4ZI2C

Bart-like domain of bartl1/ccdc104 in complex with arl3fl bound to gppnhp in p21 21 21
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
131
structure length
131
Chain Sequence
AAEEEDEVEWVVESIAGFLRGPDWSIPILDFVEQKCEVFDDEEESKLTYTEIHQEYKELVEKLLESYLKEIGINEDQFQEACTSPLAKTRTSQAILQPVLAAEDFTIFKAMMVQKNIEMQLQAIRIIQERN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Interaction of CCDC104/BARTL1 with Arl3 and Implications for Ciliary Function.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords ADP-ribosylation factor-like protein 3
total genus 56
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2015-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11527 ARL2_Bind_BART The ARF-like 2 binding protein BART
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1900 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4zi2C00
2K9AA 4ZI3D 4ZI2D 4ZI2C 4ZI3C
chains in the Genus database with same CATH superfamily
1B7TA 3BQKA 5DQWA 1D1CA 4OFZA 4B3ST 2IUBA 3W15B 1D0ZA 5F3JA 3MZKB 3ZCIA 2XAJB 5H6QB 3N2OA 1NAFA 4PJJA 3ZLIA 1FJGT 3AAAB 4IE4A 5L2LA 2XAFB 4DNDA 3PUAA 3P4RA 4ZS3A 1XMOT 3ZCJA 1ZOYA 4EOZB 3ESLA 5CGMA 3WAJA 1XMQT 1YQ4A 3HKCE 4JEUB 2B1EA 1L0VA 4PJNA 4KMCA 4O4LE 4U31A 4EV6A 5JDNA 1XWMA 3P4WA 3NRXA 4P1NA 3ZC1A 3IA3A 4JI8T 3UUBA 4WW0A 2K24A 2V7MA 4LF6T 3L39A 2W2UA 4YHJA 2XZEA 3CPZA 3LK42 2Y6XA 4DR6T 4H9SE 4JI2T 4Q25A 5CA0E 3PUZF 5HWXA 4KHPT 5KX5E 3CQCB 2LLYA 4JBWF 2XSAA 4UEMA 4F6RC 2QYWA 4QXBB 4HFBA 4OHFA 5A1LA 3RPUA 3L3PA 2YDRA 2KZ7B 1CHUA 3NZPA 3PUVF 1BR1A 3SS1A 4KP3C 5HXCA 4AKRB 2VK9A 2E5LT 3V5UA 2VB6A 4O4JE 4ASKA 3KFWX 2AXDS 2A3DA 3K8PC 3UFGA 1QLBA 4WZXA 1D1AA 2DL1A 5C8YE 3Q5WA 4PW8A 1I6ZA 2CE7A 2ZM2A 1YKHB 1S94A 3ZT6A 5L3DB 3H3AA 4HKAA 4B3MT 4LFBT 1FIOA 3VRAA 4JYAT 1MMDA 3E08A 5AQHB 1D1BA 1US7B 1IAPA 2PJQA 3K3OA 3PV0F 4XZCA 4A97A 4CI3B 4DUYT 3AE5A 3ANWA 4BA9A 3B13A 1LRZA 1V9DA 2HPJA 4JI5T 1HF8A 5FVKA 5HCJA 1M62A 4IREA 4DR4T 1BR4A 3K1SA 4LFCT 3LK2B 2VURA 5AQRB 5F8PA 5HEJA 5BR8T 4YSZA 3ABVA 3C4WA 3I1AA 3U78A 4DVDA 4JI6T 4IE7A 3N5LA 4HE8A 2WCAA 2H89A 4MFRA 2UU9T 2L3LA 4JEHB 2V5CA 3AXJA 3DJBA 1HTJF 3M3ZB 2JMKA 5AQNB 5ABHA 3C98B 4HGAA 4ZZBA 5HEUA 4ILAA 5AQVB 2DNXA 4IL9A 4TWHA 5LMNT 4HWCA 4MHCA 2XQAA 1Z8UA 1ZV4X 4ZI7E 2W66A 3VR9A 2YOEA 1WR0A 3CMLA 3PUQA 4HFHA 4NUUA 4I43B 3R6NA 1KF6A 2V1DB 3RYFE 3ZN0B 3LSVA 4K0KT 3N9NA 3QNUA 1NEKA 4H9NC 2LSGA 5LJMA 2BBJA 3JAFA 3LFMA 5FVLA 5LCYA 1YKEB 4TZ4C 1XDOA 2X9HA 3ZYKA 3ZPOA 3PUYF 3VHLA 4IE6A 1SE7A 2OA5A 1W9RA 3N9QA 4WBOA 3RQUA 2XAHB 2XAQB 2JQQA 3O1IA 2D0TA 5FP3A 2FJBA 1Y64B 4DIDB 1N32T 1VCTA 2BS2A 1E2AA 4H63V 2X67A 4GIWA 2V8SV 1W0BA 4LFAT 2OLTA 2VVSA 2DHRA 2WSSV 2QA7A 2XY8B 1T98A 5DJQC 2W00A 5LOVE 4AI6A 2C5IT 2HN2A 4HWHA 3KVBA 2EHOC 2VASA 2IW5B 4NUVA 2NTXA 3AEBA 3ZSTA 2I6HA 3EUHA 3KV5A 4EIWA 5C2TA 4JI3T 1MNEA 5L4HA 1N36T 4PFOA 3CVRA 3I0OA 1IZNB 1HNWT 2UXBT 4QH4A 2BDEA 3BQLA 4CXXA 5LHGB 1CUNA 3T1YT 3RC3A 2N2NA 2LEHA 3AE3A 1MIVA 2WAUA 4GOUA 4TWFA 4Z8XA 3RIAA 3SFDA 3ZT7A 5JRCB 4ZI2D 3CKDA 4DMWA 3ZMZB 5J0ZA 2FUPA 4PJMA 1OEDA 2YU2A 2FJEA 3P4PA 5EZYE 2NWBA 2JIWA 3N2GE 5FKYA 3A8YC 2LHNA 2LSKA 1YW0A 2LHRA 3EABA 4HFIA 3CX7B 4KUMB 1YQ3A 4YTPA 5L3CB 3PUXF 3NZQA 3RYHE 1WFDA 3M65A 3Q2MA 2E9XD 3MKDA 5JR9A 1BR0A 2X9YA 4AKHA 3P7IA 2JMHA 3E0ZA 2UUBT 3UQ4A 4ISTA 3ZYMA 4LF9T 1D0YA 1ZP0A 2DWGA 2EHOA 1WYBA 2ES0A 2LSIA 4CN4A 4DO0A 3O9XA 2W4XA 1D0XA 4IDNA 1MIWA 2ACXA 2M67A 3N9LA 5ABFB 5KMGP 4DUZT 1IJ6A 2BG9B 2VL8A 2XPKA 4GKJT 5L3FB 2JJ9A 5AQIB 4G2AA 2XUEA 3L09A 5HEOA 3ZKRA 3LJCA 4A5XA 4O2BE 5JTGA 2YN6A 2H7OA 4QH5A 5L3BB 2WDRA 1UGOA 2CBJA 2QGSA 1LKXA 2VL0A 3FBLA 4LF7T 1W0AA 3AEEA 3FXEB 4NXMT 1Z0PA 4LF8T 5IYZE 2KT9A 3FBZA 4YY3T 2H88A 5HEHA 3PJAA 4DV0T 3P4SA 3AAIA 2VKOA 1FMWA 2HH7A 2V7IA 2LM9A 3AE2A 4EAHA 1QSDA 4TN7B 4EB6E 4H63H 3OVUA 5EK3A 3GN5A 2LRLA 4DV3T 2D5UA 3VKHA 2VVNA 4GK5E 4QWNB 4DV6T 2WQYA 4IE0A 3RI5A 4HFEA 5DABA 3HKDE 4NXNT 2KLQA 1G8XA 4ISSA 5BMVE 2Y8DA 3AB3B 3X1DA 4IDZA 4E7ZA 2UUCT 2D2SA 4CI2B 5ABGA 2I59A 2VKHA 2H3RA 2H7VC 4GYSA 4EYYR 2Q9QD 2V7LA 3IF8B 4UVBB 5AQFB 3RIFA 3AAEB 4L5GA 1U4QA 3PUSA 3EI0A 3AA1B 1ZKEA 2N1GA 5FY7A 4X5TA 5LA6E 1OWAA 3QUJA 3SWHA 3ZMUB 5JDLA 4JI7T 4WBNE 2CLYC 3CX6B 2X68A 3FXDB 3KINB 4LMKA 4AISA 1FMVA 5J2TE 2SPCA 4YTMA 2F4VT 3ZSSA 2WZIA 3ZEFB 2XJ7A 3C4XA 4DMVA 2CWYA 3JC6C 4I50E 4P0BA 4QX8B 4U33A 3RYCE 2YEVC 2X9WA 3UU4A 3LDQB 4IHJE 4ZI2C 3N2KE 2KMFA 3GMIA 1KNZA 3V5SA 1H7CA 2NR4A 1IJ5A 1UURA 2L9QA 4OX9T 1N33T 2IAKA 3FZFB 4KHZF 1NWMX 4QXCB 4B3TT 3A7MA 2WMOA 2YU1A 1UX4A 3N9PA 4ZXLA 2XQ5A 2XSBA 3UULA 3BQIA 3P8CD 4EZHA 2XQ7A 4YSXA 5CA1E 3QK6A 4UF0A 5IWAT 5JREA 3DP7A 3Q5DA 4BJMA 2JQHA 4TNWA 2E9XB 2RA1A 4ILBA 2LSYA 5FYMA 3FHNA 2IC6A 2UXNB 2C0SA 2WY2A 2K9AA 4ZI3C 4AKLA 1LVFA 3UFEA 3T8OA 3UUNA 3CQXC 2J4GA 1OEDE 3PUWF 4O4HE 1E7PA 1T8BA 2V26A 3N9MA 5LBQB 2UXCT 1WR6A 2FJAA 4DV1T 2D0UA 4X20E 5CJ5A 5HXRA 3TLTA 1HNXT 4TWDA 1OXZA 3RRCA 1ZEEA 4O4IE 5H6RB 3AVRA 5AQTB 3SRZA 2NW9A 1HR0T 1UK5A 3KDSE 3OBVE 5LP6E 4HWDA 3SFEA 4AQFA 1WLXA 4CQIA 1E1HB 4A56A 3B5MA 1YD8G 1IBKT 4H9QC 4IT4A 3RIUA 5HXHA 5LMUT 2HHHT 3UT5E 3UQ7A 4FJOA 5AFUL 2MAWA 4MBQA 3FZHB 2K48A 5JRCA 1OEDC 3PDYA 2BVMA 2LT3A 3Q5XA 5LGUB 2M6BA 3AEDA 4H9OC 5AQLB 3KVAA 5JR9B 3WAKA 2KINB 2K5BB 2LOPA 1R8IA 2YDQA 3N9OA 3B57A 1KNPA 5HXSA 4IIJE 4LMJA 2W0GA 3O1JA 4TV9E 4QX7B 3ANWB 4H9RC 4NPPA 2X0HA 1SHZC 5EK4A 5FXXA 3RKGA 3RQWA 4HEAA 2LKGA 2V7JA 3Q9DA 1OEDB 3QB5A 2G0UA 4TV8E 4DR3T 3MJXA 2R6GF 2BKNA 4WNKA 3AE8A 4GYRA 5LJNA 4IGUA 4ILCA 3AEFA 2UXDT 5AQMB 4H9PC 3UUMA 4QHOA 1WYCA 2J1DG 4YT0A 2BS4A 2XTLA 3FZLB 4L0RA 3TLWA 4BAYB 4ZS2A 3OJAA 3UU5A 1X9BA 2KSRA 3NVOA 3CQGB 5HXEA 4IDOA 3ZN1B 2VWAA 1U5PA 1W09A 2WMNA 3AE4A 3O4XE 1Y01A 1VCSA 4UVAB 1KNRA 3C51A 4N78D 4C90A 1AJ3A 3F31A 4F8HA 4X66T 4ZZCA 1BR2A 3FB2A 4UV9B 3GN5B 2XQ3A 5LHHB 2NOXA 3GWHA 2Q9QC 4O8SA 2DLRA 2WP9A 4QKNA 2IDOB 3PU8A 2PTFA 1N34T 5J1GA 1VRBA 3AVSA 4PK6A 2X66A 3EHZA 5AQQB 4PNIA 4ZHQE 2CWOA 2LE8A 2VKJA 3E22E 4JI0T 5JDGA 3PE0A 5L4EA 2CMRA 2XAGB 5JDMA 2QRXA 3AEGA 1HS7A 5KXJA 5HEGA 2M6IA 4ERRA 2W63A 5JH7E 2IHR1 4B3RT 5HYAA 5L3EB 3JC6D 3JAEA 1JNRA 3QB5K 2KWHA 5E0OA 5AQPB 2K3WA 2LSJA 2XM1A 3TLSA 4XBFB 3ZJ1A 4HWFA 3RIUC 3J7Yq 3UUXB 2X0YA 3CX8B 1J5WA 1KEYA 2RPAA 3NKZA 3I9WA 2JPFA 4YJ2E 4AQFC 5IHYA 2CCQA 2XASB 2XQ6A 3PURA 4AXPA 2EHOD 1G73A 1HX8A 3AEAA 2W67A 3HKBE 4QH1A 4TX5A 5JDFA 2ZM8A 2B76A 1JNZA 2MBGA 2AE9A 5AQOB 3VU7H 3ZJ2A 4BJNA 1IBLT 2E5VA 2Q9QB 2V5DA 3JADA 2Q9QA 5JVDE 4UF0B 4ZI3D 2BG9A 3T1HT 2L8KA 4UELA 3RKOA 1NENA 3AE9A 2VKDA 4OYKA 4JI4T 5DQVA 5AQGB 2X9XA 5LXTE 4HFDA 2GK9A 4CXWA 3UU6A 2D9DA 2OV9A 4DBRA 2X51A 4JLEA 3JCFA 3PU3A 2X0LB 2CPTA 2LM2A 3C64A 2HPLA 2KWIB 3ONJA 3LBXA 4ADZA 3LG7A 2E9XA 1UCUA 5LNKA 2A2FX 2A72A 1GQEA 1SA0E 4UVCB 5LBMA 3NWIA 4AQGA 3GA8A 4KI0F 1J5ET 2ODUA 3CK6A 3AA7B 3CWZB 4OYJA 5FNVE 1O3XA 4AQYT 2BKOA 4PAGA 4U74A 5LB7B 5TAOA 4DV5T 3NRYA 4UR9A 4YHHT 3RF1A 3SOLA 4U2ZA 4LF5T 3HL6A 4I55E 2A9UA 3HKEE 3IHRA 2PG8A 3IBPA 4UXNB 2WZHA 2V6XA 2ZM0A 4LF4T 4TUYE 5FL1A 1MMGA 5FXZA 4PK4A 3AE1A 2LJLA 1DU2A 2WWUA 2LOSA 4O2AE 4CI1B 4AKGA 2W62A 3A5XA 2XQ9A 3C50A 3HA4A 1T72A 4M1PA 5AQJB 4DV2T 3AE7A 4X1KE 4DV4T 2CA5A 5FY1A 5J2UE 5C3JA 3K3QC 4J2CA 2CXDA 5L47A 2MYSA 2UXXB 1XNRT 4EEDA 3RGLA 4L9IA 4AIUA 1HG2A 5FXVA 3KBTA 1SUMB 4IL4A 4G63A 5LG3A 2NP9A 5EK2A 2V6YA 2ZM6T 3MACA 2CM0A 2YK0A 3FZMB 3L8RA 3WI3A 3OTOT 2P9BA 3I9YA 3MK7C 4PJLA 2XQ4A 3H37A 4U7IA 3F57A 5GONE 4A98A 3AE6A 4C91A 3PTRB 3QOFA 4HWIB 3J9X1 3RRWA 4JI1T 2BS3A 3ZMTB 2W61A 4HTEA 4E7SA 1UX5A 3EAMA 1I94T 3RX6A 5LG4A 3AXJB 3ZT5A 3U3IA 4I0UA 5LYJE 2Y48B 1QUUA 1XZYA 2E9XC 2EHOB 1X79A 2LRKA 2WM9A 1MIYA 3KBUA 4YLHA 3RLFF 4EYUA 4DR1T 5L3GB 3RYIE 3ETUA 4UIGA 4P09A 4CN6A 4DR5T 1EZ3A 4I4TE 2WU2A 5JDHA 2E2AA 4X1YE 1HFAA 4PK5A 2XHEB 3UTKA 2YINA 5FY0A 1M7KA 2CXFA 5ADXL 3BK9A 3LK3B 5AQUB 2JRKA 5AQSB 4X64T 1IBMT 3MA9A 3DTOA 5JR9C 2QVAA 1HX1B 3R84B 3P4QA 2UUAT 3HI2A 4U7YA 1HNZT 1J1JA 3EDUA 3F2EA 3FZKB 2J62A 5HWYA 3PUGA 4YSYA 4CXYA 5HAXA 2NTYA 4DBQA 5ABEA 4DR2T 1XDPA 2V7KA 5FMNA 4MLKA 5FL0A 2JQ9A 2CLYB 3K3NA 3KV6A 4U2YA 4FI5A 1LVKA 4LMLA 5JDQA 5LGTB 4EXTA 2IC9A 2MOZA 2C5JA 4UV8B 1WCRA 3TKLB 2WB5A 4HN9A 2CHOA 4KBMB 3PJAJ 5AQKB 4YXDA 1YXRA 2BZBA 3CIRA 2ZLYA 2DI4A 2PFVA 2C5KT 2IMLA 1XNQT 1MNDA 2ZMAA 3P50A 4GK0E 4YJ3E 3KV9A 2FBWA 2JQKA 2V6YB 5M4YA 2CBIA 3ZC0A 1S35A 1ZHCA 2I0MA 3O1HA 4X62T 4HFCA 2KXPB 2CEAA 3RH3A 3ETVA 4OK0A 2Z6EA 4IDPA 2WU5A 3QC9A 3ZYLA 3OYXA 4ZOLE 1KFYA 2ACZA 4EEBA 4DV7T 4TNVA 3ONLC 3ZMSB 2CRBA 2J47A 5CFBA 1MMNA 3AA0B 4HFVA 4ILUA 4K0UA 5FXWA 1VOMA 3S4UA 3UU8A 4KX6A 3VRBA 5F5WA 4ANJA 4ZEYA 4WYVA 2WDVA 2YKSA 4U72A 2RP4A 2DCFA 3EDVA 3Q5EA 2WS3A 1WRDA 3OKQA 4COFA 4EZ4A 1FEWA 4XAXB 4X1IE 1HG5A 4Z90A 5IUXA 4V1Av 2VQFT 2LKHA 3VR8A 3NBXX 5ABFA 2XQYA 3OPCA 3LBXB 3VKGA 4IDQA 3C4ZA 2MPKA 5CB4E 3HR0A 4QXHB 4X65T 2XM2A 3RC8A 4B6XA 2BG9C 4NIQA 4DR7T 3D0TA 4JV5T 1MMAA 2E8IA 2XQ8A 3EVYA 3G06A 2VQET 1KK7A 2BKPA 3RHWA 1T7SA 2NW7A 2WBLA 2BVLA 3AA6B 4IE5A 5ETWA 3IEEA 3OYZA 5HCMA 3ZMVB 3TLVA 2DWKA 5LHIB 2WDQA 3H3MA 4EGWA 2BBHA 4YFSA 4MALA 3KV4A 2WWVA 3MXZA 4CN1A 3AECA 4U3CA 3UU3A 4YTNA 2N9DA 3ONXA 4AKIA 4JUYA 2MTQA 4CZZB 1UUSA 3TLUA 5LGNB 2YDSA 2HN1A 5JQGE 5KDMC 2IIUA 2KNDA 2CHNA 1HCIA 4PFPA 2FJDA 4Z91A 4P0AA 2NW8A 2BG9E 2ODVA 3I0QA 2PBIA 2CXLA 4GKKT
chains in the Genus database with same CATH topology
1B7TA 3BQKA 5DQWA 1D1CA 4OFZA 3W15B 1D0ZA 5F3JA 3MZKB 3ZCIA 2XAJB 5H6QB 3N2OA 1NAFA 4PJJA 3ZLIA 3AAAB 4IE4A 5L2LA 2XAFB 4DNDA 3PUAA 4ZS3A 3ZCJA 4EOZB 3ESLA 3WAJA 3HKCE 4JEUB 2B1EA 4PJNA 4KMCA 4O4LE 5JDNA 3NRXA 3ZC1A 4WW0A 2K24A 2V7MA 4YHJA 3LK42 3CPZA 2Y6XA 4H9SE 5CA0E 5HWXA 5KX5E 3CQCB 4UEMA 4F6RC 4QXBB 4OHFA 5A1LA 3RPUA 3L3PA 3NZPA 2KZ7B 4AKRB 1BR1A 3SS1A 4KP3C 5HXCA 2VK9A 3V5UA 2VB6A 4O4JE 4ASKA 3KFWX 2A3DA 3K8PC 1D1AA 5C8YE 3Q5WA 4PW8A 2CE7A 2ZM2A 1YKHB 1S94A 5L3DB 3H3AA 4HKAA 1FIOA 1MMDA 3E08A 1D1BA 1US7B 1IAPA 2PJQA 3K3OA 4XZCA 4CI3B 3ANWA 4BA9A 3B13A 1LRZA 1V9DA 2HPJA 1HF8A 1BR4A 3LK2B 5F8PA 3I1AA 3C4WA 3U78A 4DVDA 4IE7A 3N5LA 4HE8A 4MFRA 2L3LA 4JEHB 3DJBA 1HTJF 2JMKA 3C98B 4HGAA 2DNXA 4MHCA 1ZV4X 4ZI7E 3R6NA 3VU7H 3CMLA 3PUQA 4NUUA 4I43B 3RYFE 5LHGB 2V1DB 3ZN0B 3N9NA 4H9NC 2LSGA 5LJMA 5LCYA 3LFMA 1YKEB 4TZ4C 3ZPOA 2X9HA 3ZYKA 3VHLA 4IE6A 2OA5A 3N9QA 4WBOA 2XAHB 2XAQB 2JQQA 3O1IA 2D0TA 5FP3A 1Y64B 4H63V 2X67A 4GIWA 2DHRA 2WSSV 2QA7A 1T98A 5DJQC 2W00A 5LOVE 4AI6A 2C5IT 3KVBA 2EHOC 2VASA 2IW5B 4NUVA 2NTXA 3EUHA 3KV5A 4EIWA 1MNEA 4PFOA 3CVRA 3I0OA 1IZNB 2BDEA 3BQLA 4CXXA 1CUNA 3RC3A 2N2NA 2LEHA 4Z8XA 1MIVA 2WAUA 4GOUA 5LNKA 5JRCB 4ZI2D 3CKDA 4DMWA 3ZMZB 4PJMA 2YU2A 5EZYE 2NWBA 3N2GE 2LHNA 2LSKA 1YW0A 2LHRA 3CX7B 4KUMB 5L3CB 3NZQA 3RYHE 3M65A 3Q2MA 2E9XD 3MKDA 5JR9A 1BR0A 2X9YA 4AKHA 3P7IA 2JMHA 3E0ZA 4ISTA 3ZYMA 1D0YA 2DWGA 2ES0A 2EHOA 1WYBA 2LSIA 4DO0A 3O9XA 1D0XA 1MIWA 2ACXA 2M67A 3N9LA 5KMGP 1IJ6A 2VL8A 5L3FB 2JJ9A 4G2AA 2XUEA 3L09A 3LJCA 4O2BE 2H7OA 5L3BB 2QGSA 1LKXA 3FBLA 3FXEB 1Z0PA 5IYZE 2KT9A 3FBZA 3AAIA 2VKOA 1FMWA 2HH7A 2V7IA 2LM9A 4EAHA 1QSDA 4TN7B 4EB6E 4H63H 5EK3A 3GN5A 2D5UA 3VKHA 4GK5E 4QWNB 4IE0A 5DABA 3HKDE 2KLQA 1G8XA 4ISSA 5BMVE 2Y8DA 3AB3B 4IDZA 4E7ZA 2D2SA 4CI2B 2I59A 2VKHA 2H3RA 2H7VC 4GYSA 4EYYR 2Q9QD 2V7LA 3IF8B 4UVBB 3AAEB 4L5GA 1U4QA 3PUSA 3AA1B 1ZKEA 2N1GA 5FY7A 5LA6E 1OWAA 3QUJA 3SWHA 3ZMUB 5JDLA 4WBNE 2CLYC 3CX6B 2X68A 3FXDB 3KINB 5J2TE 1FMVA 2SPCA 3ZEFB 3C4XA 4DMVA 2CWYA 3JC6C 4I50E 4P0BA 4QX8B 3RYCE 2YEVC 2X9WA 4IHJE 4ZI2C 3N2KE 2KMFA 3GMIA 1KNZA 3V5SA 1H7CA 1IJ5A 2L9QA 2IAKA 1NWMX 4QXCB 2WMOA 2YU1A 1UX4A 3N9PA 3UULA 4EZHA 5CA1E 3BQIA 3P8CD 3QK6A 4UF0A 5JREA 3DP7A 4BJMA 2E9XB 2RA1A 2LSYA 5FYMA 3FHNA 2IC6A 2UXNB 2C0SA 4ZI3C 2K9AA 4AKLA 1LVFA 3UFEA 3T8OA 3UUNA 3CQXC 4O4HE 2V26A 3N9MA 5LBQB 1WR6A 2D0UA 4X20E 5HXRA 1OXZA 3RRCA 1ZEEA 4O4IE 5H6RB 3AVRA 3SRZA 2NW9A 3OBVE 3KDSE 5LP6E 4AQFA 1WLXA 4CQIA 1E1HB 4A56A 1YD8G 4H9QC 5HXHA 3UT5E 4FJOA 5AFUL 4MBQA 2K48A 5JRCA 3PDYA 2BVMA 2LT3A 3Q5XA 5LGUB 4H9OC 3KVAA 5JR9B 3WAKA 2KINB 2K5BB 2LOPA 3N9OA 3B57A 5HXSA 4IIJE 2W0GA 3O1JA 4TV9E 4QX7B 3ANWB 4H9RC 5FXXA 5EK4A 1SHZC 4HEAA 2V7JA 3Q9DA 4TV8E 2G0UA 3MJXA 4WNKA 4GYRA 5LJNA 4IGUA 4H9PC 3UUMA 4QHOA 1WYCA 2J1DG 2XTLA 4L0RA 4BAYB 4ZS2A 3OJAA 5HXEA 3CQGB 3ZN1B 2VWAA 1U5PA 2WMNA 3O4XE 4UVAB 4N78D 3C51A 4C90A 1AJ3A 3F31A 1BR2A 3FB2A 4UV9B 3GN5B 5LHHB 2NOXA 3GWHA 2Q9QC 4O8SA 2DLRA 4QKNA 3PU8A 5J1GA 1VRBA 3AVSA 4PK6A 2X66A 4ZHQE 4PNIA 2CWOA 2LE8A 2VKJA 3E22E 5JDGA 3PE0A 2CMRA 2XAGB 5JDMA 1HS7A 5JH7E 4ERRA 2W63A 5HYAA 5L3EB 3JC6D 5E0OA 2KWHA 2LSJA 4XBFB 3ZJ1A 3J7Yq 3UUXB 4YJ2E 3CX8B 3I9WA 2JPFA 4AQFC 5IHYA 2CCQA 2XASB 3PURA 4AXPA 2EHOD 1G73A 1HX8A 3HKBE 5JDFA 4TX5A 2ZM8A 2MBGA 3ZJ2A 4BJNA 2Q9QB 2Q9QA 5JVDE 4UF0B 4ZI3D 2L8KA 4UELA 3RKOA 4OYKA 2VKDA 5DQVA 2X9XA 5LXTE 2GK9A 4CXWA 4DBRA 2X51A 4JLEA 3PU3A 2X0LB 3C64A 2HPLA 2KWIB 3LBXA 4ADZA 3LG7A 2E9XA 1UCUA 2A2FX 2A72A 1SA0E 4UVCB 5LBMA 4AQGA 3GA8A 2ODUA 3AA7B 3CWZB 4OYJA 5FNVE 1O3XA 4PAGA 4U74A 5TAOA 3NRYA 3SOLA 3HL6A 4I55E 3HKEE 3IHRA 2PG8A 3IBPA 4UXNB 2ZM0A 4TUYE 1MMGA 5FXZA 4PK4A 2LJLA 2WWUA 2LOSA 4O2AE 4CI1B 4AKGA 2W62A 3A5XA 3C50A 3HA4A 4M1PA 4X1KE 2CA5A 5FY1A 5J2UE 3K3QC 4J2CA 2CXDA 2MYSA 2UXXB 4L9IA 1HG2A 5FXVA 3KBTA 4G63A 2NP9A 5EK2A 3MACA 2CM0A 2YK0A 3WI3A 2P9BA 3I9YA 3MK7C 4PJLA 3H37A 3F57A 5GONE 4C91A 3PTRB 3J9X1 3RRWA 3ZMTB 2W61A 4HTEA 4E7SA 1UX5A 3RX6A 5LG4A 3U3IA 5LYJE 2Y48B 1QUUA 2E9XC 2EHOB 2WM9A 1X79A 3KBUA 4YLHA 1MIYA 4EYUA 5L3GB 3RYIE 3ETUA 4UIGA 4P09A 1EZ3A 4I4TE 5JDHA 4X1YE 1HFAA 4PK5A 2XHEB 3UTKA 2YINA 5FY0A 2CXFA 5ADXL 3BK9A 3LK3B 2JRKA 3MA9A 3DTOA 5JR9C 3R84B 3HI2A 3EDUA 5HWYA 3F2EA 4CXYA 3PUGA 5HAXA 2NTYA 4DBQA 2V7KA 5FMNA 4MLKA 2CLYB 3K3NA 3KV6A 5LGTB 4FI5A 1LVKA 5JDQA 4EXTA 2IC9A 2MOZA 2C5JA 4UV8B 3TKLB 4KBMB 4HN9A 2BZBA 2ZLYA 2DI4A 2PFVA 2C5KT 1MNDA 2ZMAA 4GK0E 4YJ3E 3KV9A 5M4YA 3ZC0A 1S35A 1ZHCA 3O1HA 3RH3A 2KXPB 2CEAA 3ETVA 4OK0A 2Z6EA 3QC9A 3ZYLA 3OYXA 4ZOLE 3ZMSB 1MMNA 3AA0B 4HFVA 4ILUA 4K0UA 5FXWA 1VOMA 3S4UA 4ANJA 4U72A 2RP4A 2DCFA 3EDVA 4EZ4A 1WRDA 3OKQA 1FEWA 4XAXB 4X1IE 1HG5A 4V1Av 3NBXX 2XQYA 3LBXB 3VKGA 3C4ZA 5CB4E 3HR0A 4QXHB 3RC8A 4B6XA 3D0TA 1MMAA 2E8IA 3EVYA 1KK7A 2NW7A 2WBLA 2BVLA 3AA6B 4IE5A 5ETWA 3IEEA 3OYZA 3ZMVB 5LHIB 2DWKA 4YFSA 4MALA 3KV4A 3MXZA 2N9DA 3ONXA 4AKIA 4JUYA 2MTQA 4CZZB 5LGNB 5JQGE 5KDMC 2KNDA 1HCIA 4PFPA 4P0AA 2NW8A 2ODVA 3I0QA 2PBIA 2CXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K9A A;  4ZI3 D;  4ZI2 D;  4ZI2 C;  4ZI3 C; 
#chains in the Genus database with same CATH topology
 1B7T A;  3BQK A;  5DQW A;  1D1C A;  4OFZ A;  4B3S T;  2IUB A;  3W15 B;  1D0Z A;  5F3J A;  3MZK B;  3ZCI A;  2XAJ B;  5H6Q B;  3N2O A;  1NAF A;  4PJJ A;  3ZLI A;  1FJG T;  3AAA B;  4IE4 A;  5L2L A;  2XAF B;  4DND A;  3PUA A;  3P4R A;  4ZS3 A;  1XMO T;  3ZCJ A;  1ZOY A;  4EOZ B;  3ESL A;  5CGM A;  3WAJ A;  1XMQ T;  1YQ4 A;  3HKC E;  4JEU B;  2B1E A;  1L0V A;  4PJN A;  4KMC A;  4O4L E;  4U31 A;  4EV6 A;  5JDN A;  1XWM A;  3P4W A;  3NRX A;  4P1N A;  3ZC1 A;  3IA3 A;  4JI8 T;  3UUB A;  4WW0 A;  2K24 A;  2V7M A;  4LF6 T;  3L39 A;  2W2U A;  4YHJ A;  2XZE A;  3CPZ A;  3LK4 2;  2Y6X A;  4DR6 T;  4H9S E;  4JI2 T;  4Q25 A;  5CA0 E;  3PUZ F;  5HWX A;  4KHP T;  5KX5 E;  3CQC B;  2LLY A;  4JBW F;  2XSA A;  4UEM A;  4F6R C;  2QYW A;  4QXB B;  4HFB A;  4OHF A;  5A1L A;  3RPU A;  3L3P A;  2YDR A;  2KZ7 B;  1CHU A;  3NZP A;  3PUV F;  1BR1 A;  3SS1 A;  4KP3 C;  5HXC A;  4AKR B;  2VK9 A;  2E5L T;  3V5U A;  2VB6 A;  4O4J E;  4ASK A;  3KFW X;  2AXD S;  2A3D A;  3K8P C;  3UFG A;  1QLB A;  4WZX A;  1D1A A;  2DL1 A;  5C8Y E;  3Q5W A;  4PW8 A;  1I6Z A;  2CE7 A;  2ZM2 A;  1YKH B;  1S94 A;  3ZT6 A;  5L3D B;  3H3A A;  4HKA A;  4B3M T;  4LFB T;  1FIO A;  3VRA A;  4JYA T;  1MMD A;  3E08 A;  5AQH B;  1D1B A;  1US7 B;  1IAP A;  2PJQ A;  3K3O A;  3PV0 F;  4XZC A;  4A97 A;  4CI3 B;  4DUY T;  3AE5 A;  3ANW A;  4BA9 A;  3B13 A;  1LRZ A;  1V9D A;  2HPJ A;  4JI5 T;  1HF8 A;  5FVK A;  5HCJ A;  1M62 A;  4IRE A;  4DR4 T;  1BR4 A;  3K1S A;  4LFC T;  3LK2 B;  2VUR A;  5AQR B;  5F8P A;  5HEJ A;  5BR8 T;  4YSZ A;  3ABV A;  3C4W A;  3I1A A;  3U78 A;  4DVD A;  4JI6 T;  4IE7 A;  3N5L A;  4HE8 A;  2WCA A;  2H89 A;  4MFR A;  2UU9 T;  2L3L A;  4JEH B;  2V5C A;  3AXJ A;  3DJB A;  1HTJ F;  3M3Z B;  2JMK A;  5AQN B;  5ABH A;  3C98 B;  4HGA A;  4ZZB A;  5HEU A;  4ILA A;  5AQV B;  2DNX A;  4IL9 A;  4TWH A;  5LMN T;  4HWC A;  4MHC A;  2XQA A;  1Z8U A;  1ZV4 X;  4ZI7 E;  2W66 A;  3VR9 A;  2YOE A;  1WR0 A;  3CML A;  3PUQ A;  4HFH A;  4NUU A;  4I43 B;  3R6N A;  1KF6 A;  2V1D B;  3RYF E;  3ZN0 B;  3LSV A;  4K0K T;  3N9N A;  3QNU A;  1NEK A;  4H9N C;  2LSG A;  5LJM A;  2BBJ A;  3JAF A;  3LFM A;  5FVL A;  5LCY A;  1YKE B;  4TZ4 C;  1XDO A;  2X9H A;  3ZYK A;  3ZPO A;  3PUY F;  3VHL A;  4IE6 A;  1SE7 A;  2OA5 A;  1W9R A;  3N9Q A;  4WBO A;  3RQU A;  2XAH B;  2XAQ B;  2JQQ A;  3O1I A;  2D0T A;  5FP3 A;  2FJB A;  1Y64 B;  4DID B;  1N32 T;  1VCT A;  2BS2 A;  1E2A A;  4H63 V;  2X67 A;  4GIW A;  2V8S V;  1W0B A;  4LFA T;  2OLT A;  2VVS A;  2DHR A;  2WSS V;  2QA7 A;  2XY8 B;  1T98 A;  5DJQ C;  2W00 A;  5LOV E;  4AI6 A;  2C5I T;  2HN2 A;  4HWH A;  3KVB A;  2EHO C;  2VAS A;  2IW5 B;  4NUV A;  2NTX A;  3AEB A;  3ZST A;  2I6H A;  3EUH A;  3KV5 A;  4EIW A;  5C2T A;  4JI3 T;  1MNE A;  5L4H A;  1N36 T;  4PFO A;  3CVR A;  3I0O A;  1IZN B;  1HNW T;  2UXB T;  4QH4 A;  2BDE A;  3BQL A;  4CXX A;  5LHG B;  1CUN A;  3T1Y T;  3RC3 A;  2N2N A;  2LEH A;  3AE3 A;  1MIV A;  2WAU A;  4GOU A;  4TWF A;  4Z8X A;  3RIA A;  3SFD A;  3ZT7 A;  5JRC B;  4ZI2 D;  3CKD A;  4DMW A;  3ZMZ B;  5J0Z A;  2FUP A;  4PJM A;  1OED A;  2YU2 A;  2FJE A;  3P4P A;  5EZY E;  2NWB A;  2JIW A;  3N2G E;  5FKY A;  3A8Y C;  2LHN A;  2LSK A;  1YW0 A;  2LHR A;  3EAB A;  4HFI A;  3CX7 B;  4KUM B;  1YQ3 A;  4YTP A;  5L3C B;  3PUX F;  3NZQ A;  3RYH E;  1WFD A;  3M65 A;  3Q2M A;  2E9X D;  3MKD A;  5JR9 A;  1BR0 A;  2X9Y A;  4AKH A;  3P7I A;  2JMH A;  3E0Z A;  2UUB T;  3UQ4 A;  4IST A;  3ZYM A;  4LF9 T;  1D0Y A;  1ZP0 A;  2DWG A;  2EHO A;  1WYB A;  2ES0 A;  2LSI A;  4CN4 A;  4DO0 A;  3O9X A;  2W4X A;  1D0X A;  4IDN A;  1MIW A;  2ACX A;  2M67 A;  3N9L A;  5ABF B;  5KMG P;  4DUZ T;  1IJ6 A;  2BG9 B;  2VL8 A;  2XPK A;  4GKJ T;  5L3F B;  2JJ9 A;  5AQI B;  4G2A A;  2XUE A;  3L09 A;  5HEO A;  3ZKR A;  3LJC A;  4A5X A;  4O2B E;  5JTG A;  2YN6 A;  2H7O A;  4QH5 A;  5L3B B;  2WDR A;  1UGO A;  2CBJ A;  2QGS A;  1LKX A;  2VL0 A;  3FBL A;  4LF7 T;  1W0A A;  3AEE A;  3FXE B;  4NXM T;  1Z0P A;  4LF8 T;  5IYZ E;  2KT9 A;  3FBZ A;  4YY3 T;  2H88 A;  5HEH A;  3PJA A;  4DV0 T;  3P4S A;  3AAI A;  2VKO A;  1FMW A;  2HH7 A;  2V7I A;  2LM9 A;  3AE2 A;  4EAH A;  1QSD A;  4TN7 B;  4EB6 E;  4H63 H;  3OVU A;  5EK3 A;  3GN5 A;  2LRL A;  4DV3 T;  2D5U A;  3VKH A;  2VVN A;  4GK5 E;  4QWN B;  4DV6 T;  2WQY A;  4IE0 A;  3RI5 A;  4HFE A;  5DAB A;  3HKD E;  4NXN T;  2KLQ A;  1G8X A;  4ISS A;  5BMV E;  2Y8D A;  3AB3 B;  3X1D A;  4IDZ A;  4E7Z A;  2UUC T;  2D2S A;  4CI2 B;  5ABG A;  2I59 A;  2VKH A;  2H3R A;  2H7V C;  4GYS A;  4EYY R;  2Q9Q D;  2V7L A;  3IF8 B;  4UVB B;  5AQF B;  3RIF A;  3AAE B;  4L5G A;  1U4Q A;  3PUS A;  3EI0 A;  3AA1 B;  1ZKE A;  2N1G A;  5FY7 A;  4X5T A;  5LA6 E;  1OWA A;  3QUJ A;  3SWH A;  3ZMU B;  5JDL A;  4JI7 T;  4WBN E;  2CLY C;  3CX6 B;  2X68 A;  3FXD B;  3KIN B;  4LMK A;  4AIS A;  1FMV A;  5J2T E;  2SPC A;  4YTM A;  2F4V T;  3ZSS A;  2WZI A;  3ZEF B;  2XJ7 A;  3C4X A;  4DMV A;  2CWY A;  3JC6 C;  4I50 E;  4P0B A;  4QX8 B;  4U33 A;  3RYC E;  2YEV C;  2X9W A;  3UU4 A;  3LDQ B;  4IHJ E;  4ZI2 C;  3N2K E;  2KMF A;  3GMI A;  1KNZ A;  3V5S A;  1H7C A;  2NR4 A;  1IJ5 A;  1UUR A;  2L9Q A;  4OX9 T;  1N33 T;  2IAK A;  3FZF B;  4KHZ F;  1NWM X;  4QXC B;  4B3T T;  3A7M A;  2WMO A;  2YU1 A;  1UX4 A;  3N9P A;  4ZXL A;  2XQ5 A;  2XSB A;  3UUL A;  3BQI A;  3P8C D;  4EZH A;  2XQ7 A;  4YSX A;  5CA1 E;  3QK6 A;  4UF0 A;  5IWA T;  5JRE A;  3DP7 A;  3Q5D A;  4BJM A;  2JQH A;  4TNW A;  2E9X B;  2RA1 A;  4ILB A;  2LSY A;  5FYM A;  3FHN A;  2IC6 A;  2UXN B;  2C0S A;  2WY2 A;  2K9A A;  4ZI3 C;  4AKL A;  1LVF A;  3UFE A;  3T8O A;  3UUN A;  3CQX C;  2J4G A;  1OED E;  3PUW F;  4O4H E;  1E7P A;  1T8B A;  2V26 A;  3N9M A;  5LBQ B;  2UXC T;  1WR6 A;  2FJA A;  4DV1 T;  2D0U A;  4X20 E;  5CJ5 A;  5HXR A;  3TLT A;  1HNX T;  4TWD A;  1OXZ A;  3RRC A;  1ZEE A;  4O4I E;  5H6R B;  3AVR A;  5AQT B;  3SRZ A;  2NW9 A;  1HR0 T;  1UK5 A;  3KDS E;  3OBV E;  5LP6 E;  4HWD A;  3SFE A;  4AQF A;  1WLX A;  4CQI A;  1E1H B;  4A56 A;  3B5M A;  1YD8 G;  1IBK T;  4H9Q C;  4IT4 A;  3RIU A;  5HXH A;  5LMU T;  2HHH T;  3UT5 E;  3UQ7 A;  4FJO A;  5AFU L;  2MAW A;  4MBQ A;  3FZH B;  2K48 A;  5JRC A;  1OED C;  3PDY A;  2BVM A;  2LT3 A;  3Q5X A;  5LGU B;  2M6B A;  3AED A;  4H9O C;  5AQL B;  3KVA A;  5JR9 B;  3WAK A;  2KIN B;  2K5B B;  2LOP A;  1R8I A;  2YDQ A;  3N9O A;  3B57 A;  1KNP A;  5HXS A;  4IIJ E;  4LMJ A;  2W0G A;  3O1J A;  4TV9 E;  4QX7 B;  3ANW B;  4H9R C;  4NPP A;  2X0H A;  1SHZ C;  5EK4 A;  5FXX A;  3RKG A;  3RQW A;  4HEA A;  2LKG A;  2V7J A;  3Q9D A;  1OED B;  3QB5 A;  2G0U A;  4TV8 E;  4DR3 T;  3MJX A;  2R6G F;  2BKN A;  4WNK A;  3AE8 A;  4GYR A;  5LJN A;  4IGU A;  4ILC A;  3AEF A;  2UXD T;  5AQM B;  4H9P C;  3UUM A;  4QHO A;  1WYC A;  2J1D G;  4YT0 A;  2BS4 A;  2XTL A;  3FZL B;  4L0R A;  3TLW A;  4BAY B;  4ZS2 A;  3OJA A;  3UU5 A;  1X9B A;  2KSR A;  3NVO A;  3CQG B;  5HXE A;  4IDO A;  3ZN1 B;  2VWA A;  1U5P A;  1W09 A;  2WMN A;  3AE4 A;  3O4X E;  1Y01 A;  1VCS A;  4UVA B;  1KNR A;  3C51 A;  4N78 D;  4C90 A;  1AJ3 A;  3F31 A;  4F8H A;  4X66 T;  4ZZC A;  1BR2 A;  3FB2 A;  4UV9 B;  3GN5 B;  2XQ3 A;  5LHH B;  2NOX A;  3GWH A;  2Q9Q C;  4O8S A;  2DLR A;  2WP9 A;  4QKN A;  2IDO B;  3PU8 A;  2PTF A;  1N34 T;  5J1G A;  1VRB A;  3AVS A;  4PK6 A;  2X66 A;  3EHZ A;  5AQQ B;  4PNI A;  4ZHQ E;  2CWO A;  2LE8 A;  2VKJ A;  3E22 E;  4JI0 T;  5JDG A;  3PE0 A;  5L4E A;  2CMR A;  2XAG B;  5JDM A;  2QRX A;  3AEG A;  1HS7 A;  5KXJ A;  5HEG A;  2M6I A;  4ERR A;  2W63 A;  5JH7 E;  2IHR 1;  4B3R T;  5HYA A;  5L3E B;  3JC6 D;  3JAE A;  1JNR A;  3QB5 K;  2KWH A;  5E0O A;  5AQP B;  2K3W A;  2LSJ A;  2XM1 A;  3TLS A;  4XBF B;  3ZJ1 A;  4HWF A;  3RIU C;  3J7Y q;  3UUX B;  2X0Y A;  3CX8 B;  1J5W A;  1KEY A;  2RPA A;  3NKZ A;  3I9W A;  2JPF A;  4YJ2 E;  4AQF C;  5IHY A;  2CCQ A;  2XAS B;  2XQ6 A;  3PUR A;  4AXP A;  2EHO D;  1G73 A;  1HX8 A;  3AEA A;  2W67 A;  3HKB E;  4QH1 A;  4TX5 A;  5JDF A;  2ZM8 A;  2B76 A;  1JNZ A;  2MBG A;  2AE9 A;  5AQO B;  3VU7 H;  3ZJ2 A;  4BJN A;  1IBL T;  2E5V A;  2Q9Q B;  2V5D A;  3JAD A;  2Q9Q A;  5JVD E;  4UF0 B;  4ZI3 D;  2BG9 A;  3T1H T;  2L8K A;  4UEL A;  3RKO A;  1NEN A;  3AE9 A;  2VKD A;  4OYK A;  4JI4 T;  5DQV A;  5AQG B;  2X9X A;  5LXT E;  4HFD A;  2GK9 A;  4CXW A;  3UU6 A;  2D9D A;  2OV9 A;  4DBR A;  2X51 A;  4JLE A;  3JCF A;  3PU3 A;  2X0L B;  2CPT A;  2LM2 A;  3C64 A;  2HPL A;  2KWI B;  3ONJ A;  3LBX A;  4ADZ A;  3LG7 A;  2E9X A;  1UCU A;  5LNK A;  2A2F X;  2A72 A;  1GQE A;  1SA0 E;  4UVC B;  5LBM A;  3NWI A;  4AQG A;  3GA8 A;  4KI0 F;  1J5E T;  2ODU A;  3CK6 A;  3AA7 B;  3CWZ B;  4OYJ A;  5FNV E;  1O3X A;  4AQY T;  2BKO A;  4PAG A;  4U74 A;  5LB7 B;  5TAO A;  4DV5 T;  3NRY A;  4UR9 A;  4YHH T;  3RF1 A;  3SOL A;  4U2Z A;  4LF5 T;  3HL6 A;  4I55 E;  2A9U A;  3HKE E;  3IHR A;  2PG8 A;  3IBP A;  4UXN B;  2WZH A;  2V6X A;  2ZM0 A;  4LF4 T;  4TUY E;  5FL1 A;  1MMG A;  5FXZ A;  4PK4 A;  3AE1 A;  2LJL A;  1DU2 A;  2WWU A;  2LOS A;  4O2A E;  4CI1 B;  4AKG A;  2W62 A;  3A5X A;  2XQ9 A;  3C50 A;  3HA4 A;  1T72 A;  4M1P A;  5AQJ B;  4DV2 T;  3AE7 A;  4X1K E;  4DV4 T;  2CA5 A;  5FY1 A;  5J2U E;  5C3J A;  3K3Q C;  4J2C A;  2CXD A;  5L47 A;  2MYS A;  2UXX B;  1XNR T;  4EED A;  3RGL A;  4L9I A;  4AIU A;  1HG2 A;  5FXV A;  3KBT A;  1SUM B;  4IL4 A;  4G63 A;  5LG3 A;  2NP9 A;  5EK2 A;  2V6Y A;  2ZM6 T;  3MAC A;  2CM0 A;  2YK0 A;  3FZM B;  3L8R A;  3WI3 A;  3OTO T;  2P9B A;  3I9Y A;  3MK7 C;  4PJL A;  2XQ4 A;  3H37 A;  4U7I A;  3F57 A;  5GON E;  4A98 A;  3AE6 A;  4C91 A;  3PTR B;  3QOF A;  4HWI B;  3J9X 1;  3RRW A;  4JI1 T;  2BS3 A;  3ZMT B;  2W61 A;  4HTE A;  4E7S A;  1UX5 A;  3EAM A;  1I94 T;  3RX6 A;  5LG4 A;  3AXJ B;  3ZT5 A;  3U3I A;  4I0U A;  5LYJ E;  2Y48 B;  1QUU A;  1XZY A;  2E9X C;  2EHO B;  1X79 A;  2LRK A;  2WM9 A;  1MIY A;  3KBU A;  4YLH A;  3RLF F;  4EYU A;  4DR1 T;  5L3G B;  3RYI E;  3ETU A;  4UIG A;  4P09 A;  4CN6 A;  4DR5 T;  1EZ3 A;  4I4T E;  2WU2 A;  5JDH A;  2E2A A;  4X1Y E;  1HFA A;  4PK5 A;  2XHE B;  3UTK A;  2YIN A;  5FY0 A;  1M7K A;  2CXF A;  5ADX L;  3BK9 A;  3LK3 B;  5AQU B;  2JRK A;  5AQS B;  4X64 T;  1IBM T;  3MA9 A;  3DTO A;  5JR9 C;  2QVA A;  1HX1 B;  3R84 B;  3P4Q A;  2UUA T;  3HI2 A;  4U7Y A;  1HNZ T;  1J1J A;  3EDU A;  3F2E A;  3FZK B;  2J62 A;  5HWY A;  3PUG A;  4YSY A;  4CXY A;  5HAX A;  2NTY A;  4DBQ A;  5ABE A;  4DR2 T;  1XDP A;  2V7K A;  5FMN A;  4MLK A;  5FL0 A;  2JQ9 A;  2CLY B;  3K3N A;  3KV6 A;  4U2Y A;  4FI5 A;  1LVK A;  4LML A;  5JDQ A;  5LGT B;  4EXT A;  2IC9 A;  2MOZ A;  2C5J A;  4UV8 B;  1WCR A;  3TKL B;  2WB5 A;  4HN9 A;  2CHO A;  4KBM B;  3PJA J;  5AQK B;  4YXD A;  1YXR A;  2BZB A;  3CIR A;  2ZLY A;  2DI4 A;  2PFV A;  2C5K T;  2IML A;  1XNQ T;  1MND A;  2ZMA A;  3P50 A;  4GK0 E;  4YJ3 E;  3KV9 A;  2FBW A;  2JQK A;  2V6Y B;  5M4Y A;  2CBI A;  3ZC0 A;  1S35 A;  1ZHC A;  2I0M A;  3O1H A;  4X62 T;  4HFC A;  2KXP B;  2CEA A;  3RH3 A;  3ETV A;  4OK0 A;  2Z6E A;  4IDP A;  2WU5 A;  3QC9 A;  3ZYL A;  3OYX A;  4ZOL E;  1KFY A;  2ACZ A;  4EEB A;  4DV7 T;  4TNV A;  3ONL C;  3ZMS B;  2CRB A;  2J47 A;  5CFB A;  1MMN A;  3AA0 B;  4HFV A;  4ILU A;  4K0U A;  5FXW A;  1VOM A;  3S4U A;  3UU8 A;  4KX6 A;  3VRB A;  5F5W A;  4ANJ A;  4ZEY A;  4WYV A;  2WDV A;  2YKS A;  4U72 A;  2RP4 A;  2DCF A;  3EDV A;  3Q5E A;  2WS3 A;  1WRD A;  3OKQ A;  4COF A;  4EZ4 A;  1FEW A;  4XAX B;  4X1I E;  1HG5 A;  4Z90 A;  5IUX A;  4V1A v;  2VQF T;  2LKH A;  3VR8 A;  3NBX X;  5ABF A;  2XQY A;  3OPC A;  3LBX B;  3VKG A;  4IDQ A;  3C4Z A;  2MPK A;  5CB4 E;  3HR0 A;  4QXH B;  4X65 T;  2XM2 A;  3RC8 A;  4B6X A;  2BG9 C;  4NIQ A;  4DR7 T;  3D0T A;  4JV5 T;  1MMA A;  2E8I A;  2XQ8 A;  3EVY A;  3G06 A;  2VQE T;  1KK7 A;  2BKP A;  3RHW A;  1T7S A;  2NW7 A;  2WBL A;  2BVL A;  3AA6 B;  4IE5 A;  5ETW A;  3IEE A;  3OYZ A;  5HCM A;  3ZMV B;  3TLV A;  2DWK A;  5LHI B;  2WDQ A;  3H3M A;  4EGW A;  2BBH A;  4YFS A;  4MAL A;  3KV4 A;  2WWV A;  3MXZ A;  4CN1 A;  3AEC A;  4U3C A;  3UU3 A;  4YTN A;  2N9D A;  3ONX A;  4AKI A;  4JUY A;  2MTQ A;  4CZZ B;  1UUS A;  3TLU A;  5LGN B;  2YDS A;  2HN1 A;  5JQG E;  5KDM C;  2IIU A;  2KND A;  2CHN A;  1HCI A;  4PFP A;  2FJD A;  4Z91 A;  4P0A A;  2NW8 A;  2BG9 E;  2ODV A;  3I0Q A;  2PBI A;  2CXL A;  4GKK T; 
#chains in the Genus database with same CATH homology
 1B7T A;  3BQK A;  5DQW A;  1D1C A;  4OFZ A;  3W15 B;  1D0Z A;  5F3J A;  3MZK B;  3ZCI A;  2XAJ B;  5H6Q B;  3N2O A;  1NAF A;  4PJJ A;  3ZLI A;  3AAA B;  4IE4 A;  5L2L A;  2XAF B;  4DND A;  3PUA A;  4ZS3 A;  3ZCJ A;  4EOZ B;  3ESL A;  3WAJ A;  3HKC E;  4JEU B;  2B1E A;  4PJN A;  4KMC A;  4O4L E;  5JDN A;  3NRX A;  3ZC1 A;  4WW0 A;  2K24 A;  2V7M A;  4YHJ A;  3LK4 2;  3CPZ A;  2Y6X A;  4H9S E;  5CA0 E;  5HWX A;  5KX5 E;  3CQC B;  4UEM A;  4F6R C;  4QXB B;  4OHF A;  5A1L A;  3RPU A;  3L3P A;  3NZP A;  2KZ7 B;  4AKR B;  1BR1 A;  3SS1 A;  4KP3 C;  5HXC A;  2VK9 A;  3V5U A;  2VB6 A;  4O4J E;  4ASK A;  3KFW X;  2A3D A;  3K8P C;  1D1A A;  5C8Y E;  3Q5W A;  4PW8 A;  2CE7 A;  2ZM2 A;  1YKH B;  1S94 A;  5L3D B;  3H3A A;  4HKA A;  1FIO A;  1MMD A;  3E08 A;  1D1B A;  1US7 B;  1IAP A;  2PJQ A;  3K3O A;  4XZC A;  4CI3 B;  3ANW A;  4BA9 A;  3B13 A;  1LRZ A;  1V9D A;  2HPJ A;  1HF8 A;  1BR4 A;  3LK2 B;  5F8P A;  3I1A A;  3C4W A;  3U78 A;  4DVD A;  4IE7 A;  3N5L A;  4HE8 A;  4MFR A;  2L3L A;  4JEH B;  3DJB A;  1HTJ F;  2JMK A;  3C98 B;  4HGA A;  2DNX A;  4MHC A;  1ZV4 X;  4ZI7 E;  3R6N A;  3VU7 H;  3CML A;  3PUQ A;  4NUU A;  4I43 B;  3RYF E;  5LHG B;  2V1D B;  3ZN0 B;  3N9N A;  4H9N C;  2LSG A;  5LJM A;  5LCY A;  3LFM A;  1YKE B;  4TZ4 C;  3ZPO A;  2X9H A;  3ZYK A;  3VHL A;  4IE6 A;  2OA5 A;  3N9Q A;  4WBO A;  2XAH B;  2XAQ B;  2JQQ A;  3O1I A;  2D0T A;  5FP3 A;  1Y64 B;  4H63 V;  2X67 A;  4GIW A;  2DHR A;  2WSS V;  2QA7 A;  1T98 A;  5DJQ C;  2W00 A;  5LOV E;  4AI6 A;  2C5I T;  3KVB A;  2EHO C;  2VAS A;  2IW5 B;  4NUV A;  2NTX A;  3EUH A;  3KV5 A;  4EIW A;  1MNE A;  4PFO A;  3CVR A;  3I0O A;  1IZN B;  2BDE A;  3BQL A;  4CXX A;  1CUN A;  3RC3 A;  2N2N A;  2LEH A;  4Z8X A;  1MIV A;  2WAU A;  4GOU A;  5LNK A;  5JRC B;  4ZI2 D;  3CKD A;  4DMW A;  3ZMZ B;  4PJM A;  2YU2 A;  5EZY E;  2NWB A;  3N2G E;  2LHN A;  2LSK A;  1YW0 A;  2LHR A;  3CX7 B;  4KUM B;  5L3C B;  3NZQ A;  3RYH E;  3M65 A;  3Q2M A;  2E9X D;  3MKD A;  5JR9 A;  1BR0 A;  2X9Y A;  4AKH A;  3P7I A;  2JMH A;  3E0Z A;  4IST A;  3ZYM A;  1D0Y A;  2DWG A;  2ES0 A;  2EHO A;  1WYB A;  2LSI A;  4DO0 A;  3O9X A;  1D0X A;  1MIW A;  2ACX A;  2M67 A;  3N9L A;  5KMG P;  1IJ6 A;  2VL8 A;  5L3F B;  2JJ9 A;  4G2A A;  2XUE A;  3L09 A;  3LJC A;  4O2B E;  2H7O A;  5L3B B;  2QGS A;  1LKX A;  3FBL A;  3FXE B;  1Z0P A;  5IYZ E;  2KT9 A;  3FBZ A;  3AAI A;  2VKO A;  1FMW A;  2HH7 A;  2V7I A;  2LM9 A;  4EAH A;  1QSD A;  4TN7 B;  4EB6 E;  4H63 H;  5EK3 A;  3GN5 A;  2D5U A;  3VKH A;  4GK5 E;  4QWN B;  4IE0 A;  5DAB A;  3HKD E;  2KLQ A;  1G8X A;  4ISS A;  5BMV E;  2Y8D A;  3AB3 B;  4IDZ A;  4E7Z A;  2D2S A;  4CI2 B;  2I59 A;  2VKH A;  2H3R A;  2H7V C;  4GYS A;  4EYY R;  2Q9Q D;  2V7L A;  3IF8 B;  4UVB B;  3AAE B;  4L5G A;  1U4Q A;  3PUS A;  3AA1 B;  1ZKE A;  2N1G A;  5FY7 A;  5LA6 E;  1OWA A;  3QUJ A;  3SWH A;  3ZMU B;  5JDL A;  4WBN E;  2CLY C;  3CX6 B;  2X68 A;  3FXD B;  3KIN B;  5J2T E;  1FMV A;  2SPC A;  3ZEF B;  3C4X A;  4DMV A;  2CWY A;  3JC6 C;  4I50 E;  4P0B A;  4QX8 B;  3RYC E;  2YEV C;  2X9W A;  4IHJ E;  4ZI2 C;  3N2K E;  2KMF A;  3GMI A;  1KNZ A;  3V5S A;  1H7C A;  1IJ5 A;  2L9Q A;  2IAK A;  1NWM X;  4QXC B;  2WMO A;  2YU1 A;  1UX4 A;  3N9P A;  3UUL A;  4EZH A;  5CA1 E;  3BQI A;  3P8C D;  3QK6 A;  4UF0 A;  5JRE A;  3DP7 A;  4BJM A;  2E9X B;  2RA1 A;  2LSY A;  5FYM A;  3FHN A;  2IC6 A;  2UXN B;  2C0S A;  4ZI3 C;  2K9A A;  4AKL A;  1LVF A;  3UFE A;  3T8O A;  3UUN A;  3CQX C;  4O4H E;  2V26 A;  3N9M A;  5LBQ B;  1WR6 A;  2D0U A;  4X20 E;  5HXR A;  1OXZ A;  3RRC A;  1ZEE A;  4O4I E;  5H6R B;  3AVR A;  3SRZ A;  2NW9 A;  3OBV E;  3KDS E;  5LP6 E;  4AQF A;  1WLX A;  4CQI A;  1E1H B;  4A56 A;  1YD8 G;  4H9Q C;  5HXH A;  3UT5 E;  4FJO A;  5AFU L;  4MBQ A;  2K48 A;  5JRC A;  3PDY A;  2BVM A;  2LT3 A;  3Q5X A;  5LGU B;  4H9O C;  3KVA A;  5JR9 B;  3WAK A;  2KIN B;  2K5B B;  2LOP A;  3N9O A;  3B57 A;  5HXS A;  4IIJ E;  2W0G A;  3O1J A;  4TV9 E;  4QX7 B;  3ANW B;  4H9R C;  5FXX A;  5EK4 A;  1SHZ C;  4HEA A;  2V7J A;  3Q9D A;  4TV8 E;  2G0U A;  3MJX A;  4WNK A;  4GYR A;  5LJN A;  4IGU A;  4H9P C;  3UUM A;  4QHO A;  1WYC A;  2J1D G;  2XTL A;  4L0R A;  4BAY B;  4ZS2 A;  3OJA A;  5HXE A;  3CQG B;  3ZN1 B;  2VWA A;  1U5P A;  2WMN A;  3O4X E;  4UVA B;  4N78 D;  3C51 A;  4C90 A;  1AJ3 A;  3F31 A;  1BR2 A;  3FB2 A;  4UV9 B;  3GN5 B;  5LHH B;  2NOX A;  3GWH A;  2Q9Q C;  4O8S A;  2DLR A;  4QKN A;  3PU8 A;  5J1G A;  1VRB A;  3AVS A;  4PK6 A;  2X66 A;  4ZHQ E;  4PNI A;  2CWO A;  2LE8 A;  2VKJ A;  3E22 E;  5JDG A;  3PE0 A;  2CMR A;  2XAG B;  5JDM A;  1HS7 A;  5JH7 E;  4ERR A;  2W63 A;  5HYA A;  5L3E B;  3JC6 D;  5E0O A;  2KWH A;  2LSJ A;  4XBF B;  3ZJ1 A;  3J7Y q;  3UUX B;  4YJ2 E;  3CX8 B;  3I9W A;  2JPF A;  4AQF C;  5IHY A;  2CCQ A;  2XAS B;  3PUR A;  4AXP A;  2EHO D;  1G73 A;  1HX8 A;  3HKB E;  5JDF A;  4TX5 A;  2ZM8 A;  2MBG A;  3ZJ2 A;  4BJN A;  2Q9Q B;  2Q9Q A;  5JVD E;  4UF0 B;  4ZI3 D;  2L8K A;  4UEL A;  3RKO A;  4OYK A;  2VKD A;  5DQV A;  2X9X A;  5LXT E;  2GK9 A;  4CXW A;  4DBR A;  2X51 A;  4JLE A;  3PU3 A;  2X0L B;  3C64 A;  2HPL A;  2KWI B;  3LBX A;  4ADZ A;  3LG7 A;  2E9X A;  1UCU A;  2A2F X;  2A72 A;  1SA0 E;  4UVC B;  5LBM A;  4AQG A;  3GA8 A;  2ODU A;  3AA7 B;  3CWZ B;  4OYJ A;  5FNV E;  1O3X A;  4PAG A;  4U74 A;  5TAO A;  3NRY A;  3SOL A;  3HL6 A;  4I55 E;  3HKE E;  3IHR A;  2PG8 A;  3IBP A;  4UXN B;  2ZM0 A;  4TUY E;  1MMG A;  5FXZ A;  4PK4 A;  2LJL A;  2WWU A;  2LOS A;  4O2A E;  4CI1 B;  4AKG A;  2W62 A;  3A5X A;  3C50 A;  3HA4 A;  4M1P A;  4X1K E;  2CA5 A;  5FY1 A;  5J2U E;  3K3Q C;  4J2C A;  2CXD A;  2MYS A;  2UXX B;  4L9I A;  1HG2 A;  5FXV A;  3KBT A;  4G63 A;  2NP9 A;  5EK2 A;  3MAC A;  2CM0 A;  2YK0 A;  3WI3 A;  2P9B A;  3I9Y A;  3MK7 C;  4PJL A;  3H37 A;  3F57 A;  5GON E;  4C91 A;  3PTR B;  3J9X 1;  3RRW A;  3ZMT B;  2W61 A;  4HTE A;  4E7S A;  1UX5 A;  3RX6 A;  5LG4 A;  3U3I A;  5LYJ E;  2Y48 B;  1QUU A;  2E9X C;  2EHO B;  2WM9 A;  1X79 A;  3KBU A;  4YLH A;  1MIY A;  4EYU A;  5L3G B;  3RYI E;  3ETU A;  4UIG A;  4P09 A;  1EZ3 A;  4I4T E;  5JDH A;  4X1Y E;  1HFA A;  4PK5 A;  2XHE B;  3UTK A;  2YIN A;  5FY0 A;  2CXF A;  5ADX L;  3BK9 A;  3LK3 B;  2JRK A;  3MA9 A;  3DTO A;  5JR9 C;  3R84 B;  3HI2 A;  3EDU A;  5HWY A;  3F2E A;  4CXY A;  3PUG A;  5HAX A;  2NTY A;  4DBQ A;  2V7K A;  5FMN A;  4MLK A;  2CLY B;  3K3N A;  3KV6 A;  5LGT B;  4FI5 A;  1LVK A;  5JDQ A;  4EXT A;  2IC9 A;  2MOZ A;  2C5J A;  4UV8 B;  3TKL B;  4KBM B;  4HN9 A;  2BZB A;  2ZLY A;  2DI4 A;  2PFV A;  2C5K T;  1MND A;  2ZMA A;  4GK0 E;  4YJ3 E;  3KV9 A;  5M4Y A;  3ZC0 A;  1S35 A;  1ZHC A;  3O1H A;  3RH3 A;  2KXP B;  2CEA A;  3ETV A;  4OK0 A;  2Z6E A;  3QC9 A;  3ZYL A;  3OYX A;  4ZOL E;  3ZMS B;  1MMN A;  3AA0 B;  4HFV A;  4ILU A;  4K0U A;  5FXW A;  1VOM A;  3S4U A;  4ANJ A;  4U72 A;  2RP4 A;  2DCF A;  3EDV A;  4EZ4 A;  1WRD A;  3OKQ A;  1FEW A;  4XAX B;  4X1I E;  1HG5 A;  4V1A v;  3NBX X;  2XQY A;  3LBX B;  3VKG A;  3C4Z A;  5CB4 E;  3HR0 A;  4QXH B;  3RC8 A;  4B6X A;  3D0T A;  1MMA A;  2E8I A;  3EVY A;  1KK7 A;  2NW7 A;  2WBL A;  2BVL A;  3AA6 B;  4IE5 A;  5ETW A;  3IEE A;  3OYZ A;  3ZMV B;  5LHI B;  2DWK A;  4YFS A;  4MAL A;  3KV4 A;  3MXZ A;  2N9D A;  3ONX A;  4AKI A;  4JUY A;  2MTQ A;  4CZZ B;  5LGN B;  5JQG E;  5KDM C;  2KND A;  1HCI A;  4PFP A;  4P0A A;  2NW8 A;  2ODV A;  3I0Q A;  2PBI A;  2CXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...