4LF6T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 33
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4lf6T00
4AQYT 4B3ST 4LF4T 4DUZT 3T1YT 4DR2T 4K0KT 4X66T 4JYAT 4B3RT 4B3TT 4NXMT 4DV6T 4OX9T 4DR3T 4LF8T 1HNWT 1HNXT 4DR7T 4DV7T 4X65T 4B3MT 1N34T 4DV4T 1HNZT 1XNRT 1J5ET 4DR4T 2ZM6T 4JI8T 4GKJT 1IBKT 4DV3T 2F4VT 5IWAT 4YHHT 2UXDT 4LF7T 4DV0T 4KHPT 4JI6T 2UU9T 4NXNT 4JI0T 4X62T 1HR0T 1XMOT 4JI4T 2UUBT 4DV5T 2VQFT 1N36T 2UUCT 4DR1T 4LF5T 1IBLT 2E5LT 1FJGT 4JV5T 4DUYT 4GKKT 4LF9T 4DR5T 5LMUT 4LFAT 4DR6T 4LF6T 4JI7T 2UXBT 1IBMT 1N32T 1XMQT 3T1HT 4LFBT 5BR8T 2UUAT 3OTOT 4LFCT 4JI3T 4X64T 1N33T 2UXCT 4DV1T 2HHHT 1XNQT 4JI2T 4YY3T 1I94T 4DV2T 4JI1T 2VQET 4JI5T 5LMNT
chains in the Genus database with same CATH superfamily
1NWMX 5LG4A 5IHYA 4JEUB 2IUBA 3HA4A 4CXWA 4DR7T 1Z0PA 3RF1A 5LJMA 2Y8DA 3KBUA 4TZ4C 3PUQA 4C90A 3F31A 5J0ZA 2W4XA 3ZEFB 3JAFA 5HEOA 5L3EB 4EYUA 4HWHA 4CXXA 1J5ET 4PFOA 3U3IA 5ABFB 3AE8A 5LHIB 3AA7B 5LGUB 4GKJT 3ETUA 1YXRA 2RPAA 3C4XA 4KHPT 3ZT6A 2YINA 4U7IA 5HAXA 3ZCIA 2CXDA 2WM9A 2VWAA 1UURA 1X9BA 4LF5T 3FXEB 4JEHB 1IBLT 2KMFA 3UFEA 4DUYT 4ANJA 2VB6A 1KEYA 2XHEB 3PUVF 3RIUC 3NRYA 4AQFC 2UXBT 2A72A 5FMNA 3ZMVB 2QYWA 2XJ7A 4G63A 1R8IA 4OYKA 4IDQA 1HG5A 2X9HA 2XAFB 4YSYA 2BS3A 4DBQA 2ZLYA 1QLBA 3Q5WA 4A97A 2N9DA 4ADZA 2V8SV 2WS3A 5J1GA 2HN1A 3CMLA 5HCJA 4QXBB 1HNXT 4EV6A 1QUUA 2WAUA 2SPCA 3ZCJA 2CMRA 5CJ5A 3KVAA 2DWKA 2CA5A 2CHOA 4PK4A 1MMAA 4AKLA 1XDPA 2BS2A 3NZQA 1KNZA 5HEGA 3HKEE 4PJJA 5JQGE 4QXCB 3RGLA 4EZHA 5IWAT 1MNDA 2VURA 4DV0T 4HWIB 2WQYA 1NEKA 3LK2B 3P4SA 1WFDA 2R6GF 3SRZA 1MMGA 4CXYA 4H63H 1U5PA 2FJEA 2H89A 5JDNA 4LFAT 2NWBA 5FNVE 1U4QA 4UV8B 4AXPA 2XTLA 4AIUA 3AAEB 2E9XB 4NPPA 1N33T 4JLEA 4IE6A 3UUXB 3NBXX 5C3JA 3AXJA 5KDMC 3J9X1 2YU2A 1JNZA 1MIYA 1MMDA 2QA7A 4YSXA 3ZKRA 3PE0A 4EYYR 3AA0B 1LVFA 3QOFA 4GIWA 5F5WA 5HEHA 3AB3B 1IJ5A 2XAQB 3K8PC 4DV7T 2LOPA 5IYZE 4AISA 5L3FB 5AQNB 4QH4A 2YN6A 2D9DA 3CX6B 4U31A 3WI3A 4WYVA 1XNRT 1UX5A 4IREA 2G0UA 1KFYA 3C51A 4F8HA 2BZBA 2FJDA 5TAOA 2JQHA 5ABHA 2E8IA 2LHNA 1SE7A 4ZXLA 3QB5A 5LCYA 2X9YA 1WRDA 1G8XA 3J7Yq 4C91A 3PJAJ 4ILUA 2IC9A 3AXJB 2M6BA 5J2UE 2KT9A 3Q2MA 2CLYB 2KNDA 4U3CA 3LK3B 3PUWF 4IIJE 2WU2A 4PFPA 3AEAA 4EIWA 1VCTA 3BK9A 2WZIA 2CRBA 4QX7B 3A5XA 4O4IE 2LSJA 3VR8A 2LE8A 3RIUA 3WAJA 3L8RA 1OXZA 3VRAA 4QH1A 4AQFA 3UU6A 3ZJ2A 3RYHE 3RC8A 2ZM0A 1KNRA 3AAAB 3LFMA 4CI1B 3T1YT 4K0KT 3BQKA 3AEGA 3H3AA 5LA6E 2LSKA 2OV9A 3KDSE 2BG9C 3ZMUB 3H37A 2H7OA 2K3WA 1YKHB 4L0RA 3MXZA 2V7LA 5JDMA 4JI8T 4LMLA 2DHRA 2VKJA 3C4ZA 2A2FX 4YHHT 3ZSSA 4JUYA 2ODVA 3P7IA 2AE9A 2V1DB 2NW8A 4JI0T 2FJBA 3CK6A 5JDHA 5LP6E 2Q9QD 3M65A 3P50A 2EHOC 4IE0A 1WYCA 5DQVA 2B76A 3MK7C 3O1JA 1KF6A 3HKBE 4IHJE 1BR2A 2LJLA 2DI4A 3GWHA 3RH3A 1T8BA 3N9QA 5LXTE 3KV4A 3FBZA 3ETVA 5L3GB 4P09A 4HGAA 3VU7H 3TLTA 2FBWA 1FIOA 4EZ4A 3AVSA 4JI5T 3D0TA 4IDNA 4IE4A 1T98A 5KMGP 1Z8UA 1D1AA 3KV6A 5J2TE 3GMIA 4H9SE 2LRLA 2X0LB 2K48A 2IDOB 2E9XC 3ANWA 5AQPB 1UGOA 5EK3A 5EK2A 5HXCA 2LLYA 3FBLA 4HFHA 1D0YA 2LSGA 3Q5XA 3RKOA 4HKAA 2VASA 5C2TA 3OYXA 4DV5T 4E7ZA 2B1EA 2WBLA 3UU8A 1ZOYA 4X1KE 1S35A 3ZC1A 4IDZA 2LM2A 2A3DA 4N78D 2MBGA 2V7MA 3CQCB 1HFAA 3UT5E 1N32T 4XZCA 1XMQT 5HXSA 5C8YE 2YDQA 3ANWB 1ZEEA 1WR0A 5LGNB 4OFZA 5CGMA 4YTNA 3ABVA 2V5CA 3EDUA 3Q5DA 4WBOA 5HEUA 4JI1T 2WMOA 3OVUA 4CI2B 4J2CA 3UU3A 3V5SA 1W9RA 3FZLB 3TLUA 2VKHA 2WZHA 2N2NA 4NXMT 5DABA 4KP3C 4PNIA 1ZP0A 3RQUA 2CEAA 5KX5E 3QB5K 2X9XA 2V7IA 3UFGA 4AKRB 4BJMA 2LRKA 5EK4A 5ADXL 4DR4T 5JR9A 4LMKA 3B5MA 1WCRA 1LVKA 2KXPB 5AQOB 4TX5A 3EI0A 5AQSB 3K3OA 2BG9A 4MBQA 2AXDS 4ERRA 4PJLA 2Y48B 2DNXA 2V26A 5HWXA 2LSIA 3CX7B 3MACA 5FKYA 3UULA 5LGTB 5L4EA 5ABGA 5AQQB 3IBPA 3AE6A 4WBNE 2V5DA 3P8CD 1D0XA 1HF8A 1E2AA 3JC6D 1IAPA 2EHOA 2X9WA 5ABEA 5AQHB 3NZPA 3TKLB 2WY2A 4ZI3C 4X1IE 3N9PA 1YQ3A 5JR9B 3PU3A 4BAYB 2X66A 2XQ4A 4H9OC 3AE1A 2C5JA 3UUBA 2PFVA 4YXDA 2LHRA 4YLHA 3P4RA 4ILAA 3RRWA 2BG9B 3B57A 4GK0E 4O8SA 3ZLIA 2J62A 3PUYF 4KBMB 4UVCB 2BBJA 4B3MT 4I43B 1CUNA 3AEEA 2BDEA 4PAGA 5L2LA 3NKZA 3W15B 4O4HE 2XQYA 1XWMA 2DCFA 2VVNA 5DJQC 5H6RB 3SS1A 4O4LE 4TV9E 3TLVA 2E9XA 2EHOB 4H9RC 5FYMA 1IZNB 4CN6A 2W0GA 4UEMA 4NUVA 2IC6A 2UUBT 4TWDA 4GK5E 4EXTA 3MJXA 4ZS3A 4DR1T 5BMVE 5AFUL 1FJGT 1HTJF 2W00A 2XQAA 3AECA 1SUMB 5HYAA 2HPLA 5L3DB 1YKEB 4V1Av 1J5WA 2VL0A 3FZMB 4TUYE 2H88A 2LM9A 4DV1T 5DQWA 2W63A 1MMNA 3AE9A 2RP4A 4A98A 2DWGA 1VRBA 3UTKA 4DNDA 3FHNA 5FY7A 2V7KA 4AQYT 2Y6XA 4YTMA 2KINB 3B13A 3F2EA 3ZMTB 2VKOA 2LKGA 3VHLA 4WW0A 4B6XA 4EAHA 2MPKA 3GA8A 3R84B 4ZZBA 4ZS2A 2HPJA 4AQGA 2IHR1 4HFEA 4O2BE 4PJMA 4IE7A 1FMVA 3DJBA 1W0BA 4IE5A 2JIWA 4HFVA 4FI5A 2J47A 3HR0A 4DV3T 4YHJA 4OK0A 3AE3A 4HE8A 5L4HA 2X67A 4YSZA 1IJ6A 2IW5B 1G73A 1T7SA 4ASKA 4JI4T 3L09A 4EEBA 4U33A 4OYJA 2VQFT 4HTEA 3BQIA 3VR9A 4MFRA 4DMWA 3RIFA 3RYIE 5F8PA 5HXEA 5JH7E 3PJAA 4QKNA 3RQWA 4A56A 1W0AA 3UQ4A 3UU5A 3RHWA 3U78A 2NW7A 1V9DA 3PUSA 2XASB 3OJAA 1I94T 4IL9A 3I9YA 1B7TA 1YQ4A 2M67A 3DTOA 3FXDB 3I0OA 3LBXA 4DR2T 2E5VA 4I50E 3M3ZB 4QXHB 2HH7A 2BKOA 4CN1A 2WCAA 4U7YA 2NW9A 4DO0A 2ZM6T 1UK5A 2D2SA 5JR9C 3MKDA 4OHFA 3IHRA 3PUXF 4U72A 2CHNA 3ZYKA 3S4UA 5FY1A 3OBVE 2I59A 1LKXA 2XQ7A 3K3NA 4KHZF 3SOLA 1HR0T 2YDSA 4ZI2C 3E22E 3EHZA 2XQ6A 1SA0E 2YU1A 5LG3A 2FUPA 3LBXB 5FXVA 5CA0E 2A9UA 3IEEA 2WSSV 5GONE 3SFDA 4HFDA 2VVSA 4ZOLE 4JI3T 3I0QA 5HWYA 2UXCT 1T72A 2ZM8A 3JADA 1ZKEA 2K9AA 1GQEA 1EZ3A 2C0SA 3X1DA 4KUMB 3LSVA 3FZKB 4IDPA 5FP3A 4B3ST 1OEDE 4BJNA 3CQXC 4A5XA 3BQLA 3O1HA 1W09A 2LT3A 2VKDA 4HFCA 4PJNA 5AQRB 3G06A 3ESLA 4TWHA 3ZMZB 4JBWF 3RX6A 2OA5A 4P0BA 3ZPOA 2K24A 2LSYA 4IDOA 4ZZCA 1X79A 2C5IT 4YJ2E 1D0ZA 2JRKA 3LJCA 3HKCE 4K0UA 4LF7T 3C64A 5LOVE 4HFBA 3KINB 3ZT7A 2L3LA 3FB2A 5FVLA 3ONJA 2IMLA 2DL1A 3AA1B 4KI0F 1HS7A 2LEHA 3UU4A 1JNRA 4DR5T 1H7CA 1DU2A 1XZYA 2ES0A 4LF6T 1IBMT 3ONXA 5LBMA 2GK9A 3PDYA 5E0OA 3N9MA 4GYRA 5AQIB 3QNUA 2XQ8A 4EOZB 1XNQT 4DVDA 4GYSA 3RYCE 2CM0A 3KV9A 5F3JA 3DP7A 5JDQA 5A1LA 2JJ9A 5LMNT 2WMNA 3PV0F 4Q25A 5EZYE 2XQ9A 2JQ9A 1Y64B 2RA1A 4X5TA 3E08A 2L9QA 4TN7B 3JCFA 4Z90A 3MZKB 2ACXA 1HX1B 4IT4A 2D0UA 3HL6A 3HI2A 1Y01A 2CPTA 4ZI2D 2KZ7B 3GN5A 3N2KE 1L0VA 3CX8B 2M6IA 2H3RA 3AVRA 3PUZF 4UELA 2X68A 4U74A 4XBFB 4P1NA 1ZHCA 3EVYA 4U2ZA 1WYBA 3RRCA 3WAKA 1HG2A 4PK6A 2N1GA 2WWVA 4I4TE 3N9NA 2EHOD 3AEFA 1M7KA 3I9WA 3AE7A 3H3MA 3CVRA 5BR8T 1NENA 2UUAT 2I0MA 2VK9A 4E7SA 4X64T 3O1IA 2HHHT 4QX8B 2WDRA 3AEBA 2MOZA 4YY3T 4YFSA 1QSDA 2IAKA 2P9BA 4TWFA 1YD8G 3GN5B 2UXNB 4DIDB 2MYSA 2XM2A 5ETWA 4X66T 4JYAT 2J4GA 4X1YE 4EGWA 1MNEA 3LK42 4HWDA 3NRXA 3EUHA 1N34T 4IL4A 3N2GE 1MIWA 2CXFA 2E9XD 2X0YA 2YKSA 3SFEA 2BVLA 4H63V 1YW0A 2C5KT 1AJ3A 4XAXB 1OWAA 3CKDA 2WP9A 1IBKT 3EDVA 3AE4A 2YEVC 2E2AA 5LHGB 3L3PA 3LG7A 2UXDT 2CWYA 1WLXA 4H9QC 2L8KA 4YJ3E 1XDOA 4ISTA 5FY0A 2XAGB 2UUCT 5AQMB 5JDGA 3N5LA 4MALA 3EAMA 1CHUA 1OEDA 4JV5T 2WB5A 1E1HB 3CWZB 2LOSA 3QUJA 1VCSA 4M1PA 1KNPA 4BA9A 3NVOA 4JI7T 5L3CB 4MHCA 4CZZB 2PBIA 1UX4A 4LFBT 1BR4A 2XUEA 3F57A 2Z6EA 5LYJE 5AQUB 3R6NA 1VOMA 1US7B 1WR6A 2CE7A 3ZSTA 2MAWA 2ODUA 2WDVA 3ZMSB 3A7MA 3AA6B 2XZEA 4X20E 4H9NC 4ILBA 4COFA 4DUZT 3RI5A 4B3RT 3ZC0A 4LF8T 1HNWT 4PK5A 2QGSA 5AQKB 2V6XA 5LB7B 5IUXA 4H9PC 4DV4T 3RC3A 1I6ZA 3RPUA 4MLKA 1OEDB 1M62A 2XY8B 5JVDE 3T8OA 2KWIB 3QK6A 4HN9A 4Z91A 2NP9A 3HKDE 5HEJA 4WZXA 4JI6T 2UU9T 2Q9QC 4UIGA 3K1SA 1MIVA 2VL8A 4ZI7E 4DMVA 5CA1E 2DLRA 2BVMA 3EABA 4LF9T 3VRBA 3KVBA 2NOXA 2XSBA 5FXXA 2UXXB 1LRZA 3QC9A 1HX8A 3P4WA 1NAFA 3AEDA 2W2UA 2JQKA 5JRCA 4CN4A 2XQ3A 2V6YA 1J1JA 4UVBB 4ZI3D 1FMWA 2VQET 1KK7A 1ZV4X 2YOEA 3P4PA 1UCUA 3LDQB 2ZM2A 4I0UA 4OX9T 2YDRA 3IF8B 2CBIA 2KWHA 3C4WA 4ZEYA 3NWIA 1HNZT 2NR4A 4L5GA 4F6RC 2XSAA 2W61A 5HXRA 3C98B 3PUGA 3VKGA 4CI3B 3RLFF 4O2AE 2WWUA 4TNWA 4X62T 5FVKA 5JRCB 2IIUA 2V6YB 3O4XE 4NUUA 4AKGA 5LJNA 4KMCA 4AI6A 2ZMAA 2BG9E 1D1CA 4UVAB 4GOUA 3SWHA 5FXWA 2D0TA 5FL1A 1BR1A 4QWNB 1HCIA 5FL0A 4LMJA 2JPFA 2QVAA 4ILCA 3OTOT 4LFCT 4ZHQE 3OPCA 3TLWA 3N9OA 2NTYA 2CBJA 4KX6A 3KV5A 5AQFB 4DV2T 2HN2A 4AKIA 3PURA 3PU8A 3KBTA 3ZN1B 2CWOA 4PW8A 2QRXA 5JREA 4HWCA 3VKHA 2W66A 4LF4T 2KSRA 3V5UA 2XPKA 4AKHA 4QH5A 1E7PA 3RIAA 4DV6T 3OYZA 3JAEA 4DR3T 3N2OA 4L9IA 5HXHA 5LBQB 1UUSA 2WDQA 3OKQA 3ZN0B 3RKGA 1BR0A 5LHHB 4EB6E 2LKHA 2J1DG 4HWFA 2NTXA 2F4VT 3I1AA 2PJQA 2ACZA 3IA3A 2D5UA 2JMKA 4UV9B 2JMHA 2OLTA 1OEDC 4UF0A 4Z8XA 4HEAA 2BKNA 3ZYLA 5CB4E 3FZFB 2JQQA 3AAIA 5AQTB 2Q9QA 3PTRB 3JC6C 3MA9A 5CFBA 3N9LA 3UUMA 1O3XA 2PTFA 3P4QA 2BKPA 2BBHA 4JI2T 5M4YA 3O9XA 2XAHB 3ZYMA 1SHZC 3Q9DA 2X51A 5JDLA 2W62A 5AQJB 3TLSA 4IGUA 2V7JA 4G2AA 4UXNB 2H7VC 4TV8E 4EEDA 1D1BA 4B3TT 4DBRA 1FEWA 3CIRA 2MTQA 4X65T 2XAJB 3UUNA 4WNKA 5H6QB 3FZHB 2YK0A 3Q5EA 3RYFE 3UQ7A 2FJAA 4CQIA 4FJOA 2BS4A 4UF0B 5LNKA 3PUAA 2Q9QB 2WU5A 3CPZA 5FXZA 2X0HA 4NXNT 3A8YC 4HFIA 2KLQA 1S94A 4I55E 1XMOT 3C50A 3K3QC 4ISSA 1N36T 2W67A 5JDFA 3CQGB 2XQ5A 5AQGB 2E5LT 3ONLC 4O4JE 4GKKT 4QHOA 5ABFA 5LMUT 2CLYC 4YTPA 4DR6T 5AQVB 4YT0A 4NIQA 2K5BB 3T1HT 2I6HA 5AQLB 3ZT5A 4U2YA 2CXLA 4P0AA 4UR9A 5HCMA 3E0ZA 3L39A 5JTGA 3ZJ1A 5KXJA 2PG8A 3KFWX 5L47A 3AE2A 2XM1A 4TNVA 2CCQA 5L3BB 3AE5A
chains in the Genus database with same CATH topology
4AQYT 4B3ST 4LF4T 4DUZT 3T1YT 4DR2T 4K0KT 4X66T 4JYAT 4B3RT 4B3TT 4NXMT 4DV6T 4OX9T 4DR3T 4LF8T 1HNWT 1HNXT 4DR7T 4DV7T 4X65T 4B3MT 1N34T 4DV4T 1HNZT 1XNRT 1J5ET 4DR4T 2ZM6T 4JI8T 4GKJT 1IBKT 4DV3T 2F4VT 5IWAT 4YHHT 2UXDT 4LF7T 4DV0T 4KHPT 4JI6T 2UU9T 4NXNT 4JI0T 4X62T 1HR0T 1XMOT 4JI4T 2UUBT 4DV5T 2VQFT 1N36T 2UUCT 4DR1T 4LF5T 1IBLT 2E5LT 1FJGT 4JV5T 4DUYT 4GKKT 4LF9T 4DR5T 5LMUT 4LFAT 4DR6T 4LF6T 4JI7T 2UXBT 1IBMT 1N32T 1XMQT 3T1HT 4LFBT 5BR8T 2UUAT 3OTOT 4LFCT 4JI3T 4X64T 1N33T 2UXCT 4DV1T 2HHHT 1XNQT 4JI2T 4YY3T 1I94T 4DV2T 4JI1T 2VQET 4JI5T 5LMNT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AQY T;  4B3S T;  4LF4 T;  4DUZ T;  3T1Y T;  4DR2 T;  4K0K T;  4X66 T;  4JYA T;  4B3R T;  4B3T T;  4NXM T;  4DV6 T;  4OX9 T;  4DR3 T;  4LF8 T;  1HNW T;  1HNX T;  4DR7 T;  4DV7 T;  4X65 T;  4B3M T;  1N34 T;  4DV4 T;  1HNZ T;  1XNR T;  1J5E T;  4DR4 T;  2ZM6 T;  4JI8 T;  4GKJ T;  1IBK T;  4DV3 T;  2F4V T;  5IWA T;  4YHH T;  2UXD T;  4LF7 T;  4DV0 T;  4KHP T;  4JI6 T;  2UU9 T;  4NXN T;  4JI0 T;  4X62 T;  1HR0 T;  1XMO T;  4JI4 T;  2UUB T;  4DV5 T;  2VQF T;  1N36 T;  2UUC T;  4DR1 T;  4LF5 T;  1IBL T;  2E5L T;  1FJG T;  4JV5 T;  4DUY T;  4GKK T;  4LF9 T;  4DR5 T;  5LMU T;  4LFA T;  4DR6 T;  4LF6 T;  4JI7 T;  2UXB T;  1IBM T;  1N32 T;  1XMQ T;  3T1H T;  4LFB T;  5BR8 T;  2UUA T;  3OTO T;  4LFC T;  4JI3 T;  4X64 T;  1N33 T;  2UXC T;  4DV1 T;  2HHH T;  1XNQ T;  4JI2 T;  4YY3 T;  1I94 T;  4DV2 T;  4JI1 T;  2VQE T;  4JI5 T;  5LMN T; 
#chains in the Genus database with same CATH topology
 1NWM X;  5LG4 A;  5IHY A;  4JEU B;  2IUB A;  3HA4 A;  4CXW A;  4DR7 T;  1Z0P A;  3RF1 A;  5LJM A;  2Y8D A;  3KBU A;  4TZ4 C;  3PUQ A;  4C90 A;  3F31 A;  5J0Z A;  2W4X A;  3ZEF B;  3JAF A;  5HEO A;  5L3E B;  4EYU A;  4HWH A;  4CXX A;  1J5E T;  4PFO A;  3U3I A;  5ABF B;  3AE8 A;  5LHI B;  3AA7 B;  5LGU B;  4GKJ T;  3ETU A;  1YXR A;  2RPA A;  3C4X A;  4KHP T;  3ZT6 A;  2YIN A;  4U7I A;  5HAX A;  3ZCI A;  2CXD A;  2WM9 A;  2VWA A;  1UUR A;  1X9B A;  4LF5 T;  3FXE B;  4JEH B;  1IBL T;  2KMF A;  3UFE A;  4DUY T;  4ANJ A;  2VB6 A;  1KEY A;  2XHE B;  3PUV F;  3RIU C;  3NRY A;  4AQF C;  2UXB T;  2A72 A;  5FMN A;  3ZMV B;  2QYW A;  2XJ7 A;  4G63 A;  1R8I A;  4OYK A;  4IDQ A;  1HG5 A;  2X9H A;  2XAF B;  4YSY A;  2BS3 A;  4DBQ A;  2ZLY A;  1QLB A;  3Q5W A;  4A97 A;  2N9D A;  4ADZ A;  2V8S V;  2WS3 A;  5J1G A;  2HN1 A;  3CML A;  5HCJ A;  4QXB B;  1HNX T;  4EV6 A;  1QUU A;  2WAU A;  2SPC A;  3ZCJ A;  2CMR A;  5CJ5 A;  3KVA A;  2DWK A;  2CA5 A;  2CHO A;  4PK4 A;  1MMA A;  4AKL A;  1XDP A;  2BS2 A;  3NZQ A;  1KNZ A;  5HEG A;  3HKE E;  4PJJ A;  5JQG E;  4QXC B;  3RGL A;  4EZH A;  5IWA T;  1MND A;  2VUR A;  4DV0 T;  4HWI B;  2WQY A;  1NEK A;  3LK2 B;  3P4S A;  1WFD A;  2R6G F;  3SRZ A;  1MMG A;  4CXY A;  4H63 H;  1U5P A;  2FJE A;  2H89 A;  5JDN A;  4LFA T;  2NWB A;  5FNV E;  1U4Q A;  4UV8 B;  4AXP A;  2XTL A;  4AIU A;  3AAE B;  2E9X B;  4NPP A;  1N33 T;  4JLE A;  4IE6 A;  3UUX B;  3NBX X;  5C3J A;  3AXJ A;  5KDM C;  3J9X 1;  2YU2 A;  1JNZ A;  1MIY A;  1MMD A;  2QA7 A;  4YSX A;  3ZKR A;  3PE0 A;  4EYY R;  3AA0 B;  1LVF A;  3QOF A;  4GIW A;  5F5W A;  5HEH A;  3AB3 B;  1IJ5 A;  2XAQ B;  3K8P C;  4DV7 T;  2LOP A;  5IYZ E;  4AIS A;  5L3F B;  5AQN B;  4QH4 A;  2YN6 A;  2D9D A;  3CX6 B;  4U31 A;  3WI3 A;  4WYV A;  1XNR T;  1UX5 A;  4IRE A;  2G0U A;  1KFY A;  3C51 A;  4F8H A;  2BZB A;  2FJD A;  5TAO A;  2JQH A;  5ABH A;  2E8I A;  2LHN A;  1SE7 A;  4ZXL A;  3QB5 A;  5LCY A;  2X9Y A;  1WRD A;  1G8X A;  3J7Y q;  4C91 A;  3PJA J;  4ILU A;  2IC9 A;  3AXJ B;  2M6B A;  5J2U E;  2KT9 A;  3Q2M A;  2CLY B;  2KND A;  4U3C A;  3LK3 B;  3PUW F;  4IIJ E;  2WU2 A;  4PFP A;  3AEA A;  4EIW A;  1VCT A;  3BK9 A;  2WZI A;  2CRB A;  4QX7 B;  3A5X A;  4O4I E;  2LSJ A;  3VR8 A;  2LE8 A;  3RIU A;  3WAJ A;  3L8R A;  1OXZ A;  3VRA A;  4QH1 A;  4AQF A;  3UU6 A;  3ZJ2 A;  3RYH E;  3RC8 A;  2ZM0 A;  1KNR A;  3AAA B;  3LFM A;  4CI1 B;  3T1Y T;  4K0K T;  3BQK A;  3AEG A;  3H3A A;  5LA6 E;  2LSK A;  2OV9 A;  3KDS E;  2BG9 C;  3ZMU B;  3H37 A;  2H7O A;  2K3W A;  1YKH B;  4L0R A;  3MXZ A;  2V7L A;  5JDM A;  4JI8 T;  4LML A;  2DHR A;  2VKJ A;  3C4Z A;  2A2F X;  4YHH T;  3ZSS A;  4JUY A;  2ODV A;  3P7I A;  2AE9 A;  2V1D B;  2NW8 A;  4JI0 T;  2FJB A;  3CK6 A;  5JDH A;  5LP6 E;  2Q9Q D;  3M65 A;  3P50 A;  2EHO C;  4IE0 A;  1WYC A;  5DQV A;  2B76 A;  3MK7 C;  3O1J A;  1KF6 A;  3HKB E;  4IHJ E;  1BR2 A;  2LJL A;  2DI4 A;  3GWH A;  3RH3 A;  1T8B A;  3N9Q A;  5LXT E;  3KV4 A;  3FBZ A;  3ETV A;  5L3G B;  4P09 A;  4HGA A;  3VU7 H;  3TLT A;  2FBW A;  1FIO A;  4EZ4 A;  3AVS A;  4JI5 T;  3D0T A;  4IDN A;  4IE4 A;  1T98 A;  5KMG P;  1Z8U A;  1D1A A;  3KV6 A;  5J2T E;  3GMI A;  4H9S E;  2LRL A;  2X0L B;  2K48 A;  2IDO B;  2E9X C;  3ANW A;  5AQP B;  1UGO A;  5EK3 A;  5EK2 A;  5HXC A;  2LLY A;  3FBL A;  4HFH A;  1D0Y A;  2LSG A;  3Q5X A;  3RKO A;  4HKA A;  2VAS A;  5C2T A;  3OYX A;  4DV5 T;  4E7Z A;  2B1E A;  2WBL A;  3UU8 A;  1ZOY A;  4X1K E;  1S35 A;  3ZC1 A;  4IDZ A;  2LM2 A;  2A3D A;  4N78 D;  2MBG A;  2V7M A;  3CQC B;  1HFA A;  3UT5 E;  1N32 T;  4XZC A;  1XMQ T;  5HXS A;  5C8Y E;  2YDQ A;  3ANW B;  1ZEE A;  1WR0 A;  5LGN B;  4OFZ A;  5CGM A;  4YTN A;  3ABV A;  2V5C A;  3EDU A;  3Q5D A;  4WBO A;  5HEU A;  4JI1 T;  2WMO A;  3OVU A;  4CI2 B;  4J2C A;  3UU3 A;  3V5S A;  1W9R A;  3FZL B;  3TLU A;  2VKH A;  2WZH A;  2N2N A;  4NXM T;  5DAB A;  4KP3 C;  4PNI A;  1ZP0 A;  3RQU A;  2CEA A;  5KX5 E;  3QB5 K;  2X9X A;  2V7I A;  3UFG A;  4AKR B;  4BJM A;  2LRK A;  5EK4 A;  5ADX L;  4DR4 T;  5JR9 A;  4LMK A;  3B5M A;  1WCR A;  1LVK A;  2KXP B;  5AQO B;  4TX5 A;  3EI0 A;  5AQS B;  3K3O A;  2BG9 A;  4MBQ A;  2AXD S;  4ERR A;  4PJL A;  2Y48 B;  2DNX A;  2V26 A;  5HWX A;  2LSI A;  3CX7 B;  3MAC A;  5FKY A;  3UUL A;  5LGT B;  5L4E A;  5ABG A;  5AQQ B;  3IBP A;  3AE6 A;  4WBN E;  2V5D A;  3P8C D;  1D0X A;  1HF8 A;  1E2A A;  3JC6 D;  1IAP A;  2EHO A;  2X9W A;  5ABE A;  5AQH B;  3NZP A;  3TKL B;  2WY2 A;  4ZI3 C;  4X1I E;  3N9P A;  1YQ3 A;  5JR9 B;  3PU3 A;  4BAY B;  2X66 A;  2XQ4 A;  4H9O C;  3AE1 A;  2C5J A;  3UUB A;  2PFV A;  4YXD A;  2LHR A;  4YLH A;  3P4R A;  4ILA A;  3RRW A;  2BG9 B;  3B57 A;  4GK0 E;  4O8S A;  3ZLI A;  2J62 A;  3PUY F;  4KBM B;  4UVC B;  2BBJ A;  4B3M T;  4I43 B;  1CUN A;  3AEE A;  2BDE A;  4PAG A;  5L2L A;  3NKZ A;  3W15 B;  4O4H E;  2XQY A;  1XWM A;  2DCF A;  2VVN A;  5DJQ C;  5H6R B;  3SS1 A;  4O4L E;  4TV9 E;  3TLV A;  2E9X A;  2EHO B;  4H9R C;  5FYM A;  1IZN B;  4CN6 A;  2W0G A;  4UEM A;  4NUV A;  2IC6 A;  2UUB T;  4TWD A;  4GK5 E;  4EXT A;  3MJX A;  4ZS3 A;  4DR1 T;  5BMV E;  5AFU L;  1FJG T;  1HTJ F;  2W00 A;  2XQA A;  3AEC A;  1SUM B;  5HYA A;  2HPL A;  5L3D B;  1YKE B;  4V1A v;  1J5W A;  2VL0 A;  3FZM B;  4TUY E;  2H88 A;  2LM9 A;  4DV1 T;  5DQW A;  2W63 A;  1MMN A;  3AE9 A;  2RP4 A;  4A98 A;  2DWG A;  1VRB A;  3UTK A;  4DND A;  3FHN A;  5FY7 A;  2V7K A;  4AQY T;  2Y6X A;  4YTM A;  2KIN B;  3B13 A;  3F2E A;  3ZMT B;  2VKO A;  2LKG A;  3VHL A;  4WW0 A;  4B6X A;  4EAH A;  2MPK A;  3GA8 A;  3R84 B;  4ZZB A;  4ZS2 A;  2HPJ A;  4AQG A;  2IHR 1;  4HFE A;  4O2B E;  4PJM A;  4IE7 A;  1FMV A;  3DJB A;  1W0B A;  4IE5 A;  2JIW A;  4HFV A;  4FI5 A;  2J47 A;  3HR0 A;  4DV3 T;  4YHJ A;  4OK0 A;  3AE3 A;  4HE8 A;  5L4H A;  2X67 A;  4YSZ A;  1IJ6 A;  2IW5 B;  1G73 A;  1T7S A;  4ASK A;  4JI4 T;  3L09 A;  4EEB A;  4U33 A;  4OYJ A;  2VQF T;  4HTE A;  3BQI A;  3VR9 A;  4MFR A;  4DMW A;  3RIF A;  3RYI E;  5F8P A;  5HXE A;  5JH7 E;  3PJA A;  4QKN A;  3RQW A;  4A56 A;  1W0A A;  3UQ4 A;  3UU5 A;  3RHW A;  3U78 A;  2NW7 A;  1V9D A;  3PUS A;  2XAS B;  3OJA A;  1I94 T;  4IL9 A;  3I9Y A;  1B7T A;  1YQ4 A;  2M67 A;  3DTO A;  3FXD B;  3I0O A;  3LBX A;  4DR2 T;  2E5V A;  4I50 E;  3M3Z B;  4QXH B;  2HH7 A;  2BKO A;  4CN1 A;  2WCA A;  4U7Y A;  2NW9 A;  4DO0 A;  2ZM6 T;  1UK5 A;  2D2S A;  5JR9 C;  3MKD A;  4OHF A;  3IHR A;  3PUX F;  4U72 A;  2CHN A;  3ZYK A;  3S4U A;  5FY1 A;  3OBV E;  2I59 A;  1LKX A;  2XQ7 A;  3K3N A;  4KHZ F;  3SOL A;  1HR0 T;  2YDS A;  4ZI2 C;  3E22 E;  3EHZ A;  2XQ6 A;  1SA0 E;  2YU1 A;  5LG3 A;  2FUP A;  3LBX B;  5FXV A;  5CA0 E;  2A9U A;  3IEE A;  2WSS V;  5GON E;  3SFD A;  4HFD A;  2VVS A;  4ZOL E;  4JI3 T;  3I0Q A;  5HWY A;  2UXC T;  1T72 A;  2ZM8 A;  3JAD A;  1ZKE A;  2K9A A;  1GQE A;  1EZ3 A;  2C0S A;  3X1D A;  4KUM B;  3LSV A;  3FZK B;  4IDP A;  5FP3 A;  4B3S T;  1OED E;  4BJN A;  3CQX C;  4A5X A;  3BQL A;  3O1H A;  1W09 A;  2LT3 A;  2VKD A;  4HFC A;  4PJN A;  5AQR B;  3G06 A;  3ESL A;  4TWH A;  3ZMZ B;  4JBW F;  3RX6 A;  2OA5 A;  4P0B A;  3ZPO A;  2K24 A;  2LSY A;  4IDO A;  4ZZC A;  1X79 A;  2C5I T;  4YJ2 E;  1D0Z A;  2JRK A;  3LJC A;  3HKC E;  4K0U A;  4LF7 T;  3C64 A;  5LOV E;  4HFB A;  3KIN B;  3ZT7 A;  2L3L A;  3FB2 A;  5FVL A;  3ONJ A;  2IML A;  2DL1 A;  3AA1 B;  4KI0 F;  1HS7 A;  2LEH A;  3UU4 A;  1JNR A;  4DR5 T;  1H7C A;  1DU2 A;  1XZY A;  2ES0 A;  4LF6 T;  1IBM T;  3ONX A;  5LBM A;  2GK9 A;  3PDY A;  5E0O A;  3N9M A;  4GYR A;  5AQI B;  3QNU A;  2XQ8 A;  4EOZ B;  1XNQ T;  4DVD A;  4GYS A;  3RYC E;  2CM0 A;  3KV9 A;  5F3J A;  3DP7 A;  5JDQ A;  5A1L A;  2JJ9 A;  5LMN T;  2WMN A;  3PV0 F;  4Q25 A;  5EZY E;  2XQ9 A;  2JQ9 A;  1Y64 B;  2RA1 A;  4X5T A;  3E08 A;  2L9Q A;  4TN7 B;  3JCF A;  4Z90 A;  3MZK B;  2ACX A;  1HX1 B;  4IT4 A;  2D0U A;  3HL6 A;  3HI2 A;  1Y01 A;  2CPT A;  4ZI2 D;  2KZ7 B;  3GN5 A;  3N2K E;  1L0V A;  3CX8 B;  2M6I A;  2H3R A;  3AVR A;  3PUZ F;  4UEL A;  2X68 A;  4U74 A;  4XBF B;  4P1N A;  1ZHC A;  3EVY A;  4U2Z A;  1WYB A;  3RRC A;  3WAK A;  1HG2 A;  4PK6 A;  2N1G A;  2WWV A;  4I4T E;  3N9N A;  2EHO D;  3AEF A;  1M7K A;  3I9W A;  3AE7 A;  3H3M A;  3CVR A;  5BR8 T;  1NEN A;  2UUA T;  2I0M A;  2VK9 A;  4E7S A;  4X64 T;  3O1I A;  2HHH T;  4QX8 B;  2WDR A;  3AEB A;  2MOZ A;  4YY3 T;  4YFS A;  1QSD A;  2IAK A;  2P9B A;  4TWF A;  1YD8 G;  3GN5 B;  2UXN B;  4DID B;  2MYS A;  2XM2 A;  5ETW A;  4X66 T;  4JYA T;  2J4G A;  4X1Y E;  4EGW A;  1MNE A;  3LK4 2;  4HWD A;  3NRX A;  3EUH A;  1N34 T;  4IL4 A;  3N2G E;  1MIW A;  2CXF A;  2E9X D;  2X0Y A;  2YKS A;  3SFE A;  2BVL A;  4H63 V;  1YW0 A;  2C5K T;  1AJ3 A;  4XAX B;  1OWA A;  3CKD A;  2WP9 A;  1IBK T;  3EDV A;  3AE4 A;  2YEV C;  2E2A A;  5LHG B;  3L3P A;  3LG7 A;  2UXD T;  2CWY A;  1WLX A;  4H9Q C;  2L8K A;  4YJ3 E;  1XDO A;  4IST A;  5FY0 A;  2XAG B;  2UUC T;  5AQM B;  5JDG A;  3N5L A;  4MAL A;  3EAM A;  1CHU A;  1OED A;  4JV5 T;  2WB5 A;  1E1H B;  3CWZ B;  2LOS A;  3QUJ A;  1VCS A;  4M1P A;  1KNP A;  4BA9 A;  3NVO A;  4JI7 T;  5L3C B;  4MHC A;  4CZZ B;  2PBI A;  1UX4 A;  4LFB T;  1BR4 A;  2XUE A;  3F57 A;  2Z6E A;  5LYJ E;  5AQU B;  3R6N A;  1VOM A;  1US7 B;  1WR6 A;  2CE7 A;  3ZST A;  2MAW A;  2ODU A;  2WDV A;  3ZMS B;  3A7M A;  3AA6 B;  2XZE A;  4X20 E;  4H9N C;  4ILB A;  4COF A;  4DUZ T;  3RI5 A;  4B3R T;  3ZC0 A;  4LF8 T;  1HNW T;  4PK5 A;  2QGS A;  5AQK B;  2V6X A;  5LB7 B;  5IUX A;  4H9P C;  4DV4 T;  3RC3 A;  1I6Z A;  3RPU A;  4MLK A;  1OED B;  1M62 A;  2XY8 B;  5JVD E;  3T8O A;  2KWI B;  3QK6 A;  4HN9 A;  4Z91 A;  2NP9 A;  3HKD E;  5HEJ A;  4WZX A;  4JI6 T;  2UU9 T;  2Q9Q C;  4UIG A;  3K1S A;  1MIV A;  2VL8 A;  4ZI7 E;  4DMV A;  5CA1 E;  2DLR A;  2BVM A;  3EAB A;  4LF9 T;  3VRB A;  3KVB A;  2NOX A;  2XSB A;  5FXX A;  2UXX B;  1LRZ A;  3QC9 A;  1HX8 A;  3P4W A;  1NAF A;  3AED A;  2W2U A;  2JQK A;  5JRC A;  4CN4 A;  2XQ3 A;  2V6Y A;  1J1J A;  4UVB B;  4ZI3 D;  1FMW A;  2VQE T;  1KK7 A;  1ZV4 X;  2YOE A;  3P4P A;  1UCU A;  3LDQ B;  2ZM2 A;  4I0U A;  4OX9 T;  2YDR A;  3IF8 B;  2CBI A;  2KWH A;  3C4W A;  4ZEY A;  3NWI A;  1HNZ T;  2NR4 A;  4L5G A;  4F6R C;  2XSA A;  2W61 A;  5HXR A;  3C98 B;  3PUG A;  3VKG A;  4CI3 B;  3RLF F;  4O2A E;  2WWU A;  4TNW A;  4X62 T;  5FVK A;  5JRC B;  2IIU A;  2V6Y B;  3O4X E;  4NUU A;  4AKG A;  5LJN A;  4KMC A;  4AI6 A;  2ZMA A;  2BG9 E;  1D1C A;  4UVA B;  4GOU A;  3SWH A;  5FXW A;  2D0T A;  5FL1 A;  1BR1 A;  4QWN B;  1HCI A;  5FL0 A;  4LMJ A;  2JPF A;  2QVA A;  4ILC A;  3OTO T;  4LFC T;  4ZHQ E;  3OPC A;  3TLW A;  3N9O A;  2NTY A;  2CBJ A;  4KX6 A;  3KV5 A;  5AQF B;  4DV2 T;  2HN2 A;  4AKI A;  3PUR A;  3PU8 A;  3KBT A;  3ZN1 B;  2CWO A;  4PW8 A;  2QRX A;  5JRE A;  4HWC A;  3VKH A;  2W66 A;  4LF4 T;  2KSR A;  3V5U A;  2XPK A;  4AKH A;  4QH5 A;  1E7P A;  3RIA A;  4DV6 T;  3OYZ A;  3JAE A;  4DR3 T;  3N2O A;  4L9I A;  5HXH A;  5LBQ B;  1UUS A;  2WDQ A;  3OKQ A;  3ZN0 B;  3RKG A;  1BR0 A;  5LHH B;  4EB6 E;  2LKH A;  2J1D G;  4HWF A;  2NTX A;  2F4V T;  3I1A A;  2PJQ A;  2ACZ A;  3IA3 A;  2D5U A;  2JMK A;  4UV9 B;  2JMH A;  2OLT A;  1OED C;  4UF0 A;  4Z8X A;  4HEA A;  2BKN A;  3ZYL A;  5CB4 E;  3FZF B;  2JQQ A;  3AAI A;  5AQT B;  2Q9Q A;  3PTR B;  3JC6 C;  3MA9 A;  5CFB A;  3N9L A;  3UUM A;  1O3X A;  2PTF A;  3P4Q A;  2BKP A;  2BBH A;  4JI2 T;  5M4Y A;  3O9X A;  2XAH B;  3ZYM A;  1SHZ C;  3Q9D A;  2X51 A;  5JDL A;  2W62 A;  5AQJ B;  3TLS A;  4IGU A;  2V7J A;  4G2A A;  4UXN B;  2H7V C;  4TV8 E;  4EED A;  1D1B A;  4B3T T;  4DBR A;  1FEW A;  3CIR A;  2MTQ A;  4X65 T;  2XAJ B;  3UUN A;  4WNK A;  5H6Q B;  3FZH B;  2YK0 A;  3Q5E A;  3RYF E;  3UQ7 A;  2FJA A;  4CQI A;  4FJO A;  2BS4 A;  4UF0 B;  5LNK A;  3PUA A;  2Q9Q B;  2WU5 A;  3CPZ A;  5FXZ A;  2X0H A;  4NXN T;  3A8Y C;  4HFI A;  2KLQ A;  1S94 A;  4I55 E;  1XMO T;  3C50 A;  3K3Q C;  4ISS A;  1N36 T;  2W67 A;  5JDF A;  3CQG B;  2XQ5 A;  5AQG B;  2E5L T;  3ONL C;  4O4J E;  4GKK T;  4QHO A;  5ABF A;  5LMU T;  2CLY C;  4YTP A;  4DR6 T;  5AQV B;  4YT0 A;  4NIQ A;  2K5B B;  3T1H T;  2I6H A;  5AQL B;  3ZT5 A;  4U2Y A;  2CXL A;  4P0A A;  4UR9 A;  5HCM A;  3E0Z A;  3L39 A;  5JTG A;  3ZJ1 A;  5KXJ A;  2PG8 A;  3KFW X;  5L47 A;  3AE2 A;  2XM1 A;  4TNV A;  2CCQ A;  5L3B B;  3AE5 A; 
#chains in the Genus database with same CATH homology
 4AQY T;  4B3S T;  4LF4 T;  4DUZ T;  3T1Y T;  4DR2 T;  4K0K T;  4X66 T;  4JYA T;  4B3R T;  4B3T T;  4NXM T;  4DV6 T;  4OX9 T;  4DR3 T;  4LF8 T;  1HNW T;  1HNX T;  4DR7 T;  4DV7 T;  4X65 T;  4B3M T;  1N34 T;  4DV4 T;  1HNZ T;  1XNR T;  1J5E T;  4DR4 T;  2ZM6 T;  4JI8 T;  4GKJ T;  1IBK T;  4DV3 T;  2F4V T;  5IWA T;  4YHH T;  2UXD T;  4LF7 T;  4DV0 T;  4KHP T;  4JI6 T;  2UU9 T;  4NXN T;  4JI0 T;  4X62 T;  1HR0 T;  1XMO T;  4JI4 T;  2UUB T;  4DV5 T;  2VQF T;  1N36 T;  2UUC T;  4DR1 T;  4LF5 T;  1IBL T;  2E5L T;  1FJG T;  4JV5 T;  4DUY T;  4GKK T;  4LF9 T;  4DR5 T;  5LMU T;  4LFA T;  4DR6 T;  4LF6 T;  4JI7 T;  2UXB T;  1IBM T;  1N32 T;  1XMQ T;  3T1H T;  4LFB T;  5BR8 T;  2UUA T;  3OTO T;  4LFC T;  4JI3 T;  4X64 T;  1N33 T;  2UXC T;  4DV1 T;  2HHH T;  1XNQ T;  4JI2 T;  4YY3 T;  1I94 T;  4DV2 T;  4JI1 T;  2VQE T;  4JI5 T;  5LMN T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...