4LF6T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 33
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4lf6T00
4DUZT 1HNWT 4LF9T 4NXNT 4JI3T 4X64T 4LF7T 1N34T 1HNXT 4JI0T 4DV6T 2UXDT 4OX9T 2VQFT 2VQET 4B3TT 4DV1T 4LF5T 4LFBT 4YY3T 4YHHT 4JI4T 1IBMT 1XNQT 4DR6T 4DR7T 5IWAT 4NXMT 4KHPT 1N32T 1IBKT 1N33T 1HNZT 4LFAT 4B3RT 1XMQT 4JYAT 4X62T 1FJGT 4DR4T 2UUCT 4DV7T 4LF4T 4B3ST 4K0KT 3T1HT 3T1YT 2UUAT 2F4VT 4DV0T 4AQYT 4DR2T 4JI7T 4LFCT 1N36T 4DR1T 2UXBT 4DUYT 1XMOT 2UU9T 1I94T 2HHHT 4LF6T 4GKKT 4X66T 5LMUT 2E5LT 4X65T 4LF8T 1IBLT 4DV2T 4JI5T 2UUBT 4DV3T 4GKJT 1XNRT 2UXCT 4DR3T 4JV5T 2ZM6T 5LMNT 3OTOT 4DR5T 1J5ET 4JI8T 5BR8T 4JI6T 4B3MT 4JI2T 1HR0T 4JI1T 4DV5T 4DV4T
chains in the Genus database with same CATH superfamily
4TWFA 2W0GA 1QSDA 1SHZC 2PFVA 2D2SA 4NXNT 2KLQA 4NUUA 2RPAA 3W15B 4PW8A 1MNDA 2VWAA 2YDQA 3AA6B 2XASB 3M3ZB 5JH7E 3DTOA 5ABEA 3A5XA 3ZMZB 1HNXT 4MLKA 1N34T 2KWHA 2YN6A 2FJEA 3PV0F 1D1CA 5LBQB 4DV6T 1OEDC 3LSVA 5JVDE 3VKHA 2MPKA 3CMLA 3MZKB 2A9UA 3A8YC 4I55E 5JREA 1BR4A 2N9DA 2XY8B 3AEAA 3N9PA 3CPZA 4B6XA 1W0AA 3ZC0A 2JQ9A 2HN1A 4HFCA 3PUWF 2XAQB 1T72A 2JMKA 2BDEA 1R8IA 2QVAA 2Z6EA 3SFEA 2M67A 3WAKA 4ISSA 4CXYA 3RI5A 2BKNA 3RX6A 5FKYA 5ABFB 3R84B 1XDOA 5F5WA 3RRWA 4O2AE 4ANJA 1UCUA 2BG9E 4YHHT 5DJQC 4JEHB 5FVLA 4UVAB 1YW0A 3P4PA 3TKLB 4Z8XA 5HYAA 2VURA 3MKDA 3TLVA 3FB2A 4U74A 5IHYA 1ZKEA 4CI2B 4ZI2C 4ZHQE 1MMAA 4IE7A 4X5TA 3U78A 4BJNA 3WAJA 1B7TA 2QA7A 2RP4A 2WBLA 3CK6A 3ZT7A 3AAAB 2YDSA 4EB6E 4AI6A 1JNRA 3AB3B 2C5KT 3K3OA 4HWCA 4WW0A 2LSJA 3I0OA 4C91A 4F8HA 4Z90A 3KVAA 2W61A 4J2CA 3D0TA 4IE5A 4OFZA 2NW7A 5LOVE 2JMHA 4JLEA 3UU5A 4G63A 2VVSA 3ZN1B 4YFSA 5AQNB 5CA1E 1HNZT 3ZMSB 1IAPA 5J0ZA 1FIOA 2JRKA 5FL1A 3MA9A 4X1IE 3V5UA 2CHNA 5M4YA 3RC3A 5LGUB 5F8PA 2QYWA 3PUYF 4P1NA 4UF0A 2ODUA 4HFVA 2QRXA 1T7SA 2EHOA 3KBUA 5AQVB 5CGMA 4NUVA 2Y48B 1UURA 2A72A 2ACZA 3BQKA 4TNVA 4TUYE 1Z0PA 3B57A 2K3WA 2BKPA 3RIUA 2RA1A 1LKXA 3AE7A 5J2TE 4EOZB 4TNWA 1FJGT 4DV0T 2D9DA 2JQQA 3IEEA 2XAJB 3AA1B 1YQ4A 1E7PA 4AQFC 4EXTA 2V1DB 3NRXA 4KBMB 3EVYA 5GONE 2V7JA 3SRZA 3LFMA 4WBOA 4ZXLA 4DVDA 2WAUA 2K5BB 5E0OA 3SS1A 4UVBB 4GIWA 3RH3A 1O3XA 1HG2A 2WCAA 3RRCA 2ZM8A 4H63H 2P9BA 4IDZA 3KV9A 2UXBT 1D1BA 3H37A 4DUYT 2UU9T 4YJ3E 1I94T 2Q9QD 3PUVF 1DU2A 2LOSA 2XJ7A 2LM2A 3VU7H 3FXEB 3KINB 3AEDA 4IE6A 4P09A 5L3BB 4H9RC 3AEFA 2YOEA 3GN5A 4X65T 2CXFA 1VCSA 5FYMA 4CI1B 3HI2A 3VHLA 4O4IE 2A2FX 2I59A 1MIYA 3ABVA 2WU2A 2NW9A 3SWHA 4U7IA 1JNZA 2CM0A 3N9OA 4MALA 2NTYA 2XUEA 3IHRA 3K3QC 3ZSTA 1BR0A 3C64A 4E7SA 3VR9A 1J5WA 4DR5T 4XBFB 1J5ET 3ONJA 2LJLA 2DCFA 2VKOA 3UQ7A 2NTXA 3Q9DA 2E9XC 2ZM2A 4AKRB 5JDHA 5AQIB 3Q5WA 3QOFA 5EK3A 2DWGA 4H63V 4B3MT 4HWIB 4ILAA 4O4LE 3AXJA 1HR0T 3QNUA 1FMVA 5IUXA 4O2BE 3K3NA 1WRDA 4TV8E 5AQHB 2BS3A 3P50A 4YHJA 4CXWA 3P4SA 3T1YT 4HE8A 5LBMA 3K8PC 3N2KE 3PTRB 4HWHA 4X20E 5AQSB 2CBJA 1YQ3A 2CA5A 4EEBA 2KZ7B 4JI3T 2WS3A 2B76A 3ZT6A 2V6YA 4X64T 3C98B 2PG8A 2XHEB 2NOXA 4LF7T 3AE3A 2WDRA 4YTNA 1IJ6A 2X9WA 3F2EA 4JI0T 4ZOLE 4ZS3A 4QXBB 2WWVA 4QH4A 2W62A 4TZ4C 5ETWA 5KDMC 2LE8A 4DNDA 1M7KA 2LHNA 3A7MA 4GKKT 1VOMA 4PFOA 3JC6C 5FXWA 2EHOC 3AE6A 3CQGB 3ZMVB 3P4QA 1HS7A 1MMGA 2VK9A 2DLRA 3OYXA 3J7Yq 3KBTA 3GWHA 4IHJE 4MFRA 2BKOA 2X0YA 3AAIA 4LF5T 2YINA 4LFBT 3AECA 2OV9A 3AVRA 4QKNA 4EYYR 5EK2A 5KMGP 4EEDA 4UEMA 5HXRA 1IBMT 5JRCA 2PBIA 2ZLYA 4L5GA 3RKGA 3RYHE 1BR2A 3AE9A 5HAXA 1KNPA 5CJ5A 4DIDB 5JDMA 5LP6E 2R6GF 4IL4A 2WP9A 5IWAT 4DR7T 3AEBA 1HG5A 2NR4A 2KSRA 3FZMB 4GOUA 2J62A 4U31A 5AQRB 4PJMA 4QX8B 3ZYMA 4NXMT 2NP9A 2LSIA 2NWBA 1IBKT 4XZCA 3QK6A 4HEAA 3AXJB 5AQKB 4DMWA 5LGTB 2LRKA 2MOZA 2MYSA 4HTEA 1UX4A 4YTMA 5AQTB 3FZHB 3VKGA 4X1KE 5FP3A 5HWXA 1UX5A 4HFIA 4JYAT 2X9HA 1XZYA 3QC9A 4UV9B 5FXVA 2Q9QA 3C50A 3N9QA 3UU8A 3VR8A 5L3CB 1MIVA 5LHGB 2IMLA 2CLYB 2LM9A 2WB5A 4GYSA 4ILBA 4DR4T 5EK4A 2W63A 3UU6A 2BBJA 2CEAA 4DV7T 4B3ST 4PK5A 4LF4T 2CHOA 1ZP0A 2WDVA 3IA3A 4AISA 3T1HT 4UR9A 2F4VT 2C5JA 2XSBA 3RF1A 2CPTA 3GA8A 3HKDE 3I0QA 4UF0B 1CUNA 4I43B 2EHOB 4AQFA 3N9LA 5F3JA 3LK3B 2XAGB 4U7YA 4LMLA 4OYJA 2CCQA 3UU3A 2CLYC 3S4UA 1ZOYA 2CWYA 2K48A 3EI0A 3K1SA 4UIGA 3SFDA 4Z91A 3RIUC 4QHOA 4EAHA 2IUBA 2EHOD 2LKHA 1Y01A 2UXXB 2LRLA 2LSGA 1LRZA 3KV5A 3FHNA 3MK7C 4HGAA 4IDNA 2D5UA 4DR1T 4ZZCA 2W4XA 1XMOT 4H9SE 5AQMB 2HN2A 2OLTA 2CXDA 2YDRA 4F6RC 1MIWA 3PE0A 4KP3C 2XQ4A 4H9NC 5DQWA 3WI3A 4ISTA 4WNKA 3TLUA 5L3FB 2ACXA 4PAGA 4ZI3D 3EDUA 2X51A 4X1YE 3AA0B 4WYVA 1U5PA 4BAYB 3LK42 5C8YE 3CQXC 4KUMB 4UELA 3PU8A 4I50E 4ERRA 2X9XA 4DV2T 1WR6A 5HXSA 2JQHA 2UUBT 1AJ3A 1KK7A 3N2OA 4DV3T 4A56A 2WU5A 2W00A 5CB4E 4YSZA 3HR0A 2LLYA 3Q5DA 4IDQA 3RPUA 3UUXB 5L47A 1XNRT 2XAFB 1CHUA 2WSSV 1MMDA 2MAWA 1G8XA 1D0YA 2D0TA 1WCRA 3ANWA 5AQGB 2VKHA 2LSYA 2IDOB 3PU3A 2V8SV 4Q25A 4CI3B 5AQFB 3PUXF 3B13A 3G06A 3KVBA 2ZM6T 2VASA 5AQLB 2H89A 4EZHA 4BA9A 4PK4A 2V5DA 2ZM0A 3F57A 4I0UA 1YKHB 4JI6T 3TLWA 5LG3A 1UGOA 2CWOA 1HX1B 2XQYA 4NIQA 2XPKA 5HEOA 1VRBA 4JI1T 5CFBA 5FY7A 2KT9A 4EZ4A 3LBXB 1LVKA 3PJAA 4H9PC 4BJMA 4O4JE 3OPCA 2UUAT 4EV6A 5LHIB 5AQJB 4HWFA 2W2UA 3H3MA 2K24A 1HNWT 4AKHA 1Z8UA 2FUPA 2V6XA 3KV6A 3O1HA 2H3RA 2M6IA 3VRBA 1YKEB 5JTGA 1US7B 3C4ZA 4IE0A 1GQEA 2H7OA 2X67A 3OKQA 3OJAA 4L9IA 3ZJ1A 2PJQA 4DMVA 2FJAA 4C90A 2VL0A 3V5SA 5ADXL 1T98A 4DBQA 4PK6A 3UUMA 3P4RA 1KNRA 5FXXA 2IHR1 2E9XD 2N1GA 2XQ9A 3CIRA 3QUJA 4KX6A 4QH5A 2MBGA 1WLXA 2X68A 3ANWB 4PNIA 5HXCA 4GYRA 3ZPOA 5LYJE 2DHRA 1OEDB 2WDQA 3RGLA 3LK2B 4DR3T 4B3TT 4CN1A 2BBHA 4EGWA 1FMWA 3IF8B 4AXPA 3DP7A 4OYKA 5L4HA 4DV1T 3AE2A 3AEGA 1SA0E 1MNEA 3H3AA 3ZKRA 4YY3T 2XAHB 2Q9QC 5HEHA 5LXTE 4UVCB 4AKLA 3ZC1A 3JC6D 4JI4T 1Y64B 2BG9C 4IDOA 3CKDA 4KHZF 4PJLA 2V7KA 1FEWA 5HCMA 3ZMUB 4CN4A 4ZI7E 5KXJA 4AIUA 5LG4A 1NEKA 4IIJE 4CQIA 4QWNB 2DL1A 5JDLA 2VVNA 3ZCJA 3EABA 3ZMTB 5KX5E 1OEDA 3GMIA 3T8OA 5JR9C 3ETVA 2KWIB 4KHPT 2Q9QB 4DBRA 1N33T 3HL6A 4HFHA 1U4QA 3E22E 1KEYA 4H9OC 5H6QB 2E5VA 2DWKA 2OA5A 3N9NA 2WMOA 4O8SA 5FVKA 4B3RT 2I6HA 4QH1A 2E9XB 2GK9A 4A5XA 4HN9A 5HXEA 5L3EB 1WYCA 2A3DA 3JADA 4V1Av 3RQUA 3ZLIA 4X62T 4AKIA 3J9X1 2AXDS 2XM2A 5LHHB 2XQ5A 3AE4A 5AFUL 1W0BA 2UUCT 1E2AA 3ZJ2A 1WR0A 4K0KT 1ZV4X 1KFYA 2H7VC 2IC6A 1HFAA 1YXRA 3JCFA 3LDQB 4U33A 3PUZF 2LKGA 3GN5B 4TWHA 2B1EA 5C3JA 2KINB 5JR9A 4GK5E 2PTFA 3IBPA 2WY2A 2C0SA 5FMNA 1W9RA 2MTQA 2YU1A 3LJCA 5AQOB 4ZI2D 4DR2T 5HEJA 4IGUA 1NWMX 5HCJA 4U2ZA 4CZZB 3M65A 2KNDA 1N36T 4IT4A 3DJBA 5LCYA 3AE5A 3UTKA 1IJ5A 5ABHA 3NZQA 1NENA 2IW5B 2HHHT 5L4EA 4LF6T 3I1AA 1H7CA 1OEDE 2VB6A 3QB5A 3ONXA 4TV9E 3OVUA 3NRYA 2WWUA 1ZEEA 4JUYA 5LMUT 2E5LT 1BR1A 3FXDB 2N2NA 4UXNB 4LF8T 3FBLA 3NBXX 2KXPB 3C4WA 4JI5T 4IREA 3EHZA 4M1PA 5FXZA 3RIFA 2WM9A 4CN6A 3JAEA 3RHWA 2J4GA 2BG9B 3ESLA 3SOLA 2XQ7A 4N78D 3E08A 2UXCT 4PJJA 5HEGA 5IYZE 5EZYE 4JEUB 3EDVA 3FBZA 1QUUA 3ZYKA 1WFDA 3O1IA 5AQUB 3ZSSA 4JV5T 3RC8A 3MACA 5LGNB 1HX8A 2LT3A 2WZIA 4U72A 5FY1A 2V7MA 3NWIA 4EIWA 5ABFA 4GK0E 5HWYA 2HH7A 4IE4A 5JDQA 4JI2T 5L2LA 1QLBA 3BK9A 2HPLA 3UT5E 2C5IT 2IC9A 4DV4T 3UQ4A 1SUMB 3PUGA 2ODVA 3ETUA 3N9MA 4UV8B 3EAMA 5CA0E 4QXCB 1YD8G 2BVLA 2Y8DA 4DUZT 4YSYA 2CRBA 4LF9T 2D0UA 2KMFA 3HKCE 2ES0A 2DI4A 4HFBA 1G73A 4JBWF 1W09A 2AE9A 2JPFA 1HTJF 1S35A 5LJNA 2M6BA 4P0AA 5LJMA 3JAFA 5LA6E 4ZS2A 4E7ZA 4YJ2E 4ZEYA 4P0BA 5DQVA 1NAFA 2I0MA 4PFPA 4LFCT 2UXDT 4OX9T 2XM1A 4HFEA 4AKGA 3PURA 3F31A 4QXHB 1I6ZA 1D1AA 2SPCA 2VKJA 5J1GA 3O9XA 3C4XA 3P8CD 1VCTA 4YXDA 5C2TA 4G2AA 2V26A 4LMJA 4MHCA 5FNVE 3ZYLA 1WYBA 3OBVE 2HPJA 4TWDA 3RIAA 2V5CA 3NKZA 1D0ZA 3L3PA 4XAXB 4FI5A 2BS4A 4HFDA 3NZPA 5J2UE 3CX7B 3N2GE 2LSKA 2XTLA 4OHFA 1XNQT 1XWMA 2FJDA 2LHRA 3C51A 2VQET 4DR6T 4LMKA 3OYZA 4OK0A 3O4XE 1X9BA 3ZCIA 3PJAJ 4TN7B 5H6RB 1XMQT 2FBWA 3AE8A 1X79A 1MMNA 3AAEB 4IDPA 3TLSA 2JQKA 3O1JA 4HWDA 2X66A 5L3DB 4YT0A 1N32T 3HKBE 3U3IA 4WBNE 2H88A 3PUQA 3ZN0B 1ZHCA 4QX7B 2WZHA 4LFAT 4PJNA 2IIUA 3TLTA 2FJBA 3FZFB 2BS2A 3NVOA 3Q2MA 2Y6XA 2YU2A 4K0UA 5TAOA 2L8KA 1UUSA 4YLHA 3L8RA 3RYCE 5A1LA 5JRCB 3CX8B 1IBLT 4U3CA 4ASKA 3AE1A 3UFEA 2XQAA 2LOPA 3E0ZA 5JR9B 5FL0A 2XZEA 2YK0A 3ONLC 3UFGA 2K9AA 4AQGA 2CXLA 2XQ3A 3AA7B 3P7IA 1HCIA 5JDNA 3CQCB 3B5MA 3UUBA 2WQYA 1V9DA 2V7LA 2VL8A 4WZXA 2UXNB 3HA4A 4DV5T 5FY0A 1KNZA 2YEVC 3KDSE 3Q5EA 4ZI3C 5LB7B 3ZT5A 3R6NA 3KV4A 3L09A 4AQYT 3LG7A 4JI7T 1T8BA 3RQWA 5BMVE 1M62A 2BVMA 2CE7A 4H9QC 5JDFA 4A98A 3AVSA 1LVFA 2CMRA 3ZEFB 3CX6B 3EUHA 3N5LA 4O4HE 4FJOA 4L0RA 2G0UA 3FZLB 4X66T 4ILCA 3RYIE 2XQ8A 5AQPB 1IZNB 2JIWA 1S94A 3I9YA 2JJ9A 1KF6A 2W67A 2W66A 3UUNA 5L3GB 2L9QA 2WMNA 4YTPA 2VKDA 4MBQA 3X1DA 3P4WA 1XDPA 3BQIA 4GKJT 5ABGA 5HXHA 3KFWX 3PUSA 3LBXA 5LNKA 1D0XA 3I9WA 3PDYA 4I4TE 4EYUA 5AQQB 4ZZBA 4HKAA 1J1JA 1HF8A 2E2AA 3CWZB 5JQGE 5HEUA 4IL9A 2DNXA 3HKEE 2BG9A 2X9YA 3CVRA 4ILUA 4KI0F 4KMCA 5DABA 3FZKB 2VQFT 4YSXA 5LMNT 3RLFF 3OTOT 2J1DG 2LEHA 3RKOA 3MJXA 3VRAA 4CXXA 4JI8T 3RYFE 3UULA 4ADZA 2QGSA 3PUAA 5BR8T 2NW8A 3Q5XA 5JDGA 2L3LA 2E8IA 2V7IA 2X0HA 2YKSA 3L39A 3MXZA 4NPPA 2X0LB 2XSAA 4TX5A 3UU4A 1OWAA 1SE7A 1E1HB 1EZ3A 2IAKA 2J47A 2ZMAA 3QB5K 2CBIA 2BZBA 4U2YA 1OXZA 3BQLA 4A97A 1UK5A 4DO0A 4COFA 3AEEA 2V6YB 1L0VA 2XQ6A 2E9XA
chains in the Genus database with same CATH topology
4DUZT 1HNWT 4LF9T 4NXNT 4JI3T 4X64T 4LF7T 1N34T 1HNXT 4JI0T 4DV6T 2UXDT 4OX9T 2VQFT 2VQET 4B3TT 4DV1T 4LF5T 4LFBT 4YY3T 4YHHT 4JI4T 1IBMT 1XNQT 4DR6T 4DR7T 5IWAT 4NXMT 4KHPT 1N32T 1IBKT 1N33T 1HNZT 4LFAT 4B3RT 1XMQT 4JYAT 4X62T 1FJGT 4DR4T 2UUCT 4DV7T 4LF4T 4B3ST 4K0KT 3T1HT 3T1YT 2UUAT 2F4VT 4DV0T 4AQYT 4DR2T 4JI7T 4LFCT 1N36T 4DR1T 2UXBT 4DUYT 1XMOT 2UU9T 1I94T 2HHHT 4LF6T 4GKKT 4X66T 5LMUT 2E5LT 4X65T 4LF8T 1IBLT 4DV2T 4JI5T 2UUBT 4DV3T 4GKJT 1XNRT 2UXCT 4DR3T 4JV5T 2ZM6T 5LMNT 3OTOT 4DR5T 1J5ET 4JI8T 5BR8T 4JI6T 4B3MT 4JI2T 1HR0T 4JI1T 4DV5T 4DV4T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUZ T;  1HNW T;  4LF9 T;  4NXN T;  4JI3 T;  4X64 T;  4LF7 T;  1N34 T;  1HNX T;  4JI0 T;  4DV6 T;  2UXD T;  4OX9 T;  2VQF T;  2VQE T;  4B3T T;  4DV1 T;  4LF5 T;  4LFB T;  4YY3 T;  4YHH T;  4JI4 T;  1IBM T;  1XNQ T;  4DR6 T;  4DR7 T;  5IWA T;  4NXM T;  4KHP T;  1N32 T;  1IBK T;  1N33 T;  1HNZ T;  4LFA T;  4B3R T;  1XMQ T;  4JYA T;  4X62 T;  1FJG T;  4DR4 T;  2UUC T;  4DV7 T;  4LF4 T;  4B3S T;  4K0K T;  3T1H T;  3T1Y T;  2UUA T;  2F4V T;  4DV0 T;  4AQY T;  4DR2 T;  4JI7 T;  4LFC T;  1N36 T;  4DR1 T;  2UXB T;  4DUY T;  1XMO T;  2UU9 T;  1I94 T;  2HHH T;  4LF6 T;  4GKK T;  4X66 T;  5LMU T;  2E5L T;  4X65 T;  4LF8 T;  1IBL T;  4DV2 T;  4JI5 T;  2UUB T;  4DV3 T;  4GKJ T;  1XNR T;  2UXC T;  4DR3 T;  4JV5 T;  2ZM6 T;  5LMN T;  3OTO T;  4DR5 T;  1J5E T;  4JI8 T;  5BR8 T;  4JI6 T;  4B3M T;  4JI2 T;  1HR0 T;  4JI1 T;  4DV5 T;  4DV4 T; 
#chains in the Genus database with same CATH topology
 4TWF A;  2W0G A;  1QSD A;  1SHZ C;  2PFV A;  2D2S A;  4NXN T;  2KLQ A;  4NUU A;  2RPA A;  3W15 B;  4PW8 A;  1MND A;  2VWA A;  2YDQ A;  3AA6 B;  2XAS B;  3M3Z B;  5JH7 E;  3DTO A;  5ABE A;  3A5X A;  3ZMZ B;  1HNX T;  4MLK A;  1N34 T;  2KWH A;  2YN6 A;  2FJE A;  3PV0 F;  1D1C A;  5LBQ B;  4DV6 T;  1OED C;  3LSV A;  5JVD E;  3VKH A;  2MPK A;  3CML A;  3MZK B;  2A9U A;  3A8Y C;  4I55 E;  5JRE A;  1BR4 A;  2N9D A;  2XY8 B;  3AEA A;  3N9P A;  3CPZ A;  4B6X A;  1W0A A;  3ZC0 A;  2JQ9 A;  2HN1 A;  4HFC A;  3PUW F;  2XAQ B;  1T72 A;  2JMK A;  2BDE A;  1R8I A;  2QVA A;  2Z6E A;  3SFE A;  2M67 A;  3WAK A;  4ISS A;  4CXY A;  3RI5 A;  2BKN A;  3RX6 A;  5FKY A;  5ABF B;  3R84 B;  1XDO A;  5F5W A;  3RRW A;  4O2A E;  4ANJ A;  1UCU A;  2BG9 E;  4YHH T;  5DJQ C;  4JEH B;  5FVL A;  4UVA B;  1YW0 A;  3P4P A;  3TKL B;  4Z8X A;  5HYA A;  2VUR A;  3MKD A;  3TLV A;  3FB2 A;  4U74 A;  5IHY A;  1ZKE A;  4CI2 B;  4ZI2 C;  4ZHQ E;  1MMA A;  4IE7 A;  4X5T A;  3U78 A;  4BJN A;  3WAJ A;  1B7T A;  2QA7 A;  2RP4 A;  2WBL A;  3CK6 A;  3ZT7 A;  3AAA B;  2YDS A;  4EB6 E;  4AI6 A;  1JNR A;  3AB3 B;  2C5K T;  3K3O A;  4HWC A;  4WW0 A;  2LSJ A;  3I0O A;  4C91 A;  4F8H A;  4Z90 A;  3KVA A;  2W61 A;  4J2C A;  3D0T A;  4IE5 A;  4OFZ A;  2NW7 A;  5LOV E;  2JMH A;  4JLE A;  3UU5 A;  4G63 A;  2VVS A;  3ZN1 B;  4YFS A;  5AQN B;  5CA1 E;  1HNZ T;  3ZMS B;  1IAP A;  5J0Z A;  1FIO A;  2JRK A;  5FL1 A;  3MA9 A;  4X1I E;  3V5U A;  2CHN A;  5M4Y A;  3RC3 A;  5LGU B;  5F8P A;  2QYW A;  3PUY F;  4P1N A;  4UF0 A;  2ODU A;  4HFV A;  2QRX A;  1T7S A;  2EHO A;  3KBU A;  5AQV B;  5CGM A;  4NUV A;  2Y48 B;  1UUR A;  2A72 A;  2ACZ A;  3BQK A;  4TNV A;  4TUY E;  1Z0P A;  3B57 A;  2K3W A;  2BKP A;  3RIU A;  2RA1 A;  1LKX A;  3AE7 A;  5J2T E;  4EOZ B;  4TNW A;  1FJG T;  4DV0 T;  2D9D A;  2JQQ A;  3IEE A;  2XAJ B;  3AA1 B;  1YQ4 A;  1E7P A;  4AQF C;  4EXT A;  2V1D B;  3NRX A;  4KBM B;  3EVY A;  5GON E;  2V7J A;  3SRZ A;  3LFM A;  4WBO A;  4ZXL A;  4DVD A;  2WAU A;  2K5B B;  5E0O A;  3SS1 A;  4UVB B;  4GIW A;  3RH3 A;  1O3X A;  1HG2 A;  2WCA A;  3RRC A;  2ZM8 A;  4H63 H;  2P9B A;  4IDZ A;  3KV9 A;  2UXB T;  1D1B A;  3H37 A;  4DUY T;  2UU9 T;  4YJ3 E;  1I94 T;  2Q9Q D;  3PUV F;  1DU2 A;  2LOS A;  2XJ7 A;  2LM2 A;  3VU7 H;  3FXE B;  3KIN B;  3AED A;  4IE6 A;  4P09 A;  5L3B B;  4H9R C;  3AEF A;  2YOE A;  3GN5 A;  4X65 T;  2CXF A;  1VCS A;  5FYM A;  4CI1 B;  3HI2 A;  3VHL A;  4O4I E;  2A2F X;  2I59 A;  1MIY A;  3ABV A;  2WU2 A;  2NW9 A;  3SWH A;  4U7I A;  1JNZ A;  2CM0 A;  3N9O A;  4MAL A;  2NTY A;  2XUE A;  3IHR A;  3K3Q C;  3ZST A;  1BR0 A;  3C64 A;  4E7S A;  3VR9 A;  1J5W A;  4DR5 T;  4XBF B;  1J5E T;  3ONJ A;  2LJL A;  2DCF A;  2VKO A;  3UQ7 A;  2NTX A;  3Q9D A;  2E9X C;  2ZM2 A;  4AKR B;  5JDH A;  5AQI B;  3Q5W A;  3QOF A;  5EK3 A;  2DWG A;  4H63 V;  4B3M T;  4HWI B;  4ILA A;  4O4L E;  3AXJ A;  1HR0 T;  3QNU A;  1FMV A;  5IUX A;  4O2B E;  3K3N A;  1WRD A;  4TV8 E;  5AQH B;  2BS3 A;  3P50 A;  4YHJ A;  4CXW A;  3P4S A;  3T1Y T;  4HE8 A;  5LBM A;  3K8P C;  3N2K E;  3PTR B;  4HWH A;  4X20 E;  5AQS B;  2CBJ A;  1YQ3 A;  2CA5 A;  4EEB A;  2KZ7 B;  4JI3 T;  2WS3 A;  2B76 A;  3ZT6 A;  2V6Y A;  4X64 T;  3C98 B;  2PG8 A;  2XHE B;  2NOX A;  4LF7 T;  3AE3 A;  2WDR A;  4YTN A;  1IJ6 A;  2X9W A;  3F2E A;  4JI0 T;  4ZOL E;  4ZS3 A;  4QXB B;  2WWV A;  4QH4 A;  2W62 A;  4TZ4 C;  5ETW A;  5KDM C;  2LE8 A;  4DND A;  1M7K A;  2LHN A;  3A7M A;  4GKK T;  1VOM A;  4PFO A;  3JC6 C;  5FXW A;  2EHO C;  3AE6 A;  3CQG B;  3ZMV B;  3P4Q A;  1HS7 A;  1MMG A;  2VK9 A;  2DLR A;  3OYX A;  3J7Y q;  3KBT A;  3GWH A;  4IHJ E;  4MFR A;  2BKO A;  2X0Y A;  3AAI A;  4LF5 T;  2YIN A;  4LFB T;  3AEC A;  2OV9 A;  3AVR A;  4QKN A;  4EYY R;  5EK2 A;  5KMG P;  4EED A;  4UEM A;  5HXR A;  1IBM T;  5JRC A;  2PBI A;  2ZLY A;  4L5G A;  3RKG A;  3RYH E;  1BR2 A;  3AE9 A;  5HAX A;  1KNP A;  5CJ5 A;  4DID B;  5JDM A;  5LP6 E;  2R6G F;  4IL4 A;  2WP9 A;  5IWA T;  4DR7 T;  3AEB A;  1HG5 A;  2NR4 A;  2KSR A;  3FZM B;  4GOU A;  2J62 A;  4U31 A;  5AQR B;  4PJM A;  4QX8 B;  3ZYM A;  4NXM T;  2NP9 A;  2LSI A;  2NWB A;  1IBK T;  4XZC A;  3QK6 A;  4HEA A;  3AXJ B;  5AQK B;  4DMW A;  5LGT B;  2LRK A;  2MOZ A;  2MYS A;  4HTE A;  1UX4 A;  4YTM A;  5AQT B;  3FZH B;  3VKG A;  4X1K E;  5FP3 A;  5HWX A;  1UX5 A;  4HFI A;  4JYA T;  2X9H A;  1XZY A;  3QC9 A;  4UV9 B;  5FXV A;  2Q9Q A;  3C50 A;  3N9Q A;  3UU8 A;  3VR8 A;  5L3C B;  1MIV A;  5LHG B;  2IML A;  2CLY B;  2LM9 A;  2WB5 A;  4GYS A;  4ILB A;  4DR4 T;  5EK4 A;  2W63 A;  3UU6 A;  2BBJ A;  2CEA A;  4DV7 T;  4B3S T;  4PK5 A;  4LF4 T;  2CHO A;  1ZP0 A;  2WDV A;  3IA3 A;  4AIS A;  3T1H T;  4UR9 A;  2F4V T;  2C5J A;  2XSB A;  3RF1 A;  2CPT A;  3GA8 A;  3HKD E;  3I0Q A;  4UF0 B;  1CUN A;  4I43 B;  2EHO B;  4AQF A;  3N9L A;  5F3J A;  3LK3 B;  2XAG B;  4U7Y A;  4LML A;  4OYJ A;  2CCQ A;  3UU3 A;  2CLY C;  3S4U A;  1ZOY A;  2CWY A;  2K48 A;  3EI0 A;  3K1S A;  4UIG A;  3SFD A;  4Z91 A;  3RIU C;  4QHO A;  4EAH A;  2IUB A;  2EHO D;  2LKH A;  1Y01 A;  2UXX B;  2LRL A;  2LSG A;  1LRZ A;  3KV5 A;  3FHN A;  3MK7 C;  4HGA A;  4IDN A;  2D5U A;  4DR1 T;  4ZZC A;  2W4X A;  1XMO T;  4H9S E;  5AQM B;  2HN2 A;  2OLT A;  2CXD A;  2YDR A;  4F6R C;  1MIW A;  3PE0 A;  4KP3 C;  2XQ4 A;  4H9N C;  5DQW A;  3WI3 A;  4IST A;  4WNK A;  3TLU A;  5L3F B;  2ACX A;  4PAG A;  4ZI3 D;  3EDU A;  2X51 A;  4X1Y E;  3AA0 B;  4WYV A;  1U5P A;  4BAY B;  3LK4 2;  5C8Y E;  3CQX C;  4KUM B;  4UEL A;  3PU8 A;  4I50 E;  4ERR A;  2X9X A;  4DV2 T;  1WR6 A;  5HXS A;  2JQH A;  2UUB T;  1AJ3 A;  1KK7 A;  3N2O A;  4DV3 T;  4A56 A;  2WU5 A;  2W00 A;  5CB4 E;  4YSZ A;  3HR0 A;  2LLY A;  3Q5D A;  4IDQ A;  3RPU A;  3UUX B;  5L47 A;  1XNR T;  2XAF B;  1CHU A;  2WSS V;  1MMD A;  2MAW A;  1G8X A;  1D0Y A;  2D0T A;  1WCR A;  3ANW A;  5AQG B;  2VKH A;  2LSY A;  2IDO B;  3PU3 A;  2V8S V;  4Q25 A;  4CI3 B;  5AQF B;  3PUX F;  3B13 A;  3G06 A;  3KVB A;  2ZM6 T;  2VAS A;  5AQL B;  2H89 A;  4EZH A;  4BA9 A;  4PK4 A;  2V5D A;  2ZM0 A;  3F57 A;  4I0U A;  1YKH B;  4JI6 T;  3TLW A;  5LG3 A;  1UGO A;  2CWO A;  1HX1 B;  2XQY A;  4NIQ A;  2XPK A;  5HEO A;  1VRB A;  4JI1 T;  5CFB A;  5FY7 A;  2KT9 A;  4EZ4 A;  3LBX B;  1LVK A;  3PJA A;  4H9P C;  4BJM A;  4O4J E;  3OPC A;  2UUA T;  4EV6 A;  5LHI B;  5AQJ B;  4HWF A;  2W2U A;  3H3M A;  2K24 A;  1HNW T;  4AKH A;  1Z8U A;  2FUP A;  2V6X A;  3KV6 A;  3O1H A;  2H3R A;  2M6I A;  3VRB A;  1YKE B;  5JTG A;  1US7 B;  3C4Z A;  4IE0 A;  1GQE A;  2H7O A;  2X67 A;  3OKQ A;  3OJA A;  4L9I A;  3ZJ1 A;  2PJQ A;  4DMV A;  2FJA A;  4C90 A;  2VL0 A;  3V5S A;  5ADX L;  1T98 A;  4DBQ A;  4PK6 A;  3UUM A;  3P4R A;  1KNR A;  5FXX A;  2IHR 1;  2E9X D;  2N1G A;  2XQ9 A;  3CIR A;  3QUJ A;  4KX6 A;  4QH5 A;  2MBG A;  1WLX A;  2X68 A;  3ANW B;  4PNI A;  5HXC A;  4GYR A;  3ZPO A;  5LYJ E;  2DHR A;  1OED B;  2WDQ A;  3RGL A;  3LK2 B;  4DR3 T;  4B3T T;  4CN1 A;  2BBH A;  4EGW A;  1FMW A;  3IF8 B;  4AXP A;  3DP7 A;  4OYK A;  5L4H A;  4DV1 T;  3AE2 A;  3AEG A;  1SA0 E;  1MNE A;  3H3A A;  3ZKR A;  4YY3 T;  2XAH B;  2Q9Q C;  5HEH A;  5LXT E;  4UVC B;  4AKL A;  3ZC1 A;  3JC6 D;  4JI4 T;  1Y64 B;  2BG9 C;  4IDO A;  3CKD A;  4KHZ F;  4PJL A;  2V7K A;  1FEW A;  5HCM A;  3ZMU B;  4CN4 A;  4ZI7 E;  5KXJ A;  4AIU A;  5LG4 A;  1NEK A;  4IIJ E;  4CQI A;  4QWN B;  2DL1 A;  5JDL A;  2VVN A;  3ZCJ A;  3EAB A;  3ZMT B;  5KX5 E;  1OED A;  3GMI A;  3T8O A;  5JR9 C;  3ETV A;  2KWI B;  4KHP T;  2Q9Q B;  4DBR A;  1N33 T;  3HL6 A;  4HFH A;  1U4Q A;  3E22 E;  1KEY A;  4H9O C;  5H6Q B;  2E5V A;  2DWK A;  2OA5 A;  3N9N A;  2WMO A;  4O8S A;  5FVK A;  4B3R T;  2I6H A;  4QH1 A;  2E9X B;  2GK9 A;  4A5X A;  4HN9 A;  5HXE A;  5L3E B;  1WYC A;  2A3D A;  3JAD A;  4V1A v;  3RQU A;  3ZLI A;  4X62 T;  4AKI A;  3J9X 1;  2AXD S;  2XM2 A;  5LHH B;  2XQ5 A;  3AE4 A;  5AFU L;  1W0B A;  2UUC T;  1E2A A;  3ZJ2 A;  1WR0 A;  4K0K T;  1ZV4 X;  1KFY A;  2H7V C;  2IC6 A;  1HFA A;  1YXR A;  3JCF A;  3LDQ B;  4U33 A;  3PUZ F;  2LKG A;  3GN5 B;  4TWH A;  2B1E A;  5C3J A;  2KIN B;  5JR9 A;  4GK5 E;  2PTF A;  3IBP A;  2WY2 A;  2C0S A;  5FMN A;  1W9R A;  2MTQ A;  2YU1 A;  3LJC A;  5AQO B;  4ZI2 D;  4DR2 T;  5HEJ A;  4IGU A;  1NWM X;  5HCJ A;  4U2Z A;  4CZZ B;  3M65 A;  2KND A;  1N36 T;  4IT4 A;  3DJB A;  5LCY A;  3AE5 A;  3UTK A;  1IJ5 A;  5ABH A;  3NZQ A;  1NEN A;  2IW5 B;  2HHH T;  5L4E A;  4LF6 T;  3I1A A;  1H7C A;  1OED E;  2VB6 A;  3QB5 A;  3ONX A;  4TV9 E;  3OVU A;  3NRY A;  2WWU A;  1ZEE A;  4JUY A;  5LMU T;  2E5L T;  1BR1 A;  3FXD B;  2N2N A;  4UXN B;  4LF8 T;  3FBL A;  3NBX X;  2KXP B;  3C4W A;  4JI5 T;  4IRE A;  3EHZ A;  4M1P A;  5FXZ A;  3RIF A;  2WM9 A;  4CN6 A;  3JAE A;  3RHW A;  2J4G A;  2BG9 B;  3ESL A;  3SOL A;  2XQ7 A;  4N78 D;  3E08 A;  2UXC T;  4PJJ A;  5HEG A;  5IYZ E;  5EZY E;  4JEU B;  3EDV A;  3FBZ A;  1QUU A;  3ZYK A;  1WFD A;  3O1I A;  5AQU B;  3ZSS A;  4JV5 T;  3RC8 A;  3MAC A;  5LGN B;  1HX8 A;  2LT3 A;  2WZI A;  4U72 A;  5FY1 A;  2V7M A;  3NWI A;  4EIW A;  5ABF A;  4GK0 E;  5HWY A;  2HH7 A;  4IE4 A;  5JDQ A;  4JI2 T;  5L2L A;  1QLB A;  3BK9 A;  2HPL A;  3UT5 E;  2C5I T;  2IC9 A;  4DV4 T;  3UQ4 A;  1SUM B;  3PUG A;  2ODV A;  3ETU A;  3N9M A;  4UV8 B;  3EAM A;  5CA0 E;  4QXC B;  1YD8 G;  2BVL A;  2Y8D A;  4DUZ T;  4YSY A;  2CRB A;  4LF9 T;  2D0U A;  2KMF A;  3HKC E;  2ES0 A;  2DI4 A;  4HFB A;  1G73 A;  4JBW F;  1W09 A;  2AE9 A;  2JPF A;  1HTJ F;  1S35 A;  5LJN A;  2M6B A;  4P0A A;  5LJM A;  3JAF A;  5LA6 E;  4ZS2 A;  4E7Z A;  4YJ2 E;  4ZEY A;  4P0B A;  5DQV A;  1NAF A;  2I0M A;  4PFP A;  4LFC T;  2UXD T;  4OX9 T;  2XM1 A;  4HFE A;  4AKG A;  3PUR A;  3F31 A;  4QXH B;  1I6Z A;  1D1A A;  2SPC A;  2VKJ A;  5J1G A;  3O9X A;  3C4X A;  3P8C D;  1VCT A;  4YXD A;  5C2T A;  4G2A A;  2V26 A;  4LMJ A;  4MHC A;  5FNV E;  3ZYL A;  1WYB A;  3OBV E;  2HPJ A;  4TWD A;  3RIA A;  2V5C A;  3NKZ A;  1D0Z A;  3L3P A;  4XAX B;  4FI5 A;  2BS4 A;  4HFD A;  3NZP A;  5J2U E;  3CX7 B;  3N2G E;  2LSK A;  2XTL A;  4OHF A;  1XNQ T;  1XWM A;  2FJD A;  2LHR A;  3C51 A;  2VQE T;  4DR6 T;  4LMK A;  3OYZ A;  4OK0 A;  3O4X E;  1X9B A;  3ZCI A;  3PJA J;  4TN7 B;  5H6R B;  1XMQ T;  2FBW A;  3AE8 A;  1X79 A;  1MMN A;  3AAE B;  4IDP A;  3TLS A;  2JQK A;  3O1J A;  4HWD A;  2X66 A;  5L3D B;  4YT0 A;  1N32 T;  3HKB E;  3U3I A;  4WBN E;  2H88 A;  3PUQ A;  3ZN0 B;  1ZHC A;  4QX7 B;  2WZH A;  4LFA T;  4PJN A;  2IIU A;  3TLT A;  2FJB A;  3FZF B;  2BS2 A;  3NVO A;  3Q2M A;  2Y6X A;  2YU2 A;  4K0U A;  5TAO A;  2L8K A;  1UUS A;  4YLH A;  3L8R A;  3RYC E;  5A1L A;  5JRC B;  3CX8 B;  1IBL T;  4U3C A;  4ASK A;  3AE1 A;  3UFE A;  2XQA A;  2LOP A;  3E0Z A;  5JR9 B;  5FL0 A;  2XZE A;  2YK0 A;  3ONL C;  3UFG A;  2K9A A;  4AQG A;  2CXL A;  2XQ3 A;  3AA7 B;  3P7I A;  1HCI A;  5JDN A;  3CQC B;  3B5M A;  3UUB A;  2WQY A;  1V9D A;  2V7L A;  2VL8 A;  4WZX A;  2UXN B;  3HA4 A;  4DV5 T;  5FY0 A;  1KNZ A;  2YEV C;  3KDS E;  3Q5E A;  4ZI3 C;  5LB7 B;  3ZT5 A;  3R6N A;  3KV4 A;  3L09 A;  4AQY T;  3LG7 A;  4JI7 T;  1T8B A;  3RQW A;  5BMV E;  1M62 A;  2BVM A;  2CE7 A;  4H9Q C;  5JDF A;  4A98 A;  3AVS A;  1LVF A;  2CMR A;  3ZEF B;  3CX6 B;  3EUH A;  3N5L A;  4O4H E;  4FJO A;  4L0R A;  2G0U A;  3FZL B;  4X66 T;  4ILC A;  3RYI E;  2XQ8 A;  5AQP B;  1IZN B;  2JIW A;  1S94 A;  3I9Y A;  2JJ9 A;  1KF6 A;  2W67 A;  2W66 A;  3UUN A;  5L3G B;  2L9Q A;  2WMN A;  4YTP A;  2VKD A;  4MBQ A;  3X1D A;  3P4W A;  1XDP A;  3BQI A;  4GKJ T;  5ABG A;  5HXH A;  3KFW X;  3PUS A;  3LBX A;  5LNK A;  1D0X A;  3I9W A;  3PDY A;  4I4T E;  4EYU A;  5AQQ B;  4ZZB A;  4HKA A;  1J1J A;  1HF8 A;  2E2A A;  3CWZ B;  5JQG E;  5HEU A;  4IL9 A;  2DNX A;  3HKE E;  2BG9 A;  2X9Y A;  3CVR A;  4ILU A;  4KI0 F;  4KMC A;  5DAB A;  3FZK B;  2VQF T;  4YSX A;  5LMN T;  3RLF F;  3OTO T;  2J1D G;  2LEH A;  3RKO A;  3MJX A;  3VRA A;  4CXX A;  4JI8 T;  3RYF E;  3UUL A;  4ADZ A;  2QGS A;  3PUA A;  5BR8 T;  2NW8 A;  3Q5X A;  5JDG A;  2L3L A;  2E8I A;  2V7I A;  2X0H A;  2YKS A;  3L39 A;  3MXZ A;  4NPP A;  2X0L B;  2XSA A;  4TX5 A;  3UU4 A;  1OWA A;  1SE7 A;  1E1H B;  1EZ3 A;  2IAK A;  2J47 A;  2ZMA A;  3QB5 K;  2CBI A;  2BZB A;  4U2Y A;  1OXZ A;  3BQL A;  4A97 A;  1UK5 A;  4DO0 A;  4COF A;  3AEE A;  2V6Y B;  1L0V A;  2XQ6 A;  2E9X A; 
#chains in the Genus database with same CATH homology
 4DUZ T;  1HNW T;  4LF9 T;  4NXN T;  4JI3 T;  4X64 T;  4LF7 T;  1N34 T;  1HNX T;  4JI0 T;  4DV6 T;  2UXD T;  4OX9 T;  2VQF T;  2VQE T;  4B3T T;  4DV1 T;  4LF5 T;  4LFB T;  4YY3 T;  4YHH T;  4JI4 T;  1IBM T;  1XNQ T;  4DR6 T;  4DR7 T;  5IWA T;  4NXM T;  4KHP T;  1N32 T;  1IBK T;  1N33 T;  1HNZ T;  4LFA T;  4B3R T;  1XMQ T;  4JYA T;  4X62 T;  1FJG T;  4DR4 T;  2UUC T;  4DV7 T;  4LF4 T;  4B3S T;  4K0K T;  3T1H T;  3T1Y T;  2UUA T;  2F4V T;  4DV0 T;  4AQY T;  4DR2 T;  4JI7 T;  4LFC T;  1N36 T;  4DR1 T;  2UXB T;  4DUY T;  1XMO T;  2UU9 T;  1I94 T;  2HHH T;  4LF6 T;  4GKK T;  4X66 T;  5LMU T;  2E5L T;  4X65 T;  4LF8 T;  1IBL T;  4DV2 T;  4JI5 T;  2UUB T;  4DV3 T;  4GKJ T;  1XNR T;  2UXC T;  4DR3 T;  4JV5 T;  2ZM6 T;  5LMN T;  3OTO T;  4DR5 T;  1J5E T;  4JI8 T;  5BR8 T;  4JI6 T;  4B3M T;  4JI2 T;  1HR0 T;  4JI1 T;  4DV5 T;  4DV4 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...