4LF6T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 33
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4lf6T00
4K0KT 4JV5T 2UXBT 4DR1T 4YY3T 4B3ST 5LMNT 5BR8T 4LFBT 4DV5T 4NXNT 1XNRT 5LMUT 4GKKT 4DUYT 4DV7T 1IBMT 1J5ET 4JI3T 4DV4T 4OX9T 4DV3T 4LF9T 5IWAT 1N34T 4DR2T 2UU9T 3T1HT 2UUBT 4DR7T 4GKJT 4DR5T 4LFCT 4JI6T 2UUAT 4JI5T 3OTOT 4B3TT 1N36T 3T1YT 4DV6T 4DV2T 1XNQT 1IBKT 4JYAT 1HNZT 1HNXT 4X66T 2VQET 2ZM6T 4AQYT 4DR6T 4YHHT 1N32T 4X64T 4JI0T 4DR4T 4KHPT 4DV1T 4X62T 4NXMT 1I94T 2UXCT 2UUCT 4LF8T 4DR3T 4JI7T 2VQFT 2F4VT 1XMQT 4JI4T 4X65T 1IBLT 4LFAT 4DV0T 4B3RT 1HNWT 4B3MT 4LF5T 4JI2T 2HHHT 4JI8T 1FJGT 2E5LT 1XMOT 4JI1T 4LF4T 1N33T 2UXDT 4LF6T 4DUZT 4LF7T 1HR0T
chains in the Genus database with same CATH superfamily
3PUAA 1WCRA 3DTOA 4O8SA 4HFVA 3ETUA 5L3FB 3SFEA 4B3ST 4CN6A 2L3LA 5CGMA 2K24A 5CJ5A 3WI3A 1O3XA 5AQSB 4XZCA 4DV7T 4DV4T 1J5ET 3O1IA 3K3QC 4JEUB 2V7KA 2BZBA 4CXYA 4JEHB 1UK5A 4MHCA 5HEHA 4AKIA 5AQQB 2DCFA 2ACZA 1WRDA 3KV9A 3HI2A 4WBOA 2JQ9A 3GMIA 2NW9A 3ZCJA 3CX6B 2X0LB 3FZFB 5CB4E 3UUXB 1G8XA 4DVDA 3LK2B 4HE8A 2SPCA 4X20E 2CLYC 4ISTA 4HEAA 1YW0A 5KDMC 2IHR1 4ZS3A 2CMRA 1D1AA 3F57A 2BDEA 2AXDS 4JI2T 3AEFA 3A8YC 2QVAA 3AE6A 1G73A 5JDHA 5JREA 3QB5A 1N33T 3N9MA 4P0AA 5GONE 3ZPOA 2YU1A 3BQIA 4DR1T 4YY3T 3JADA 2X68A 3OYZA 5LMNT 3EDUA 4I50E 2WU5A 2KZ7B 2BVLA 3ZYLA 4OFZA 5M4YA 2BKOA 4UVBB 3ONXA 2CWOA 3N5LA 3CQXC 3ETVA 2XY8B 1B7TA 1X79A 2XTLA 4XAXB 3KINB 3AE7A 3AA7B 3UUMA 3Q5EA 5TAOA 2LM2A 3OTOT 1IJ5A 3AA0B 3ZEFB 1NAFA 2E2AA 4ZEYA 3AE2A 2BS4A 1LVKA 5AQOB 2IUBA 4AQFA 5HAXA 2OV9A 2M6BA 2C5KT 3KVAA 4GYSA 5JDGA 4U7YA 3N9QA 2LRLA 2WB5A 3UQ7A 2LJLA 4ZOLE 2H7OA 4QX7B 3RX6A 2J1DG 1XMQT 3RIFA 3AEDA 2HH7A 1OEDA 4TV9E 3VKGA 4TUYE 5LXTE 2MAWA 1WR6A 2JJ9A 1R8IA 3EUHA 4I55E 4QXHB 1AJ3A 1NEKA 1MMAA 2LEHA 3HR0A 4AIUA 2UXNB 3TLTA 4DV5T 3ZT5A 4EYUA 4H9SE 5LMUT 4JI3T 3C4XA 3QK6A 3TKLB 2UU9T 4WZXA 4EB6E 4L0RA 3ZYMA 5J1GA 3R6NA 2X66A 5HCMA 2W67A 3PU3A 3TLUA 4ZI7E 5L3BB 4NXMT 3K8PC 1KNRA 3UU6A 1QSDA 2UXCT 1T98A 3AB3B 4TV8E 3V5SA 3IBPA 3CQCB 2X9HA 2Y8DA 3ZSTA 1V9DA 4CXXA 3LJCA 5HWXA 3PUXF 2ZMAA 4UV8B 4IDNA 4GK0E 2NOXA 3PUYF 4PAGA 3CVRA 3Q5DA 2E9XA 2FJAA 2Q9QD 2Q9QA 4YTPA 5JDNA 2PTFA 3WAJA 2LSYA 5FY1A 1MMGA 1GQEA 2LLYA 3GWHA 3NZQA 1MIVA 5HXCA 3KV5A 1WYCA 1XZYA 1T72A 1HG2A 1SE7A 4C90A 3ZJ1A 3AE9A 3H3MA 3I1AA 3O4XE 3X1DA 2V8SV 4AQFC 1W9RA 3T1HT 4U2ZA 4GKJT 4DR5T 4LFCT 2YEVC 2XPKA 4ERRA 3BK9A 2H88A 3ESLA 5JRCB 4ZI2C 4B6XA 2BBJA 3AECA 1N32T 2BVMA 4X1KE 3RF1A 5C2TA 3AA1B 3ZT6A 5KXJA 3KDSE 3FBLA 5AQUB 1FEWA 2CBJA 4KX6A 2VB6A 4DBRA 1YXRA 4M1PA 1VRBA 4A56A 2FJDA 2F4VT 4LMJA 5LGUB 1ZHCA 2BG9B 4JI4T 2LSJA 3ZLIA 1US7B 1SA0E 2VL0A 3O9XA 3BQKA 1UURA 2XAGB 3SOLA 3TLWA 2E5LT 2FJEA 5JDLA 5L3CB 2WDVA 4DUZT 4PJMA 2FBWA 2ZM2A 2M67A 4EYYR 2FJBA 2XASB 5L4HA 5LJMA 4YJ2E 3UU5A 2R6GF 1XNRT 4DUYT 5AQPB 2XZEA 1N34T 3Q5XA 5DQVA 4EOZB 5HYAA 2I0MA 4CI2B 4O4HE 2UUAT 2YN6A 3HA4A 2LT3A 1N36T 4TNVA 4KBMB 2NW8A 4Z91A 1ZEEA 1HNXT 3U3IA 3JCFA 2M6IA 3RLFF 4MBQA 3E22E 2X0YA 2QGSA 3AXJA 3UFEA 2VVNA 4EV6A 2E9XC 5L47A 5J0ZA 2N9DA 2J62A 2XM1A 2PFVA 2NR4A 3P4WA 4UIGA 4QHOA 1KNZA 4TZ4C 3EHZA 4CI1B 3C4ZA 5JQGE 3MK7C 5AQNB 4GYRA 4LF5T 4IDQA 5ABFB 4H9NC 2NP9A 3RI5A 3TLSA 1IJ6A 4AISA 4O2BE 5LYJE 3VR9A 2A3DA 5FY0A 3MACA 4K0KT 3H3AA 4O4JE 2UXBT 2LKGA 3L3PA 2YDSA 4U3CA 2OA5A 1H7CA 3VKHA 3LG7A 4YHJA 5FVLA 2W66A 4FI5A 3RYCE 1IBMT 4IDOA 4OX9T 1D0XA 4MALA 4AKGA 3RIUA 4DR2T 3IHRA 2V7MA 5ADXL 3RRWA 3RIAA 3NZPA 3PDYA 3FZLB 3T1YT 3ZMUB 1MIWA 3ZN1B 3JC6C 4E7SA 2CBIA 2H3RA 1JNZA 4N78D 5DJQC 4ZZBA 2KWIB 3AVSA 5EK4A 4PFPA 1I94T 3N2OA 1S35A 1W09A 2LRKA 1T8BA 3PUQA 4LFAT 4U72A 5JH7E 2P9BA 4Z90A 3OJAA 3GN5B 5HEUA 3FZKB 4OYJA 3N9OA 1LKXA 2LSKA 5CA1E 1E2AA 1FMVA 4UEMA 2A9UA 1NWMX 4O4IE 3RPUA 5DQWA 3AEAA 2D2SA 2D9DA 4PK4A 3OBVE 5BR8T 1CUNA 1W0AA 3CQGB 5AQMB 3UT5E 2JQKA 1M62A 4ASKA 4IL4A 4HWDA 2YKSA 1E1HB 4BJMA 4IE6A 4EEBA 4QWNB 2BKPA 4QH1A 2X0HA 5EK2A 3RRCA 3VU7H 5JDFA 2B76A 3LBXB 3J9X1 2K5BB 4JLEA 2D0TA 4QXBB 4H9RC 4U33A 1D1CA 2I6HA 3C4WA 3SRZA 4K0UA 3CIRA 5FL0A 5JR9B 3KVBA 3AAAB 5IYZE 4YT0A 2JRKA 1KK7A 3FXDB 3N9LA 3L09A 4IHJE 1IBLT 2CXLA 5JDQA 4YSZA 5LB7B 2ODVA 1MMDA 1HX8A 4ZI3C 4ZI2D 1XDPA 5AQGB 3RIUC 4U31A 2BG9E 1WFDA 2WP9A 3IEEA 4PW8A 4OK0A 5LBQB 1WR0A 2CXFA 3OPCA 2C5IT 4CXWA 2VASA 3RQWA 5FMNA 1JNRA 3QUJA 1HCIA 3I0QA 4BAYB 4ISSA 2K48A 2X9WA 2E8IA 3J7Yq 3ZKRA 4B3TT 3K1SA 5L3EB 3NRYA 3UQ4A 2JQHA 3MKDA 3B13A 1HNZT 5F3JA 4DR6T 2W00A 3Q9DA 2XQ9A 4KHPT 3SWHA 2NTXA 2WU2A 2BS2A 4EZHA 5LHIB 5LOVE 5ABHA 1J1JA 4OHFA 3N9NA 1Y01A 4U74A 3AVRA 3C50A 1HTJF 4DMWA 2EHOB 4TX5A 4IE0A 4DV0T 1BR2A 4COFA 2G0UA 2V26A 3B57A 3NVOA 2YK0A 3I9YA 3CMLA 4H9PC 2CPTA 2XUEA 4UF0B 5LGNB 4JI1T 3EABA 3AEEA 2CM0A 4IL9A 2XAJB 2A72A 3P7IA 4YTNA 3W15B 3PE0A 5LCYA 1UCUA 3FBZA 5C3JA 2KINB 5E0OA 1LRZA 2C0SA 3ANWB 2E9XD 2WSSV 4DV3T 4QXCB 3O1HA 4NIQA 3OVUA 3ONJA 4KHZF 3MA9A 3OYXA 2V7LA 4HFDA 3ONLC 5FP3A 4UVCB 2CXDA 1ZP0A 1IAPA 2N1GA 2VQET 2LSIA 4F8HA 4X64T 4QH4A 4UVAB 4Q25A 5LA6E 3PUSA 2DL1A 2Y48B 2H89A 1T7SA 2YDRA 2Y6XA 5C8YE 2IMLA 2W2UA 3Q5WA 2YOEA 4B3MT 4I43B 3VRBA 3C64A 1EZ3A 4EGWA 2E5VA 3ZMVB 3ZMTB 1YQ3A 3EAMA 3LDQB 3QC9A 5FNVE 2IC9A 5AQKB 2MBGA 3JC6D 4A97A 3PUGA 4C91A 4JV5T 1HS7A 5HEJA 2HPJA 4DBQA 2HN1A 4EAHA 2XAHB 3VRAA 5AQVB 5JTGA 3UUBA 3FB2A 2HPLA 4PK6A 1WYBA 2VURA 5FXXA 3E08A 5HXHA 5ABEA 4JI6T 4ILUA 4JI5T 4YLHA 2WCAA 3AE1A 4V1Av 4J2CA 2D0UA 4IDPA 4HFHA 1OXZA 2PG8A 3UFGA 4IE5A 2RA1A 4IE4A 2W62A 3JAFA 1VCSA 5AFUL 4KMCA 4LF8T 4DR3T 3G06A 2BG9A 3NBXX 2AE9A 4O2AE 3UULA 4GIWA 3PUWF 2X9XA 4ANJA 3PUZF 5LG4A 1QUUA 3N2KE 3ZMZB 4IGUA 2IDOB 3QB5K 4L9IA 2HHHT 3C51A 4GOUA 3AEGA 2VWAA 4QX8B 2V1DB 2VK9A 3RYFE 3PURA 4HFEA 2CEAA 3T8OA 4OYKA 1FMWA 2XSAA 2XJ7A 2GK9A 2MYSA 2QA7A 2V6YA 2EHOC 3P8CD 2CRBA 3HKEE 4NXNT 4AKHA 1Y64B 2NWBA 5KX5E 3GA8A 5FL1A 4HTEA 5IWAT 3QNUA 4IDZA 2CWYA 1BR4A 1OWAA 1M7KA 2XHEB 3PV0F 5L2LA 1XNQT 1IBKT 3QOFA 2J47A 3HL6A 2WMOA 5AQTB 4ZI3D 2WWUA 2VKDA 3AAIA 4JI0T 3AE4A 1Z0PA 2LE8A 1Z8UA 2NW7A 2NTYA 4HFCA 3FZHB 3RC8A 2DHRA 3EI0A 3S4UA 4YXDA 1D0ZA 2LKHA 5FXZA 2XQ4A 3P50A 3H37A 5EK3A 3F31A 4DNDA 1HNWT 2WS3A 3RYHE 1UGOA 5ABFA 3K3OA 2VKJA 4H63V 4ZS2A 2V5DA 3RHWA 2WBLA 3UU8A 1BR1A 4CZZB 3M65A 5A1LA 1HF8A 2VKOA 1UUSA 3L8RA 3AE8A 2V7JA 4UV9B 3ZC1A 2DI4A 4AXPA 5IUXA 2W63A 4O4LE 4ADZA 4GKKT 2ES0A 3D0TA 4HFIA 4JUYA 4IIJE 2V7IA 4ZZCA 4EXTA 4YFSA 2K9AA 3K3NA 2JIWA 4DMVA 3FXEB 5HWYA 3KFWX 2KWHA 2XAQB 1ZOYA 2OLTA 2HN2A 2KT9A 5LBMA 1D1BA 3KBUA 3CK6A 1KF6A 3SFDA 3KV6A 4DV2T 2BG9C 3KV4A 2WDQA 2IW5B 2PBIA 4X66T 2KMFA 4TWFA 1MNDA 4AI6A 2MOZA 3HKCE 3UU4A 2WWVA 5ABGA 4G63A 1KFYA 4UR9A 2VL8A 3P4PA 4Z8XA 3ABVA 1BR0A 1YD8G 5EZYE 3O1JA 3P4RA 4YSYA 1L0VA 4A98A 3LSVA 2JQQA 2W61A 1LVFA 1FIOA 4NUVA 4WW0A 4L5GA 4X65T 3U78A 3VHLA 4P09A 3GN5A 3AEBA 5IHYA 3AE3A 2CA5A 1OEDB 1XWMA 4TN7B 2CHNA 3CX8B 3LK3B 3DP7A 3LK42 5LG3A 5H6QB 3OKQA 5F8PA 3TLVA 3RH3A 2UXDT 3IA3A 1U5PA 2JMHA 2QRXA 2XSBA 2VVSA 4IE7A 4WNKA 3SS1A 5HCJA 4I0UA 2YDQA 4DR7T 1ZV4X 4G2AA 4A5XA 5HEOA 4NUUA 4KI0F 3PTRB 4DV6T 1KNPA 3CKDA 4ILCA 4NPPA 3CX7B 5LHGB 2ZM6T 2X67A 3JAEA 3LBXA 3ZC0A 4EIWA 4DV1T 2XQAA 2W0GA 3PU8A 4GK5E 4E7ZA 1HX1B 1SHZC 2H7VC 3P4SA 2LM9A 5JR9A 3E0ZA 1IZNB 3HKDE 3C98B 2IIUA 4HWFA 4HFBA 5H6RB 1J5WA 2RP4A 2LOSA 2FUPA 4HN9A 3LFMA 4HWHA 4PFOA 3RC3A 4AKLA 4U7IA 1UX5A 4PJNA 2L9QA 1SUMB 5L3GB 2WM9A 1FJGT 4LF4T 1MNEA 2E9XB 2Q9QB 5LP6E 5HXEA 3DJBA 5LGTB 3N2GE 5BMVE 5AQIB 4CI3B 3PUVF 3R84B 1D0YA 5KMGP 3UU3A 4YJ3E 4EEDA 4X1YE 3EVYA 2PJQA 2LHNA 3A7MA 1KEYA 2KLQA 2LOPA 4MLKA 4LF9T 5HXRA 2N2NA 2UUBT 2KNDA 2UXXB 2X51A 4DIDB 2B1EA 3MJXA 4LMLA 5AQFB 4X1IE 4JYAT 4ILBA 2D5UA 4PJLA 4F6RC 5L4EA 2A2FX 3IF8B 5F5WA 4BJNA 4DR4T 5HXSA 2X9YA 2C5JA 5FY7A 3AA6B 3RGLA 2BKNA 3AAEB 4IT4A 4FJOA 1ZKEA 2RPAA 4JI7T 4MFRA 2WZHA 5HEGA 2EHOA 2EHOD 4H9OC 3HKBE 4HKAA 2LSGA 4HWCA 2V5CA 2ZM8A 4HWIB 1W0BA 2JPFA 4AKRB 2XQ7A 3A5XA 2XAFB 2BBHA 2DWGA 4CQIA 4KP3C 2K3WA 2ODUA 1YKHB 4UF0A 2BS3A 2YU2A 2MTQA 1VOMA 2ACXA 2XQ3A 4X5TA 2ZLYA 4KUMB 3UTKA 3ANWA 3NKZA 3PJAJ 3RYIE 2L8KA 4H63H 2ZM0A 5AQHB 5J2TE 5CFBA 1OEDC 5LHHB 2CLYB 2XQ6A 3ZJ2A 5JR9C 2DWKA 3ZCIA 2CHOA 3RQUA 1X9BA 3I9WA 2I59A 2V6XA 1MMNA 4CN4A 3FHNA 3KBTA 4ZHQE 5CA0E 3VR8A 2MPKA 5JRCA 2WY2A 2WQYA 3N9PA 4YTMA 2WDRA 2WZIA 5ETWA 5LJNA 3AXJB 4P1NA 4BA9A 3M3ZB 3NWIA 2VQFT 4DO0A 3NRXA 3UUNA 2QYWA 5JDMA 1HFAA 5DABA 4PK5A 4H9QC 3WAKA 4QKNA 4CN1A 3ZMSB 3EDVA 2V6YB 1S94A 2W4XA 4WBNE 3Q2MA 2WAUA 2VKHA 1XMOT 3MXZA 1VCTA 3ZYKA 5JVDE 4LF6T 4PNIA 5AQRB 3ZN0B 1E7PA 3MZKB 4P0BA 3V5UA 3PJAA 5FXWA 2XM2A 1I6ZA 4LFBT 2IAKA 4U2YA 1OEDE 5J2UE 1DU2A 1YQ4A 4ILAA 4TNWA 4JBWF 5L3DB 1YKEB 3RKGA 5AQLB 2JMKA 4IREA 5AQJB 1CHUA 2YINA 4UELA 2CE7A 4QH5A 1QLBA 1XDOA 2CCQA 2DNXA 5FXVA 4AQGA 2Q9QC 2J4GA 1HG5A 4TWDA 4AQYT 4YHHT 4I4TE 3ZSSA 3ZT7A 4X62T 3BQLA 1NENA 4HGAA 2KXPB 2Z6EA 2UUCT 2XQ5A 5FKYA 4EZ4A 3RKOA 1MIYA 1WLXA 5FYMA 2KSRA 4ZXLA 2DLRA 3F2EA 2IC6A 3CWZB 2XQ8A 3FZMB 4B3RT 4YSXA 3L39A 2LHRA 4WYVA 3P4QA 4PJJA 1U4QA 2WMNA 3AE5A 4JI8T 4LMKA 4XBFB 5LNKA 3B5MA 3CPZA 5FVKA 4TWHA 1UX4A 3I0OA 2XQYA 4LF7T 1HR0T 4UXNB
chains in the Genus database with same CATH topology
4K0KT 4JV5T 2UXBT 4DR1T 4YY3T 4B3ST 5LMNT 5BR8T 4LFBT 4DV5T 4NXNT 1XNRT 5LMUT 4GKKT 4DUYT 4DV7T 1IBMT 1J5ET 4JI3T 4DV4T 4OX9T 4DV3T 4LF9T 5IWAT 1N34T 4DR2T 2UU9T 3T1HT 2UUBT 4DR7T 4GKJT 4DR5T 4LFCT 4JI6T 2UUAT 4JI5T 3OTOT 4B3TT 1N36T 3T1YT 4DV6T 4DV2T 1XNQT 1IBKT 4JYAT 1HNZT 1HNXT 4X66T 2VQET 2ZM6T 4AQYT 4DR6T 4YHHT 1N32T 4X64T 4JI0T 4DR4T 4KHPT 4DV1T 4X62T 4NXMT 1I94T 2UXCT 2UUCT 4LF8T 4DR3T 4JI7T 2VQFT 2F4VT 1XMQT 4JI4T 4X65T 1IBLT 4LFAT 4DV0T 4B3RT 1HNWT 4B3MT 4LF5T 4JI2T 2HHHT 4JI8T 1FJGT 2E5LT 1XMOT 4JI1T 4LF4T 1N33T 2UXDT 4LF6T 4DUZT 4LF7T 1HR0T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K0K T;  4JV5 T;  2UXB T;  4DR1 T;  4YY3 T;  4B3S T;  5LMN T;  5BR8 T;  4LFB T;  4DV5 T;  4NXN T;  1XNR T;  5LMU T;  4GKK T;  4DUY T;  4DV7 T;  1IBM T;  1J5E T;  4JI3 T;  4DV4 T;  4OX9 T;  4DV3 T;  4LF9 T;  5IWA T;  1N34 T;  4DR2 T;  2UU9 T;  3T1H T;  2UUB T;  4DR7 T;  4GKJ T;  4DR5 T;  4LFC T;  4JI6 T;  2UUA T;  4JI5 T;  3OTO T;  4B3T T;  1N36 T;  3T1Y T;  4DV6 T;  4DV2 T;  1XNQ T;  1IBK T;  4JYA T;  1HNZ T;  1HNX T;  4X66 T;  2VQE T;  2ZM6 T;  4AQY T;  4DR6 T;  4YHH T;  1N32 T;  4X64 T;  4JI0 T;  4DR4 T;  4KHP T;  4DV1 T;  4X62 T;  4NXM T;  1I94 T;  2UXC T;  2UUC T;  4LF8 T;  4DR3 T;  4JI7 T;  2VQF T;  2F4V T;  1XMQ T;  4JI4 T;  4X65 T;  1IBL T;  4LFA T;  4DV0 T;  4B3R T;  1HNW T;  4B3M T;  4LF5 T;  4JI2 T;  2HHH T;  4JI8 T;  1FJG T;  2E5L T;  1XMO T;  4JI1 T;  4LF4 T;  1N33 T;  2UXD T;  4LF6 T;  4DUZ T;  4LF7 T;  1HR0 T; 
#chains in the Genus database with same CATH topology
 3PUA A;  1WCR A;  3DTO A;  4O8S A;  4HFV A;  3ETU A;  5L3F B;  3SFE A;  4B3S T;  4CN6 A;  2L3L A;  5CGM A;  2K24 A;  5CJ5 A;  3WI3 A;  1O3X A;  5AQS B;  4XZC A;  4DV7 T;  4DV4 T;  1J5E T;  3O1I A;  3K3Q C;  4JEU B;  2V7K A;  2BZB A;  4CXY A;  4JEH B;  1UK5 A;  4MHC A;  5HEH A;  4AKI A;  5AQQ B;  2DCF A;  2ACZ A;  1WRD A;  3KV9 A;  3HI2 A;  4WBO A;  2JQ9 A;  3GMI A;  2NW9 A;  3ZCJ A;  3CX6 B;  2X0L B;  3FZF B;  5CB4 E;  3UUX B;  1G8X A;  4DVD A;  3LK2 B;  4HE8 A;  2SPC A;  4X20 E;  2CLY C;  4IST A;  4HEA A;  1YW0 A;  5KDM C;  2IHR 1;  4ZS3 A;  2CMR A;  1D1A A;  3F57 A;  2BDE A;  2AXD S;  4JI2 T;  3AEF A;  3A8Y C;  2QVA A;  3AE6 A;  1G73 A;  5JDH A;  5JRE A;  3QB5 A;  1N33 T;  3N9M A;  4P0A A;  5GON E;  3ZPO A;  2YU1 A;  3BQI A;  4DR1 T;  4YY3 T;  3JAD A;  2X68 A;  3OYZ A;  5LMN T;  3EDU A;  4I50 E;  2WU5 A;  2KZ7 B;  2BVL A;  3ZYL A;  4OFZ A;  5M4Y A;  2BKO A;  4UVB B;  3ONX A;  2CWO A;  3N5L A;  3CQX C;  3ETV A;  2XY8 B;  1B7T A;  1X79 A;  2XTL A;  4XAX B;  3KIN B;  3AE7 A;  3AA7 B;  3UUM A;  3Q5E A;  5TAO A;  2LM2 A;  3OTO T;  1IJ5 A;  3AA0 B;  3ZEF B;  1NAF A;  2E2A A;  4ZEY A;  3AE2 A;  2BS4 A;  1LVK A;  5AQO B;  2IUB A;  4AQF A;  5HAX A;  2OV9 A;  2M6B A;  2C5K T;  3KVA A;  4GYS A;  5JDG A;  4U7Y A;  3N9Q A;  2LRL A;  2WB5 A;  3UQ7 A;  2LJL A;  4ZOL E;  2H7O A;  4QX7 B;  3RX6 A;  2J1D G;  1XMQ T;  3RIF A;  3AED A;  2HH7 A;  1OED A;  4TV9 E;  3VKG A;  4TUY E;  5LXT E;  2MAW A;  1WR6 A;  2JJ9 A;  1R8I A;  3EUH A;  4I55 E;  4QXH B;  1AJ3 A;  1NEK A;  1MMA A;  2LEH A;  3HR0 A;  4AIU A;  2UXN B;  3TLT A;  4DV5 T;  3ZT5 A;  4EYU A;  4H9S E;  5LMU T;  4JI3 T;  3C4X A;  3QK6 A;  3TKL B;  2UU9 T;  4WZX A;  4EB6 E;  4L0R A;  3ZYM A;  5J1G A;  3R6N A;  2X66 A;  5HCM A;  2W67 A;  3PU3 A;  3TLU A;  4ZI7 E;  5L3B B;  4NXM T;  3K8P C;  1KNR A;  3UU6 A;  1QSD A;  2UXC T;  1T98 A;  3AB3 B;  4TV8 E;  3V5S A;  3IBP A;  3CQC B;  2X9H A;  2Y8D A;  3ZST A;  1V9D A;  4CXX A;  3LJC A;  5HWX A;  3PUX F;  2ZMA A;  4UV8 B;  4IDN A;  4GK0 E;  2NOX A;  3PUY F;  4PAG A;  3CVR A;  3Q5D A;  2E9X A;  2FJA A;  2Q9Q D;  2Q9Q A;  4YTP A;  5JDN A;  2PTF A;  3WAJ A;  2LSY A;  5FY1 A;  1MMG A;  1GQE A;  2LLY A;  3GWH A;  3NZQ A;  1MIV A;  5HXC A;  3KV5 A;  1WYC A;  1XZY A;  1T72 A;  1HG2 A;  1SE7 A;  4C90 A;  3ZJ1 A;  3AE9 A;  3H3M A;  3I1A A;  3O4X E;  3X1D A;  2V8S V;  4AQF C;  1W9R A;  3T1H T;  4U2Z A;  4GKJ T;  4DR5 T;  4LFC T;  2YEV C;  2XPK A;  4ERR A;  3BK9 A;  2H88 A;  3ESL A;  5JRC B;  4ZI2 C;  4B6X A;  2BBJ A;  3AEC A;  1N32 T;  2BVM A;  4X1K E;  3RF1 A;  5C2T A;  3AA1 B;  3ZT6 A;  5KXJ A;  3KDS E;  3FBL A;  5AQU B;  1FEW A;  2CBJ A;  4KX6 A;  2VB6 A;  4DBR A;  1YXR A;  4M1P A;  1VRB A;  4A56 A;  2FJD A;  2F4V T;  4LMJ A;  5LGU B;  1ZHC A;  2BG9 B;  4JI4 T;  2LSJ A;  3ZLI A;  1US7 B;  1SA0 E;  2VL0 A;  3O9X A;  3BQK A;  1UUR A;  2XAG B;  3SOL A;  3TLW A;  2E5L T;  2FJE A;  5JDL A;  5L3C B;  2WDV A;  4DUZ T;  4PJM A;  2FBW A;  2ZM2 A;  2M67 A;  4EYY R;  2FJB A;  2XAS B;  5L4H A;  5LJM A;  4YJ2 E;  3UU5 A;  2R6G F;  1XNR T;  4DUY T;  5AQP B;  2XZE A;  1N34 T;  3Q5X A;  5DQV A;  4EOZ B;  5HYA A;  2I0M A;  4CI2 B;  4O4H E;  2UUA T;  2YN6 A;  3HA4 A;  2LT3 A;  1N36 T;  4TNV A;  4KBM B;  2NW8 A;  4Z91 A;  1ZEE A;  1HNX T;  3U3I A;  3JCF A;  2M6I A;  3RLF F;  4MBQ A;  3E22 E;  2X0Y A;  2QGS A;  3AXJ A;  3UFE A;  2VVN A;  4EV6 A;  2E9X C;  5L47 A;  5J0Z A;  2N9D A;  2J62 A;  2XM1 A;  2PFV A;  2NR4 A;  3P4W A;  4UIG A;  4QHO A;  1KNZ A;  4TZ4 C;  3EHZ A;  4CI1 B;  3C4Z A;  5JQG E;  3MK7 C;  5AQN B;  4GYR A;  4LF5 T;  4IDQ A;  5ABF B;  4H9N C;  2NP9 A;  3RI5 A;  3TLS A;  1IJ6 A;  4AIS A;  4O2B E;  5LYJ E;  3VR9 A;  2A3D A;  5FY0 A;  3MAC A;  4K0K T;  3H3A A;  4O4J E;  2UXB T;  2LKG A;  3L3P A;  2YDS A;  4U3C A;  2OA5 A;  1H7C A;  3VKH A;  3LG7 A;  4YHJ A;  5FVL A;  2W66 A;  4FI5 A;  3RYC E;  1IBM T;  4IDO A;  4OX9 T;  1D0X A;  4MAL A;  4AKG A;  3RIU A;  4DR2 T;  3IHR A;  2V7M A;  5ADX L;  3RRW A;  3RIA A;  3NZP A;  3PDY A;  3FZL B;  3T1Y T;  3ZMU B;  1MIW A;  3ZN1 B;  3JC6 C;  4E7S A;  2CBI A;  2H3R A;  1JNZ A;  4N78 D;  5DJQ C;  4ZZB A;  2KWI B;  3AVS A;  5EK4 A;  4PFP A;  1I94 T;  3N2O A;  1S35 A;  1W09 A;  2LRK A;  1T8B A;  3PUQ A;  4LFA T;  4U72 A;  5JH7 E;  2P9B A;  4Z90 A;  3OJA A;  3GN5 B;  5HEU A;  3FZK B;  4OYJ A;  3N9O A;  1LKX A;  2LSK A;  5CA1 E;  1E2A A;  1FMV A;  4UEM A;  2A9U A;  1NWM X;  4O4I E;  3RPU A;  5DQW A;  3AEA A;  2D2S A;  2D9D A;  4PK4 A;  3OBV E;  5BR8 T;  1CUN A;  1W0A A;  3CQG B;  5AQM B;  3UT5 E;  2JQK A;  1M62 A;  4ASK A;  4IL4 A;  4HWD A;  2YKS A;  1E1H B;  4BJM A;  4IE6 A;  4EEB A;  4QWN B;  2BKP A;  4QH1 A;  2X0H A;  5EK2 A;  3RRC A;  3VU7 H;  5JDF A;  2B76 A;  3LBX B;  3J9X 1;  2K5B B;  4JLE A;  2D0T A;  4QXB B;  4H9R C;  4U33 A;  1D1C A;  2I6H A;  3C4W A;  3SRZ A;  4K0U A;  3CIR A;  5FL0 A;  5JR9 B;  3KVB A;  3AAA B;  5IYZ E;  4YT0 A;  2JRK A;  1KK7 A;  3FXD B;  3N9L A;  3L09 A;  4IHJ E;  1IBL T;  2CXL A;  5JDQ A;  4YSZ A;  5LB7 B;  2ODV A;  1MMD A;  1HX8 A;  4ZI3 C;  4ZI2 D;  1XDP A;  5AQG B;  3RIU C;  4U31 A;  2BG9 E;  1WFD A;  2WP9 A;  3IEE A;  4PW8 A;  4OK0 A;  5LBQ B;  1WR0 A;  2CXF A;  3OPC A;  2C5I T;  4CXW A;  2VAS A;  3RQW A;  5FMN A;  1JNR A;  3QUJ A;  1HCI A;  3I0Q A;  4BAY B;  4ISS A;  2K48 A;  2X9W A;  2E8I A;  3J7Y q;  3ZKR A;  4B3T T;  3K1S A;  5L3E B;  3NRY A;  3UQ4 A;  2JQH A;  3MKD A;  3B13 A;  1HNZ T;  5F3J A;  4DR6 T;  2W00 A;  3Q9D A;  2XQ9 A;  4KHP T;  3SWH A;  2NTX A;  2WU2 A;  2BS2 A;  4EZH A;  5LHI B;  5LOV E;  5ABH A;  1J1J A;  4OHF A;  3N9N A;  1Y01 A;  4U74 A;  3AVR A;  3C50 A;  1HTJ F;  4DMW A;  2EHO B;  4TX5 A;  4IE0 A;  4DV0 T;  1BR2 A;  4COF A;  2G0U A;  2V26 A;  3B57 A;  3NVO A;  2YK0 A;  3I9Y A;  3CML A;  4H9P C;  2CPT A;  2XUE A;  4UF0 B;  5LGN B;  4JI1 T;  3EAB A;  3AEE A;  2CM0 A;  4IL9 A;  2XAJ B;  2A72 A;  3P7I A;  4YTN A;  3W15 B;  3PE0 A;  5LCY A;  1UCU A;  3FBZ A;  5C3J A;  2KIN B;  5E0O A;  1LRZ A;  2C0S A;  3ANW B;  2E9X D;  2WSS V;  4DV3 T;  4QXC B;  3O1H A;  4NIQ A;  3OVU A;  3ONJ A;  4KHZ F;  3MA9 A;  3OYX A;  2V7L A;  4HFD A;  3ONL C;  5FP3 A;  4UVC B;  2CXD A;  1ZP0 A;  1IAP A;  2N1G A;  2VQE T;  2LSI A;  4F8H A;  4X64 T;  4QH4 A;  4UVA B;  4Q25 A;  5LA6 E;  3PUS A;  2DL1 A;  2Y48 B;  2H89 A;  1T7S A;  2YDR A;  2Y6X A;  5C8Y E;  2IML A;  2W2U A;  3Q5W A;  2YOE A;  4B3M T;  4I43 B;  3VRB A;  3C64 A;  1EZ3 A;  4EGW A;  2E5V A;  3ZMV B;  3ZMT B;  1YQ3 A;  3EAM A;  3LDQ B;  3QC9 A;  5FNV E;  2IC9 A;  5AQK B;  2MBG A;  3JC6 D;  4A97 A;  3PUG A;  4C91 A;  4JV5 T;  1HS7 A;  5HEJ A;  2HPJ A;  4DBQ A;  2HN1 A;  4EAH A;  2XAH B;  3VRA A;  5AQV B;  5JTG A;  3UUB A;  3FB2 A;  2HPL A;  4PK6 A;  1WYB A;  2VUR A;  5FXX A;  3E08 A;  5HXH A;  5ABE A;  4JI6 T;  4ILU A;  4JI5 T;  4YLH A;  2WCA A;  3AE1 A;  4V1A v;  4J2C A;  2D0U A;  4IDP A;  4HFH A;  1OXZ A;  2PG8 A;  3UFG A;  4IE5 A;  2RA1 A;  4IE4 A;  2W62 A;  3JAF A;  1VCS A;  5AFU L;  4KMC A;  4LF8 T;  4DR3 T;  3G06 A;  2BG9 A;  3NBX X;  2AE9 A;  4O2A E;  3UUL A;  4GIW A;  3PUW F;  2X9X A;  4ANJ A;  3PUZ F;  5LG4 A;  1QUU A;  3N2K E;  3ZMZ B;  4IGU A;  2IDO B;  3QB5 K;  4L9I A;  2HHH T;  3C51 A;  4GOU A;  3AEG A;  2VWA A;  4QX8 B;  2V1D B;  2VK9 A;  3RYF E;  3PUR A;  4HFE A;  2CEA A;  3T8O A;  4OYK A;  1FMW A;  2XSA A;  2XJ7 A;  2GK9 A;  2MYS A;  2QA7 A;  2V6Y A;  2EHO C;  3P8C D;  2CRB A;  3HKE E;  4NXN T;  4AKH A;  1Y64 B;  2NWB A;  5KX5 E;  3GA8 A;  5FL1 A;  4HTE A;  5IWA T;  3QNU A;  4IDZ A;  2CWY A;  1BR4 A;  1OWA A;  1M7K A;  2XHE B;  3PV0 F;  5L2L A;  1XNQ T;  1IBK T;  3QOF A;  2J47 A;  3HL6 A;  2WMO A;  5AQT B;  4ZI3 D;  2WWU A;  2VKD A;  3AAI A;  4JI0 T;  3AE4 A;  1Z0P A;  2LE8 A;  1Z8U A;  2NW7 A;  2NTY A;  4HFC A;  3FZH B;  3RC8 A;  2DHR A;  3EI0 A;  3S4U A;  4YXD A;  1D0Z A;  2LKH A;  5FXZ A;  2XQ4 A;  3P50 A;  3H37 A;  5EK3 A;  3F31 A;  4DND A;  1HNW T;  2WS3 A;  3RYH E;  1UGO A;  5ABF A;  3K3O A;  2VKJ A;  4H63 V;  4ZS2 A;  2V5D A;  3RHW A;  2WBL A;  3UU8 A;  1BR1 A;  4CZZ B;  3M65 A;  5A1L A;  1HF8 A;  2VKO A;  1UUS A;  3L8R A;  3AE8 A;  2V7J A;  4UV9 B;  3ZC1 A;  2DI4 A;  4AXP A;  5IUX A;  2W63 A;  4O4L E;  4ADZ A;  4GKK T;  2ES0 A;  3D0T A;  4HFI A;  4JUY A;  4IIJ E;  2V7I A;  4ZZC A;  4EXT A;  4YFS A;  2K9A A;  3K3N A;  2JIW A;  4DMV A;  3FXE B;  5HWY A;  3KFW X;  2KWH A;  2XAQ B;  1ZOY A;  2OLT A;  2HN2 A;  2KT9 A;  5LBM A;  1D1B A;  3KBU A;  3CK6 A;  1KF6 A;  3SFD A;  3KV6 A;  4DV2 T;  2BG9 C;  3KV4 A;  2WDQ A;  2IW5 B;  2PBI A;  4X66 T;  2KMF A;  4TWF A;  1MND A;  4AI6 A;  2MOZ A;  3HKC E;  3UU4 A;  2WWV A;  5ABG A;  4G63 A;  1KFY A;  4UR9 A;  2VL8 A;  3P4P A;  4Z8X A;  3ABV A;  1BR0 A;  1YD8 G;  5EZY E;  3O1J A;  3P4R A;  4YSY A;  1L0V A;  4A98 A;  3LSV A;  2JQQ A;  2W61 A;  1LVF A;  1FIO A;  4NUV A;  4WW0 A;  4L5G A;  4X65 T;  3U78 A;  3VHL A;  4P09 A;  3GN5 A;  3AEB A;  5IHY A;  3AE3 A;  2CA5 A;  1OED B;  1XWM A;  4TN7 B;  2CHN A;  3CX8 B;  3LK3 B;  3DP7 A;  3LK4 2;  5LG3 A;  5H6Q B;  3OKQ A;  5F8P A;  3TLV A;  3RH3 A;  2UXD T;  3IA3 A;  1U5P A;  2JMH A;  2QRX A;  2XSB A;  2VVS A;  4IE7 A;  4WNK A;  3SS1 A;  5HCJ A;  4I0U A;  2YDQ A;  4DR7 T;  1ZV4 X;  4G2A A;  4A5X A;  5HEO A;  4NUU A;  4KI0 F;  3PTR B;  4DV6 T;  1KNP A;  3CKD A;  4ILC A;  4NPP A;  3CX7 B;  5LHG B;  2ZM6 T;  2X67 A;  3JAE A;  3LBX A;  3ZC0 A;  4EIW A;  4DV1 T;  2XQA A;  2W0G A;  3PU8 A;  4GK5 E;  4E7Z A;  1HX1 B;  1SHZ C;  2H7V C;  3P4S A;  2LM9 A;  5JR9 A;  3E0Z A;  1IZN B;  3HKD E;  3C98 B;  2IIU A;  4HWF A;  4HFB A;  5H6R B;  1J5W A;  2RP4 A;  2LOS A;  2FUP A;  4HN9 A;  3LFM A;  4HWH A;  4PFO A;  3RC3 A;  4AKL A;  4U7I A;  1UX5 A;  4PJN A;  2L9Q A;  1SUM B;  5L3G B;  2WM9 A;  1FJG T;  4LF4 T;  1MNE A;  2E9X B;  2Q9Q B;  5LP6 E;  5HXE A;  3DJB A;  5LGT B;  3N2G E;  5BMV E;  5AQI B;  4CI3 B;  3PUV F;  3R84 B;  1D0Y A;  5KMG P;  3UU3 A;  4YJ3 E;  4EED A;  4X1Y E;  3EVY A;  2PJQ A;  2LHN A;  3A7M A;  1KEY A;  2KLQ A;  2LOP A;  4MLK A;  4LF9 T;  5HXR A;  2N2N A;  2UUB T;  2KND A;  2UXX B;  2X51 A;  4DID B;  2B1E A;  3MJX A;  4LML A;  5AQF B;  4X1I E;  4JYA T;  4ILB A;  2D5U A;  4PJL A;  4F6R C;  5L4E A;  2A2F X;  3IF8 B;  5F5W A;  4BJN A;  4DR4 T;  5HXS A;  2X9Y A;  2C5J A;  5FY7 A;  3AA6 B;  3RGL A;  2BKN A;  3AAE B;  4IT4 A;  4FJO A;  1ZKE A;  2RPA A;  4JI7 T;  4MFR A;  2WZH A;  5HEG A;  2EHO A;  2EHO D;  4H9O C;  3HKB E;  4HKA A;  2LSG A;  4HWC A;  2V5C A;  2ZM8 A;  4HWI B;  1W0B A;  2JPF A;  4AKR B;  2XQ7 A;  3A5X A;  2XAF B;  2BBH A;  2DWG A;  4CQI A;  4KP3 C;  2K3W A;  2ODU A;  1YKH B;  4UF0 A;  2BS3 A;  2YU2 A;  2MTQ A;  1VOM A;  2ACX A;  2XQ3 A;  4X5T A;  2ZLY A;  4KUM B;  3UTK A;  3ANW A;  3NKZ A;  3PJA J;  3RYI E;  2L8K A;  4H63 H;  2ZM0 A;  5AQH B;  5J2T E;  5CFB A;  1OED C;  5LHH B;  2CLY B;  2XQ6 A;  3ZJ2 A;  5JR9 C;  2DWK A;  3ZCI A;  2CHO A;  3RQU A;  1X9B A;  3I9W A;  2I59 A;  2V6X A;  1MMN A;  4CN4 A;  3FHN A;  3KBT A;  4ZHQ E;  5CA0 E;  3VR8 A;  2MPK A;  5JRC A;  2WY2 A;  2WQY A;  3N9P A;  4YTM A;  2WDR A;  2WZI A;  5ETW A;  5LJN A;  3AXJ B;  4P1N A;  4BA9 A;  3M3Z B;  3NWI A;  2VQF T;  4DO0 A;  3NRX A;  3UUN A;  2QYW A;  5JDM A;  1HFA A;  5DAB A;  4PK5 A;  4H9Q C;  3WAK A;  4QKN A;  4CN1 A;  3ZMS B;  3EDV A;  2V6Y B;  1S94 A;  2W4X A;  4WBN E;  3Q2M A;  2WAU A;  2VKH A;  1XMO T;  3MXZ A;  1VCT A;  3ZYK A;  5JVD E;  4LF6 T;  4PNI A;  5AQR B;  3ZN0 B;  1E7P A;  3MZK B;  4P0B A;  3V5U A;  3PJA A;  5FXW A;  2XM2 A;  1I6Z A;  4LFB T;  2IAK A;  4U2Y A;  1OED E;  5J2U E;  1DU2 A;  1YQ4 A;  4ILA A;  4TNW A;  4JBW F;  5L3D B;  1YKE B;  3RKG A;  5AQL B;  2JMK A;  4IRE A;  5AQJ B;  1CHU A;  2YIN A;  4UEL A;  2CE7 A;  4QH5 A;  1QLB A;  1XDO A;  2CCQ A;  2DNX A;  5FXV A;  4AQG A;  2Q9Q C;  2J4G A;  1HG5 A;  4TWD A;  4AQY T;  4YHH T;  4I4T E;  3ZSS A;  3ZT7 A;  4X62 T;  3BQL A;  1NEN A;  4HGA A;  2KXP B;  2Z6E A;  2UUC T;  2XQ5 A;  5FKY A;  4EZ4 A;  3RKO A;  1MIY A;  1WLX A;  5FYM A;  2KSR A;  4ZXL A;  2DLR A;  3F2E A;  2IC6 A;  3CWZ B;  2XQ8 A;  3FZM B;  4B3R T;  4YSX A;  3L39 A;  2LHR A;  4WYV A;  3P4Q A;  4PJJ A;  1U4Q A;  2WMN A;  3AE5 A;  4JI8 T;  4LMK A;  4XBF B;  5LNK A;  3B5M A;  3CPZ A;  5FVK A;  4TWH A;  1UX4 A;  3I0O A;  2XQY A;  4LF7 T;  1HR0 T;  4UXN B; 
#chains in the Genus database with same CATH homology
 4K0K T;  4JV5 T;  2UXB T;  4DR1 T;  4YY3 T;  4B3S T;  5LMN T;  5BR8 T;  4LFB T;  4DV5 T;  4NXN T;  1XNR T;  5LMU T;  4GKK T;  4DUY T;  4DV7 T;  1IBM T;  1J5E T;  4JI3 T;  4DV4 T;  4OX9 T;  4DV3 T;  4LF9 T;  5IWA T;  1N34 T;  4DR2 T;  2UU9 T;  3T1H T;  2UUB T;  4DR7 T;  4GKJ T;  4DR5 T;  4LFC T;  4JI6 T;  2UUA T;  4JI5 T;  3OTO T;  4B3T T;  1N36 T;  3T1Y T;  4DV6 T;  4DV2 T;  1XNQ T;  1IBK T;  4JYA T;  1HNZ T;  1HNX T;  4X66 T;  2VQE T;  2ZM6 T;  4AQY T;  4DR6 T;  4YHH T;  1N32 T;  4X64 T;  4JI0 T;  4DR4 T;  4KHP T;  4DV1 T;  4X62 T;  4NXM T;  1I94 T;  2UXC T;  2UUC T;  4LF8 T;  4DR3 T;  4JI7 T;  2VQF T;  2F4V T;  1XMQ T;  4JI4 T;  4X65 T;  1IBL T;  4LFA T;  4DV0 T;  4B3R T;  1HNW T;  4B3M T;  4LF5 T;  4JI2 T;  2HHH T;  4JI8 T;  1FJG T;  2E5L T;  1XMO T;  4JI1 T;  4LF4 T;  1N33 T;  2UXD T;  4LF6 T;  4DUZ T;  4LF7 T;  1HR0 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...