3P7IA

Crystal structure of escherichia coli phnd in complex with 2-aminoethyl phosphonate
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
300
structure length
300
Chain Sequence
KALNFGIISTESQQNLKPQWTPFLQDMEKKLGVKVNAFFAPDYAGIIQGMRFNKVDIAWYGNLSAMEAVDRANGQVFAQTVAADGSPGYWSVLIVNKDSPINNLNDLLAKRKDLTFGNGDPNSTSGFLVPGYYVFAKNNISASDFKRTVNAGHETNALAVANKQVDVATNNTENLDKLKTSAPEKLKELKVIWKSPLIPGDPIVWRKNLSETTKDKIYDFFMNYGKTPEEKAVLERLGWAPFRASSDLQLVPIRQLALFKEMQSVKDNKGLNEQDKLAKTTAIQAQLDDLDRLNNALSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords PhnD, subunit of alkylphosphonate ABC transporter
publication title Structure of the Escherichia coli Phosphonate Binding Protein PhnD and Rationally Optimized Phosphonate Biosensors.
pubmed doi rcsb
source organism Escherichia coli uti89
total genus 119
structure length 300
sequence length 300
ec nomenclature
pdb deposition date 2010-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12974 Phosphonate-bd ABC transporter, phosphonate, periplasmic substrate-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3p7iA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3p7iA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3p7iA02
1B4HA 2WKYA 5CM6A 2XX8A 3RUMA 1LFHA 5EYFA 4YZZA 2V3TA 3QXMA 4PP0A 4EQBA 4R2FA 2RF1A 4PETA 1Z7NE 4EF1A 5H8NA 2UVJA 4MF3A 4R6YA 4TQUQ 1KWHA 2QJEA 2RC9A 4XIGQ 2D5WA 4F19A 3CVGA 3LC8A 2AL4A 1IITA 5ELVA 5EHMA 3FD3A 3VFJA 1PEBA 1Q1KA 4U1ZA 3TPAA 1B3EA 3MP6A 3L6HA 2Y7WA 1PDAA 4R6HA 4R6KA 4LP2B 1I69A 1MY3A 1DTZA 3Q29A 3SEVA 4PE5B 3CFZA 2DXRA 2GRVA 1MXWA 3W9VA 2O6AA 3RPWA 4KCDA 3I3VA 4FECA 3FJ7A 1DOTA 3FVGA 2DP8A 4JXIA 2VGQA 1A7LA 3TTLA 3PPPA 3KBRA 4OMBA 4C1TA 2MBGA 2NVUB 5CBRA 4PFYA 3EF7A 5I57B 4KYEA 2H4IA 3U1OA 3WAFA 1PBQA 5DEXB 2K48A 1B58A 3K1MA 1JNFA 2DVCA 2UYFA 3H4ZA 1URGA 1B3HA 1M5CA 1LRZA 3FXEB 4G4PA 4OZ9A 4LZ8A 1LCFA 2QS4A 4AB5A 4BDQA 2PBWA 5CC2A 5H8NB 4YU0A 1UTBA 1Y3QA 3K0VA 2VD3A 1Y20A 3OELA 3CFLA 4QFKA 4G68A 1XT8A 4F3SA 1IQ7A 4H8IA 4ZEFA 4JB7A 1XS5A 1MG1A 1OQGA 1AMFA 1OVTA 5BUUA 1XHYA 1SBPA 4M4GA 4GF8A 3CFXA 4MBPA 3V5AA 4FEBA 3R7XA 1MQHA 1MQIA 1H3DA 3Q27A 3G3FA 4M1VA 2Z8DA 3OEKA 5JTYB 2DWHA 4R73A 4CQIA 1LGBC 3D4CA 1MH4A 4ELRA 3PPOA 2F78A 1PB9A 2XXWA 1TT1A 3LR1A 1A8EA 2IC6A 4OEUA 4LVQA 3R6UA 4JSOA 2R6GE 5K2XA 2I58A 4LZ7A 1B3LA 3FIRA 4YKKA 4LA9A 1SQYA 4F39A 3G3JA 2IEEA 3BBRA 3MQ9A 2O68A 5IKBA 1B4ZA 3VDFA 1B5JA 3IORA 2THIA 2Z22A 4ZEKA 4GIZA 3H7MA 4R2BA 1MPCA 3R26A 5CI5A 3KN7A 1UTBB 3UP9A 5H8FA 3K6XA 4ECFA 3ILUB 4R72A 4MH5A 4ZEBA 1FQEA 4O3BA 4OQOA 5B70A 3PPRA 5I56B 1LB8A 2HAVA 5L9OA 4DLDA 1LFGA 1DPPA 2I4CA 2E0SA 3EQ1A 1AOVA 4KYDA 4MFIA 2CA5A 1N3WA 1LLSA 3UORA 2XXYA 2O69A 4QFOA 4FJPA 3PGFA 3EHSA 1US4A 2XXVA 1N3XA 3W9WA 3FV1A 3U92A 1IXCA 3OO8A 3FJGA 2W7YA 4XKQA 3E3KA 1Y1ZA 1SW2A 4EUOA 5KDTA 4G8HA 1H44A 1OVBA 1H7CA 1R9LA 1A55A 3O6HA 4NF4B 3TCHA 3MVYA 4X9TA 5I58A 3UGWA 3K6VA 1SW4A 4YKJA 4EF2A 4U4SA 5DT6A 2YPNA 3FVNA 3HCQA 3HV1A 4H6DA 2ONSA 5ITPA 5H8FB 3MPLA 5ICTA 4KQPA 4YMAA 3CR9A 3ECRA 1Y9UA 1WODA 3IOTA 2XXPA 3H6WA 3GBAA 2PT2A 4LUBA 3A3CA 1YTVA 1O7TA 3VXBA 4UA8A 4OHNA 3GBBA 4DIGA 3IB1A 4QFPA 3KZGA 4XTCQ 3B7DA 4LQ5A 2R71A 3PUWE 1TWYA 5ITOA 4POXA 2ESNA 3N6UA 1MRPA 4HCYA 3IJXB 4YB6A 2ZNTA 2Q8JA 2XD3A 3OXNA 2I0CA 4UACA 2O1LA 5KDTB 2O1MA 4IGTA 2QS1A 3FVOA 1URDA 3K00A 3LSFB 1JEVA 2E1SA 4U2RA 5AA3A 5DVJA 4DXBA 2OJTA 3S2VA 1ATGA 4ELQA 3FVKA 4G8NA 3TAJA 2A5TB 5LOMA 2ZYMA 5IAIA 3M3FA 4EYYR 3VLUA 5TU0A 5CMKA 2Z8EA 1SW5A 2CMOA 2DXYA 3N26A 2OCUA 3PMVA 5H8HA 4FI5A 1NMUA 4YICA 3N94A 3TCFA 1FQCA 1IIWA 3O29A 1NH7A 2YLNA 1BIYA 3S9NC 2GH9A 4ZECA 4F2OA 3T66A 1B5HA 1QKAA 4NF5A 1P1NA 1I6AA 4YKPA 1MXZA 4MLVA 3OD7A 2Y7RA 4RXLA 2DS9A 1LFIA 2DSFA 4NMYA 1LVFA 3MVWA 4RK2A 3QIMA 3PD9A 2X9YA 1HSLA 4R74A 4U22A 1RYOA 3MZBA 1P1QA 3DP8A 3IL1B 2XTLA 4RPNA 3U8QA 2YJPA 4IO3A 1EH3A 1B7ZA 3KSJA 4IGRA 3H6VA 3KGCA 3N5LA 4KYSA 1HSEA 4ISUA 3RNNA 3PPNA 4X1DA 4NF6A 1D4NA 3HHGA 2UYEA 1FTOA 1N0TA 1MY0A 4OFJA 4FIMA 3MJNA 1MDQA 5H8HB 2DE2A 1UIUA 1UTHA 4TOZA 2DQVA 2AYSA 3PUYE 4KI0E 2KLFA 1WVJA 4HW8A 4DCYA 4R9GA 1JW4A 3C32A 4NF5B 3QAXA 1VE4A 3O6IA 2V25A 1Q35A 1L5TA 4Z7EA 3MPKA 3TFLA 2X9XA 2ZYNA 1M5EA 4YKIA 2PYYA 3H6UA 3UIFA 3T96B 3RTFB 3IAZA 3G3HA 3P7IA 4GOTA 3S4UA 1ZIUA 1D9YA 1ELJA 2V3UA 4ZE8A 1YPNA 4ELOA 5H8QB 3U94A 3CSBA 1B7UA 3CI8A 1DPEA 1LAGE 4YAHX 1NKXA 2O84X 3OO7A 1N76A 3CSGA 3SERA 3A3UA 3MZ1A 4JDFA 2X9WA 5F1QA 3ZS6A 4IY6A 3C36A 3O28A 4NF6B 4FAJA 2OWTA 2VHAA 5TP9A 2V3QA 3THIA 1OIBA 1ZTYA 4ELPA 1NH8A 2UVGA 4NEDA 3V8XB 4GFRA 5AA1A 2QS2A 2X7PA 2OBGA 4DNDA 4WKMA 2B3FA 3SDFA 1UTHB 3ILTB 3KOTA 2VD2A 4XKRA 2I49A 4Q5TA 2F7AA 4BDNA 4U23A 3SEUA 1VR5A 1R6ZA 4N07A 3T9UA 1IXIA 2NWJA 3OOAA 4U4XA 3JYRA 4OVJA 4OEVA 3W15C 4R9FA 2Y7PA 2IA4A 3CVRA 1NFTA 2HFBA 2ZYKA 2FA7A 3S9MC 3VXCA 3L6GA 1PC3A 4U21A 4R75A 4PFWA 1SW1A 3IO6A 3KEIA 4JBZA 2DYXA 3TCGA 3IJOB 3IX1A 2PT1A 1FTLA 2KWHA 4PFTA 4OTEA 1FTMA 1B5IA 2ZYOA 5DVFA 4KPTA 2NXOA 5L9MA 3H06B 5KZTA 2ALUA 1N84A 5I2NA 4LATA 1MM6A 4F1VA 5TP9B 4JWXA 3U93A 3E9XA 4GD5A 3SETA 5HBCA 3A09A 1USYE 2B3BA 4OWDA 4F2QA 3KOSA 2Q9TA 1OQHA 4NE4A 4J2CA 3MZ9A 1IZ1A 1XOCA 2H98A 1IXHA 4G68B 3I6VA 3PV0E 3IOWA 3MXZA 2HCAA 5FHMA 5KCJA 4ESXA 4ZEIA 4QFLA 1I6QA 3QYTA 1JW1A 3C9HA 3C33A 2ZXTA 4IO4A 5JK4A 2RC7A 3TZAA 4GWOA 4NWDA 1SYHA 3TYHA 2DWJA 3KN8A 5CRYA 2F7BA 4G2ZA 4H0WA 4EXLA 3FXDB 3FXQA 2XD2A 2RCBA 4TLMB 1LCTA 5F7VA 2OK2A 3DP4A 1A54A 3QSLA 2I6EA 3M3LA 3AXFA 1AL3A 1GV8A 4AB6A 2ANJA 1B05A 4RYAA 1B6HA 1WDNA 3S9EA 4OESA 3T9HB 3PUZE 3BFUA 5I2KA 4XKNA 1B46A 4ZZEA 5ICQA 1Z0PA 3EHUA 3HPIA 2P1SA 3CG1A 4LQ2A 2UVHA 4H5FA 2G93A 4XXUA 3EPEA 5FHOA 3K4UA 1GGGA 3T93B 5KCJB 1B1HA 2DE3A 2VP1A 4POWA 4RA1A 3UN6A 1LAFE 2BJJX 2F36A 5AA2A 4GL8A 3VE1B 3IO4A 2I4BA 1B7HA 3RT8A 4H65A 4GVOA 4YB5A 1YCJA 2I3VA 3IB2A 1MS7A 2Y84A 4K3FA 2O51A 4F1YA 3K6WA 2XXQA 4YMBA 5AE4A 3LSWA 1AH5A 1LAXA 3BFTA 2Q89A 1P1WA 1FQBA 3FV2A 4RPOA 2QL3A 4F31B 2UVIA 3TTMA 3S9LC 2HXWA 4Q0CA 4GRKA 1A99A 1MDP1 1R9QA 4IO7A 1ZU0A 4U1OA 3SKPA 1Y3PA 4OXVA 3M8UA 2I0BA 1QULA 2PX1A 4MLQA 3TTRA 1IUDA 5DVIA 1Y3NA 4ZDMA 2GFEA 1IJ5A 4NWCA 5I58B 3PPQA 2Q2AA 4HTGA 1UIVA 3IOVA 2C5JA 4TLLB 3JZJA 1PBPA 3DLNA 2OZZA 4XKPA 2C5IT 3GLBA 4H1XA 1QUIA 3CRBA 3KN3A 4O3CA 2F5XA 1MXVA 4KCCA 1LB9A 3MVZA 3MBPA 1FW0A 1MY4A 3K1NA 3LUYA 2XXUA 3QUFA 1Y4CA 3ZSFA 2H25A 3TTNA 5DYHA 2UXAA 2QMWA 3TKLB 2D21A 4QFNA 5FTIA 4ESWA 3BKIB 3GXAA 4QSDA 2ZNUA 1Y4TA 4ONYA 2F34A 5J1DA 1QVSA 2G0UA 1JEUA 3SEXA 3KSXA 2X26A 1HSJA 2H5YA 4KR5A 2Q88A 3TMGA 1OLAA 2ZNSA 2ONKE 4BDMA 4GQOA 1POTA 1S7YA 2A5SA 5JEIA 3VVFA 1JETA 3HHFA 1GTKA 2NOOA 3MC2A 1B51A 2PVUA 1MPDA 3DP6A 1ZBMA 4ND9A 3OENA 5HM4B 2R9JA 1SVXB 1QKBA 4X48A 3QK6A 1POY1 3USDA 2M8CA 3FXRA 3TQLA 1P1UA 4EDPA 4LONB 1MQDA 4BDRA 3TTKA 1EU8A 4H8JA 3E13X 3RN8A 1B9JA 2X7QA 1ZLQA 1MY1A 3FJMA 1ZKBA 4BDOA 3ODBA 1ZMGA 5I57A 5DEXA 3MVXA 1PB7A 1B32A 2REJA 3LBSA 4JWOA 2HQ0A 5L9SA 3Q25A 3FXUA 2Y7IA 1NNFA 1LBCA 3SEYA 4GXAA 5K2YA 3KFMA 1II5A 1SD3A 2PMSA 3O66A 4G68C 4DE8A 2XHDA 1SYIA 4C0RA 4KHZE 4BDLA 4N6PA 4P0IA 4ZE9A 3L3PA 2FYIA 4E0WA 1H43A 4Q30B 3G7WA 1QW0A 4IY5A 2XXIA 4QSCA 5TPAA 5FHNA 2AL5A 4G8MA 4EQ7A 4GXSB 4WEPA 3TODA 1B1XA 1MXXA 4NF8A 3LSXA 1M5FA 3OSQA 2G29A 3FZVA 3WAEA 4F1UA 1MM7A 5JTYA 1T0KA 3VV5A 4I9DA 1XC1A 4FORA 3OO9A 4FEDA 3U72A 3IK6B 1BP5A 5I84A 4FE8A 3TKDA 2HAUA 4L17A 1I6BA 4ZEDA 1S50A 1M5DA 1LSTA 1FTKA 2D3IA 3SESA 4E0XA 1D9VA 1B0HA 4Z0IA 1FCKA 2B65A 3OO6A 1QJMA 1LAHE 1GVCA 3C31A 4OERA 2F35A 2DE4A 2QRYA 3RQTA 1FQAA 3O2AA 5HPQA 4F22A 1YAEA 3IOUA 3FGSA 3C4MA 2QPQA 1H76A 3V83A 3OEMA 5FTHA 5A5XA 1F9BA 3N6TA 3E4RA 3Q28A 2CZLA 4JSDA 3K02A 1B3GA 4DCXA 3V89B 1Y1MA 3EN3A 3H6TA 1XVXA 2ZMBA 1N04A 1VFEA 1FQFA 1ZKEA 3M3KA 3DELB 5TPAB 3H3GA 4IB2A 4DXCA 1FQDA 2FNCA 3PD8A 1AIVA 1EZPA 3T9VA 4NF8B 3PUVE 1B2HA 5I56A 4LZ5A 4DDDA 1A8FA 2H9BA 3VLVA 1IXGA 3RGYA 2QS3A 2F6GA 3KJ7A 5ISUA 1ZJLA 2VOZA 4P0GA 3IB0A 2O7IA 3QUJA 2GHBA 3PU5A 5EHSA 4AQ4A 4THIA 4QRZA 3MUQA 5CMCA 3B6QA 3G3IA 4HCWA 2AIXA 3KG2A 3DM0A 2C5KT 2F6PA 1OMPA 2GHAA 2RCAA 3CKDA 1URSA 4KD5A 3FUZA 1BLFA 4NF4A 1ANFA 3VVDA 3KJTA 5L8DA 1JQFA 2IC9A 3C34A 3TQWA 4BLAA 1P99A 5A5XB 3FASA 3IR1A 4B6XA 2XX9A 4PQJA 1B40A 3I5OA 3ZKKA 3SEWA 1B3FA 4IO5A 4P11A 3OMBA 1MPBA 2F97A 3RLFE 3T22A 1SI1A 2P0SA 2F8DA 4ZZAA 2XX7A 2LAOA 4QHQA 3FATA 3VVEA 2ONRA 1BTJA 4I8CA 4GL0A 2F7CA 3VLWA 2RC8A 3G3KA 1D3KA 1DSNA 4I62A 3UK4A 3O97A 1N7XA 5I2NB 3K2DA 2H99A 5AA2D 4QF9A 1MXUA 3RY3A 1NNTA 1JVXA 1Z7ME 1QUJA 4IO6A 1VFDA 2XXTA 3T9XB 4F3GA 4OETA 2ABHA 4DXUA 3CG3A 3HN0A 4OENA 5I59A 1R1NA 3EHTA 4RK9A 1EZ9A 3MAMA 3B6WA 2Y7KA 5CMMA 1VSOA 3H03A 3TELA 1MXYA 4H67A 4N13A 3ONMA 4RJZA 2A5TA 3CIJA 1B0LA 2O7UA 1IJ6A 1A40A 4F3PA 1OLCA 3O6GA 2XXXA 4NTLA 2XXHA 1IEJA 2V93A 4ZS9A 1RYXA 4YB7A 2QSXA 4DZ1A 2I3WA 5AA4A 1N7WA 1DTGA 4I1DA 3K6UA 1H45A 2RINA 2V84A 4F18A 2KWIB 1QUKA 2DOJA 1MY2A 4OYVA 1BKAA 3HSTA 3G3GA 1O64A 1DMBA 2QMXA 4JWYA 1M5BA 2OWSA 3PMWA 1MQGA 4O3AA 4F3BA 1PB8A 3GZGA 1NNPA 2I48A 1FTJA 5I2KB 2Q2CA 4F29A 4WXJA 2HZKA 1XVYA 4L0RA 5I59B 2OLBA 3HO7A 2DWIA 4OFLA 3LSLA 5H8SA 1SDXA 3MWBA 4OFOA 3UA8A 5AA2B 1JVYA 2XXRA 1P1OA 2DVZA 4H5GA 1CB6A 4EQ9A 2HEUA 4GLIA 1USYH 1QSDA 3JV9A 3RT6B 4X1BA 4RNSA 4RY1A 3OSRA 3TEPA 3PMXA 3K01A 1J1NA 5AA4B 3ZKLA 5DTBA 3MP1A 4IO2A 1NNKA 3O9PA 4C1UA 3Q26A 1MQJA 4WEDA 1JW5A 1TFAA 3RTWB 4HS7A 1O63A 3D4GA 2REGA 2DWAA 4Q8RA 3PUXE 3TDJA 4PFUA 5M2VA 3MP8A 1SI0A 1RKMA 1B52A 1LBBA 2RKMA 5BWJA 2Z8FA 1CE2A 5B7DA 1S9TA 4G77A 4EXKA 3F11A 1MH3A 1GR2A 3B6TA 3K1PA 3C35A 5H8QA 4KFQA 5CMBA 1TFDA 1US5A 1EZOA 3TUSA 2NUVA 2P2AA 1UQWA 4QSEA 3MW0A 2HZLA 4FATA 5CBSA 1NL5A 2Z23A 1TXFA
chains in the Genus database with same CATH superfamily
1B4HA 2WKYA 5CM6A 2XX8A 3RUMA 4OA4A 1LFHA 1D0ZA 1MMNA 4YZZA 5EYFA 2V3TA 3QXMA 4PP0A 4EQBA 4R2FA 3H37A 2RF1A 4PETA 3RYCE 4PC9A 1Z7NE 2CHOA 4OFZA 4EF1A 5H8NA 2UVJA 4MF3A 3KINB 4R6YA 1DCUA 1FPBA 4TQUQ 4KXPA 1KWHA 2QJEA 2RC9A 4XIGQ 4EGWA 3N2KE 3NKZA 4LF8T 2D5WA 4F19A 1FSAA 3CVGA 5LHGB 3KV5A 2FBPA 2F3BA 3LC8A 4LMJA 2AL4A 3RX6A 2QVRA 2XWOA 3FBPA 1IITA 4AKHA 5ELVA 3IEEA 2XSAA 4GWWA 5EHMA 4XEQA 3FD3A 2ACZA 3B50A 4N4UA 2E5LT 1IBMT 2XM2A 5JQGE 3FB2A 4MX6A 3VFJA 1PEBA 4HFEA 1Q1KA 4U1ZA 3TPAA 1B3EA 1YZ0A 3ROJA 3OPCA 1INPA 1T72A 2LSIA 4U33A 3MP6A 2UXNB 3L6HA 4OYJA 2Y7WA 3PU3A 1MMAA 1PDAA 4GWXA 4R6HA 3P4RA 2XQ3A 2Y8DA 3PJAJ 1KA0A 4LP2B 3RIUA 4R6KA 1I69A 1MY3A 3Q9DA 1DTZA 1W09A 3UU4A 3Q29A 3SEVA 4PE5B 4YTPA 2ODVA 4QXHB 2DXRA 2D9DA 1MXWA 1Z8UA 2GRVA 4DR2T 3CFZA 4LFAT 3W9VA 3PUAA 1FPFA 2O6AA 3RPWA 1FPDA 4KCDA 3I3VA 4CXWA 4CI3B 2H7VC 5LJMA 4FECA 4QH4A 4UVBB 3EABA 1HNXT 3FJ7A 1DOTA 1E1HB 3FVGA 4AKIA 2DP8A 2WBDA 1GQEA 4JXIA 5LB7B 4IIJE 2BVMA 2VGQA 4EEDA 1A7LA 3TTLA 4PJLA 5DABA 3PPPA 1IMFA 4QH1A 3KBRA 4OMBA 3HFUA 4C1TA 5DJQC 2MBGA 2NVUB 4P09A 5CBRA 4PFYA 5AQTB 3EF7A 5AQIB 5I57B 4KYEA 2H4IA 3U1OA 3WAFA 1PBQA 3ESLA 5DEXB 4YFSA 2K48A 1B58A 4OVSA 4DV1T 3K1MA 2W63A 2WDRA 1JNFA 2DVCA 2UYFA 3H4ZA 4HWDA 2WZIA 3IFCA 2ES0A 3TLUA 1URGA 1B3HA 1M5CA 1LRZA 3FXEB 5HEGA 4COFA 2ZZVA 2M67A 4G4PA 4OZ9A 4LZ8A 1LCFA 2QS4A 4AB5A 1D9QA 4BDQA 2CM0A 2PBWA 5CC2A 5H8NB 4YU0A 5GONE 1UTBA 1ZV4X 2OLTA 1Y3QA 2OV9A 3MJXA 5JTGA 3K0VA 2VD3A 1IBLT 2MPKA 1Y20A 3OELA 3CFLA 4QFKA 4G68A 4DV3T 3ZPOA 1D0YA 1XT8A 4F3SA 1IQ7A 4H8IA 2L5VA 4ZEFA 4JB7A 2BS3A 4TWHA 1MG1A 1XS5A 1FJ6A 1OQGA 1AMFA 4H45A 1OVTA 5BUUA 4CZZB 4PBQA 2KNDA 2FHYA 1SA0E 3M3ZB 1XHYA 2W66A 3O1JA 1SBPA 2JQKA 4M4GA 5LMNT 4I43B 4GF8A 2XAFB 2WWUA 2V1DB 4EEBA 3CFXA 4MBPA 3V5AA 4JI8T 4FEBA 2V6XA 3R7XA 1MQHA 2CLYC 1MQIA 2BG9E 2H88A 1H3DA 3Q27A 3G3FA 2B76A 4KHZF 3ANWB 4M1VA 2Z8DA 2VASA 2X68A 3AEBA 3OEKA 5JTYB 4PF8A 2DWHA 4R73A 1LBZA 3OBVE 3T0JA 4CQIA 1LGBC 1D1AA 3D4CA 1MH4A 2LSKA 4ELRA 3PPOA 2F78A 5LCYA 1PB9A 3NVOA 1D1BA 1U5PA 4HFDA 2XXWA 1TT1A 4NQ8A 3LR1A 1ZOYA 1A8EA 4CI1B 5LHHB 1HCIA 2JPFA 2IC6A 4OEUA 2Y6XA 4LN5A 3VKHA 4LVQA 3RC8A 2LJLA 3R6UA 4EB6E 4JSOA 1FPIA 3FZLB 2R6GE 4QH5A 2I58A 5K2XA 3JC6C 2UXXB 4HTEA 4LZ7A 1B3LA 3FIRA 4YKKA 3AVSA 2WB5A 4LA9A 4JEHB 4O94A 1SQYA 4I4TE 4X64T 4X65T 4EZ4A 4F39A 4O8SA 3EAMA 3G3JA 2KZ7B 1LBVA 3ZC1A 2H3RA 4G63A 4XF5A 1JNRA 2W0GA 2JIWA 4NGUA 2E2AA 2MTQA 3I9YA 4HWFA 2IEEA 2YDQA 3BBRA 1EZ3A 2XQ6A 3MQ9A 2O68A 1HFAA 1B4ZA 3VDFA 5IKBA 2LOSA 1B5JA 3IORA 1OEDE 2THIA 2Z22A 4QBAA 4ZEKA 3UT5E 4GIZA 3T1HT 3H7MA 4R2BA 1MPCA 1NAFA 1VCSA 5FL0A 2PG8A 2JQ9A 3R26A 5CI5A 2V7JA 4AIUA 3KN7A 4IDOA 4ZI2D 1UTBB 3Q5WA 3SOLA 4QKNA 1IBKT 3UP9A 3AAAB 5AQJB 5H8FA 1XDOA 3K6XA 4ECFA 4ERRA 3KBUA 3ILUB 5IZ1A 4R72A 3AVRA 2P3VA 5LJNA 4MH5A 1YD8G 3P4SA 5F3JA 4YSYA 4O4JE 4ZEBA 1FQEA 4O3BA 4OQOA 4O8MA 5AQSB 2VQET 1OXZA 5CGMA 5B70A 2F4VT 4N8GA 4NIQA 2UU9T 3PPRA 5I56B 5AFUL 2XWKA 2IIUA 1LB8A 3E08A 2HAVA 4O4IE 3QC9A 5L9OA 1LFGA 4DLDA 1DPPA 3HKBE 5AQNB 2I4CA 2E0SA 3EQ1A 2D5UA 1AOVA 2N1GA 3AE1A 4KYDA 3PUSA 4MFIA 4LMLA 4AQFC 2CA5A 1N3WA 2D0UA 1LLSA 2XXYA 3PJAA 4EOZB 3UORA 1K9YA 2A72A 2O69A 3OYZA 3B13A 2L9QA 3AEEA 4QFOA 1NENA 1XNQT 4FJPA 2L3LA 1IMBA 3LK2B 4U7IA 4A56A 3EHSA 1US4A 2XXVA 3PGFA 3EKIA 1NUXA 1N3XA 5LGNB 3W9WA 1OWAA 4AKGA 1Y64B 1MNDA 4ZI7E 1FTAA 5AQUB 3FV1A 3T1YT 5JDGA 3U92A 1IXCA 3OO8A 3FJGA 2LSGA 5JRCB 2W7YA 4XKQA 2XM1A 3E3KA 2QRXA 1Y1ZA 3EVYA 2ACXA 2K24A 4JI2T 1SW2A 4X1IE 3FZHB 3OVUA 2PFZA 5LOVE 4EUOA 2UUAT 5LYJE 4HE2A 5KDTA 4G8HA 2XQYA 3WAKA 5L3DB 1H44A 1H7CA 1OVBA 1R9LA 1A55A 2HXRA 3O6HA 4NF4B 3TCHA 3MVYA 4PFBA 4X9TA 5I58A 1WCRA 3UGWA 4PAKA 5HXCA 4NX1A 3ABVA 3K6VA 1SW4A 4YKJA 4EF2A 3AAEB 4U4SA 5DT6A 2YPNA 3FVNA 1UX4A 3HCQA 1G0IA 3WI3A 5ET6A 3HV1A 2X0LB 3GN5B 4H6DA 2ONSA 5ITPA 4JV5T 3U65A 3FZFB 5H8FB 3MPLA 5ICTA 1YW0A 4KQPA 3W15B 5IYZE 4DR3T 4MALA 4HN9A 2WDQA 2OX3A 4YMAA 1RDYA 3UQ7A 2XSBA 3CR9A 3CX7B 4HEAA 3CWZB 3ECRA 1Y9UA 2KR0A 4U3CA 3VKGA 4GK0E 2PJQA 1WODA 2YEVC 3IOTA 2XXPA 3LK42 2X9HA 3H6WA 3GBAA 2NW7A 3AE6A 2PT2A 4LUBA 3A3CA 1YTVA 3RGLA 1O7TA 4UF0A 3VXBA 2RPAA 4UA8A 2I59A 4OHNA 3LDQB 1X9BA 3GBBA 4DIGA 2WU5A 4X20E 5KDMC 3IB1A 4ZI3C 4QFPA 5EQAA 2CWYA 5L3GB 2PCRA 3KZGA 1YKEB 4XTCQ 4JI4T 3B7DA 3RPLA 4LQ5A 5JR9C 2R71A 4LMKA 3ZMUB 2M6BA 3PUWE 1TWYA 3N9MA 4IE7A 5ITOA 4POXA 5FVLA 5LXTE 2ESNA 1S94A 4DI3D 3MSTA 3GMIA 4MNCA 3N6UA 2ODUA 5HCJA 1MRPA 3HL6A 4N8YA 4HCYA 1IZNB 2EHOC 3IJXB 4TV9E 3UU8A 4YB6A 4UV9B 4ZHQE 5EQ8A 2ZNTA 5C8YE 2Q8JA 4WZXA 5JDHA 2XD3A 5JDLA 3RPUA 3OXNA 4XZCA 2I0CA 3RF1A 4UACA 2O1LA 5KDTB 4JVIA 3AEAA 2VVNA 2E9XD 2O1MA 3OTOT 4IGTA 2QS1A 1URDA 4DR6T 3FVOA 3K00A 3LSFB 3RYFE 1JEVA 2E1SA 4U2RA 4TUYE 1MIWA 5AA3A 4IDZA 5IZ3A 2FBWA 4HE0A 2XPKA 1FEWA 5DVJA 4DXBA 2OJTA 3QMFA 3S2VA 1ATGA 5FY0A 4GIWA 5HXRA 2UXCT 4ELQA 2ZZWA 1NV2A 2JMKA 2LT3A 2WU2A 3FVKA 4G8NA 3TAJA 1WLXA 2A5TB 5LOMA 4GBVA 2GQ1A 2ZYMA 4TNVA 5IAIA 3M3FA 4X1KE 4EYYR 3UU6A 3VLUA 1OEDA 5TU0A 1FRPA 3CX6B 5CMKA 2Z8EA 2ZM8A 1SW5A 2CMOA 4U2YA 2DXYA 3N26A 2OCUA 3PMVA 2XJ7A 3VRBA 5H8HA 5M4YA 4FI5A 3EI0A 4U31A 2LM2A 1NMUA 4YICA 3N94A 5DW8A 3TCFA 1FQCA 1IIWA 3O29A 4O4LE 3UFEA 4A97A 1NH7A 3C50A 2W00A 2YLNA 3ZMVB 4U7YA 1BIYA 1SUMB 1US7B 2VURA 4IREA 5AQKB 3S9NC 3HA4A 1NV1A 1NWMX 4X5TA 1FPEA 2GH9A 4ZECA 4F2OA 3T66A 1B5HA 2Y48B 1QLBA 1QKAA 5C3JA 4DR1T 1XMOT 4NF5A 2Q74A 1P1NA 1I6AA 1MIYA 3K3QC 4YKPA 1MXZA 1S35A 4MLVA 3PE0A 1QUUA 3OD7A 2Y7RA 4K0KT 4NXMT 4JUYA 2DI4A 4RXLA 2DS9A 2BG9B 5FMNA 2V7KA 2VL0A 4YT0A 1LFIA 2DSFA 3ZSSA 1ZEEA 3KVBA 5HAXA 5FNVE 4NMYA 1LVFA 4LF4T 3MVWA 4RK2A 3QIMA 4AXPA 4GKKT 1NI9A 4YSZA 3PD9A 2HPJA 4P8BA 2X9YA 1HSLA 2E5VA 1HG5A 4R74A 4PGPA 4U22A 1RYOA 3MZBA 4TWFA 1P1QA 3DP8A 3IL1B 3SFEA 2GK9A 3CQGB 5FY1A 2XTLA 4TWDA 4XAXB 4YLHA 2MKZA 4RPNA 3U8QA 2KSRA 3HI2A 3RIUC 2YJPA 4IO3A 1EH3A 1B7ZA 3KSJA 3BQLA 4NUVA 4IGRA 5EYHA 4HE8A 3FBLA 2P9BA 3H6VA 4B3RT 3KGCA 3N5LA 4KYSA 5CFBA 4TV8E 2QYWA 2WM9A 4K0UA 1HSEA 3KC1A 1WR6A 5LTCA 3UULA 4ISUA 2NW9A 3RNNA 1OEDB 3PPNA 4X1DA 4IDQA 4NF6A 1D4NA 3HHGA 2CZHA 2UYEA 1FTOA 5FXXA 5A1LA 2MAWA 1HG2A 5HEJA 4ZXLA 1N0TA 5CA1E 4JLEA 1MY0A 4YJ2E 3MJNA 4FIMA 4TNWA 4OFJA 1MDQA 2V5DA 5H8HB 3UUMA 2DE2A 3TLWA 4MAGA 3ZN1B 2QVUA 2LE8A 3SWHA 3ZMTB 4ZZBA 1UIUA 2E9XB 1UTHA 4TOZA 2DQVA 2NWBA 2AYSA 2Q9QA 2XAJB 4CXXA 3PUYE 1NUWA 4KI0E 3RRWA 2KLFA 1WVJA 5CB4E 4UR9A 4HW8A 4X04A 2ZM2A 4DCYA 3NRXA 4R9GA 1HTJF 2P3NA 1JW4A 2WQYA 2RA1A 1W0BA 3C32A 4NF5B 1E2AA 3QAXA 1VE4A 3O6IA 2WBLA 4JI5T 2V25A 1Q35A 2WWVA 4OVRA 1WFDA 2HN2A 1BR2A 3IBPA 1L5TA 4ILAA 4Z7EA 2LLYA 3MPKA 3HKEE 3TFLA 2X9XA 2ZYNA 3VR8A 4DI4B 2FIXA 3LBXA 1M5EA 4YKIA 2PYYA 2Z6EA 3D0TA 1IMCA 4E7ZA 3H6UA 4NG7A 1I94T 3UIFA 3T8OA 2L8KA 3T96B 3RTFB 3G06A 3ISPA 3VRAA 5FP3A 4JYAT 3U78A 3ZSTA 3IAZA 2WYPA 3G3HA 3P7IA 4GOTA 3S4UA 1ZIUA 1IAPA 1D9YA 4DBRA 3UUBA 4P1LA 2VK9A 1ELJA 3UU3A 2V3UA 3FBZA 4ZE8A 1YPNA 3PUXF 5H8QB 3U94A 4ELOA 2LKHA 3CSBA 4IL9A 1B7UA 3RRCA 3AA6B 5JREA 3CI8A 1DPEA 1LAGE 4JVDA 3AXJA 4YAHX 2YOEA 5HXSA 1NKXA 2O84X 3OO7A 1N76A 4GBWA 2VPNA 3CSGA 3AEDA 4O4HE 3A3UA 3SERA 3MZ1A 5F5WA 4JDFA 4C91A 4E7SA 1EYIA 2X9WA 5F1QA 4N15A 4IY6A 5AQOB 3ZS6A 1YKHB 2SPCA 4I50E 4I40A 3C36A 4PFRA 3O28A 4NF6B 4FAJA 2OWTA 2VHAA 5TP9A 2V3QA 3THIA 1OIBA 1ZTYA 4ELPA 4LF6T 4WW0A 5BMVE 4X66T 1NH8A 2PBIA 2W62A 1SE7A 2UVGA 4NEDA 3O1IA 4CN4A 3V8XB 4GFRA 5AA1A 3A5XA 3OKQA 2QS2A 2X7PA 2OBGA 4DNDA 4WKMA 2B3FA 3SDFA 4FJOA 1UTHB 5L4EA 1QGXA 4H9NC 3N2GE 3ILTB 3KOTA 2IDOB 3PTRB 2VD2A 2Q9QB 4Q25A 4XKRA 2JJKA 2I49A 4Q5TA 2F7AA 4O2BE 4DMWA 2X0HA 4AISA 2A3DA 4BDNA 5HEHA 4U23A 3SEUA 4UELA 1IMAA 1VR5A 1R6ZA 4N07A 3F2EA 3T9UA 1IXIA 3E79A 5EK2A 2NWJA 3OOAA 3FHNA 5EK3A 3RIAA 3KC0A 4U4XA 3JYRA 4OVJA 4OEVA 3W15C 4R9FA 2Y7PA 2IA4A 3CVRA 4HE1A 3KFWX 5A5LA 1NFTA 2HFBA 4PFIA 4IHJE 2K5BB 2ZYKA 2FJBA 4UIGA 4DV0T 2FA7A 3VXCA 3S9MC 3LBXB 3L6GA 1PC3A 4U21A 3FZKB 4PE3A 1DBZA 3L39A 4R75A 4MNPA 4X8RA 3J9X1 3EDUA 4QXCB 4PFWA 4KI0F 1SW1A 5L3BB 3IO6A 3KEIA 2WCAA 4JBZA 4OHFA 2D2SA 3AECA 1XDPA 4IT4A 1HNZT 2DYXA 4ZZCA 4DV6T 3KVAA 3TCGA 4DR5T 2V7IA 3IJOB 3IX1A 3BK9A 2DWKA 2PT1A 1UUSA 2YINA 4EYUA 1N32T 1FTLA 3MACA 2KWHA 2V5CA 4PFTA 3RYIE 4BA9A 4OTEA 1O3XA 4F6RC 4ZI2C 3QOFA 2CZIA 3AE8A 1NEKA 1FTMA 4H9PC 3I9WA 4IR8A 1BR1A 1B5IA 5ABEA 2YU2A 5HEOA 1FBPA 4DUZT 2ZYOA 5DVFA 4KPTA 1W0AA 2NXOA 3H06B 5L9MA 5KZTA 2ALUA 1N84A 2V26A 3N9LA 5I2NA 4LATA 1MM6A 4F1VA 4HFHA 1BR0A 3JAEA 5JH7E 5TP9B 4N17A 4JWXA 3U93A 1NV5A 5H6RB 3E9XA 2VWAA 4GD5A 1FJ9A 3SETA 5HBCA 2K3WA 2KMFA 3A09A 1USYE 2B3BA 4OWDA 4F2QA 5AQHB 3IFAA 3KOSA 2B4LA 1Q9DA 2Q9TA 1LBXA 1KZ8A 2CHNA 1OQHA 4P0BA 4NE4A 4J2CA 4WNKA 2VT5A 4C90A 4U2ZA 3MZ9A 1IZ1A 1HF8A 1XOCA 3ZYMA 2H98A 1LEVA 1IXHA 2UUCT 3SFDA 4G68B 3I6VA 3PV0E 3A7MA 3IOWA 1WYCA 4LFBT 1YQ3A 4N91A 4WYVA 3SS1A 3MXZA 2HCAA 5FHMA 1NUYA 2V4CA 4KBMB 5J0ZA 3NZPA 5KCJA 5LGTB 1JNZA 4MJOA 4ESXA 1VRBA 2XZEA 1FBDA 4JBWF 5LA6E 1I6ZA 2WEFA 4MHCA 2X51A 4ZEIA 2V8SV 4QFLA 2X0YA 3AE3A 4NXNT 2XAQB 1I6QA 1HX8A 3QYTA 5HCMA 1JW1A 3C9HA 5T3JA 3C33A 5ET7A 2DNXA 2ZXTA 4U72A 4IO4A 4JVCA 5J1GA 4G2AA 5JK4A 2RC7A 3TZAA 1HX1B 4GWOA 5LNKA 2BS4A 2NR4A 2KLQA 4NWDA 1SYHA 4Z91A 3TYHA 5FXZA 2DWJA 4HWHA 3KN8A 5CRYA 2XAGB 2F7BA 4IE4A 4G2ZA 4H0WA 4EXLA 4UABA 3FXDB 3FXQA 2XD2A 2RCBA 4TLMB 3RI5A 1LCTA 5F7VA 2OK2A 3DP4A 3V5SA 1G8XA 1X79A 3RYDA 5AQLB 1A54A 2XXKA 1NV4A 2LEHA 4ZS3A 2W4XA 1KK7A 2XAHB 2BG9C 3QSLA 2K9AA 2I6EA 2WMNA 3M3LA 3AXFA 4JI6T 2Y5LA 1AL3A 1KF6A 4JEUB 4ZEYA 1GV8A 4AB6A 1N36T 2ANJA 4GK5E 3HR0A 2B4MA 1FBFA 1B05A 4H9OC 4RYAA 1B6HA 5LBMA 1WDNA 3GYYA 1IMEA 4P56A 1V9DA 2WYKA 3S9EA 2XY8B 4BAYB 4NAPA 4OESA 2WY2A 3T9HB 5F8PA 3PUZE 3BFUA 2C0SA 3RQUA 3CIRA 1LBWA 5I2KA 4XKNA 2ZM0A 1B46A 5JDNA 4ZZEA 5ICQA 2R6GF 1Z0PA 5F24A 3EHUA 1NV6A 3HPIA 2OA5A 2P1SA 3CG1A 4LQ2A 2UVHA 4H5FA 2G93A 4XXUA 3EPEA 3ZYLA 2HPLA 4B3ST 5FHOA 3K4UA 1U4QA 3TLTA 5ETWA 1GGGA 3T93B 5KCJB 2A9UA 1B1HA 2CEXA 2DE3A 3LG7A 2VP1A 4PJMA 4H9RC 4POWA 4RA1A 3UN6A 1LAFE 2BJJX 2F36A 5AA2A 4GL8A 3VE1B 3IO4A 5IHYA 2I4BA 1B7HA 3RT8A 4H65A 4GVOA 4YB5A 3C98B 1YCJA 2I3VA 2WSSV 3K3OA 3P50A 2WX9A 1LVKA 3AA1B 3IB2A 3ZJ2A 3LFMA 3I0OA 3AB3B 4WBNE 1MS7A 3ZN0B 2Y84A 2E9XC 3ZYKA 4K3FA 4IDNA 2O51A 4F1YA 3K6WA 2XXQA 4YMBA 5AE4A 3LSWA 1AH5A 1LAXA 2LKGA 4YTNA 2XQ8A 3BFTA 1M62A 4Z90A 2CLYB 2Q89A 3UTKA 1P1WA 1FQBA 3QB5K 5KX5E 5L47A 4PK6A 4OX9T 3NWIA 5FYMA 3FV2A 4RPOA 2WAUA 4HWCA 2QL3A 2CXLA 4AQFA 4F31B 2UVIA 3TTMA 4DV2T 3S9LC 2HXWA 4Q0CA 4GRKA 3LSVA 1A99A 4MHFA 1MDP1 4O7MA 5KXJA 1R9QA 4IO7A 1ZU0A 4U1OA 3SKPA 1Y3PA 2UXBT 2IHR1 4OXVA 3NBXX 2I0BA 3M8UA 1WRDA 1QULA 2PX1A 1FPJA 5L4HA 4MLQA 1MNEA 2YKSA 3TTRA 1IUDA 3SRZA 5DVIA 1DK4A 1Y3NA 4LF7T 4ZDMA 2GFEA 4MLKA 3KBTA 1IJ5A 4NWCA 2W61A 3RKOA 3C4XA 4AS4A 3LJCA 1EYKA 2CXDA 5I58B 1YXRA 5J2TE 2PFYA 3PPQA 2Q2AA 4HTGA 5I3SA 4V1Av 1UIVA 2FIEA 3IOVA 3TLVA 3E0ZA 2C5JA 4TLLB 3JZJA 2WMOA 1PBPA 2JMHA 3DLNA 1EYJA 1FPGA 2OZZA 4XKPA 4AS5A 3EDVA 4MMPA 2C5IT 2CEAA 3ETVA 3GLBA 4H1XA 4ISSA 2IAKA 1QUIA 3CRBA 4GWYA 1YQ4A 3VHLA 3KN3A 1HNWT 4O3CA 4GWUA 1FMWA 3TLSA 1XNRT 2F5XA 4IL4A 3H3MA 1MXVA 4KCCA 3B5MA 3CQCB 1LB9A 3MVZA 3MBPA 4ZOLE 1FW0A 1MY4A 2NTYA 3AE2A 3K1NA 3LUYA 5LDZA 3M65A 2XXUA 3QUFA 3LK3B 1Y4CA 3ZSFA 3CMLA 2H25A 2LSJA 4HFCA 4UF0B 3TTNA 5DYHA 2CBJA 2UXAA 5LMUT 2QMWA 3TKLB 4PAIA 3B8BA 2D21A 4PAGA 4ADZA 4QFNA 5FTIA 2BZBA 3MYUA 4ESWA 4X1YE 3NRYA 2FJEA 2CEYA 3BKIB 4OVQA 2DLRA 3RPLB 5AQQB 3GXAA 3CPZA 4QSDA 2ZLYA 3ETUA 2ZNUA 2BKPA 5L2LA 3UUXB 1Y4TA 2F34A 4ONYA 5J1DA 1QVSA 2XQ5A 2G0UA 2IUBA 1JEUA 5IZZA 2JQHA 3SEXA 3KSXA 5FBPA 5JR9A 2BKOA 2X26A 3KDSE 3I1AA 2BBHA 1HSJA 1RDXA 2H5YA 4KR5A 2Q88A 3TMGA 1OLAA 5EYGA 2ZNSA 4JI0T 2ONKE 2XWVA 2YDRA 1NV7A 4BDMA 4GQOA 1POTA 1YXIA 3N9QA 4DVDA 1S7YA 2A5SA 2M6IA 3FZMB 2EHOA 5JEIA 4GWZA 3BIGA 3VVFA 1JETA 2W67A 3PUWF 4P0AA 3HHFA 4X62T 5LG4A 1GTKA 2NOOA 3MC2A 4JI1T 1B51A 4ZS2A 2Q9QD 2KXPB 1VOMA 4AKRB 5IZ3B 4DV4T 2PVUA 1MPDA 1DU2A 3DP6A 1ZBMA 1KEYA 4QXBB 1SHZC 3H3AA 3J7Yq 4ND9A 3OENA 5HM4B 2R9JA 5HEUA 1W9RA 2J47A 1SVXB 1QKBA 4X48A 3QK6A 1POY1 3U3IA 2OWZA 3MZKB 3USDA 1FMVA 2M8CA 3FXRA 3TQLA 1P1UA 4EDPA 4LONB 1MQDA 4BDRA 1HR0T 5LP6E 3TTKA 1EU8A 4H8JA 3E13X 4JI3T 2DHRA 1B9JA 3RN8A 4H63V 2X7QA 4YXDA 3PU8A 3ZC0A 1ZLQA 4N6DA 4MBQA 1MY1A 4HGAA 4MCOA 3FJMA 3QNUA 1ZKBA 4BDOA 4GYRA 3ODBA 1ZMGA 5I57A 2WP9A 4CXYA 5DEXA 3MVXA 5J16A 3OJAA 1PB7A 4YJ3E 1B32A 2QA7A 1N33T 5I5PA 3ZCIA 4O7IA 4DR7T 4PJNA 2REJA 5JDFA 3LBSA 2VVSA 4JWOA 3C4ZA 5LBQB 5IWAT 2HQ0A 5L9SA 3Q25A 2X67A 3FXUA 2Y7IA 1NNFA 3NZQA 1LBCA 4GXAA 5JDMA 5K2YA 3KBZA 3KFMA 3SEYA 1II5A 1SD3A 2PMSA 3O66A 4G68C 4DE8A 4MEVA 5JR9B 1FBEA 2XHDA 3AEFA 5FXVA 1SYIA 3O9XA 5I7IA 1D0XA 4C0RA 3JADA 4PK4A 3KV6A 4KHZE 4BDLA 4N6PA 3ZMSB 1FBGA 4P0IA 2Y5KA 5BR8T 1YYZA 4NUUA 3L3PA 4ZE9A 2YU1A 2FYIA 4E0WA 5TAOA 5FY7A 3R6NA 1H43A 4Q30B 2EHOB 2NP9A 3G7WA 1QW0A 4IY5A 2XXIA 2N9DA 4QXDA 2QVAA 4QSCA 5TPAA 5FHNA 1XI6A 4I0UA 2V7LA 2AL5A 4G8MA 4EQ7A 4GXSB 2FJDA 4WEPA 1B1XA 3TODA 1MXXA 4NF8A 3LSXA 5CJ5A 1M5FA 3OSQA 2VKJA 1XZYA 2G29A 3FZVA 3WAEA 4F1UA 4ANJA 2QVVA 3EUHA 4DO0A 5ABGA 1L0VA 1CNQA 3ANWA 1MM7A 1Y01A 5JTYA 1T0KA 3VV5A 4H9QC 4U74A 4I9DA 1XC1A 5FXWA 1MMDA 4PFOA 4FORA 3PDYA 3OO9A 3O4XE 4FEDA 4Z8XA 3U72A 3UQ4A 2RP4A 3IK6B 2JJ9A 2XQAA 3V5UA 3K3NA 4TN7B 1BP5A 4PTKA 5I84A 3Q5XA 4YTMA 4FE8A 5AQRB 3TKDA 4CN1A 2A2FX 2HAUA 4L17A 1I6BA 5IGAA 4PAFA 4ZEDA 2H89A 1S50A 3O1HA 2XUEA 1M5DA 2IMLA 1FTKA 1LSTA 2D3IA 3SESA 4E0XA 3C64A 1B0HA 1D9VA 4N6KA 1UX5A 2CRBA 5ADXL 5L3CB 4Z0IA 1XWMA 1FCKA 2B65A 3OO6A 1QJMA 1LAHE 5ET5A 1GVCA 3C31A 4OERA 5J2UE 2F35A 2DE4A 2QRYA 3RQTA 1T8BA 1FQAA 1KFYA 3ZJ1A 4AQGA 3O2AA 4GX3A 2VQFT 3A29A 5HPQA 3L09A 1MIVA 4EZHA 4I3YA 4F22A 3IF8B 1YAEA 2XHEB 2YN6A 5EQ7A 3AE9A 3IOUA 4GYSA 3FGSA 3C4MA 2QPQA 1H76A 3V83A 3OEMA 1VDWA 5FTHA 5A5XA 5AQFB 2ZMAA 5L3EB 1F9BA 3N6TA 5HXHA 4LF5T 2F3DA 3E4RA 3Q28A 4P47A 2CZLA 4JSDA 3K02A 2KINB 4A98A 3C51A 2HHHT 1B3GA 4DCXA 2LOPA 3PUYF 1Y1MA 3EN3A 3V89B 3H6TA 1XVXA 4ISTA 2ZMBA 1N04A 1VFEA 2XQ7A 2XASB 1FQFA 4KX6A 1ZKEA 3JCFA 3SZPA 4QX7B 4A5XA 3M3KA 3DELB 5TPAB 3H3GA 4IB2A 4DXCA 4HFVA 1FQDA 2FNCA 3PD8A 1AIVA 4AI6A 1EZPA 3T9VA 4AKLA 4NF8B 3PUVE 3NOHA 2BBJA 1B2HA 5I56A 3RKGA 4LZ5A 1KNRA 4DDDA 1A8FA 2BKNA 4P3LA 2H9BA 4IGUA 3AXJB 3PUGA 3BQKA 3VLVA 1FJGT 1VCTA 1IXGA 3RGYA 3AA7B 2I0MA 1UGOA 2QS3A 2B1EA 4MNIA 2PTFA 1LKXA 3A8YC 2F6GA 3KJ7A 4M1PA 4UVCB 3VR9A 5ISUA 1ZJLA 5EK4A 2IW5B 1BK4A 3ZEFB 2E8IA 3D1RA 2VOZA 4P0GA 3IB0A 2O7IA 1FPKA 3QUJA 4UXNB 2WBBA 1KA1A 2GHBA 3PU5A 5HYAA 5EHSA 4AQ4A 4THIA 4QRZA 3MUQA 5CMCA 3UUNA 3B6QA 3G3IA 1ZHCA 4HCWA 5JRCA 3MKDA 5CA0E 2YDSA 4YSXA 2FUPA 2AIXA 3ZCJA 3KG2A 3RH3A 2HH7A 3DM0A 3RYHE 2C5KT 2WZHA 2F6PA 1OMPA 2GHAA 2RCAA 5ABFA 4ASKA 1M7KA 3CKDA 4OYKA 1URSA 4KD5A 3FUZA 5HXEA 3X1DA 1BLFA 2BDEA 3PURA 4HXVA 5AQMB 1XMQT 4NF4A 2AE9A 1B7TA 2DCFA 1ANFA 3VVDA 3KJTA 2J1DG 5L8DA 1JQFA 3GA8A 4CN6A 2JQQA 3ONXA 3ONJA 2MOZA 1G0HA 2IC9A 4JI7T 3GN5A 3C34A 3TQWA 4BLAA 5FKYA 3RIFA 2I6HA 1P99A 5A5XB 1SPIA 4OANA 3FASA 3IR1A 4B6XA 4H63H 2XX9A 4PQJA 3DJBA 1B40A 3P4PA 4YY3T 3I5OA 4EAHA 4PNIA 3ZKKA 1NV0A 3SEWA 1D1CA 2R8TA 1B3FA 3JC6D 4IO5A 4P11A 3OMBA 3T1BA 3I0QA 1MPBA 2F97A 3RLFE 4DV7T 2QGSA 4HFIA 3LUZA 3T22A 1SI1A 2P0SA 2F8DA 3P4QA 4QWNB 4ZZAA 2XX7A 2LAOA 2J4GA 4QHQA 4TZ4C 1LBYA 3FATA 3VVEA 4PCDA 2ONRA 1BTJA 1R8IA 4L5GA 2NTXA 4DUYT 4LFCT 2KQZA 4GWSA 1BR4A 4I8CA 3KV4A 4GL0A 3N9PA 2F7CA 4GX6A 3ZT7A 3UU5A 3BQIA 3VLWA 2RC8A 4FBPA 4N81A 3G3KA 5IM2A 3AA0B 4MFRA 5JDQA 1D3KA 1DSNA 4F8HA 4I62A 3UK4A 3O97A 2CCQA 1N7XA 5I2NB 2N2NA 2CZKA 3K2DA 2H99A 3OYXA 4DMVA 5AA2D 4XBFB 3UFGA 4QF9A 2BJIA 1MXUA 4HWIB 1T98A 4O2AE 3RY3A 5H6QB 4KHPT 1JVXA 1NNTA 1Z7ME 3WAJA 1QUJA 1CHUA 2HN1A 3PUVF 2D0TA 4IO6A 3EHZA 1VFDA 2XXTA 3T9XB 3AE7A 4F3GA 4PGNA 4OETA 2ABHA 4DXUA 3CG3A 3HN0A 5ABFB 4OENA 1E7PA 4UVAB 5I59A 1R1NA 3EHTA 1WYBA 4RK9A 1EZ9A 3MAMA 4LF9T 4PDDA 4NHBA 3B6WA 2XQ4A 2Y7KA 5CMMA 1VSOA 3H03A 3TELA 1MXYA 3ZT6A 4H67A 3BIHA 5KMGP 4TX5A 2CPTA 3ONMA 1KNZA 4G61A 4MIJA 5FVKA 5HWXA 4N13A 3HKDE 3IA3A 1OEDC 4QX8B 4RJZA 4PFPA 2DDKA 5EZYE 3ONLC 2VKDA 1KNPA 2A5TA 5LGUB 2NW8A 3AE5A 2WDVA 3CIJA 5HWYA 4PDHA 1B0LA 2O7UA 1IJ6A 3P8CD 1A40A 3RC3A 4WBOA 4F3PA 3AAIA 3JAFA 4QHOA 1OLCA 2LHNA 3HKCE 4B3MT 3R84B 2QFLA 3O6GA 2XXXA 2CMRA 2PFVA 4NPPA 4NTLA 2XXHA 1IEJA 5DQWA 2V93A 3PV0F 4ZS9A 1FPLA 1RYXA 1IMDA 4YB7A 4EXTA 2QSXA 5ET8A 3FXBA 4DZ1A 2I3WA 5AA4A 1J5ET 1N7WA 2ZZXA 5JVDE 5ESYA 4NN3A 2KT9A 4IE6A 1UURA 1DTGA 1FIOA 4I1DA 4ILCA 3K6UA 3PUQA 3P4WA 1H45A 2RINA 4PBHA 2V84A 2BS2A 4F18A 3DTOA 4YHJA 1UK5A 2KWIB 1QUKA 3RLFF 1G73A 2DOJA 1MY2A 4UEMA 4OYVA 2J62A 4HKAA 1BKAA 3HSTA 1J1JA 3G3GA 1O64A 2BG9A 2VPOA 2XWIA 1DMBA 2QMXA 4JWYA 2YK0A 1M5BA 2OWSA 3PMWA 1MQGA 3CX8B 4O3AA 2FJAA 4F3BA 1PB8A 3CQXC 2DWGA 1N34T 1NV3A 2BVLA 4XFEA 3GZGA 1NNPA 2I48A 4IE0A 5AQVB 1FTJA 5I2KB 2Q2CA 2WS3A 4F29A 4WXJA 2HZKA 3K1SA 1XVYA 4GX4A 3C4WA 4PF6A 2XQ9A 4L0RA 5I59B 2UUBT 3E22E 2V6YA 4ZI3D 2OLBA 3HO7A 2FVZA 2DWIA 3Q5DA 4OFLA 4UV8B 4H46A 2JRKA 3N9OA 3LSLA 5H8SA 1SDXA 2V7MA 3MWBA 4NF0A 3N9NA 2VB6A 4KUMB 4OFOA 3UA8A 5AA2B 1JVYA 2XXRA 4EV6A 1P1OA 1MMGA 2CBIA 5AQPB 3PUZF 2DVZA 4BJMA 2EHOD 3CHGA 4P1EA 4H5GA 2VKOA 1CB6A 2LRLA 4OVTA 4EQ9A 2HEUA 4GLIA 1FBHA 1USYH 1QSDA 4I55E 3AEGA 3JV9A 3RT6B 3IHRA 4X1BA 3DP7A 4DBQA 4RNSA 4RY1A 3OSRA 3E78A 2Q9QC 3ZT5A 4YHHT 3TEPA 2HPGA 2VKHA 4L9IA 3PMXA 4P9KA 5AQGB 3K01A 2AXDS 2E9XA 4DIDB 1J1NA 4DV5T 3ZKLA 5AA4B 5DTBA 3MP1A 3CK6A 1HS7A 3RHWA 4IO2A 3MA9A 4HFBA 4PJJA 1NNKA 3O9PA 5C2TA 3Q26A 4C1UA 1T7SA 4EIWA 1MQJA 4WEDA 1JW5A 1TFAA 3RTWB 4DR4T 1AJ3A 4HS7A 1O63A 3D4GA 2LM9A 2REGA 3Q2MA 2MYSA 2DWAA 4Q8RA 4B3TT 3LV0A 5FL1A 3PUXE 4ILBA 3Q5EA 3TDJA 2H7OA 4PFUA 5M2VA 3F31A 4OK0A 1SI0A 1RKMA 3MP8A 4P1NA 1JP4A 1B52A 1LBBA 1K9ZA 2RKMA 5BWJA 2NOXA 2Z8FA 1CE2A 5B7DA 2CE7A 1S9TA 4IDPA 3KV9A 1CUNA 4H9SE 5L3FB 4GKJT 3ZMZB 4KMCA 3GWHA 4G77A 4AQYT 2Q8MA 3N2OA 4PK5A 4EXKA 3F11A 2CXFA 4PW8A 2CWOA 1MH3A 2HHMA 1RDZA 5LG3A 2LRKA 1J5WA 5LHIB 2LSYA 2W2UA 3QB5A 4I3EA 1GR2A 2V6YB 3B6TA 3K8PC 3K1PA 3C35A 4BJNA 5H8QA 3L8RA 2ZM6T 2UXDT 3PTYA 4KFQA 5CMBA 1TFDA 4KP3C 1US5A 1EZOA 1WR0A 4CI2B 3TUSA 3RQWA 2NUVA 3B57A 4OVPA 2P2AA 2LHRA 4GOUA 3VU7H 1UQWA 3AE4A 3ZKRA 1ZP0A 4IE5A 4QSEA 4N78D 5E0OA 2XA5A 3MW0A 5IUXA 1AWBA 2X66A 3F57A 5ABHA 1FBCA 2HZLA 4FATA 5DQVA 5CBSA 1NUZA 3ZLIA 1NL5A 4ILUA 2VL8A 1UCUA 3MK7C 2DL1A 5EQ9A 2Z23A 1TXFA
chains in the Genus database with same CATH topology
1B4HA 2WKYA 5CM6A 2XX8A 3RUMA 1LFHA 1D0ZA 1MMNA 4YZZA 5EYFA 2V3TA 3QXMA 4PP0A 4EQBA 4R2FA 3H37A 2RF1A 4PETA 3RYCE 1Z7NE 4OFZA 4EF1A 5H8NA 2UVJA 4MF3A 3KINB 4R6YA 4TQUQ 1KWHA 2QJEA 2RC9A 4XIGQ 3N2KE 2D5WA 4F19A 3CVGA 5LHGB 3KV5A 3LC8A 2AL4A 3RX6A 1IITA 4AKHA 5ELVA 3IEEA 5EHMA 3FD3A 5JQGE 3FB2A 3VFJA 1PEBA 1Q1KA 4U1ZA 3TPAA 1B3EA 2LSIA 3MP6A 2UXNB 3L6HA 4OYJA 2Y7WA 3PU3A 1MMAA 1PDAA 4R6HA 2Y8DA 4R6KA 4LP2B 1I69A 1MY3A 3Q9DA 1DTZA 3Q29A 3SEVA 4PE5B 3CFZA 2ODVA 4QXHB 2DXRA 2GRVA 1MXWA 3W9VA 3PUAA 2O6AA 3RPWA 4KCDA 3I3VA 4CXWA 4CI3B 2H7VC 5LJMA 4FECA 4UVBB 3FJ7A 1DOTA 1E1HB 3FVGA 4AKIA 2DP8A 4JXIA 2VGQA 4IIJE 2BVMA 1A7LA 3TTLA 4PJLA 5DABA 3PPPA 3KBRA 4OMBA 4C1TA 5DJQC 2MBGA 2NVUB 4P09A 5CBRA 4PFYA 3EF7A 5I57B 4KYEA 2H4IA 3U1OA 3WAFA 1PBQA 3ESLA 5DEXB 4YFSA 2K48A 1B58A 3K1MA 2W63A 1JNFA 2DVCA 2UYFA 3H4ZA 2ES0A 1URGA 1B3HA 1M5CA 1LRZA 3FXEB 2M67A 4G4PA 4OZ9A 4LZ8A 1LCFA 2QS4A 4AB5A 4BDQA 2CM0A 2PBWA 5CC2A 5H8NB 4YU0A 5GONE 1UTBA 1ZV4X 1Y3QA 3MJXA 3K0VA 2VD3A 1Y20A 3OELA 3CFLA 4QFKA 4G68A 3ZPOA 1D0YA 1XT8A 4F3SA 1IQ7A 4H8IA 4ZEFA 4JB7A 1XS5A 1MG1A 1OQGA 1AMFA 1OVTA 5BUUA 4CZZB 2KNDA 1SA0E 1XHYA 3O1JA 1SBPA 4M4GA 4I43B 4GF8A 2XAFB 2WWUA 2V1DB 3CFXA 4MBPA 3V5AA 4FEBA 3R7XA 1MQHA 2CLYC 1MQIA 1H3DA 3Q27A 3G3FA 3ANWB 4M1VA 2Z8DA 2VASA 2X68A 3OEKA 5JTYB 2DWHA 4R73A 3OBVE 4CQIA 1LGBC 1D1AA 3D4CA 1MH4A 2LSKA 4ELRA 3PPOA 2F78A 5LCYA 1PB9A 1D1BA 1U5PA 2XXWA 1TT1A 3LR1A 1A8EA 4CI1B 5LHHB 1HCIA 2JPFA 2IC6A 4OEUA 2Y6XA 3VKHA 4LVQA 3RC8A 2LJLA 3R6UA 4EB6E 4JSOA 2R6GE 5K2XA 2I58A 3JC6C 2UXXB 4HTEA 4LZ7A 1B3LA 3FIRA 4YKKA 3AVSA 4LA9A 4JEHB 1SQYA 4I4TE 4F39A 4EZ4A 4O8SA 3G3JA 2KZ7B 3ZC1A 2H3RA 4G63A 2W0GA 2MTQA 3I9YA 2IEEA 3BBRA 1EZ3A 3MQ9A 2O68A 1HFAA 1B4ZA 3VDFA 5IKBA 2LOSA 1B5JA 3IORA 2THIA 2Z22A 4ZEKA 3UT5E 4GIZA 3H7MA 4R2BA 1MPCA 1NAFA 2PG8A 3R26A 5CI5A 2V7JA 3KN7A 4ZI2D 1UTBB 3Q5WA 3SOLA 4QKNA 3UP9A 3AAAB 5H8FA 3K6XA 4ECFA 4ERRA 3KBUA 3ILUB 4R72A 3AVRA 5LJNA 4MH5A 1YD8G 5F3JA 4O4JE 4ZEBA 1FQEA 4O3BA 4OQOA 1OXZA 5B70A 3PPRA 5I56B 5AFUL 1LB8A 3E08A 2HAVA 4O4IE 3QC9A 5L9OA 1LFGA 4DLDA 1DPPA 2I4CA 3HKBE 2E0SA 3EQ1A 2D5UA 1AOVA 2N1GA 4KYDA 3PUSA 4MFIA 4AQFC 2CA5A 1N3WA 2D0UA 1LLSA 2XXYA 4EOZB 3UORA 2A72A 2O69A 3OYZA 3B13A 2L9QA 4QFOA 4FJPA 2L3LA 3PGFA 3LK2B 4A56A 3EHSA 1US4A 2XXVA 1N3XA 5LGNB 3W9WA 1OWAA 4AKGA 1Y64B 1MNDA 4ZI7E 3FV1A 5JDGA 3U92A 1IXCA 3OO8A 3FJGA 2LSGA 5JRCB 2W7YA 4XKQA 3E3KA 1Y1ZA 3EVYA 2ACXA 2K24A 1SW2A 4X1IE 5LOVE 4EUOA 5LYJE 5KDTA 4G8HA 2XQYA 3WAKA 1H44A 1OVBA 5L3DB 1H7CA 1R9LA 1A55A 3O6HA 4NF4B 3TCHA 3MVYA 4X9TA 5I58A 3UGWA 5HXCA 3K6VA 1SW4A 4YKJA 4EF2A 3AAEB 4U4SA 5DT6A 2YPNA 3FVNA 1UX4A 3HCQA 3WI3A 3HV1A 2X0LB 3GN5B 4H6DA 2ONSA 5ITPA 5H8FB 3MPLA 5ICTA 1YW0A 4KQPA 3W15B 5IYZE 4MALA 4HN9A 4YMAA 3CR9A 3CX7B 4HEAA 3CWZB 3ECRA 1Y9UA 3VKGA 4GK0E 2PJQA 1WODA 2YEVC 3IOTA 2XXPA 3LK42 2X9HA 3H6WA 3GBAA 2NW7A 2PT2A 4LUBA 3A3CA 1YTVA 1O7TA 4UF0A 3VXBA 4UA8A 2I59A 4OHNA 3GBBA 4DIGA 4X20E 5KDMC 3IB1A 4ZI3C 4QFPA 2CWYA 5L3GB 3KZGA 1YKEB 4XTCQ 3B7DA 4LQ5A 5JR9C 2R71A 3ZMUB 3PUWE 1TWYA 3N9MA 4IE7A 5ITOA 4POXA 5LXTE 2ESNA 1S94A 3GMIA 3N6UA 2ODUA 1MRPA 3HL6A 4HCYA 1IZNB 2EHOC 3IJXB 4TV9E 4YB6A 4UV9B 4ZHQE 2ZNTA 5C8YE 2Q8JA 5JDHA 2XD3A 5JDLA 3RPUA 3OXNA 4XZCA 2I0CA 4UACA 2O1LA 5KDTB 2E9XD 2O1MA 4IGTA 2QS1A 1URDA 3FVOA 3K00A 3LSFB 3RYFE 1JEVA 2E1SA 4U2RA 4TUYE 1MIWA 5AA3A 4IDZA 1FEWA 5DVJA 4DXBA 2OJTA 3S2VA 1ATGA 5FY0A 4GIWA 5HXRA 4ELQA 2JMKA 2LT3A 3FVKA 4G8NA 3TAJA 1WLXA 2A5TB 5LOMA 2ZYMA 5IAIA 3M3FA 4X1KE 4EYYR 3VLUA 5TU0A 3CX6B 5CMKA 2Z8EA 2ZM8A 1SW5A 2CMOA 2DXYA 3N26A 2OCUA 3PMVA 5H8HA 5M4YA 4FI5A 1NMUA 4YICA 3N94A 3TCFA 1FQCA 1IIWA 3O29A 4O4LE 3UFEA 1NH7A 3C50A 2W00A 2YLNA 3ZMVB 1BIYA 1US7B 3S9NC 3HA4A 1NWMX 2GH9A 4ZECA 4F2OA 3T66A 1B5HA 2Y48B 1QKAA 4NF5A 1P1NA 1I6AA 1MIYA 3K3QC 4YKPA 1MXZA 1S35A 4MLVA 3PE0A 1QUUA 3OD7A 2Y7RA 4JUYA 2DI4A 4RXLA 2DS9A 5FMNA 2V7KA 1LFIA 2DSFA 1ZEEA 3KVBA 5HAXA 5FNVE 4NMYA 1LVFA 3MVWA 4RK2A 3QIMA 4AXPA 3PD9A 2HPJA 2X9YA 1HSLA 4R74A 1HG5A 4U22A 1RYOA 3MZBA 1P1QA 3DP8A 3IL1B 2GK9A 3CQGB 5FY1A 2XTLA 4XAXB 4YLHA 4RPNA 3U8QA 3HI2A 2YJPA 4IO3A 1EH3A 1B7ZA 3KSJA 3BQLA 4NUVA 4IGRA 4HE8A 3FBLA 2P9BA 3H6VA 3KGCA 3N5LA 4KYSA 4TV8E 2WM9A 4K0UA 1HSEA 1WR6A 3UULA 4ISUA 2NW9A 3RNNA 3PPNA 4X1DA 4NF6A 1D4NA 3HHGA 2UYEA 1FTOA 5FXXA 5A1LA 1HG2A 1N0TA 5CA1E 4JLEA 1MY0A 4YJ2E 3MJNA 4FIMA 4OFJA 1MDQA 5H8HB 3UUMA 2DE2A 3ZN1B 2LE8A 3SWHA 3ZMTB 1UIUA 2E9XB 1UTHA 4TOZA 2DQVA 2NWBA 2AYSA 2Q9QA 2XAJB 4CXXA 3PUYE 4KI0E 3RRWA 2KLFA 1WVJA 5CB4E 4HW8A 2ZM2A 4DCYA 3NRXA 4R9GA 1HTJF 1JW4A 2RA1A 3C32A 4NF5B 3QAXA 1VE4A 3O6IA 2WBLA 2V25A 1Q35A 1BR2A 3IBPA 1L5TA 4Z7EA 3MPKA 3HKEE 3TFLA 2X9XA 2ZYNA 3LBXA 1M5EA 4YKIA 2PYYA 2Z6EA 3D0TA 4E7ZA 3H6UA 3UIFA 3T8OA 2L8KA 3T96B 3RTFB 5FP3A 3U78A 3IAZA 3G3HA 3P7IA 4GOTA 3S4UA 1ZIUA 1IAPA 1D9YA 4DBRA 2VK9A 1ELJA 2V3UA 3FBZA 4ZE8A 1YPNA 4ELOA 5H8QB 3U94A 3CSBA 1B7UA 3RRCA 3AA6B 5JREA 3CI8A 1DPEA 1LAGE 4YAHX 1NKXA 5HXSA 2O84X 3OO7A 1N76A 3CSGA 4O4HE 3SERA 3A3UA 3MZ1A 4JDFA 4C91A 4E7SA 2X9WA 5F1QA 3ZS6A 4IY6A 1YKHB 2SPCA 4I50E 3C36A 3O28A 4NF6B 4FAJA 2OWTA 2VHAA 5TP9A 2V3QA 3THIA 1OIBA 1ZTYA 4ELPA 4WW0A 5BMVE 1NH8A 2PBIA 2W62A 2UVGA 4NEDA 3O1IA 3V8XB 4GFRA 5AA1A 3A5XA 3OKQA 2QS2A 2X7PA 2OBGA 4DNDA 4WKMA 2B3FA 3SDFA 4FJOA 1UTHB 4H9NC 3N2GE 3ILTB 3KOTA 3PTRB 2VD2A 2Q9QB 4XKRA 2I49A 4Q5TA 2F7AA 4O2BE 4DMWA 2A3DA 4BDNA 4U23A 3SEUA 4UELA 1VR5A 1R6ZA 4N07A 3F2EA 3T9UA 1IXIA 2NWJA 5EK2A 3OOAA 3FHNA 5EK3A 4U4XA 3JYRA 4OVJA 4OEVA 3W15C 4R9FA 2Y7PA 2IA4A 3CVRA 3KFWX 1NFTA 2HFBA 4IHJE 2K5BB 2ZYKA 2FA7A 4UIGA 3VXCA 3S9MC 3LBXB 3L6GA 1PC3A 4U21A 4R75A 3J9X1 3EDUA 4QXCB 4PFWA 1SW1A 5L3BB 3IO6A 3KEIA 4JBZA 4OHFA 2D2SA 2DYXA 3KVAA 3TCGA 2V7IA 3IJOB 3IX1A 3BK9A 2DWKA 2PT1A 2YINA 4EYUA 1FTLA 3MACA 2KWHA 4PFTA 3RYIE 4BA9A 4OTEA 1O3XA 4F6RC 4ZI2C 1FTMA 4H9PC 3I9WA 1BR1A 1B5IA 2YU2A 2ZYOA 5DVFA 4KPTA 2NXOA 5L9MA 3H06B 5KZTA 2ALUA 1N84A 2V26A 3N9LA 5I2NA 4LATA 1MM6A 4F1VA 1BR0A 5JH7E 5TP9B 4JWXA 3U93A 5H6RB 3E9XA 2VWAA 4GD5A 3SETA 5HBCA 2KMFA 3A09A 1USYE 2B3BA 4OWDA 4F2QA 3KOSA 2Q9TA 1OQHA 4P0BA 4NE4A 4J2CA 4WNKA 4C90A 3MZ9A 1IZ1A 1HF8A 1XOCA 3ZYMA 2H98A 1IXHA 4G68B 3I6VA 3PV0E 3IOWA 1WYCA 3SS1A 3MXZA 2HCAA 5FHMA 4KBMB 3NZPA 5KCJA 5LGTB 4ESXA 1VRBA 5LA6E 4MHCA 2X51A 4ZEIA 4QFLA 2XAQB 1I6QA 1HX8A 3QYTA 1JW1A 3C9HA 3C33A 2DNXA 2ZXTA 4U72A 4IO4A 5J1GA 4G2AA 5JK4A 2RC7A 3TZAA 4GWOA 5LNKA 2KLQA 4NWDA 1SYHA 3TYHA 5FXZA 2DWJA 3KN8A 5CRYA 2XAGB 2F7BA 4IE4A 4G2ZA 4H0WA 4EXLA 3FXDB 3FXQA 2XD2A 2RCBA 4TLMB 1LCTA 5F7VA 2OK2A 3DP4A 3V5SA 1G8XA 1X79A 1A54A 2LEHA 4ZS3A 1KK7A 2XAHB 3QSLA 2K9AA 2I6EA 2WMNA 3M3LA 3AXFA 1AL3A 1GV8A 4JEUB 4AB6A 2ANJA 4GK5E 3HR0A 1B05A 4H9OC 4RYAA 1B6HA 5LBMA 1WDNA 1V9DA 3S9EA 4BAYB 4OESA 3T9HB 5F8PA 3PUZE 3BFUA 2C0SA 5I2KA 4XKNA 2ZM0A 1B46A 5JDNA 4ZZEA 5ICQA 1Z0PA 3EHUA 3HPIA 2OA5A 2P1SA 3CG1A 4LQ2A 2UVHA 4H5FA 2G93A 4XXUA 3EPEA 3ZYLA 2HPLA 5FHOA 3K4UA 1U4QA 5ETWA 1GGGA 3T93B 5KCJB 1B1HA 2DE3A 3LG7A 2VP1A 4PJMA 4H9RC 4POWA 4RA1A 3UN6A 1LAFE 2BJJX 2F36A 5AA2A 4GL8A 3VE1B 3IO4A 5IHYA 2I4BA 1B7HA 3RT8A 4H65A 4GVOA 4YB5A 3C98B 1YCJA 2I3VA 2WSSV 3K3OA 1LVKA 3AA1B 3IB2A 3ZJ2A 3LFMA 3I0OA 3AB3B 4WBNE 1MS7A 3ZN0B 2Y84A 2E9XC 3ZYKA 4K3FA 2O51A 4F1YA 3K6WA 2XXQA 4YMBA 5AE4A 3LSWA 1AH5A 1LAXA 3BFTA 2CLYB 2Q89A 3UTKA 1P1WA 1FQBA 5KX5E 4PK6A 5FYMA 3FV2A 4RPOA 2WAUA 2QL3A 4F31B 2CXLA 4AQFA 2UVIA 3TTMA 3S9LC 2HXWA 4Q0CA 4GRKA 1A99A 1MDP1 1R9QA 4IO7A 1ZU0A 4U1OA 3SKPA 1Y3PA 4OXVA 3NBXX 2I0BA 3M8UA 1WRDA 1QULA 2PX1A 4MLQA 1MNEA 3TTRA 1IUDA 3SRZA 5DVIA 1Y3NA 4ZDMA 2GFEA 4MLKA 3KBTA 1IJ5A 4NWCA 2W61A 3RKOA 3C4XA 3LJCA 2CXDA 5I58B 5J2TE 3PPQA 2Q2AA 4HTGA 4V1Av 1UIVA 3IOVA 3E0ZA 2C5JA 4TLLB 3JZJA 2WMOA 1PBPA 2JMHA 3DLNA 2OZZA 4XKPA 3EDVA 2C5IT 2CEAA 3ETVA 3GLBA 4H1XA 4ISSA 2IAKA 1QUIA 3CRBA 3VHLA 3KN3A 4O3CA 1FMWA 2F5XA 1MXVA 4KCCA 3CQCB 1LB9A 3MVZA 3MBPA 4ZOLE 1FW0A 1MY4A 2NTYA 3K1NA 3LUYA 3M65A 2XXUA 3QUFA 3LK3B 1Y4CA 3ZSFA 3CMLA 2H25A 2LSJA 4UF0B 3TTNA 5DYHA 2UXAA 2QMWA 3TKLB 2D21A 4PAGA 4ADZA 4QFNA 5FTIA 2BZBA 4ESWA 4X1YE 3NRYA 3BKIB 2DLRA 3GXAA 3CPZA 4QSDA 2ZLYA 3ETUA 2ZNUA 5L2LA 3UUXB 1Y4TA 2F34A 4ONYA 5J1DA 1QVSA 2G0UA 1JEUA 3SEXA 3KSXA 5JR9A 2X26A 3KDSE 3I1AA 1HSJA 2H5YA 4KR5A 2Q88A 3TMGA 1OLAA 2ZNSA 2ONKE 4BDMA 4GQOA 1POTA 3N9QA 4DVDA 1S7YA 2A5SA 2EHOA 5JEIA 3VVFA 1JETA 4P0AA 3HHFA 5LG4A 1GTKA 2NOOA 3MC2A 1B51A 4ZS2A 2Q9QD 2KXPB 1VOMA 4AKRB 2PVUA 1MPDA 3DP6A 1ZBMA 4QXBB 1SHZC 3H3AA 3J7Yq 4ND9A 3OENA 5HM4B 2R9JA 1SVXB 1QKBA 4X48A 3QK6A 1POY1 3U3IA 3MZKB 3USDA 1FMVA 2M8CA 3FXRA 3TQLA 1P1UA 4EDPA 4LONB 1MQDA 4BDRA 5LP6E 3TTKA 1EU8A 4H8JA 3E13X 3RN8A 2DHRA 1B9JA 4H63V 2X7QA 3PU8A 3ZC0A 1ZLQA 4MBQA 1MY1A 4HGAA 3FJMA 1ZKBA 4BDOA 4GYRA 3ODBA 1ZMGA 5I57A 4CXYA 5DEXA 3MVXA 3OJAA 1PB7A 4YJ3E 1B32A 2QA7A 3ZCIA 4PJNA 2REJA 5JDFA 3LBSA 4JWOA 3C4ZA 5LBQB 2HQ0A 5L9SA 3Q25A 2X67A 3FXUA 2Y7IA 1NNFA 3NZQA 1LBCA 4GXAA 5JDMA 5K2YA 3KFMA 3SEYA 1II5A 1SD3A 2PMSA 3O66A 4G68C 4DE8A 5JR9B 2XHDA 5FXVA 1SYIA 3O9XA 1D0XA 4C0RA 4PK4A 4KHZE 3KV6A 4BDLA 4N6PA 3ZMSB 4P0IA 4NUUA 3L3PA 4ZE9A 2YU1A 2FYIA 4E0WA 5TAOA 5FY7A 3R6NA 1H43A 4Q30B 2EHOB 2NP9A 3G7WA 1QW0A 4IY5A 2XXIA 2N9DA 4QSCA 5TPAA 5FHNA 2V7LA 2AL5A 4G8MA 4EQ7A 4GXSB 4WEPA 3TODA 1B1XA 1MXXA 4NF8A 3LSXA 1M5FA 3OSQA 2VKJA 2G29A 3FZVA 3WAEA 4F1UA 4ANJA 3EUHA 4DO0A 3ANWA 1MM7A 5JTYA 1T0KA 3VV5A 4H9QC 4U74A 4I9DA 1XC1A 5FXWA 1MMDA 4PFOA 4FORA 3PDYA 3OO9A 3O4XE 4FEDA 4Z8XA 3U72A 2RP4A 3IK6B 2JJ9A 3V5UA 3K3NA 4TN7B 1BP5A 5I84A 3Q5XA 4FE8A 3TKDA 2A2FX 2HAUA 4L17A 1I6BA 4ZEDA 1S50A 3O1HA 2XUEA 1M5DA 1LSTA 1FTKA 2D3IA 3SESA 4E0XA 3C64A 1B0HA 1D9VA 1UX5A 5ADXL 5L3CB 4Z0IA 1FCKA 2B65A 3OO6A 1QJMA 1LAHE 1GVCA 3C31A 4OERA 5J2UE 2F35A 2DE4A 2QRYA 3RQTA 1FQAA 3ZJ1A 4AQGA 3O2AA 5HPQA 3L09A 1MIVA 4EZHA 4F22A 3IF8B 1YAEA 2XHEB 3IOUA 4GYSA 3FGSA 3C4MA 2QPQA 1H76A 3V83A 3OEMA 5FTHA 5A5XA 2ZMAA 5L3EB 1F9BA 3N6TA 5HXHA 3E4RA 3Q28A 2CZLA 4JSDA 3K02A 2KINB 3C51A 1B3GA 4DCXA 2LOPA 3V89B 1Y1MA 3EN3A 3H6TA 1XVXA 4ISTA 2ZMBA 1N04A 1VFEA 2XASB 1FQFA 1ZKEA 4QX7B 3M3KA 3DELB 5TPAB 3H3GA 4IB2A 4DXCA 4HFVA 1FQDA 2FNCA 3PD8A 1AIVA 4AI6A 1EZPA 3T9VA 4AKLA 4NF8B 3PUVE 1B2HA 5I56A 4LZ5A 4DDDA 1A8FA 2H9BA 4IGUA 3PUGA 3BQKA 3VLVA 1IXGA 3RGYA 3AA7B 2QS3A 2B1EA 1LKXA 2F6GA 3KJ7A 4M1PA 4UVCB 5ISUA 1ZJLA 5EK4A 2IW5B 3ZEFB 2E8IA 2VOZA 4P0GA 3IB0A 2O7IA 3QUJA 4UXNB 2GHBA 3PU5A 5HYAA 5EHSA 4AQ4A 4THIA 4QRZA 3MUQA 5CMCA 3UUNA 3B6QA 3G3IA 1ZHCA 4HCWA 5JRCA 3MKDA 5CA0E 2AIXA 3ZCJA 3KG2A 3RH3A 2HH7A 3DM0A 3RYHE 2C5KT 2F6PA 1OMPA 2GHAA 2RCAA 4ASKA 3CKDA 4OYKA 1URSA 4KD5A 3FUZA 5HXEA 1BLFA 2BDEA 3PURA 4NF4A 1B7TA 2DCFA 1ANFA 3VVDA 3KJTA 2J1DG 5L8DA 1JQFA 3GA8A 2JQQA 3ONXA 2MOZA 2IC9A 3GN5A 3C34A 3TQWA 4BLAA 1P99A 5A5XB 3FASA 3IR1A 4B6XA 4H63H 2XX9A 4PQJA 3DJBA 1B40A 3I5OA 4EAHA 4PNIA 3ZKKA 3SEWA 1D1CA 1B3FA 3JC6D 4IO5A 4P11A 3OMBA 3I0QA 1MPBA 2F97A 3RLFE 2QGSA 3T22A 1SI1A 2P0SA 2F8DA 4QWNB 4ZZAA 2XX7A 2LAOA 4QHQA 4TZ4C 3FATA 3VVEA 2ONRA 1BTJA 4L5GA 2NTXA 1BR4A 4I8CA 3KV4A 4GL0A 3N9PA 2F7CA 3BQIA 3VLWA 2RC8A 3G3KA 3AA0B 4MFRA 5JDQA 1D3KA 1DSNA 4I62A 3UK4A 3O97A 2CCQA 1N7XA 5I2NB 2N2NA 3K2DA 2H99A 3OYXA 4DMVA 5AA2D 4XBFB 4QF9A 1MXUA 1T98A 4O2AE 3RY3A 5H6QB 1NNTA 1JVXA 1Z7ME 3WAJA 1QUJA 2D0TA 4IO6A 1VFDA 2XXTA 3T9XB 4F3GA 4OETA 2ABHA 4DXUA 3CG3A 3HN0A 4OENA 4UVAB 5I59A 1R1NA 3EHTA 1WYBA 4RK9A 1EZ9A 3MAMA 3B6WA 2Y7KA 5CMMA 1VSOA 3H03A 3TELA 1MXYA 4H67A 5KMGP 4TX5A 4N13A 3ONMA 1KNZA 5HWXA 3HKDE 4QX8B 4RJZA 4PFPA 5EZYE 2VKDA 2A5TA 2NW8A 5LGUB 3CIJA 5HWYA 1B0LA 2O7UA 1IJ6A 3P8CD 1A40A 3RC3A 4WBOA 4F3PA 3AAIA 4QHOA 1OLCA 2LHNA 3HKCE 3R84B 3O6GA 2XXXA 2CMRA 2PFVA 4NTLA 2XXHA 1IEJA 5DQWA 2V93A 4ZS9A 1RYXA 4YB7A 4EXTA 2QSXA 4DZ1A 2I3WA 5AA4A 1N7WA 5JVDE 2KT9A 4IE6A 1DTGA 1FIOA 4I1DA 3K6UA 3PUQA 1H45A 2RINA 2V84A 4F18A 3DTOA 4YHJA 2KWIB 1QUKA 1G73A 2DOJA 1MY2A 4UEMA 4OYVA 4HKAA 1BKAA 3HSTA 3G3GA 1O64A 1DMBA 2QMXA 4JWYA 2YK0A 1M5BA 2OWSA 3PMWA 1MQGA 3CX8B 4O3AA 4F3BA 1PB8A 3CQXC 2DWGA 2BVLA 3GZGA 1NNPA 2I48A 4IE0A 1FTJA 5I2KB 2Q2CA 4F29A 4WXJA 2HZKA 1XVYA 3C4WA 4L0RA 5I59B 3E22E 4ZI3D 2OLBA 3HO7A 2DWIA 4OFLA 4UV8B 2JRKA 3N9OA 3LSLA 5H8SA 1SDXA 2V7MA 3MWBA 3N9NA 2VB6A 4KUMB 4OFOA 3UA8A 5AA2B 1JVYA 2XXRA 1P1OA 1MMGA 2DVZA 4BJMA 2EHOD 4H5GA 2VKOA 1CB6A 4EQ9A 2HEUA 4GLIA 1USYH 1QSDA 4I55E 3JV9A 3RT6B 3IHRA 4X1BA 3DP7A 4DBQA 4RNSA 4RY1A 3OSRA 2Q9QC 3TEPA 2VKHA 4L9IA 3PMXA 3K01A 1J1NA 2E9XA 5AA4B 3ZKLA 5DTBA 3MP1A 1HS7A 4IO2A 3MA9A 4PJJA 1NNKA 3O9PA 4C1UA 3Q26A 4EIWA 1MQJA 4WEDA 1JW5A 1TFAA 3RTWB 1AJ3A 4HS7A 1O63A 3D4GA 2LM9A 2REGA 3Q2MA 2MYSA 2DWAA 4Q8RA 3PUXE 3TDJA 2H7OA 4PFUA 5M2VA 3F31A 4OK0A 1SI0A 1RKMA 3MP8A 1B52A 1LBBA 2RKMA 5BWJA 2NOXA 2Z8FA 1CE2A 5B7DA 2CE7A 1S9TA 5L3FB 3KV9A 1CUNA 4H9SE 3ZMZB 4KMCA 3GWHA 4G77A 3N2OA 4PK5A 4EXKA 3F11A 2CXFA 4PW8A 2CWOA 1MH3A 5LHIB 2LSYA 1GR2A 3B6TA 3K8PC 3K1PA 3C35A 4BJNA 5H8QA 4KFQA 5CMBA 1TFDA 4KP3C 1US5A 1EZOA 4CI2B 3TUSA 2NUVA 3B57A 2P2AA 2LHRA 4GOUA 3VU7H 1UQWA 4IE5A 4QSEA 4N78D 5E0OA 3MW0A 2X66A 3F57A 2HZLA 4FATA 5DQVA 5CBSA 3ZLIA 1NL5A 4ILUA 2VL8A 1UCUA 3MK7C 2Z23A 1TXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B4H A;  2WKY A;  5CM6 A;  2XX8 A;  3RUM A;  1LFH A;  5EYF A;  4YZZ A;  2V3T A;  3QXM A;  4PP0 A;  4EQB A;  4R2F A;  2RF1 A;  4PET A;  1Z7N E;  4EF1 A;  5H8N A;  2UVJ A;  4MF3 A;  4R6Y A;  4TQU Q;  1KWH A;  2QJE A;  2RC9 A;  4XIG Q;  2D5W A;  4F19 A;  3CVG A;  3LC8 A;  2AL4 A;  1IIT A;  5ELV A;  5EHM A;  3FD3 A;  3VFJ A;  1PEB A;  1Q1K A;  4U1Z A;  3TPA A;  1B3E A;  3MP6 A;  3L6H A;  2Y7W A;  1PDA A;  4R6H A;  4R6K A;  4LP2 B;  1I69 A;  1MY3 A;  1DTZ A;  3Q29 A;  3SEV A;  4PE5 B;  3CFZ A;  2DXR A;  2GRV A;  1MXW A;  3W9V A;  2O6A A;  3RPW A;  4KCD A;  3I3V A;  4FEC A;  3FJ7 A;  1DOT A;  3FVG A;  2DP8 A;  4JXI A;  2VGQ A;  1A7L A;  3TTL A;  3PPP A;  3KBR A;  4OMB A;  4C1T A;  2MBG A;  2NVU B;  5CBR A;  4PFY A;  3EF7 A;  5I57 B;  4KYE A;  2H4I A;  3U1O A;  3WAF A;  1PBQ A;  5DEX B;  2K48 A;  1B58 A;  3K1M A;  1JNF A;  2DVC A;  2UYF A;  3H4Z A;  1URG A;  1B3H A;  1M5C A;  1LRZ A;  3FXE B;  4G4P A;  4OZ9 A;  4LZ8 A;  1LCF A;  2QS4 A;  4AB5 A;  4BDQ A;  2PBW A;  5CC2 A;  5H8N B;  4YU0 A;  1UTB A;  1Y3Q A;  3K0V A;  2VD3 A;  1Y20 A;  3OEL A;  3CFL A;  4QFK A;  4G68 A;  1XT8 A;  4F3S A;  1IQ7 A;  4H8I A;  4ZEF A;  4JB7 A;  1XS5 A;  1MG1 A;  1OQG A;  1AMF A;  1OVT A;  5BUU A;  1XHY A;  1SBP A;  4M4G A;  4GF8 A;  3CFX A;  4MBP A;  3V5A A;  4FEB A;  3R7X A;  1MQH A;  1MQI A;  1H3D A;  3Q27 A;  3G3F A;  4M1V A;  2Z8D A;  3OEK A;  5JTY B;  2DWH A;  4R73 A;  4CQI A;  1LGB C;  3D4C A;  1MH4 A;  4ELR A;  3PPO A;  2F78 A;  1PB9 A;  2XXW A;  1TT1 A;  3LR1 A;  1A8E A;  2IC6 A;  4OEU A;  4LVQ A;  3R6U A;  4JSO A;  2R6G E;  5K2X A;  2I58 A;  4LZ7 A;  1B3L A;  3FIR A;  4YKK A;  4LA9 A;  1SQY A;  4F39 A;  3G3J A;  2IEE A;  3BBR A;  3MQ9 A;  2O68 A;  5IKB A;  1B4Z A;  3VDF A;  1B5J A;  3IOR A;  2THI A;  2Z22 A;  4ZEK A;  4GIZ A;  3H7M A;  4R2B A;  1MPC A;  3R26 A;  5CI5 A;  3KN7 A;  1UTB B;  3UP9 A;  5H8F A;  3K6X A;  4ECF A;  3ILU B;  4R72 A;  4MH5 A;  4ZEB A;  1FQE A;  4O3B A;  4OQO A;  5B70 A;  3PPR A;  5I56 B;  1LB8 A;  2HAV A;  5L9O A;  4DLD A;  1LFG A;  1DPP A;  2I4C A;  2E0S A;  3EQ1 A;  1AOV A;  4KYD A;  4MFI A;  2CA5 A;  1N3W A;  1LLS A;  3UOR A;  2XXY A;  2O69 A;  4QFO A;  4FJP A;  3PGF A;  3EHS A;  1US4 A;  2XXV A;  1N3X A;  3W9W A;  3FV1 A;  3U92 A;  1IXC A;  3OO8 A;  3FJG A;  2W7Y A;  4XKQ A;  3E3K A;  1Y1Z A;  1SW2 A;  4EUO A;  5KDT A;  4G8H A;  1H44 A;  1OVB A;  1H7C A;  1R9L A;  1A55 A;  3O6H A;  4NF4 B;  3TCH A;  3MVY A;  4X9T A;  5I58 A;  3UGW A;  3K6V A;  1SW4 A;  4YKJ A;  4EF2 A;  4U4S A;  5DT6 A;  2YPN A;  3FVN A;  3HCQ A;  3HV1 A;  4H6D A;  2ONS A;  5ITP A;  5H8F B;  3MPL A;  5ICT A;  4KQP A;  4YMA A;  3CR9 A;  3ECR A;  1Y9U A;  1WOD A;  3IOT A;  2XXP A;  3H6W A;  3GBA A;  2PT2 A;  4LUB A;  3A3C A;  1YTV A;  1O7T A;  3VXB A;  4UA8 A;  4OHN A;  3GBB A;  4DIG A;  3IB1 A;  4QFP A;  3KZG A;  4XTC Q;  3B7D A;  4LQ5 A;  2R71 A;  3PUW E;  1TWY A;  5ITO A;  4POX A;  2ESN A;  3N6U A;  1MRP A;  4HCY A;  3IJX B;  4YB6 A;  2ZNT A;  2Q8J A;  2XD3 A;  3OXN A;  2I0C A;  4UAC A;  2O1L A;  5KDT B;  2O1M A;  4IGT A;  2QS1 A;  3FVO A;  1URD A;  3K00 A;  3LSF B;  1JEV A;  2E1S A;  4U2R A;  5AA3 A;  5DVJ A;  4DXB A;  2OJT A;  3S2V A;  1ATG A;  4ELQ A;  3FVK A;  4G8N A;  3TAJ A;  2A5T B;  5LOM A;  2ZYM A;  5IAI A;  3M3F A;  4EYY R;  3VLU A;  5TU0 A;  5CMK A;  2Z8E A;  1SW5 A;  2CMO A;  2DXY A;  3N26 A;  2OCU A;  3PMV A;  5H8H A;  4FI5 A;  1NMU A;  4YIC A;  3N94 A;  3TCF A;  1FQC A;  1IIW A;  3O29 A;  1NH7 A;  2YLN A;  1BIY A;  3S9N C;  2GH9 A;  4ZEC A;  4F2O A;  3T66 A;  1B5H A;  1QKA A;  4NF5 A;  1P1N A;  1I6A A;  4YKP A;  1MXZ A;  4MLV A;  3OD7 A;  2Y7R A;  4RXL A;  2DS9 A;  1LFI A;  2DSF A;  4NMY A;  1LVF A;  3MVW A;  4RK2 A;  3QIM A;  3PD9 A;  2X9Y A;  1HSL A;  4R74 A;  4U22 A;  1RYO A;  3MZB A;  1P1Q A;  3DP8 A;  3IL1 B;  2XTL A;  4RPN A;  3U8Q A;  2YJP A;  4IO3 A;  1EH3 A;  1B7Z A;  3KSJ A;  4IGR A;  3H6V A;  3KGC A;  3N5L A;  4KYS A;  1HSE A;  4ISU A;  3RNN A;  3PPN A;  4X1D A;  4NF6 A;  1D4N A;  3HHG A;  2UYE A;  1FTO A;  1N0T A;  1MY0 A;  4OFJ A;  4FIM A;  3MJN A;  1MDQ A;  5H8H B;  2DE2 A;  1UIU A;  1UTH A;  4TOZ A;  2DQV A;  2AYS A;  3PUY E;  4KI0 E;  2KLF A;  1WVJ A;  4HW8 A;  4DCY A;  4R9G A;  1JW4 A;  3C32 A;  4NF5 B;  3QAX A;  1VE4 A;  3O6I A;  2V25 A;  1Q35 A;  1L5T A;  4Z7E A;  3MPK A;  3TFL A;  2X9X A;  2ZYN A;  1M5E A;  4YKI A;  2PYY A;  3H6U A;  3UIF A;  3T96 B;  3RTF B;  3IAZ A;  3G3H A;  3P7I A;  4GOT A;  3S4U A;  1ZIU A;  1D9Y A;  1ELJ A;  2V3U A;  4ZE8 A;  1YPN A;  4ELO A;  5H8Q B;  3U94 A;  3CSB A;  1B7U A;  3CI8 A;  1DPE A;  1LAG E;  4YAH X;  1NKX A;  2O84 X;  3OO7 A;  1N76 A;  3CSG A;  3SER A;  3A3U A;  3MZ1 A;  4JDF A;  2X9W A;  5F1Q A;  3ZS6 A;  4IY6 A;  3C36 A;  3O28 A;  4NF6 B;  4FAJ A;  2OWT A;  2VHA A;  5TP9 A;  2V3Q A;  3THI A;  1OIB A;  1ZTY A;  4ELP A;  1NH8 A;  2UVG A;  4NED A;  3V8X B;  4GFR A;  5AA1 A;  2QS2 A;  2X7P A;  2OBG A;  4DND A;  4WKM A;  2B3F A;  3SDF A;  1UTH B;  3ILT B;  3KOT A;  2VD2 A;  4XKR A;  2I49 A;  4Q5T A;  2F7A A;  4BDN A;  4U23 A;  3SEU A;  1VR5 A;  1R6Z A;  4N07 A;  3T9U A;  1IXI A;  2NWJ A;  3OOA A;  4U4X A;  3JYR A;  4OVJ A;  4OEV A;  3W15 C;  4R9F A;  2Y7P A;  2IA4 A;  3CVR A;  1NFT A;  2HFB A;  2ZYK A;  2FA7 A;  3S9M C;  3VXC A;  3L6G A;  1PC3 A;  4U21 A;  4R75 A;  4PFW A;  1SW1 A;  3IO6 A;  3KEI A;  4JBZ A;  2DYX A;  3TCG A;  3IJO B;  3IX1 A;  2PT1 A;  1FTL A;  2KWH A;  4PFT A;  4OTE A;  1FTM A;  1B5I A;  2ZYO A;  5DVF A;  4KPT A;  2NXO A;  5L9M A;  3H06 B;  5KZT A;  2ALU A;  1N84 A;  5I2N A;  4LAT A;  1MM6 A;  4F1V A;  5TP9 B;  4JWX A;  3U93 A;  3E9X A;  4GD5 A;  3SET A;  5HBC A;  3A09 A;  1USY E;  2B3B A;  4OWD A;  4F2Q A;  3KOS A;  2Q9T A;  1OQH A;  4NE4 A;  4J2C A;  3MZ9 A;  1IZ1 A;  1XOC A;  2H98 A;  1IXH A;  4G68 B;  3I6V A;  3PV0 E;  3IOW A;  3MXZ A;  2HCA A;  5FHM A;  5KCJ A;  4ESX A;  4ZEI A;  4QFL A;  1I6Q A;  3QYT A;  1JW1 A;  3C9H A;  3C33 A;  2ZXT A;  4IO4 A;  5JK4 A;  2RC7 A;  3TZA A;  4GWO A;  4NWD A;  1SYH A;  3TYH A;  2DWJ A;  3KN8 A;  5CRY A;  2F7B A;  4G2Z A;  4H0W A;  4EXL A;  3FXD B;  3FXQ A;  2XD2 A;  2RCB A;  4TLM B;  1LCT A;  5F7V A;  2OK2 A;  3DP4 A;  1A54 A;  3QSL A;  2I6E A;  3M3L A;  3AXF A;  1AL3 A;  1GV8 A;  4AB6 A;  2ANJ A;  1B05 A;  4RYA A;  1B6H A;  1WDN A;  3S9E A;  4OES A;  3T9H B;  3PUZ E;  3BFU A;  5I2K A;  4XKN A;  1B46 A;  4ZZE A;  5ICQ A;  1Z0P A;  3EHU A;  3HPI A;  2P1S A;  3CG1 A;  4LQ2 A;  2UVH A;  4H5F A;  2G93 A;  4XXU A;  3EPE A;  5FHO A;  3K4U A;  1GGG A;  3T93 B;  5KC