4ZI2C

Bart-like domain of bartl1/ccdc104 in complex with arl3fl bound to gppnhp in p21 21 21
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
131
structure length
131
Chain Sequence
AAEEEDEVEWVVESIAGFLRGPDWSIPILDFVEQKCEVFDDEEESKLTYTEIHQEYKELVEKLLESYLKEIGINEDQFQEACTSPLAKTRTSQAILQPVLAAEDFTIFKAMMVQKNIEMQLQAIRIIQERN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ADP-ribosylation factor-like protein 3
publication title The Interaction of CCDC104/BARTL1 with Arl3 and Implications for Ciliary Function.
pubmed doi rcsb
source organism Mus musculus
total genus 56
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2015-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11527 ARL2_Bind_BART The ARF-like 2 binding protein BART
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1900 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4zi2C00
4ZI2D 2K9AA 4ZI2C 4ZI3D 4ZI3C
chains in the Genus database with same CATH superfamily
2BZBA 1WFDA 4LFBT 3CIRA 2EHOD 3PUSA 4HFDA 3P50A 5FY0A 3CX6B 4KHZF 2WSSV 2WMOA 3V5SA 4MLKA 5LHHB 3M3ZB 4TWDA 1FJGT 4U31A 1D0XA 4YSZA 4IDOA 1MMDA 4LF5T 5IHYA 3LFMA 4L5GA 2YOEA 1IZNB 3C51A 2CEAA 4WW0A 3U78A 3RGLA 4MBQA 5DABA 2A3DA 1S35A 4GK5E 5JRCA 4H9NC 2HH7A 1N33T 2XASB 1HF8A 3AE5A 2XQ6A 3QB5K 2X9HA 2W2UA 4ANJA 3K3NA 2FJDA 2WCAA 3JADA 2V5DA 1V9DA 4YTNA 5AQOB 1XDOA 4O4IE 2L8KA 5AQIB 2NW8A 1FMVA 4YSXA 4H9PC 1B7TA 4LFAT 3PDYA 1XNRT 2YINA 4G63A 3C4WA 4H9SE 2J1DG 4HN9A 4JV5T 4IL9A 3N9QA 1YQ3A 2XUEA 5CGMA 4JI5T 5ETWA 2CWYA 2LSYA 2VK9A 4O8SA 1CHUA 4PJNA 3Q9DA 4BJNA 4DO0A 4OK0A 4EYUA 5JRCB 5FXWA 3UQ4A 3RKGA 3KFWX 2H3RA 2V5CA 2KXPB 3I9WA 1WR0A 2V7JA 2WWVA 1BR4A 4TX5A 4TNVA 3UUNA 5HEOA 5FXVA 5AQGB 3AE2A 3RRWA 4IE7A 4AIUA 2RPAA 4UELA 4K0KT 2VASA 4HTEA 1WCRA 3K3QC 3T8OA 2JMKA 3PV0F 1HS7A 4H9OC 1YQ4A 3UU4A 2VKDA 2LRKA 1O3XA 5CB4E 3C98B 1LVFA 3CX8B 4DUZT 2LSIA 2VVNA 2LHNA 4AQFA 3C64A 4QHOA 3C4ZA 4ZS3A 3MJXA 4IDNA 3T1HT 4MFRA 3FZLB 3L3PA 3OTOT 5JR9C 3WAKA 2MAWA 3SRZA 2BVLA 2LSJA 1OEDA 4YTMA 2UXBT 2CWOA 4AKLA 2CA5A 2LHRA 1BR1A 2VWAA 5BR8T 1S94A 4O4JE 2QGSA 2ZMAA 2CMRA 1ZHCA 2V1DB 2D2SA 1HFAA 3TKLB 4XBFB 4ZI2D 3N9PA 1JNRA 1DU2A 3P4SA 2H7OA 5L47A 1IBKT 4YHHT 2E8IA 2HN1A 3AEEA 1LVKA 3O1IA 3ZPOA 3ZC0A 5IWAT 4X1IE 2UUCT 3ZMZB 3VR8A 2WZIA 4C91A 2JIWA 2VKHA 3ZCIA 3I0QA 2CRBA 3UT5E 5FNVE 4ZI7E 4H63V 3O9XA 4BA9A 3KBTA 1IAPA 3BK9A 5LJNA 2VQFT 2LOSA 4EZHA 5C8YE 2I0MA 5LYJE 4YSYA 2XHEB 3TLWA 3CMLA 3W15B 4AI6A 2JQHA 2XQ9A 2X9WA 5H6RB 5HXCA 2KMFA 3LK3B 2PJQA 2Q9QC 3E22E 2XQ7A 5HEJA 1E7PA 2WU5A 2XAFB 4Q25A 5FL0A 5AQRB 5LBQB 3HKDE 1U5PA 3X1DA 1XNQT 2W0GA 3VRAA 3AEBA 3ZYMA 2VQET 3NBXX 2Y6XA 3AB3B 2FUPA 4J2CA 2DWKA 1T72A 2ZLYA 4AKGA 1HNWT 3Q5EA 3AVSA 3ZYKA 3D0TA 3RHWA 2RA1A 2BKOA 2X0HA 2JRKA 4LF7T 2C5KT 5JTGA 5J2TE 2NOXA 4U72A 4UR9A 4NUUA 2IW5B 5C2TA 1W9RA 4CXYA 2M6IA 4DV2T 5L3FB 2YKSA 5J1GA 4ISTA 3NZPA 1OEDE 4IIJE 1D1AA 1KEYA 2K3WA 3DJBA 4P0AA 3C50A 3AE8A 3ONJA 4ZZCA 2W00A 4G2AA 3RYCE 4X5TA 2X9XA 1SUMB 1BR2A 2N2NA 5AQPB 3G06A 4P0BA 4DV5T 2X51A 5HEUA 4GKJT 3EDVA 3Q2MA 2IDOB 3ANWA 4EV6A 4X62T 3RYHE 4QH1A 4GOUA 4HFCA 3LG7A 3TLTA 4PK6A 4A98A 3FZHB 2WB5A 2K48A 3N2KE 3A5XA 4TWFA 2I59A 3I0OA 2DCFA 5AQNB 2E9XA 4GYRA 4ZS2A 5HEHA 3PUQA 1XWMA 4ISSA 4O2AE 4Z91A 4DBQA 4UXNB 5L3CB 3CX7B 4E7ZA 2CE7A 1SA0E 3AA7B 2IC6A 4HGAA 5HAXA 2MYSA 3PUYF 5AQKB 2BG9E 3H3MA 1VCSA 3EVYA 3GWHA 3B13A 3H37A 2XJ7A 2BBHA 4DMWA 2X0LB 1N32T 5FVKA 3ANWB 3CQGB 1HG5A 4HEAA 5AQTB 5GONE 2XQ8A 1VOMA 2EHOC 2HN2A 5JVDE 5CFBA 1N34T 3PUZF 1D1BA 2YU1A 4TNWA 3L09A 2K9AA 2NW9A 1WRDA 2X67A 3KDSE 2HPJA 2AE9A 2CHNA 2E9XB 3PU3A 2VKJA 2KT9A 2FJAA 2WQYA 1H7CA 3EAMA 4LF6T 4ZZBA 3V5UA 1R8IA 2AXDS 1QUUA 4ILBA 3ONXA 4KMCA 4IDQA 2JQKA 4JI0T 3VKGA 1UX4A 4ZOLE 4YLHA 1KNRA 2E9XD 2BVMA 2LRLA 4H9QC 2X9YA 4PNIA 1OXZA 3PUAA 4O2BE 3PE0A 4HWHA 4QX8B 3OJAA 4CN4A 2UXDT 3SFDA 5LMNT 3LSVA 4ZEYA 3QB5A 2UXXB 4ZI3D 2V7LA 3WI3A 3F57A 4COFA 2VURA 2KWHA 2WBLA 1VCTA 3JCFA 5LMUT 1KNZA 4YJ2E 3J9X1 4YFSA 2H7VC 2NTXA 5TAOA 2WM9A 4CN6A 3AE6A 2V7IA 4DVDA 2W66A 3CQXC 3PUGA 2BS2A 2W67A 3ZSSA 3O1HA 3M65A 4L0RA 4HFVA 2FJBA 3O4XE 5JREA 5LGUB 1UK5A 2XY8B 1MMGA 1ZKEA 4JBWF 4P1NA 2YK0A 3L39A 3LDQB 4GK0E 4LF4T 4U2ZA 3VRBA 3AE9A 4GIWA 1UX5A 4BJMA 2G0UA 1W0BA 1KFYA 2ZM0A 4HWFA 4PJLA 2WP9A 5E0OA 3RQWA 1KK7A 5ADXL 4AISA 3MACA 4X1YE 5HCMA 3TLSA 1LRZA 4WBNE 3Q5WA 2N9DA 5L3EB 3P8CD 3ONLC 1YKHB 2YEVC 3AAIA 1NEKA 4OHFA 5FY7A 2NWBA 4IGUA 3FZFB 3ZT7A 3JC6D 3MK7C 1HNXT 3KV4A 3Q5XA 4DR7T 3UUBA 4UEMA 4UVBB 3P4WA 3SFEA 3AEDA 3SOLA 3B57A 4I50E 4UVAB 3ZJ1A 4CI3B 4DV6T 2IC9A 4JI1T 4HFEA 4A56A 3UTKA 4U2YA 3R6NA 2Y48B 3Q5DA 2LOPA 2GK9A 4NXMT 2H89A 2IMLA 4ZI2C 4N78D 5AQMB 4BAYB 2V7MA 1XDPA 3EHZA 2K5BB 2NP9A 5JDGA 3DP7A 3PU8A 4PJMA 1KNPA 1HX1B 4HWIB 4JEHB 4IE6A 5FMNA 5LNKA 5BMVE 2XM2A 3N9LA 3AAEB 2LJLA 2BKNA 1I6ZA 2OV9A 2QVAA 3FHNA 3K3OA 5KX5E 2HPLA 2Q9QA 3P4QA 4IDPA 4NPPA 3ZMUB 4H63H 5AQQB 3T1YT 2LT3A 1ZOYA 4LF8T 1NAFA 1MNDA 2DLRA 5KMGP 2C5IT 4GYSA 4JI8T 1J1JA 1NWMX 2PBIA 3GN5A 2VL8A 5DQWA 3A7MA 3QOFA 1G73A 1SE7A 3AE1A 3LK2B 1OEDC 2M6BA 4PAGA 2BKPA 3FBLA 4CXWA 5HWXA 2MBGA 4ERRA 1T98A 1J5WA 3TLUA 4EZ4A 3EUHA 2LEHA 4JLEA 5HEGA 3UULA 2V7KA 1GQEA 2NW7A 1JNZA 5CA0E 1D1CA 2WU2A 5LGNB 2XAGB 4EB6E 3P4RA 5L4EA 3PUWF 2Q9QB 3VR9A 2CXFA 4TZ4C 3ZSTA 5L4HA 4EOZB 1UURA 4YTPA 2W61A 3GN5B 1IBLT 5IYZE 2LSGA 4X64T 2UUBT 1ZP0A 2CLYC 1L0VA 3EI0A 3OVUA 3RIUC 1ZV4X 4DR6T 2Q9QD 4GKKT 2XQYA 4IE0A 4UV9B 2V6XA 3MZKB 4YHJA 3I9YA 3KVAA 2BG9C 1MIYA 3LJCA 3AE3A 3RIAA 2E5LT 5AQFB 2D9DA 3AXJA 5AQSB 4B3RT 3K8PC 2LM9A 3ZMVB 4DR4T 3UFGA 4AXPA 5HYAA 4O4HE 2CHOA 4HE8A 2ES0A 4HWDA 5EK3A 2V8SV 3PURA 4FJOA 2W62A 3RKOA 2W4XA 2XTLA 3QC9A 3IA3A 5LG4A 4IDZA 1MIVA 1MIWA 1OWAA 4H9RC 5J0ZA 4ILUA 4QWNB 3ZCJA 5ABFA 4ILCA 3UUXB 3H3AA 2VVSA 2ZM2A 2JQ9A 2N1GA 2WDQA 3F31A 3HKEE 5FYMA 4QXHB 1IJ6A 3AXJB 4YXDA 5LXTE 2EHOA 3KINB 3OYZA 4HWCA 3MA9A 2OLTA 2V6YA 4DBRA 3ZC1A 1YW0A 2WAUA 2CCQA 3PJAJ 1Z8UA 2DHRA 5J2UE 4UIGA 2KNDA 3RYIE 2ODUA 4OFZA 4CZZB 3PTRB 5FXXA 4KHPT 2XAQB 1M7KA 3N5LA 1HNZT 5ABFB 2YU2A 1MMNA 3ZLIA 4K0UA 4TUYE 5M4YA 3CVRA 2QRXA 1D0ZA 2IIUA 4Z90A 5C3JA 4DR3T 2CBJA 3UU6A 3HR0A 2BS3A 3N9NA 3LBXA 1KF6A 1YXRA 1Z0PA 3NWIA 2EHOB 4EEDA 3ESLA 1FIOA 4DIDB 2V26A 4L9IA 3UUMA 5CA1E 3EDUA 4TV9E 2XM1A 3BQLA 4V1Av 3QK6A 3AE7A 4TN7B 2V6YB 4U74A 4PK5A 4EGWA 3ZN0B 4KI0F 4JYAT 2ODVA 2PG8A 4AQYT 1Y64B 2WMNA 2NTYA 4C90A 2E9XC 4EYYR 3UU3A 2PTFA 3MXZA 2KSRA 3RC3A 2H88A 4KBMB 3HKBE 1T8BA 2LSKA 5AQUB 4IT4A 2HHHT 3ZN1B 3N2OA 4ZI3C 2UUAT 4LMLA 2IHR1 3FBZA 1FMWA 3HKCE 2WWUA 4AKIA 4O4LE 3LBXB 2A2FX 5FVLA 3N9OA 3HI2A 5LP6E 4TV8E 4UVCB 5AFUL 4X66T 4JI3T 3FZMB 1WR6A 3KBUA 1HCIA 3SS1A 4B3ST 1ZEEA 3CKDA 2SPCA 2LKHA 2W63A 5L2LA 5L3BB 4CI1B 2UXNB 5L3DB 3ZMSB 1FEWA 5HXHA 4DV3T 3DTOA 3FZKB 1MMAA 2P9BA 3K1SA 4HKAA 3FB2A 2QYWA 1YKEB 3AVRA 4LF9T 3AAAB 3S4UA 2YDQA 1J5ET 3OKQA 3ABVA 2KWIB 3GMIA 4A5XA 5FXZA 4U7IA 1XMOT 4IHJE 5JQGE 2B1EA 3U3IA 3NKZA 4U3CA 1US7B 4JI2T 4KP3C 3B5MA 4M1PA 4MHCA 5JR9A 5LG3A 2L9QA 2LKGA 2X68A 4YY3T 4IREA 3OYXA 4IE4A 3RRCA 2D0UA 3JC6C 3ZMTB 2CXDA 2E2AA 5ABGA 1UGOA 3A8YC 4U7YA 2M67A 2WDVA 5HXRA 4DR5T 2QA7A 4ZXLA 1HTJF 3KVBA 4DV0T 3E0ZA 3WAJA 2K24A 2CM0A 3RI5A 4JI6T 5LJMA 2FBWA 5FL1A 2XAHB 2VB6A 3SWHA 3UU5A 4AQGA 4DUYT 3AE4A 2VL0A 5JR9B 3IEEA 2BDEA 4DV4T 3IF8B 3QNUA 3O1JA 2LE8A 3VU7H 4CQIA 3PUVF 2ZM6T 4QH5A 2E5VA 1BR0A 4X20E 2KINB 4ZHQE 4DMVA 4WZXA 2J47A 4OX9T 3AA6B 4PJJA 5ABHA 1Y01A 2D5UA 2CXLA 5KXJA 1NENA 2WZHA 3UU8A 4HFIA 3UFEA 4E7SA 4YJ3E 2J62A 1EZ3A 1T7SA 4JEUB 2BS4A 3J7Yq 1WLXA 4U33A 3MKDA 4HFHA 2IUBA 2LM2A 3RYFE 3BQIA 5JDMA 2A9UA 3F2EA 4ASKA 2D0TA 5DQVA 4AQFC 4B3TT 2A72A 2C5JA 1X9BA 3FXEB 5F3JA 3GA8A 2ACXA 4XAXB 1U4QA 3OPCA 3CWZB 2JPFA 2FJEA 3AEGA 4IE5A 3N2GE 3CQCB 5JDQA 2OA5A 3L8RA 3CPZA 3ZT6A 4WNKA 4B3MT 3ETUA 4PFOA 3JAEA 4ILAA 4OYKA 1D0YA 5IUXA 4JI4T 3C4XA 5LCYA 5JDHA 4CXXA 3P4PA 3ZYLA 1OEDB 2VKOA 2X0YA 3RIUA 3NRYA 4QKNA 2KZ7B 3AA1B 1W09A 2DNXA 3VKHA 4Z8XA 4DNDA 2BG9A 3TLVA 5JH7E 2KLQA 4QX7B 4FI5A 3RH3A 5FP3A 5F5WA 4JUYA 4KUMB 2L3LA 1XZYA 2XQ3A 5A1LA 3RLFF 3AA0B 3AEAA 3KV6A 2YN6A 4NUVA 1HR0T 4F8HA 1IBMT 4I4TE 2NR4A 3ZKRA 1UCUA 4AKRB 4I43B 4EAHA 1WYBA 2DI4A 4EEBA 4ADZA 4PK4A 4UF0A 4CN1A 5AQVB 5FY1A 2CLYB 4WBOA 1QLBA 2YDSA 4LMKA 5LHGB 1E2AA 4NXNT 5HXEA 5HCJA 2UXCT 2J4GA 5KDMC 4MALA 5LB7B 2JMHA 3R84B 2ACZA 4QXBB 2UU9T 2BG9B 3CK6A 2ZM8A 3N9MA 4PW8A 3RIFA 3KV5A 1QSDA 3RC8A 5HWYA 4P09A 3PUXF 5JDFA 4CI2B 3AEFA 4I0UA 1E1HB 5LA6E 1IJ5A 3HL6A 2YDRA 5EK4A 4X1KE 2C0SA 4UV8B 3JAFA 3KV9A 3BQKA 3RQUA 3FXDB 1X79A 5HXSA 3AECA 3EABA 3RF1A 1HG2A 2PFVA 2X66A 2Y8DA 4EXTA 2LLYA 3UQ7A 4UF0B 2RP4A 5FKYA 2XQ5A 1MNEA 5EZYE 5LGTB 2MOZA 2WY2A 1SHZC 5AQLB 4B6XA 4DV7T 2I6HA 4OYJA 2JJ9A 3IHRA 5JDNA 1M62A 2DWGA 3ZT5A 2JQQA 1HX8A 4DV1T 4WYVA 5LBMA 1UUSA 5AQJB 5DJQC 3QUJA 4PFPA 4A97A 2R6GF 2IAKA 4IL4A 2CBIA 3P7IA 4LFCT 1WYCA 2CPTA 3OBVE 4YT0A 2XSBA 4QXCB 2MTQA 1VRBA 3RX6A 5JDLA 3LK42 1YD8G 2MPKA 2XPKA 3HA4A 4DR1T 3I1AA 2F4VT 3NRXA 2XSAA 1AJ3A 3RPUA 2XQAA 4HFBA 4AKHA 3PJAA 5EK2A 1CUNA 3NVOA 5L3GB 5LHIB 3ZJ2A 4XZCA 3E08A 2XQ4A 1I94T 3VHLA 1G8XA 1LKXA 5H6QB 4F6RC 4DR2T 5AQHB 2BBJA 1N36T 2XZEA 4I55E 4LMJA 4X65T 1XMQT 2DL1A 2B76A 2WDRA 5CJ5A 3NZQA 4TWHA 3IBPA 2WS3A 5LOVE 3ETVA 4JI7T 2Z6EA 5ABEA 4KX6A 1W0AA 4QH4A 4NIQA 5F8PA 2XAJB 4EIWA 3ZEFB
chains in the Genus database with same CATH topology
1NAFA 1MNDA 5L3FB 2BZBA 3OYXA 4IE4A 2DLRA 5KMGP 2C5IT 4GYSA 3RRCA 2D0UA 2EHOD 5J1GA 1NWMX 2PBIA 3GN5A 3PUSA 3JC6C 3NZPA 2VL8A 4ISTA 4IIJE 5DQWA 5FY0A 3CX6B 1D1AA 2WSSV 3DJBA 4P0AA 2WMOA 3ZMTB 2CXDA 3C50A 3V5SA 4MLKA 1G73A 5LHHB 3LK2B 2W00A 4G2AA 3RYCE 4PAGA 2X9XA 3FBLA 4CXWA 2M67A 5HWXA 1BR2A 5HXRA 2MBGA 2N2NA 4ERRA 2QA7A 1T98A 1HTJF 3KVBA 1D0XA 4EZ4A 4P0BA 2X51A 3EUHA 1MMDA 2LEHA 4JLEA 3EDVA 3UULA 3E0ZA 3Q2MA 3WAJA 2K24A 3ANWA 2V7KA 5IHYA 3RYHE 2NW7A 3LFMA 2CM0A 4GOUA 5CA0E 4L5GA 5LJMA 1IZNB 1D1CA 5LGNB 2XAGB 2XAHB 3C51A 4EB6E 2VB6A 3SWHA 2CEAA 3LG7A 4AQGA 2Q9QB 4WW0A 4PK6A 2CXFA 3U78A 4MBQA 4TZ4C 5DABA 2A3DA 5JR9B 3IEEA 1S35A 2K48A 3N2KE 4GK5E 2BDEA 5JRCA 4H9NC 2HH7A 3A5XA 2XASB 3IF8B 2I59A 3I0OA 1HF8A 3O1JA 2LE8A 3VU7H 4CQIA 2DCFA 4EOZB 2E9XA 4GYRA 2X9HA 4ZS2A 1BR0A 4X20E 2KINB 4ZHQE 4ANJA 3K3NA 2W61A 4DMVA 3GN5B 3PUQA 5IYZE 4ISSA 2LSGA 3AA6B 4PJJA 1V9DA 4O2AE 2D5UA 4O4IE 2CLYC 2L8KA 4DBQA 2CXLA 4UXNB 5L3CB 1ZV4X 3CX7B 4E7ZA 2CE7A 1SA0E 2Q9QD 3AA7B 3UFEA 2NW8A 1FMVA 2IC6A 2XQYA 4HGAA 5HAXA 4E7SA 4IE0A 2MYSA 4YJ3E 4H9PC 4UV9B 1EZ3A 1B7TA 3EVYA 3PDYA 3MZKB 3GWHA 4JEUB 4YHJA 3J7Yq 3B13A 2YINA 3H37A 3I9YA 3KVAA 4G63A 4DMWA 3C4WA 1MIYA 3LJCA 2X0LB 2J1DG 4H9SE 3ANWB 1WLXA 4HN9A 3CQGB 3MKDA 1HG5A 3RYFE 3BQIA 3N9QA 4HEAA 3F2EA 2XUEA 5JDMA 4ASKA 5GONE 5ETWA 2CWYA 2LSYA 2D0TA 1VOMA 2VK9A 5DQVA 4AQFC 2EHOC 2A72A 3K8PC 4O8SA 5JVDE 2C5JA 2LM9A 3FXEB 4PJNA 3ZMVB 3GA8A 5F3JA 3Q9DA 2ACXA 4XAXB 1U4QA 1D1BA 4BJNA 4DO0A 2YU1A 3CWZB 4OK0A 4EYUA 2JPFA 4AXPA 5HYAA 3L09A 2K9AA 4O4HE 5JRCB 5FXWA 4HE8A 2NW9A 4IE5A 1WRDA 3N2GE 2ES0A 3CQCB 2X67A 3KDSE 3KFWX 5JDQA 2OA5A 2H3RA 2HPJA 2KXPB 3I9WA 2E9XB 2V7JA 3CPZA 4WNKA 3PU3A 5EK3A 3ETUA 4PFOA 3PURA 1BR4A 2VKJA 4FJOA 2W62A 4TX5A 2KT9A 4OYKA 1D0YA 3C4XA 3UUNA 3RKOA 2XTLA 5FXVA 3QC9A 5LCYA 5JDHA 3RRWA 1H7CA 4IDZA 4CXXA 4IE7A 5LG4A 4UELA 3ZYLA 2VKOA 1MIVA 3NRYA 1MIWA 2VASA 4HTEA 4QKNA 1OWAA 2KZ7B 4H9RC 3AA1B 3V5UA 3K3QC 3T8OA 2DNXA 4ILUA 2JMKA 4QWNB 3ZCJA 1QUUA 3ONXA 1HS7A 4H9OC 4KMCA 3VKHA 3UUXB 4Z8XA 3H3AA 4DNDA 2ZM2A 3VKGA 1UX4A 4ZOLE 5JH7E 2KLQA 4YLHA 2VKDA 1O3XA 2E9XD 4QX7B 2N1GA 2BVMA 4FI5A 3F31A 2X9YA 3C98B 4H9QC 4PNIA 5CB4E 3RH3A 5FP3A 1OXZA 3PUAA 3HKEE 1LVFA 4JUYA 3CX8B 3PE0A 4KUMB 4O2BE 5FYMA 4QXHB 2L3LA 1IJ6A 2LSIA 5A1LA 2LHNA 4QX8B 3OJAA 4AQFA 2EHOA 3AA0B 5LXTE 3KV6A 4NUVA 3C64A 3KINB 2UXXB 3OYZA 4ZI3D 4QHOA 3C4ZA 2V7LA 4ZS3A 3MJXA 3F57A 3MA9A 3WI3A 4I4TE 2KWHA 2WBLA 4MFRA 4DBRA 3ZC1A 1YW0A 1KNZA 3L3PA 2WAUA 5JR9C 3WAKA 1UCUA 4AKRB 4I43B 4EAHA 1WYBA 2DI4A 4YJ2E 3J9X1 2CCQA 4YFSA 2DHRA 3SRZA 2H7VC 2BVLA 2NTXA 4ADZA 4PK4A 2LSJA 5TAOA 4UF0A 5J2UE 2WM9A 4UIGA 5FY1A 2CWOA 2CLYB 2KNDA 2V7IA 4WBOA 3CQXC 3PUGA 3RYIE 4DVDA 2ODUA 4OFZA 4CZZB 3PTRB 5FXXA 4AKLA 5LHGB 2CA5A 2LHRA 5HXEA 1BR1A 2VWAA 3O1HA 2XAQB 5KDMC 1S94A 3M65A 4L0RA 4MALA 3N5LA 2JMHA 2YU2A 4HFVA 4O4JE 3R84B 1MMNA 4QXBB 2QGSA 3ZLIA 2ZMAA 4K0UA 4TUYE 2CMRA 5M4YA 3CVRA 3O4XE 1ZHCA 2V1DB 5JREA 1D0ZA 2D2SA 1HFAA 5LGUB 3TKLB 2ZM8A 3N9MA 1MMGA 4PW8A 1ZKEA 4XBFB 3HR0A 4ZI2D 3N9NA 3N9PA 3LBXA 2YK0A 3KV5A 1QSDA 4GK0E 1Z0PA 2H7OA 3RC8A 5HWYA 4P09A 2EHOB 4GIWA 1UX5A 4BJMA 5JDFA 2G0UA 3ESLA 2ZM0A 4CI2B 1FIOA 2V26A 2E8IA 4L9IA 1E1HB 3UUMA 5LA6E 5CA1E 3EDUA 1IJ5A 3BQLA 4PJLA 4TV9E 1LVKA 3O1IA 5E0OA 3HL6A 4V1Av 3QK6A 4TN7B 3ZPOA 3ZC0A 4U74A 5EK4A 4X1KE 2C0SA 4UV8B 3KV9A 4PK5A 3BQKA 1KK7A 4X1IE 3ZN0B 5ADXL 3FXDB 3ZMZB 1X79A 3MACA 5HXSA 4X1YE 1HG2A 2ODVA 2PG8A 4C91A 2PFVA 2VKHA 2X66A 2Y8DA 3ZCIA 4EXTA 1Y64B 1LRZA 2WMNA 4WBNE 3Q5WA 2NTYA 4UF0B 3I0QA 4C90A 2E9XC 2RP4A 3UT5E 5FNVE 4EYYR 4ZI7E 1MNEA 2N9DA 5L3EB 3MXZA 4H63V 5EZYE 3RC3A 3O9XA 3P8CD 5LGTB 2MOZA 3KBTA 4BA9A 1YKHB 4KBMB 2YEVC 1SHZC 1IAPA 4B6XA 3HKBE 3BK9A 5LJNA 4OYJA 3AAIA 2JJ9A 3IHRA 2LSKA 5JDNA 4OHFA 2LOSA 2DWGA 5FY7A 2JQQA 3ZN1B 3N2OA 4ZI3C 2NWBA 1HX8A 4IGUA 4EZHA 5C8YE 5LYJE 5LBMA 2XHEB 3FBZA 3JC6D 3MK7C 1FMWA 5DJQC 3QUJA 3HKCE 3CMLA 2WWUA 4PFPA 4AKIA 3KV4A 3W15B 4O4LE 2IAKA 3Q5XA 3LBXB 4AI6A 2A2FX 3P7IA 1WYCA 4UEMA 3OBVE 4UVBB 3N9OA 3HI2A 3SOLA 5LP6E 4TV8E 4UVCB 2X9WA 5H6RB 5AFUL 3B57A 5HXCA 4QXCB 2MTQA 1VRBA 3RX6A 2KMFA 3LK3B 1WR6A 2PJQA 1YD8G 3KBUA 3LK42 5JDLA 2Q9QC 1HCIA 3E22E 3SS1A 4I50E 4UVAB 3ZJ1A 3HA4A 4CI3B 2XAFB 3I1AA 3NRXA 1ZEEA 2IC9A 1AJ3A 3RPUA 4AKHA 4A56A 3UTKA 3CKDA 2SPCA 5EK2A 1CUNA 2W63A 5LBQB 3HKDE 5L2LA 1U5PA 5L3GB 3R6NA 2Y48B 5L3BB 4CI1B 5LHIB 2LOPA 2UXNB 3ZJ2A 5L3DB 4XZCA 3E08A 2GK9A 2W0GA 3ZMSB 1FEWA 4ZI2C 3VHLA 4N78D 5HXHA 1G8XA 1LKXA 3DTOA 3ZYMA 4BAYB 2V7MA 3NBXX 5H6QB 4F6RC 2Y6XA 2K5BB 1MMAA 3AB3B 4J2CA 2P9BA 2DWKA 4HKAA 3FB2A 2ZLYA 1YKEB 2NP9A 4AKGA 3AVRA 5JDGA 3AAAB 4I55E 3DP7A 3S4UA 3PU8A 4PJMA 3AVSA 3OKQA 3ZYKA 3D0TA 2KWIB 3GMIA 4JEHB 4IE6A 5FXZA 5FMNA 5LNKA 2RA1A 5BMVE 4IHJE 3N9LA 5JQGE 2B1EA 3AAEB 3NZQA 2LJLA 3U3IA 2JRKA 3IBPA 5LOVE 2C5KT 5J2TE 2NOXA 3FHNA 3K3OA 5KX5E 1US7B 2HPLA 4U72A 2Q9QA 4KP3C 3ETVA 4M1PA 4MHCA 4NUUA 4H63H 3ZMUB 2Z6EA 5JR9A 2IW5B 2LT3A 4CXYA 5F8PA 2L9QA 2XAJB 2X68A 4EIWA 3ZEFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZI2 D;  2K9A A;  4ZI2 C;  4ZI3 D;  4ZI3 C; 
#chains in the Genus database with same CATH topology
 2BZB A;  1WFD A;  4LFB T;  3CIR A;  2EHO D;  3PUS A;  4HFD A;  3P50 A;  5FY0 A;  3CX6 B;  4KHZ F;  2WSS V;  2WMO A;  3V5S A;  4MLK A;  5LHH B;  3M3Z B;  4TWD A;  1FJG T;  4U31 A;  1D0X A;  4YSZ A;  4IDO A;  1MMD A;  4LF5 T;  5IHY A;  3LFM A;  4L5G A;  2YOE A;  1IZN B;  3C51 A;  2CEA A;  4WW0 A;  3U78 A;  3RGL A;  4MBQ A;  5DAB A;  2A3D A;  1S35 A;  4GK5 E;  5JRC A;  4H9N C;  2HH7 A;  1N33 T;  2XAS B;  1HF8 A;  3AE5 A;  2XQ6 A;  3QB5 K;  2X9H A;  2W2U A;  4ANJ A;  3K3N A;  2FJD A;  2WCA A;  3JAD A;  2V5D A;  1V9D A;  4YTN A;  5AQO B;  1XDO A;  4O4I E;  2L8K A;  5AQI B;  2NW8 A;  1FMV A;  4YSX A;  4H9P C;  1B7T A;  4LFA T;  3PDY A;  1XNR T;  2YIN A;  4G63 A;  3C4W A;  4H9S E;  2J1D G;  4HN9 A;  4JV5 T;  4IL9 A;  3N9Q A;  1YQ3 A;  2XUE A;  5CGM A;  4JI5 T;  5ETW A;  2CWY A;  2LSY A;  2VK9 A;  4O8S A;  1CHU A;  4PJN A;  3Q9D A;  4BJN A;  4DO0 A;  4OK0 A;  4EYU A;  5JRC B;  5FXW A;  3UQ4 A;  3RKG A;  3KFW X;  2H3R A;  2V5C A;  2KXP B;  3I9W A;  1WR0 A;  2V7J A;  2WWV A;  1BR4 A;  4TX5 A;  4TNV A;  3UUN A;  5HEO A;  5FXV A;  5AQG B;  3AE2 A;  3RRW A;  4IE7 A;  4AIU A;  2RPA A;  4UEL A;  4K0K T;  2VAS A;  4HTE A;  1WCR A;  3K3Q C;  3T8O A;  2JMK A;  3PV0 F;  1HS7 A;  4H9O C;  1YQ4 A;  3UU4 A;  2VKD A;  2LRK A;  1O3X A;  5CB4 E;  3C98 B;  1LVF A;  3CX8 B;  4DUZ T;  2LSI A;  2VVN A;  2LHN A;  4AQF A;  3C64 A;  4QHO A;  3C4Z A;  4ZS3 A;  3MJX A;  4IDN A;  3T1H T;  4MFR A;  3FZL B;  3L3P A;  3OTO T;  5JR9 C;  3WAK A;  2MAW A;  3SRZ A;  2BVL A;  2LSJ A;  1OED A;  4YTM A;  2UXB T;  2CWO A;  4AKL A;  2CA5 A;  2LHR A;  1BR1 A;  2VWA A;  5BR8 T;  1S94 A;  4O4J E;  2QGS A;  2ZMA A;  2CMR A;  1ZHC A;  2V1D B;  2D2S A;  1HFA A;  3TKL B;  4XBF B;  4ZI2 D;  3N9P A;  1JNR A;  1DU2 A;  3P4S A;  2H7O A;  5L47 A;  1IBK T;  4YHH T;  2E8I A;  2HN1 A;  3AEE A;  1LVK A;  3O1I A;  3ZPO A;  3ZC0 A;  5IWA T;  4X1I E;  2UUC T;  3ZMZ B;  3VR8 A;  2WZI A;  4C91 A;  2JIW A;  2VKH A;  3ZCI A;  3I0Q A;  2CRB A;  3UT5 E;  5FNV E;  4ZI7 E;  4H63 V;  3O9X A;  4BA9 A;  3KBT A;  1IAP A;  3BK9 A;  5LJN A;  2VQF T;  2LOS A;  4EZH A;  5C8Y E;  2I0M A;  5LYJ E;  4YSY A;  2XHE B;  3TLW A;  3CML A;  3W15 B;  4AI6 A;  2JQH A;  2XQ9 A;  2X9W A;  5H6R B;  5HXC A;  2KMF A;  3LK3 B;  2PJQ A;  2Q9Q C;  3E22 E;  2XQ7 A;  5HEJ A;  1E7P A;  2WU5 A;  2XAF B;  4Q25 A;  5FL0 A;  5AQR B;  5LBQ B;  3HKD E;  1U5P A;  3X1D A;  1XNQ T;  2W0G A;  3VRA A;  3AEB A;  3ZYM A;  2VQE T;  3NBX X;  2Y6X A;  3AB3 B;  2FUP A;  4J2C A;  2DWK A;  1T72 A;  2ZLY A;  4AKG A;  1HNW T;  3Q5E A;  3AVS A;  3ZYK A;  3D0T A;  3RHW A;  2RA1 A;  2BKO A;  2X0H A;  2JRK A;  4LF7 T;  2C5K T;  5JTG A;  5J2T E;  2NOX A;  4U72 A;  4UR9 A;  4NUU A;  2IW5 B;  5C2T A;  1W9R A;  4CXY A;  2M6I A;  4DV2 T;  5L3F B;  2YKS A;  5J1G A;  4IST A;  3NZP A;  1OED E;  4IIJ E;  1D1A A;  1KEY A;  2K3W A;  3DJB A;  4P0A A;  3C50 A;  3AE8 A;  3ONJ A;  4ZZC A;  2W00 A;  4G2A A;  3RYC E;  4X5T A;  2X9X A;  1SUM B;  1BR2 A;  2N2N A;  5AQP B;  3G06 A;  4P0B A;  4DV5 T;  2X51 A;  5HEU A;  4GKJ T;  3EDV A;  3Q2M A;  2IDO B;  3ANW A;  4EV6 A;  4X62 T;  3RYH E;  4QH1 A;  4GOU A;  4HFC A;  3LG7 A;  3TLT A;  4PK6 A;  4A98 A;  3FZH B;  2WB5 A;  2K48 A;  3N2K E;  3A5X A;  4TWF A;  2I59 A;  3I0O A;  2DCF A;  5AQN B;  2E9X A;  4GYR A;  4ZS2 A;  5HEH A;  3PUQ A;  1XWM A;  4ISS A;  4O2A E;  4Z91 A;  4DBQ A;  4UXN B;  5L3C B;  3CX7 B;  4E7Z A;  2CE7 A;  1SA0 E;  3AA7 B;  2IC6 A;  4HGA A;  5HAX A;  2MYS A;  3PUY F;  5AQK B;  2BG9 E;  3H3M A;  1VCS A;  3EVY A;  3GWH A;  3B13 A;  3H37 A;  2XJ7 A;  2BBH A;  4DMW A;  2X0L B;  1N32 T;  5FVK A;  3ANW B;  3CQG B;  1HG5 A;  4HEA A;  5AQT B;  5GON E;  2XQ8 A;  1VOM A;  2EHO C;  2HN2 A;  5JVD E;  5CFB A;  1N34 T;  3PUZ F;  1D1B A;  2YU1 A;  4TNW A;  3L09 A;  2K9A A;  2NW9 A;  1WRD A;  2X67 A;  3KDS E;  2HPJ A;  2AE9 A;  2CHN A;  2E9X B;  3PU3 A;  2VKJ A;  2KT9 A;  2FJA A;  2WQY A;  1H7C A;  3EAM A;  4LF6 T;  4ZZB A;  3V5U A;  1R8I A;  2AXD S;  1QUU A;  4ILB A;  3ONX A;  4KMC A;  4IDQ A;  2JQK A;  4JI0 T;  3VKG A;  1UX4 A;  4ZOL E;  4YLH A;  1KNR A;  2E9X D;  2BVM A;  2LRL A;  4H9Q C;  2X9Y A;  4PNI A;  1OXZ A;  3PUA A;  4O2B E;  3PE0 A;  4HWH A;  4QX8 B;  3OJA A;  4CN4 A;  2UXD T;  3SFD A;  5LMN T;  3LSV A;  4ZEY A;  3QB5 A;  2UXX B;  4ZI3 D;  2V7L A;  3WI3 A;  3F57 A;  4COF A;  2VUR A;  2KWH A;  2WBL A;  1VCT A;  3JCF A;  5LMU T;  1KNZ A;  4YJ2 E;  3J9X 1;  4YFS A;  2H7V C;  2NTX A;  5TAO A;  2WM9 A;  4CN6 A;  3AE6 A;  2V7I A;  4DVD A;  2W66 A;  3CQX C;  3PUG A;  2BS2 A;  2W67 A;  3ZSS A;  3O1H A;  3M65 A;  4L0R A;  4HFV A;  2FJB A;  3O4X E;  5JRE A;  5LGU B;  1UK5 A;  2XY8 B;  1MMG A;  1ZKE A;  4JBW F;  4P1N A;  2YK0 A;  3L39 A;  3LDQ B;  4GK0 E;  4LF4 T;  4U2Z A;  3VRB A;  3AE9 A;  4GIW A;  1UX5 A;  4BJM A;  2G0U A;  1W0B A;  1KFY A;  2ZM0 A;  4HWF A;  4PJL A;  2WP9 A;  5E0O A;  3RQW A;  1KK7 A;  5ADX L;  4AIS A;  3MAC A;  4X1Y E;  5HCM A;  3TLS A;  1LRZ A;  4WBN E;  3Q5W A;  2N9D A;  5L3E B;  3P8C D;  3ONL C;  1YKH B;  2YEV C;  3AAI A;  1NEK A;  4OHF A;  5FY7 A;  2NWB A;  4IGU A;  3FZF B;  3ZT7 A;  3JC6 D;  3MK7 C;  1HNX T;  3KV4 A;  3Q5X A;  4DR7 T;  3UUB A;  4UEM A;  4UVB B;  3P4W A;  3SFE A;  3AED A;  3SOL A;  3B57 A;  4I50 E;  4UVA B;  3ZJ1 A;  4CI3 B;  4DV6 T;  2IC9 A;  4JI1 T;  4HFE A;  4A56 A;  3UTK A;  4U2Y A;  3R6N A;  2Y48 B;  3Q5D A;  2LOP A;  2GK9 A;  4NXM T;  2H89 A;  2IML A;  4ZI2 C;  4N78 D;  5AQM B;  4BAY B;  2V7M A;  1XDP A;  3EHZ A;  2K5B B;  2NP9 A;  5JDG A;  3DP7 A;  3PU8 A;  4PJM A;  1KNP A;  1HX1 B;  4HWI B;  4JEH B;  4IE6 A;  5FMN A;  5LNK A;  5BMV E;  2XM2 A;  3N9L A;  3AAE B;  2LJL A;  2BKN A;  1I6Z A;  2OV9 A;  2QVA A;  3FHN A;  3K3O A;  5KX5 E;  2HPL A;  2Q9Q A;  3P4Q A;  4IDP A;  4NPP A;  3ZMU B;  4H63 H;  5AQQ B;  3T1Y T;  2LT3 A;  1ZOY A;  4LF8 T;  1NAF A;  1MND A;  2DLR A;  5KMG P;  2C5I T;  4GYS A;  4JI8 T;  1J1J A;  1NWM X;  2PBI A;  3GN5 A;  2VL8 A;  5DQW A;  3A7M A;  3QOF A;  1G73 A;  1SE7 A;  3AE1 A;  3LK2 B;  1OED C;  2M6B A;  4PAG A;  2BKP A;  3FBL A;  4CXW A;  5HWX A;  2MBG A;  4ERR A;  1T98 A;  1J5W A;  3TLU A;  4EZ4 A;  3EUH A;  2LEH A;  4JLE A;  5HEG A;  3UUL A;  2V7K A;  1GQE A;  2NW7 A;  1JNZ A;  5CA0 E;  1D1C A;  2WU2 A;  5LGN B;  2XAG B;  4EB6 E;  3P4R A;  5L4E A;  3PUW F;  2Q9Q B;  3VR9 A;  2CXF A;  4TZ4 C;  3ZST A;  5L4H A;  4EOZ B;  1UUR A;  4YTP A;  2W61 A;  3GN5 B;  1IBL T;  5IYZ E;  2LSG A;  4X64 T;  2UUB T;  1ZP0 A;  2CLY C;  1L0V A;  3EI0 A;  3OVU A;  3RIU C;  1ZV4 X;  4DR6 T;  2Q9Q D;  4GKK T;  2XQY A;  4IE0 A;  4UV9 B;  2V6X A;  3MZK B;  4YHJ A;  3I9Y A;  3KVA A;  2BG9 C;  1MIY A;  3LJC A;  3AE3 A;  3RIA A;  2E5L T;  5AQF B;  2D9D A;  3AXJ A;  5AQS B;  4B3R T;  3K8P C;  2LM9 A;  3ZMV B;  4DR4 T;  3UFG A;  4AXP A;  5HYA A;  4O4H E;  2CHO A;  4HE8 A;  2ES0 A;  4HWD A;  5EK3 A;  2V8S V;  3PUR A;  4FJO A;  2W62 A;  3RKO A;  2W4X A;  2XTL A;  3QC9 A;  3IA3 A;  5LG4 A;  4IDZ A;  1MIV A;  1MIW A;  1OWA A;  4H9R C;  5J0Z A;  4ILU A;  4QWN B;  3ZCJ A;  5ABF A;  4ILC A;  3UUX B;  3H3A A;  2VVS A;  2ZM2 A;  2JQ9 A;  2N1G A;  2WDQ A;  3F31 A;  3HKE E;  5FYM A;  4QXH B;  1IJ6 A;  3AXJ B;  4YXD A;  5LXT E;  2EHO A;  3KIN B;  3OYZ A;  4HWC A;  3MA9 A;  2OLT A;  2V6Y A;  4DBR A;  3ZC1 A;  1YW0 A;  2WAU A;  2CCQ A;  3PJA J;  1Z8U A;  2DHR A;  5J2U E;  4UIG A;  2KND A;  3RYI E;  2ODU A;  4OFZ A;  4CZZ B;  3PTR B;  5FXX A;  4KHP T;  2XAQ B;  1M7K A;  3N5L A;  1HNZ T;  5ABF B;  2YU2 A;  1MMN A;  3ZLI A;  4K0U A;  4TUY E;  5M4Y A;  3CVR A;  2QRX A;  1D0Z A;  2IIU A;  4Z90 A;  5C3J A;  4DR3 T;  2CBJ A;  3UU6 A;  3HR0 A;  2BS3 A;  3N9N A;  3LBX A;  1KF6 A;  1YXR A;  1Z0P A;  3NWI A;  2EHO B;  4EED A;  3ESL A;  1FIO A;  4DID B;  2V26 A;  4L9I A;  3UUM A;  5CA1 E;  3EDU A;  4TV9 E;  2XM1 A;  3BQL A;  4V1A v;  3QK6 A;  3AE7 A;  4TN7 B;  2V6Y B;  4U74 A;  4PK5 A;  4EGW A;  3ZN0 B;  4KI0 F;  4JYA T;  2ODV A;  2PG8 A;  4AQY T;  1Y64 B;  2WMN A;  2NTY A;  4C90 A;  2E9X C;  4EYY R;  3UU3 A;  2PTF A;  3MXZ A;  2KSR A;  3RC3 A;  2H88 A;  4KBM B;  3HKB E;  1T8B A;  2LSK A;  5AQU B;  4IT4 A;  2HHH T;  3ZN1 B;  3N2O A;  4ZI3 C;  2UUA T;  4LML A;  2IHR 1;  3FBZ A;  1FMW A;  3HKC E;  2WWU A;  4AKI A;  4O4L E;  3LBX B;  2A2F X;  5FVL A;  3N9O A;  3HI2 A;  5LP6 E;  4TV8 E;  4UVC B;  5AFU L;  4X66 T;  4JI3 T;  3FZM B;  1WR6 A;  3KBU A;  1HCI A;  3SS1 A;  4B3S T;  1ZEE A;  3CKD A;  2SPC A;  2LKH A;  2W63 A;  5L2L A;  5L3B B;  4CI1 B;  2UXN B;  5L3D B;  3ZMS B;  1FEW A;  5HXH A;  4DV3 T;  3DTO A;  3FZK B;  1MMA A;  2P9B A;  3K1S A;  4HKA A;  3FB2 A;  2QYW A;  1YKE B;  3AVR A;  4LF9 T;  3AAA B;  3S4U A;  2YDQ A;  1J5E T;  3OKQ A;  3ABV A;  2KWI B;  3GMI A;  4A5X A;  5FXZ A;  4U7I A;  1XMO T;  4IHJ E;  5JQG E;  2B1E A;  3U3I A;  3NKZ A;  4U3C A;  1US7 B;  4JI2 T;  4KP3 C;  3B5M A;  4M1P A;  4MHC A;  5JR9 A;  5LG3 A;  2L9Q A;  2LKG A;  2X68 A;  4YY3 T;  4IRE A;  3OYX A;  4IE4 A;  3RRC A;  2D0U A;  3JC6 C;  3ZMT B;  2CXD A;  2E2A A;  5ABG A;  1UGO A;  3A8Y C;  4U7Y A;  2M67 A;  2WDV A;  5HXR A;  4DR5 T;  2QA7 A;  4ZXL A;  1HTJ F;  3KVB A;  4DV0 T;  3E0Z A;  3WAJ A;  2K24 A;  2CM0 A;  3RI5 A;  4JI6 T;  5LJM A;  2FBW A;  5FL1 A;  2XAH B;  2VB6 A;  3SWH A;  3UU5 A;  4AQG A;  4DUY T;  3AE4 A;  2VL0 A;  5JR9 B;  3IEE A;  2BDE A;  4DV4 T;  3IF8 B;  3QNU A;  3O1J A;  2LE8 A;  3VU7 H;  4CQI A;  3PUV F;  2ZM6 T;  4QH5 A;  2E5V A;  1BR0 A;  4X20 E;  2KIN B;  4ZHQ E;  4DMV A;  4WZX A;  2J47 A;  4OX9 T;  3AA6 B;  4PJJ A;  5ABH A;  1Y01 A;  2D5U A;  2CXL A;  5KXJ A;  1NEN A;  2WZH A;  3UU8 A;  4HFI A;  3UFE A;  4E7S A;  4YJ3 E;  2J62 A;  1EZ3 A;  1T7S A;  4JEU B;  2BS4 A;  3J7Y q;  1WLX A;  4U33 A;  3MKD A;  4HFH A;  2IUB A;  2LM2 A;  3RYF E;  3BQI A;  5JDM A;  2A9U A;  3F2E A;  4ASK A;  2D0T A;  5DQV A;  4AQF C;  4B3T T;  2A72 A;  2C5J A;  1X9B A;  3FXE B;  5F3J A;  3GA8 A;  2ACX A;  4XAX B;  1U4Q A;  3OPC A;  3CWZ B;  2JPF A;  2FJE A;  3AEG A;  4IE5 A;  3N2G E;  3CQC B;  5JDQ A;  2OA5 A;  3L8R A;  3CPZ A;  3ZT6 A;  4WNK A;  4B3M T;  3ETU A;  4PFO A;  3JAE A;  4ILA A;  4OYK A;  1D0Y A;  5IUX A;  4JI4 T;  3C4X A;  5LCY A;  5JDH A;  4CXX A;  3P4P A;  3ZYL A;  1OED B;  2VKO A;  2X0Y A;  3RIU A;  3NRY A;  4QKN A;  2KZ7 B;  3AA1 B;  1W09 A;  2DNX A;  3VKH A;  4Z8X A;  4DND A;  2BG9 A;  3TLV A;  5JH7 E;  2KLQ A;  4QX7 B;  4FI5 A;  3RH3 A;  5FP3 A;  5F5W A;  4JUY A;  4KUM B;  2L3L A;  1XZY A;  2XQ3 A;  5A1L A;  3RLF F;  3AA0 B;  3AEA A;  3KV6 A;  2YN6 A;  4NUV A;  1HR0 T;  4F8H A;  1IBM T;  4I4T E;  2NR4 A;  3ZKR A;  1UCU A;  4AKR B;  4I43 B;  4EAH A;  1WYB A;  2DI4 A;  4EEB A;  4ADZ A;  4PK4 A;  4UF0 A;  4CN1 A;  5AQV B;  5FY1 A;  2CLY B;  4WBO A;  1QLB A;  2YDS A;  4LMK A;  5LHG B;  1E2A A;  4NXN T;  5HXE A;  5HCJ A;  2UXC T;  2J4G A;  5KDM C;  4MAL A;  5LB7 B;  2JMH A;  3R84 B;  2ACZ A;  4QXB B;  2UU9 T;  2BG9 B;  3CK6 A;  2ZM8 A;  3N9M A;  4PW8 A;  3RIF A;  3KV5 A;  1QSD A;  3RC8 A;  5HWY A;  4P09 A;  3PUX F;  5JDF A;  4CI2 B;  3AEF A;  4I0U A;  1E1H B;  5LA6 E;  1IJ5 A;  3HL6 A;  2YDR A;  5EK4 A;  4X1K E;  2C0S A;  4UV8 B;  3JAF A;  3KV9 A;  3BQK A;  3RQU A;  3FXD B;  1X79 A;  5HXS A;  3AEC A;  3EAB A;  3RF1 A;  1HG2 A;  2PFV A;  2X66 A;  2Y8D A;  4EXT A;  2LLY A;  3UQ7 A;  4UF0 B;  2RP4 A;  5FKY A;  2XQ5 A;  1MNE A;  5EZY E;  5LGT B;  2MOZ A;  2WY2 A;  1SHZ C;  5AQL B;  4B6X A;  4DV7 T;  2I6H A;  4OYJ A;  2JJ9 A;  3IHR A;  5JDN A;  1M62 A;  2DWG A;  3ZT5 A;  2JQQ A;  1HX8 A;  4DV1 T;  4WYV A;  5LBM A;  1UUS A;  5AQJ B;  5DJQ C;  3QUJ A;  4PFP A;  4A97 A;  2R6G F;  2IAK A;  4IL4 A;  2CBI A;  3P7I A;  4LFC T;  1WYC A;  2CPT A;  3OBV E;  4YT0 A;  2XSB A;  4QXC B;  2MTQ A;  1VRB A;  3RX6 A;  5JDL A;  3LK4 2;  1YD8 G;  2MPK A;  2XPK A;  3HA4 A;  4DR1 T;  3I1A A;  2F4V T;  3NRX A;  2XSA A;  1AJ3 A;  3RPU A;  2XQA A;  4HFB A;  4AKH A;  3PJA A;  5EK2 A;  1CUN A;  3NVO A;  5L3G B;  5LHI B;  3ZJ2 A;  4XZC A;  3E08 A;  2XQ4 A;  1I94 T;  3VHL A;  1G8X A;  1LKX A;  5H6Q B;  4F6R C;  4DR2 T;  5AQH B;  2BBJ A;  1N36 T;  2XZE A;  4I55 E;  4LMJ A;  4X65 T;  1XMQ T;  2DL1 A;  2B76 A;  2WDR A;  5CJ5 A;  3NZQ A;  4TWH A;  3IBP A;  2WS3 A;  5LOV E;  3ETV A;  4JI7 T;  2Z6E A;  5ABE A;  4KX6 A;  1W0A A;  4QH4 A;  4NIQ A;  5F8P A;  2XAJ B;  4EIW A;  3ZEF B; 
#chains in the Genus database with same CATH homology
 1NAF A;  1MND A;  5L3F B;  2BZB A;  3OYX A;  4IE4 A;  2DLR A;  5KMG P;  2C5I T;  4GYS A;  3RRC A;  2D0U A;  2EHO D;  5J1G A;  1NWM X;  2PBI A;  3GN5 A;  3PUS A;  3JC6 C;  3NZP A;  2VL8 A;  4IST A;  4IIJ E;  5DQW A;  5FY0 A;  3CX6 B;  1D1A A;  2WSS V;  3DJB A;  4P0A A;  2WMO A;  3ZMT B;  2CXD A;  3C50 A;  3V5S A;  4MLK A;  1G73 A;  5LHH B;  3LK2 B;  2W00 A;  4G2A A;  3RYC E;  4PAG A;  2X9X A;  3FBL A;  4CXW A;  2M67 A;  5HWX A;  1BR2 A;  5HXR A;  2MBG A;  2N2N A;  4ERR A;  2QA7 A;  1T98 A;  1HTJ F;  3KVB A;  1D0X A;  4EZ4 A;  4P0B A;  2X51 A;  3EUH A;  1MMD A;  2LEH A;  4JLE A;  3EDV A;  3UUL A;  3E0Z A;  3Q2M A;  3WAJ A;  2K24 A;  3ANW A;  2V7K A;  5IHY A;  3RYH E;  2NW7 A;  3LFM A;  2CM0 A;  4GOU A;  5CA0 E;  4L5G A;  5LJM A;  1IZN B;  1D1C A;  5LGN B;  2XAG B;  2XAH B;  3C51 A;  4EB6 E;  2VB6 A;  3SWH A;  2CEA A;  3LG7 A;  4AQG A;  2Q9Q B;  4WW0 A;  4PK6 A;  2CXF A;  3U78 A;  4MBQ A;  4TZ4 C;  5DAB A;  2A3D A;  5JR9 B;  3IEE A;  1S35 A;  2K48 A;  3N2K E;  4GK5 E;  2BDE A;  5JRC A;  4H9N C;  2HH7 A;  3A5X A;  2XAS B;  3IF8 B;  2I59 A;  3I0O A;  1HF8 A;  3O1J A;  2LE8 A;  3VU7 H;  4CQI A;  2DCF A;  4EOZ B;  2E9X A;  4GYR A;  2X9H A;  4ZS2 A;  1BR0 A;  4X20 E;  2KIN B;  4ZHQ E;  4ANJ A;  3K3N A;  2W61 A;  4DMV A;  3GN5 B;  3PUQ A;  5IYZ E;  4ISS A;  2LSG A;  3AA6 B;  4PJJ A;  1V9D A;  4O2A E;  2D5U A;  4O4I E;  2CLY C;  2L8K A;  4DBQ A;  2CXL A;  4UXN B;  5L3C B;  1ZV4 X;  3CX7 B;  4E7Z A;  2CE7 A;  1SA0 E;  2Q9Q D;  3AA7 B;  3UFE A;  2NW8 A;  1FMV A;  2IC6 A;  2XQY A;  4HGA A;  5HAX A;  4E7S A;  4IE0 A;  2MYS A;  4YJ3 E;  4H9P C;  4UV9 B;  1EZ3 A;  1B7T A;  3EVY A;  3PDY A;  3MZK B;  3GWH A;  4JEU B;  4YHJ A;  3J7Y q;  3B13 A;  2YIN A;  3H37 A;  3I9Y A;  3KVA A;  4G63 A;  4DMW A;  3C4W A;  1MIY A;  3LJC A;  2X0L B;  2J1D G;  4H9S E;  3ANW B;  1WLX A;  4HN9 A;  3CQG B;  3MKD A;  1HG5 A;  3RYF E;  3BQI A;  3N9Q A;  4HEA A;  3F2E A;  2XUE A;  5JDM A;  4ASK A;  5GON E;  5ETW A;  2CWY A;  2LSY A;  2D0T A;  1VOM A;  2VK9 A;  5DQV A;  4AQF C;  2EHO C;  2A72 A;  3K8P C;  4O8S A;  5JVD E;  2C5J A;  2LM9 A;  3FXE B;  4PJN A;  3ZMV B;  3GA8 A;  5F3J A;  3Q9D A;  2ACX A;  4XAX B;  1U4Q A;  1D1B A;  4BJN A;  4DO0 A;  2YU1 A;  3CWZ B;  4OK0 A;  4EYU A;  2JPF A;  4AXP A;  5HYA A;  3L09 A;  2K9A A;  4O4H E;  5JRC B;  5FXW A;  4HE8 A;  2NW9 A;  4IE5 A;  1WRD A;  3N2G E;  2ES0 A;  3CQC B;  2X67 A;  3KDS E;  3KFW X;  5JDQ A;  2OA5 A;  2H3R A;  2HPJ A;  2KXP B;  3I9W A;  2E9X B;  2V7J A;  3CPZ A;  4WNK A;  3PU3 A;  5EK3 A;  3ETU A;  4PFO A;  3PUR A;  1BR4 A;  2VKJ A;  4FJO A;  2W62 A;  4TX5 A;  2KT9 A;  4OYK A;  1D0Y A;  3C4X A;  3UUN A;  3RKO A;  2XTL A;  5FXV A;  3QC9 A;  5LCY A;  5JDH A;  3RRW A;  1H7C A;  4IDZ A;  4CXX A;  4IE7 A;  5LG4 A;  4UEL A;  3ZYL A;  2VKO A;  1MIV A;  3NRY A;  1MIW A;  2VAS A;  4HTE A;  4QKN A;  1OWA A;  2KZ7 B;  4H9R C;  3AA1 B;  3V5U A;  3K3Q C;  3T8O A;  2DNX A;  4ILU A;  2JMK A;  4QWN B;  3ZCJ A;  1QUU A;  3ONX A;  1HS7 A;  4H9O C;  4KMC A;  3VKH A;  3UUX B;  4Z8X A;  3H3A A;  4DND A;  2ZM2 A;  3VKG A;  1UX4 A;  4ZOL E;  5JH7 E;  2KLQ A;  4YLH A;  2VKD A;  1O3X A;  2E9X D;  4QX7 B;  2N1G A;  2BVM A;  4FI5 A;  3F31 A;  2X9Y A;  3C98 B;  4H9Q C;  4PNI A;  5CB4 E;  3RH3 A;  5FP3 A;  1OXZ A;  3PUA A;  3HKE E;  1LVF A;  4JUY A;  3CX8 B;  3PE0 A;  4KUM B;  4O2B E;  5FYM A;  4QXH B;  2L3L A;  1IJ6 A;  2LSI A;  5A1L A;  2LHN A;  4QX8 B;  3OJA A;  4AQF A;  2EHO A;  3AA0 B;  5LXT E;  3KV6 A;  4NUV A;  3C64 A;  3KIN B;  2UXX B;  3OYZ A;  4ZI3 D;  4QHO A;  3C4Z A;  2V7L A;  4ZS3 A;  3MJX A;  3F57 A;  3MA9 A;  3WI3 A;  4I4T E;  2KWH A;  2WBL A;  4MFR A;  4DBR A;  3ZC1 A;  1YW0 A;  1KNZ A;  3L3P A;  2WAU A;  5JR9 C;  3WAK A;  1UCU A;  4AKR B;  4I43 B;  4EAH A;  1WYB A;  2DI4 A;  4YJ2 E;  3J9X 1;  2CCQ A;  4YFS A;  2DHR A;  3SRZ A;  2H7V C;  2BVL A;  2NTX A;  4ADZ A;  4PK4 A;  2LSJ A;  5TAO A;  4UF0 A;  5J2U E;  2WM9 A;  4UIG A;  5FY1 A;  2CWO A;  2CLY B;  2KND A;  2V7I A;  4WBO A;  3CQX C;  3PUG A;  3RYI E;  4DVD A;  2ODU A;  4OFZ A;  4CZZ B;  3PTR B;  5FXX A;  4AKL A;  5LHG B;  2CA5 A;  2LHR A;  5HXE A;  1BR1 A;  2VWA A;  3O1H A;  2XAQ B;  5KDM C;  1S94 A;  3M65 A;  4L0R A;  4MAL A;  3N5L A;  2JMH A;  2YU2 A;  4HFV A;  4O4J E;  3R84 B;  1MMN A;  4QXB B;  2QGS A;  3ZLI A;  2ZMA A;  4K0U A;  4TUY E;  2CMR A;  5M4Y A;  3CVR A;  3O4X E;  1ZHC A;  2V1D B;  5JRE A;  1D0Z A;  2D2S A;  1HFA A;  5LGU B;  3TKL B;  2ZM8 A;  3N9M A;  1MMG A;  4PW8 A;  1ZKE A;  4XBF B;  3HR0 A;  4ZI2 D;  3N9N A;  3N9P A;  3LBX A;  2YK0 A;  3KV5 A;  1QSD A;  4GK0 E;  1Z0P A;  2H7O A;  3RC8 A;  5HWY A;  4P09 A;  2EHO B;  4GIW A;  1UX5 A;  4BJM A;  5JDF A;  2G0U A;  3ESL A;  2ZM0 A;  4CI2 B;  1FIO A;  2V26 A;  2E8I A;  4L9I A;  1E1H B;  3UUM A;  5LA6 E;  5CA1 E;  3EDU A;  1IJ5 A;  3BQL A;  4PJL A;  4TV9 E;  1LVK A;  3O1I A;  5E0O A;  3HL6 A;  4V1A v;  3QK6 A;  4TN7 B;  3ZPO A;  3ZC0 A;  4U74 A;  5EK4 A;  4X1K E;  2C0S A;  4UV8 B;  3KV9 A;  4PK5 A;  3BQK A;  1KK7 A;  4X1I E;  3ZN0 B;  5ADX L;  3FXD B;  3ZMZ B;  1X79 A;  3MAC A;  5HXS A;  4X1Y E;  1HG2 A;  2ODV A;  2PG8 A;  4C91 A;  2PFV A;  2VKH A;  2X66 A;  2Y8D A;  3ZCI A;  4EXT A;  1Y64 B;  1LRZ A;  2WMN A;  4WBN E;  3Q5W A;  2NTY A;  4UF0 B;  3I0Q A;  4C90 A;  2E9X C;  2RP4 A;  3UT5 E;  5FNV E;  4EYY R;  4ZI7 E;  1MNE A;  2N9D A;  5L3E B;  3MXZ A;  4H63 V;  5EZY E;  3RC3 A;  3O9X A;  3P8C D;  5LGT B;  2MOZ A;  3KBT A;  4BA9 A;  1YKH B;  4KBM B;  2YEV C;  1SHZ C;  1IAP A;  4B6X A;  3HKB E;  3BK9 A;  5LJN A;  4OYJ A;  3AAI A;  2JJ9 A;  3IHR A;  2LSK A;  5JDN A;  4OHF A;  2LOS A;  2DWG A;  5FY7 A;  2JQQ A;  3ZN1 B;  3N2O A;  4ZI3 C;  2NWB A;  1HX8 A;  4IGU A;  4EZH A;  5C8Y E;  5LYJ E;  5LBM A;  2XHE B;  3FBZ A;  3JC6 D;  3MK7 C;  1FMW A;  5DJQ C;  3QUJ A;  3HKC E;  3CML A;  2WWU A;  4PFP A;  4AKI A;  3KV4 A;  3W15 B;  4O4L E;  2IAK A;  3Q5X A;  3LBX B;  4AI6 A;  2A2F X;  3P7I A;  1WYC A;  4UEM A;  3OBV E;  4UVB B;  3N9O A;  3HI2 A;  3SOL A;  5LP6 E;  4TV8 E;  4UVC B;  2X9W A;  5H6R B;  5AFU L;  3B57 A;  5HXC A;  4QXC B;  2MTQ A;  1VRB A;  3RX6 A;  2KMF A;  3LK3 B;  1WR6 A;  2PJQ A;  1YD8 G;  3KBU A;  3LK4 2;  5JDL A;  2Q9Q C;  1HCI A;  3E22 E;  3SS1 A;  4I50 E;  4UVA B;  3ZJ1 A;  3HA4 A;  4CI3 B;  2XAF B;  3I1A A;  3NRX A;  1ZEE A;  2IC9 A;  1AJ3 A;  3RPU A;  4AKH A;  4A56 A;  3UTK A;  3CKD A;  2SPC A;  5EK2 A;  1CUN A;  2W63 A;  5LBQ B;  3HKD E;  5L2L A;  1U5P A;  5L3G B;  3R6N A;  2Y48 B;  5L3B B;  4CI1 B;  5LHI B;  2LOP A;  2UXN B;  3ZJ2 A;  5L3D B;  4XZC A;  3E08 A;  2GK9 A;  2W0G A;  3ZMS B;  1FEW A;  4ZI2 C;  3VHL A;  4N78 D;  5HXH A;  1G8X A;  1LKX A;  3DTO A;  3ZYM A;  4BAY B;  2V7M A;  3NBX X;  5H6Q B;  4F6R C;  2Y6X A;  2K5B B;  1MMA A;  3AB3 B;  4J2C A;  2P9B A;  2DWK A;  4HKA A;  3FB2 A;  2ZLY A;  1YKE B;  2NP9 A;  4AKG A;  3AVR A;  5JDG A;  3AAA B;  4I55 E;  3DP7 A;  3S4U A;  3PU8 A;  4PJM A;  3AVS A;  3OKQ A;  3ZYK A;  3D0T A;  2KWI B;  3GMI A;  4JEH B;  4IE6 A;  5FXZ A;  5FMN A;  5LNK A;  2RA1 A;  5BMV E;  4IHJ E;  3N9L A;  5JQG E;  2B1E A;  3AAE B;  3NZQ A;  2LJL A;  3U3I A;  2JRK A;  3IBP A;  5LOV E;  2C5K T;  5J2T E;  2NOX A;  3FHN A;  3K3O A;  5KX5 E;  1US7 B;  2HPL A;  4U72 A;  2Q9Q A;  4KP3 C;  3ETV A;  4M1P A;  4MHC A;  4NUU A;  4H63 H;  3ZMU B;  2Z6E A;  5JR9 A;  2IW5 B;  2LT3 A;  4CXY A;  5F8P A;  2L9Q A;  2XAJ B;  2X68 A;  4EIW A;  3ZEF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...