3P7IA

Crystal structure of escherichia coli phnd in complex with 2-aminoethyl phosphonate
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
300
structure length
300
Chain Sequence
KALNFGIISTESQQNLKPQWTPFLQDMEKKLGVKVNAFFAPDYAGIIQGMRFNKVDIAWYGNLSAMEAVDRANGQVFAQTVAADGSPGYWSVLIVNKDSPINNLNDLLAKRKDLTFGNGDPNSTSGFLVPGYYVFAKNNISASDFKRTVNAGHETNALAVANKQVDVATNNTENLDKLKTSAPEKLKELKVIWKSPLIPGDPIVWRKNLSETTKDKIYDFFMNYGKTPEEKAVLERLGWAPFRASSDLQLVPIRQLALFKEMQSVKDNKGLNEQDKLAKTTAIQAQLDDLDRLNNALSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Escherichia coli Phosphonate Binding Protein PhnD and Rationally Optimized Phosphonate Biosensors.
pubmed doi rcsb
source organism Escherichia coli uti89
molecule tags Transport protein
molecule keywords PhnD, subunit of alkylphosphonate ABC transporter
total genus 119
structure length 300
sequence length 300
ec nomenclature
pdb deposition date 2010-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12974 Phosphonate-bd ABC transporter, phosphonate, periplasmic substrate-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3p7iA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3p7iA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3p7iA02
1ZU0A 1KWHA 2O68A 3H6UA 4G4PA 1I69A 3IOWA 3FZVA 2Y7RA 1IJ6A 2F7AA 4GXAA 2P2AA 4H8JA 3ZSFA 2X9XA 2CMOA 1GGGA 1UTHB 2QMXA 3DELB 1FQCA 1SVXB 3KOSA 3G3JA 3MVYA 3OSQA 3PGFA 1TXFA 2DXRA 4NEDA 3TQWA 3CVRA 4OZ9A 3H03A 3MW0A 4RXLA 3SEXA 3VLUA 4YMBA 5AA2D 3DP4A 4LUBA 3TELA 4R74A 3TZAA 1EZPA 2LAOA 2PMSA 1B2HA 4HCYA 4G8HA 4OXVA 4ZS9A 2RC9A 4FE8A 4DE8A 2I4CA 2Z8EA 3FVOA 2PX1A 4JXIA 4HS7A 5H8QB 2ZYMA 1UTHA 3LSLA 4IO5A 1LFGA 4P0IA 5TU0A 1B3EA 4NF8A 4B6XA 3TEPA 4IY5A 4QHQA 4F31B 4L0RA 1MXWA 5I2NA 4LQ2A 2DE2A 4XKRA 1UTBB 5A5XB 3ILTB 3CVGA 1VFDA 5ISUA 5DEXB 4WEDA 2MBGA 3O6HA 2RF1A 4IY6A 2H9BA 3MXZA 1LAXA 2DSFA 4GD5A 2D21A 3ODBA 1PB7A 4UACA 3SERA 2X9WA 3FVGA 3S4UA 1YCJA 1AIVA 2G0UA 3KJ7A 2A5TA 1FQEA 2B3FA 4LZ7A 1PC3A 1XVXA 3M3FA 1DPEA 2RCAA 3IJXB 4H5FA 3U1OA 1MY1A 2VOZA 4F3BA 4C1TA 4G2ZA 3RTWB 1I6QA 3W15C 4ESWA 4F39A 1R9QA 1B7ZA 2DVCA 4OYVA 4PFTA 4RPNA 4EF2A 1H3DA 1A55A 4LZ8A 5LOMA 5FTIA 3PUXE 4F1YA 4IO6A 2F97A 3UK4A 2Y7WA 3JYRA 4RY1A 2QJEA 4DLDA 5I2KA 1LSTA 3FXUA 1B51A 3C33A 1DMBA 2AL4A 3VV5A 2IA4A 3EHSA 3QYTA 1RYOA 4FATA 3HCQA 5EHMA 1TWYA 2Q2AA 4MH5A 1B0HA 1S50A 3O6GA 1MQDA 1N7WA 1URDA 4TOZA 3BKIB 1FQFA 4ZECA 1LCFA 3KSJA 2C5KT 1B52A 4FEBA 3HV1A 1Z7ME 4G8MA 4IO2A 4Q30B 5I2KB 3IAZA 4G68C 5DVJA 3S9MC 1LAHE 1EZOA 3PUVE 5DT6A 5H8QA 1MQIA 3E9XA 1Q1KA 3KOTA 3CSGA 2AYSA 3CR9A 3AXFA 3I6VA 1AMFA 5CRYA 1N0TA 4ZEIA 1P99A 1HSJA 2DE3A 2D3IA 1OVTA 2QS2A 2X9YA 3K1NA 3RTFB 1NMUA 3T9VA 3TKDA 1NKXA 3GBAA 1B7HA 1MPDA 4FIMA 1IZ1A 1QKAA 3EHTA 4OWDA 2Q8JA 2K48A 2XX9A 1SDXA 3FGSA 4NE4A 2FA7A 2HCAA 1DPPA 1QULA 1GR2A 3H4ZA 3MAMA 4WEPA 1N7XA 1TFAA 4NWCA 4EQ7A 3K6XA 3CRBA 1D4NA 2HEUA 5B70A 3TTLA 1B3LA 1ELJA 1WODA 2GHBA 2XXUA 5B7DA 3ILUB 1URGA 1JVXA 2DE4A 4JDFA 4R9FA 5F1QA 3IX1A 2HZLA 5I59A 5L9SA 1JW1A 3FXRA 3KN8A 3IO6A 3QIMA 4F22A 3IB0A 2QPQA 5DYHA 3SEYA 2H98A 5I57B 1PBPA 2HAUA 3O28A 4MF3A 4YB5A 2Q88A 3F11A 3LSFB 2C5JA 1MY4A 2F78A 3KEIA 4XXUA 3TCGA 2KLFA 3BFUA 1R9LA 5ITOA 3IO4A 4AB5A 3FASA 1P1QA 5AA2B 2OBGA 1LB8A 4FI5A 2B65A 2UVJA 3CSBA 3IL1B 1SQYA 3PMXA 5K2YA 5AE4A 5I59B 2OJTA 1T0KA 1A8EA 3T93B 1A40A 1ATGA 3A09A 1NL5A 4EF1A 1FQDA 4ELQA 2ALUA 3PMVA 4H65A 4ZEFA 3VE1B 3K2DA 5I84A 1ZJLA 3BBRA 1SBPA 1ZKEA 1B46A 5BUUA 5KZTA 1ANFA 1URSA 4F2OA 1VR5A 3Q27A 1GV8A 1MQJA 5AA1A 3HHGA 5HBCA 4BDRA 3Q28A 2I48A 4ND9A 5KDTB 1MY0A 4K3FA 4TQUQ 5ELVA 3TKLB 3QK6A 1Y1ZA 2F8DA 1LFIA 2HAVA 4F3SA 3DLNA 4ESXA 3U8QA 4DCXA 3FATA 1QVSA 3CFZA 3TTNA 5ICTA 2A5SA 1Z7NE 3G3HA 1GTKA 1YPNA 3FIRA 4KYSA 1R1NA 3IOTA 2YLNA 1SYHA 3IOVA 1MH3A 4YB7A 4F19A 3TCFA 1XC1A 3E4RA 4PE5B 2O7IA 4YKKA 3OENA 4KR5A 3PPOA 3DP8A 4JWOA 1BLFA 2BJJX 5FHOA 3PD8A 2UYFA 1GVCA 1O7TA 1YAEA 1PB8A 1TFDA 1FTKA 2QL3A 1JEUA 1SW5A 1MXYA 2E0SA 4H1XA 4GL8A 5AA2A 4DZ1A 1TT1A 3PUWE 3GZGA 4KYEA 4I1DA 3TAJA 3VLVA 2O69A 4JSDA 2C5IT 1DTGA 1Y3QA 3C9HA 3EF7A 3O97A 1XOCA 3MQ9A 4UA8A 4YAHX 2UXAA 3BFTA 2E1SA 3KJTA 4YKPA 4X1DA 4PFYA 2VGQA 1O63A 4NF4B 5TP9B 5KCJB 4R9GA 1UIUA 3ZKLA 3Q26A 1YTVA 2PVUA 3N26A 4F3PA 3B6QA 1M5EA 1MM6A 4ZEKA 2KWIB 4I8CA 5H8FB 2OCUA 4ZDMA 2GHAA 4OERA 5DVIA 1N3WA 5CMCA 3SEWA 4AB6A 4THIA 1M5FA 1D9YA 1UIVA 1US4A 3TUSA 3UGWA 1A99A 2P0SA 1SYIA 2DVZA 2XXYA 3SEUA 4YMAA 2NOOA 2V3TA 5TPAB 2V84A 4R75A 4G68B 3FXEB 2OLBA 2XXXA 5I57A 1BKAA 1B1XA 1NH8A 3C32A 2O84X 2IEEA 3T9UA 3OELA 4R2BA 2H5YA 4CQIA 3LSXA 4MBPA 4YZZA 1USYH 1NNFA 2UVIA 3FXQA 4I9DA 4Z0IA 3HN0A 1MQGA 3LSWA 4U4SA 5KDTA 1OQHA 1B6HA 4QSCA 2M8CA 3Q29A 4KCCA 4RJZA 4GF8A 4PFUA 3MJNA 3W9WA 5CBSA 4PETA 2H99A 5H8SA 3USDA 1MXUA 3VXCA 4BDLA 4NF4A 5TP9A 4OEVA 4QRZA 1B3FA 4EQBA 1OMPA 3UORA 1QUIA 4RA1A 4BDMA 4OFLA 3O6IA 2ZMBA 4IO3A 4I62A 4M1VA 1POTA 2Z8DA 1LCTA 1M5BA 1HSEA 4J2CA 3QSLA 1SW4A 3FVKA 1H44A 5IAIA 2O1LA 5A5XA 1FTMA 3PV0E 1Y20A 2G29A 2Z22A 3THIA 3VVFA 2Z8FA 2UYEA 4FECA 1LBBA 3G3FA 4G8NA 2F6GA 1Y1MA 1MDP1 3VVDA 4DXCA 3FV2A 1A54A 1IXHA 4QF9A 1IQ7A 3K6UA 3JZJA 3MBPA 3R26A 4L17A 2I0CA 3QAXA 5DVFA 5HM4B 3B6WA 4EXLA 5EYFA 4EYYR 1P1UA 1MDQA 5IKBA 1QUKA 1VE4A 2RC8A 4OFJA 3KZGA 1RKMA 3N5LA 1CE2A 2REJA 4IO7A 2Y84A 2AL5A 3GBBA 4OEUA 4O3CA 1QUJA 3SESA 3TTKA 1FCKA 4OTEA 4ECFA 1F9BA 1ZKBA 3H6VA 4GRKA 4ZZAA 1IUDA 1XVYA 2QMWA 4KQPA 4ZZEA 3T9XB 4U4XA 4DXBA 1JETA 2O6AA 3GLBA 3VXBA 1II5A 4F18A 1H7CA 1L5TA 4EQ9A 3KG2A 4POWA 1Y3NA 4LA9A 1OLCA 1EU8A 4OENA 1LBCA 2ESNA 5H8FA 4R6KA 3O66A 4C0RA 4Q5TA 3U92A 4ONYA 1SI0A 2HZKA 2UVGA 4PFWA 2W7YA 1JEVA 1QKBA 2XXHA 3L6HA 5ICQA 1IIWA 1R6ZA 1RYXA 4JWYA 3OMBA 3ZKKA 2DS9A 3G3GA 2O7UA 4RNSA 3IJOB 1I6AA 4NF5A 3LBSA 4MFIA 1J1NA 5I2NB 1MM7A 3KBRA 1Y3PA 5TPAA 4F3GA 4XKQA 1PB9A 2DYXA 3IOUA 4GXSB 3IB2A 4OETA 2R6GE 4ELRA 4Z7EA 5I56B 3G3KA 3OEKA 2X26A 4JBZA 3DM0A 1B58A 3QUJA 1FQBA 2I3VA 1US5A 2XD3A 3OEMA 2HFBA 1AL3A 2F7CA 1NH7A 4PP0A 3VDFA 1PEBA 2DP8A 2D5WA 4FAJA 3CG3A 5M2VA 5JTYA 5J1DA 2RKMA 4N07A 4M4GA 1ZIUA 3IR1A 4C1UA 4IO4A 4NWDA 3LUYA 4O3AA 3T66A 2VP1A 2ZXTA 4BDQA 3CKDA 4QFPA 4ZE8A 1P1NA 2F36A 4F1UA 5AA4B 4QFOA 3PU5A 1P1WA 2ZNUA 2WKYA 1Z0PA 5L9OA 1OVBA 2F6PA 2QS1A 1WDNA 4NMYA 2G93A 4U2RA 3OOAA 1B40A 4XKNA 3WAEA 4F2QA 3C36A 3CIJA 3RUMA 5HPQA 3MP6A 1FTOA 1OQGA 5K2XA 3OSRA 5I56A 3MVZA 2RINA 3MZ1A 3N6TA 4LQ5A 3S9LC 1O64A 2F34A 4KD5A 3C34A 1B7UA 3K02A 1MPBA 1PDAA 2Y7KA 3LR1A 4KHZE 1QW0A 2B3BA 4RK2A 3K00A 1LVFA 4YKIA 2V25A 4U21A 3HHFA 2XTLA 3N6UA 4KCDA 3HPIA 4X48A 3TMGA 4F1VA 3OO9A 3KGCA 1ZMGA 1DSNA 1WVJA 4PQJA 4U23A 4OHNA 1FTLA 2XXRA 2V93A 4OVJA 3MWBA 3N94A 3TCHA 5JEIA 3IORA 3U94A 2Q89A 2I49A 3EQ1A 4MLVA 3TQLA 2ZYNA 1IITA 1SW1A 1SW2A 3V8XB 2ZNSA 2OZZA 1S9TA 3K6WA 3UIFA 4U1OA 4Q8RA 5ITPA 1XHYA 1POY1 4ELOA 4DXUA 4DCYA 2Z23A 2HXWA 1MPCA 2F35A 4FEDA 4QFKA 3T22A 4ZEDA 4ELPA 2RCBA 2XXQA 3V89B 2XX7A 3TYHA 2CA5A 3MUQA 4XTCQ 3UN6A 3FVNA 3A3CA 3CG1A 1JVYA 4NF6A 1LAFE 1MXXA 2OWSA 2R71A 4GOTA 4NF5B 1DTZA 4G68A 1MH4A 2ONKE 4BDOA 4Q0CA 5L8DA 4H0WA 4XIGQ 3I5OA 4JWXA 1BIYA 3IB1A 4QFNA 3VFJA 1MS7A 2XX8A 3K0VA 5AA3A 2YJPA 1A7LA 3EHUA 3W9VA 4LVQA 4YU0A 1H45A 3PMWA 1JNFA 4RPOA 1NNTA 2FNCA 4NTLA 2VD3A 2GH9A 3TDJA 1MG1A 3RT8A 1EZ9A 3FUZA 5KCJA 4HW8A 4H5GA 2ANJA 2DWJA 3FJMA 1M5CA 1JW5A 1S7YA 1AH5A 4H8IA 2NXOA 1N76A 1IJ5A 4KYDA 1D9VA 4DDDA 3D4CA 1USYE 1Y4CA 4R6HA 2VD2A 3R6UA 1D3KA 1LLSA 1QJMA 2HQ0A 3QUFA 5JTYB 3G3IA 5I58A 1ZLQA 1MY2A 1UTBA 1Q35A 1MXZA 3K6VA 2O51A 3T9HB 3KSXA 1Y9UA 3H6TA 3MZBA 4GQOA 4YKJA 5DEXA 4ZEBA 3RN8A 3CI8A 1LRZA 3HO7A 3MPLA 4FORA 3P7IA 4DNDA 3M3LA 1JQFA 2R9JA 2V3QA 3C31A 4IB2A 3RPWA 4NF8B 3E3KA 4KFQA 2NWJA 1FTJA 2XHDA 3G7WA 2NVUB 3PD9A 3MVWA 4GFRA 1NNPA 5CI5A 3S9NC 2THIA 3K1PA 3SEVA 4YICA 3DP6A 1B3GA 3HSTA 3KN7A 1B32A 4O3BA 4R6YA 1UQWA 3C35A 3MVXA 3PUZE 4DIGA 5CMBA 4TLMB 2P1SA 1N84A 2REGA 2ZYKA 1B3HA 4GL0A 1H76A 1PBQA 4X1BA 2F5XA 3FD3A 5H8HA 5CC2A 3D4GA 4IGRA 4LZ5A 3UA8A 4WKMA 2I3WA 1LGBC 2I4BA 1VFEA 2OWTA 4U1ZA 1IXGA 2CZLA 4P0GA 5FHNA 3PPQA 3PUYE 3H3GA 4RYAA 3ECRA 4WXJA 3A3UA 3S9EA 1ZTYA 4EUOA 3V83A 4H6DA 2F7BA 1DOTA 2GRVA 3FV1A 2OK2A 3WAFA 3RGYA 5BWJA 1B05A 5H8NA 3TFLA 3ONMA 1MXVA 5EHSA 3MP1A 4F29A 2ZNTA 4N13A 3RQTA 3K01A 3TODA 5CBRA 3GXAA 5H8HB 4E0XA 2DQVA 2QS3A 3K4UA 2QS4A 3CFLA 4NF6B 4ZE9A 4IGTA 1CB6A 3RLFE 3MPKA 2DWIA 1IXIA 4OESA 4GVOA 2YPNA 2PT2A 4OMBA 4ISUA 1MQHA 3KFMA 2X7QA 3OO7A 4JB7A 3TTRA 3EN3A 1H43A 4X9TA 2I0BA 3UP9A 4EDPA 2ONRA 4BLAA 1B4HA 4GWOA 3PPNA 3Q25A 4BDNA 3O2AA 4FJPA 2PYYA 3RY3A 2H25A 2XD2A 2XXPA 3E13X 3O29A 3QXMA 3V5AA 2DOJA 2KWHA 1P1OA 3VLWA 1AOVA 2O1MA 4R72A 3L3PA 3C4MA 4E0WA 1VSOA 3K1MA 5DTBA 4KI0E 3RT6B 5F7VA 2PT1A 2XXVA 3SDFA 4R2FA 3B6TA 2UVHA 4YB6A 5FTHA 4LP2B 2IC9A 1ZBMA 3H6WA 3H7MA 4LATA 3TTMA 5FHMA 3VVEA 3MZ9A 5I58B 3L6GA 1B5JA 1MRPA 1B9JA 4EXKA 4N6PA 1NFTA 1JW4A 1LAGE 2DWAA 2Q9TA 3SETA 3MC2A 1IEJA 2GFEA 2ZYOA 1SI1A 2Y7IA 3I3VA 4OQOA 5AA4A 3PPPA 2DXYA 3LC8A 3SKPA 3OXNA 2VHAA 1B5HA 3U72A 2AIXA 2H4IA 2PBWA 3JV9A 4POXA 1B1HA 4QSDA 4R73A 4QSEA 5CMMA 1OLAA 1I6BA 2ABHA 4GLIA 3T96B 2I58A 1FW0A 1EH3A 3FXDB 2XXIA 2I6EA 2RC7A 3H06B 1IXCA 2XXTA 4OFOA 5CMKA 2QRYA 3FJ7A 5JK4A 3EPEA 2DWHA 3S2VA 1BP5A 1Y4TA 4AQ4A 3U93A 4RK9A 1HSLA 3OO8A 1LFHA 1M5DA 2XXWA 1FQAA 2A5TB 1A8FA 2FYIA 3B7DA 4HCWA 4TLLB 1B5IA 1NNKA 4HTGA 2QSXA 2Y7PA 3ZS6A 3MP8A 1N3XA 2ONSA 1BTJA 3IK6B 4LONB 4U22A 3OO6A 4JSOA 2Q2CA 4P11A 3M3KA 3TPAA 3RNNA 1LB9A 1B4ZA 1MY3A 3KN3A 3CFXA 4MLQA 4QFLA 5CM6A 4H67A 2V3UA 5H8NB 1QSDA 4GIZA 1SD3A 2X7PA 3FJGA 4KPTA 2NUVA 2IC6A 1XT8A 3O9PA 3OD7A 4XKPA 1OIBA 3M8UA 3R7XA 4G77A 3PPRA 1B0LA 5L9MA 1N04A 1XS5A
chains in the Genus database with same CATH superfamily
2VASA 4HWIB 5JDHA 4LFCT 1KWHA 4DR5T 3Q5EA 1I69A 2Y7RA 1IJ6A 4GXAA 4O8MA 3IEEA 3BIHA 1Y64B 2CMOA 1GGGA 2YU1A 4YY3T 2BG9B 4NEDA 3TQWA 4RXLA 3VLUA 4BJMA 4YMBA 3DP4A 3C50A 4R74A 1B2HA 4OXVA 2PX1A 4HS7A 3LSLA 1W0BA 5TU0A 3O9XA 3TEPA 5C2TA 4F31B 3UUMA 5I2NA 4LQ2A 1QLBA 1VDWA 2DE2A 3ILTB 1VFDA 3ZC0A 4WEDA 2MBGA 3PJAJ 3MXZA 2D21A 5KMGP 1PB7A 4UACA 5ABHA 3FVGA 4IL9A 3TLTA 1AIVA 4GYRA 1FQEA 4LZ7A 4GKJT 5HEUA 1MY1A 3IA3A 4C1TA 3RTWB 2D0UA 1I6QA 4Q25A 2DVCA 4PFTA 4OYVA 4RPNA 5AQNB 3PUXE 3X1DA 5I2KA 1JNZA 3IFCA 2KQZA 1DMBA 3VV5A 1E2AA 1RYOA 2WB5A 1TWYA 4MH5A 1S50A 4TOZA 3BKIB 2K9AA 3KSJA 1B52A 2C5KT 2J47A 3JAFA 4U72A 3HV1A 1QGXA 2VQET 1EZOA 3HR0A 1LBWA 5H8QA 1Q1KA 3KOTA 2AYSA 3HL6A 1IMAA 3RTFB 1OVTA 1VCSA 3T9VA 1NMUA 5HXSA 1NKXA 4FIMA 1IZ1A 4QH1A 4OWDA 5KDMC 3M3ZB 2PBIA 1SDXA 2WQYA 1WYBA 5LG4A 3H4ZA 4UR9A 3J7Yq 1IMDA 4CI1B 3CRBA 4B3MT 2XQ3A 5F1QA 5I59A 2HZLA 4GWSA 4CI2B 1UURA 3IB0A 5DYHA 1YW0A 5EYHA 4MF3A 4YB5A 4CXXA 3KEIA 3TCGA 4TNWA 4EIWA 2CXLA 4LFBT 3ISPA 3K1SA 5L3FB 1P1QA 4AB5A 2CBIA 2OBGA 2B65A 4TNVA 5I59B 1SQYA 5HEOA 2WCAA 1ATGA 1FQDA 5JTGA 1RDYA 3PMVA 4ZEFA 3A7MA 5AQSB 2LM2A 5KZTA 1B46A 5BUUA 5ET5A 5AA1A 4ND9A 5KDTB 3RRCA 2F4VT 4O7IA 5ELVA 2WS3A 4ESXA 4UV8B 2HXRA 3CFZA 1Z7NE 1GTKA 1HG2A 1LEVA 3FIRA 3IOTA 3Q5DA 4QKNA 3OENA 4KMCA 4JWOA 1GQEA 4FJOA 4JVIA 3PUQA 1GVCA 1YAEA 3RPLA 1W9RA 2JMKA 4ERRA 3N9QA 3OKQA 3UQ7A 1MXYA 4DZ1A 1TT1A 1FBEA 5FNVE 3GZGA 3O4XE 2C5IT 1Y3QA 3MQ9A 3WAKA 5AQUB 2V6YA 4P09A 2UXAA 3P4QA 4PFYA 2XWOA 1O63A 4XEQA 3ZKLA 3Q26A 1XNQT 1YTVA 2XWVA 3N26A 1SUMB 2NW9A 3ZT6A 4DR4T 3UTKA 4I8CA 5H8FB 4IE7A 4EZHA 4OERA 5DVIA 4ZI2C 1N3WA 5CMCA 4AB6A 3B50A 4OFZA 2V3TA 4DV0T 1XDOA 4G68B 3FXEB 4I4TE 5I57A 3C32A 2LLYA 2WSSV 2O84X 4ISSA 4CQIA 2H5YA 3LSXA 4YZZA 3P50A 5JDNA 2UVIA 1D1CA 1BR4A 2FIXA 4U4SA 1OQHA 4IE4A 3AEDA 3BIGA 1FBGA 4GF8A 3KBZA 2CWYA 4OX9T 3W9WA 2XM1A 3MSTA 5H8SA 3USDA 4BDLA 4QRZA 1QUIA 1OXZA 3SOLA 1V9DA 2KZ7B 2WWVA 2Z8DA 1SW4A 1U5PA 3HKEE 3RIUC 5ET8A 5A5XA 2MAWA 3ZN1B 2UYEA 3MYUA 1LBBA 3UUBA 4YSZA 3CK6A 1IXHA 1IQ7A 3R26A 3JZJA 5HM4B 3B6WA 2JRKA 4EXLA 1P1UA 2NTXA 5IKBA 2XSAA 5C8YE 1SA0E 4PBHA 3OBVE 5LOVE 3L8RA 3P8CD 5FMNA 3GYYA 4ECFA 1Z8UA 3T0JA 1ZKBA 1B7TA 3A8YC 4YTPA 1IBLT 4U4XA 2Z6EA 4IL4A 4WNKA 4DXBA 3I0QA 3GLBA 1HS7A 5IGAA 1H7CA 1L5TA 4YJ2E 1OLCA 2IMLA 4LF8T 3N9NA 3C4ZA 2ESNA 5LJNA 3B13A 3NVOA 4UF0A 3U92A 3EI0A 1JEVA 2W7YA 3L6HA 1RYXA 1R6ZA 2WEFA 4E7ZA 4O2AE 4EZ4A 3UULA 1MM7A 3ZN0B 1Y3PA 3N2GE 4HWDA 2NW7A 4UVAB 3IOUA 4OETA 4QX7B 4NXNT 3IHRA 2I3VA 2XD3A 3OEMA 4H9QC 3FBPA 2F7CA 2CXFA 4MEVA 3PUXF 4AIUA 4HTEA 5HCMA 5F3JA 1ZIUA 2FHYA 4IO4A 1M62A 4NX1A 4C90A 4JI7T 4NWDA 4P1EA 1CHUA 2X68A 4A98A 2ZXTA 4F1UA 4ZE8A 1P1NA 4X66T 5L9OA 3RGLA 4DBRA 4GWUA 2XQ8A 1B40A 3R84B 2QVUA 5K2XA 3AE2A 1FTOA 3MVZA 2RINA 3MZ1A 4LQ5A 4EEBA 5AQGB 3CX8B 2XTLA 4Z90A 3TMGA 3FZKB 3KGCA 1DSNA 4OVRA 2CPTA 2V93A 4OVJA 5FKYA 1BR0A 2I49A 4WYVA 4MLVA 3TQLA 1US7B 2YK0A 2V5CA 1SW2A 3UFGA 1D0XA 3VR9A 4QH5A 4DV1T 1S9TA 2NP9A 2OZZA 3ZEFB 5AQVB 3GWHA 3RQUA 1UCUA 1MPCA 4FEDA 1LFHA 4ELPA 2RCBA 2XX7A 2W62A 3VRBA 1FMVA 4P1NA 4GOUA 5AQKB 3FVNA 3CG1A 5ESYA 2OWSA 5ETWA 4WZXA 5L8DA 4H0WA 3PUYF 3V5SA 5AA3A 2XX8A 2D0TA 3EHUA 3W9VA 1Q9DA 4QWNB 4RPOA 2FNCA 4X1YE 3FBLA 4DR1T 4NTLA 4ZS2A 3AE6A 3ZMTB 1MG1A 4BAYB 4EOZB 3FUZA 3RT8A 2DWJA 4O4IE 2CEAA 3FJMA 1M5CA 1S7YA 5GONE 1N76A 1N33T 2Q74A 4K0KT 4NXMT 4TV9E 3N9MA 5L3CB 3RI5A 2V6XA 5IWAT 3D4CA 3R6UA 1D3KA 3AA7B 4TUYE 3QUFA 3OYXA 5JTYB 4PW8A 1IZNB 3KV5A 3SFDA 1MY2A 3ONJA 1Q35A 5ABEA 2VKJA 3H6TA 3EHZA 3LV0A 3RN8A 1NV3A 3CI8A 3MPLA 4FORA 4DNDA 3EABA 5EYGA 2R9JA 1BK4A 4IB2A 3SZPA 2NWJA 3BK9A 2XHDA 3M65A 2ZM0A 2ACZA 3FZFB 3MACA 3P4SA 1WLXA 2LE8A 4DIDB 3SEVA 1O3XA 4EV6A 4DV5T 1B3GA 1YD8G 4O3BA 4R6YA 1UQWA 1FMWA 4DUYT 1DBZA 3VU7H 3KVAA 2ZYKA 4GL0A 4UABA 4CI3B 4AI6A 3ZJ1A 5CC2A 3D4GA 4IGRA 3HFUA 2Y6XA 3IBPA 2I3WA 1LGBC 5IHYA 2B76A 1IXGA 2HH7A 2CZLA 1JNRA 3T8OA 5CGMA 2VT5A 3S9EA 1G8XA 2GRVA 4ZI3D 3FV1A 3RGYA 2X51A 1XWMA 4PFOA 3ONMA 4OVPA 3LUZA 5H8HB 1MMGA 4CXWA 2QS3A 4NF6B 2QS4A 1KK7A 3SWHA 1CB6A 3RLFE 2WU5A 3UUXB 4PK5A 1OEDA 5HWYA 4OMBA 4O2BE 2V7LA 1HNZT 2X7QA 3TTRA 4X9TA 2I6HA 4U74A 4BLAA 1E1HB 2CRBA 4BDNA 3RY3A 3ZSFA 2XD2A 3LSVA 1AOVA 3SFEA 2CZKA 2O1MA 2X0YA 4K0UA 5FL0A 3LK2B 2EHOA 2XXVA 4NN3A 3SDFA 3B6TA 2UVHA 5FTHA 5A5LA 3K3NA 4LATA 2XQ6A 4TWFA 4GK0E 2PG8A 5E0OA 2WDQA 5JRCA 1LAGE 1NFTA 4HE0A 2Q9TA 4PFIA 2XAJB 3SETA 4TWHA 2K5BB 3PPPA 1MIWA 2VHAA 3FZHB 2CWOA 3AB3B 2PBWA 4O4JE 5AQTB 1G73A 2CHOA 4GLIA 3B8BA 3D0TA 2XXTA 2QA7A 3AXJB 4YJ3E 4ILUA 1BP5A 4O8SA 4UEMA 1HSLA 1M5DA 3PU3A 3RC3A 2A5TB 2XXWA 1A8FA 1KNZA 3B7DA 4MBQA 1B5IA 1FSAA 5T3JA 2ONSA 4U22A 3S9MC 4MNCA 3M3KA 3RNNA 1LB9A 1B4ZA 1MY3A 3KN3A 4N8YA 5DQVA 3LG7A 1NV2A 2BJIA 4KPTA 4YU0A 4JEUB 2IC6A 2Y48B 3R7XA 2BS2A 2OX3A 2V1DB 1N04A 1NUWA 3L09A 4P47A 2O68A 4G4PA 3CX6B 4HFVA 2Q9QC 4H8JA 1HX1B 4OA4A 2X9XA 2QMXA 1UTHB 3UU8A 3PGFA 1FQCA 1VRBA 4ZZCA 3G3JA 3EAMA 5LBMA 4OZ9A 2Q9QB 3O1HA 3MW0A 1HFAA 1EZPA 3TELA 4QXCB 5IYZE 4ZHQE 4FE8A 3AE9A 2I4CA 5H8QB 1J1JA 3BQKA 1UTHA 3HKBE 4P0IA 4A5XA 5IM2A 4NF8A 4B6XA 4L0RA 1YXRA 5EQAA 4PGNA 2XUEA 4ILCA 5ISUA 4MJOA 3BQIA 2HN2A 2H9BA 1LAXA 2ZM8A 2DSFA 3ODBA 3AVSA 2X9WA 3S4UA 2G0UA 2BG9E 4DMVA 2RCAA 3IJXB 2QVAA 4QXDA 3U1OA 3A5XA 5AQFB 3N2KE 2VOZA 4I3YA 4G2ZA 4F39A 1B7ZA 5I7IA 3ANWB 4N6DA 1UUSA 4F1YA 2AE9A 2DWGA 2B1EA 4OYJA 2Y7WA 2QJEA 4DLDA 1LSTA 3FXUA 2W66A 2R6GF 5KXJA 3EHSA 2N2NA 5ABFA 5EHMA 3F31A 3O6GA 2I0MA 5L3EB 4KXPA 3TTNA 1WR0A 5AQLB 5C3JA 2YDQA 5DVJA 3PUVE 1MQIA 2KSRA 3PUSA 3E79A 3I6VA 3AXFA 3UK4A 3OYZA 1N0TA 4PJNA 1HSJA 1P99A 2QS2A 2J62A 2X9YA 1IBMT 4HWHA 3TKDA 3GBAA 1INPA 2XX9A 2HCAA 1DPPA 1QULA 4EQ7A 3RPLB 4NWCA 4G2AA 2CZIA 3TTLA 1ELJA 2XXUA 5B7DA 3ILUB 5HYAA 1JVXA 2UXDT 1NV7A 3KN8A 3IO6A 1PBPA 2XQ5A 5I3SA 4JUYA 2UUAT 4YLHA 4XAXB 4XXUA 4HXVA 2KLFA 3BFUA 4IE5A 1R9LA 2UXCT 3AE8A 3FASA 5L3BB 2OJTA 3T93B 1A40A 3A09A 4EF1A 2DL1A 2ALUA 3VE1B 3FBZA 2OA5A 4F2OA 5ADXL 2WBLA 4QXBB 1VR5A 2W63A 5L3DB 2KMFA 3HHGA 4LMLA 2I48A 2H3RA 2VPNA 3QK6A 2BVMA 1LFIA 1WYCA 4DCXA 3FATA 2V8SV 3A29A 2VB6A 3JADA 4YB7A 1SYHA 4DUZT 3ONLC 3E4RA 4YKKA 2GK9A 3PPOA 1UGOA 4QX8B 2V4CA 3NZPA 1BLFA 2BJJX 1FTKA 2QL3A 2E0SA 4GL8A 2W2UA 3PUZF 4I1DA 2CBJA 3ANWA 4JSDA 3VKHA 3WI3A 3O97A 1RDXA 4YAHX 2J1DG 2M67A 1N36T 5AQIB 2UXNB 2E1SA 3BFTA 1YYZA 4X1DA 2VGQA 5KCJB 1UIUA 2ZZWA 2HPLA 2ACXA 1KA0A 3B6QA 3ZMZB 4YT0A 3PURA 3AAIA 4PTKA 4IHJE 3T1YT 4EB6E 4PFPA 4PK4A 1UIVA 2AXDS 2P0SA 1KZ8A 3MKDA 3AA0B 3SEUA 3UGWA 2FIEA 2H7VC 3AVRA 4HWFA 4MAGA 4R75A 2OLBA 2XXXA 2WDRA 2XZEA 1NH8A 1B1XA 3CQXC 5JRCB 3CX7B 3K3OA 2D2SA 3T9UA 3OELA 4ASKA 5LA6E 1KNPA 4I50E 1NNFA 4Z0IA 4I9DA 3HN0A 3LSWA 4H9RC 4JI5T 4UVBB 4PFUA 3MJNA 1J5ET 1K9ZA 1MXUA 4NF4A 5TP9A 1FBPA 4DR3T 2EHOD 4MFRA 4NGUA 2ZMBA 4I62A 2WP9A 2IHR1 4OYKA 3UUNA 3QSLA 3AEAA 4P8BA 2VVNA 4JI4T 3PV0E 2NTYA 2Z22A 4KUMB 4FECA 3RYHE 4EQBA 4DXCA 4YXDA 4KBMB 3K6UA 4L17A 5DVFA 2I0CA 3QAXA 1S35A 4EYYR 4YHHT 1QUKA 2RC8A 2OLTA 4ISTA 5H6RB 1RKMA 2DCFA 3GBBA 2UXBT 4O3CA 3SESA 4OTEA 5I56B 1F9BA 4GBWA 4F19A 4KQPA 2EHOC 1JETA 2O6AA 3VXBA 4LMKA 2XAQB 2W0GA 3JAEA 4PFBA 1WCRA 5FXZA 3RRWA 1Y3NA 4LA9A 4X8RA 5ABGA 2V7IA 4OENA 4B3ST 1LBCA 2XQ4A 4GWWA 4C91A 2HZKA 2UVGA 2ZLYA 1IIWA 3ZKKA 3G3GA 2A72A 4PJJA 2O7UA 4RNSA 4P0BA 1MMNA 3GN5A 1I6AA 3IJOB 4NF5A 4MFIA 1J1NA 4ILBA 5I2NB 5TPAA 4F3GA 1UK5A 4XKQA 2DYXA 4GXSB 4LF9T 2R6GE 4ELRA 4Z7EA 4GWZA 2WYPA 2MYSA 4JBZA 1B58A 3QUJA 2HFBA 4PP0A 4QXHB 5M2VA 5JTYA 2PFZA 2QVRA 4YSXA 2PTFA 4M4GA 5JR9A 3IR1A 3LUYA 4O3AA 3T66A 2XM2A 3ZYMA 4LMJA 4QFPA 2WZIA 3UU4A 2F36A 5AA4B 2ZNUA 2WKYA 5HEGA 1OVBA 4F2QA 3RUMA 2UXXB 1X79A 2BS3A 5LXTE 1G0HA 5JREA 1O64A 1B7UA 3K02A 1MPBA 3FXBA 4KHZE 2B3BA 3K00A 4U21A 4GWXA 4KCDA 3HPIA 4X48A 3F2EA 5LG3A 4NF0A 5LB7B 3VHLA 4X5TA 3MWBA 3N94A 4HFIA 1XMQT 3IORA 2Q89A 2BG9A 1DCUA 4P56A 1K9YA 5AQHB 3UU3A 3V8XB 2RPAA 5EZYE 5ITPA 5L4HA 4ELOA 4DXUA 2HXWA 1E7PA 4JI0T 4QFKA 4ZEDA 2XXQA 1FEWA 3QB5K 2WU2A 3RYDA 3UN6A 3C64A 4F6RC 5FY1A 1JVYA 4M1PA 5LP6E 4BDOA 2IDOB 5AQRB 5L2LA 4XIGQ 5CA0E 2LOPA 2YJPA 4LVQA 1H45A 1XI6A 1JNFA 3RPUA 1IMBA 2VD3A 4DV7T 5FXXA 4H5GA 1LVKA 2NXOA 3EDUA 4DO0A 5L3GB 1D1AA 1QJMA 4AQFC 1DU2A 3G3IA 4PBQA 5I58A 2MKZA 4PE3A 2Q9QD 4A56A 1Y9UA 3KSXA 4GQOA 2LHRA 3P7IA 2VVSA 2V5DA 1JQFA 2V3QA 3E3KA 4KFQA 1YXIA 2JQ9A 1FPJA 4F8HA 4JI1T 3P4WA 4GFRA 2THIA 4DV4T 3EKIA 4KI0F 4N6KA 2DLRA 3DP6A 2E9XB 4JV5T 1B32A 1D1BA 3C35A 3MVXA 2YU2A 2P1SA 4UXNB 4X1BA 1H76A 2F5XA 4HFDA 5EK3A 4WKMA 1VFEA 4DR2T 4PAGA 3H3GA 1ZTYA 3V83A 2F7BA 1DOTA 5BWJA 2CLYC 3ESLA 5EHSA 3RQTA 1ZV4X 1NV1A 4DMWA 3GXAA 1UX4A 3K01A 3TODA 3AEEA 4ZE9A 2LRLA 4CXYA 2DWIA 4H9SE 2PT2A 2YDSA 3KFMA 4N8GA 2XSBA 4JB7A 1H43A 3UP9A 4AS5A 5J1GA 4EDPA 3NRXA 4GWOA 3Q25A 1AWBA 4OANA 3QXMA 3V5AA 3O29A 3AECA 4JLEA 2DOJA 1FBHA 1FJGT 1SPIA 3U65A 3PV0F 5FL1A 2PT1A 5EQ9A 2P9BA 5EQ8A 3KFWX 4R2FA 4AKLA 4LP2B 3NBXX 1EYJA 1ZBMA 4JVDA 3RIFA 2YDRA 3VVEA 4YTNA 3L6GA 2XQAA 4N6PA 1IEJA 2GFEA 2ZYOA 4OQOA 3EVYA 5AA4A 2DXYA 3LC8A 3CIRA 1I94T 3L39A 3LDQB 2H4IA 2JJ9A 4QSDA 3ZJ2A 4POXA 5IZZA 1FPDA 1L0VA 2FJDA 2B4MA 1I6BA 2ABHA 3NZQA 2I58A 3FXDB 2XXIA 5CMKA 1IXCA 2QRYA 3VR8A 4AQ4A 3DJBA 5JH7E 4ANJA 3U93A 1KF6A 1FQAA 4H63H 1CNQA 2QSXA 3AAEB 1BTJA 5M4YA 3OO6A 4P11A 3TPAA 3CFXA 5CM6A 5H8NB 4GIZA 4O94A 4XKPA 2X7PA 1KEYA 3LBXA 2XA5A 2L9QA 3GN5B 1NV6A 4G77A 2KLQA 3ZYKA 2CEYA 4M1VA 4OK0A 2CZHA 3H6UA 2XXKA 3IOWA 2F7AA 2P2AA 3KOSA 3OSQA 3MVYA 1TXFA 2XPKA 5AA2D 5ET6A 3TZAA 3CPZA 2KR0A 2LAOA 2PMSA 4ZS9A 1MIYA 5DJQC 3RH3A 3FVOA 4JXIA 2W67A 2YEVC 2M6IA 2QGSA 4IO5A 1U4QA 1LFGA 4IY5A 4QHQA 2CXDA 2BBJA 1MXWA 5LNKA 2KXPB 5AQJB 5A5XB 4XKRA 3K3QC 3PTRB 4U3CA 2BBHA 3ZT5A 5DEXB 3O6HA 2RF1A 4IY6A 4GD5A 3SERA 2CEXA 4AISA 3KJ7A 2A5TA 4H9PC 4N4UA 4H5FA 2WBDA 4F3BA 2NWBA 3EUHA 1BR2A 5AQMB 4EF2A 4LF6T 1H3DA 1A55A 4LZ8A 1XDPA 3JYRA 4HFBA 4RY1A 4X1KE 3V5UA 1B51A 2AL4A 4OVSA 3QYTA 2LJLA 3HCQA 2Q2AA 1B0HA 5AFUL 1MQDA 4BA9A 1URDA 3RIUA 4Q30B 1Z7ME 5I2KB 4DV6T 3IAZA 4AQGA 5HEHA 4G68C 3SS1A 4H46A 3CSGA 3CR9A 5CRYA 4AS4A 3PDYA 4ZEIA 2DE3A 3K1NA 3OTOT 3JC6D 2Q8JA 2OWZA 2FA7A 1GR2A 3N9LA 1NI9A 1N7XA 3I9WA 4JI2T 4PK6A 2HEUA 1B3LA 2GHBA 2N9DA 4PF8A 1URGA 5L9SA 2DE4A 4I0UA 3QIMA 3SEYA 5I57B 4WBOA 2HAUA 3O28A 1MY4A 2LSYA 3ZMVB 2NR4A 2UVJA 1LB8A 3IL1B 3PMXA 5AE4A 3O1JA 3P4PA 4P9KA 1A8EA 1T0KA 3QB5A 1NL5A 2XAHB 4ELQA 4ZOLE 5I84A 3K2DA 1NUXA 1ZJLA 1SBPA 1URSA 5JDMA 4V1Av 3C4XA 3C51A 3C98B 3HKDE 5BMVE 1MY0A 4K3FA 3TKLB 5JR9C 1Y1ZA 3DLNA 3ZT7A 3UU6A 5AQQB 1N32T 5ICTA 3AE5A 2XASB 2A5SA 3G3HA 1T72A 1YPNA 2HN1A 2A3DA 5LBQB 1UX5A 3TCFA 1XC1A 4PE5B 2O7IA 1NV5A 3G06A 1HX8A 2UYFA 1O7TA 1MMAA 1QUUA 4Z91A 1PB8A 4NG7A 4HE8A 4TX5A 3AEFA 4MCOA 1LBXA 2XWIA 4KYEA 3VLVA 3TTKA 3H37A 1MMDA 3KJTA 4YKPA 4NF4B 5TP9B 1IMEA 4R9GA 2PVUA 4F3PA 1XNRT 3ROJA 4H9NC 3PJAA 2OCUA 2GHAA 3KC0A 1YZ0A 4ZI3C 5L4EA 1XMOT 4O7MA 4THIA 1M5FA 1T98A 1D9YA 3TUSA 2XXYA 1SYIA 2NOOA 4X20E 2V84A 4UV9B 1BKAA 2IEEA 3ZYLA 1USYH 3FXQA 4B3TT 4IT4A 1MQGA 1B6HA 4QSCA 2X0HA 2M8CA 3Q29A 4COFA 2LKGA 2ES0A 4PETA 5FVKA 4HE1A 2PFYA 4EXTA 3UORA 4RA1A 4OFLA 2NOXA 2LM9A 1POTA 1HNWT 1M5BA 4J2CA 4TWDA 3AA6B 5IAIA 2A2FX 2O1LA 2WBBA 3ZCIA 5FVLA 2G29A 2VKHA 3TLWA 4FAJA 4G8NA 1Y1MA 3VVDA 3I9YA 3FV2A 5H8NA 4QF9A 2FVZA 4ZI7E 2K24A 1VE4A 3TLUA 3KZGA 4WW0A 1CE2A 2REJA 4OEUA 3LJCA 1QUJA 3H6VA 4GRKA 2VKOA 1XVYA 2QMWA 4O4HE 3RQWA 5HXCA 2LSJA 1II5A 4F18A 4TZ4C 4EQ9A 4EEDA 3AE4A 1EU8A 4JI3T 3PUWF 3RYFE 5JDFA 4Q5TA 4C0RA 3CHGA 1SI0A 3NRYA 4PFWA 2Y8DA 4JWYA 5AQPB 3OMBA 1HTJF 4IREA 5L47A 2RA1A 4H9OC 4I40A 1PB9A 3N9OA 2VQFT 3IB2A 4U31A 1FBFA 3G3KA 4NQ8A 3OEKA 4KX6A 2X26A 1FQBA 5FBPA 4O4LE 1NH7A 2DP8A 5I5PA 3UQ4A 3CG3A 2FJAA 2XAFB 2RKMA 4N07A 4IIJE 3AXJA 4AKRB 2VP1A 3IF8B 3IFAA 3ONXA 2H7OA 4BDQA 3CKDA 2CE7A 3HKCE 3PU5A 3I1AA 2BZBA 1P1WA 3NKZA 2F6PA 2QS1A 3R6NA 1WDNA 2G93A 4XKNA 3OOAA 3WAEA 5HPQA 3C36A 1YQ3A 4A97A 3MP6A 3OSRA 2BG9C 5I56A 2ZM2A 3ZMUB 2UUCT 2F34A 3THIA 3CMLA 3LR1A 4MNIA 1QW0A 5LDZA 4EAHA 3HHFA 3U78A 1LBZA 1G0IA 1YKEB 5EQ7A 5H6QB 4N81A 2X66A 5LHHB 4PQJA 1FTLA 4DV2T 2BDEA 3TCHA 4PAFA 4AKGA 5J0ZA 5LHGB 4PCDA 3N2OA 3UIFA 1XHYA 1POY1 5FXVA 2Z23A 4GWYA 3NOHA 1WFDA 2CA5A 2E9XA 2LT3A 2XAGB 3A3CA 2CMRA 2HHHT 4NF6A 2R71A 1NEKA 1W0AA 3KV9A 1DTZA 1MH4A 1MIVA 3VRAA 4P3LA 3I5OA 4JWXA 3IB1A 3K0VA 1A7LA 5HCJA 3RYIE 3PMWA 4AQYT 1NNTA 3TDJA 2LSGA 2GH9A 2A9UA 1CUNA 1WR6A 2LOSA 3PUGA 1FPKA 5KCJA 4GIWA 1FBDA 1JW5A 4H8IA 1AH5A 2V7MA 4LF5T 4KYDA 4B3RT 1Y4CA 5FXWA 2ZZVA 5LMUT 4MMPA 2YINA 4AKHA 2O51A 5F24A 5TAOA 5AA2B 3MZBA 5DEXA 4HFCA 1LRZA 4LF7T 4HN9A 3HO7A 3M3LA 4DR6T 4OHFA 3RPWA 2UU9T 4NF8B 2F3BA 2VURA 2NVUB 1FJ9A 2XQ7A 1NNPA 5CI5A 5IUXA 3S9NC 2JQKA 2HPJA 2MPKA 2YN6A 3PE0A 4DIGA 1N84A 2REGA 4LFAT 1B3HA 1PBQA 5H8HA 4LZ5A 2WZHA 2Y5KA 2I4BA 2VL8A 4P0GA 2C0SA 2DWKA 4RYAA 4EUOA 1RDZA 2PFVA 5BR8T 3AAAB 3Q2MA 5IZ1A 4GBVA 1MXVA 4F29A 4E0XA 2DQVA 3OVUA 4IGTA 3MPKA 1IXIA 4QH4A 4ZXLA 4GVOA 2YPNA 4HE2A 4KHZF 2EHOB 2I59A 1FRPA 2WYKA 3PU8A 3H3AA 2Q9QA 3FB2A 3TLVA 2I0BA 1B4HA 3CQCB 2PYYA 1WRDA 1NWMX 3DTOA 3VLWA 2KWHA 3L3PA 3C4MA 4E0WA 2WDVA 1HR0T 4JBWF 1NAFA 3C4WA 2JIWA 4IDNA 4YB6A 4GX3A 3ZC1A 2ODUA 3H7MA 3TTMA 5FHMA 1NUYA 2X67A 1X9BA 1MRPA 4QHOA 1OWAA 4EXKA 2DWAA 1SI1A 2Y7IA 2D5UA 2JMHA 3SKPA 3OXNA 2WMOA 1B5HA 2ZZXA 3ZLIA 2AIXA 1B1HA 1IMCA 4QSEA 2W61A 2JQHA 2HPGA 1EH3A 3AA1B 2I6EA 2RC7A 4QBAA 4OFOA 3FJ7A 4XFEA 3EPEA 3KV6A 2DWHA 1Y4TA 3KBUA 3OO8A 3MJXA 2V6YB 2FYIA 2LSKA 5FP3A 3ZS6A 1Y01A 3MP8A 3IK6B 2FUPA 3LFMA 4MLQA 4QFLA 4H67A 1QSDA 1M7KA 1SD3A 3FJGA 5J16A 2NUVA 1XT8A 1OIBA 3M8UA 4GKKT 1FIOA 3FZMB 3RKGA 5DW8A 3H3MA 3PPRA 1B0LA 3U3IA 1N34T 1ZU0A 3FZVA 1NENA 3TLSA 2M6BA 3DELB 5J1DA 4MIJA 1SVXB 4G63A 2DXRA 3CVRA 4I55E 3H03A 3SEXA 4LUBA 2V26A 4N91A 4HCYA 4G8HA 2RC9A 2Q8MA 4DE8A 2Z8EA 2ZYMA 4MNPA 2JQQA 5CJ5A 2E2AA 3RHWA 5LYJE 4KHPT 1B3EA 2FBWA 2DHRA 4UELA 3FHNA 4ADZA 1UTBB 2L3LA 3CVGA 1HF8A 4GX4A 3QOFA 3E78A 4DI3D 3KDSE 4IGUA 1YCJA 4I43B 2B3FA 1PC3A 1XVXA 3M3FA 1DPEA 4IDOA 2ZM6T 3MA9A 4YTMA 5DABA 1YQ4A 3W15C 4ESWA 1R9QA 3RF1A 1ZOYA 5LOMA 5FTIA 3NWIA 2WM9A 5HXHA 4IO6A 4PDDA 2F97A 3W15B 2BKPA 3C33A 4X65T 2IA4A 1AJ3A 4FATA 4H63V 4CN4A 1N7WA 4ZECA 3I0OA 1FQFA 1LCFA 4FEBA 3VKGA 4G8MA 4IO2A 3Q5WA 5HXRA 1LAHE 5DT6A 1ZHCA 2CLYB 3E9XA 4PJLA 3ZKRA 4JYAT 1AMFA 3UA8A 4L9IA 2D3IA 3O1IA 4JVCA 4OVTA 1B7HA 1MPDA 2DDKA 4NUUA 3D1RA 4WBNE 1QKAA 3KVBA 3ABVA 3EHTA 3QMFA 4HEAA 2K48A 5HWXA 3FGSA 4NE4A 3K8PC 1VOMA 2QFLA 4WEPA 3MAMA 2MTQA 1TFAA 3K6XA 4UVCB 1D4NA 5B70A 4CN6A 1WODA 4YSYA 2P3NA 2OV9A 4R9FA 4JDFA 4MALA 3IX1A 5IZ3B 2LHNA 1JW1A 3FXRA 4F22A 1D0ZA 2QPQA 2H98A 1D9QA 2Q88A 3F11A 2C5JA 3J9X1 3LSFB 4XF5A 2F78A 1T7SA 5ITOA 3IO4A 3CSBA 5H8FA 4FI5A 5K2YA 4AKIA 2E8IA 4JEHB 4H65A 2DI4A 3QNUA 3BBRA 1ZKEA 4U7IA 1OEDE 2L5VA 4IDQA 5CA1E 1ANFA 1GV8A 5LGUB 3Q27A 3B5MA 1MQJA 3T1HT 4UIGA 5HBCA 4BDRA 3Q28A 2NW8A 4U33A 4TQUQ 2L8KA 2F8DA 4F3SA 2HAVA 3RKOA 2XQ9A 4IR8A 3U8QA 1QVSA 2E5LT 4KYSA 1R1NA 3IOVA 2YLNA 4X64T 1MH3A 5ABFB 4KR5A 3HI2A 3DP8A 4P0AA 5FHOA 4OVQA 3PD8A 5J2UE 5KX5E 1TFDA 1JEUA 1KFYA 2IW5B 1SW5A 4H1XA 4KP3C 5AA2A 1FPEA 2P3VA 3T1BA 3PUWE 2E9XC 3TAJA 2X0LB 2O69A 3EF7A 1DTGA 3C9HA 2QRXA 4CZZB 1XOCA 4UA8A 2WX9A 4DVDA 2YKSA 3F57A 4BJNA 5FYMA 1M5EA 1MM6A 4ZEKA 2KWIB 4ZDMA 1HNXT 3SEWA 4GX6A 4MHCA 1US4A 1FPBA 1A99A 4YMAA 2DVZA 2LEHA 5TPAB 5LHIB 4HFEA 4DV3T 3AE7A 1YKHB 4U2ZA 1LBYA 4LN5A 4R2BA 4MBPA 5LJMA 1BR1A 4X1IE 5KDTA 4KCCA 4RJZA 4EYUA 4NAPA 5CBSA 4N17A 3CQGB 2H99A 4FBPA 3VXCA 2XQYA 4OEVA 1B3FA 4NUVA 2Y5LA 1OMPA 4BDMA 1SHZC 4U2YA 2JJKA 3O6IA 4IO3A 1IAPA 2MOZA 2RP4A 3UU5A 1LCTA 1HSEA 2CHNA 2E5VA 1H44A 3AE1A 4HKAA 3FVKA 1FTMA 1Y20A 3VVFA 4JI8T 2Z8FA 3G3FA 2F6GA 2ZMAA 4HGAA 1MDP1 1W09A 1A54A 2BVLA 3MBPA 4PDHA 1S94A 2KT9A 5EYFA 3LBXB 1MDQA 4OFJA 4DI4B 4P1LA 3N5LA 2WWUA 4IO7A 2Y84A 2AL5A 1EYIA 4TN7B 1FCKA 2UUBT 4ZZAA 3T9XB 5F5WA 1IUDA 4AQFA 4ZZEA 2H89A 2J4GA 1MNDA 1EZ3A 2R8TA 2E9XD 3N9PA 3LK42 3KG2A 4POWA 5LGNB 2XJ7A 3LK3B 2FBPA 5J2TE 2H88A 4R6KA 1D0YA 3O66A 1VCTA 3WAJA 4ONYA 3PUAA 5LTCA 2BKNA 1QKBA 2XXHA 5DQWA 4GK5E 3Q9DA 2DS9A 4XZCA 1ZEEA 4X62T 3LBSA 2LKHA 5JVDE 2N1GA 3KBRA 2W4XA 2GQ1A 4Z8XA 4IDZA 3ZCJA 3DM0A 5IZ3A 5HEJA 1EYKA 1US5A 4PF6A 3VDFA 3PTYA 1AL3A 1PEBA 2D5WA 2W00A 1R8IA 2BKOA 4ZS3A 5JQGE 5LCYA 2BS4A 3RC8A 4C1UA 2XWKA 4PGPA 4QFOA 1MNEA 1Z0PA 1I6ZA 2WAUA 4NMYA 4U2RA 3FZLB 3CIJA 4MX6A 1OQGA 2K3WA 4NHBA 3N6TA 3S9LC 2LSIA 5HAXA 4KD5A 3C34A 2DNXA 1PDAA 2Y7KA 4X04A 5JDLA 4H45A 4RK2A 1LVFA 4YKIA 2V25A 3N6UA 5JDGA 4F1VA 3OO9A 3RIAA 1ZMGA 2FJBA 2JPFA 1WVJA 3UFEA 2WMNA 4OHNA 4PJMA 1KA1A 4U23A 2XXRA 3GMIA 5JEIA 3U94A 2VPOA 4G61A 4E7SA 3ZMSB 3EQ1A 2VL0A 3AEGA 2ZYNA 3E0ZA 1IITA 1SW1A 2PCRA 1HCIA 2ZNSA 4U7YA 3K6WA 4Q8RA 4U1OA 4DR7T 1FPGA 1NV0A 1FPFA 4DCYA 3T22A 2F35A 3V89B 3E08A 3TYHA 3MUQA 3ZSSA 1FJ6A 4XTCQ 2V7KA 1LAFE 1MXXA 1NUZA 4GOTA 4NF5B 4G68A 2ONKE 4ILAA 5F8PA 4IE0A 2LRKA 3ZSTA 1J5WA 1ZP0A 3KINB 1SE7A 4Q0CA 1BIYA 4QFNA 3VFJA 1MS7A 4ZI2D 2X9HA 4IE6A 2FJEA 3P4RA 1EZ9A 4HW8A 2ANJA 4EGWA 2IAKA 5A1LA 3ZPOA 5JDQA 1OEDB 1IJ5A 4MLKA 1D9VA 2HHMA 4DDDA 1USYE 2CCQA 1FTAA 4R6HA 5CFBA 2VD2A 2VKDA 1LLSA 1T8BA 2HQ0A 5EK4A 1ZLQA 1UTBA 2VK9A 1MXZA 3K6VA 2B4LA 3T9HB 4YKJA 5ICQA 3KV4A 4ZEBA 1OEDC 4YFSA 3Q5XA 3C31A 2IIUA 1FTJA 4JI6T 3G7WA 3PD9A 3MVWA 3AE3A 3RX6A 3K1PA 4AXPA 4YICA 3CWZB 3HSTA 1FBCA 5FY7A 3KN7A 3PUZE 5CMBA 4TLMB 4DBQA 4YHJA 3FD3A 2D9DA 3EDVA 2OWTA 4U1ZA 2WY2A 1IBKT 4N78D 5FHNA 3PPQA 3PUYE 1IMFA 3ECRA 4WXJA 3A3UA 4H6DA 4L5GA 3WAFA 2OK2A 2V7JA 3HA4A 1B05A 3TFLA 4ZZBA 3MP1A 4I3EA 2ZNTA 1XZYA 4N13A 2IUBA 5CBRA 3K4UA 2YOEA 3CFLA 2XY8B 4HFHA 3MK7C 4LF4T 4OESA 2KINB 3ETVA 4TV8E 3OJAA 1MQHA 5LGTB 3BQLA 4ISUA 3OO7A 3SRZA 3EN3A 5ET7A 2ONRA 3PPNA 3JCFA 1KNRA 3E22E 3O2AA 2H25A 2XXPA 4FJPA 3E13X 4PAKA 1P1OA 4R72A 4NIQA 3AEBA 1VSOA 3K1MA 5DTBA 4KI0E 3RT6B 5F7VA 4HWCA 1NV4A 3GA8A 1DK4A 1LBVA 2IC9A 3H6WA 1LKXA 3MZ9A 5I58B 2KNDA 1B5JA 2CM0A 1B9JA 2PJQA 4MHFA 1JW4A 2QVVA 3MC2A 5LMNT 3I3VA 2VWAA 3DP7A 3UT5E 3U72A 4CN1A 3JV9A 5CMMA 3B57A 4R73A 4IDPA 3QC9A 4PNIA 1OLAA 3RYCE 3T96B 4PC9A 3JC6C 4UF0B 1FW0A 3H06B 2SPCA 5CB4E 5JR9B 5JK4A 1FPLA 3S2VA 1HG5A 2XHEB 5EK2A 4RK9A 1FPIA 4XBFB 4HCWA 4TLLB 4N15A 2F3DA 3PUVF 3KBTA 5FY0A 4PAIA 1NNKA 4HTGA 2Y7PA 1N3XA 4NPPA 3RLFF 4LONB 4JSOA 2Q2CA 2QYWA 4ZEYA 2ODVA 5HXEA 2V3UA 3ETUA 5AQOB 3OPCA 3O9PA 3OD7A 4PFRA 3KC1A 4GYSA 3MZKB 5L9MA 1XS5A 1JP4A
chains in the Genus database with same CATH topology
2VASA 5JDHA 1KWHA 1I69A 2Y7RA 1IJ6A 4GXAA 3IEEA 1Y64B 2CMOA 1GGGA 2YU1A 4NEDA 3TQWA 4RXLA 3VLUA 4BJMA 4YMBA 3DP4A 3C50A 4R74A 1B2HA 4OXVA 2PX1A 4HS7A 3LSLA 5TU0A 3O9XA 3TEPA 4F31B 3UUMA 5I2NA 4LQ2A 2DE2A 3ILTB 1VFDA 3ZC0A 4WEDA 2MBGA 3MXZA 2D21A 5KMGP 1PB7A 4UACA 3FVGA 1AIVA 4GYRA 1FQEA 4LZ7A 1MY1A 4C1TA 3RTWB 2D0UA 1I6QA 2DVCA 4PFTA 4OYVA 4RPNA 3PUXE 5I2KA 1DMBA 3VV5A 1RYOA 1TWYA 4MH5A 1S50A 4TOZA 3BKIB 2K9AA 3KSJA 2C5KT 1B52A 4U72A 3HV1A 1EZOA 3HR0A 5H8QA 1Q1KA 3KOTA 2AYSA 3HL6A 3RTFB 1OVTA 3T9VA 1NMUA 5HXSA 1NKXA 4FIMA 1IZ1A 4OWDA 5KDMC 2PBIA 1SDXA 1WYBA 5LG4A 3H4ZA 3J7Yq 4CI1B 3CRBA 5F1QA 5I59A 2HZLA 4CI2B 3IB0A 5DYHA 1YW0A 4MF3A 4YB5A 4CXXA 3KEIA 3TCGA 4EIWA 2CXLA 5L3FB 4AB5A 1P1QA 2OBGA 2B65A 5I59B 1SQYA 1ATGA 1FQDA 3PMVA 4ZEFA 5KZTA 1B46A 5BUUA 5AA1A 4ND9A 5KDTB 3RRCA 5ELVA 4ESXA 4UV8B 3CFZA 1Z7NE 1GTKA 1HG2A 3FIRA 3IOTA 4QKNA 3OENA 4KMCA 4JWOA 4FJOA 3PUQA 1GVCA 1YAEA 2JMKA 4ERRA 3N9QA 3OKQA 1MXYA 4DZ1A 1TT1A 5FNVE 3GZGA 3O4XE 2C5IT 1Y3QA 3MQ9A 3WAKA 4P09A 2UXAA 4PFYA 1O63A 3ZKLA 3Q26A 1YTVA 3N26A 2NW9A 3UTKA 4I8CA 5H8FB 4IE7A 4EZHA 4OERA 5DVIA 4ZI2C 1N3WA 5CMCA 4AB6A 4OFZA 2V3TA 5I57A 4G68B 3FXEB 4I4TE 3C32A 2WSSV 2O84X 4ISSA 4CQIA 2H5YA 3LSXA 4YZZA 5JDNA 2UVIA 1D1CA 1BR4A 4U4SA 1OQHA 4IE4A 4GF8A 2CWYA 3W9WA 5H8SA 3USDA 4BDLA 4QRZA 1QUIA 1OXZA 3SOLA 1V9DA 2KZ7B 2Z8DA 1SW4A 1U5PA 3HKEE 5A5XA 3ZN1B 2UYEA 1LBBA 1IXHA 1IQ7A 3R26A 3JZJA 5HM4B 3B6WA 2JRKA 4EXLA 1P1UA 2NTXA 5IKBA 5C8YE 1SA0E 3OBVE 5LOVE 3P8CD 5FMNA 4ECFA 1ZKBA 1B7TA 4U4XA 2Z6EA 4WNKA 4DXBA 3I0QA 3GLBA 1HS7A 1H7CA 1L5TA 4YJ2E 1OLCA 3N9NA 3C4ZA 2ESNA 5LJNA 3B13A 4UF0A 3U92A 2W7YA 1JEVA 3L6HA 1RYXA 1R6ZA 4E7ZA 4O2AE 4EZ4A 3UULA 1MM7A 3ZN0B 1Y3PA 3N2GE 2NW7A 4UVAB 3IOUA 4OETA 4QX7B 3IHRA 2I3VA 2XD3A 3OEMA 4H9QC 2F7CA 2CXFA 4HTEA 5F3JA 1ZIUA 4IO4A 4NWDA 4C90A 2X68A 2ZXTA 4F1UA 4ZE8A 1P1NA 5L9OA 4DBRA 1B40A 3R84B 5K2XA 1FTOA 3MVZA 2RINA 3MZ1A 4LQ5A 3CX8B 2XTLA 3TMGA 3KGCA 1DSNA 2V93A 4OVJA 1BR0A 2I49A 4MLVA 3TQLA 1US7B 2YK0A 1SW2A 2OZZA 1D0XA 1S9TA 2NP9A 3ZEFB 3GWHA 1UCUA 1MPCA 4FEDA 1LFHA 4ELPA 2RCBA 2XX7A 2W62A 1FMVA 4GOUA 3FVNA 3CG1A 2OWSA 5ETWA 5L8DA 4H0WA 3V5SA 5AA3A 2XX8A 2D0TA 3EHUA 3W9VA 4QWNB 4RPOA 2FNCA 4X1YE 3FBLA 4NTLA 4ZS2A 3ZMTB 1MG1A 4BAYB 4EOZB 3FUZA 3RT8A 2DWJA 4O4IE 2CEAA 3FJMA 1M5CA 1S7YA 5GONE 1N76A 4TV9E 3N9MA 5L3CB 3D4CA 3R6UA 1D3KA 3AA7B 4TUYE 3QUFA 3OYXA 5JTYB 4PW8A 1IZNB 3KV5A 1MY2A 1Q35A 2VKJA 3H6TA 3RN8A 3CI8A 3MPLA 4FORA 4DNDA 2R9JA 4IB2A 2NWJA 3BK9A 2XHDA 3M65A 2ZM0A 3MACA 1WLXA 2LE8A 3SEVA 1O3XA 1B3GA 1YD8G 4O3BA 4R6YA 1UQWA 1FMWA 4GL0A 2ZYKA 3VU7H 3KVAA 4CI3B 4AI6A 3ZJ1A 5CC2A 3D4GA 4IGRA 2Y6XA 3IBPA 2I3WA 1LGBC 5IHYA 1IXGA 2HH7A 2CZLA 3T8OA 3S9EA 1G8XA 2GRVA 4ZI3D 3FV1A 3RGYA 2X51A 4PFOA 3ONMA 5H8HB 1MMGA 4CXWA 2QS3A 4NF6B 2QS4A 1KK7A 3SWHA 1CB6A 3RLFE 3UUXB 4PK5A 5HWYA 4OMBA 4O2BE 2V7LA 2X7QA 3TTRA 4X9TA 4U74A 4BLAA 1E1HB 4BDNA 3RY3A 3ZSFA 2XD2A 1AOVA 2O1MA 4K0UA 3LK2B 2EHOA 2XXVA 3SDFA 3B6TA 2UVHA 5FTHA 3K3NA 4LATA 4GK0E 2PG8A 5E0OA 5JRCA 1NFTA 1LAGE 3SETA 2Q9TA 2XAJB 2K5BB 3PPPA 2VHAA 1MIWA 2CWOA 3AB3B 2PBWA 4O4JE 1G73A 4GLIA 3D0TA 2XXTA 2QA7A 4YJ3E 4ILUA 1BP5A 4O8SA 4UEMA 1HSLA 1M5DA 3PU3A 3RC3A 2A5TB 2XXWA 1A8FA 1KNZA 3B7DA 4MBQA 1B5IA 2ONSA 4U22A 3S9MC 3M3KA 3RNNA 1LB9A 1B4ZA 1MY3A 3KN3A 5DQVA 3LG7A 4YU0A 4KPTA 4JEUB 2IC6A 2Y48B 3R7XA 2V1DB 1N04A 3L09A 2O68A 4G4PA 3CX6B 4HFVA 2Q9QC 4H8JA 2X9XA 2QMXA 1UTHB 3PGFA 1FQCA 1VRBA 3G3JA 5LBMA 4OZ9A 2Q9QB 3O1HA 3MW0A 1HFAA 1EZPA 3TELA 4QXCB 5IYZE 4ZHQE 4FE8A 2I4CA 5H8QB 3BQKA 1UTHA 3HKBE 4P0IA 4NF8A 4B6XA 4L0RA 2XUEA 5ISUA 3BQIA 2H9BA 1LAXA 2ZM8A 2DSFA 3ODBA 3AVSA 2X9WA 3S4UA 2G0UA 4DMVA 2RCAA 3IJXB 3U1OA 3A5XA 2VOZA 3N2KE 4G2ZA 4F39A 1B7ZA 3ANWB 4F1YA 2DWGA 2B1EA 4OYJA 2Y7WA 2QJEA 4DLDA 1LSTA 3FXUA 3EHSA 2N2NA 5EHMA 3F31A 3O6GA 5L3EB 3TTNA 5DVJA 3PUVE 1MQIA 3PUSA 3I6VA 3AXFA 3UK4A 3OYZA 1N0TA 4PJNA 2QS2A 1HSJA 1P99A 2X9YA 3TKDA 3GBAA 2XX9A 2HCAA 1DPPA 1QULA 4EQ7A 4NWCA 4G2AA 3TTLA 1ELJA 2XXUA 5B7DA 3ILUB 5HYAA 1JVXA 3KN8A 3IO6A 1PBPA 4JUYA 4YLHA 4XAXB 4XXUA 2KLFA 3BFUA 4IE5A 1R9LA 3FASA 5L3BB 2OJTA 3T93B 1A40A 3A09A 4EF1A 2ALUA 3VE1B 3FBZA 2OA5A 4F2OA 5ADXL 2WBLA 4QXBB 1VR5A 2W63A 5L3DB 2KMFA 3HHGA 2I48A 2H3RA 3QK6A 2BVMA 1LFIA 1WYCA 4DCXA 3FATA 2VB6A 4YB7A 1SYHA 3E4RA 4YKKA 2GK9A 3PPOA 4QX8B 3NZPA 1BLFA 2BJJX 1FTKA 2QL3A 2E0SA 4GL8A 4I1DA 3ANWA 4JSDA 3VKHA 3WI3A 3O97A 4YAHX 2J1DG 2M67A 2UXNB 2E1SA 3BFTA 4X1DA 2VGQA 5KCJB 1UIUA 3B6QA 2HPLA 2ACXA 3ZMZB 3PURA 3AAIA 4IHJE 4EB6E 4PFPA 4PK4A 1UIVA 3UGWA 2P0SA 3MKDA 3AA0B 3SEUA 2H7VC 3AVRA 4R75A 2OLBA 2XXXA 1NH8A 1B1XA 3CQXC 5JRCB 3CX7B 3K3OA 2D2SA 3T9UA 3OELA 4ASKA 5LA6E 4I50E 1NNFA 4Z0IA 4I9DA 3HN0A 3LSWA 4H9RC 4UVBB 4PFUA 3MJNA 1MXUA 4NF4A 5TP9A 2EHOD 4MFRA 2ZMBA 4I62A 4OYKA 3UUNA 3QSLA 3PV0E 2NTYA 2Z22A 4KUMB 4FECA 3RYHE 4EQBA 4DXCA 4KBMB 3K6UA 4L17A 5DVFA 2I0CA 3QAXA 1S35A 4EYYR 1QUKA 2RC8A 5H6RB 4ISTA 1RKMA 2DCFA 3GBBA 3SESA 4O3CA 4OTEA 5I56B 1F9BA 4F19A 4KQPA 2EHOC 1JETA 2O6AA 3VXBA 2XAQB 2W0GA 5FXZA 3RRWA 1Y3NA 4LA9A 2V7IA 4OENA 1LBCA 4C91A 2HZKA 2UVGA 2ZLYA 1IIWA 3ZKKA 3G3GA 2A72A 4PJJA 2O7UA 4RNSA 4P0BA 1MMNA 3GN5A 1I6AA 3IJOB 4NF5A 4MFIA 1J1NA 5I2NB 5TPAA 4F3GA 4XKQA 2DYXA 4GXSB 2R6GE 4ELRA 4Z7EA 2MYSA 4JBZA 1B58A 3QUJA 2HFBA 4PP0A 4QXHB 5M2VA 5JTYA 4M4GA 5JR9A 3IR1A 3LUYA 4O3AA 3T66A 3ZYMA 4QFPA 2F36A 5AA4B 2ZNUA 2WKYA 1OVBA 4F2QA 3RUMA 2UXXB 1X79A 5LXTE 5JREA 1O64A 1B7UA 3K02A 1MPBA 4KHZE 2B3BA 3K00A 4U21A 4KCDA 3HPIA 4X48A 3F2EA 3VHLA 3MWBA 3N94A 3IORA 2Q89A 3V8XB 5EZYE 5ITPA 4ELOA 4DXUA 2HXWA 4ZEDA 4QFKA 2XXQA 1FEWA 3UN6A 3C64A 4F6RC 5FY1A 1JVYA 4M1PA 5LP6E 4BDOA 5L2LA 4XIGQ 5CA0E 2LOPA 2YJPA 4LVQA 1H45A 1JNFA 3RPUA 2VD3A 5FXXA 4H5GA 1LVKA 2NXOA 3EDUA 4DO0A 5L3GB 1D1AA 1QJMA 4AQFC 3G3IA 5I58A 2Q9QD 4A56A 1Y9UA 3KSXA 4GQOA 2LHRA 3P7IA 1JQFA 2V3QA 3E3KA 4KFQA 4GFRA 2THIA 2DLRA 3DP6A 2E9XB 1B32A 1D1BA 3C35A 3MVXA 2YU2A 2P1SA 4UXNB 4X1BA 1H76A 2F5XA 5EK3A 4WKMA 1VFEA 4PAGA 3H3GA 1ZTYA 3V83A 2F7BA 1DOTA 5BWJA 2CLYC 3ESLA 5EHSA 3RQTA 1ZV4X 3K01A 4DMWA 3GXAA 1UX4A 3TODA 4ZE9A 4CXYA 2DWIA 4H9SE 2PT2A 3KFMA 4JB7A 1H43A 3UP9A 4EDPA 5J1GA 3NRXA 4GWOA 3Q25A 3QXMA 3V5AA 3O29A 4JLEA 2DOJA 2PT1A 2P9BA 3KFWX 4R2FA 4AKLA 4LP2B 3NBXX 1ZBMA 3VVEA 3L6GA 4N6PA 1IEJA 2GFEA 2ZYOA 4OQOA 3EVYA 5AA4A 2DXYA 3LC8A 2H4IA 2JJ9A 4QSDA 3ZJ2A 4POXA 1I6BA 2ABHA 3NZQA 2I58A 3FXDB 2XXIA 5CMKA 1IXCA 2QRYA 4AQ4A 3DJBA 5JH7E 4ANJA 3U93A 1FQAA 4H63H 2QSXA 3AAEB 1BTJA 5M4YA 3OO6A 4P11A 3TPAA 3CFXA 5CM6A 5H8NB 4GIZA 4XKPA 2X7PA 3LBXA 2L9QA 3GN5B 4G77A 2KLQA 3ZYKA 4M1VA 4OK0A 3H6UA 3IOWA 2F7AA 2P2AA 3KOSA 3OSQA 3MVYA 1TXFA 5AA2D 3TZAA 3CPZA 2LAOA 2PMSA 4ZS9A 1MIYA 5DJQC 3RH3A 3FVOA 4JXIA 2YEVC 2QGSA 4IO5A 1U4QA 1LFGA 4IY5A 4QHQA 2CXDA 1MXWA 5LNKA 2KXPB 5A5XB 4XKRA 3K3QC 3PTRB 5DEXB 3O6HA 2RF1A 4IY6A 4GD5A 3SERA 3KJ7A 2A5TA 4H9PC 4H5FA 4F3BA 2NWBA 3EUHA 1BR2A 4EF2A 1H3DA 1A55A 4LZ8A 3JYRA 4RY1A 4X1KE 3V5UA 1B51A 2AL4A 3QYTA 2LJLA 3HCQA 2Q2AA 1B0HA 5AFUL 1MQDA 4BA9A 1URDA 4Q30B 1Z7ME 5I2KB 3IAZA 4G68C 4AQGA 3SS1A 3CSGA 3CR9A 5CRYA 3PDYA 4ZEIA 2DE3A 3K1NA 3JC6D 2Q8JA 2FA7A 1GR2A 3N9LA 1N7XA 3I9WA 2HEUA 4PK6A 1B3LA 2GHBA 2N9DA 1URGA 5L9SA 2DE4A 3QIMA 3SEYA 5I57B 4WBOA 2HAUA 3O28A 1MY4A 2LSYA 3ZMVB 2UVJA 1LB8A 3IL1B 3PMXA 5AE4A 3O1JA 1T0KA 1A8EA 1NL5A 2XAHB 4ELQA 4ZOLE 5I84A 3K2DA 1ZJLA 1SBPA 1URSA 5JDMA 4V1Av 3C4XA 3C51A 3C98B 3HKDE 5BMVE 1MY0A 4K3FA 3TKLB 5JR9C 1Y1ZA 3DLNA 5ICTA 2XASB 2A5SA 3G3HA 1YPNA 2A3DA 5LBQB 1UX5A 3TCFA 1XC1A 4PE5B 2O7IA 1HX8A 2UYFA 1O7TA 1MMAA 1QUUA 1PB8A 4HE8A 4TX5A 4KYEA 3VLVA 3TTKA 3H37A 1MMDA 3KJTA 4YKPA 4NF4B 5TP9B 4R9GA 2PVUA 4F3PA 4H9NC 2OCUA 2GHAA 4ZI3C 4THIA 1M5FA 1T98A 1D9YA 3TUSA 2XXYA 1SYIA 2NOOA 4X20E 2V84A 4UV9B 1BKAA 2IEEA 3ZYLA 1USYH 3FXQA 1MQGA 1B6HA 4QSCA 2M8CA 3Q29A 2ES0A 4PETA 4EXTA 3UORA 4RA1A 4OFLA 2NOXA 2LM9A 1POTA 1M5BA 4J2CA 3AA6B 5IAIA 2A2FX 2O1LA 3ZCIA 2G29A 2VKHA 4FAJA 4G8NA 1Y1MA 3VVDA 3I9YA 3FV2A 5H8NA 4QF9A 4ZI7E 2K24A 1VE4A 3KZGA 4WW0A 2REJA 1CE2A 4OEUA 3LJCA 1QUJA 3H6VA 4GRKA 2VKOA 1XVYA 2QMWA 4O4HE 5HXCA 2LSJA 1II5A 4F18A 4TZ4C 4EQ9A 1EU8A 3RYFE 5JDFA 4Q5TA 4C0RA 1SI0A 3NRYA 4PFWA 2Y8DA 4JWYA 3OMBA 1HTJF 2RA1A 4H9OC 1PB9A 3N9OA 3IB2A 3G3KA 3OEKA 2X26A 1FQBA 4O4LE 1NH7A 2DP8A 3CG3A 2XAFB 2RKMA 4N07A 4IIJE 4AKRB 2VP1A 3IF8B 3ONXA 2H7OA 4BDQA 3CKDA 2CE7A 3HKCE 3PU5A 3I1AA 2BZBA 1P1WA 2F6PA 2QS1A 3R6NA 1WDNA 2G93A 4XKNA 3OOAA 3WAEA 5HPQA 3C36A 3MP6A 3OSRA 5I56A 2ZM2A 3ZMUB 2F34A 3THIA 3CMLA 3LR1A 1QW0A 4EAHA 3HHFA 3U78A 1YKEB 5H6QB 2X66A 5LHHB 4PQJA 1FTLA 2BDEA 3TCHA 4AKGA 5LHGB 3N2OA 3UIFA 1XHYA 1POY1 5FXVA 2Z23A 2CA5A 2E9XA 2LT3A 2XAGB 3A3CA 2CMRA 4NF6A 2R71A 3KV9A 1DTZA 1MH4A 1MIVA 3I5OA 4JWXA 3IB1A 3K0VA 1A7LA 3RYIE 3PMWA 1NNTA 3TDJA 2LSGA 2GH9A 1CUNA 1WR6A 2LOSA 3PUGA 5KCJA 4GIWA 1JW5A 4H8IA 1AH5A 2V7MA 4KYDA 1Y4CA 5FXWA 2YINA 4AKHA 2O51A 5TAOA 5AA2B 3MZBA 5DEXA 1LRZA 3HO7A 4HN9A 3M3LA 4OHFA 3RPWA 4NF8B 2NVUB 1NNPA 5CI5A 3S9NC 2HPJA 3PE0A 4DIGA 1N84A 2REGA 1B3HA 1PBQA 5H8HA 4LZ5A 2I4BA 2VL8A 4P0GA 2C0SA 2DWKA 4RYAA 4EUOA 2PFVA 3AAAB 3Q2MA 1MXVA 4F29A 4E0XA 2DQVA 4IGTA 3MPKA 1IXIA 4GVOA 2YPNA 2EHOB 2I59A 3PU8A 3H3AA 2Q9QA 3FB2A 2I0BA 1B4HA 3CQCB 2PYYA 1WRDA 1NWMX 3DTOA 3VLWA 2KWHA 3L3PA 3C4MA 4E0WA 1NAFA 3C4WA 4YB6A 3ZC1A 2ODUA 3H7MA 3TTMA 5FHMA 2X67A 1MRPA 4QHOA 1OWAA 4EXKA 2DWAA 1SI1A 2Y7IA 2D5UA 2JMHA 3SKPA 3OXNA 2WMOA 1B5HA 3ZLIA 2AIXA 1B1HA 4QSEA 2W61A 1EH3A 3AA1B 2I6EA 2RC7A 4OFOA 3FJ7A 3EPEA 3KV6A 2DWHA 1Y4TA 3KBUA 3OO8A 3MJXA 2FYIA 2LSKA 5FP3A 3ZS6A 3MP8A 3IK6B 3LFMA 4MLQA 4QFLA 4H67A 1QSDA 1SD3A 3FJGA 2NUVA 1XT8A 1OIBA 3M8UA 1FIOA 3PPRA 1B0LA 3U3IA 1ZU0A 3FZVA 3DELB 5J1DA 1SVXB 4G63A 2DXRA 3CVRA 4I55E 3H03A 3SEXA 4LUBA 2V26A 4HCYA 4G8HA 2RC9A 4DE8A 2Z8EA 2ZYMA 2JQQA 5LYJE 1B3EA 2DHRA 4UELA 3FHNA 4ADZA 1UTBB 2L3LA 3CVGA 1HF8A 3KDSE 4IGUA 1YCJA 4I43B 2B3FA 1PC3A 1XVXA 3M3FA 1DPEA 3MA9A 5DABA 3W15C 4ESWA 1R9QA 5LOMA 5FTIA 2WM9A 5HXHA 4IO6A 2F97A 3W15B 3C33A 2IA4A 1AJ3A 4FATA 4H63V 1N7WA 4ZECA 3I0OA 1FQFA 1LCFA 4FEBA 3VKGA 4G8MA 4IO2A 3Q5WA 5HXRA 1LAHE 5DT6A 1ZHCA 2CLYB 3E9XA 4PJLA 1AMFA 3UA8A 4L9IA 2D3IA 3O1IA 1B7HA 1MPDA 4NUUA 4WBNE 1QKAA 3KVBA 3EHTA 4HEAA 2K48A 5HWXA 3FGSA 4NE4A 3K8PC 1VOMA 4WEPA 3MAMA 2MTQA 1TFAA 3K6XA 4UVCB 1D4NA 5B70A 1WODA 4R9FA 4JDFA 4MALA 3IX1A 2LHNA 1JW1A 3FXRA 4F22A 1D0ZA 2QPQA 2H98A 2Q88A 3F11A 3LSFB 2C5JA 3J9X1 2F78A 5ITOA 3IO4A 3CSBA 5H8FA 4FI5A 5K2YA 4AKIA 2E8IA 4JEHB 4H65A 2DI4A 3BBRA 1ZKEA 5CA1E 1ANFA 1GV8A 5LGUB 3Q27A 1MQJA 4UIGA 5HBCA 4BDRA 3Q28A 2NW8A 4TQUQ 2L8KA 2F8DA 4F3SA 2HAVA 3RKOA 3U8QA 1QVSA 4KYSA 1R1NA 3IOVA 2YLNA 1MH3A 4KR5A 3HI2A 3DP8A 4P0AA 5FHOA 3PD8A 5J2UE 5KX5E 1TFDA 1JEUA 1SW5A 2IW5B 4H1XA 4KP3C 5AA2A 3PUWE 2E9XC 3TAJA 2X0LB 2O69A 3EF7A 1DTGA 3C9HA 4CZZB 1XOCA 4UA8A 4DVDA 3F57A 4BJNA 5FYMA 1M5EA 1MM6A 4ZEKA 2KWIB 4ZDMA 3SEWA 4MHCA 1US4A 4YMAA 1A99A 2DVZA 2LEHA 5TPAB 5LHIB 1YKHB 4R2BA 4MBPA 5LJMA 1BR1A 4X1IE 5KDTA 4KCCA 4RJZA 4EYUA 5CBSA 3CQGB 2H99A 3VXCA 2XQYA 4OEVA 1B3FA 4NUVA 1OMPA 4BDMA 1SHZC 3O6IA 4IO3A 1IAPA 2MOZA 2RP4A 1LCTA 1HSEA 3FVKA 1H44A 4HKAA 1FTMA 1Y20A 3VVFA 2Z8FA 3G3FA 2F6GA 2ZMAA 4HGAA 1MDP1 1A54A 2BVLA 3MBPA 1S94A 2KT9A 5EYFA 3LBXB 1MDQA 4OFJA 3N5LA 2WWUA 4IO7A 2Y84A 2AL5A 4TN7B 1FCKA 4ZZAA 3T9XB 1IUDA 4AQFA 4ZZEA 1MNDA 1EZ3A 2E9XD 3N9PA 3LK42 3KG2A 4POWA 5LGNB 3LK3B 5J2TE 4R6KA 1D0YA 3O66A 3WAJA 4ONYA 3PUAA 1QKBA 2XXHA 5DQWA 4GK5E 3Q9DA 2DS9A 4XZCA 1ZEEA 3LBSA 5JVDE 2N1GA 3KBRA 4Z8XA 4IDZA 3ZCJA 3DM0A 1US5A 3VDFA 1AL3A 1PEBA 2D5WA 2W00A 4ZS3A 5JQGE 5LCYA 3RC8A 4C1UA 4QFOA 1MNEA 1Z0PA 4NMYA 2WAUA 4U2RA 3CIJA 1OQGA 3N6TA 3S9LC 2LSIA 5HAXA 4KD5A 3C34A 2DNXA 1PDAA 2Y7KA 5JDLA 4RK2A 4YKIA 1LVFA 2V25A 3N6UA 5JDGA 4F1VA 3OO9A 1ZMGA 2JPFA 1WVJA 3UFEA 2WMNA 4OHNA 4PJMA 4U23A 2XXRA 3GMIA 5JEIA 3U94A 4E7SA 3ZMSB 3EQ1A 2ZYNA 3E0ZA 1IITA 1SW1A 1HCIA 2ZNSA 3K6WA 4Q8RA 4U1OA 4DCYA 3T22A 2F35A 3V89B 3E08A 3TYHA 3MUQA 4XTCQ 2V7KA 1LAFE 1MXXA 4NF5B 4GOTA 4G68A 2ONKE 5F8PA 4IE0A 4Q0CA 3KINB 1BIYA 4QFNA 3VFJA 1MS7A 4ZI2D 2X9HA 4IE6A 1EZ9A 4HW8A 2ANJA 2IAKA 5A1LA 3ZPOA 5JDQA 1IJ5A 4MLKA 1D9VA 4DDDA 1USYE 2CCQA 4R6HA 2VD2A 2VKDA 1LLSA 2HQ0A 5EK4A 1ZLQA 1UTBA 2VK9A 1MXZA 3K6VA 3T9HB 4YKJA 5ICQA 3KV4A 4ZEBA 4YFSA 3Q5XA 3C31A 1FTJA 3G7WA 3PD9A 3MVWA 3RX6A 3K1PA 4AXPA 4YICA 3CWZB 3HSTA 5FY7A 3KN7A 3PUZE 5CMBA 4TLMB 4DBQA 4YHJA 3FD3A 3EDVA 2OWTA 4U1ZA 4N78D 5FHNA 3PPQA 3PUYE 3ECRA 4WXJA 3A3UA 4H6DA 4L5GA 3WAFA 2OK2A 2V7JA 3HA4A 1B05A 3TFLA 3MP1A 2ZNTA 4N13A 5CBRA 3K4UA 3CFLA 3MK7C 4OESA 2KINB 3ETVA 4TV8E 1MQHA 3OJAA 3BQLA 5LGTB 4ISUA 3OO7A 3SRZA 3EN3A 2ONRA 3PPNA 3O2AA 3E22E 4FJPA 2H25A 2XXPA 3E13X 1P1OA 4R72A 1VSOA 3K1MA 5DTBA 4KI0E 3RT6B 5F7VA 3GA8A 2IC9A 3H6WA 1LKXA 3MZ9A 5I58B 2KNDA 2CM0A 1B5JA 2PJQA 1B9JA 1JW4A 3MC2A 3I3VA 2VWAA 3DP7A 3UT5E 3U72A 3JV9A 5CMMA 3B57A 4R73A 3QC9A 4PNIA 1OLAA 3RYCE 3T96B 3JC6C 4UF0B 1FW0A 3H06B 2SPCA 5CB4E 5JR9B 5JK4A 3S2VA 1HG5A 2XHEB 5EK2A 4RK9A 4XBFB 4HCWA 4TLLB 3KBTA 5FY0A 1NNKA 4HTGA 2Y7PA 1N3XA 4LONB 4JSOA 2Q2CA 2ODVA 5HXEA 2V3UA 3ETUA 3O9PA 3OD7A 4GYSA 3MZKB 5L9MA 1XS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZU0 A;  1KWH A;  2O68 A;  3H6U A;  4G4P A;  1I69 A;  3IOW A;  3FZV A;  2Y7R A;  1IJ6 A;  2F7A A;  4GXA A;  2P2A A;  4H8J A;  3ZSF A;  2X9X A;  2CMO A;  1GGG A;  1UTH B;  2QMX A;  3DEL B;  1FQC A;  1SVX B;  3KOS A;  3G3J A;  3MVY A;  3OSQ A;  3PGF A;  1TXF A;  2DXR A;  4NED A;  3TQW A;  3CVR A;  4OZ9 A;  3H03 A;  3MW0 A;  4RXL A;  3SEX A;  3VLU A;  4YMB A;  5AA2 D;  3DP4 A;  4LUB A;  3TEL A;  4R74 A;  3TZA A;  1EZP A;  2LAO A;  2PMS A;  1B2H A;  4HCY A;  4G8H A;  4OXV A;  4ZS9 A;  2RC9 A;  4FE8 A;  4DE8 A;  2I4C A;  2Z8E A;  3FVO A;  2PX1 A;  4JXI A;  4HS7 A;  5H8Q B;  2ZYM A;  1UTH A;  3LSL A;  4IO5 A;  1LFG A;  4P0I A;  5TU0 A;  1B3E A;  4NF8 A;  4B6X A;  3TEP A;  4IY5 A;  4QHQ A;  4F31 B;  4L0R A;  1MXW A;  5I2N A;  4LQ2 A;  2DE2 A;  4XKR A;  1UTB B;  5A5X B;  3ILT B;  3CVG A;  1VFD A;  5ISU A;  5DEX B;  4WED A;  2MBG A;  3O6H A;  2RF1 A;  4IY6 A;  2H9B A;  3MXZ A;  1LAX A;  2DSF A;  4GD5 A;  2D21 A;  3ODB A;  1PB7 A;  4UAC A;  3SER A;  2X9W A;  3FVG A;  3S4U A;  1YCJ A;  1AIV A;  2G0U A;  3KJ7 A;  2A5T A;  1FQE A;  2B3F A;  4LZ7 A;  1PC3 A;  1XVX A;  3M3F A;  1DPE A;  2RCA A;  3IJX B;  4H5F A;  3U1O A;  1MY1 A;  2VOZ A;  4F3B A;  4C1T A;  4G2Z A;  3RTW B;  1I6Q A;  3W15 C;  4ESW A;  4F39 A;  1R9Q A;  1B7Z A;  2DVC A;  4OYV A;  4PFT A;  4RPN A;  4EF2 A;  1H3D A;  1A55 A;  4LZ8 A;  5LOM A;  5FTI A;  3PUX E;  4F1Y A;  4IO6 A;  2F97 A;  3UK4 A;  2Y7W A;  3JYR A;  4RY1 A;  2QJE A;  4DLD A;  5I2K A;  1LST A;  3FXU A;  1B51 A;  3C33 A;  1DMB A;  2AL4 A;  3VV5 A;  2IA4 A;  3EHS A;  3QYT A;  1RYO A;  4FAT A;  3HCQ A;  5EHM A;  1TWY A;  2Q2A A;  4MH5 A;  1B0H A;  1S50 A;  3O6G A;  1MQD A;  1N7W A;  1URD A;  4TOZ A;  3BKI B;  1FQF A;  4ZEC A;  1LCF A;  3KSJ A;  2C5K T;  1B52 A;  4FEB A;  3HV1 A;  1Z7M E;  4G8M A;  4IO2 A;  4Q30 B;  5I2K B;  3IAZ A;  4G68 C;  5DVJ A;  3S9M C;  1LAH E;  1EZO A;  3PUV E;  5DT6 A;  5H8Q A;  1MQI A;  3E9X A;  1Q1K A;  3KOT A;  3CSG A;  2AYS A;  3CR9 A;  3AXF A;  3I6V A;  1AMF A;  5CRY A;  1N0T A;  4ZEI A;  1P99 A;  1HSJ A;  2DE3 A;  2D3I A;  1OVT A;  2QS2 A;  2X9Y A;  3K1N A;  3RTF B;  1NMU A;  3T9V A;  3TKD A;  1NKX A;  3GBA A;  1B7H A;  1MPD A;  4FIM A;  1IZ1 A;  1QKA A;  3EHT A;  4OWD A;  2Q8J A;  2K48 A;  2XX9 A;  1SDX A;  3FGS A;  4NE4 A;  2FA7 A;  2HCA A;  1DPP A;  1QUL A;  1GR2 A;  3H4Z A;  3MAM A;  4WEP A;  1N7X A;  1TFA A;  4NWC A;  4EQ7 A;  3K6X A;  3CRB A;  1D4N A;  2HEU A;  5B70 A;  3TTL A;  1B3L A;  1ELJ A;  1WOD A;  2GHB A;  2XXU A;  5B7D A;  3ILU B;  1URG A;  1JVX A;  2DE4 A;  4JDF A;  4R9F A;  5F1Q A;  3IX1 A;  2HZL A;  5I59 A;  5L9S A;  1JW1 A;  3FXR A;  3KN8 A;  3IO6 A;  3QIM A;  4F22 A;  3IB0 A;  2QPQ A;  5DYH A;  3SEY A;  2H98 A;  5I57 B;  1PBP A;  2HAU A;  3O28 A;  4MF3 A;  4YB5 A;  2Q88 A;  3F11 A;  3LSF B;  2C5J A;  1MY4 A;  2F78 A;  3KEI A;  4XXU A;  3TCG A;  2KLF A;  3BFU A;  1R9L A;  5ITO A;  3IO4 A;  4AB5 A;  3FAS A;  1P1Q A;  5AA2 B;  2OBG A;  1LB8 A;  4FI5 A;  2B65 A;  2UVJ A;  3CSB A;  3IL1 B;  1SQY A;  3PMX A;  5K2Y A;  5AE4 A;  5I59 B;  2OJT A;  1T0K A;  1A8E A;  3T93 B;  1A40 A;  1ATG A;  3A09 A;  1NL5 A;  4EF1 A;  1FQD A;  4ELQ A;  2ALU A;  3PMV A;  4H65 A;  4ZEF A;  3VE1 B;  3K2D A;  5I84 A;  1ZJL A;  3BBR A;  1SBP A;  1ZKE A;  1B46 A;  5BUU A;  5KZT A;  1ANF A;  1URS A;  4F2O A;  1VR5 A;  3Q27 A;  1GV8 A;  1MQJ A;  5AA1 A;  3HHG A;  5HBC A;  4BDR A;  3Q28 A;  2I48 A;  4ND9 A;  5KDT B;  1MY0 A;  4K3F A;  4TQU Q;  5ELV A;  3TKL B;  3QK6 A;  1Y1Z A;  2F8D A;  1LFI A;  2HAV A;  4F3S A;  3DLN A;  4ESX A;  3U8Q A;  4DCX A;  3FAT A;  1QVS A;  3CFZ A;  3TTN A;  5ICT A;  2A5S A;  1Z7N E;  3G3H A;  1GTK A;  1YPN A;  3FIR A;  4KYS A;  1R1N A;  3IOT A;  2YLN A;  1SYH A;  3IOV A;  1MH3 A;  4YB7 A;  4F19 A;  3TCF A;  1XC1 A;  3E4R A;  4PE5 B;  2O7I A;  4YKK A;  3OEN A;  4KR5 A;  3PPO A;  3DP8 A;  4JWO A;  1BLF A;  2BJJ X;  5FHO A;  3PD8 A;  2UYF A;  1GVC A;  1O7T A;  1YAE A;  1PB8 A;  1TFD A;  1FTK A;  2QL3 A;  1JEU A;  1SW5 A;  1MXY A;  2E0S A;  4H1X A;  4GL8 A;  5AA2 A;  4DZ1 A;  1TT1 A;  3PUW E;  3GZG A;  4KYE A;  4I1D A;  3TAJ A;  3VLV A;  2O69 A;  4JSD A;  2C5I T;  1DTG A;  1Y3Q A;  3C9H A;  3EF7 A;  3O97 A;  1XOC A;  3MQ9 A;  4UA8 A;  4YAH X;  2UXA A;  3BFT A;  2E1S A;  3KJT A;  4YKP A;  4X1D A;  4PFY A;  2VGQ A;  1O63 A;  4NF4 B;  5TP9 B;  5KCJ B;  4R9G A;  1UIU A;  3ZKL A;  3Q26 A;  1YTV A;  2PVU A;  3N26 A;  4F3P A;  3B6Q A;  1M5E A;  1MM6 A;  4ZEK A;  2KWI B;  4I8C A;  5H8F B;  2OCU A;  4ZDM A;  2GHA A;  4OER A;  5DVI A;  1N3W A;  5CMC A;  3SEW A;  4AB6 A;  4THI A;  1M5F A;  1D9Y A;  1UIV A;  1US4 A;  3TUS A;  3UGW A;  1A99 A;  2P0S A;  1SYI A;  2DVZ A;  2XXY A;  3SEU A;  4YMA A;  2NOO A;  2V3T A;  5TPA B;  2V84 A;  4R75 A;  4G68 B;  3FXE B;  2OLB A;  2XXX A;  5I57 A;  1BKA A;  1B1X A;  1NH8 A;  3C32 A;  2O84 X;  2IEE A;  3T9U A;  3OEL A;  4R2B A;  2H5Y A;  4CQI A;  3LSX A;  4MBP A;  4YZZ A;  1USY H;  1NNF A;  2UVI A;  3FXQ A;  4I9D A;  4Z0I A;  3HN0 A;  1MQG A;  3LSW A;  4U4S A;  5KDT A;  1OQH A;  1B6H A;  4QSC A;  2M8C A;  3Q29 A;  4KCC A;  4RJZ A;  4GF8 A;  4PFU A;  3MJN A;  3W9W A;  5CBS A;  4PET A;  2H99 A;  5H8S A;  3USD A;  1MXU A;  3VXC A;  4BDL A;  4NF4 A;  5TP9 A;  4OEV A;  4QRZ A;  1B3F A;  4EQB A;  1OMP A;  3UOR A;  1QUI A;  4RA1 A;  4BDM A;  4OFL A;  3O6I A;  2ZMB A;  4IO3 A;  4I62 A;  4M1V A;  1POT A;  2Z8D A;  1LCT A;  1M5B A;  1HSE A;  4J2C A;  3QSL A;  1SW4 A;  3FVK A;  1H44 A;  5IAI A;  2O1L A;  5A5X A;  1FTM A;  3PV0 E;  1Y20 A;  2G29 A;  2Z22 A;  3THI A;  3VVF A;  2Z8F A;  2UYE A;  4FEC A;  1LBB A;  3G3F A;  4G8N A;  2F6G A;  1Y1M A;  1MDP 1;  3VVD A;  4DXC A;  3FV2 A;  1A54 A;  1IXH A;  4QF9 A;  1IQ7 A;  3K6U A;  3JZJ A;  3MBP A;  3R26 A;  4L17 A;  2I0C A;  3QAX A;  5DVF A;  5HM4 B;  3B6W A;  4EXL A;  5EYF A;  4EYY R;  1P1U A;  1MDQ A;  5IKB A;  1QUK A;  1VE4 A;  2RC8 A;  4OFJ A;  3KZG A;  1RKM A;  3N5L A;  1CE2 A;  2REJ A;  4IO7 A;  2Y84 A;  2AL5 A;  3GBB A;  4OEU A;  4O3C A;  1QUJ A;  3SES A;  3TTK A;  1FCK A;  4OTE A;  4ECF A;  1F9B A;  1ZKB A;  3H6V A;  4GRK A;  4ZZA A;  1IUD A;  1XVY A;  2QMW A;  4KQP A;  4ZZE A;  3T9X B;  4U4X A;  4DXB A;  1JET A;  2O6A A;  3GLB A;  3VXB A;  1II5 A;  4F18 A;  1H7C A;  1L5T A;  4EQ9 A;  3KG2 A;  4POW A;  1Y3N A;  4LA9 A;  1OLC A;  1EU8 A;  4OEN A;  1LBC A;  2ESN A;  5H8F A;  4R6K A;  3O66 A;  4C0R A;  4Q5T A;  3U92 A;  4ONY A;  1SI0 A;  2HZK A;  2UVG A;  4PFW A;  2W7Y A;  1JEV A;  1QKB A;  2XXH A;  3L6H A;  5ICQ A;  1IIW A;  1R6Z A;  1RYX A;  4JWY A;  3OMB A;  3ZKK A;  2DS9 A;  3G3G A;  2O7U A