3CFXA 4RPOA 5JTYB 2GK9A 2F35A 3VVEA 1WR6A 2DP8A 2RC7A 1B3EA 3QSLA 2L9QA 2CZLA 3L09A 3IR1A 1RKMA 2GH9A 4UIGA 3HL6A 4AKGA 3SKPA 3KVBA 1FQCA 3PUXE 4ZS2A 5TP9A 4EQ7A 1M5EA 2K9AA 1AL3A 3C32A 4PETA 4FIMA 2YLNA 3MVWA 3C4ZA 3UUNA 3RH3A 5H6QB 4JWYA 2F7AA 5HXHA 5ITPA 3GBAA 1IAPA 1XC1A 1N3XA 4IB2A 3IOVA 4UV9B 2DI4A 3FBLA 5LHGB 3I3VA 3K6XA 1D9YA 2HAUA 5EK3A 5KX5E 2Y8DA 1IIWA 3OD7A 4FJPA 5ICQA 1MMNA 3PTRB 1MQIA 3RYFE 2DWKA 4PFWA 1MXUA 5B7DA 5I2NA 4KR5A 4UELA 1SD3A 2M8CA 3MP1A 3MXZA 4POXA 4WNKA 2Z8EA 3C9HA 2Z6EA 5A5XA 4OHFA 5M4YA 5JK4A 2R71A 3PPQA 1FTOA 2QS2A 3SEXA 3EDVA 2I49A 5HXRA 4H5FA 4LUBA 2OBGA 4V1Av 4ILUA 1FQEA 1US7B 4XKNA 1UIVA 4HEAA 1D9VA 4OEUA 4JEHB 3I0QA 1VRBA 3K0VA 1IXIA 4OYKA 2PJQA 4QSEA 2UYFA 3CQXC 2XHDA 3TMGA 4B6XA 3CVRA 5HXSA 4DLDA 1TT1A 4MLKA 1AMFA 3VLUA 5I57B 2DHRA 1MPBA 4KUMB 3KDSE 5JREA 5TP9B 2V84A 2LOPA 4KP3C 2Q9QA 2CXLA 3ZMTB 2QS1A 3VXCA 2RC8A 3KINB 1H7CA 2XXIA 2KLQA 3LK2B 4JBZA 1B1XA 4M1PA 2NP9A 3AXFA 2NW9A 4IE0A 5H8QB 3O29A 5FP3A 5L3CB 4TZ4C 2WM9A 2FA7A 2LSKA 5ETWA 4HCWA 1IEJA 4DMVA 5LXTE 3DP4A 3LBXA 2E9XD 4H8IA 4RA1A 2VP1A 4R9GA 2ZYKA 4ZEDA 2OCUA 3BFTA 4UVAB 4IO6A 2UXAA 3PMVA 2JMHA 5F1QA 3IEEA 2R9JA 2BVMA 3PURA 4RYAA 5I57A 1NH7A 1ZIUA 1JQFA 4XXUA 3NRXA 2DXYA 3MP6A 3TELA 3E08A 3VVFA 2F6GA 4F31B 5CRYA 4OFZA 5E0OA 5H6RB 3UT5E 3E0ZA 3RGYA 3CWZB 1Y4CA 5IAIA 4C0RA 2DYXA 4F3BA 4ESWA 4R74A 1MY3A 2D0UA 4P0IA 4HN9A 4QHOA 2WMNA 2UVHA 4KMCA 3LK42 3SEYA 2YJPA 3OKQA 3O1IA 3ECRA 2QGSA 5LYJE 1ANFA 5FY1A 2ZYNA 5I84A 2IW5B 3C4XA 1LBBA 2EHOC 5C8YE 1H76A 3R6UA 5AFUL 3RPWA 3BQIA 3AVRA 5EHMA 3KFWX 4L17A 4QF9A 3LFMA 4ZE8A 1HG2A 4YICA 3V5AA 5CBRA 2BZBA 3IL1B 2VOZA 4XIGQ 1BKAA 2OZZA 4IIJE 3FV2A 4U1ZA 2F7BA 4MLVA 1GVCA 4R2BA 4QXBB 5JEIA 3J7Yq 1HX8A 4UF0B 4BA9A 1PEBA 2DWAA 2UYEA 3N5LA 3G7WA 4OETA 4O4IE 2I48A 1QUJA 4OXVA 1SI1A 1LFIA 5L8DA 4GYSA 4OFJA 4EXLA 2Q89A 4ZS9A 3UN6A 4GD5A 4PE5B 3CSGA 3RC8A 1OXZA 4AQFC 3PUVE 2ABHA 2K24A 3SEVA 2D0TA 2Q8JA 3OMBA 1B5HA 2Z22A 1A55A 1HF8A 4YHJA 1B1HA 2ESNA 4KQPA 4KPTA 4IY5A 1GTKA 3IBPA 5LGUB 1OVBA 5I59B 4YFSA 3SRZA 3OBVE 1ZJLA 4I62A 3S9NC 2UVGA 3UUMA 3C50A 1L5TA 1XS5A 4MHCA 4TV8E 2FYIA 3I6VA 4LZ5A 1CE2A 1LRZA 2VL8A 5J1DA 1MMGA 4KHZE 3K6UA 3CR9A 3KN7A 3PUQA 4EZ4A 4TOZA 3C34A 3HO7A 2O84X 2RKMA 2Y7IA 1MXWA 1JEUA 2Y7KA 3TTKA 2XUEA 3AA0B 2KZ7B 3RRWA 1VR5A 2X0LB 2ZNUA 2QMWA 4ELOA 1B0LA 2CLYB 4QHQA 1CUNA 5HXCA 1KNZA 1MNEA 3M65A 1N0TA 4ECFA 3UTKA 4IHJE 4EZHA 3HKCE 2YINA 2PMSA 2XD3A 4CQIA 2XXRA 1ZKBA 2B1EA 2N9DA 2HQ0A 2W63A 4X1KE 3OEKA 2KINB 4QXCB 1YD8G 2QS3A 4EOZB 3ZMSB 3N26A 1Q1KA 2V7JA 4BAYB 3RUMA 1MPDA 3U72A 4HKAA 1BP5A 5A5XB 2IC9A 3GN5A 4QFKA 3DP8A 2OK2A 2L8KA 2NOOA 4KD5A 5AA1A 4E0XA 4H63V 3NZPA 2ZYOA 1PBQA 2XXPA 2MOZA 3BFUA 3Q28A 3MAMA 3EVYA 4PK5A 2O7IA 5HYAA 3PV0E 4ZI3C 2F36A 2WKYA 3IB1A 3L3PA 1FQBA 4I4TE 4QX7B 3N9OA 4OFOA 4BJNA 4HTGA 3L6GA 3H6WA 1US5A 3O4XE 4Q5TA 2O7UA 3CX6B 2C0SA 3VFJA 4NF8B 4X48A 3AVSA 1Y20A 2Y7RA 4X20E 3PDYA 5KZTA 3U8QA 2RCAA 5LOMA 2I0CA 1IZNB 2NW8A 3O9PA 3G3GA 2WWUA 3IAZA 4O3BA 4UEMA 5HPQA 2VGQA 4OMBA 2UVIA 4JWXA 1B7UA 1ZV4X 3F2EA 2YU1A 2DWHA 2H25A 3CQCB 1SW5A 3H37A 4TV9E 4F1YA 2KWIB 4DMWA 5DT6A 1FTMA 3OEMA 2P1SA 3KOTA 4EUOA 3ZMUB 5CMMA 4YB7A 3I0OA 2UVJA 3GWHA 4YZZA 1HFAA 2HZKA 2XX8A 3SOLA 4QWNB 2QL3A 5FYMA 3H3AA 1B7ZA 1PB8A 4F29A 5J1GA 2F8DA 2H3RA 4ESXA 4C90A 1RYXA 3KBUA 1NWMX 3H4ZA 2P2AA 3H6TA 4H8JA 3JV9A 3Q27A 4ZECA 3P8CD 1ZKEA 4J2CA 4HTEA 1B4ZA 3QYTA 5LJNA 1DMBA 3EHSA 4NUVA 1URGA 1JW1A 3LG7A 3TUSA 3ZMVB 4O3AA 2QJEA 3I9YA 5L3FB 1P1OA 2DOJA 3TTMA 3VLWA 1JVXA 2XXXA 1FCKA 3UIFA 3FVKA 2V26A 4IO7A 3Q5XA 1QJMA 2H99A 4ND9A 4TLLB 2LAOA 1O63A 1Y1ZA 3GZGA 3MZBA 1Y9UA 2E1SA 2VHAA 4UVBB 4IE4A 4OYVA 3U94A 1XVYA 2HXWA 3DELB 1G8XA 5DEXB 4NWDA 5JDQA 3ZCIA 4GRKA 2D2SA 3BQKA 3JC6D 2V7LA 1BTJA 4EIWA 1IUDA 1OQGA 3N2KE 4IO3A 3KN3A 4X1YE 1MXZA 4P09A 3WAJA 4IGTA 1B51A 1SW2A 3N2OA 1CB6A 3N6TA 2X7PA 5LBMA 3MJXA 4EF1A 1LCTA 3FV1A 3H06B 5H8NA 4ELPA 5KDTA 4M1VA 4U4XA 4MBQA 3TCGA 4PQJA 4N6PA 3VLVA 3PUAA 5AA3A 3LBXB 5CMCA 5JDGA 4AI6A 3TAJA 3OJAA 1RYOA 3C4WA 2GHAA 3SS1A 1JW4A 3W15C 4DE8A 4QKNA 2B65A 4XBFB 4AKIA 5FY0A 2D3IA 4RK9A 3ZS6A 2JJ9A 1NNFA 2WMOA 5KDMC 3TFLA 3DP6A 3U93A 3T66A 1DTGA 2NUVA 1US4A 4OERA 2P9BA 1KK7A 5HBCA 3CX7B 2IEEA 3ZJ2A 1D1CA 3MPLA 2D5WA 2ZNSA 1MNDA 1LB9A 2CWOA 1B3HA 4JB7A 3QIMA 3BQLA 3FHNA 4R9FA 4H6DA 4QX8B 2XQYA 1YKEB 5EYFA 1UX4A 1FMWA 4GL8A 3C36A 3CSBA 1SW4A 2LJLA 3T9UA 2YEVC 4F19A 3Q5WA 4F39A 3T96B 5EK2A 3LSFB 4JLEA 2F6PA 3K8PC 3C98B 3EQ1A 4QFLA 4MLQA 4GXAA 4EF2A 3KJ7A 1FMVA 2M67A 3O6IA 3VV5A 3MVZA 3Q25A 3S9LC 3K1NA 3V89B 2JRKA 5DVJA 4ADZA 1NH8A 1MPCA 3B57A 5H8FA 1ATGA 4DXBA 2LM9A 2GFEA 2O51A 4PK6A 5DVIA 3M3LA 2XAHB 4ERRA 2XXQA 3TTRA 4AQFA 1ZTYA 3UUXB 1B5JA 1DPEA 3TPAA 4EAHA 2LHRA 2PT1A 5LHIB 3F31A 4O4JE 2QMXA 4X9TA 3TDJA 2F34A 2CMRA 3LUYA 3L6HA 2CEAA 3N9QA 4FI5A 4PJJA 1TWYA 4LVQA 5I58B 3USDA 2V3TA 1JEVA 3TZAA 1YAEA 3HV1A 3TQLA 1B0HA 1MRPA 4K0UA 2DWJA 4EYUA 2DCFA 3O2AA 1PC3A 3JYRA 4X1DA 3DP7A 2Q9TA 2JPFA 3J9X1 4P0GA 4UA8A 2DE4A 4AQ4A 1URSA 3ETUA 2O69A 3KEIA 5I2KA 4FATA 4XAXB 1B3GA 4DCXA 2A2FX 1B46A 3PPNA 2ONRA 4NMYA 1MG1A 3ESLA 2ZM8A 2ZYMA 4QFPA 3UORA 3PUWE 1U5PA 5AA2D 3MBPA 5K2YA 1P99A 5FNVE 4H0WA 1D4NA 1AIVA 4GK0E 3K01A 3T9VA 5TPAB 5CMBA 3OSRA 4PJMA 5DVFA 1YW0A 1A8EA 3AAAB 3IF8B 2QSXA 4ZEIA 5JR9B 2ES0A 4NTLA 3O1JA 3RYIE 1XVXA 2Y48B 5FY7A 2A3DA 3KFMA 4DXUA 4G77A 3KV4A 1XOCA 2G93A 4BJMA 2ODVA 1LFGA 3TTLA 4E7ZA 5CA0E 2Q9QD 3E22E 1D0YA 2V7KA 2Q9QB 2I3WA 3O97A 4XTCQ 4H65A 2OJTA 1I6BA 1IXHA 2X67A 3WAKA 4PFUA 3S9MC 2XXWA 4RY1A 1ZBMA 1VSOA 3R6NA 4BLAA 4XKRA 3E3KA 3WAEA 4IDZA 1ZMGA 3IO4A 4Q0CA 1B3FA 2KLFA 2ZLYA 2LE8A 3IORA 3E9XA 4R6KA 3VE1B 3M8UA 2X9YA 3ZYMA 3KBTA 1BR1A 2FNCA 4I1DA 2AL5A 5LGTB 4GYRA 2C5IT 1Y1MA 2LSJA 5AA4B 3O9XA 1ELJA 3RC3A 3VDFA 1LVFA 2Y7PA 4ZEKA 3QC9A 1A7LA 2XXHA 5FTIA 3ZSFA 1PDAA 5H8HB 4ONYA 5KCJB 2Y6XA 1OVTA 2E8IA 4ISTA 2G29A 4QSDA 3HN0A 1MMAA 2J1DG 3LSLA 1HTJF 1OLAA 4Q8RA 5I2KB 2ANJA 2UXXB 1JETA 2F78A 2AL4A 1AJ3A 2CE7A 4LQ2A 3E4RA 3QUFA 4PFPA 4LZ7A 2DQVA 1S35A 2HPJA 2XAGB 1NL5A 2Y84A 3W9VA 2XD2A 2VB6A 2XAJB 5IKBA 3FASA 4GVOA 5K2XA 1IJ6A 2E9XB 1NMUA 2PFVA 3FJMA 2ONKE 4F1UA 2W0GA 5I58A 1EZ3A 3IO6A 4G8MA 4N13A 3HA4A 3I1AA 3ZMZB 3OOAA 2X26A 4FORA 4NE4A 3I9WA 3ETVA 4GL0A 3C51A 3CQGB 4PNIA 3AB3B 3IHRA 5ADXL 1QUUA 3Q9DA 4IGUA 1O7TA 3O66A 4EXTA 1MIWA 5AA4A 2XAFB 4GOUA 2CM0A 1LKXA 3NZQA 1Z7NE 4H9QC 3BKIB 1B32A 5LHHB 4ZI3D 3LBSA 4JSDA 3K2DA 1AOVA 3O6HA 4F1VA 5DQWA 1EU8A 5H8HA 1WRDA 4LA9A 4Q30B 3TYHA 4KFQA 1R1NA 3K3OA 3FJGA 4ZEFA 4UVCB 5LCYA 3UGWA 2N1GA 3H6UA 4R6YA 3R26A 4DXCA 5JRCA 1H44A 3IOTA 1WVJA 3K3NA 4IGRA 5M2VA 5L2LA 4DZ1A 3ZLIA 2YK0A 2NTXA 3KV5A 4ZHQE 4TQUQ 1F9BA 1QKBA 2PBWA 3K00A 2BJJX 4DCYA 3RTFB 3VHLA 4MH5A 4EYYR 3O6GA 3FBZA 4G68B 3TCHA 1IJ5A 4ELRA 4QFOA 2H5YA 4YMAA 4LQ5A 2W00A 1WLXA 2AIXA 1JNFA 3T9XB 2O68A 4KYDA 1POY1 3UP9A 4FE8A 4CXWA 4BDRA 4OTEA 4IO4A 4KBMB 3HKEE 5LP6E 3PU3A 2QA7A 3UFEA 3KSJA 2EHOA 3DJBA 2Q88A 1LB8A 2H7OA 4U2RA 3FGSA 4FEDA 3MJNA 5ELVA 2I58A 4YKJA 4ZZAA 3EDUA 4RK2A 4IE5A 3C64A 1POTA 4YLHA 2X9XA 3ZJ1A 1SI0A 4CXYA 4LONB 1N7WA 1IXGA 3C35A 3C33A 1LGBC 3FZVA 3MKDA 4PFTA 5H8QA 4EB6E 2CWYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NF4 B;  4H5F A;  4Z0I A;  1SVX B;  4LUB A;  2OBG A;  3SEU A;  4RK9 A;  2D3I A;  5AE4 A;  3ZS6 A;  5I2N B;  1NFT A;  1NNF A;  1FQE A;  1MXV A;  3T93 B;  1Y3N A;  4XKN A;  3TFL A;  1UIV A;  4BDM A;  3DP6 A;  1D9V A;  2DWI A;  3U93 A;  4OEU A;  3T66 A;  2THI A;  3OO9 A;  1DTG A;  4YB6 A;  2NUV A;  1US4 A;  3BBR A;  4OER A;  5AA2 B;  3ODB A;  1MM7 A;  5HBC A;  4LZ8 A;  5TU0 A;  4NF6 A;  4JWO A;  3K0V A;  1IXI A;  1TFA A;  2IEE A;  4QSE A;  2UYF A;  3MPL A;  2D5W A;  2XHD A;  2ZNS A;  4B6X A;  1MH4 A;  4G68 C;  1LB9 A;  3MWB A;  3CVR A;  1B3H A;  4YB5 A;  4YKI A;  4DLD A;  1TT1 A;  3QIM A;  4JB7 A;  3FXU A;  3D4C A;  1PB9 A;  1AMF A;  4R9F A;  2O1M A;  1M5D A;  4H6D A;  3VLU A;  4X1B A;  4HW8 A;  5I57 B;  1MPB A;  1IXC A;  4G8N A;  2I4B A;  3H6V A;  1OQH A;  4NF6 B;  5EYF A;  2V84 A;  5TP9 B;  2I0B A;  1LAF E;  5KDT B;  3IB0 A;  2OLB A;  3IX1 A;  1P1U A;  4GL8 A;  3RNN A;  3VXC A;  3C36 A;  2QS1 A;  3CSB A;  2RC8 A;  1UIU A;  1B7H A;  1IQ7 A;  2XXI A;  1H7C A;  1SW4 A;  2B3B A;  5F7V A;  3RQT A;  3T9U A;  4F19 A;  2ALU A;  1B52 A;  1SYH A;  1SYI A;  2CMO A;  4KCD A;  4OFL A;  4JBZ A;  4WXJ A;  1B1X A;  4F39 A;  3T96 B;  5L9O A;  2NWJ A;  2DS9 A;  1J1N A;  1I6Q A;  3LSF B;  1OMP A;  2F6P A;  3AXF A;  3CKD A;  1D3K A;  2GRV A;  1UTH A;  2PT2 A;  3EQ1 A;  5EHS A;  5H8Q B;  3O29 A;  4QFL A;  1MM6 A;  3PD9 A;  3SES A;  4MLQ A;  4GXA A;  4EF2 A;  3KJ7 A;  2R6G E;  3TOD A;  3B6W A;  3O6I A;  2FA7 A;  3S9E A;  5FHO A;  4F3S A;  1FTL A;  2C5J A;  4HCW A;  3LSX A;  3CG3 A;  3MVZ A;  1WDN A;  3Q25 A;  2REG A;  1IEJ A;  3VV5 A;  3S9L C;  1MQD A;  3VVD A;  3K1N A;  5FHN A;  4F22 A;  2Z8F A;  3V89 B;  1QVS A;  3EHU A;  3DP4 A;  5DVJ A;  1NH8 A;  5TPA A;  1MPC A;  4H8I A;  4RA1 A;  3FXD B;  2RIN A;  5H8F A;  2VP1 A;  1USY H;  4R9G A;  4EXK A;  1ATG A;  2ZYK A;  4ZED A;  2OCU A;  4DXB A;  2GFE A;  2O51 A;  3BFT A;  3MP8 A;  4IO6 A;  1QKA A;  2UXA A;  3A09 A;  3M3L A;  3PMV A;  5DVI A;  5F1Q A;  2R9J A;  2XXQ A;  1Q35 A;  3TMG A;  3TTR A;  5KDT A;  4R75 A;  4RYA A;  1T0K A;  4U22 A;  5I57 A;  1ZTY A;  1NH7 A;  1ZIU A;  5FTH A;  1JQF A;  1B5J A;  1OIB A;  4XXU A;  5H8F B;  1S9T A;  2DXY A;  3MP6 A;  3TEL A;  1DPE A;  3TPA A;  3VVF A;  2F6G A;  4F31 B;  2PT1 A;  3B6T A;  5CRY A;  3THI A;  2HZL A;  4OHN A;  4GLI A;  3OEN A;  1Y4C A;  3RGY A;  3SDF A;  4C0R A;  5IAI A;  2DYX A;  3HCQ A;  4GFR A;  2QMX A;  4X9T A;  3TDJ A;  4F3B A;  4ESW A;  2F34 A;  3LUY A;  3L6H A;  4L0R A;  4R74 A;  1MY3 A;  4P0I A;  3SEW A;  4PFY A;  1QSD A;  2DVC A;  3FIR A;  1EH3 A;  4ZDM A;  2UVH A;  5CC2 A;  2G0U A;  2I6E A;  1WOD A;  3KZG A;  4FI5 A;  3RY3 A;  3SEY A;  2YJP A;  3K6W A;  3TEP A;  1R6Z A;  1TWY A;  2C5K T;  1B4H A;  3ECR A;  3JZJ A;  3QAX A;  4GQO A;  4LVQ A;  4MFI A;  2ZYN A;  1ANF A;  3K1P A;  5I58 B;  3USD A;  4U21 A;  5I84 A;  1MQG A;  2V3T A;  3GXA A;  3Q26 A;  4FAJ A;  1BLF A;  1JEV A;  1LBB A;  1H76 A;  1MY1 A;  1VFD A;  1YAE A;  3CFZ A;  3HV1 A;  3R6U A;  3TQL A;  3RPW A;  4WED A;  1AOV A;  1B0H A;  1MRP A;  2YPN A;  1MQJ A;  3SER A;  2A5T B;  1GGG A;  1N04 A;  5EHM A;  3QUJ A;  2DWJ A;  4L17 A;  4QF9 A;  3CG1 A;  3H03 A;  3OO7 A;  4KI0 E;  4ZE8 A;  3O2A A;  1PC3 A;  2F5X A;  3JYR A;  4YIC A;  3FVO A;  3V5A A;  5CBR A;  4X1D A;  4I8C A;  4M4G A;  5JTY A;  3IL1 B;  2VOZ A;  4XIG Q;  1BKA A;  3FUZ A;  3V83 A;  4XKP A;  2OZZ A;  2Q9T A;  5CI5 A;  1P1W A;  3ILU B;  1ZU0 A;  3FV2 A;  4U1Z A;  2F7B A;  4MLV A;  1GVC A;  4R2B A;  1EZO A;  4U23 A;  2OWT A;  3RT6 B;  5JEI A;  2V3U A;  4P0G A;  4UA8 A;  2DE4 A;  3RN8 A;  3IK6 B;  4AQ4 A;  5ISU A;  1URS A;  2O69 A;  3MW0 A;  1PEB A;  2DWA A;  3KEI A;  4JXI A;  2UYE A;  1M5F A;  3IJO B;  4R73 A;  4FAT A;  3B7D A;  3N5L A;  5I2K A;  3G7W A;  3N6U A;  1PB7 A;  4OET A;  4F29 A;  1QW0 A;  4O3C A;  1B3G A;  2I48 A;  1QUJ A;  4OXV A;  1B46 A;  4DCX A;  1SI1 A;  3PPN A;  3PPO A;  1LFI A;  2V3Q A;  4G4P A;  2ONR A;  4GOT A;  4NMY A;  4OFJ A;  1KWH A;  2QS4 A;  2Q89 A;  3FXR A;  4ZS9 A;  1MG1 A;  4EXL A;  5CMK A;  3UN6 A;  2O1L A;  1B2H A;  4GD5 A;  2DSF A;  2ZYM A;  4PE5 B;  4QFP A;  3UOR A;  1JW5 A;  3CSG A;  5B70 A;  4YKK A;  4NF5 B;  1NNP A;  3A3U A;  3PUW E;  4H1X A;  5AA2 D;  3PUV E;  2ABH A;  2XX9 A;  3MBP A;  1P99 A;  3PPP A;  4GF8 A;  5K2Y A;  3B6Q A;  4H0W A;  3SEV A;  1D4N A;  2REJ A;  3G3H A;  3OMB A;  1B5H A;  2PX1 A;  2Z22 A;  2Q8J A;  3V8X B;  1A55 A;  3K01 A;  1AIV A;  1B1H A;  2ESN A;  5ITO A;  1B9J A;  4KQP A;  1M5C A;  3T9V A;  4G68 A;  5TPA B;  3P7I A;  5CMB A;  1FTJ A;  4IY5 A;  1YCJ A;  4KPT A;  1GTK A;  3OSR A;  2XXU A;  1LAG E;  5DVF A;  1OVB A;  1A8E A;  5I59 B;  1N76 A;  3VXB A;  1NNT A;  4OEN A;  4Z7E A;  2QSX A;  4HCY A;  1A8F A;  3T22 A;  3MVY A;  2E0S A;  3A3C A;  4ZEI A;  1ZJL A;  4I62 A;  4C1T A;  5L9S A;  4EQB A;  3S9N C;  2UVG A;  2KWH A;  2DXR A;  1ZLQ A;  1L5T A;  1XS5 A;  3MPK A;  3TTN A;  4NTL A;  5CBS A;  2FYI A;  3I6V A;  4LZ5 A;  4TLM B;  1XVX A;  1HSL A;  4EQ9 A;  2PVU A;  2XXY A;  4GXS B;  3S4U A;  1CE2 A;  3KFM A;  1LRZ A;  4ELP A;  5J1D A;  4DXU A;  1Y4T A;  3D4G A;  4G77 A;  5L9M A;  1XOC A;  3FXQ A;  2G93 A;  3K4U A;  4F3G A;  1LFG A;  4E0W A;  3K02 A;  4KHZ E;  3RLF E;  1MDP 1;  3TTL A;  2V93 A;  5H8S A;  4MBP A;  3K6U A;  1DOT A;  3FXE B;  1R9Q A;  3CR9 A;  1S50 A;  1FQA A;  4LP2 B;  3KN7 A;  3T9H B;  1I6A A;  2D21 A;  4TOZ A;  3C34 A;  3HO7 A;  2O84 X;  2I3W A;  2RKM A;  2DE3 A;  1MXW A;  1MY4 A;  2Y7I A;  3CVG A;  3O97 A;  3CIJ A;  2I3V A;  4XTC Q;  1JEU A;  4H65 A;  2Y7K A;  1NKX A;  3ZKK A;  4YMB A;  3TTK A;  3PUY E;  1YPN A;  1O64 A;  2OJT A;  1I6B A;  3G3I A;  1VR5 A;  4LAT A;  3KJT A;  4F3P A;  3MZ9 A;  1IXH A;  2RC9 A;  2ZNU A;  4OQO A;  1A54 A;  2QMW A;  1EZ9 A;  3OO8 A;  4ELO A;  1N84 A;  4OES A;  1B0L A;  4KCC A;  4QHQ A;  4PFU A;  3KBR A;  3KG2 A;  1MDQ A;  2XXW A;  2F7C A;  3FJ7 A;  3T9X B;  3S9M C;  2HEU A;  1NNK A;  1IZ1 A;  1ZBM A;  4RY1 A;  1B05 A;  1LLS A;  1N0T A;  1VSO A;  2B3F A;  2QRY A;  2XX7 A;  1XT8 A;  3G3F A;  3TZA A;  4ECF A;  1BIY A;  2PMS A;  4BLA A;  4XKR A;  2XD3 A;  4CQI A;  3E3K A;  2XXR A;  1ZKB A;  4OVJ A;  2NXO A;  4QFN A;  3WAE A;  3UK4 A;  2HQ0 A;  1ZMG A;  3CI8 A;  3IO4 A;  3KGC A;  3N94 A;  4Q0C A;  4DIG A;  1MH3 A;  1B3F A;  3OEK A;  2V25 A;  2QS3 A;  3FVN A;  3N26 A;  1B40 A;  1B58 A;  1Q1K A;  2KLF A;  2VD3 A;  1A99 A;  3PMX A;  3IOR A;  3M3K A;  3RUM A;  1LAX A;  1MPD A;  3E9X A;  3DLN A;  2Z8D A;  4R6K A;  3U72 A;  3VE1 B;  1A40 A;  3M8U A;  5KCJ A;  2X9Y A;  1BP5 A;  4F2Q A;  4ISU A;  3OO6 A;  2DE2 A;  5A5X B