4LF6T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 33
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4lf6T00
4JI0T 3OTOT 4B3TT 4NXNT 4DR7T 4LFAT 4DV3T 5IWAT 1J5ET 1IBLT 4JI3T 2F4VT 3T1YT 4DUZT 4JI2T 5LMNT 4JI4T 4YY3T 1N36T 2UU9T 1HNXT 1IBKT 4DUYT 4LF4T 4JI7T 4DR1T 4OX9T 4B3ST 4DR3T 4DR6T 4JI5T 4GKKT 1HNZT 4YHHT 1N32T 4DR4T 1IBMT 4LF6T 4LF5T 4JI6T 4DV4T 4JV5T 4DR2T 4B3MT 4DV0T 2UUBT 4JI8T 2UUAT 4X62T 2UUCT 5BR8T 4AQYT 4DV1T 4LF9T 4KHPT 4LF7T 4X65T 4DR5T 4LFBT 1XNRT 1HNWT 1HR0T 4GKJT 4LF8T 1XMQT 4DV5T 4NXMT 2UXCT 4K0KT 1XNQT 1N33T 4B3RT 4X64T 1N34T 4DV2T 1I94T 4DV7T 3T1HT 2VQFT 2E5LT 1XMOT 2VQET 4JYAT 4X66T 2UXBT 4LFCT 4DV6T 2HHHT 1FJGT 2ZM6T 5LMUT 2UXDT 4JI1T
chains in the Genus database with same CATH superfamily
3DP7A 4C91A 4CN4A 3UU4A 2JMHA 2FJAA 2ZLYA 2AE9A 2YU2A 2E8IA 4ILCA 5F3JA 4DMVA 5LOVE 1J5WA 4ZI3C 3AE9A 3ZN1B 5HXRA 3MZKB 3PUAA 5JRCB 3A5XA 4EB6E 4HKAA 2WU5A 3RYIE 2H89A 3ANWB 4LF5T 3MJXA 4JI6T 4MBQA 4IDQA 3CMLA 4DR2T 5KXJA 2IMLA 3AEAA 3UT5E 3N2GE 4V1Av 4ZOLE 3QUJA 3AVSA 2MBGA 4OK0A 3UUBA 3K3NA 2WZIA 5LHGB 5CB4E 4Q25A 4X20E 4DR5T 4MHCA 3I9WA 2X68A 1KNRA 2WMOA 3ETUA 3TLUA 5JR9A 4X1YE 2VURA 4LF8T 5L3FB 1XMQT 5AQHB 3H3AA 2XAFB 4ILAA 1AJ3A 3N2OA 4HFVA 3CIRA 1N33T 2KSRA 3SFEA 2VK9A 1MIYA 4YJ3E 5HEGA 2HPLA 4DV6T 2EHOA 2RP4A 5L3BB 2CXLA 1S94A 2UXDT 5LG4A 3VU7H 5BMVE 2GK9A 4IDZA 3EVYA 1Y01A 3ZCJA 2LRLA 3P4SA 4UXNB 4EAHA 2V5DA 3LG7A 3RKOA 3CVRA 1MMAA 4HFCA 3PJAJ 1OEDB 4U31A 3AE1A 3PDYA 3ZMVB 4GYRA 1N32T 2X51A 2BVLA 2WZHA 1US7B 4HFDA 5FP3A 1OEDC 2UUBT 3DJBA 2AXDS 1O3XA 2UUAT 3O1IA 1E7PA 3NWIA 2BBHA 2CWOA 5JRCA 4AKGA 5C3JA 2XQ8A 2X66A 3A7MA 5L3DB 3ANWA 3FZMB 2IC9A 4EYYR 4GK5E 2XASB 1HNWT 5FNVE 4IDNA 5EZYE 2UXXB 3C51A 3VRAA 3NZPA 4X64T 1MNDA 2VKOA 2B1EA 2CBJA 3R6NA 3GA8A 3EDUA 3A8YC 4JI1T 2BKOA 4DR7T 1W09A 5FXXA 3UFGA 1EZ3A 4H9PC 4NPPA 5FY0A 5HAXA 3B57A 3B13A 4AIUA 4PNIA 2QGSA 4ZZBA 3J9X1 5LMNT 2J4GA 2W63A 3V5SA 4ZI3D 4JI7T 2BS2A 4PJMA 4JI5T 4GKKT 4U2YA 2K5BB 2LEHA 3P7IA 4HFIA 4PK5A 1DU2A 4JLEA 1IAPA 2J62A 3OVUA 3P50A 2XZEA 2W00A 4EZHA 4TZ4C 2XPKA 2QRXA 5JDFA 4YFSA 3E0ZA 3R84B 3V5UA 4LMJA 4UIGA 3H3MA 1OEDA 4CI1B 1WCRA 1FIOA 4QH5A 5HEJA 3CPZA 4HWIB 4GK0E 4FI5A 2JJ9A 3VRBA 1XNRT 1HG2A 4M1PA 2LOSA 4ZS2A 3FHNA 1BR2A 5GONE 2KINB 4YTMA 4QX8B 5L2LA 3U78A 3IBPA 4ILBA 2V7LA 2V7JA 4CQIA 3K1SA 2W61A 2LLYA 4H63V 4EZ4A 4YSYA 5FMNA 2LT3A 2R6GF 3L39A 2YK0A 1VCSA 4IGUA 2LM9A 4YSZA 1WLXA 4BA9A 2PBIA 3EDVA 1N36T 4YXDA 3QOFA 3ZT6A 4CXXA 4B3ST 4XBFB 4QXBB 4B6XA 1BR1A 3K3QC 4WBOA 3IA3A 4ZEYA 3ZMZB 2LKGA 1FEWA 3N9LA 2CXFA 2L8KA 1VOMA 2DWKA 3U3IA 3KBUA 2I6HA 5EK3A 3BK9A 2WY2A 4HEAA 2K48A 2W4XA 4JI8T 2D2SA 1T98A 3RGLA 4DV1T 3ZMUB 2VKHA 3OKQA 4IDPA 2P9BA 2Y48B 2B76A 2CA5A 3JADA 5JDGA 1IJ6A 3N2KE 4BJMA 3CWZB 3F2EA 4DBQA 2UXBT 3FZKB 3TKLB 5L4EA 5AQOB 3OTOT 4NXNT 3Q5EA 2CPTA 4LFAT 5JDHA 4EIWA 3LSVA 2Z6EA 5IWAT 4UELA 3ESLA 4HWFA 3O1JA 2CRBA 3I1AA 4IL9A 3PUXF 2QVAA 4IREA 5JREA 4P09A 3C50A 1D0ZA 5JDMA 2HN1A 1LKXA 3RF1A 2C5JA 3N9MA 4ILUA 1IBMT 5FVKA 4DV4T 3OPCA 3UU3A 4IE7A 4EEBA 2IUBA 2MAWA 3CK6A 3TLTA 4ADZA 4YJ2E 3F57A 2NTYA 3RIFA 3KDSE 4F6RC 2LM2A 3RIUC 3DTOA 2KMFA 1ZOYA 1B7TA 2XAJB 2WSSV 5J2TE 3UU5A 2ES0A 1VCTA 1NENA 2BZBA 2XSBA 3ZMSB 3PTRB 1R8IA 2W67A 3FZFB 3IEEA 1LVKA 4ZXLA 2CHOA 4P1NA 3RC3A 4K0KT 3BQLA 4MFRA 4IE6A 3ZC0A 4TWHA 2V6XA 2LE8A 2YKSA 3ZYLA 2CLYB 2Y6XA 2OV9A 1FMWA 4FJOA 3I0QA 4U7IA 2XQ9A 5HEUA 5J0ZA 2WWUA 2NW7A 3UTKA 2VKDA 5HXHA 4H9OC 2CLYC 3PUSA 4TV9E 5FL1A 3AXJB 2ZM0A 3O9XA 1M7KA 3MKDA 4UV9B 4OX9T 2NR4A 3G06A 3C4ZA 5DABA 2XQ6A 5HYAA 4TWFA 4UVBB 2YN6A 5TAOA 4HWHA 1SHZC 1XDPA 5CFBA 4JEHB 1UCUA 3LK2B 2WCAA 3M65A 5HCJA 3ONJA 2W0GA 4TUYE 1YD8G 3H37A 4G63A 2LHRA 5JTGA 3VR9A 3ZN0B 4Z90A 3RIUA 5ABGA 3RKGA 3PJAA 4KI0F 1MIWA 1IJ5A 2FJBA 4YSXA 5ABEA 1LRZA 2V5CA 4IDOA 4N78D 1SE7A 2X9HA 4GKJT 1J1JA 2UXNB 2XQ5A 1YW0A 3RYFE 2NW8A 5IHYA 2WS3A 4ZI7E 1KF6A 5JDLA 2LHNA 2X9YA 3ZCIA 3PU8A 3HA4A 2IDOB 2XAGB 3AE5A 4X66T 2LSJA 2XTLA 4DO0A 1FJGT 1OWAA 4ZHQE 3AA0B 2KXPB 4QX7B 2JQKA 4JI3T 3T1YT 4NUUA 5CA0E 5AQGB 2DI4A 1MMDA 1CHUA 1XDOA 2PJQA 2MOZA 3RYHE 2N1GA 4YHHT 1NWMX 5KX5E 1Y64B 5LNKA 4F8HA 3AXJA 4TNVA 3AE3A 2LJLA 1UX4A 4TV8E 4NUVA 4DMWA 1YQ3A 2V1DB 4KUMB 4PK6A 5AQVB 4QKNA 5EK2A 2BG9E 5C8YE 1HTJF 2YINA 3TLVA 2UXCT 5FXZA 3UQ4A 1V9DA 3QK6A 4E7SA 3OBVE 1HG5A 5A1LA 2XQYA 3K3OA 4HTEA 5J2UE 1WR0A 4P0BA 3I9YA 2K9AA 2N9DA 2X0HA 3QNUA 5C2TA 1M62A 4A56A 4AI6A 3FB2A 4YTNA 4C90A 3ZJ2A 3AE2A 1W9RA 1U4QA 2KZ7B 1WRDA 2D9DA 2CM0A 4I43B 3RRCA 4DUZT 5DQWA 3ZT7A 3FZLB 4DBRA 4LF4T 4UVCB 4I55E 2BDEA 5HXSA 3PUQA 4X1IE 1HCIA 2DL1A 4A98A 4UR9A 2QA7A 4O4IE 4L0RA 4PW8A 3IF8B 4L5GA 4B3MT 4TWDA 1MIVA 5JH7E 2XM2A 5AQKB 4YTPA 4ZI2D 2NOXA 2K3WA 4IE5A 1FMVA 4Z8XA 3P4PA 5IUXA 5EK4A 2IAKA 3D0TA 1Z8UA 3P4QA 3RQWA 4MLKA 1HX1B 3K8PC 1KEYA 4DV5T 1YXRA 5L3EB 2VVNA 3ETVA 3L3PA 4WNKA 1I6ZA 1OXZA 2VQFT 2M67A 3AA7B 1BR4A 4TNWA 1KNPA 4OHFA 2A3DA 1WYCA 2NP9A 2CCQA 3ABVA 2V7IA 5ADXL 2RA1A 1SUMB 3AE8A 1UK5A 3AEBA 3I0OA 3N9OA 3C4XA 2C5IT 2V8SV 4IHJE 2I59A 4DVDA 2JPFA 3QB5A 2BS3A 4EYUA 3CKDA 4ZS3A 1UX5A 2L3LA 3JC6D 4O2AE 2BG9B 2LOPA 4DR1T 3LK42 2XAHB 2JMKA 2XJ7A 5ABFB 3IHRA 3NKZA 4DNDA 4PK4A 5ETWA 1E1HB 1JNRA 3ZYMA 2XHEB 2LSYA 4JV5T 3PUWF 4U74A 4AQFC 5AQJB 1MMNA 1NEKA 2CEAA 3FXDB 2BG9C 2BBJA 2UUCT 2E5VA 2X0LB 2IIUA 2H7OA 2W2UA 3AE4A 1IZNB 5E0OA 5LHIB 1HS7A 3VKGA 5F5WA 1HF8A 4AQGA 3EI0A 4GIWA 4HE8A 2W66A 4NXMT 1G8XA 3EABA 4YT0A 2CXDA 5FY1A 3KV4A 4YHJA 3RPUA 2X0YA 3VKHA 4PJLA 4QXCB 5LBMA 3LDQB 4P0AA 4JI0T 3MK7C 4COFA 3NRYA 3B5MA 4Z91A 2J1DG 2HN2A 1X9BA 4UEMA 2V26A 3PUVF 4CXYA 3ZKRA 1IBKT 2LSGA 4DUYT 4EXTA 4H9QC 4CI3B 1H7CA 4HFHA 3UUXB 1NAFA 4BAYB 3O1HA 4DR3T 2Y8DA 2JQ9A 2JIWA 4O4JE 3ONLC 3Q5WA 1XZYA 3LFMA 2MTQA 3QC9A 2ZM8A 1WR6A 1LVFA 4U33A 4AQFA 1GQEA 5FVLA 2HH7A 2BG9A 5LXTE 4KHPT 3HI2A 5ABFA 4GYSA 3GMIA 2KWIB 2LSIA 3KINB 3AECA 3LK3B 2DWGA 1UGOA 1BR0A 2XY8B 4B3RT 4EGWA 3RYCE 3UU8A 4H9NC 3F31A 4L9IA 4U72A 1XMOT 3PV0F 3Q5DA 2ZMAA 4LFCT 2V7KA 1S35A 2K24A 4O2BE 3NRXA 3ZEFB 1WFDA 4U2ZA 3WAKA 1J5ET 1VRBA 2ACXA 3EUHA 1W0AA 2DNXA 3WAJA 3Q9DA 4JI2T 5ABHA 4IT4A 1MMGA 3SFDA 4H63H 2H88A 2XSAA 1W0BA 4QH1A 4ERRA 4PFPA 3W15B 5KDMC 2Q9QD 4KBMB 3AAAB 2LSKA 1YKHB 3AB3B 4XZCA 5AQUB 5FYMA 1D0XA 4O8SA 3VR8A 5LYJE 4ASKA 4AKIA 4LF9T 4TN7B 5HWYA 5LJNA 4CN1A 2CWYA 5HWXA 1KFYA 2E9XB 3AA6B 3LJCA 2PG8A 2HPJA 2G0UA 2PFVA 4X5TA 1D0YA 4HWDA 3AAIA 5FKYA 4ZI2C 3T1HT 2C0SA 3ZSSA 2E9XC 2KLQA 2BS4A 5IYZE 5HXEA 5JDNA 2ZM6T 5L3CB 2LKHA 2C5KT 4I50E 2ACZA 3C98B 3HKDE 4UV8B 4B3TT 3SS1A 1X79A 4HWCA 4DV3T 4KX6A 5LJMA 3EHZA 2XQAA 2F4VT 2IW5B 2VKJA 1L0VA 4AKHA 4KMCA 5LCYA 4AXPA 5HEHA 3EAMA 1HNZT 4QHOA 5DJQC 3AEDA 3HR0A 4UVAB 2W62A 3AE7A 4I0UA 5LP6E 2WAUA 3T8OA 2N2NA 5LHHB 1YKEB 3UULA 3JC6C 2X67A 2WQYA 2H3RA 3RC8A 3L8RA 2WWVA 4X65T 5L3GB 1QLBA 4YLHA 3MXZA 5KMGP 3PUYF 4AISA 4UF0B 2CBIA 3WI3A 1HR0T 2A9UA 2YDRA 3OYXA 1E2AA 4X1KE 2VB6A 4OYJA 4H9RC 4ZZCA 3O4XE 3ZMTB 3PURA 1N34T 1QUUA 2CHNA 2E5LT 3GWHA 4QXHB 2VQET 3AA1B 4JYAT 3KFWX 2KNDA 3RH3A 4EOZB 3MACA 1HFAA 4WZXA 5LMUT 2E9XA 3ZYKA 2ODVA 2NWBA 5AQSB 5AQFB 3RIAA 3C4WA 2I0MA 3N5LA 4BJNA 5HCMA 3AAEB 1G73A 2VL8A 3QB5K 3UUNA 2WDQA 3BQIA 5F8PA 1SA0E 1ZEEA 4G2AA 2A72A 4IE0A 4CI2B 3UUMA 3Q5XA 1KK7A 4EV6A 4DR4T 3KVAA 4LF6T 3FXEB 3MA9A 4HGAA 3P4RA 3CQGB 5AQQB 3PE0A 2WDRA 4DV0T 4I4TE 2WU2A 3NZQA 3ZJ1A 3JAFA 2IHR1 4AKRB 5LB7B 3BQKA 3N9NA 1XWMA 2EHOD 2XQ4A 5DQVA 2YOEA 4LFBT 2BKPA 4QWNB 1CUNA 4HFBA 4LMLA 2M6BA 4J2CA 5M4YA 2X9WA 4PAGA 4A5XA 1XNQT 2IC6A 1T72A 3P8CD 2ZM2A 5AQNB 2QYWA 4JEUB 2E9XD 4AKLA 3RHWA 3M3ZB 3RX6A 2FJDA 4UF0A 1YQ4A 5AQMB 3PU3A 3TLSA 3N9QA 3RRWA 2XQ7A 2CMRA 3HKCE 3E22E 1D1BA 1ZHCA 4YY3T 2UU9T 3AVRA 2WB5A 2M6IA 3NBXX 3AEEA 5FY7A 2FUPA 2JQQA 4HN9A 3ZLIA 1UURA 3SWHA 2V6YB 3X1DA 3GN5B 3PUGA 2V7MA 3KVBA 4EEDA 2Q9QB 3KV9A 3P4WA 3C64A 1ZKEA 4KP3C 4O4LE 5FL0A 4TX5A 4LF7T 2J47A 3J7Yq 5FXWA 2FBWA 2Q9QC 2YDSA 2WMNA 3AE6A 3FBZA 5FXVA 5AQTB 5JDQA 2BVMA 1ZV4X 5HXCA 2E2AA 3E08A 5AQLB 4PJJA 1I94T 4DV2T 4ANJA 4HFEA 4LMKA 2A2FX 2DCFA 4IE4A 2XUEA 2ODUA 2XAQB 4WYVA 5AQIB 3ZT5A 2VWAA 4U3CA 3LBXB 2YU1A 1D1CA 4E7ZA 1IBLT 3PUZF 3ONXA 1ZP0A 3HL6A 3N9PA 5LGNB 3ZSTA 4NIQA 2NTXA 3UQ7A 5H6QB 5HEOA 2VL0A 1T7SA 2JRKA 4OFZA 3RI5A 3UU6A 3FZHB 5L47A 2MPKA 5CJ5A 2WM9A 4QH4A 3NVOA 4X62T 4AQYT 2KWHA 2CE7A 4CN6A 3Q2MA 2VVSA 3SRZA 5L4HA 2RPAA 3HKEE 4PFOA 2DLRA 4OYKA 3TLWA 5CGMA 3VHLA 2V6YA 3CX8B 1WYBA 3GN5A 5J1GA 4H9SE 3OJAA 2XM1A 2NW9A 3AEGA 2Q9QA 3JCFA 4GOUA 5JQGE 2XQ3A 4A97A 3CQCB 3KV5A 1MNEA 4JBWF 5AQRB 2D0TA 2MYSA 4XAXB 2L9QA 4WBNE 2YEVC 1QSDA 2OLTA 4IIJE 2DHRA 3JAEA 1U5PA 5LGTB 2WP9A 4PJNA 4DIDB 3SOLA 1Z0PA 4U7YA 4JI4T 2YDQA 1HNXT 3OYZA 3FBLA 3RLFF 4CXWA 4DR6T 5AQPB 5AFUL 5LGUB 3AEFA 3ZC1A 3LBXA 3CX7B 4JUYA 3KV6A 2KT9A 3CQXC 2OA5A 4KHZF 5JR9B 2H7VC 5LBQB 5JVDE 3L09A 2VASA 1JNZA 5H6RB 2FJEA 5BR8T 5CA1E 2SPCA 2JQHA 4CZZB 2WDVA 1HX8A 4IL4A 2D5UA 4O4HE 2D0UA 2BKNA 5JR9C 2EHOB 5LA6E 3UFEA 1KNZA 1T8BA 4ISSA 3KBTA 1OEDE 1UUSA 2X9XA 3RQUA 4ISTA 5LG3A 3CX6B 4K0UA 4WW0A 2LRKA 3S4UA 2PTFA 4DV7T 2EHOC 2WBLA 3ZPOA 1D1AA 2HHHT 3HKBE 4MALA
chains in the Genus database with same CATH topology
4JI0T 3OTOT 4B3TT 4NXNT 4DR7T 4LFAT 4DV3T 5IWAT 1J5ET 1IBLT 4JI3T 2F4VT 3T1YT 4DUZT 4JI2T 5LMNT 4JI4T 4YY3T 1N36T 2UU9T 1HNXT 1IBKT 4DUYT 4LF4T 4JI7T 4DR1T 4OX9T 4B3ST 4DR3T 4DR6T 4JI5T 4GKKT 1HNZT 4YHHT 1N32T 4DR4T 1IBMT 4LF6T 4LF5T 4JI6T 4DV4T 4JV5T 4DR2T 4B3MT 4DV0T 2UUBT 4JI8T 2UUAT 4X62T 2UUCT 5BR8T 4AQYT 4DV1T 4LF9T 4KHPT 4LF7T 4X65T 4DR5T 4LFBT 1XNRT 1HNWT 1HR0T 4GKJT 4LF8T 1XMQT 4DV5T 4NXMT 2UXCT 4K0KT 1XNQT 1N33T 4B3RT 4X64T 1N34T 4DV2T 1I94T 4DV7T 3T1HT 2VQFT 2E5LT 1XMOT 2VQET 4JYAT 4X66T 2UXBT 4LFCT 4DV6T 2HHHT 1FJGT 2ZM6T 5LMUT 2UXDT 4JI1T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI0 T;  3OTO T;  4B3T T;  4NXN T;  4DR7 T;  4LFA T;  4DV3 T;  5IWA T;  1J5E T;  1IBL T;  4JI3 T;  2F4V T;  3T1Y T;  4DUZ T;  4JI2 T;  5LMN T;  4JI4 T;  4YY3 T;  1N36 T;  2UU9 T;  1HNX T;  1IBK T;  4DUY T;  4LF4 T;  4JI7 T;  4DR1 T;  4OX9 T;  4B3S T;  4DR3 T;  4DR6 T;  4JI5 T;  4GKK T;  1HNZ T;  4YHH T;  1N32 T;  4DR4 T;  1IBM T;  4LF6 T;  4LF5 T;  4JI6 T;  4DV4 T;  4JV5 T;  4DR2 T;  4B3M T;  4DV0 T;  2UUB T;  4JI8 T;  2UUA T;  4X62 T;  2UUC T;  5BR8 T;  4AQY T;  4DV1 T;  4LF9 T;  4KHP T;  4LF7 T;  4X65 T;  4DR5 T;  4LFB T;  1XNR T;  1HNW T;  1HR0 T;  4GKJ T;  4LF8 T;  1XMQ T;  4DV5 T;  4NXM T;  2UXC T;  4K0K T;  1XNQ T;  1N33 T;  4B3R T;  4X64 T;  1N34 T;  4DV2 T;  1I94 T;  4DV7 T;  3T1H T;  2VQF T;  2E5L T;  1XMO T;  2VQE T;  4JYA T;  4X66 T;  2UXB T;  4LFC T;  4DV6 T;  2HHH T;  1FJG T;  2ZM6 T;  5LMU T;  2UXD T;  4JI1 T; 
#chains in the Genus database with same CATH topology
 3DP7 A;  4C91 A;  4CN4 A;  3UU4 A;  2JMH A;  2FJA A;  2ZLY A;  2AE9 A;  2YU2 A;  2E8I A;  4ILC A;  5F3J A;  4DMV A;  5LOV E;  1J5W A;  4ZI3 C;  3AE9 A;  3ZN1 B;  5HXR A;  3MZK B;  3PUA A;  5JRC B;  3A5X A;  4EB6 E;  4HKA A;  2WU5 A;  3RYI E;  2H89 A;  3ANW B;  4LF5 T;  3MJX A;  4JI6 T;  4MBQ A;  4IDQ A;  3CML A;  4DR2 T;  5KXJ A;  2IML A;  3AEA A;  3UT5 E;  3N2G E;  4V1A v;  4ZOL E;  3QUJ A;  3AVS A;  2MBG A;  4OK0 A;  3UUB A;  3K3N A;  2WZI A;  5LHG B;  5CB4 E;  4Q25 A;  4X20 E;  4DR5 T;  4MHC A;  3I9W A;  2X68 A;  1KNR A;  2WMO A;  3ETU A;  3TLU A;  5JR9 A;  4X1Y E;  2VUR A;  4LF8 T;  5L3F B;  1XMQ T;  5AQH B;  3H3A A;  2XAF B;  4ILA A;  1AJ3 A;  3N2O A;  4HFV A;  3CIR A;  1N33 T;  2KSR A;  3SFE A;  2VK9 A;  1MIY A;  4YJ3 E;  5HEG A;  2HPL A;  4DV6 T;  2EHO A;  2RP4 A;  5L3B B;  2CXL A;  1S94 A;  2UXD T;  5LG4 A;  3VU7 H;  5BMV E;  2GK9 A;  4IDZ A;  3EVY A;  1Y01 A;  3ZCJ A;  2LRL A;  3P4S A;  4UXN B;  4EAH A;  2V5D A;  3LG7 A;  3RKO A;  3CVR A;  1MMA A;  4HFC A;  3PJA J;  1OED B;  4U31 A;  3AE1 A;  3PDY A;  3ZMV B;  4GYR A;  1N32 T;  2X51 A;  2BVL A;  2WZH A;  1US7 B;  4HFD A;  5FP3 A;  1OED C;  2UUB T;  3DJB A;  2AXD S;  1O3X A;  2UUA T;  3O1I A;  1E7P A;  3NWI A;  2BBH A;  2CWO A;  5JRC A;  4AKG A;  5C3J A;  2XQ8 A;  2X66 A;  3A7M A;  5L3D B;  3ANW A;  3FZM B;  2IC9 A;  4EYY R;  4GK5 E;  2XAS B;  1HNW T;  5FNV E;  4IDN A;  5EZY E;  2UXX B;  3C51 A;  3VRA A;  3NZP A;  4X64 T;  1MND A;  2VKO A;  2B1E A;  2CBJ A;  3R6N A;  3GA8 A;  3EDU A;  3A8Y C;  4JI1 T;  2BKO A;  4DR7 T;  1W09 A;  5FXX A;  3UFG A;  1EZ3 A;  4H9P C;  4NPP A;  5FY0 A;  5HAX A;  3B57 A;  3B13 A;  4AIU A;  4PNI A;  2QGS A;  4ZZB A;  3J9X 1;  5LMN T;  2J4G A;  2W63 A;  3V5S A;  4ZI3 D;  4JI7 T;  2BS2 A;  4PJM A;  4JI5 T;  4GKK T;  4U2Y A;  2K5B B;  2LEH A;  3P7I A;  4HFI A;  4PK5 A;  1DU2 A;  4JLE A;  1IAP A;  2J62 A;  3OVU A;  3P50 A;  2XZE A;  2W00 A;  4EZH A;  4TZ4 C;  2XPK A;  2QRX A;  5JDF A;  4YFS A;  3E0Z A;  3R84 B;  3V5U A;  4LMJ A;  4UIG A;  3H3M A;  1OED A;  4CI1 B;  1WCR A;  1FIO A;  4QH5 A;  5HEJ A;  3CPZ A;  4HWI B;  4GK0 E;  4FI5 A;  2JJ9 A;  3VRB A;  1XNR T;  1HG2 A;  4M1P A;  2LOS A;  4ZS2 A;  3FHN A;  1BR2 A;  5GON E;  2KIN B;  4YTM A;  4QX8 B;  5L2L A;  3U78 A;  3IBP A;  4ILB A;  2V7L A;  2V7J A;  4CQI A;  3K1S A;  2W61 A;  2LLY A;  4H63 V;  4EZ4 A;  4YSY A;  5FMN A;  2LT3 A;  2R6G F;  3L39 A;  2YK0 A;  1VCS A;  4IGU A;  2LM9 A;  4YSZ A;  1WLX A;  4BA9 A;  2PBI A;  3EDV A;  1N36 T;  4YXD A;  3QOF A;  3ZT6 A;  4CXX A;  4B3S T;  4XBF B;  4QXB B;  4B6X A;  1BR1 A;  3K3Q C;  4WBO A;  3IA3 A;  4ZEY A;  3ZMZ B;  2LKG A;  1FEW A;  3N9L A;  2CXF A;  2L8K A;  1VOM A;  2DWK A;  3U3I A;  3KBU A;  2I6H A;  5EK3 A;  3BK9 A;  2WY2 A;  4HEA A;  2K48 A;  2W4X A;  4JI8 T;  2D2S A;  1T98 A;  3RGL A;  4DV1 T;  3ZMU B;  2VKH A;  3OKQ A;  4IDP A;  2P9B A;  2Y48 B;  2B76 A;  2CA5 A;  3JAD A;  5JDG A;  1IJ6 A;  3N2K E;  4BJM A;  3CWZ B;  3F2E A;  4DBQ A;  2UXB T;  3FZK B;  3TKL B;  5L4E A;  5AQO B;  3OTO T;  4NXN T;  3Q5E A;  2CPT A;  4LFA T;  5JDH A;  4EIW A;  3LSV A;  2Z6E A;  5IWA T;  4UEL A;  3ESL A;  4HWF A;  3O1J A;  2CRB A;  3I1A A;  4IL9 A;  3PUX F;  2QVA A;  4IRE A;  5JRE A;  4P09 A;  3C50 A;  1D0Z A;  5JDM A;  2HN1 A;  1LKX A;  3RF1 A;  2C5J A;  3N9M A;  4ILU A;  1IBM T;  5FVK A;  4DV4 T;  3OPC A;  3UU3 A;  4IE7 A;  4EEB A;  2IUB A;  2MAW A;  3CK6 A;  3TLT A;  4ADZ A;  4YJ2 E;  3F57 A;  2NTY A;  3RIF A;  3KDS E;  4F6R C;  2LM2 A;  3RIU C;  3DTO A;  2KMF A;  1ZOY A;  1B7T A;  2XAJ B;  2WSS V;  5J2T E;  3UU5 A;  2ES0 A;  1VCT A;  1NEN A;  2BZB A;  2XSB A;  3ZMS B;  3PTR B;  1R8I A;  2W67 A;  3FZF B;  3IEE A;  1LVK A;  4ZXL A;  2CHO A;  4P1N A;  3RC3 A;  4K0K T;  3BQL A;  4MFR A;  4IE6 A;  3ZC0 A;  4TWH A;  2V6X A;  2LE8 A;  2YKS A;  3ZYL A;  2CLY B;  2Y6X A;  2OV9 A;  1FMW A;  4FJO A;  3I0Q A;  4U7I A;  2XQ9 A;  5HEU A;  5J0Z A;  2WWU A;  2NW7 A;  3UTK A;  2VKD A;  5HXH A;  4H9O C;  2CLY C;  3PUS A;  4TV9 E;  5FL1 A;  3AXJ B;  2ZM0 A;  3O9X A;  1M7K A;  3MKD A;  4UV9 B;  4OX9 T;  2NR4 A;  3G06 A;  3C4Z A;  5DAB A;  2XQ6 A;  5HYA A;  4TWF A;  4UVB B;  2YN6 A;  5TAO A;  4HWH A;  1SHZ C;  1XDP A;  5CFB A;  4JEH B;  1UCU A;  3LK2 B;  2WCA A;  3M65 A;  5HCJ A;  3ONJ A;  2W0G A;  4TUY E;  1YD8 G;  3H37 A;  4G63 A;  2LHR A;  5JTG A;  3VR9 A;  3ZN0 B;  4Z90 A;  3RIU A;  5ABG A;  3RKG A;  3PJA A;  4KI0 F;  1MIW A;  1IJ5 A;  2FJB A;  4YSX A;  5ABE A;  1LRZ A;  2V5C A;  4IDO A;  4N78 D;  1SE7 A;  2X9H A;  4GKJ T;  1J1J A;  2UXN B;  2XQ5 A;  1YW0 A;  3RYF E;  2NW8 A;  5IHY A;  2WS3 A;  4ZI7 E;  1KF6 A;  5JDL A;  2LHN A;  2X9Y A;  3ZCI A;  3PU8 A;  3HA4 A;  2IDO B;  2XAG B;  3AE5 A;  4X66 T;  2LSJ A;  2XTL A;  4DO0 A;  1FJG T;  1OWA A;  4ZHQ E;  3AA0 B;  2KXP B;  4QX7 B;  2JQK A;  4JI3 T;  3T1Y T;  4NUU A;  5CA0 E;  5AQG B;  2DI4 A;  1MMD A;  1CHU A;  1XDO A;  2PJQ A;  2MOZ A;  3RYH E;  2N1G A;  4YHH T;  1NWM X;  5KX5 E;  1Y64 B;  5LNK A;  4F8H A;  3AXJ A;  4TNV A;  3AE3 A;  2LJL A;  1UX4 A;  4TV8 E;  4NUV A;  4DMW A;  1YQ3 A;  2V1D B;  4KUM B;  4PK6 A;  5AQV B;  4QKN A;  5EK2 A;  2BG9 E;  5C8Y E;  1HTJ F;  2YIN A;  3TLV A;  2UXC T;  5FXZ A;  3UQ4 A;  1V9D A;  3QK6 A;  4E7S A;  3OBV E;  1HG5 A;  5A1L A;  2XQY A;  3K3O A;  4HTE A;  5J2U E;  1WR0 A;  4P0B A;  3I9Y A;  2K9A A;  2N9D A;  2X0H A;  3QNU A;  5C2T A;  1M62 A;  4A56 A;  4AI6 A;  3FB2 A;  4YTN A;  4C90 A;  3ZJ2 A;  3AE2 A;  1W9R A;  1U4Q A;  2KZ7 B;  1WRD A;  2D9D A;  2CM0 A;  4I43 B;  3RRC A;  4DUZ T;  5DQW A;  3ZT7 A;  3FZL B;  4DBR A;  4LF4 T;  4UVC B;  4I55 E;  2BDE A;  5HXS A;  3PUQ A;  4X1I E;  1HCI A;  2DL1 A;  4A98 A;  4UR9 A;  2QA7 A;  4O4I E;  4L0R A;  4PW8 A;  3IF8 B;  4L5G A;  4B3M T;  4TWD A;  1MIV A;  5JH7 E;  2XM2 A;  5AQK B;  4YTP A;  4ZI2 D;  2NOX A;  2K3W A;  4IE5 A;  1FMV A;  4Z8X A;  3P4P A;  5IUX A;  5EK4 A;  2IAK A;  3D0T A;  1Z8U A;  3P4Q A;  3RQW A;  4MLK A;  1HX1 B;  3K8P C;  1KEY A;  4DV5 T;  1YXR A;  5L3E B;  2VVN A;  3ETV A;  3L3P A;  4WNK A;  1I6Z A;  1OXZ A;  2VQF T;  2M67 A;  3AA7 B;  1BR4 A;  4TNW A;  1KNP A;  4OHF A;  2A3D A;  1WYC A;  2NP9 A;  2CCQ A;  3ABV A;  2V7I A;  5ADX L;  2RA1 A;  1SUM B;  3AE8 A;  1UK5 A;  3AEB A;  3I0O A;  3N9O A;  3C4X A;  2C5I T;  2V8S V;  4IHJ E;  2I59 A;  4DVD A;  2JPF A;  3QB5 A;  2BS3 A;  4EYU A;  3CKD A;  4ZS3 A;  1UX5 A;  2L3L A;  3JC6 D;  4O2A E;  2BG9 B;  2LOP A;  4DR1 T;  3LK4 2;  2XAH B;  2JMK A;  2XJ7 A;  5ABF B;  3IHR A;  3NKZ A;  4DND A;  4PK4 A;  5ETW A;  1E1H B;  1JNR A;  3ZYM A;  2XHE B;  2LSY A;  4JV5 T;  3PUW F;  4U74 A;  4AQF C;  5AQJ B;  1MMN A;  1NEK A;  2CEA A;  3FXD B;  2BG9 C;  2BBJ A;  2UUC T;  2E5V A;  2X0L B;  2IIU A;  2H7O A;  2W2U A;  3AE4 A;  1IZN B;  5E0O A;  5LHI B;  1HS7 A;  3VKG A;  5F5W A;  1HF8 A;  4AQG A;  3EI0 A;  4GIW A;  4HE8 A;  2W66 A;  4NXM T;  1G8X A;  3EAB A;  4YT0 A;  2CXD A;  5FY1 A;  3KV4 A;  4YHJ A;  3RPU A;  2X0Y A;  3VKH A;  4PJL A;  4QXC B;  5LBM A;  3LDQ B;  4P0A A;  4JI0 T;  3MK7 C;  4COF A;  3NRY A;  3B5M A;  4Z91 A;  2J1D G;  2HN2 A;  1X9B A;  4UEM A;  2V26 A;  3PUV F;  4CXY A;  3ZKR A;  1IBK T;  2LSG A;  4DUY T;  4EXT A;  4H9Q C;  4CI3 B;  1H7C A;  4HFH A;  3UUX B;  1NAF A;  4BAY B;  3O1H A;  4DR3 T;  2Y8D A;  2JQ9 A;  2JIW A;  4O4J E;  3ONL C;  3Q5W A;  1XZY A;  3LFM A;  2MTQ A;  3QC9 A;  2ZM8 A;  1WR6 A;  1LVF A;  4U33 A;  4AQF A;  1GQE A;  5FVL A;  2HH7 A;  2BG9 A;  5LXT E;  4KHP T;  3HI2 A;  5ABF A;  4GYS A;  3GMI A;  2KWI B;  2LSI A;  3KIN B;  3AEC A;  3LK3 B;  2DWG A;  1UGO A;  1BR0 A;  2XY8 B;  4B3R T;  4EGW A;  3RYC E;  3UU8 A;  4H9N C;  3F31 A;  4L9I A;  4U72 A;  1XMO T;  3PV0 F;  3Q5D A;  2ZMA A;  4LFC T;  2V7K A;  1S35 A;  2K24 A;  4O2B E;  3NRX A;  3ZEF B;  1WFD A;  4U2Z A;  3WAK A;  1J5E T;  1VRB A;  2ACX A;  3EUH A;  1W0A A;  2DNX A;  3WAJ A;  3Q9D A;  4JI2 T;  5ABH A;  4IT4 A;  1MMG A;  3SFD A;  4H63 H;  2H88 A;  2XSA A;  1W0B A;  4QH1 A;  4ERR A;  4PFP A;  3W15 B;  5KDM C;  2Q9Q D;  4KBM B;  3AAA B;  2LSK A;  1YKH B;  3AB3 B;  4XZC A;  5AQU B;  5FYM A;  1D0X A;  4O8S A;  3VR8 A;  5LYJ E;  4ASK A;  4AKI A;  4LF9 T;  4TN7 B;  5HWY A;  5LJN A;  4CN1 A;  2CWY A;  5HWX A;  1KFY A;  2E9X B;  3AA6 B;  3LJC A;  2PG8 A;  2HPJ A;  2G0U A;  2PFV A;  4X5T A;  1D0Y A;  4HWD A;  3AAI A;  5FKY A;  4ZI2 C;  3T1H T;  2C0S A;  3ZSS A;  2E9X C;  2KLQ A;  2BS4 A;  5IYZ E;  5HXE A;  5JDN A;  2ZM6 T;  5L3C B;  2LKH A;  2C5K T;  4I50 E;  2ACZ A;  3C98 B;  3HKD E;  4UV8 B;  4B3T T;  3SS1 A;  1X79 A;  4HWC A;  4DV3 T;  4KX6 A;  5LJM A;  3EHZ A;  2XQA A;  2F4V T;  2IW5 B;  2VKJ A;  1L0V A;  4AKH A;  4KMC A;  5LCY A;  4AXP A;  5HEH A;  3EAM A;  1HNZ T;  4QHO A;  5DJQ C;  3AED A;  3HR0 A;  4UVA B;  2W62 A;  3AE7 A;  4I0U A;  5LP6 E;  2WAU A;  3T8O A;  2N2N A;  5LHH B;  1YKE B;  3UUL A;  3JC6 C;  2X67 A;  2WQY A;  2H3R A;  3RC8 A;  3L8R A;  2WWV A;  4X65 T;  5L3G B;  1QLB A;  4YLH A;  3MXZ A;  5KMG P;  3PUY F;  4AIS A;  4UF0 B;  2CBI A;  3WI3 A;  1HR0 T;  2A9U A;  2YDR A;  3OYX A;  1E2A A;  4X1K E;  2VB6 A;  4OYJ A;  4H9R C;  4ZZC A;  3O4X E;  3ZMT B;  3PUR A;  1N34 T;  1QUU A;  2CHN A;  2E5L T;  3GWH A;  4QXH B;  2VQE T;  3AA1 B;  4JYA T;  3KFW X;  2KND A;  3RH3 A;  4EOZ B;  3MAC A;  1HFA A;  4WZX A;  5LMU T;  2E9X A;  3ZYK A;  2ODV A;  2NWB A;  5AQS B;  5AQF B;  3RIA A;  3C4W A;  2I0M A;  3N5L A;  4BJN A;  5HCM A;  3AAE B;  1G73 A;  2VL8 A;  3QB5 K;  3UUN A;  2WDQ A;  3BQI A;  5F8P A;  1SA0 E;  1ZEE A;  4G2A A;  2A72 A;  4IE0 A;  4CI2 B;  3UUM A;  3Q5X A;  1KK7 A;  4EV6 A;  4DR4 T;  3KVA A;  4LF6 T;  3FXE B;  3MA9 A;  4HGA A;  3P4R A;  3CQG B;  5AQQ B;  3PE0 A;  2WDR A;  4DV0 T;  4I4T E;  2WU2 A;  3NZQ A;  3ZJ1 A;  3JAF A;  2IHR 1;  4AKR B;  5LB7 B;  3BQK A;  3N9N A;  1XWM A;  2EHO D;  2XQ4 A;  5DQV A;  2YOE A;  4LFB T;  2BKP A;  4QWN B;  1CUN A;  4HFB A;  4LML A;  2M6B A;  4J2C A;  5M4Y A;  2X9W A;  4PAG A;  4A5X A;  1XNQ T;  2IC6 A;  1T72 A;  3P8C D;  2ZM2 A;  5AQN B;  2QYW A;  4JEU B;  2E9X D;  4AKL A;  3RHW A;  3M3Z B;  3RX6 A;  2FJD A;  4UF0 A;  1YQ4 A;  5AQM B;  3PU3 A;  3TLS A;  3N9Q A;  3RRW A;  2XQ7 A;  2CMR A;  3HKC E;  3E22 E;  1D1B A;  1ZHC A;  4YY3 T;  2UU9 T;  3AVR A;  2WB5 A;  2M6I A;  3NBX X;  3AEE A;  5FY7 A;  2FUP A;  2JQQ A;  4HN9 A;  3ZLI A;  1UUR A;  3SWH A;  2V6Y B;  3X1D A;  3GN5 B;  3PUG A;  2V7M A;  3KVB A;  4EED A;  2Q9Q B;  3KV9 A;  3P4W A;  3C64 A;  1ZKE A;  4KP3 C;  4O4L E;  5FL0 A;  4TX5 A;  4LF7 T;  2J47 A;  3J7Y q;  5FXW A;  2FBW A;  2Q9Q C;  2YDS A;  2WMN A;  3AE6 A;  3FBZ A;  5FXV A;  5AQT B;  5JDQ A;  2BVM A;  1ZV4 X;  5HXC A;  2E2A A;  3E08 A;  5AQL B;  4PJJ A;  1I94 T;  4DV2 T;  4ANJ A;  4HFE A;  4LMK A;  2A2F X;  2DCF A;  4IE4 A;  2XUE A;  2ODU A;  2XAQ B;  4WYV A;  5AQI B;  3ZT5 A;  2VWA A;  4U3C A;  3LBX B;  2YU1 A;  1D1C A;  4E7Z A;  1IBL T;  3PUZ F;  3ONX A;  1ZP0 A;  3HL6 A;  3N9P A;  5LGN B;  3ZST A;  4NIQ A;  2NTX A;  3UQ7 A;  5H6Q B;  5HEO A;  2VL0 A;  1T7S A;  2JRK A;  4OFZ A;  3RI5 A;  3UU6 A;  3FZH B;  5L47 A;  2MPK A;  5CJ5 A;  2WM9 A;  4QH4 A;  3NVO A;  4X62 T;  4AQY T;  2KWH A;  2CE7 A;  4CN6 A;  3Q2M A;  2VVS A;  3SRZ A;  5L4H A;  2RPA A;  3HKE E;  4PFO A;  2DLR A;  4OYK A;  3TLW A;  5CGM A;  3VHL A;  2V6Y A;  3CX8 B;  1WYB A;  3GN5 A;  5J1G A;  4H9S E;  3OJA A;  2XM1 A;  2NW9 A;  3AEG A;  2Q9Q A;  3JCF A;  4GOU A;  5JQG E;  2XQ3 A;  4A97 A;  3CQC B;  3KV5 A;  1MNE A;  4JBW F;  5AQR B;  2D0T A;  2MYS A;  4XAX B;  2L9Q A;  4WBN E;  2YEV C;  1QSD A;  2OLT A;  4IIJ E;  2DHR A;  3JAE A;  1U5P A;  5LGT B;  2WP9 A;  4PJN A;  4DID B;  3SOL A;  1Z0P A;  4U7Y A;  4JI4 T;  2YDQ A;  1HNX T;  3OYZ A;  3FBL A;  3RLF F;  4CXW A;  4DR6 T;  5AQP B;  5AFU L;  5LGU B;  3AEF A;  3ZC1 A;  3LBX A;  3CX7 B;  4JUY A;  3KV6 A;  2KT9 A;  3CQX C;  2OA5 A;  4KHZ F;  5JR9 B;  2H7V C;  5LBQ B;  5JVD E;  3L09 A;  2VAS A;  1JNZ A;  5H6R B;  2FJE A;  5BR8 T;  5CA1 E;  2SPC A;  2JQH A;  4CZZ B;  2WDV A;  1HX8 A;  4IL4 A;  2D5U A;  4O4H E;  2D0U A;  2BKN A;  5JR9 C;  2EHO B;  5LA6 E;  3UFE A;  1KNZ A;  1T8B A;  4ISS A;  3KBT A;  1OED E;  1UUS A;  2X9X A;  3RQU A;  4IST A;  5LG3 A;  3CX6 B;  4K0U A;  4WW0 A;  2LRK A;  3S4U A;  2PTF A;  4DV7 T;  2EHO C;  2WBL A;  3ZPO A;  1D1A A;  2HHH T;  3HKB E;  4MAL A; 
#chains in the Genus database with same CATH homology
 4JI0 T;  3OTO T;  4B3T T;  4NXN T;  4DR7 T;  4LFA T;  4DV3 T;  5IWA T;  1J5E T;  1IBL T;  4JI3 T;  2F4V T;  3T1Y T;  4DUZ T;  4JI2 T;  5LMN T;  4JI4 T;  4YY3 T;  1N36 T;  2UU9 T;  1HNX T;  1IBK T;  4DUY T;  4LF4 T;  4JI7 T;  4DR1 T;  4OX9 T;  4B3S T;  4DR3 T;  4DR6 T;  4JI5 T;  4GKK T;  1HNZ T;  4YHH T;  1N32 T;  4DR4 T;  1IBM T;  4LF6 T;  4LF5 T;  4JI6 T;  4DV4 T;  4JV5 T;  4DR2 T;  4B3M T;  4DV0 T;  2UUB T;  4JI8 T;  2UUA T;  4X62 T;  2UUC T;  5BR8 T;  4AQY T;  4DV1 T;  4LF9 T;  4KHP T;  4LF7 T;  4X65 T;  4DR5 T;  4LFB T;  1XNR T;  1HNW T;  1HR0 T;  4GKJ T;  4LF8 T;  1XMQ T;  4DV5 T;  4NXM T;  2UXC T;  4K0K T;  1XNQ T;  1N33 T;  4B3R T;  4X64 T;  1N34 T;  4DV2 T;  1I94 T;  4DV7 T;  3T1H T;  2VQF T;  2E5L T;  1XMO T;  2VQE T;  4JYA T;  4X66 T;  2UXB T;  4LFC T;  4DV6 T;  2HHH T;  1FJG T;  2ZM6 T;  5LMU T;  2UXD T;  4JI1 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...