3P7IA

Crystal structure of escherichia coli phnd in complex with 2-aminoethyl phosphonate
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
300
structure length
300
Chain Sequence
b'KALNFGIISTESQQNLKPQWTPFLQDMEKKLGVKVNAFFAPDYAGIIQGMRFNKVDIAWYGNLSAMEAVDRANGQVFAQTVAADGSPGYWSVLIVNKDSPINNLNDLLAKRKDLTFGNGDPNSTSGFLVPGYYVFAKNNISASDFKRTVNAGHETNALAVANKQVDVATNNTENLDKLKTSAPEKLKELKVIWKSPLIPGDPIVWRKNLSETTKDKIYDFFMNYGKTPEEKAVLERLGWAPFRASSDLQLVPIRQLALFKEMQSVKDNKGLNEQDKLAKTTAIQAQLDDLDRLNNALSAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PhnD, subunit of alkylphosphonate ABC transporter
publication title Structure of the Escherichia coli Phosphonate Binding Protein PhnD and Rationally Optimized Phosphonate Biosensors.
pubmed doi rcsb
source organism Escherichia coli uti89
molecule tags Transport protein
total genus 119
structure length 300
sequence length 300
ec nomenclature
pdb deposition date 2010-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12974 Phosphonate-bd ABC transporter, phosphonate, periplasmic substrate-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3p7iA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3p7iA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3p7iA02
2X9YA 3KN3A 4MLQA 2G29A 4JXIA 3Q26A 1Q35A 1Y4TA 2NVUB 1II5A 3N6TA 4N13A 2ONSA 3R6UA 2F34A 3OSRA 5B70A 3OO6A 4NF4A 4WEPA 4TOZA 3UGWA 5I57A 3VFJA 1MDQA 4RA1A 2OLBA 3FXQA 4HW8A 2KWIB 3G3JA 3L6GA 1EZ9A 3L6HA 3ILUB 4RK9A 3QYTA 4G68C 4I1DA 3O28A 3S4UA 3PPOA 3T9UA 4U2RA 3TCGA 1ZIUA 1EH3A 1Z0PA 4YAHX 3BKIB 2QPQA 1EZOA 1I6BA 3MZ9A 3EPEA 3S9EA 3OOAA 1M5DA 1AL3A 4R75A 3SEVA 2V84A 2BJJX 4ZEIA 4ECFA 5AA1A 5H8FA 3LSWA 2Q2AA 5ELVA 4GWOA 3PUYE 4LQ5A 2GRVA 1S50A 1A8EA 3KFMA 2AL4A 2W7YA 4R2BA 1UTBB 2F97A 4I62A 2UYFA 3N94A 1PB8A 3DM0A 1TFDA 4B6XA 5I2NA 3CR9A 5K2YA 1NH8A 1BIYA 4TLMB 3ZS6A 2OWSA 3PUWE 3M8UA 5DVIA 4ESWA 1XS5A 2HZLA 4QHQA 3B6QA 3MC2A 5AA4A 4F19A 3VE1B 2X26A 4POXA 3O6IA 3EHSA 5I84A 3TQLA 4EXLA 1UTHB 1LAFE 2UVHA 4HCWA 3M3LA 1IJ6A 4IGRA 1IXGA 4Z0IA 2ONKE 5CBSA 4N07A 3FVNA 3H6TA 4O3BA 4KYSA 1B3LA 3FVOA 4OESA 5A5XB 3G3IA 4F2QA 3D4CA 5F1QA 3GLBA 4GVOA 4ZDMA 4JWYA 4CQIA 1A54A 3OO9A 4IY5A 3RPWA 2ZYKA 4NF4B 3KJ7A 5IAIA 4O3AA 1MH4A 3PD9A 1UIUA 5DYHA 1M5BA 3KG2A 4RXLA 4H65A 4DE8A 4KI0E 3V5AA 2XTLA 4GF8A 3UK4A 4GXAA 3R7XA 3PMWA 2UVGA 1IZ1A 4JSOA 2D5WA 1ZU0A 3OO8A 1BP5A 4YKJA 4BDOA 2P2AA 4ZZEA 3LBSA 1AOVA 4GQOA 4YICA 4R72A 4NMYA 1H45A 2Z8FA 3PUZE 1B7HA 1MDP1 2RC7A 3FXUA 4EDPA 3PD8A 3RT8A 3U94A 3H7MA 4DCXA 3FGSA 3MZ1A 4OXVA 3K0VA 4POWA 4H6DA 3ECRA 5L9SA 1Y3NA 4RYAA 4IO6A 3IO6A 2DVCA 2PT2A 1BKAA 3C9HA 3QUJA 3IJOB 3DP6A 4YKKA 3K6UA 5CBRA 2I0CA 2ESNA 3TCFA 4FI5A 4MBPA 4U22A 4OERA 3S9NC 3K1NA 4JBZA 1YAEA 3AXFA 4AQ4A 4KD5A 3VXCA 1SW2A 1QVSA 1AH5A 4PQJA 3VVEA 1PB9A 4AB5A 4IO3A 5I58B 1OMPA 5AA4B 1JNFA 3T66A 2Y7PA 3H06B 4XTCQ 5CMCA 4YB7A 1PB7A 3IJXB 4FEDA 5DVFA 4NF6A 2XXHA 4U1ZA 2F78A 1IXHA 4PP0A 4GD5A 4FATA 4U23A 4QSEA 1TWYA 4LQ2A 5L9OA 1O63A 1NMUA 1MQHA 4LATA 4G8NA 3WAFA 3KEIA 1N84A 4I8CA 3ZKLA 5DVJA 2MBGA 3QAXA 4IB2A 4OHNA 1N3WA 4H8IA 1FTMA 1PBQA 2HAVA 4F31B 1MQJA 3PV0E 4H5FA 4YKIA 2A5TA 2F35A 2H9BA 1MM7A 4GLIA 3MVWA 3KOSA 4KCCA 1MQIA 1FTJA 3K1PA 4JWXA 3C4MA 1SW5A 5FHOA 4MLVA 1MQGA 1PC3A 4F1VA 4FECA 1QKBA 3KOTA 4X1BA 3F11A 3U72A 4LVQA 4LZ7A 5FTIA 2HAUA 1CB6A 2XHDA 5CMMA 2OJTA 5TPAA 2HCAA 3MP8A 3PUVE 2V3UA 3HCQA 2Y7KA 2H5YA 3EHTA 3UN6A 1RYOA 1B32A 1LAHE 4G4PA 4PFWA 4KFQA 1NH7A 4ELOA 3T22A 3GXAA 4Q8RA 4Q30B 1TFAA 4BLAA 2Q8JA 5AA2D 3S9LC 4ZZAA 3E4RA 1JW4A 3K6VA 3K00A 4BDQA 4XKPA 1ZKBA 1P1UA 1NKXA 1IQ7A 4GL0A 1OLAA 3ILTB 3VVFA 3PPNA 1POY1 1JW5A 1LBCA 4F2OA 3L3PA 2DWIA 3IO4A 2ZYOA 2Z23A 4YU0A 3BFUA 2OWTA 2I6EA 3HHFA 1LFIA 2D3IA 2B3FA 2E1SA 4N6PA 3PGFA 4F39A 4NF6B 2F6GA 3PMXA 4QRZA 4G8MA 4ZEBA 1TT1A 4OWDA 1D9YA 1Y20A 2PYYA 2I4CA 3TKLB 1B40A 1LBBA 4LZ8A 1IIWA 1JEVA 5AA3A 3G3FA 3RT6B 1S7YA 4AB6A 2QMXA 4X1DA 4DIGA 4ZE8A 2GHAA 1DTGA 2I49A 4KYEA 3RY3A 5JEIA 1JVXA 4DXUA 1SI0A 1MXYA 2OBGA 1OVBA 2PMSA 1B5HA 3O97A 4LONB 4F3GA 4IO2A 3E9XA 2NUVA 2DSFA 3FV2A 1JETA 2ONRA 4EYYR 2HZKA 1XVYA 3QIMA 1DSNA 5ICTA 3T9HB 2HXWA 4OEVA 1B3HA 2XXYA 4RY1A 4TLLB 1BLFA 2NOOA 3B7DA 3IORA 4BDRA 4QFLA 2H4IA 5TP9A 1FQDA 4FORA 4ELRA 3H6WA 4OVJA 3MPLA 1JEUA 4QSCA 3TTLA 1NNTA 4L0RA 4EF2A 2ZYNA 4R74A 3KN8A 3TELA 1PDAA 2ZNUA 4XKRA 2CA5A 2P0SA 1MM6A 2UYEA 4ISUA 4IY6A 4QFKA 3TKDA 5CRYA 4IO4A 1US5A 5KDTA 1N76A 2PX1A 2C5KT 5DEXA 1LAGE 1P1OA 3G3HA 2R71A 1Y1MA 3FD3A 3SESA 2VGQA 4G2ZA 1MY4A 1QSDA 5FHMA 3U92A 2RCBA 4K3FA 3KZGA 1Z7ME 1S9TA 3H03A 1B3GA 2A5SA 1B4HA 5EYFA 4FAJA 3IR1A 1VFDA 3OXNA 1FTKA 1ZTYA 3T96B 1ATGA 1LB9A 1MPBA 4QFPA 4PFUA 2V3QA 2XXPA 4IO5A 1BTJA 1ZMGA 1OVTA 2ZMBA 3VLUA 3G7WA 4FE8A 4EQ9A 2REGA 5BWJA 4OQOA 3SEWA 3W9VA 4RK2A 3LUYA 2DWAA 1URDA 4NTLA 1D9VA 5BUUA 2YJPA 2ZNSA 4YMAA 4EXKA 1B7ZA 2F36A 2FNCA 4IGTA 3KSJA 3A3CA 4QFOA 2Y7IA 2AIXA 2I58A 2ZNTA 3HSTA 2ALUA 4PETA 1I69A 3CVGA 1JW1A 2Q9TA 4G68A 5I57B 4EQ7A 2O7UA 1AMFA 1SDXA 5JTYA 3TMGA 4Q0CA 3RGYA 1R6ZA 1HSJA 3K02A 3EQ1A 5EHSA 1B52A 1Y3QA 3TAJA 3VDFA 1IEJA 4GL8A 1MS7A 2GHBA 3IB0A 1P1NA 2Y7RA 3RQTA 1MXVA 3JYRA 4R9FA 3D4GA 3MP1A 4QF9A 3IX1A 3SEUA 2XXXA 1DPEA 2CMOA 1FQAA 4U4SA 4DXBA 5KDTB 1MXWA 5H8FB 5AA2A 1LVFA 1VSOA 4BDLA 1GV8A 4F22A 1SYHA 3CFZA 4YZZA 5F7VA 4JWOA 1M5EA 2DS9A 3Q25A 1P1QA 4MF3A 2OCUA 2RCAA 5KCJA 1P1WA 3CG3A 4HCYA 4RPOA 1LFGA 4C0RA 3MVZA 1IITA 5I2NB 1JQFA 1FCKA 2O68A 2I3VA 3RNNA 4EQBA 5KZTA 3FV1A 5H8QA 2PBWA 2Z22A 1UIVA 2F7AA 5M2VA 1IXIA 1ELJA 4H8JA 1B5JA 1FW0A 3O6HA 3QSLA 4C1UA 2HFBA 3PU5A 1USYH 4H0WA 1B5IA 2XXQA 3FXEB 3O2AA 1MXZA 3DLNA 2AL5A 5DT6A 3TTRA 4R9GA 1JVYA 2XX7A 3FUZA 4FIMA 2X7QA 2G0UA 3P7IA 1H76A 2Q89A 4ZS9A 1YPNA 1SBPA 5H8HA 1B58A 4OETA 1A40A 1FQEA 2VOZA 3PPRA 2O1MA 2LAOA 3E13X 3OEKA 4C1TA 2DXYA 5CC2A 1A99A 3OSQA 3PPPA 5JTYB 5ICQA 3FJ7A 2REJA 4BDNA 4XKNA 3IB1A 2O69A 1ZBMA 3RN8A 1MXXA 1MXUA 2FYIA 3TUSA 1TXFA 5I56A 3WAEA 1SYIA 2D21A 4OFOA 3PUXE 2B65A 1B1HA 1H3DA 1SQYA 2X9WA 5EHMA 2Z8EA 4LZ5A 5I59A 3LR1A 3HHGA 3UIFA 1Y4CA 3N5LA 1N04A 4YB6A 3RTWB 3HV1A 4I9DA 1ZKEA 3GZGA 4M1VA 5AE4A 2YLNA 3CKDA 2HQ0A 1FTLA 3MBPA 1NNFA 3S9MC 3FVKA 2OZZA 3TCHA 5IKBA 3ZSFA 3N26A 2RKMA 3W9WA 3OENA 2IEEA 3R26A 5KCJB 3JV9A 1EZPA 2V3TA 3W15C 2V25A 1OIBA 3FATA 1MRPA 2XXVA 3VLWA 3V8XB 4R6YA 2I48A 2X9XA 4ZEDA 1I6QA 2ZXTA 4DCYA 1L5TA 2DVZA 3GBBA 1OLCA 3HO7A 4OENA 5CM6A 1Y9UA 4R2FA 3IK6B 2NXOA 4U1OA 4U21A 2VHAA 3O9PA 5H8SA 5CMKA 1Y3PA 3TDJA 1GR2A 5HPQA 3H3GA 1MY0A 2DQVA 1XHYA 5L9MA 1MY1A 4F18A 2O51A 5B7DA 3EN3A 1R9QA 3DP4A 4X9TA 1B05A 5H8HB 3O6GA 1O7TA 1KWHA 3M3KA 2O84X 5LOMA 5FTHA 4H5GA 2DP8A 2RC9A 4X48A 3G3KA 4RPNA 1SD3A 1LCTA 3K1MA 1LGBC 2A5TB 3C32A 1N7WA 4QFNA 3FXDB 4NE4A 2XD2A 5I2KA 1B3EA 3KGCA 1MQDA 1DTZA 1IJ5A 1URSA 3DP8A 1QULA 4L17A 1SW1A 3LSXA 3TQWA 3A09A 5I56B 4WXJA 1N7XA 1MY3A 1RYXA 4XKQA 5A5XA 4F3PA 5I59B 3B6TA 3SETA 2P1SA 1ANFA 2O7IA 3TTMA 4JB7A 2R9JA 3QXMA 2FA7A 3LSLA 1R1NA 5TPAB 4J2CA 5ITPA 3U8QA 3MP6A 4MH5A 1RKMA 3MAMA 3SEYA 4KCDA 4P0IA 4DDDA 3U1OA 2H98A 4KPTA 3TODA 3I5OA 1H43A 1B9JA 3A3UA 1NNKA 4NF5A 2VD3A 5ISUA 1LB8A 4GIZA 3UP9A 5TU0A 1YTVA 1QUKA 3QUFA 4TQUQ 4OZ9A 2QS1A 1M5FA 1MG1A 4P0GA 2O1LA 2WKYA 4KHZE 1HSEA 3MQ9A 1B0HA 1FQCA 3TEPA 1B7UA 2DYXA 3IOWA 3UA8A 3MXZA 1HSLA 4PFYA 3JZJA 1M5CA 1NFTA 2I4BA 1A8FA 4Z7EA 3ZKKA 3MVYA 4H1XA 1H44A 3B6WA 1LSTA 3HN0A 3K6WA 1URGA 1B2HA 3H4ZA 4R6HA 1OQHA 2NWJA 1Y1ZA 4PFTA 3FVGA 5HM4B 4F3BA 2UVIA 4ONYA 1VFEA 1DPPA 2ABHA 3SDFA 1USYE 1A55A 4GRKA 3I6VA 2RC8A 2M8CA 1XC1A 4G77A 2F6PA 5I58A 4WEDA 2XXUA 2DE4A 1FQFA 2F5XA 2GFEA 3O29A 4RNSA 1GVCA 3OMBA 1SVXB 2THIA 5I2KB 2DE3A 3H6VA 1POTA 4HTGA 2DWJA 1B6HA 3U93A 3RLFE 1WVJA 1Z7NE 3KBRA 3VV5A 3FJMA 2QRYA 2C5JA 4KQPA 3TFLA 4ND9A 1MH3A 4F1YA 5TP9B 2ANJA 2XXRA 1NL5A 4QSDA 2GH9A 1B3FA 3IOUA 1MPDA 2F7CA 1FQBA 2V93A 2DOJA 2QS4A 2B3BA 3MW0A 4XXUA 3MJNA 2DWHA 2YPNA 1FTOA 4OEUA 1IUDA 3FJGA 3G3GA 3K2DA 1GTKA 4NF5B 3IOTA 4DLDA 2XX9A 2VP1A 4BDMA 4GXSB 2I3WA 4M4GA 3IL1B 2RINA 3S2VA 4NWCA 3TTKA 1O64A 3MPKA 1XT8A 2DE2A 4FJPA 5FHNA 5DEXB 3KN7A 4RJZA 3Q27A 4JDFA 1I6AA 5H8NA 3USDA 1IXCA 3GBAA 3T9VA 4DNDA 4P11A 3THIA 4ELPA 3KJTA 5HBCA 5L8DA 3QK6A 2IC9A 1VE4A 3K01A 3VVDA 3PMVA 3M3FA 4OMBA 1SI1A 1A7LA 2QSXA 4WKMA 3ONMA 4DXCA 3C34A 4HS7A 1LAXA 3UORA 4E0WA 3EF7A 5CMBA 3CFLA 4FEBA 2R6GE 1B51A 1QKAA 3VXBA 1B46A 3I3VA 2XD3A 3MWBA 4NWDA 3C35A 1F9BA 1SW4A 4ESXA 3OEMA 4KR5A 4OFLA 3Q29A 3E3KA 1US4A 4DZ1A 3FZVA 1CE2A 2Q88A 2ZYMA 3TPAA 2IC6A 2KLFA 5ITOA 2H25A 4YKPA 4GOTA 2QMWA 4G8HA 3C36A 1N3XA 3CG1A 4UACA 1LLSA 3TZAA 1WODA 4MFIA 3T9XB 1MPCA 3MVXA 4LUBA 2IA4A 3IAZA 3KSXA 4OFJA 4O3CA 3LC8A 3TYHA 4NF8A 3RUMA 4F1UA 3LSFB 3CSBA 4G68B 3FASA 2DXRA 4ZEFA 2F7BA 4PE5B 3BBRA 1VR5A 4GFRA 4F3SA 4OTEA 3EHUA 3H6UA 4LA9A 2XX8A 3C33A 1MY2A 2PT1A 3TTNA 3V83A 2Y84A 4KYDA 3IOVA 4JSDA 4ELQA 4U4XA 4UA8A 4E0XA 3SEXA 1GGGA 1Q1KA 1UQWA 3Q28A 1WDNA 4NEDA 3T93B 1D3KA 2Q2CA 4Q5TA 1EU8A 3CSGA 2UVJA 1LCFA 2OK2A 1ZLQA 3CRBA 3O66A 1B1XA 5AA2B 2QJEA 1QUJA 3ODBA 5H8NB 4R73A 2XXIA 3CIJA 1D4NA 3HPIA 4LP2B 3OD7A 3CVRA 4EUOA 2VD2A 2F8DA 2CZLA 1N0TA 2H99A 2C5IT 3C31A 3K6XA 2K48A 2XXWA 4ZEKA 1OQGA 5H8QB 1B4ZA 1NNPA 2Z8DA 4R6KA 4THIA 1AIVA 1QUIA 3IB2A 2E0SA 1LFHA 1DMBA 1PBPA 3K4UA 1P99A 1QW0A 1H7CA 4OYVA 1QJMA 2G93A 1B0LA 1UTBA 2HEUA 4ZE9A 2QS3A 3PPQA 3SERA 5DTBA 3FXRA 3OO7A 1R9LA 4YB5A 2I0BA 1DOTA 3CI8A 1ZJLA 3N6UA 4ZECA 3MUQA 3V89B 3OELA 4YMBA 4XIGQ 5K2XA 2RF1A 2X7PA 5JK4A 2PVUA 1J1NA 2XXTA 4H67A 4NF8B 3VLVA 4IO7A 3RTFB 2QS2A 3BFTA 1XVXA 2QL3A 2O6AA 4F29A 3FIRA 1UTHA 2UXAA 3CFXA 3DELB 1PEBA 2KWHA 5CI5A 1YCJA 2AYSA 1XOCA 1LRZA 1T0KA 2Y7WA 3SKPA 4EF1A 3MZBA 5J1DA
chains in the Genus database with same CATH superfamily
2X9YA 1UX4A 4LMLA 3FZLB 3KN3A 2W4XA 3KBZA 4AQGA 2CXDA 4MLQA 2J4GA 4EV6A 2G29A 4JXIA 5LDZA 4X8RA 3Q26A 1Q35A 1Y4TA 4QXBB 4EGWA 2NVUB 1II5A 3N6TA 3ONJA 4N13A 4OVPA 2FJAA 2ONSA 2K3WA 3R6UA 4H9PC 2F34A 3OSRA 3OO6A 5B70A 4V1Av 4NF4A 4WEPA 4QWNB 2AE9A 4TOZA 4IL9A 4P1EA 4PTKA 3UGWA 5I57A 1B7TA 3VFJA 4PJJA 2XQ6A 3ETUA 4QH5A 1MDQA 4RA1A 2OLBA 4U7YA 4WZXA 2JQHA 3FXQA 1HNXT 1VCTA 4HW8A 2KWIB 3G3JA 4YJ3E 1L0VA 3UFEA 2CXLA 3L6GA 3AECA 1EZ9A 3L6HA 5FXXA 3ILUB 3PV0F 4XFEA 3C51A 5FKYA 4BA9A 3QYTA 4G68C 4RK9A 5T3JA 4I1DA 4I3YA 4YSYA 1HTJF 3O28A 3S4UA 3PPOA 3T9UA 4U2RA 4ILBA 3TCGA 1ZIUA 1EH3A 5LBMA 5I5PA 3H37A 4OYJA 2XASB 1Z0PA 4YAHX 3BKIB 5ABGA 2QPQA 1X9BA 1EZOA 1I6BA 3MZ9A 4P1NA 4DV3T 3EPEA 3PTYA 3S9EA 4DI3D 2LOPA 3ZN0B 3OOAA 2LSYA 1M5DA 4EOZB 4N78D 3ANWA 1AL3A 4R75A 4TN7B 4H9QC 1NWMX 3HKDE 3SEVA 2V84A 1S35A 2BJJX 4ZEIA 5FYMA 4ECFA 4MNPA 5AA1A 5H8FA 2CXFA 3LSWA 2Q2AA 5ELVA 3P4PA 4MLKA 4GWOA 3PUYE 4LQ5A 2GRVA 1S50A 3JC6C 1A8EA 1YW0A 5FMNA 3KFMA 3Q5DA 4KP3C 2AL4A 2W7YA 3PUVF 4R2BA 4P9KA 1UTBB 3F57A 2B4MA 4UXNB 5HWYA 2F97A 2ODUA 4I62A 2UYFA 1FBFA 3N94A 1PB8A 2XPKA 3DM0A 1TFDA 1NUXA 4B6XA 5I2NA 5HXSA 1K9YA 3CR9A 5K2YA 2H7VC 1NH8A 1NUZA 2ACXA 1BIYA 4TLMB 3KV9A 2Q9QB 3FBPA 4DV1T 5HEGA 3ZS6A 3R84B 4X62T 2OWSA 3AEEA 4O7MA 3PUWE 3UU4A 3M8UA 4TUYE 3AEBA 3AAIA 2ZZWA 5DVIA 4ESWA 3KVBA 2LE8A 1XS5A 2HZLA 4JI1T 4QHQA 3C64A 2GK9A 3B6QA 1LBXA 3EKIA 3MC2A 5AA4A 2DNXA 4F19A 2CZHA 3VE1B 2JPFA 5ET8A 2X26A 2BS2A 2LT3A 4POXA 3O6IA 4O8MA 5M4YA 3RF1A 3EHSA 5I84A 3TQLA 4EXLA 4NX1A 5JDQA 1UTHB 1LAFE 2UVHA 4HCWA 3M3LA 2V7LA 3RPLB 1IJ6A 1IAPA 4IGRA 1IXGA 4Z0IA 2ONKE 5CBSA 3UUNA 2UUBT 5DQWA 4GX4A 4N07A 5J0ZA 3FVNA 4IHJE 3H6TA 4O3BA 2ZLYA 2B1EA 4KYSA 2WBLA 1B3LA 1IMBA 3FVOA 4OESA 4OK0A 3C50A 4E7SA 5A5XB 3N9NA 2C0SA 3QNUA 4AKLA 3G3IA 4MX6A 4BJMA 4P3LA 4F2QA 3OJAA 3D4CA 1HNZT 5F1QA 3GLBA 1G73A 4GVOA 4ZDMA 3AE5A 4JWYA 3ZT5A 4CQIA 4IIJE 1A54A 4IDNA 3ONXA 3OO9A 4IY5A 3RPWA 5C3JA 2LEHA 2ZYKA 4NF4B 4NGUA 4IREA 1I94T 3KJ7A 1G0HA 3SFEA 5IAIA 4O3AA 4NXMT 4PFPA 1MH4A 3PD9A 2DWGA 5KX5E 3ZJ2A 1UIUA 5DYHA 1M5BA 4QXHB 2BG9B 4I0UA 3KG2A 2R8TA 2NTXA 4DVDA 4M1PA 4RXLA 2A3DA 4H65A 5AQSB 4KI0E 4JI5T 4DE8A 3V5AA 2XTLA 3CPZA 5CB4E 2FIXA 3ZMVB 4TV8E 2VB6A 4GF8A 1KZ8A 1MNEA 3UK4A 5ABFA 4GXAA 4MNIA 4PFIA 3R7XA 4TNWA 5F3JA 1NV7A 4PAIA 2BS3A 3PMWA 2HHHT 2B76A 5EK3A 3IF8B 1IZ1A 2UVGA 4JSOA 2D5WA 3HL6A 1ZU0A 4OX9T 3OO8A 1BP5A 2V7MA 4YKJA 4BDOA 2P2AA 4O2BE 4PFOA 3RQWA 3LBSA 3CX7B 4ZZEA 1AOVA 4GQOA 3EVYA 4YICA 4UVCB 4QH1A 5FP3A 4R72A 3KC0A 3KBTA 5BMVE 3EABA 3NKZA 4NMYA 3PU3A 2UXCT 4L9IA 1H45A 3N9QA 2Z8FA 1NI9A 3PUZE 2FJBA 3U3IA 2WU2A 5JDGA 3O4XE 1B7HA 1MDP1 1YKHB 3O1JA 2RC7A 5AQHB 3FXUA 4EDPA 3R6NA 2V4CA 4HTEA 4ILAA 3PD8A 3UQ4A 3RT8A 3U94A 3H7MA 1J1JA 4DCXA 1LKXA 3FGSA 3MZ1A 4OXVA 5AQIB 4LFAT 3K0VA 4POWA 2L9QA 4H6DA 3ECRA 3UULA 5AFUL 5L9SA 4DV2T 1Y3NA 2KXPB 4RYAA 4IO6A 3IO6A 2DVCA 1MMGA 2PT2A 1BKAA 3C9HA 3QUJA 5HEOA 3ZMTB 3DP6A 3IJOB 4YKKA 3LBXA 3K6UA 5CBRA 3FBLA 2I0CA 2ESNA 3TCFA 4FJOA 4FI5A 4MBPA 4U22A 4OERA 3S9NC 3KBUA 3K1NA 2L3LA 4JBZA 3PURA 2ZMAA 4HE8A 5CJ5A 1YAEA 5LHHB 3AXFA 4AQ4A 3NZPA 4AKGA 4KD5A 3VXCA 2UXNB 4AISA 5CFBA 5KXJA 1SW2A 1QVSA 1AH5A 4PQJA 3VVEA 3I1AA 3E0ZA 2IMLA 1PB9A 4AB5A 2DCFA 4H46A 4IO3A 5I58B 4XEQA 5ESYA 1OMPA 3UU5A 1OEDB 3PUAA 5AA4B 1JNFA 1NEKA 3T66A 2Y7PA 1BR0A 3H06B 3CX6B 4XTCQ 5CMCA 2I59A 1WFDA 2JMKA 4YB7A 1PB7A 3IJXB 2V1DB 2CRBA 4FEDA 5DVFA 3FZFB 5ETWA 4NF6A 2XXHA 4UR9A 4U1ZA 1NUYA 2F78A 1IXHA 4PP0A 4GD5A 4FATA 4IDOA 4U23A 4Z90A 1GQEA 4QSEA 1TWYA 3QB5A 4HFHA 4LQ2A 4OYKA 5L9OA 5LB7B 4HN9A 3QMFA 4GWUA 1O63A 3Q5WA 1NMUA 1MQHA 4LATA 4DR7T 5HEJA 4G8NA 2CZKA 2YDRA 3BIGA 4O4IE 3WAFA 2ZM6T 5EK4A 1N84A 3KEIA 4I8CA 3ZKLA 5DVJA 2MBGA 3ETVA 1RDYA 3A5XA 3QAXA 4IB2A 4OHNA 3AE1A 4LF5T 1MMDA 1N3WA 4ZEYA 2BKOA 4H8IA 1FTMA 3EDUA 4EZHA 1PBQA 2HAVA 5EQ7A 5IZZA 2WWUA 3D1RA 4F31B 3Q2MA 1MQJA 2JIWA 3PV0E 1EZ3A 1SUMB 3RQUA 4AQYT 2ZM2A 1NV2A 2A5TA 2VT5A 2F35A 5IHYA 4H5FA 4YKIA 3V5SA 4JEHB 2Q9QC 2ZM0A 4HE1A 2H9BA 2CLYB 1MM7A 3MK7C 4EB6E 4P8BA 5F24A 1FMVA 4GLIA 2XSBA 5FNVE 3I9WA 3MVWA 4AIUA 4FBPA 3KOSA 4KCCA 3BQIA 4JI3T 2MPKA 4JUYA 1MQIA 4HXVA 1FTJA 2LLYA 5FL0A 3K1PA 4O94A 4AI6A 4P09A 4JWXA 4COFA 3C4MA 2WDQA 4JLEA 3RKGA 1Q9DA 1SW5A 2BVLA 5FHOA 5KMGP 2Y48B 4MLVA 1MQGA 1PC3A 3EDVA 5IGAA 4ISTA 4F1VA 4FECA 2XWOA 1WYCA 1QKBA 3KOTA 3L39A 4X1BA 3F11A 3U72A 4LVQA 4LZ7A 5FTIA 2XXKA 3CQXC 2HAUA 3SRZA 1CB6A 4HWHA 4MHCA 2XHDA 5CMMA 3WI3A 2OJTA 4B3RT 5TPAA 1UCUA 4TNVA 4YTPA 2HCAA 3MP8A 2WQYA 3PUVE 2V3UA 3RLFF 5EYGA 3HCQA 2Y7KA 5LYJE 4UVAB 2H5YA 5FVKA 2WSSV 4ZI2C 3EHTA 2WBBA 4PJNA 4YT0A 3UN6A 3DP7A 1B32A 1LAHE 1RYOA 3JC6D 2KR0A 4G4PA 3QOFA 1SPIA 4PFWA 4KFQA 5L3BB 5L3GB 1FBPA 3D0TA 1NH7A 4ELOA 3FZMB 3GXAA 3T22A 4Q8RA 2X51A 3UTKA 1TFAA 4TX5A 4Q30B 4BLAA 4GBWA 2Q8JA 5AA2D 3S9LC 4IGUA 4ZZAA 1T8BA 1KNZA 3E4RA 4DBRA 4IDQA 2LSGA 4EAHA 1JW4A 3K6VA 3ESLA 3RX6A 3UUMA 3LBXB 3K00A 4BDQA 4XKPA 1ZKBA 1P1UA 5JREA 1NKXA 1IQ7A 1VRBA 1OLAA 4GL0A 2JJKA 4N4UA 3ILTB 2V7KA 3VVFA 3PPNA 3JADA 3LFMA 4N81A 1E2AA 2BG9C 1POY1 1JW5A 1NUWA 3GN5B 1FSAA 4PK4A 1LVKA 1FPBA 1LBCA 4PBHA 4PF6A 4PFBA 4CN4A 1NV3A 4YY3T 3AVRA 4F2OA 3FB2A 4G2AA 2KT9A 3L3PA 3P50A 3ONLC 4LMJA 2DWIA 4MBQA 5HXEA 3IO4A 4JYAT 2ZYOA 2Z23A 4WYVA 3IA3A 4YU0A 2P9BA 3PU8A 3LSVA 5AQOB 4QH4A 1VDWA 5HEHA 4JV5T 1R8IA 4TZ4C 3BFUA 3UUXB 2JQKA 2OWTA 2I6EA 3HHFA 2IHR1 4IE4A 1LFIA 1W09A 2D3IA 2B3FA 4KBMB 2E1SA 4N6PA 3PGFA 3PUQA 1K9ZA 4F39A 4Z91A 3J9X1 1G0IA 4NF6B 5FXZA 2VKHA 2F6GA 3AB3B 3PMXA 1LBWA 4DO0A 4QRZA 2YKSA 2VWAA 4XF5A 4G8MA 3PJAJ 4ZEBA 1MIWA 5KDMC 2F3DA 1TT1A 4PFRA 2CEAA 4PJMA 4OWDA 1WRDA 1D9YA 1XWMA 1Y20A 5ET6A 1IZNB 2PYYA 3F2EA 2I4CA 1MMNA 3TKLB 1B40A 1LBBA 2MOZA 3RGLA 4LZ8A 1IIWA 5I3SA 4A97A 1JEVA 2VPOA 5AA3A 2HN1A 3RC8A 3G3FA 3RT6B 2VKJA 1S7YA 2CHNA 3MSTA 2DI4A 2XQYA 4AB6A 2R6GF 1IBMT 3RYDA 1LEVA 2QMXA 4X1DA 1KEYA 3MA9A 4DIGA 1YYZA 2M67A 2GHAA 4ZE8A 1SHZC 2NOXA 1DTGA 2I49A 3X1DA 4KYEA 3RY3A 2YU2A 4ADZA 5JEIA 4KXPA 1JVXA 4DXUA 1SI0A 1MXYA 2OBGA 1WR6A 3AXJB 4JBWF 4X04A 3TLVA 1OVBA 2PMSA 4NHBA 1YQ3A 4I55E 3NRXA 1B5HA 3O97A 1LBVA 4LONB 4F3GA 3H3MA 4Z8XA 3LG7A 4IO2A 1N32T 2ZZVA 1OEDC 3E9XA 2NUVA 3VR8A 3EAMA 4YTMA 1RDXA 2DSFA 3FV2A 1JNRA 3KINB 4U2ZA 2JMHA 3J7Yq 1JETA 2ONRA 4EYYR 2HZKA 1XVYA 3QIMA 1DSNA 5ICTA 4GK0E 1U5PA 3T9HB 2HXWA 4OEVA 1B3HA 2XXYA 4RY1A 4ZI3C 4TLLB 3LK3B 1UURA 2V6XA 1BLFA 2NOOA 1G8XA 3B7DA 3IORA 4BDRA 4PGPA 4QFLA 2H4IA 2XQ9A 5TP9A 1FQDA 4FORA 5F8PA 5JR9A 3H6WA 4ELRA 4OVJA 3MPLA 5L4EA 1XI6A 1JEUA 4QSCA 3TTLA 3Q5EA 3F31A 4C90A 3O1HA 2ACZA 4QXCB 1NNTA 4PK6A 3RYHE 4L0RA 4EF2A 2F4VT 2ZYNA 1MIYA 2XQ8A 4R74A 3KN8A 5HEUA 1W9RA 2F3BA 3TELA 1PDAA 3CQGB 2ZNUA 4GWXA 4XKRA 2CA5A 4LF4T 2D5UA 2P0SA 5EQAA 2SPCA 1MM6A 3NVOA 1I6ZA 2CLYC 5LA6E 2UYEA 4ISUA 4IY6A 4QFKA 3TKDA 5CRYA 2HPJA 1KNRA 4IO4A 3C4WA 1ZHCA 1US5A 5KDTA 3PUXF 4AQFA 1N76A 2X66A 2PX1A 2XQ3A 2WX9A 4QX8B 2CEYA 2C5KT 4ERRA 5DEXA 1LAGE 2Y6XA 2CHOA 1P1OA 3G3HA 3I0OA 2R71A 1Y1MA 2M6IA 3FD3A 1T98A 4H9OC 3SESA 2WU5A 3ZYMA 4NPPA 2VGQA 5LG3A 4G2ZA 4HKAA 5JDLA 1DU2A 1MY4A 4MCOA 1QSDA 2QVRA 3PE0A 5FHMA 3U92A 2RCBA 2EHOC 4DR2T 4K3FA 3KZGA 2NR4A 4KUMB 1HCIA 1Z7ME 1S9TA 4O8SA 3H03A 3N9OA 1B3GA 2A5SA 1B4HA 5EYFA 4FAJA 5LJMA 5HYAA 3IR1A 1VFDA 4CI1B 2OV9A 3OXNA 1FTKA 2WZHA 3ZMZB 3OVUA 1ZTYA 4DBQA 3T96B 1ATGA 1LB9A 1MPBA 4QFPA 1KF6A 4PFUA 2QRXA 2V3QA 3P4QA 3P4RA 2XXPA 2V6YA 3VR9A 4IO5A 1BTJA 2BBJA 1ZMGA 4YHJA 4NQ8A 1OVTA 1IMEA 2BJIA 4YFSA 2E9XB 3RI5A 4N6DA 2ZMBA 3VLUA 3G7WA 4FE8A 4EQ9A 4MNCA 3CQCB 1OWAA 2REGA 5BWJA 1T72A 4OQOA 3SEWA 3W9VA 2Q9QD 4JEUB 2GQ1A 4RK2A 3HA4A 4CI2B 4EXTA 3LUYA 5H6RB 5J16A 4UEMA 2DWAA 1URDA 4NTLA 3CHGA 1FJ6A 1M7KA 1D9VA 5BUUA 2YJPA 2ZNSA 4YMAA 4IDZA 3P4WA 2MAWA 4PK5A 4ZS3A 1LBYA 4EXKA 4MJOA 1B7ZA 2F36A 2W67A 4U31A 1XNQT 2FNCA 4IGTA 4GKKT 3KSJA 3A3CA 1WCRA 4QFOA 2Y7IA 2AIXA 4N8GA 2I58A 2CWOA 4TWDA 2ZNTA 3HSTA 1HX8A 2ALUA 3EI0A 3RIUC 5JDHA 1I69A 4PETA 5EQ9A 3CVGA 4NUVA 2X0LB 2XWKA 3W15B 1JW1A 2IIUA 2Q9TA 4G68A 5JDNA 5I57B 3L8RA 1YXIA 4ZI2D 4EQ7A 3GWHA 2O7UA 1AMFA 3AEDA 1HS7A 1SDXA 5JTYA 4GYRA 3TMGA 4Q0CA 3RGYA 4YLHA 4X66T 2XQAA 1R6ZA 1HSJA 2X68A 5JR9B 4XZCA 2LRKA 3K02A 4UABA 3EQ1A 4DV7T 5EHSA 1B52A 4YSXA 1Y3QA 3OBVE 3TAJA 3VDFA 3OTOT 4HWIB 4N17A 1IEJA 4A5XA 1FPGA 4IE0A 4GL8A 1Y01A 1MS7A 4ILCA 3T1BA 2XAQB 2GHBA 5IUXA 3ZPOA 3IB0A 1P1NA 2Y7RA 1NV5A 3RQTA 3ZYKA 3SS1A 1MXVA 3JYRA 4R9FA 3SWHA 1WYBA 3TLWA 2QVUA 5JH7E 2W0GA 3D4GA 3MP1A 2BG9E 4QF9A 4ZHQE 3IX1A 3SEUA 2HN2A 2XXXA 2XHEB 5LCYA 1DPEA 3ZYLA 2H3RA 5TAOA 3VRBA 2CMOA 3IHRA 5C8YE 5AQQB 1FQAA 1X79A 4U4SA 1D0YA 5LBQB 4HE2A 3ANWB 3GYYA 3B50A 4DXBA 3M3ZB 5L4HA 5KDTB 4CN6A 1MXWA 4BJNA 4AKHA 2NTYA 5H8FB 4ZXLA 5AA2A 1LVFA 4DV4T 1VSOA 3T8OA 1GV8A 4BDLA 4YHHT 4F22A 4DIDB 1SYHA 3NRYA 3CFZA 4YZZA 5F7VA 4JWOA 3L09A 3T1YT 1M5EA 1WLXA 2DS9A 3Q25A 1P1QA 4DUYT 4MF3A 3RYFE 5LMNT 1BR1A 2XAJB 2OCUA 2RCAA 4BAYB 4DV6T 5KCJA 2D9DA 1P1WA 3OPCA 4K0KT 4LF6T 3CG3A 4HCYA 4RPOA 1LFGA 3P4SA 4C0RA 3MVZA 5LHIB 3AAEB 2PFYA 1FPFA 3PUGA 1IITA 3BIHA 5I2NB 4PDHA 1JQFA 1FCKA 5HWXA 4DV0T 2I3VA 2O68A 2PCRA 3RNNA 1ZV4X 4UELA 4EQBA 5I7IA 5FL1A 1CUNA 5KZTA 4WBOA 3FV1A 2WDVA 2E5VA 2D0UA 5H8QA 2PBWA 2Z22A 5ABHA 1UIVA 2F7AA 5LXTE 1DK4A 1XDPA 1FPJA 4GX3A 5CA1E 5M2VA 1IXIA 1ELJA 4H8JA 3FBZA 3QC9A 2CMRA 5AQLB 1B5JA 4P0AA 3AA6B 1FW0A 3AEAA 3IBPA 2XWVA 2OLTA 3O6HA 3QSLA 4AS4A 2HFBA 4C1UA 2W63A 3PU5A 1USYH 2P3NA 5JDFA 4H0WA 1B5IA 2XXQA 3FXEB 3O2AA 3ZEFB 2WBDA 5AQNB 1MXZA 2AL5A 2PTFA 3DLNA 2XAHB 5LGTB 4KHZF 4PBQA 5DT6A 2ODVA 4PGNA 4PNIA 1AJ3A 3TTRA 2LKHA 5ADXL 4R9GA 4IL4A 1JVYA 5CA0E 5JDMA 2WYKA 2XX7A 3FUZA 4FIMA 4NIQA 1CNQA 3CK6A 2X7QA 3Q9DA 2G0UA 1OEDE 4A56A 3OKQA 1D0ZA 4UVBB 3P7IA 3BQLA 1H76A 2Q89A 4ZS9A 3N9PA 4YSZA 2KLQA 1YPNA 1SBPA 4K0UA 5FY1A 5H8HA 4PAFA 4GWYA 3PUYF 1B58A 3EHZA 4OETA 2KZ7B 4KX6A 5LGNB 4QX7B 1D1BA 1A40A 4N91A 1FQEA 4ZI3D 5JRCA 2VOZA 3PPRA 2O1MA 2LAOA 5HCJA 4EEBA 3HKCE 3E13X 1INPA 2BBHA 2VL0A 3OEKA 4C1TA 3N2GE 3RKOA 1HG2A 2DXYA 3E78A 5CC2A 1A99A 5BR8T 5LJNA 5IM2A 5EQ8A 3OSQA 3CMLA 3RYIE 3PPPA 5FXWA 5JTYB 3ZT7A 5ICQA 3FJ7A 1UK5A 2REJA 4BDNA 4XKNA 3IB1A 2YU1A 4H9NC 3FZHB 3PUWF 2O69A 3A29A 1ZBMA 3RN8A 1MXXA 1MXUA 2FYIA 1KK7A 3TUSA 4IE7A 3N2KE 3DJBA 2E9XC 1TXFA 4NAPA 5A5LA 4CXYA 5I56A 3WAEA 2L8KA 1SYIA 5ABFB 2D21A 4OFOA 4O4HE 3PUXE 5FVLA 2B65A 4NN3A 1B1HA 3M65A 1H3DA 1SQYA 2X9WA 5EHMA 1HX1B 2Z8EA 4LZ5A 5I59A 3LR1A 4P47A 3HHGA 3DTOA 3UIFA 3HI2A 3VRAA 4ZI7E 1Y4CA 1KFYA 3N5LA 1N04A 4YB6A 3RYCE 3RTWB 5L3FB 2P3VA 5J1GA 3HV1A 1ZKEA 3KV6A 3GZGA 4I9DA 4M1VA 1D9QA 5AE4A 2YLNA 3CKDA 2HQ0A 1FTLA 3MBPA 1NNFA 3S9MC 5LOVE 2I0MA 1FBHA 3FVKA 4JI6T 4MIJA 4X1IE 3RRWA 2LHNA 2RP4A 3TLSA 3ZMUB 5IWAT 4O4LE 2DDKA 4GWWA 2OZZA 3BK9A 3TCHA 3VKGA 4GWSA 1S94A 2LHRA 5IKBA 3ZSFA 4YJ2E 4LN5A 4ILUA 3N26A 2EHOD 3AE8A 2RKMA 4TWHA 4I43B 2BDEA 1XMOT 2CZIA 3W9WA 4OVSA 3OENA 2IEEA 3R26A 2FIEA 1W0AA 5KCJB 3O1IA 3JV9A 1EZPA 2XZEA 2V3TA 1FBEA 4QKNA 2V25A 3W15C 1OIBA 4GOUA 4GKJT 3AE7A 2XM2A 2QA7A 2FJEA 2CBIA 3FATA 1MRPA 4NUUA 2XXVA 3VLWA 3V8XB 1LBZA 4R6YA 2I48A 3I0QA 2N9DA 4E7ZA 2X9XA 2A72A 1FJGT 1I6QA 2ZXTA 4DCYA 4ZEDA 1L5TA 2E8IA 4X1KE 2KINB 2DVZA 3GBBA 1QUUA 1CHUA 1OLCA 3HO7A 4OENA 5CM6A 5DJQC 1Y9UA 5AQTB 4R2FA 3IK6B 4X64T 2KQZA 5ABEA 2NXOA 2IAKA 4U1OA 4U21A 2VHAA 2WAUA 1ZOYA 3O9PA 5A1LA 4GX6A 2PG8A 2YK0A 5H8SA 5CMKA 3ZSTA 1Y3PA 1JNZA 3TDJA 2IDOB 4LF8T 2WY2A 3K3QC 1GR2A 2QVVA 1MNDA 5HPQA 3H3GA 1MY0A 4PAKA 2W66A 1OXZA 4X20E 2DQVA 4JVCA 3NZQA 1XHYA 5L9MA 1N34T 4U72A 1MY1A 4F18A 2X0HA 2O51A 5DQVA 5B7DA 5AQFB 2AXDS 3C98B 3EN3A 1R9QA 3MJXA 3AE6A 3DP4A 4X9TA 1BR4A 2Q9QA 3V5UA 2OA5A 1B05A 5AQGB 4TWFA 4X5TA 5H8HB 3O6GA 3AVSA 1KWHA 1O7TA 3M3KA 2O84X 4X65T 3OYZA 1M62A 2MTQA 5LOMA 4U3CA 5FTHA 2QYWA 4UV8B 1HG5A 4H5GA 2DP8A 2RC9A 5JRCB 2DL1A 4X48A 3G3KA 2FJDA 5HCMA 4OHFA 4PCDA 5FBPA 4RPNA 3KFWX 3UFGA 1SD3A 3AEFA 4H63V 1LCTA 3K1MA 1LGBC 2K24A 2A5TB 5GONE 2LSJA 4B3MT 3G06A 3C32A 1N7WA 4QFNA 5LTCA 2UUAT 1YKEB 4I50E 3FXDB 4NE4A 2XD2A 5I2KA 1B3EA 3KGCA 2K9AA 1MQDA 1DTZA 1UUSA 5F5WA 1IJ5A 1URSA 4DI4B 1FPDA 4HEAA 3DP8A 2NW7A 4HFCA 4ANJA 2LJLA 1QULA 3C4XA 4L17A 1SW1A 3LSXA 3TQWA 3A09A 4EZ4A 4O2AE 4OA4A 5L3DB 3LUZA 1IMAA 5I56B 4WXJA 4MMPA 4UF0A 1N7XA 4WNKA 1MY3A 5ET5A 3AE3A 1RYXA 3LK42 4XKQA 5A5XA 4F3PA 5IZ1A 5I59B 4HFVA 3B6TA 1V9DA 3SETA 2P1SA 1ANFA 2O7IA 3TTMA 4JB7A 2R9JA 3QXMA 4JI2T 2FA7A 3LSLA 1R1NA 5TPAB 1UX5A 1QGXA 3FHNA 1O3XA 4J2CA 5ITPA 3U8QA 3MP6A 1FPKA 4MH5A 1RKMA 3IFCA 4G63A 3MAMA 2CBJA 3SEYA 1XZYA 4KCDA 2FVZA 4P0IA 4DDDA 4HWDA 3U1OA 3CX8B 2H98A 3VU7H 4KPTA 2JJ9A 3C4ZA 3TODA 4ISSA 3I5OA 1H43A 4CN1A 2BG9A 4I40A 1B9JA 1IMCA 3UT5E 3A3UA 1NNKA 4NF5A 4AXPA 1FBCA 2VD3A 5ISUA 2YEVC 1LB8A 4GIZA 2PFVA 4IE6A 3UP9A 5TU0A 1YTVA 2WMOA 4B3TT 1QUKA 2ES0A 3QUFA 3PDYA 4P56A 4TQUQ 2L5VA 1ZP0A 2LKGA 4PC9A 2OWZA 3T1HT 4OZ9A 1FEWA 2QS1A 1M5FA 3VKHA 4TV9E 4GBVA 4MEVA 2WWVA 1MG1A 4P0GA 2O1LA 2WKYA 4IR8A 4KHZE 4DV5T 1HSEA 3MQ9A 1B0HA 1FQCA 3UQ7A 3TEPA 4OVRA 1B7UA 2DYXA 3IOWA 3UA8A 3MXZA 3ZLIA 1HSLA 1N36T 4PFYA 1HR0T 3JZJA 1M5CA 1NFTA 2I4BA 3CWZB 4QBAA 1A8FA 4GIWA 4HFDA 4HFIA 3Q5XA 5FY0A 4PF8A 3ZT6A 4Z7EA 3ZKKA 3MVYA 4H1XA 2LSIA 2LOSA 1H44A 3B6WA 1LSTA 2UXBT 3HN0A 4IDPA 5AQJB 3K6WA 4WBNE 2WS3A 2N1GA 1URGA 4EEDA 1B2HA 2V5CA 3H4ZA 2QVAA 4R6HA 2BKNA 1OQHA 2NWJA 1Y1ZA 4QHOA 4PFTA 2W00A 3FVGA 2LRLA 2M6BA 5HM4B 4F3BA 2UVIA 3AEGA 4ONYA 2YOEA 1VFEA 3RH3A 1VOMA 3ROJA 3OYXA 1DPPA 2ABHA 3SDFA 1USYE 2OX3A 3MYUA 3TLUA 4PAGA 4U2YA 4JVDA 2MKZA 1A55A 3ZN1B 3AA7B 2VL8A 4GRKA 1NAFA 4JI4T 1EYJA 3I6VA 4GK5E 4F6RC 1XDOA 2RC8A 2M8CA 1XC1A 1D0XA 4G77A 3FXBA 1E7PA 1DBZA 2VVSA 2F6PA 3FZKB 4MHFA 4NF0A 3I9YA 3PTRB 3AA0B 5I58A 1WR0A 4LFBT 4WEDA 1OEDA 2CPTA 4KMCA 2XXUA 3JAEA 5DABA 3SFDA 3T0JA 2DE4A 4GYSA 2IUBA 2W62A 1FQFA 2F5XA 2GFEA 3O29A 4RNSA 3KDSE 1GVCA 4ZZBA 2IW5B 3OMBA 3ABVA 2E9XD 2E2AA 4LF9T 2BVMA 1SVXB 2THIA 5I2KB 2DE3A 3H6VA 2NP9A 4UIGA 1POTA 4HTGA 2UU9T 2DWJA 2J1DG 3E08A 1B6HA 3U78A 3U93A 1EYKA 1IMFA 3RLFE 1WVJA 1Z7NE 1KNPA 3KBRA 3VV5A 2XQ4A 1MMAA 5H6QB 3FJMA 1FBGA 2QRYA 2NW8A 2KSRA 3MKDA 3RRCA 1DCUA 4UF0B 1SA0E 1IMDA 2V26A 2C5JA 4LMKA 2YDSA 5EYHA 3E79A 3EUHA 4KQPA 3UUBA 5LNKA 1J5WA 4L5GA 4O7IA 2PBIA 4WW0A 1N33T 2V8SV 5LHGB 4ND9A 3TFLA 2XSAA 1MH3A 3BQKA 4F1YA 4AKIA 5TP9B 2ANJA 2XXRA 1NL5A 4QSDA 2GH9A 4EYUA 2WYPA 2XM1A 2B4LA 4AKRB 3N9LA 1B3FA 3IOUA 1MPDA 2F7CA 2HPLA 2VASA 1FQBA 3HKEE 2V93A 2DOJA 3SOLA 2B3BA 2QS4A 3MW0A 4XXUA 3UU8A 2YDQA 3RC3A 2HH7A 3MJNA 4O4JE 4JI0T 2DWHA 4MAGA 2YPNA 1FTOA 4OEUA 5IZ3A 2E5LT 1IUDA 3FJGA 3G3GA 3K2DA 1GTKA 4ASKA 4NF5B 2X9HA 3IOTA 3ZSSA 4DLDA 1E1HB 2XX9A 2VP1A 4BDMA 4GXSB 2I3WA 2VK9A 4M4GA 3IL1B 4U74A 4GWZA 1HFAA 2RINA 3S2VA 4NWCA 2XQ5A 1FTAA 4Q25A 5J2TE 3TTKA 2QGSA 2EHOA 3HR0A 2D2SA 1O64A 3MPKA 2VKDA 3PUSA 1XT8A 2DE2A 4FJPA 5L47A 5FHNA 5IYZE 2FBPA 4U33A 1T7SA 3MACA 5DEXB 3KN7A 4RJZA 3WAKA 2BS4A 3Q27A 4JDFA 1I6AA 4H63H 2WP9A 5H8NA 3USDA 4DUZT 1IXCA 3GBAA 3T9VA 4P0BA 3NBXX 3B13A 3E22E 4DNDA 4I4TE 2BKPA 5HXCA 4UV9B 4P11A 1JP4A 3THIA 2MYSA 2J62A 4ELPA 3KJTA 2HHMA 4A98A 5HBCA 1BK4A 3HFUA 5L8DA 3QK6A 2FBWA 2V5DA 3WAJA 2IC9A 1VE4A 3K01A 3VVDA 2LSKA 3PMVA 1XNRT 3M3FA 1Y64B 4OMBA 1SI1A 1A7LA 3U65A 4DMWA 1FMWA 2QSXA 2JRKA 4WKMA 3PJAA 3ONMA 4DXCA 3C34A 3K3NA 1LAXA 4HS7A 3UORA 4E0WA 3RIAA 3EF7A 3KV4A 1J5ET 5CMBA 2WEFA 3CFLA 4JI8T 2VPNA 4FEBA 1FIOA 3ZJ1A 2R6GE 4DR6T 1B51A 1QKAA 4C91A 3VXBA 2CE7A 2VKOA 2VQFT 1B46A 3I3VA 2V6YB 2XD3A 3MWBA 4NWDA 2WZIA 4DR1T 3LV0A 1YXRA 2LM2A 3C35A 2DLRA 1F9BA 1SW4A 1W0BA 3GN5A 4ESXA 1NV0A 3OEMA 5L3CB 4KR5A 4OFLA 3Q29A 1MIVA 5HXHA 2Y5LA 2BZBA 3AAAB 1FJ9A 3ISPA 3A7MA 3E3KA 4OFZA 1KA1A 4HWCA 4OVQA 3LJCA 1US4A 4DZ1A 5AQVB 3FZVA 1CE2A 2Q88A 1YD8G 2ZYMA 3TPAA 4B3ST 4JVIA 2VURA 2IC6A 5LP6E 5AQMB 2CEXA 5L3EB 2KLFA 3ZMSB 5ITOA 2H25A 1XMQT 1AWBA 3RIUA 4YKPA 4GOTA 2QMWA 1IBKT 4G8HA 3C36A 5CGMA 1N3XA 3LDQB 4LF7T 2WDRA 3CG1A 4UACA 4IT4A 3AA1B 1LLSA 3TZAA 1WODA 4HE0A 4PW8A 4MFIA 3RIFA 3T9XB 1MPCA 5HXRA 4KHPT 4OVTA 3MVXA 4LUBA 2IA4A 3IAZA 3KSXA 4OFJA 2Q74A 3LK2B 4XBFB 4O3CA 3ZC0A 3LC8A 3TYHA 2W2UA 4NF8A 1NV1A 3RUMA 4F1UA 2WMNA 3LSFB 4EIWA 4XAXB 3CSBA 4G68B 4YXDA 3FASA 5EZYE 3K8PC 2X0YA 2DXRA 4ZEFA 2F7BA 2A9UA 4HFBA 4PE5B 3B8BA 3BBRA 1VR5A 5JQGE 4GFRA 4F3SA 2DHRA 4OTEA 3EHUA 3H6UA 4LA9A 2XX8A 3C33A 1MY2A 2PT1A 3TTNA 3V83A 5J2UE 2RPAA 4DR5T 2Y84A 4KYDA 4N6KA 2CM0A 1D1CA 3AE9A 2HPGA 2LM9A 4AS5A 3IOVA 4JSDA 4CZZB 4ELQA 2NWBA 3AXJA 4ZZCA 3K3OA 2WM9A 1D1AA 2XQ7A 4CI3B 4U4XA 4UA8A 4E0XA 3O9XA 3SEXA 1GGGA 2CWYA 1Q1KA 4PE3A 2XAGB 2H89A 5FXVA 1UQWA 3Q28A 4DR4T 2KMFA 5IZ3B 2YN6A 3P8CD 3IFAA 2NW9A 1WDNA 4NEDA 4U7IA 3NWIA 3HKBE 2XJ7A 4DR3T 3T93B 5AQKB 3SZPA 1D3KA 2Q2CA 3JAFA 1EU8A 2N2NA 4Q5TA 4G61A 3CSGA 2UVJA 4PDDA 1U4QA 1SE7A 5AQUB 1LCFA 2XA5A 1US7B 2ZZXA 2EHOB 2OK2A 2D0TA 3IEEA 1RDZA 1ZLQA 2XWIA 2PFZA 3CRBA 4QXDA 3O66A 1B1XA 3H3AA 2JQ9A 4OANA 3ZCJA 5AA2B 3B5MA 2QJEA 3K1SA 5JVDE 2V7JA 1QUJA 1ZEEA 3ODBA 5H8NB 4R73A 2XXIA 3CIJA 5LMUT 2Z6EA 1D4NA 3HPIA 4LP2B 1NV4A 4CXWA 3CVRA 3OD7A 4EUOA 3A8YC 1FPEA 5L2LA 3AE4A 2VD2A 2F8DA 3KC1A 3UU3A 4F8HA 5LGUB 2CZLA 1N0TA 2H99A 1QLBA 2C5IT 5JTGA 4JI7T 3C31A 2YINA 5HAXA 2XAFB 3K6XA 3ZC1A 2VQET 3RHWA 2K48A 2XXWA 4ZEKA 1OQGA 5JR9C 4H45A 5H8QB 2H88A 2H7OA 3GMIA 1UGOA 1B4ZA 1NNPA 4KI0F 2Z8DA 4R6KA 4THIA 2QFLA 4IE5A 1AIVA 2K5BB 1QUIA 1FPIA 2Q8MA 2ZM8A 2I6HA 1HNWT 3IB2A 2E0SA 1HF8A 1IBLT 4H9RC 1LFHA 1DMBA 1FPLA 1PBPA 4NG7A 2XUEA 2CCQA 3K4UA 4ZOLE 1P99A 3UU6A 1QW0A 2KNDA 1H7CA 1NENA 5LG4A 4DMVA 4OYVA 2JQQA 5AQRB 3TLTA 4HGAA 2XY8B 5FY7A 1QJMA 3AE2A 1B0LA 1UTBA 2G93A 5ET7A 3VHLA 1EYIA 2HEUA 2HXRA 4ZE9A 2QS3A 3PPQA 3SERA 5DTBA 3PUZF 4PJLA 3FXRA 3OO7A 4P1LA 3JCFA 4AQFC 3ZKRA 1R9LA 2Y8DA 2UUCT 4YB5A 2V7IA 2I0BA 4N8YA 1DOTA 2X67A 4HFEA 3ZCIA 3GA8A 3CI8A 1ZJLA 4HWFA 2J47A 4X1YE 3N6UA 4ZECA 2WCAA 3MUQA 1FBDA 3NOHA 4I3EA 3OELA 3V89B 4XIGQ 5K2XA 2RF1A 4YMBA 2X7PA 4YTNA 2UXDT 5JK4A 2PVUA 2UXXB 2A2FX 1J1NA 1Z8UA 4ZS2A 2DWKA 3N9MA 2XXTA 4H67A 2Y5KA 1KA0A 2W61A 2E9XA 3CIRA 4NF8B 3N2OA 1YQ4A 3B57A 3VLVA 2FUPA 3RPUA 4IO7A 4MALA 2FHYA 3RTFB 4LFCT 2QS2A 3QB5K 3BFTA 4H9SE 1FRPA 2PJQA 1XVXA 5C2TA 2QL3A 2O6AA 4F29A 3FIRA 4MFRA 1BR2A 1NV6A 1UTHA 2UXAA 4CXXA 3CFXA 2WB5A 5AQPB 5E0OA 1VCSA 3DELB 1PEBA 2KWHA 3RPLA 4NXNT 5DW8A 5EK2A 5CI5A 4N15A 1YCJA 3MZKB 2AYSA 1XOCA 1YZ0A 1LRZA 2RA1A 3KVAA 1T0KA 2Y7WA 3KV5A 3SKPA 4EF1A 3MZBA 5J1DA 2VVNA
chains in the Genus database with same CATH topology
2X9YA 1UX4A 3KN3A 4AQGA 2CXDA 4MLQA 2G29A 4JXIA 3Q26A 1Q35A 1Y4TA 4QXBB 2NVUB 1II5A 3N6TA 4N13A 2ONSA 3R6UA 4H9PC 2F34A 3OSRA 3OO6A 5B70A 4V1Av 4NF4A 4WEPA 4QWNB 4TOZA 3UGWA 5I57A 1B7TA 3VFJA 4PJJA 3ETUA 1MDQA 4RA1A 2OLBA 3FXQA 4HW8A 2KWIB 3G3JA 4YJ3E 3UFEA 2CXLA 3L6GA 1EZ9A 3L6HA 5FXXA 3ILUB 3C51A 4BA9A 3QYTA 4G68C 4RK9A 4I1DA 1HTJF 3O28A 3S4UA 3PPOA 3T9UA 4U2RA 3TCGA 1ZIUA 1EH3A 5LBMA 3H37A 4OYJA 2XASB 1Z0PA 4YAHX 3BKIB 2QPQA 1EZOA 1I6BA 3MZ9A 3EPEA 3S9EA 2LOPA 3ZN0B 3OOAA 2LSYA 1M5DA 4EOZB 4N78D 3ANWA 1AL3A 4R75A 4TN7B 4H9QC 1NWMX 3HKDE 3SEVA 2V84A 1S35A 2BJJX 4ZEIA 5FYMA 4ECFA 5AA1A 5H8FA 2CXFA 3LSWA 2Q2AA 5ELVA 4MLKA 4GWOA 3PUYE 4LQ5A 2GRVA 1S50A 3JC6C 1A8EA 1YW0A 5FMNA 3KFMA 4KP3C 2AL4A 2W7YA 4R2BA 1UTBB 3F57A 4UXNB 5HWYA 2F97A 2ODUA 4I62A 2UYFA 3N94A 1PB8A 3DM0A 1TFDA 4B6XA 5I2NA 5HXSA 3CR9A 5K2YA 2H7VC 1NH8A 2ACXA 1BIYA 4TLMB 3KV9A 2Q9QB 3ZS6A 3R84B 2OWSA 3PUWE 3M8UA 4TUYE 5DVIA 3AAIA 4ESWA 3KVBA 2LE8A 1XS5A 2HZLA 4QHQA 3C64A 2GK9A 3B6QA 3MC2A 5AA4A 2DNXA 4F19A 3VE1B 2JPFA 2X26A 2LT3A 4POXA 3O6IA 5M4YA 3EHSA 5I84A 3TQLA 4EXLA 5JDQA 1UTHB 1LAFE 2UVHA 4HCWA 3M3LA 2V7LA 1IJ6A 1IAPA 4IGRA 1IXGA 4Z0IA 2ONKE 5CBSA 3UUNA 5DQWA 4N07A 3FVNA 4IHJE 3H6TA 4O3BA 2ZLYA 2B1EA 4KYSA 2WBLA 1B3LA 3FVOA 4OESA 4OK0A 3C50A 4E7SA 5A5XB 3N9NA 2C0SA 4AKLA 3G3IA 4BJMA 4F2QA 3OJAA 3D4CA 5F1QA 3GLBA 1G73A 4GVOA 4ZDMA 4JWYA 4CQIA 4IIJE 1A54A 3ONXA 3OO9A 4IY5A 3RPWA 2LEHA 2ZYKA 4NF4B 3KJ7A 5IAIA 4O3AA 4PFPA 1MH4A 3PD9A 2DWGA 5KX5E 3ZJ2A 1UIUA 5DYHA 1M5BA 4QXHB 3KG2A 2NTXA 4DVDA 4M1PA 4RXLA 2A3DA 4H65A 4DE8A 4KI0E 3V5AA 2XTLA 3CPZA 5CB4E 3ZMVB 4TV8E 2VB6A 4GF8A 1MNEA 3UK4A 4GXAA 3R7XA 5F3JA 3PMWA 2UVGA 5EK3A 1IZ1A 3IF8B 4JSOA 2D5WA 3HL6A 1ZU0A 3OO8A 1BP5A 2V7MA 4YKJA 4BDOA 2P2AA 4O2BE 4PFOA 4ZZEA 3LBSA 3CX7B 1AOVA 4GQOA 3EVYA 4YICA 4UVCB 5FP3A 4R72A 3KBTA 5BMVE 4NMYA 3PU3A 4L9IA 1H45A 3N9QA 2Z8FA 3PUZE 3U3IA 3O4XE 5JDGA 1B7HA 1MDP1 1YKHB 3O1JA 2RC7A 3FXUA 4EDPA 3R6NA 4HTEA 3PD8A 3RT8A 3U94A 3H7MA 4DCXA 1LKXA 3FGSA 3MZ1A 4OXVA 3K0VA 4POWA 2L9QA 4H6DA 3ECRA 3UULA 5AFUL 5L9SA 1Y3NA 2KXPB 4RYAA 4IO6A 3IO6A 2DVCA 1MMGA 2PT2A 1BKAA 3C9HA 3QUJA 3ZMTB 3IJOB 3DP6A 4YKKA 3LBXA 3K6UA 5CBRA 3FBLA 2I0CA 2ESNA 3TCFA 4FJOA 4FI5A 4MBPA 4U22A 4OERA 3S9NC 3KBUA 3K1NA 2L3LA 4JBZA 3PURA 2ZMAA 4HE8A 1YAEA 5LHHB 3AXFA 4AQ4A 3NZPA 4AKGA 4KD5A 3VXCA 2UXNB 1SW2A 1QVSA 1AH5A 4PQJA 3VVEA 3I1AA 3E0ZA 1PB9A 4AB5A 2DCFA 4IO3A 5I58B 1OMPA 3PUAA 5AA4B 1JNFA 3T66A 2Y7PA 1BR0A 3H06B 3CX6B 4XTCQ 5CMCA 2I59A 2JMKA 4YB7A 1PB7A 3IJXB 2V1DB 4FEDA 5DVFA 5ETWA 4NF6A 2XXHA 4U1ZA 2F78A 1IXHA 4PP0A 4GD5A 4FATA 4U23A 4QSEA 1TWYA 4LQ2A 4OYKA 5L9OA 4HN9A 1O63A 3Q5WA 1NMUA 1MQHA 4LATA 4G8NA 4O4IE 3WAFA 5EK4A 1N84A 3KEIA 4I8CA 3ZKLA 5DVJA 2MBGA 3ETVA 3A5XA 3QAXA 4IB2A 4OHNA 1MMDA 1N3WA 4H8IA 1FTMA 3EDUA 4EZHA 1PBQA 2HAVA 2WWUA 4F31B 3Q2MA 1MQJA 3PV0E 1EZ3A 4H5FA 4YKIA 2ZM2A 2A5TA 2F35A 5IHYA 3V5SA 4JEHB 2Q9QC 2ZM0A 2H9BA 2CLYB 1MM7A 3MK7C 4EB6E 1FMVA 4GLIA 5FNVE 3I9WA 3MVWA 3KOSA 4KCCA 3BQIA 4JUYA 1MQIA 1FTJA 3K1PA 4AI6A 4P09A 4JWXA 3C4MA 4JLEA 1SW5A 2BVLA 5FHOA 5KMGP 2Y48B 4MLVA 1MQGA 1PC3A 3EDVA 4ISTA 4F1VA 4FECA 1WYCA 1QKBA 3KOTA 4X1BA 3F11A 3U72A 4LVQA 4LZ7A 5FTIA 3CQXC 2HAUA 3SRZA 1CB6A 4MHCA 2XHDA 5CMMA 3WI3A 2OJTA 5TPAA 1UCUA 2HCAA 3MP8A 3PUVE 2V3UA 3HCQA 2Y7KA 5LYJE 4UVAB 2H5YA 2WSSV 4ZI2C 3EHTA 4PJNA 3UN6A 3DP7A 1B32A 1LAHE 1RYOA 3JC6D 4G4PA 4PFWA 4KFQA 5L3BB 5L3GB 3D0TA 1NH7A 4ELOA 3T22A 3GXAA 4Q8RA 2X51A 3UTKA 1TFAA 4TX5A 4Q30B 4BLAA 2Q8JA 5AA2D 3S9LC 4IGUA 4ZZAA 1KNZA 3E4RA 4DBRA 1JW4A 2LSGA 4EAHA 3K6VA 3ESLA 3RX6A 3UUMA 3LBXB 3K00A 4BDQA 4XKPA 1ZKBA 1P1UA 5JREA 1NKXA 1IQ7A 1VRBA 1OLAA 4GL0A 3ILTB 2V7KA 3VVFA 3PPNA 3LFMA 1POY1 1JW5A 3GN5B 4PK4A 1LVKA 1LBCA 3AVRA 4F2OA 3FB2A 4G2AA 2KT9A 3L3PA 2DWIA 4MBQA 5HXEA 3IO4A 2ZYOA 2Z23A 4YU0A 2P9BA 3PU8A 4TZ4C 3BFUA 3UUXB 2OWTA 2I6EA 3HHFA 4IE4A 1LFIA 2D3IA 2B3FA 4KBMB 2E1SA 4N6PA 3PGFA 3PUQA 4F39A 3J9X1 4NF6B 5FXZA 2VKHA 2F6GA 3AB3B 3PMXA 4DO0A 4QRZA 2VWAA 4G8MA 4ZEBA 1MIWA 5KDMC 1TT1A 2CEAA 4PJMA 4OWDA 1WRDA 1D9YA 1Y20A 1IZNB 2PYYA 3F2EA 2I4CA 1MMNA 3TKLB 1B40A 1LBBA 2MOZA 4LZ8A 1IIWA 1JEVA 5AA3A 3RC8A 3G3FA 3RT6B 2VKJA 1S7YA 2DI4A 2XQYA 4AB6A 2QMXA 4X1DA 3MA9A 4DIGA 4ZE8A 2M67A 2GHAA 1SHZC 2NOXA 1DTGA 2I49A 4KYEA 3RY3A 2YU2A 4ADZA 5JEIA 1JVXA 4DXUA 1SI0A 1MXYA 2OBGA 1WR6A 1OVBA 2PMSA 4I55E 3NRXA 1B5HA 3O97A 4LONB 4F3GA 4Z8XA 3LG7A 4IO2A 3E9XA 2NUVA 2DSFA 3FV2A 3KINB 2JMHA 3J7Yq 1JETA 2ONRA 4EYYR 2HZKA 1XVYA 3QIMA 1DSNA 5ICTA 4GK0E 1U5PA 3T9HB 2HXWA 4OEVA 1B3HA 2XXYA 4RY1A 4ZI3C 4TLLB 3LK3B 1BLFA 2NOOA 1G8XA 3B7DA 3IORA 4BDRA 4QFLA 2H4IA 5TP9A 1FQDA 4FORA 5F8PA 5JR9A 3H6WA 4ELRA 4OVJA 3MPLA 1JEUA 4QSCA 3TTLA 3F31A 4C90A 3O1HA 4QXCB 1NNTA 4PK6A 3RYHE 4L0RA 4EF2A 2ZYNA 1MIYA 4R74A 3KN8A 3TELA 1PDAA 3CQGB 2ZNUA 4XKRA 2CA5A 2D5UA 2P0SA 2SPCA 1MM6A 2CLYC 5LA6E 2UYEA 4ISUA 4IY6A 4QFKA 3TKDA 5CRYA 2HPJA 4IO4A 3C4WA 1ZHCA 1US5A 5KDTA 4AQFA 1N76A 2X66A 2PX1A 4QX8B 2C5KT 4ERRA 5DEXA 1LAGE 2Y6XA 1P1OA 3G3HA 3I0OA 2R71A 1Y1MA 3FD3A 1T98A 4H9OC 3SESA 3ZYMA 2VGQA 4G2ZA 4HKAA 5JDLA 1MY4A 1QSDA 5FHMA 3PE0A 3U92A 2RCBA 2EHOC 4K3FA 3KZGA 4KUMB 1HCIA 1Z7ME 1S9TA 4O8SA 3H03A 3N9OA 1B3GA 2A5SA 1B4HA 5EYFA 4FAJA 5LJMA 5HYAA 3IR1A 1VFDA 4CI1B 3OXNA 1FTKA 3ZMZB 1ZTYA 4DBQA 3T96B 1ATGA 1LB9A 1MPBA 4QFPA 4PFUA 2V3QA 2XXPA 4IO5A 1BTJA 1ZMGA 4YHJA 1OVTA 4YFSA 2E9XB 2ZMBA 3VLUA 3G7WA 4FE8A 4EQ9A 3CQCB 1OWAA 2REGA 5BWJA 4OQOA 3SEWA 3W9VA 2Q9QD 4JEUB 4RK2A 3HA4A 4CI2B 4EXTA 3LUYA 5H6RB 4UEMA 2DWAA 1URDA 4NTLA 1D9VA 5BUUA 2YJPA 2ZNSA 4YMAA 4IDZA 4PK5A 4ZS3A 4EXKA 1B7ZA 2F36A 2FNCA 4IGTA 3KSJA 3A3CA 4QFOA 2Y7IA 2AIXA 2I58A 2CWOA 2ZNTA 3HSTA 1HX8A 2ALUA 4PETA 5JDHA 1I69A 3CVGA 4NUVA 2X0LB 3W15B 1JW1A 2Q9TA 4G68A 5JDNA 5I57B 4ZI2D 4EQ7A 3GWHA 2O7UA 1AMFA 1HS7A 1SDXA 5JTYA 4GYRA 3TMGA 4Q0CA 3RGYA 4YLHA 1R6ZA 1HSJA 2X68A 5JR9B 4XZCA 3K02A 3EQ1A 5EHSA 1B52A 1Y3QA 3OBVE 3TAJA 3VDFA 1IEJA 4IE0A 4GL8A 1MS7A 2XAQB 2GHBA 3ZPOA 3IB0A 1P1NA 2Y7RA 3RQTA 3ZYKA 3SS1A 1MXVA 3JYRA 4R9FA 3SWHA 1WYBA 5JH7E 2W0GA 3D4GA 3MP1A 4QF9A 4ZHQE 3IX1A 3SEUA 2XXXA 2XHEB 5LCYA 1DPEA 3ZYLA 2H3RA 5TAOA 2CMOA 3IHRA 5C8YE 1FQAA 1X79A 4U4SA 1D0YA 5LBQB 3ANWB 4DXBA 5KDTB 1MXWA 4BJNA 4AKHA 2NTYA 5H8FB 5AA2A 1LVFA 1VSOA 3T8OA 1GV8A 4BDLA 4F22A 1SYHA 3NRYA 3CFZA 4YZZA 5F7VA 4JWOA 3L09A 1M5EA 1WLXA 2DS9A 3Q25A 1P1QA 4MF3A 3RYFE 1BR1A 2XAJB 2OCUA 2RCAA 4BAYB 5KCJA 1P1WA 3CG3A 4HCYA 4RPOA 1LFGA 4C0RA 3MVZA 5LHIB 3AAEB 3PUGA 1IITA 5I2NB 1JQFA 1FCKA 2O68A 2I3VA 5HWXA 3RNNA 1ZV4X 4UELA 4EQBA 1CUNA 5KZTA 4WBOA 3FV1A 2D0UA 5H8QA 2PBWA 2Z22A 1UIVA 2F7AA 5LXTE 5CA1E 5M2VA 1IXIA 1ELJA 4H8JA 3FBZA 3QC9A 2CMRA 1B5JA 4P0AA 3AA6B 1FW0A 3IBPA 3O6HA 3QSLA 4C1UA 2HFBA 2W63A 3PU5A 1USYH 5JDFA 4H0WA 1B5IA 2XXQA 3FXEB 3O2AA 3ZEFB 1MXZA 3DLNA 2AL5A 2XAHB 5LGTB 5DT6A 2ODVA 4PNIA 1AJ3A 3TTRA 5ADXL 4R9GA 1JVYA 5CA0E 5JDMA 2XX7A 3FUZA 4FIMA 2X7QA 3Q9DA 2G0UA 4A56A 3OKQA 1D0ZA 4UVBB 3P7IA 3BQLA 1H76A 2Q89A 4ZS9A 3N9PA 2KLQA 1YPNA 1SBPA 4K0UA 5FY1A 5H8HA 1B58A 4OETA 2KZ7B 5LGNB 4QX7B 1D1BA 1A40A 1FQEA 4ZI3D 5JRCA 2VOZA 3PPRA 2O1MA 2LAOA 3HKCE 3E13X 3OEKA 4C1TA 3N2GE 3RKOA 1HG2A 2DXYA 5CC2A 1A99A 5LJNA 3OSQA 3CMLA 3RYIE 3PPPA 5FXWA 5JTYB 5ICQA 3FJ7A 2REJA 4BDNA 4XKNA 3IB1A 2YU1A 4H9NC 2O69A 1ZBMA 3RN8A 1MXXA 1MXUA 2FYIA 1KK7A 3TUSA 4IE7A 3N2KE 3DJBA 2E9XC 1TXFA 4CXYA 5I56A 3WAEA 2L8KA 1SYIA 2D21A 4OFOA 4O4HE 3PUXE 2B65A 1B1HA 3M65A 1H3DA 1SQYA 2X9WA 5EHMA 2Z8EA 4LZ5A 5I59A 3LR1A 3HHGA 3DTOA 3UIFA 3HI2A 4ZI7E 1Y4CA 3N5LA 1N04A 4YB6A 3RYCE 3RTWB 5L3FB 3HV1A 5J1GA 4I9DA 1ZKEA 3KV6A 3GZGA 4M1VA 5AE4A 2YLNA 3CKDA 2HQ0A 1FTLA 3MBPA 1NNFA 3S9MC 5LOVE 3FVKA 4X1IE 3RRWA 2LHNA 2RP4A 3ZMUB 4O4LE 2OZZA 3BK9A 3TCHA 3VKGA 1S94A 2LHRA 5IKBA 3ZSFA 4YJ2E 4ILUA 3N26A 2EHOD 2RKMA 4I43B 2BDEA 3W9WA 3OENA 2IEEA 3R26A 5KCJB 3O1IA 3JV9A 1EZPA 2V3TA 3W15C 4QKNA 2V25A 1OIBA 4GOUA 2QA7A 3FATA 1MRPA 4NUUA 2XXVA 3VLWA 3V8XB 4R6YA 2I48A 3I0QA 2N9DA 4E7ZA 2X9XA 2A72A 1I6QA 2ZXTA 4DCYA 4ZEDA 1L5TA 2E8IA 4X1KE 2KINB 2DVZA 3GBBA 1QUUA 1OLCA 3HO7A 4OENA 5CM6A 5DJQC 1Y9UA 4R2FA 3IK6B 2NXOA 2IAKA 4U1OA 4U21A 2VHAA 2WAUA 3O9PA 5A1LA 2PG8A 2YK0A 5H8SA 5CMKA 1Y3PA 3TDJA 3K3QC 1GR2A 1MNDA 5HPQA 3H3GA 1MY0A 1OXZA 4X20E 2DQVA 3NZQA 1XHYA 5L9MA 1MY1A 4U72A 4F18A 2O51A 5DQVA 5B7DA 3C98B 3EN3A 1R9QA 3MJXA 3DP4A 4X9TA 1BR4A 2Q9QA 3V5UA 2OA5A 1B05A 5H8HB 3O6GA 3AVSA 1KWHA 1O7TA 3M3KA 2O84X 3OYZA 2MTQA 5LOMA 5FTHA 4UV8B 1HG5A 4H5GA 2DP8A 2RC9A 5JRCB 4X48A 3G3KA 4OHFA 4RPNA 3KFWX 1SD3A 4H63V 1LCTA 3K1MA 1LGBC 2K24A 2A5TB 5GONE 2LSJA 3C32A 1N7WA 4QFNA 1YKEB 4I50E 3FXDB 4NE4A 2XD2A 5I2KA 1B3EA 3KGCA 2K9AA 1MQDA 1DTZA 1IJ5A 1URSA 4HEAA 3DP8A 2NW7A 4ANJA 2LJLA 1QULA 3C4XA 4L17A 1SW1A 3LSXA 3TQWA 3A09A 4EZ4A 4O2AE 5L3DB 5I56B 4WXJA 4UF0A 1N7XA 4WNKA 1MY3A 1RYXA 3LK42 4XKQA 5A5XA 4F3PA 5I59B 4HFVA 3B6TA 1V9DA 3SETA 2P1SA 1ANFA 2O7IA 3TTMA 4JB7A 2R9JA 3QXMA 2FA7A 3LSLA 1R1NA 5TPAB 1UX5A 3FHNA 1O3XA 4J2CA 5ITPA 3U8QA 3MP6A 4MH5A 1RKMA 4G63A 3MAMA 3SEYA 4KCDA 4P0IA 4DDDA 3U1OA 3CX8B 2H98A 3VU7H 4KPTA 2JJ9A 3C4ZA 3TODA 4ISSA 3I5OA 1H43A 1B9JA 3UT5E 3A3UA 1NNKA 4NF5A 4AXPA 2VD3A 5ISUA 2YEVC 1LB8A 4GIZA 2PFVA 4IE6A 3UP9A 5TU0A 1YTVA 2WMOA 1QUKA 2ES0A 3QUFA 3PDYA 4TQUQ 4OZ9A 1FEWA 2QS1A 1M5FA 3VKHA 4TV9E 1MG1A 4P0GA 2O1LA 2WKYA 4KHZE 1HSEA 3MQ9A 1B0HA 1FQCA 3TEPA 1B7UA 2DYXA 3IOWA 3UA8A 3MXZA 3ZLIA 1HSLA 4PFYA 3JZJA 1M5CA 1NFTA 2I4BA 3CWZB 1A8FA 4GIWA 3Q5XA 5FY0A 4Z7EA 3ZKKA 3MVYA 4H1XA 2LSIA 2LOSA 1H44A 3B6WA 1LSTA 3HN0A 3K6WA 4WBNE 2N1GA 1URGA 1B2HA 3H4ZA 4R6HA 1OQHA 2NWJA 1Y1ZA 4QHOA 4PFTA 2W00A 3FVGA 5HM4B 4F3BA 2UVIA 4ONYA 1VFEA 3RH3A 1VOMA 3OYXA 1DPPA 2ABHA 3SDFA 1USYE 4PAGA 1A55A 3ZN1B 3AA7B 2VL8A 4GRKA 1NAFA 3I6VA 4GK5E 4F6RC 2RC8A 2M8CA 1XC1A 1D0XA 4G77A 2F6PA 3I9YA 3PTRB 3AA0B 5I58A 4WEDA 4KMCA 2XXUA 5DABA 2DE4A 4GYSA 2W62A 1FQFA 2F5XA 2GFEA 3O29A 4RNSA 3KDSE 1GVCA 2IW5B 3OMBA 2E9XD 2BVMA 1SVXB 2THIA 5I2KB 2DE3A 3H6VA 2NP9A 4UIGA 1POTA 4HTGA 2DWJA 2J1DG 3E08A 1B6HA 3U78A 3U93A 3RLFE 1WVJA 1Z7NE 3KBRA 3VV5A 1MMAA 5H6QB 3FJMA 2QRYA 2NW8A 3RRCA 3MKDA 4UF0B 1SA0E 2V26A 2C5JA 3EUHA 4KQPA 5LNKA 4L5GA 2PBIA 4WW0A 3TFLA 5LHGB 4ND9A 1MH3A 3BQKA 4F1YA 4AKIA 5TP9B 2ANJA 2XXRA 1NL5A 4QSDA 2GH9A 4EYUA 4AKRB 3N9LA 1B3FA 3IOUA 1MPDA 2F7CA 2HPLA 2VASA 1FQBA 3HKEE 2V93A 2DOJA 3SOLA 2B3BA 2QS4A 3MW0A 4XXUA 3RC3A 2HH7A 3MJNA 4O4JE 2DWHA 2YPNA 1FTOA 4OEUA 1IUDA 3FJGA 3G3GA 3K2DA 1GTKA 4ASKA 4NF5B 2X9HA 3IOTA 4DLDA 1E1HB 2XX9A 2VP1A 4BDMA 4GXSB 2I3WA 2VK9A 4M4GA 3IL1B 4U74A 1HFAA 2RINA 3S2VA 4NWCA 5J2TE 3TTKA 2QGSA 2EHOA 3HR0A 2D2SA 1O64A 3MPKA 2VKDA 3PUSA 1XT8A 2DE2A 4FJPA 5FHNA 5IYZE 3MACA 5DEXB 3KN7A 4RJZA 3WAKA 3Q27A 4JDFA 1I6AA 4H63H 5H8NA 3USDA 1IXCA 3GBAA 3T9VA 4P0BA 3NBXX 3B13A 3E22E 4DNDA 4I4TE 5HXCA 4UV9B 4P11A 3THIA 2MYSA 4ELPA 3KJTA 5HBCA 5L8DA 3QK6A 3WAJA 2IC9A 1VE4A 3K01A 3VVDA 2LSKA 3PMVA 3M3FA 1Y64B 4OMBA 1SI1A 1A7LA 4DMWA 1FMWA 2QSXA 2JRKA 4WKMA 3ONMA 4DXCA 3C34A 3K3NA 1LAXA 4HS7A 3UORA 4E0WA 3EF7A 3KV4A 5CMBA 3CFLA 4FEBA 1FIOA 3ZJ1A 2R6GE 1B51A 1QKAA 4C91A 3VXBA 2CE7A 2VKOA 1B46A 3I3VA 2XD3A 3MWBA 4NWDA 3C35A 2DLRA 1F9BA 1SW4A 3GN5A 4ESXA 3OEMA 5L3CB 4KR5A 4OFLA 3Q29A 1MIVA 5HXHA 2BZBA 3AAAB 3E3KA 4OFZA 3LJCA 1US4A 4DZ1A 3FZVA 1CE2A 2Q88A 1YD8G 2ZYMA 3TPAA 2IC6A 5LP6E 2KLFA 5L3EB 3ZMSB 5ITOA 2H25A 4YKPA 4GOTA 2QMWA 4G8HA 3C36A 1N3XA 3CG1A 4UACA 3AA1B 1LLSA 3TZAA 1WODA 4PW8A 4MFIA 3T9XB 1MPCA 5HXRA 3MVXA 4LUBA 2IA4A 3IAZA 3KSXA 4OFJA 3LK2B 4XBFB 4O3CA 3ZC0A 3LC8A 3TYHA 4NF8A 3RUMA 4F1UA 2WMNA 3LSFB 4EIWA 4XAXB 3CSBA 4G68B 3FASA 5EZYE 3K8PC 2DXRA 4ZEFA 2F7BA 4PE5B 3BBRA 1VR5A 5JQGE 4GFRA 4F3SA 2DHRA 4OTEA 3EHUA 3H6UA 4LA9A 2XX8A 3C33A 1MY2A 2PT1A 3TTNA 3V83A 5J2UE 2Y84A 4KYDA 2CM0A 1D1CA 2LM9A 3IOVA 4JSDA 4CZZB 4ELQA 2NWBA 3K3OA 2WM9A 1D1AA 4CI3B 4U4XA 4UA8A 4E0XA 3O9XA 3SEXA 1GGGA 2CWYA 1Q1KA 1UQWA 2XAGB 5FXVA 3Q28A 2KMFA 3P8CD 2NW9A 1WDNA 4NEDA 3HKBE 3T93B 1D3KA 2Q2CA 4Q5TA 1EU8A 2N2NA 3CSGA 2UVJA 1U4QA 1LCFA 1US7B 2EHOB 2OK2A 2D0TA 3IEEA 1ZLQA 3CRBA 3O66A 1B1XA 3H3AA 3ZCJA 5AA2B 2QJEA 5JVDE 2V7JA 1QUJA 1ZEEA 3ODBA 5H8NB 4R73A 2XXIA 3CIJA 2Z6EA 1D4NA 3HPIA 4LP2B 3OD7A 4CXWA 3CVRA 4EUOA 5L2LA 2VD2A 2F8DA 5LGUB 2CZLA 1N0TA 2H99A 2C5IT 3C31A 2YINA 5HAXA 2XAFB 3K6XA 3ZC1A 2K48A 2XXWA 4ZEKA 1OQGA 5JR9C 5H8QB 2H7OA 3GMIA 1B4ZA 1NNPA 2Z8DA 4R6KA 4THIA 4IE5A 1AIVA 2K5BB 1QUIA 2ZM8A 3IB2A 2E0SA 1HF8A 4H9RC 1LFHA 1DMBA 1PBPA 2XUEA 2CCQA 3K4UA 4ZOLE 1P99A 1QW0A 2KNDA 1H7CA 5LG4A 4DMVA 4OYVA 2JQQA 4HGAA 1QJMA 5FY7A 2G93A 1B0LA 1UTBA 3VHLA 2HEUA 4ZE9A 2QS3A 3PPQA 3SERA 5DTBA 4PJLA 3FXRA 3OO7A 4AQFC 1R9LA 2Y8DA 4YB5A 2V7IA 2I0BA 1DOTA 2X67A 3ZCIA 3GA8A 3CI8A 1ZJLA 4X1YE 3N6UA 4ZECA 3MUQA 3V89B 3OELA 4YMBA 4XIGQ 5K2XA 2RF1A 2X7PA 5JK4A 2PVUA 2UXXB 2A2FX 1J1NA 4ZS2A 2DWKA 3N9MA 2XXTA 4H67A 2W61A 2E9XA 4NF8B 3N2OA 3B57A 3VLVA 3RPUA 4IO7A 4MALA 3RTFB 2QS2A 3BFTA 4H9SE 2PJQA 1XVXA 2QL3A 2O6AA 4F29A 3FIRA 4MFRA 1BR2A 1UTHA 2UXAA 4CXXA 3CFXA 5E0OA 3DELB 1PEBA 2KWHA 5EK2A 5CI5A 1YCJA 3MZKB 2AYSA 1XOCA 1LRZA 2RA1A 3KVAA 1T0KA 2Y7WA 3KV5A 3SKPA 4EF1A 3MZBA 5J1DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X9Y A;  3KN3 A;  4MLQ A;  2G29 A;  4JXI A;  3Q26 A;  1Q35 A;  1Y4T A;  2NVU B;  1II5 A;  3N6T A;  4N13 A;  2ONS A;  3R6U A;  2F34 A;  3OSR A;  5B70 A;  3OO6 A;  4NF4 A;  4WEP A;  4TOZ A;  3UGW A;  5I57 A;  3VFJ A;  1MDQ A;  4RA1 A;  2OLB A;  3FXQ A;  4HW8 A;  2KWI B;  3G3J A;  3L6G A;  1EZ9 A;  3L6H A;  3ILU B;  4RK9 A;  3QYT A;  4G68 C;  4I1D A;  3O28 A;  3S4U A;  3PPO A;  3T9U A;  4U2R A;  3TCG A;  1ZIU A;  1EH3 A;  1Z0P A;  4YAH X;  3BKI B;  2QPQ A;  1EZO A;  1I6B A;  3MZ9 A;  3EPE A;  3S9E A;  3OOA A;  1M5D A;  1AL3 A;  4R75 A;  3SEV A;  2V84 A;  2BJJ X;  4ZEI A;  4ECF A;  5AA1 A;  5H8F A;  3LSW A;  2Q2A A;  5ELV A;  4GWO A;  3PUY E;  4LQ5 A;  2GRV A;  1S50 A;  1A8E A;  3KFM A;  2AL4 A;  2W7Y A;  4R2B A;  1UTB B;  2F97 A;  4I62 A;  2UYF A;  3N94 A;  1PB8 A;  3DM0 A;  1TFD A;  4B6X A;  5I2N A;  3CR9 A;  5K2Y A;  1NH8 A;  1BIY A;  4TLM B;  3ZS6 A;  2OWS A;  3PUW E;  3M8U A;  5DVI A;  4ESW A;  1XS5 A;  2HZL A;  4QHQ A;  3B6Q A;  3MC2 A;  5AA4 A;  4F19 A;  3VE1 B;  2X26 A;  4POX A;  3O6I A;  3EHS A;  5I84 A;  3TQL A;  4EXL A;  1UTH B;  1LAF E;  2UVH A;  4HCW A;  3M3L A;  1IJ6 A;  4IGR A;  1IXG A;  4Z0I A;  2ONK E;  5CBS A;  4N07 A;  3FVN A;  3H6T A;  4O3B A;  4KYS A;  1B3L A;  3FVO A;  4OES A;  5A5X B;  3G3I A;  4F2Q A;  3D4C A;  5F1Q A;  3GLB A;  4GVO A;  4ZDM A;  4JWY A;  4CQI A;  1A54 A;  3OO9 A;  4IY5 A;  3RPW A;  2ZYK A;  4NF4 B;  3KJ7 A;  5IAI A;  4O3A A;  1MH4 A;  3PD9 A;  1UIU A;  5DYH A;  1M5B A;  3KG2 A;  4RXL A;  4H65 A;  4DE8 A;  4KI0 E;  3V5A A;  2XTL A;  4GF8 A;  3UK4 A;  4GXA A;  3R7X A;  3PMW A;  2UVG A;  1IZ1 A;  4JSO A;  2D5W A;  1ZU0 A;  3OO8 A;  1BP5 A;  4YKJ A;  4BDO A;  2P2A A;  4ZZE A;  3LBS A;  1AOV A;  4GQO A;  4YIC A;  4R72 A;  4NMY A;  1H45 A;  2Z8F A;  3PUZ E;  1B7H A;  1MDP 1;  2RC7 A;  3FXU A;  4EDP A;  3PD8 A;  3RT8 A;  3U94 A;  3H7M A;  4DCX A;  3FGS A;  3MZ1 A;  4OXV A;  3K0V A;  4POW A;  4H6D A;  3ECR A;  5L9S A;  1Y3N A;  4RYA A;  4IO6 A;  3IO6 A;  2DVC A;  2PT2 A;  1BKA A;  3C9H A;  3QUJ A;  3IJO B;  3DP6 A;  4YKK A;  3K6U A;  5CBR A;  2I0C A;  2ESN A;  3TCF A;  4FI5 A;  4MBP A;  4U22 A;  4OER A;  3S9N C;  3K1N A;  4JBZ A;  1YAE A;  3AXF A;  4AQ4 A;  4KD5 A;  3VXC A;  1SW2 A;  1QVS A;  1AH5 A;  4PQJ A;  3VVE A;  1PB9 A;  4AB5 A;  4IO3 A;  5I58 B;  1OMP A;  5AA4 B;  1JNF A;  3T66 A;  2Y7P A;  3H06 B;  4XTC Q;  5CMC A;  4YB7 A;  1PB7 A;  3IJX B;  4FED A;  5DVF A;  4NF6 A;  2XXH A;  4U1Z A;  2F78 A;  1IXH A;  4PP0 A;  4GD5 A;  4FAT A;  4U23 A;  4QSE A;  1TWY A;  4LQ2 A;  5L9O A;  1O63 A;  1NMU A;  1MQH A;  4LAT A;  4G8N A;  3WAF A;  3KEI A;  1N84 A;  4I8C A;  3ZKL A;  5DVJ A;  2MBG A;  3QAX A;  4IB2 A;  4OHN A;  1N3W A;  4H8I A;  1FTM A;  1PBQ A;  2HAV A;  4F31 B;  1MQJ A;  3PV0 E;  4H5F A;  4YKI A;  2A5T A;  2F35 A;  2H9B A;  1MM7 A;  4GLI A;  3MVW A;  3KOS A;  4KCC A;  1MQI A;  1FTJ A;  3K1P A;  4JWX A;  3C4M A;  1SW5 A;  5FHO A;  4MLV A;  1MQG A;  1PC3 A;  4F1V A;  4FEC A;  1QKB A;  3KOT A;  4X1B A;  3F11 A;  3U72 A;  4LVQ A;  4LZ7 A;  5FTI A;  2HAU A;  1CB6 A;  2XHD A;  5CMM A;  2OJT A;  5TPA A;  2HCA A;  3MP8 A;  3PUV E;  2V3U A;  3HCQ A;  2Y7K A;  2H5Y A;  3EHT A;  3UN6 A;  1RYO A;  1B32 A;  1LAH E;  4G4P A;  4PFW A;  4KFQ A;  1NH7 A;  4ELO A;  3T22 A;  3GXA A;  4Q8R A;  4Q30 B;  1TFA A;  4BLA A;  2Q8J A;  5AA2 D;  3S9L C;  4ZZA A;  3E4R A;  1JW4 A;  3K6V A;  3K00 A;  4BDQ A;  4XKP A;  1ZKB A;  1P1U A;  1NKX A;  1IQ7 A;  4GL0 A;  1OLA A;  3ILT B;  3VVF A;  3PPN A;  1POY 1;  1JW5 A;  1LBC A;  4F2O A;  3L3P A;  2DWI A;  3IO4 A;  2ZYO A;  2Z23 A;  4YU0 A;  3BFU A;  2OWT A;  2I6E A;  3HHF A;  1LFI A;  2D3I A;  2B3F A;  2E1S A;  4N6P A;  3PGF A;  4F39 A;  4NF6 B;  2F6G A;  3PMX A;  4QRZ A;  4G8M A;  4ZEB A;  1TT1 A;  4OWD A;  1D9Y A;  1Y20 A;  2PYY A;  2I4C A;  3TKL B;  1B40 A;  1LBB A;  4LZ8 A;  1IIW A;  1JEV A;  5AA3 A;  3G3F A;  3RT6 B;  1S7Y A;  4AB6 A;  2QMX A;  4X1D A;  4DIG A;  4ZE8 A;  2GHA A;  1DTG A;  2I49 A;  4KYE A;  3RY3 A;  5JEI A;  1JVX A;  4DXU A;  1SI0 A;  1MXY A;  2OBG A;  1OVB A;  2PMS A;  1B5H A;  3O97 A;  4LON B;  4F3G A;  4IO2 A;  3E9X A;  2NUV A;  2DSF A;  3FV2 A;  1JET A;  2ONR A;  4EYY R;  2HZK A;  1XVY A;  3QIM A;  1DSN A;  5ICT A;  3T9H B;  2HXW A;  4OEV A;  1B3H A;  2XXY A;  4RY1 A;  4TLL B;  1BLF A;  2NOO A;  3B7D A;  3IOR A;  4BDR A;  4QFL A;  2H4I A;  5TP9 A;  1FQD A;  4FOR A;  4ELR A;  3H6W A;  4OVJ A;  3MPL A;  1JEU A;  4QSC A;  3TTL A;  1NNT A;  4L0R A;  4EF2 A;  2ZYN A;  4R74 A;  3KN8 A;  3TEL A;  1PDA A;  2ZNU A;  4XKR A;  2CA5 A;  2P0S A;  1MM6 A;  2UYE A;  4ISU A;  4IY6 A;  4QFK A;  3TKD A;  5CRY A;  4IO4 A;  1US5 A;  5KDT A;  1N76 A;  2PX1 A;  2C5K T;  5DEX A;  1LAG E;  1P1O A;  3G3H A;  2R71 A;  1Y1M A;  3FD3 A;  3SES A;  2VGQ A;  4G2Z A;  1MY4 A;  1QSD A;  5FHM A;  3U92 A;  2RCB A;  4K3F A;  3KZG A;  1Z7M E;  1S9T A;  3H03 A;  1B3G A;  2A5S A;  1B4H A;  5EYF A;  4FAJ A;  3IR1 A;  1VFD A;  3OXN A;  1FTK A;  1ZTY A;  3T96 B;  1ATG A;  1LB9 A;  1MPB A;  4QFP A;  4PFU A;  2V3Q A;  2XXP A;  4IO5 A;  1BTJ A;  1ZMG A;  1OVT A;  2ZMB A;  3VLU A;  3G7W A;  4FE8 A;  4EQ9 A;  2REG A;  5BWJ A;  4OQO A;  3SEW A;  3W9V A;  4RK2 A;  3LUY A;  2DWA A;  1URD A;  4NTL A;  1D9V A;  5BUU A;  2YJP A;  2ZNS A;  4YMA A;  4EXK A;  1B7Z A;  2F36 A;  2FNC A;  4IGT A;  3KSJ A;  3A3C A;  4QFO A;  2Y7I A;  2AIX A;  2I58 A;  2ZNT A;  3HST A;  2ALU A;  4PET A;  1I69 A;  3CVG A;  1JW1 A;  2Q9T A;  4G68 A;  5I57 B;  4EQ7 A;  2O7U A;  1AMF A;  1SDX A;  5JTY A;  3TMG A;  4Q0C A;  3RGY A;  1R6Z A;  1HSJ A;  3K02 A;  3EQ1 A;  5EHS A;  1B52 A;  1Y3Q A;  3TAJ A;  3VDF A;  1IEJ A;  4GL8 A;  1MS7 A;  2GHB A;  3IB0 A;  1P1N A;  2Y7R A;  3RQT A;  1MXV A;  3JYR A;  4R9F A;  3D4G A;  3MP1 A;  4QF9 A;  3IX1 A;  3SEU A;  2XXX A;  1DPE A;  2CMO A;  1FQA A;  4U4S A;  4DXB A;  5KDT B;  1MXW A;  5H8F B;  5AA2 A;  1LVF A;  1VSO A;  4BDL A;  1GV8 A;  4F22 A;  1SYH A;  3CFZ A;  4YZZ A;  5F7V A;  4JWO A;  1M5E A;  2DS9 A;  3Q25 A;  1P1Q A;  4MF3 A;  2OCU A;  2RCA A;  5KCJ A;  1P1W A;  3CG3 A;  4HCY A;  4RPO A;  1LFG A;  4C0R A;  3MVZ A;  1IIT A;  5I2N B;  1JQF A;  1FCK A;  2O68 A;  2I3V A;  3RNN A;  4EQB A;  5KZT A;  3FV1 A;  5H8Q A;  2PBW A;  2Z22 A;  1UIV A;  2F7A A;  5M2V A;  1IXI A;  1ELJ A;  4H8J A;  1B5J A;  1FW0 A;  3O6H A;  3QSL A;  4C1U A;  2HFB A;  3PU5 A;  1USY H;  4H0W A;  1B5I A;  2XXQ A;  3FXE B;  3O2A A;  1MXZ A;  3DLN A;  2AL5 A;  5DT6 A;  3TTR A;  4R9G A;  1JVY A;  2XX7 A;  3FUZ A;  4FIM A;  2X7Q A;  2G0U A;  3P7I A;  1H76 A;  2