4ZI2C

Bart-like domain of bartl1/ccdc104 in complex with arl3fl bound to gppnhp in p21 21 21
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
131
structure length
131
Chain Sequence
AAEEEDEVEWVVESIAGFLRGPDWSIPILDFVEQKCEVFDDEEESKLTYTEIHQEYKELVEKLLESYLKEIGINEDQFQEACTSPLAKTRTSQAILQPVLAAEDFTIFKAMMVQKNIEMQLQAIRIIQERN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor-like protein 3
publication title The Interaction of CCDC104/BARTL1 with Arl3 and Implications for Ciliary Function.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 56
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2015-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11527 ARL2_Bind_BART The ARF-like 2 binding protein BART
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1900 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4zi2C00
2K9AA 4ZI3D 4ZI2D 4ZI3C 4ZI2C
chains in the Genus database with same CATH superfamily
3RIUA 3AE3A 3OVUA 2WB5A 2VASA 2WMOA 4ZI2D 5FXVA 3GN5B 1IZNB 5FXXA 4DBRA 1HNZT 4YJ2E 3IA3A 1M62A 4DUZT 2XSBA 5KX5E 5AQFB 3EABA 4ADZA 4KHZF 3EVYA 2WM9A 4HGAA 5ABGA 4BAYB 4UVCB 2VL0A 5LBQB 3C4WA 2X9HA 4EV6A 2BZBA 1SA0E 3AE2A 4EZHA 2XQ5A 1BR4A 5FKYA 4JI7T 4CI1B 4DR4T 2B1EA 4YTPA 3UUXB 5CJ5A 4U2YA 4PJNA 1WFDA 4KI0F 4ASKA 4HWFA 5C3JA 5L47A 4G2AA 4WBOA 4F6RC 2LOSA 1ZKEA 2WDQA 3UUNA 2Q9QA 2LSJA 4HKAA 3AE4A 4O8SA 3ZJ1A 4EZ4A 2ZM6T 3KV6A 4DV1T 2DHRA 2XAQB 2YU1A 1YKEB 3PUWF 3IEEA 1HR0T 3ZKRA 3LJCA 3ZJ2A 2A72A 4DO0A 1WR0A 3H37A 4KBMB 4NUVA 3U78A 2RPAA 2UXXB 2VL8A 2FUPA 5TAOA 2D0UA 1EZ3A 2VKOA 4X1IE 5DQVA 4LMJA 5FY0A 4Q25A 1VCSA 3RLFF 3AE9A 2V8SV 2W00A 1MIYA 3CKDA 5HCMA 3RYHE 2MYSA 1HFAA 3H3MA 5JVDE 2CXLA 4YSXA 3ZCJA 2UXBT 5EZYE 5HEHA 5FNVE 4QX7B 4X62T 3KINB 3PU8A 3VR9A 2LRLA 4ZI3C 5AQHB 4KUMB 4P1NA 4HWIB 4I50E 4KX6A 5AFUL 2JQKA 1NEKA 3PTRB 4X64T 4PW8A 2ZM8A 4PNIA 1Z8UA 2AXDS 3AB3B 4JV5T 2YDSA 2ODVA 3FZKB 3LK3B 2NW8A 2A2FX 3AEBA 1KEYA 2CEAA 2WWUA 4AQFC 4BA9A 3ONXA 4IHJE 3PUZF 2VVNA 2UXNB 1OEDA 2IW5B 3LFMA 4EAHA 2PBIA 3B13A 2ES0A 2WBLA 1ZOYA 4DBQA 2LM9A 4IDZA 2HN2A 3I9YA 3V5SA 4IL9A 3RPUA 5AQMB 2LLYA 2JQQA 2WSSV 1VRBA 5A1LA 3PUXF 3O1JA 1HG5A 3HR0A 3FHNA 1IJ5A 4TWFA 2I59A 3WAKA 5AQIB 2XQ6A 4LF9T 2LSYA 1NAFA 3I0QA 3AE7A 5HEJA 5IUXA 4O4LE 2PG8A 4TZ4C 1IJ6A 3VRAA 3AE1A 2IIUA 3AE5A 3TLUA 3EHZA 1MMDA 3OKQA 3C98B 2VKDA 3AA7B 3AA1B 4DV2T 2V5CA 4JI3T 3L3PA 3K3NA 1W09A 1QSDA 4LF6T 3RF1A 3L09A 4PAGA 3GA8A 2N9DA 2XPKA 5E0OA 1YD8G 2CE7A 4ZI7E 3CQGB 1I6ZA 5JRCA 5AQNB 1J5WA 1D0YA 2FJBA 4UIGA 5AQKB 3AEDA 1UCUA 1G73A 2V7MA 4CN4A 4UVAB 3CIRA 3CPZA 1D0ZA 1L0VA 1O3XA 2LJLA 3ZC1A 5ABHA 4FJOA 3UU4A 4YFSA 4CXWA 2WU5A 4MFRA 4P09A 3FZFB 1LKXA 1WRDA 2CM0A 3EDUA 5AQRB 5DJQC 1U4QA 2BG9E 4HFBA 5JH7E 2JQHA 3KVBA 1FMVA 1UGOA 1HX8A 4X65T 2P9BA 5F8PA 3UFEA 3B57A 4HFIA 4U3CA 4MBQA 1MNDA 2DNXA 3S4UA 5F3JA 2CWYA 3AEAA 1Z0PA 4AKGA 2CWOA 4YSYA 3AE8A 2XZEA 3RKGA 1ZP0A 3E08A 1N33T 3CK6A 3BQLA 5FP3A 3GN5A 5L3EB 1T8BA 4I0UA 3SRZA 3JCFA 1SE7A 1T98A 3RC8A 4AKHA 3RYCE 2PTFA 4CN1A 5LXTE 4AKIA 4P0AA 4B3ST 5HCJA 3JADA 5ETWA 4B3MT 5JQGE 3KDSE 2XM2A 4DIDB 3RQUA 4U74A 5JDLA 5HXHA 5JDGA 3CQCB 1BR0A 3AECA 4ERRA 4HFCA 5HEOA 3ZMZB 1YQ4A 4UV8B 1N34T 2E9XC 1LVKA 3FBZA 1KK7A 2LHNA 1KF6A 5AQSB 3PJAJ 4ZZCA 3PUAA 3JC6C 2PJQA 4DVDA 3VRBA 4GK0E 3TLSA 2KT9A 3SWHA 3ZLIA 5HXCA 1E7PA 1B7TA 3NRYA 2B76A 4NPPA 1YKHB 2BG9C 3K1SA 3AEEA 2XQ9A 4HFEA 3PJAA 1I94T 3ETVA 3PUGA 3G06A 3FBLA 3CX7B 4ZEYA 2XTLA 1LRZA 5JREA 2BBJA 3WI3A 1XDOA 2BVLA 5AQLB 2QGSA 5LJNA 4YTNA 2GK9A 3J9X1 4O4JE 4DV7T 1KNZA 4DMVA 1JNRA 4L0RA 5C2TA 3F31A 4PFPA 1HF8A 4CI3B 2LSIA 4DV4T 4DV3T 4X5TA 3RYFE 1NENA 4CI2B 3AA0B 5LMUT 4H63H 2K3WA 2XAJB 5FY1A 2X9XA 4YT0A 3ZYKA 4BJMA 3ANWB 4JEUB 4B6XA 4WYVA 2A3DA 3AEGA 5FXWA 4PK4A 3L8RA 4GYRA 3T1YT 3OYXA 4H9QC 3PU3A 4KHPT 3PE0A 1H7CA 2L3LA 3UT5E 5FVKA 3EUHA 2QRXA 1XZYA 3RRWA 4JBWF 3HA4A 4HWHA 1UURA 2YINA 2X0LB 3MK7C 1XMOT 4GYSA 5C8YE 3C64A 2E9XB 4YTMA 2BS4A 2BS3A 4OHFA 4UR9A 4JLEA 1XDPA 2ZM0A 3ZN1B 2QVAA 2UUCT 4KMCA 4IE0A 3V5UA 2UUBT 3N9PA 2XAFB 2YEVC 2BG9B 5CA1E 4A98A 3ZSTA 2FJEA 5HXSA 3ONJA 2F4VT 4XBFB 4CN6A 4FI5A 5LMNT 3N2KE 2X66A 4B3TT 4WZXA 1N32T 2NTXA 3PURA 4I55E 3HKEE 2XJ7A 3AA6B 5EK4A 4YJ3E 3PUSA 5J2UE 4GKKT 2UXDT 4IDPA 4XAXB 4TN7B 3I9WA 3ZPOA 5LP6E 1QUUA 2Y48B 3QK6A 2LE8A 3W15B 2H88A 4IDOA 3AAIA 2D2SA 5FMNA 1BR2A 4DNDA 5L4HA 3Q5XA 3KV5A 4Z91A 2W0GA 2LKHA 3CVRA 1S35A 3VKHA 4HEAA 2MOZA 3N9NA 1D0XA 3ZMUB 3KFWX 1ZV4X 1QLBA 4EIWA 3K3OA 5JDQA 3O1IA 4DR7T 2SPCA 1N36T 1KNPA 3T8OA 4HFVA 5AQQB 2XY8B 4CXYA 5L4EA 5LGTB 2WCAA 3H3AA 4ZHQE 4UV9B 3D0TA 4YHHT 2G0UA 4EOZB 5AQOB 3MKDA 1FIOA 3UU5A 5LHHB 3I1AA 3MA9A 3RH3A 3UU3A 2RP4A 1S94A 1G8XA 3FZLB 2CRBA 3RRCA 1MNEA 2WP9A 5HEUA 1FMWA 4CXXA 4NXNT 2CCQA 3ZCIA 2XHEB 4GIWA 5HWYA 4JEHB 4X66T 2WS3A 3QB5A 3P4WA 4O4HE 4OK0A 2I6HA 4UF0B 3X1DA 2DLRA 2HN1A 3UUBA 3KV9A 4NIQA 2K5BB 4AKRB 5J2TE 3OYZA 4YHJA 2PFVA 2YDQA 4PJJA 3MZKB 2K48A 2KWIB 4QH1A 1ZEEA 3P7IA 4GK5E 4AKLA 2W2UA 4CZZB 5EK2A 2VB6A 3UU6A 3Q2MA 3LK2B 4ZS3A 5M4YA 4QH4A 3DP7A 4YLHA 5JDFA 2E9XD 2IUBA 4HN9A 2VVSA 4L9IA 4AQGA 4PJLA 4HFDA 3JC6D 5LGUB 4J2CA 1D1CA 2XASB 2WWVA 3FB2A 4EYYR 3UUMA 2V7IA 1D1AA 2BBHA 3C4XA 4PJMA 3ZT7A 5BMVE 3AE6A 4LFCT 2YOEA 4DV0T 4OX9T 4JI4T 4EEDA 2C5KT 5IHYA 3VHLA 1UX5A 3QB5K 3PV0F 5LCYA 3M3ZB 3NVOA 4TV9E 3GMIA 2BDEA 2L9QA 4QHOA 1SHZC 5FY7A 5IYZE 2NWBA 3Q5DA 4JI2T 5HWXA 1IBKT 5J1GA 4OFZA 2VQFT 2EHOC 2ZM2A 3RHWA 2JJ9A 4IE7A 4TNVA 4JI8T 3QUJA 1X9BA 5L2LA 5F5WA 4N78D 1Y64B 3RKOA 1U5PA 1UK5A 3N9MA 2X9YA 3CX8B 2VURA 2KXPB 4K0KT 4QKNA 2D5UA 3LDQB 1T72A 2J4GA 3KVAA 4DR2T 4LFBT 3P8CD 1YXRA 1XNQT 3AAAB 1E1HB 5HXEA 1IBMT 3ANWA 1WR6A 4UELA 3JAEA 2H7VC 4NUUA 1J5ET 1MMGA 3HKCE 3R84B 3FZMB 3QNUA 3IHRA 2W63A 5HYAA 2LOPA 3BQKA 4TUYE 3K8PC 4NXMT 2W4XA 2LHRA 5JDMA 4OYKA 2Z6EA 3AVRA 5HXRA 5FXZA 3DJBA 2BS2A 2C5JA 3KBUA 2HH7A 3E22E 4IDQA 4L5GA 2E9XA 3AVSA 4XZCA 3TLWA 4IE4A 3SS1A 3UQ4A 3NBXX 3ZEFB 2JMKA 3NWIA 3SFDA 2V6YB 4DR1T 1HS7A 2BG9A 3SFEA 4K0UA 2W62A 3RI5A 3RIAA 2ACXA 2BKOA 3L39A 5AQJB 2EHOB 4O2BE 5AQVB 4X20E 4UEMA 3RX6A 3ZYMA 2VK9A 5L3DB 2MTQA 1WYCA 1M7KA 4A97A 2MPKA 3ETUA 5AQTB 3VKGA 2C5IT 4MHCA 2UXCT 4QWNB 3MJXA 3B5MA 1BR1A 1YQ3A 1IBLT 2WMNA 3NRXA 1KNRA 4IE6A 4HE8A 3PUVF 2J62A 3NKZA 4UXNB 1XMQT 4ZZBA 2CMRA 4IIJE 2A9UA 3TKLB 2V5DA 2KMFA 3FZHB 2CXDA 1FJGT 4H9OC 4ZI3D 2FBWA 2FJDA 4B3RT 3LBXB 3M65A 2IAKA 2XQ7A 3OPCA 2ZMAA 3C50A 4V1Av 5JDNA 4DUYT 2JIWA 2KZ7B 5LJMA 2DWGA 2E2AA 2M67A 4DMWA 2C0SA 3RQWA 1J1JA 3P4PA 2K24A 2W66A 3EI0A 4ILBA 2YKSA 5H6RB 2X68A 5FVLA 3N9OA 5H6QB 2X0HA 1D1BA 1OWAA 2KWHA 3RC3A 3AAEB 4LMKA 2DI4A 3MXZA 4U7IA 4HFHA 2XAGB 4H9PC 5JR9C 4C91A 3EDVA 3RIUC 4ILUA 3A5XA 5L3FB 3HKBE 3AXJB 5ABFB 4AISA 3T1HT 4O4IE 3ZT5A 5BR8T 3LSVA 3PUYF 1MMAA 2YN6A 3VR8A 3JAFA 2HPJA 4UF0A 1CHUA 2N2NA 1IAPA 2NR4A 5LB7B 1XWMA 2N1GA 4YXDA 2NOXA 2JPFA 4QH5A 3IBPA 1ZHCA 3RGLA 3P50A 3F57A 5L3BB 2WZIA 4Z8XA 2D0TA 1HNWT 1HTJF 1T7SA 2YU2A 2V7JA 5KXJA 4AXPA 2XQ8A 2KINB 3ZMTB 4TV8E 4HWDA 3R6NA 1HNXT 2OLTA 3E0ZA 3LK42 4PK5A 4QX8B 4YY3T 4ZXLA 4LF4T 2NTYA 1SUMB 4OYJA 1OEDE 4H9RC 2WDVA 5CA0E 5IWAT 3HI2A 2Q9QC 5KMGP 3OBVE 2M6BA 2VKHA 4MALA 2ZLYA 4LFAT 4JI1T 4TWHA 4ISTA 3I0OA 2BVMA 4QXHB 3BQIA 3A8YC 2QA7A 3F2EA 5LYJE 4JI6T 2EHOD 3UFGA 4WBNE 1XNRT 3ZMSB 1KFYA 2AE9A 3PDYA 3N9QA 3N2GE 2LKGA 2HHHT 2E5LT 4ILCA 4AQFA 5LG3A 2X51A 2DWKA 2LM2A 4WNKA 3EAMA 1NWMX 2KSRA 3P4SA 1OXZA 5JR9B 4IDNA 2W61A 3OJAA 3ZN0B 4Z90A 2YK0A 4A5XA 4AI6A 3ZYLA 3ESLA 4H63V 1VCTA 2V26A 5DQWA 2NW7A 4DR3T 4X1YE 2JMHA 3AEFA 3HKDE 4ZI2C 2V7KA 3NZPA 2X67A 5LA6E 3Q9DA 2K9AA 1MIWA 2M6IA 3SOLA 4EB6E 3BK9A 4E7ZA 5KDMC 1R8IA 4ISSA 5CFBA 1MIVA 3CWZB 4C90A 3O4XE 4H9NC 2Y6XA 3ZC0A 2CLYC 1YW0A 4JUYA 2CPTA 2IHR1 1OEDC 4PK6A 3P4QA 1US7B 4HTEA 3OTOT 2DL1A 2X0YA 2NW9A 4TNWA 5FL0A 3HL6A 2KNDA 3DTOA 5LOVE 2XQ4A 3K3QC 2J1DG 2DCFA 2UUAT 5LHIB 2Q9QB 4LMLA 3TLVA 3RYIE 1W0BA 2OA5A 2V7LA 5LGNB 1VOMA 2WDRA 2V6YA 2XQAA 3N5LA 3UULA 3Q5EA 4EGWA 1DU2A 4GOUA 5JDHA 1V9DA 4U72A 4TX5A 4QXBB 1WCRA 2JRKA 3C51A 2BKPA 5L3CB 2LSKA 2X9WA 2CHNA 2EHOA 2CHOA 3N2OA 5FYMA 1GQEA 1X79A 4JI5T 4ANJA 2WAUA 4A56A 2IC6A 4PFOA 4DR6T 1W0AA 3O1HA 5ABEA 4ZS2A 4ILAA 2IMLA 2CA5A 3FXDB 4IL4A 2BKNA 5AQGB 1UX4A 5HEGA 3U3IA 5GONE 5HAXA 2VQET 2KLQA 3GWHA 5J0ZA 1FEWA 5LHGB 3LBXA 2WQYA 2V6XA 4U2ZA 4LF7T 5CB4E 2ACZA 2E5VA 2HPLA 2OV9A 4AQYT 5L3GB 2XM1A 2MAWA 4TWDA 2CLYB 2LSGA 3UQ7A 4BJNA 1OEDB 2WU2A 2L8KA 3VU7H 3RIFA 1Y01A 1HX1B 4LF8T 3IF8B 4DR5T 5LNKA 3ZSSA 5DABA 1JNZA 2YDRA 4EYUA 4F8HA 4DV6T 1CUNA 3PUQA 1LVFA 1AJ3A 3TLTA 2XQ3A 3MACA 2XUEA 3O9XA 4I4TE 3N9LA 4QXCB 2W67A 2E8IA 4IT4A 4U31A 4IREA 3AXJA 5ABFA 4COFA 3FXEB 2JQ9A 2H89A 4I43B 2IC9A 2QYWA 3C4ZA 1UUSA 5CGMA 4GKJT 1WLXA 4M1PA 5LBMA 4LF5T 2V1DB 2WY2A 3WAJA 4IE5A 4JI0T 3QC9A 2VKJA 4H9SE 4G63A 1HCIA 3NZQA 2IDOB 2LT3A 3P4RA 4EEBA 2RA1A 2XAHB 2CBJA 2LRKA 2NP9A 4YSZA 4DV5T 2ODUA 4UVBB 1E2AA 2J47A 1WYBA 3A7MA 5JRCB 2CXFA 3QOFA 4WW0A 4KP3C 2VWAA 4CQIA 2D9DA 4HWCA 2Q9QD 1HG2A 4AIUA 5JTGA 4P0BA 3CX6B 2CBIA 2UU9T 4IGUA 4EXTA 2R6GF 3KV4A 2XSAA 5FL1A 2H7OA 4U33A 2WZHA 3ABVA 2XQYA 4MLKA 3ONLC 2LEHA 4O2AE 3LG7A 2FJAA 5ADXL 4X1KE 2H3RA 3CMLA 3UTKA 3ZT6A 2MBGA 4E7SA 2I0MA 5AQUB 3ZMVB 3UU8A 1W9RA 4ZOLE 4JYAT 5EK3A 3CQXC 5LG4A 3J7Yq 2Y8DA 4U7YA 3Q5WA 1MMNA 3KBTA 5AQPB 5JR9A
chains in the Genus database with same CATH topology
4L9IA 4AQGA 3RYCE 4PJLA 5LXTE 2EHOD 4WBNE 3JC6D 5LGUB 4AKIA 3ZMSB 4J2CA 1D1CA 2VASA 2WMOA 3PDYA 4P0AA 3N9QA 3N2GE 2XASB 5FXVA 4ZI2D 3GN5B 1IZNB 3FB2A 4EYYR 4AQFA 5FXXA 4DBRA 3UUMA 4YJ2E 2V7IA 1D1AA 2X51A 2DWKA 3C4XA 4PJMA 5ETWA 5KX5E 5BMVE 5JQGE 3KDSE 4WNKA 1NWMX 2C5KT 4U74A 5JDLA 1OXZA 5IHYA 4ADZA 5HXHA 5JDGA 3VHLA 3EVYA 5JR9B 3CQCB 2W61A 3OJAA 4ERRA 1BR0A 1UX5A 5LCYA 2WM9A 3ZN0B 4HGAA 2YK0A 4BAYB 3ZMZB 4AI6A 4TV9E 3GMIA 3ZYLA 3ESLA 4UV8B 2BDEA 2E9XC 1LVKA 4UVCB 4H63V 2L9QA 4QHOA 3FBZA 1SHZC 1KK7A 2LHNA 5LBQB 5FY7A 5IYZE 2NWBA 2V26A 5DQWA 3C4WA 5HWXA 2NW7A 5J1GA 4OFZA 4X1YE 2EHOC 2X9HA 2ZM2A 3PUAA 2JMHA 3JC6C 2PJQA 2BZBA 4DVDA 1SA0E 4EZHA 2JJ9A 4IE7A 4GK0E 3HKDE 1BR4A 2KT9A 3QUJA 4ZI2C 3SWHA 3ZLIA 2V7KA 5HXCA 3NZPA 4CI1B 5L2LA 4N78D 2X67A 1B7TA 3NRYA 2B1EA 5LA6E 3Q9DA 1YKHB 2K9AA 1Y64B 3RKOA 1MIWA 1U5PA 3N9MA 3UUXB 2X9YA 3SOLA 4EB6E 4PJNA 3BK9A 3CX8B 3ETVA 3PUGA 2KXPB 4E7ZA 3FBLA 4ASKA 4QKNA 3CX7B 4ISSA 5KDMC 2D5UA 2XTLA 3F2EA 4G2AA 1LRZA 4WBOA 4F6RC 5JREA 1MIVA 3CWZB 3WI3A 2LOSA 4C90A 1ZKEA 2BVLA 2QGSA 3O4XE 3UUNA 5LJNA 2Q9QA 2GK9A 4H9NC 2LSJA 3J9X1 4HKAA 4O8SA 2Y6XA 4O4JE 3ZJ1A 3ZC0A 3KVAA 2CLYC 3P8CD 1YW0A 4EZ4A 4JUYA 3AAAB 3KV6A 2DHRA 2XAQB 2YU1A 4PK6A 1YKEB 1KNZA 1E1HB 4DMVA 3IEEA 1US7B 5HXEA 4HTEA 3ANWA 3LJCA 4L0RA 3ZJ2A 2A72A 1WR6A 4DO0A 4UELA 3F31A 4PFPA 2H7VC 3H37A 4KBMB 1HF8A 4NUVA 4CI3B 3U78A 2NW9A 4NUUA 1MMGA 3HKCE 2LSIA 3R84B 2UXXB 3HL6A 2KNDA 2VL8A 3DTOA 5LOVE 5TAOA 2D0UA 1EZ3A 3IHRA 2W63A 3K3QC 2J1DG 5HYAA 2DCFA 2VKOA 3RYFE 5LHIB 2LOPA 2Q9QB 4CI2B 3AA0B 3BQKA 4X1IE 5DQVA 4TUYE 3RYIE 2OA5A 4H63H 3K8PC 5FY0A 2V7LA 2LHRA 5JDMA 5LGNB 4OYKA 2Z6EA 3AVRA 1VOMA 2XAJB 5FY1A 5HXRA 2W00A 5FXZA 2X9XA 3DJBA 1MIYA 3ZYKA 3CKDA 3N5LA 3UULA 3RYHE 4BJMA 2MYSA 1HFAA 3ANWB 4GOUA 4JEUB 5JDHA 1V9DA 5JVDE 4U72A 2CXLA 2C5JA 4B6XA 3ZCJA 3KBUA 2HH7A 5EZYE 2A3DA 3E22E 4L5GA 4TX5A 5FNVE 5FXWA 4PK4A 4QXBB 2E9XA 3AVSA 4XZCA 4QX7B 3C51A 2JRKA 4IE4A 3KINB 3PU8A 4GYRA 5L3CB 3OYXA 3SS1A 4H9QC 2LSKA 3PU3A 2X9WA 3PE0A 2EHOA 1H7CA 3N2OA 2L3LA 3NBXX 3ZEFB 4ZI3C 2JMKA 4KUMB 5FYMA 1X79A 4I50E 3UT5E 5AFUL 3EUHA 3PTRB 3RRWA 4ANJA 3HA4A 4PW8A 1HS7A 2WAUA 4A56A 2YINA 2W62A 2X0LB 2ZM8A 4K0UA 4PNIA 3MK7C 3AB3B 2IC6A 4GYSA 5C8YE 4PFOA 2ODVA 3O1HA 3C64A 2ACXA 2E9XB 2NW8A 3LK3B 4OHFA 4ZS2A 4JLEA 2A2FX 2EHOB 4O2BE 2CA5A 3FXDB 2ZM0A 4X20E 4UEMA 3ZN1B 2CEAA 2WWUA 4AQFC 3RX6A 3ZYMA 2VK9A 5L3DB 4KMCA 4BA9A 3ONXA 1UX4A 3U3IA 4IHJE 4IE0A 3V5UA 2UXNB 2MTQA 3N9PA 1WYCA 2IW5B 2XAFB 2YEVC 3LFMA 5GONE 5CA1E 4EAHA 2PBIA 3B13A 2ES0A 5HAXA 2WBLA 3ETUA 2KLQA 3GWHA 3VKGA 4DBQA 5HXSA 1FEWA 2C5IT 3LBXA 4MHCA 5LHGB 4XBFB 2LM9A 4FI5A 4QWNB 3N2KE 3MJXA 1BR1A 4IDZA 2X66A 5CB4E 3I9YA 2HPLA 2WMNA 2NTXA 3V5SA 3PURA 4I55E 3NRXA 3RPUA 3HKEE 5L3GB 3AA6B 4IE6A 2JQQA 4HE8A 2CLYB 2WSSV 5EK4A 4YJ3E 1VRBA 2LSGA 3PUSA 5A1LA 4UXNB 5J2UE 4BJNA 2L8KA 3O1JA 2CMRA 1HG5A 3HR0A 3VU7H 4XAXB 4IIJE 3FHNA 4TN7B 1IJ5A 2KMFA 3TKLB 2I59A 2CXDA 3I9WA 3ZPOA 5LP6E 1QUUA 4H9OC 4ZI3D 2Y48B 3QK6A 2LE8A 3WAKA 3W15B 3IF8B 3LBXB 3M65A 5LNKA 2IAKA 3AAIA 2D2SA 5FMNA 2ZMAA 3C50A 1BR2A 4V1Av 4DNDA 2LSYA 5JDNA 5DABA 1NAFA 2KZ7B 3Q5XA 3I0QA 5LJMA 2DWGA 3KV5A 4EYUA 1CUNA 3PUQA 1LVFA 1AJ3A 4O4LE 2M67A 4DMWA 3MACA 2PG8A 4TZ4C 2W0GA 2C0SA 2XUEA 3O9XA 4I4TE 1IJ6A 3N9LA 3CVRA 2K24A 4QXCB 1S35A 2E8IA 1MMDA 3VKHA 4HEAA 5H6RB 3OKQA 3C98B 2X68A 2MOZA 2VKDA 3AA7B 3FXEB 3N9NA 1D0XA 3AA1B 3N9OA 5H6QB 1D1BA 3ZMUB 3L3PA 3K3NA 2IC9A 3KFWX 4I43B 1ZV4X 1QSDA 4EIWA 3K3OA 5JDQA 3O1IA 3L09A 3C4ZA 4PAGA 3GA8A 2N9DA 2SPCA 1OWAA 2KWHA 3RC3A 3AAEB 1WLXA 5E0OA 1YD8G 3T8OA 2DI4A 4M1PA 4HFVA 2CE7A 3MXZA 3CQGB 4ZI7E 2XAGB 4H9PC 5JR9C 5JRCA 5LBMA 1D0YA 2V1DB 4C91A 3EDVA 3WAJA 4IE5A 4UIGA 3QC9A 4CXYA 2VKJA 5LGTB 4ILUA 4H9SE 4G63A 1HCIA 3NZQA 3H3AA 4ZHQE 4UV9B 3A5XA 5L3FB 2LT3A 1UCUA 3D0TA 3HKBE 2G0UA 4O4IE 2RA1A 1G73A 2XAHB 2NP9A 4EOZB 3MKDA 1FIOA 1MMAA 2ODUA 5LHHB 2V7MA 3I1AA 4UVAB 4UVBB 2HPJA 3MA9A 4UF0A 3CPZA 3RH3A 2RP4A 1D0ZA 1IAPA 1S94A 2N2NA 1G8XA 1O3XA 2LJLA 3ZC1A 1WYBA 3RRCA 4FJOA 1MNEA 5JRCB 1FMWA 2CXFA 4YFSA 4CXWA 4MFRA 2N1GA 4P09A 4CXXA 1LKXA 1WRDA 2NOXA 2JPFA 2CCQA 2CM0A 4WW0A 3ZCIA 3EDUA 2XHEB 5DJQC 4KP3C 2VWAA 1U4QA 4CQIA 3IBPA 1ZHCA 2Q9QD 1HG2A 4GIWA 5HWYA 5JH7E 4JEHB 3F57A 5L3BB 4Z8XA 2D0TA 1HTJF 3KVBA 4P0BA 2YU2A 2V7JA 3CX6B 1FMVA 4O4HE 4OK0A 4AXPA 4UF0B 1HX8A 4IGUA 2DLRA 4EXTA 2KINB 3ZMTB 2P9BA 3KV9A 4TV8E 5F8PA 3R6NA 3UFEA 2K5BB 3B57A 3E0ZA 4MBQA 1MNDA 3LK42 3KV4A 4AKRB 5J2TE 2DNXA 3S4UA 4PK5A 2H7OA 2XQYA 4QX8B 5F3JA 2CWYA 1Z0PA 4MLKA 4AKGA 2CWOA 2NTYA 3OYZA 2PFVA 4YHJA 4OYJA 3MZKB 4PJJA 2LEHA 4O2AE 3LG7A 4H9RC 2K48A 2KWIB 5ADXL 1ZEEA 5CA0E 3P7IA 4X1KE 2H3RA 3E08A 4GK5E 3CMLA 4AKLA 3BQLA 3HI2A 5FP3A 3UTKA 2Q9QC 3GN5A 4CZZB 5EK2A 2MBGA 4E7SA 5KMGP 3OBVE 5L3EB 2VKHA 2VB6A 4MALA 3ZMVB 2ZLYA 3Q2MA 3LK2B 4ZS3A 4ZOLE 4ISTA 3I0OA 5M4YA 5EK3A 3CQXC 5LG4A 2BVMA 4QXHB 3DP7A 3J7Yq 2Y8DA 3SRZA 3BQIA 4YLHA 2QA7A 1MMNA 1T98A 3Q5WA 3RC8A 3KBTA 5JDFA 2E9XD 5LYJE 5JR9A 4AKHA 4HN9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K9A A;  4ZI3 D;  4ZI2 D;  4ZI3 C;  4ZI2 C; 
#chains in the Genus database with same CATH topology
 3RIU A;  3AE3 A;  3OVU A;  2WB5 A;  2VAS A;  2WMO A;  4ZI2 D;  5FXV A;  3GN5 B;  1IZN B;  5FXX A;  4DBR A;  1HNZ T;  4YJ2 E;  3IA3 A;  1M62 A;  4DUZ T;  2XSB A;  5KX5 E;  5AQF B;  3EAB A;  4ADZ A;  4KHZ F;  3EVY A;  2WM9 A;  4HGA A;  5ABG A;  4BAY B;  4UVC B;  2VL0 A;  5LBQ B;  3C4W A;  2X9H A;  4EV6 A;  2BZB A;  1SA0 E;  3AE2 A;  4EZH A;  2XQ5 A;  1BR4 A;  5FKY A;  4JI7 T;  4CI1 B;  4DR4 T;  2B1E A;  4YTP A;  3UUX B;  5CJ5 A;  4U2Y A;  4PJN A;  1WFD A;  4KI0 F;  4ASK A;  4HWF A;  5C3J A;  5L47 A;  4G2A A;  4WBO A;  4F6R C;  2LOS A;  1ZKE A;  2WDQ A;  3UUN A;  2Q9Q A;  2LSJ A;  4HKA A;  3AE4 A;  4O8S A;  3ZJ1 A;  4EZ4 A;  2ZM6 T;  3KV6 A;  4DV1 T;  2DHR A;  2XAQ B;  2YU1 A;  1YKE B;  3PUW F;  3IEE A;  1HR0 T;  3ZKR A;  3LJC A;  3ZJ2 A;  2A72 A;  4DO0 A;  1WR0 A;  3H37 A;  4KBM B;  4NUV A;  3U78 A;  2RPA A;  2UXX B;  2VL8 A;  2FUP A;  5TAO A;  2D0U A;  1EZ3 A;  2VKO A;  4X1I E;  5DQV A;  4LMJ A;  5FY0 A;  4Q25 A;  1VCS A;  3RLF F;  3AE9 A;  2V8S V;  2W00 A;  1MIY A;  3CKD A;  5HCM A;  3RYH E;  2MYS A;  1HFA A;  3H3M A;  5JVD E;  2CXL A;  4YSX A;  3ZCJ A;  2UXB T;  5EZY E;  5HEH A;  5FNV E;  4QX7 B;  4X62 T;  3KIN B;  3PU8 A;  3VR9 A;  2LRL A;  4ZI3 C;  5AQH B;  4KUM B;  4P1N A;  4HWI B;  4I50 E;  4KX6 A;  5AFU L;  2JQK A;  1NEK A;  3PTR B;  4X64 T;  4PW8 A;  2ZM8 A;  4PNI A;  1Z8U A;  2AXD S;  3AB3 B;  4JV5 T;  2YDS A;  2ODV A;  3FZK B;  3LK3 B;  2NW8 A;  2A2F X;  3AEB A;  1KEY A;  2CEA A;  2WWU A;  4AQF C;  4BA9 A;  3ONX A;  4IHJ E;  3PUZ F;  2VVN A;  2UXN B;  1OED A;  2IW5 B;  3LFM A;  4EAH A;  2PBI A;  3B13 A;  2ES0 A;  2WBL A;  1ZOY A;  4DBQ A;  2LM9 A;  4IDZ A;  2HN2 A;  3I9Y A;  3V5S A;  4IL9 A;  3RPU A;  5AQM B;  2LLY A;  2JQQ A;  2WSS V;  1VRB A;  5A1L A;  3PUX F;  3O1J A;  1HG5 A;  3HR0 A;  3FHN A;  1IJ5 A;  4TWF A;  2I59 A;  3WAK A;  5AQI B;  2XQ6 A;  4LF9 T;  2LSY A;  1NAF A;  3I0Q A;  3AE7 A;  5HEJ A;  5IUX A;  4O4L E;  2PG8 A;  4TZ4 C;  1IJ6 A;  3VRA A;  3AE1 A;  2IIU A;  3AE5 A;  3TLU A;  3EHZ A;  1MMD A;  3OKQ A;  3C98 B;  2VKD A;  3AA7 B;  3AA1 B;  4DV2 T;  2V5C A;  4JI3 T;  3L3P A;  3K3N A;  1W09 A;  1QSD A;  4LF6 T;  3RF1 A;  3L09 A;  4PAG A;  3GA8 A;  2N9D A;  2XPK A;  5E0O A;  1YD8 G;  2CE7 A;  4ZI7 E;  3CQG B;  1I6Z A;  5JRC A;  5AQN B;  1J5W A;  1D0Y A;  2FJB A;  4UIG A;  5AQK B;  3AED A;  1UCU A;  1G73 A;  2V7M A;  4CN4 A;  4UVA B;  3CIR A;  3CPZ A;  1D0Z A;  1L0V A;  1O3X A;  2LJL A;  3ZC1 A;  5ABH A;  4FJO A;  3UU4 A;  4YFS A;  4CXW A;  2WU5 A;  4MFR A;  4P09 A;  3FZF B;  1LKX A;  1WRD A;  2CM0 A;  3EDU A;  5AQR B;  5DJQ C;  1U4Q A;  2BG9 E;  4HFB A;  5JH7 E;  2JQH A;  3KVB A;  1FMV A;  1UGO A;  1HX8 A;  4X65 T;  2P9B A;  5F8P A;  3UFE A;  3B57 A;  4HFI A;  4U3C A;  4MBQ A;  1MND A;  2DNX A;  3S4U A;  5F3J A;  2CWY A;  3AEA A;  1Z0P A;  4AKG A;  2CWO A;  4YSY A;  3AE8 A;  2XZE A;  3RKG A;  1ZP0 A;  3E08 A;  1N33 T;  3CK6 A;  3BQL A;  5FP3 A;  3GN5 A;  5L3E B;  1T8B A;  4I0U A;  3SRZ A;  3JCF A;  1SE7 A;  1T98 A;  3RC8 A;  4AKH A;  3RYC E;  2PTF A;  4CN1 A;  5LXT E;  4AKI A;  4P0A A;  4B3S T;  5HCJ A;  3JAD A;  5ETW A;  4B3M T;  5JQG E;  3KDS E;  2XM2 A;  4DID B;  3RQU A;  4U74 A;  5JDL A;  5HXH A;  5JDG A;  3CQC B;  1BR0 A;  3AEC A;  4ERR A;  4HFC A;  5HEO A;  3ZMZ B;  1YQ4 A;  4UV8 B;  1N34 T;  2E9X C;  1LVK A;  3FBZ A;  1KK7 A;  2LHN A;  1KF6 A;  5AQS B;  3PJA J;  4ZZC A;  3PUA A;  3JC6 C;  2PJQ A;  4DVD A;  3VRB A;  4GK0 E;  3TLS A;  2KT9 A;  3SWH A;  3ZLI A;  5HXC A;  1E7P A;  1B7T A;  3NRY A;  2B76 A;  4NPP A;  1YKH B;  2BG9 C;  3K1S A;  3AEE A;  2XQ9 A;  4HFE A;  3PJA A;  1I94 T;  3ETV A;  3PUG A;  3G06 A;  3FBL A;  3CX7 B;  4ZEY A;  2XTL A;  1LRZ A;  5JRE A;  2BBJ A;  3WI3 A;  1XDO A;  2BVL A;  5AQL B;  2QGS A;  5LJN A;  4YTN A;  2GK9 A;  3J9X 1;  4O4J E;  4DV7 T;  1KNZ A;  4DMV A;  1JNR A;  4L0R A;  5C2T A;  3F31 A;  4PFP A;  1HF8 A;  4CI3 B;  2LSI A;  4DV4 T;  4DV3 T;  4X5T A;  3RYF E;  1NEN A;  4CI2 B;  3AA0 B;  5LMU T;  4H63 H;  2K3W A;  2XAJ B;  5FY1 A;  2X9X A;  4YT0 A;  3ZYK A;  4BJM A;  3ANW B;  4JEU B;  4B6X A;  4WYV A;  2A3D A;  3AEG A;  5FXW A;  4PK4 A;  3L8R A;  4GYR A;  3T1Y T;  3OYX A;  4H9Q C;  3PU3 A;  4KHP T;  3PE0 A;  1H7C A;  2L3L A;  3UT5 E;  5FVK A;  3EUH A;  2QRX A;  1XZY A;  3RRW A;  4JBW F;  3HA4 A;  4HWH A;  1UUR A;  2YIN A;  2X0L B;  3MK7 C;  1XMO T;  4GYS A;  5C8Y E;  3C64 A;  2E9X B;  4YTM A;  2BS4 A;  2BS3 A;  4OHF A;  4UR9 A;  4JLE A;  1XDP A;  2ZM0 A;  3ZN1 B;  2QVA A;  2UUC T;  4KMC A;  4IE0 A;  3V5U A;  2UUB T;  3N9P A;  2XAF B;  2YEV C;  2BG9 B;  5CA1 E;  4A98 A;  3ZST A;  2FJE A;  5HXS A;  3ONJ A;  2F4V T;  4XBF B;  4CN6 A;  4FI5 A;  5LMN T;  3N2K E;  2X66 A;  4B3T T;  4WZX A;  1N32 T;  2NTX A;  3PUR A;  4I55 E;  3HKE E;  2XJ7 A;  3AA6 B;  5EK4 A;  4YJ3 E;  3PUS A;  5J2U E;  4GKK T;  2UXD T;  4IDP A;  4XAX B;  4TN7 B;  3I9W A;  3ZPO A;  5LP6 E;  1QUU A;  2Y48 B;  3QK6 A;  2LE8 A;  3W15 B;  2H88 A;  4IDO A;  3AAI A;  2D2S A;  5FMN A;  1BR2 A;  4DND A;  5L4H A;  3Q5X A;  3KV5 A;  4Z91 A;  2W0G A;  2LKH A;  3CVR A;  1S35 A;  3VKH A;  4HEA A;  2MOZ A;  3N9N A;  1D0X A;  3ZMU B;  3KFW X;  1ZV4 X;  1QLB A;  4EIW A;  3K3O A;  5JDQ A;  3O1I A;  4DR7 T;  2SPC A;  1N36 T;  1KNP A;  3T8O A;  4HFV A;  5AQQ B;  2XY8 B;  4CXY A;  5L4E A;  5LGT B;  2WCA A;  3H3A A;  4ZHQ E;  4UV9 B;  3D0T A;  4YHH T;  2G0U A;  4EOZ B;  5AQO B;  3MKD A;  1FIO A;  3UU5 A;  5LHH B;  3I1A A;  3MA9 A;  3RH3 A;  3UU3 A;  2RP4 A;  1S94 A;  1G8X A;  3FZL B;  2CRB A;  3RRC A;  1MNE A;  2WP9 A;  5HEU A;  1FMW A;  4CXX A;  4NXN T;  2CCQ A;  3ZCI A;  2XHE B;  4GIW A;  5HWY A;  4JEH B;  4X66 T;  2WS3 A;  3QB5 A;  3P4W A;  4O4H E;  4OK0 A;  2I6H A;  4UF0 B;  3X1D A;  2DLR A;  2HN1 A;  3UUB A;  3KV9 A;  4NIQ A;  2K5B B;  4AKR B;  5J2T E;  3OYZ A;  4YHJ A;  2PFV A;  2YDQ A;  4PJJ A;  3MZK B;  2K48 A;  2KWI B;  4QH1 A;  1ZEE A;  3P7I A;  4GK5 E;  4AKL A;  2W2U A;  4CZZ B;  5EK2 A;  2VB6 A;  3UU6 A;  3Q2M A;  3LK2 B;  4ZS3 A;  5M4Y A;  4QH4 A;  3DP7 A;  4YLH A;  5JDF A;  2E9X D;  2IUB A;  4HN9 A;  2VVS A;  4L9I A;  4AQG A;  4PJL A;  4HFD A;  3JC6 D;  5LGU B;  4J2C A;  1D1C A;  2XAS B;  2WWV A;  3FB2 A;  4EYY R;  3UUM A;  2V7I A;  1D1A A;  2BBH A;  3C4X A;  4PJM A;  3ZT7 A;  5BMV E;  3AE6 A;  4LFC T;  2YOE A;  4DV0 T;  4OX9 T;  4JI4 T;  4EED A;  2C5K T;  5IHY A;  3VHL A;  1UX5 A;  3QB5 K;  3PV0 F;  5LCY A;  3M3Z B;  3NVO A;  4TV9 E;  3GMI A;  2BDE A;  2L9Q A;  4QHO A;  1SHZ C;  5FY7 A;  5IYZ E;  2NWB A;  3Q5D A;  4JI2 T;  5HWX A;  1IBK T;  5J1G A;  4OFZ A;  2VQF T;  2EHO C;  2ZM2 A;  3RHW A;  2JJ9 A;  4IE7 A;  4TNV A;  4JI8 T;  3QUJ A;  1X9B A;  5L2L A;  5F5W A;  4N78 D;  1Y64 B;  3RKO A;  1U5P A;  1UK5 A;  3N9M A;  2X9Y A;  3CX8 B;  2VUR A;  2KXP B;  4K0K T;  4QKN A;  2D5U A;  3LDQ B;  1T72 A;  2J4G A;  3KVA A;  4DR2 T;  4LFB T;  3P8C D;  1YXR A;  1XNQ T;  3AAA B;  1E1H B;  5HXE A;  1IBM T;  3ANW A;  1WR6 A;  4UEL A;  3JAE A;  2H7V C;  4NUU A;  1J5E T;  1MMG A;  3HKC E;  3R84 B;  3FZM B;  3QNU A;  3IHR A;  2W63 A;  5HYA A;  2LOP A;  3BQK A;  4TUY E;  3K8P C;  4NXM T;  2W4X A;  2LHR A;  5JDM A;  4OYK A;  2Z6E A;  3AVR A;  5HXR A;  5FXZ A;  3DJB A;  2BS2 A;  2C5J A;  3KBU A;  2HH7 A;  3E22 E;  4IDQ A;  4L5G A;  2E9X A;  3AVS A;  4XZC A;  3TLW A;  4IE4 A;  3SS1 A;  3UQ4 A;  3NBX X;  3ZEF B;  2JMK A;  3NWI A;  3SFD A;  2V6Y B;  4DR1 T;  1HS7 A;  2BG9 A;  3SFE A;  4K0U A;  2W62 A;  3RI5 A;  3RIA A;  2ACX A;  2BKO A;  3L39 A;  5AQJ B;  2EHO B;  4O2B E;  5AQV B;  4X20 E;  4UEM A;  3RX6 A;  3ZYM A;  2VK9 A;  5L3D B;  2MTQ A;  1WYC A;  1M7K A;  4A97 A;  2MPK A;  3ETU A;  5AQT B;  3VKG A;  2C5I T;  4MHC A;  2UXC T;  4QWN B;  3MJX A;  3B5M A;  1BR1 A;  1YQ3 A;  1IBL T;  2WMN A;  3NRX A;  1KNR A;  4IE6 A;  4HE8 A;  3PUV F;  2J62 A;  3NKZ A;  4UXN B;  1XMQ T;  4ZZB A;  2CMR A;  4IIJ E;  2A9U A;  3TKL B;  2V5D A;  2KMF A;  3FZH B;  2CXD A;  1FJG T;  4H9O C;  4ZI3 D;  2FBW A;  2FJD A;  4B3R T;  3LBX B;  3M65 A;  2IAK A;  2XQ7 A;  3OPC A;  2ZMA A;  3C50 A;  4V1A v;  5JDN A;  4DUY T;  2JIW A;  2KZ7 B;  5LJM A;  2DWG A;  2E2A A;  2M67 A;  4DMW A;  2C0S A;  3RQW A;  1J1J A;  3P4P A;  2K24 A;  2W66 A;  3EI0 A;  4ILB A;  2YKS A;  5H6R B;  2X68 A;  5FVL A;  3N9O A;  5H6Q B;  2X0H A;  1D1B A;  1OWA A;  2KWH A;  3RC3 A;  3AAE B;  4LMK A;  2DI4 A;  3MXZ A;  4U7I A;  4HFH A;  2XAG B;  4H9P C;  5JR9 C;  4C91 A;  3EDV A;  3RIU C;  4ILU A;  3A5X A;  5L3F B;  3HKB E;  3AXJ B;  5ABF B;  4AIS A;  3T1H T;  4O4I E;  3ZT5 A;  5BR8 T;  3LSV A;  3PUY F;  1MMA A;  2YN6 A;  3VR8 A;  3JAF A;  2HPJ A;  4UF0 A;  1CHU A;  2N2N A;  1IAP A;  2NR4 A;  5LB7 B;  1XWM A;  2N1G A;  4YXD A;  2NOX A;  2JPF A;  4QH5 A;  3IBP A;  1ZHC A;  3RGL A;  3P50 A;  3F57 A;  5L3B B;  2WZI A;  4Z8X A;  2D0T A;  1HNW T;  1HTJ F;  1T7S A;  2YU2 A;  2V7J A;  5KXJ A;  4AXP A;  2XQ8 A;  2KIN B;  3ZMT B;  4TV8 E;  4HWD A;  3R6N A;  1HNX T;  2OLT A;  3E0Z A;  3LK4 2;  4PK5 A;  4QX8 B;  4YY3 T;  4ZXL A;  4LF4 T;  2NTY A;  1SUM B;  4OYJ A;  1OED E;  4H9R C;  2WDV A;  5CA0 E;  5IWA T;  3HI2 A;  2Q9Q C;  5KMG P;  3OBV E;  2M6B A;  2VKH A;  4MAL A;  2ZLY A;  4LFA T;  4JI1 T;  4TWH A;  4IST A;  3I0O A;  2BVM A;  4QXH B;  3BQI A;  3A8Y C;  2QA7 A;  3F2E A;  5LYJ E;  4JI6 T;  2EHO D;  3UFG A;  4WBN E;  1XNR T;  3ZMS B;  1KFY A;  2AE9 A;  3PDY A;  3N9Q A;  3N2G E;  2LKG A;  2HHH T;  2E5L T;  4ILC A;  4AQF A;  5LG3 A;  2X51 A;  2DWK A;  2LM2 A;  4WNK A;  3EAM A;  1NWM X;  2KSR A;  3P4S A;  1OXZ A;  5JR9 B;  4IDN A;  2W61 A;  3OJA A;  3ZN0 B;  4Z90 A;  2YK0 A;  4A5X A;  4AI6 A;  3ZYL A;  3ESL A;  4H63 V;  1VCT A;  2V26 A;  5DQW A;  2NW7 A;  4DR3 T;  4X1Y E;  2JMH A;  3AEF A;  3HKD E;  4ZI2 C;  2V7K A;  3NZP A;  2X67 A;  5LA6 E;  3Q9D A;  2K9A A;  1MIW A;  2M6I A;  3SOL A;  4EB6 E;  3BK9 A;  4E7Z A;  5KDM C;  1R8I A;  4ISS A;  5CFB A;  1MIV A;  3CWZ B;  4C90 A;  3O4X E;  4H9N C;  2Y6X A;  3ZC0 A;  2CLY C;  1YW0 A;  4JUY A;  2CPT A;  2IHR 1;  1OED C;  4PK6 A;  3P4Q A;  1US7 B;  4HTE A;  3OTO T;  2DL1 A;  2X0Y A;  2NW9 A;  4TNW A;  5FL0 A;  3HL6 A;  2KND A;  3DTO A;  5LOV E;  2XQ4 A;  3K3Q C;  2J1D G;  2DCF A;  2UUA T;  5LHI B;  2Q9Q B;  4LML A;  3TLV A;  3RYI E;  1W0B A;  2OA5 A;  2V7L A;  5LGN B;  1VOM A;  2WDR A;  2V6Y A;  2XQA A;  3N5L A;  3UUL A;  3Q5E A;  4EGW A;  1DU2 A;  4GOU A;  5JDH A;  1V9D A;  4U72 A;  4TX5 A;  4QXB B;  1WCR A;  2JRK A;  3C51 A;  2BKP A;  5L3C B;  2LSK A;  2X9W A;  2CHN A;  2EHO A;  2CHO A;  3N2O A;  5FYM A;  1GQE A;  1X79 A;  4JI5 T;  4ANJ A;  2WAU A;  4A56 A;  2IC6 A;  4PFO A;  4DR6 T;  1W0A A;  3O1H A;  5ABE A;  4ZS2 A;  4ILA A;  2IML A;  2CA5 A;  3FXD B;  4IL4 A;  2BKN A;  5AQG B;  1UX4 A;  5HEG A;  3U3I A;  5GON E;  5HAX A;  2VQE T;  2KLQ A;  3GWH A;  5J0Z A;  1FEW A;  5LHG B;  3LBX A;  2WQY A;  2V6X A;  4U2Z A;  4LF7 T;  5CB4 E;  2ACZ A;  2E5V A;  2HPL A;  2OV9 A;  4AQY T;  5L3G B;  2XM1 A;  2MAW A;  4TWD A;  2CLY B;  2LSG A;  3UQ7 A;  4BJN A;  1OED B;  2WU2 A;  2L8K A;  3VU7 H;  3RIF A;  1Y01 A;  1HX1 B;  4LF8 T;  3IF8 B;  4DR5 T;  5LNK A;  3ZSS A;  5DAB A;  1JNZ A;  2YDR A;  4EYU A;  4F8H A;  4DV6 T;  1CUN A;  3PUQ A;  1LVF A;  1AJ3 A;  3TLT A;  2XQ3 A;  3MAC A;  2XUE A;  3O9X A;  4I4T E;  3N9L A;  4QXC B;  2W67 A;  2E8I A;  4IT4 A;  4U31 A;  4IRE A;  3AXJ A;  5ABF A;  4COF A;  3FXE B;  2JQ9 A;  2H89 A;  4I43 B;  2IC9 A;  2QYW A;  3C4Z A;  1UUS A;  5CGM A;  4GKJ T;  1WLX A;  4M1P A;  5LBM A;  4LF5 T;  2V1D B;  2WY2 A;  3WAJ A;  4IE5 A;  4JI0 T;  3QC9 A;  2VKJ A;  4H9S E;  4G63 A;  1HCI A;  3NZQ A;  2IDO B;  2LT3 A;  3P4R A;  4EEB A;  2RA1 A;  2XAH B;  2CBJ A;  2LRK A;  2NP9 A;  4YSZ A;  4DV5 T;  2ODU A;  4UVB B;  1E2A A;  2J47 A;  1WYB A;  3A7M A;  5JRC B;  2CXF A;  3QOF A;  4WW0 A;  4KP3 C;  2VWA A;  4CQI A;  2D9D A;  4HWC A;  2Q9Q D;  1HG2 A;  4AIU A;  5JTG A;  4P0B A;  3CX6 B;  2CBI A;  2UU9 T;  4IGU A;  4EXT A;  2R6G F;  3KV4 A;  2XSA A;  5FL1 A;  2H7O A;  4U33 A;  2WZH A;  3ABV A;  2XQY A;  4MLK A;  3ONL C;  2LEH A;  4O2A E;  3LG7 A;  2FJA A;  5ADX L;  4X1K E;  2H3R A;  3CML A;  3UTK A;  3ZT6 A;  2MBG A;  4E7S A;  2I0M A;  5AQU B;  3ZMV B;  3UU8 A;  1W9R A;  4ZOL E;  4JYA T;  5EK3 A;  3CQX C;  5LG4 A;  3J7Y q;  2Y8D A;  4U7Y A;  3Q5W A;  1MMN A;  3KBT A;  5AQP B;  5JR9 A; 
#chains in the Genus database with same CATH homology
 4L9I A;  4AQG A;  3RYC E;  4PJL A;  5LXT E;  2EHO D;  4WBN E;  3JC6 D;  5LGU B;  4AKI A;  3ZMS B;  4J2C A;  1D1C A;  2VAS A;  2WMO A;  3PDY A;  4P0A A;  3N9Q A;  3N2G E;  2XAS B;  5FXV A;  4ZI2 D;  3GN5 B;  1IZN B;  3FB2 A;  4EYY R;  4AQF A;  5FXX A;  4DBR A;  3UUM A;  4YJ2 E;  2V7I A;  1D1A A;  2X51 A;  2DWK A;  3C4X A;  4PJM A;  5ETW A;  5KX5 E;  5BMV E;  5JQG E;  3KDS E;  4WNK A;  1NWM X;  2C5K T;  4U74 A;  5JDL A;  1OXZ A;  5IHY A;  4ADZ A;  5HXH A;  5JDG A;  3VHL A;  3EVY A;  5JR9 B;  3CQC B;  2W61 A;  3OJA A;  4ERR A;  1BR0 A;  1UX5 A;  5LCY A;  2WM9 A;  3ZN0 B;  4HGA A;  2YK0 A;  4BAY B;  3ZMZ B;  4AI6 A;  4TV9 E;  3GMI A;  3ZYL A;  3ESL A;  4UV8 B;  2BDE A;  2E9X C;  1LVK A;  4UVC B;  4H63 V;  2L9Q A;  4QHO A;  3FBZ A;  1SHZ C;  1KK7 A;  2LHN A;  5LBQ B;  5FY7 A;  5IYZ E;  2NWB A;  2V26 A;  5DQW A;  3C4W A;  5HWX A;  2NW7 A;  5J1G A;  4OFZ A;  4X1Y E;  2EHO C;  2X9H A;  2ZM2 A;  3PUA A;  2JMH A;  3JC6 C;  2PJQ A;  2BZB A;  4DVD A;  1SA0 E;  4EZH A;  2JJ9 A;  4IE7 A;  4GK0 E;  3HKD E;  1BR4 A;  2KT9 A;  3QUJ A;  4ZI2 C;  3SWH A;  3ZLI A;  2V7K A;  5HXC A;  3NZP A;  4CI1 B;  5L2L A;  4N78 D;  2X67 A;  1B7T A;  3NRY A;  2B1E A;  5LA6 E;  3Q9D A;  1YKH B;  2K9A A;  1Y64 B;  3RKO A;  1MIW A;  1U5P A;  3N9M A;  3UUX B;  2X9Y A;  3SOL A;  4EB6 E;  4PJN A;  3BK9 A;  3CX8 B;  3ETV A;  3PUG A;  2KXP B;  4E7Z A;  3FBL A;  4ASK A;  4QKN A;  3CX7 B;  4ISS A;  5KDM C;  2D5U A;  2XTL A;  3F2E A;  4G2A A;  1LRZ A;  4WBO A;  4F6R C;  5JRE A;  1MIV A;  3CWZ B;  3WI3 A;  2LOS A;  4C90 A;  1ZKE A;  2BVL A;  2QGS A;  3O4X E;  3UUN A;  5LJN A;  2Q9Q A;  2GK9 A;  4H9N C;  2LSJ A;  3J9X 1;  4HKA A;  4O8S A;  2Y6X A;  4O4J E;  3ZJ1 A;  3ZC0 A;  3KVA A;  2CLY C;  3P8C D;  1YW0 A;  4EZ4 A;  4JUY A;  3AAA B;  3KV6 A;  2DHR A;  2XAQ B;  2YU1 A;  4PK6 A;  1YKE B;  1KNZ A;  1E1H B;  4DMV A;  3IEE A;  1US7 B;  5HXE A;  4HTE A;  3ANW A;  3LJC A;  4L0R A;  3ZJ2 A;  2A72 A;  1WR6 A;  4DO0 A;  4UEL A;  3F31 A;  4PFP A;  2H7V C;  3H37 A;  4KBM B;  1HF8 A;  4NUV A;  4CI3 B;  3U78 A;  2NW9 A;  4NUU A;  1MMG A;  3HKC E;  2LSI A;  3R84 B;  2UXX B;  3HL6 A;  2KND A;  2VL8 A;  3DTO A;  5LOV E;  5TAO A;  2D0U A;  1EZ3 A;  3IHR A;  2W63 A;  3K3Q C;  2J1D G;  5HYA A;  2DCF A;  2VKO A;  3RYF E;  5LHI B;  2LOP A;  2Q9Q B;  4CI2 B;  3AA0 B;  3BQK A;  4X1I E;  5DQV A;  4TUY E;  3RYI E;  2OA5 A;  4H63 H;  3K8P C;  5FY0 A;  2V7L A;  2LHR A;  5JDM A;  5LGN B;  4OYK A;  2Z6E A;  3AVR A;  1VOM A;  2XAJ B;  5FY1 A;  5HXR A;  2W00 A;  5FXZ A;  2X9X A;  3DJB A;  1MIY A;  3ZYK A;  3CKD A;  3N5L A;  3UUL A;  3RYH E;  4BJM A;  2MYS A;  1HFA A;  3ANW B;  4GOU A;  4JEU B;  5JDH A;  1V9D A;  5JVD E;  4U72 A;  2CXL A;  2C5J A;  4B6X A;  3ZCJ A;  3KBU A;  2HH7 A;  5EZY E;  2A3D A;  3E22 E;  4L5G A;  4TX5 A;  5FNV E;  5FXW A;  4PK4 A;  4QXB B;  2E9X A;  3AVS A;  4XZC A;  4QX7 B;  3C51 A;  2JRK A;  4IE4 A;  3KIN B;  3PU8 A;  4GYR A;  5L3C B;  3OYX A;  3SS1 A;  4H9Q C;  2LSK A;  3PU3 A;  2X9W A;  3PE0 A;  2EHO A;  1H7C A;  3N2O A;  2L3L A;  3NBX X;  3ZEF B;  4ZI3 C;  2JMK A;  4KUM B;  5FYM A;  1X79 A;  4I50 E;  3UT5 E;  5AFU L;  3EUH A;  3PTR B;  3RRW A;  4ANJ A;  3HA4 A;  4PW8 A;  1HS7 A;  2WAU A;  4A56 A;  2YIN A;  2W62 A;  2X0L B;  2ZM8 A;  4K0U A;  4PNI A;  3MK7 C;  3AB3 B;  2IC6 A;  4GYS A;  5C8Y E;  4PFO A;  2ODV A;  3O1H A;  3C64 A;  2ACX A;  2E9X B;  2NW8 A;  3LK3 B;  4OHF A;  4ZS2 A;  4JLE A;  2A2F X;  2EHO B;  4O2B E;  2CA5 A;  3FXD B;  2ZM0 A;  4X20 E;  4UEM A;  3ZN1 B;  2CEA A;  2WWU A;  4AQF C;  3RX6 A;  3ZYM A;  2VK9 A;  5L3D B;  4KMC A;  4BA9 A;  3ONX A;  1UX4 A;  3U3I A;  4IHJ E;  4IE0 A;  3V5U A;  2UXN B;  2MTQ A;  3N9P A;  1WYC A;  2IW5 B;  2XAF B;  2YEV C;  3LFM A;  5GON E;  5CA1 E;  4EAH A;  2PBI A;  3B13 A;  2ES0 A;  5HAX A;  2WBL A;  3ETU A;  2KLQ A;  3GWH A;  3VKG A;  4DBQ A;  5HXS A;  1FEW A;  2C5I T;  3LBX A;  4MHC A;  5LHG B;  4XBF B;  2LM9 A;  4FI5 A;  4QWN B;  3N2K E;  3MJX A;  1BR1 A;  4IDZ A;  2X66 A;  5CB4 E;  3I9Y A;  2HPL A;  2WMN A;  2NTX A;  3V5S A;  3PUR A;  4I55 E;  3NRX A;  3RPU A;  3HKE E;  5L3G B;  3AA6 B;  4IE6 A;  2JQQ A;  4HE8 A;  2CLY B;  2WSS V;  5EK4 A;  4YJ3 E;  1VRB A;  2LSG A;  3PUS A;  5A1L A;  4UXN B;  5J2U E;  4BJN A;  2L8K A;  3O1J A;  2CMR A;  1HG5 A;  3HR0 A;  3VU7 H;  4XAX B;  4IIJ E;  3FHN A;  4TN7 B;  1IJ5 A;  2KMF A;  3TKL B;  2I59 A;  2CXD A;  3I9W A;  3ZPO A;  5LP6 E;  1QUU A;  4H9O C;  4ZI3 D;  2Y48 B;  3QK6 A;  2LE8 A;  3WAK A;  3W15 B;  3IF8 B;  3LBX B;  3M65 A;  5LNK A;  2IAK A;  3AAI A;  2D2S A;  5FMN A;  2ZMA A;  3C50 A;  1BR2 A;  4V1A v;  4DND A;  2LSY A;  5JDN A;  5DAB A;  1NAF A;  2KZ7 B;  3Q5X A;  3I0Q A;  5LJM A;  2DWG A;  3KV5 A;  4EYU A;  1CUN A;  3PUQ A;  1LVF A;  1AJ3 A;  4O4L E;  2M67 A;  4DMW A;  3MAC A;  2PG8 A;  4TZ4 C;  2W0G A;  2C0S A;  2XUE A;  3O9X A;  4I4T E;  1IJ6 A;  3N9L A;  3CVR A;  2K24 A;  4QXC B;  1S35 A;  2E8I A;  1MMD A;  3VKH A;  4HEA A;  5H6R B;  3OKQ A;  3C98 B;  2X68 A;  2MOZ A;  2VKD A;  3AA7 B;  3FXE B;  3N9N A;  1D0X A;  3AA1 B;  3N9O A;  5H6Q B;  1D1B A;  3ZMU B;  3L3P A;  3K3N A;  2IC9 A;  3KFW X;  4I43 B;  1ZV4 X;  1QSD A;  4EIW A;  3K3O A;  5JDQ A;  3O1I A;  3L09 A;  3C4Z A;  4PAG A;  3GA8 A;  2N9D A;  2SPC A;  1OWA A;  2KWH A;  3RC3 A;  3AAE B;  1WLX A;  5E0O A;  1YD8 G;  3T8O A;  2DI4 A;  4M1P A;  4HFV A;  2CE7 A;  3MXZ A;  3CQG B;  4ZI7 E;  2XAG B;  4H9P C;  5JR9 C;  5JRC A;  5LBM A;  1D0Y A;  2V1D B;  4C91 A;  3EDV A;  3WAJ A;  4IE5 A;  4UIG A;  3QC9 A;  4CXY A;  2VKJ A;  5LGT B;  4ILU A;  4H9S E;  4G63 A;  1HCI A;  3NZQ A;  3H3A A;  4ZHQ E;  4UV9 B;  3A5X A;  5L3F B;  2LT3 A;  1UCU A;  3D0T A;  3HKB E;  2G0U A;  4O4I E;  2RA1 A;  1G73 A;  2XAH B;  2NP9 A;  4EOZ B;  3MKD A;  1FIO A;  1MMA A;  2ODU A;  5LHH B;  2V7M A;  3I1A A;  4UVA B;  4UVB B;  2HPJ A;  3MA9 A;  4UF0 A;  3CPZ A;  3RH3 A;  2RP4 A;  1D0Z A;  1IAP A;  1S94 A;  2N2N A;  1G8X A;  1O3X A;  2LJL A;  3ZC1 A;  1WYB A;  3RRC A;  4FJO A;  1MNE A;  5JRC B;  1FMW A;  2CXF A;  4YFS A;  4CXW A;  4MFR A;  2N1G A;  4P09 A;  4CXX A;  1LKX A;  1WRD A;  2NOX A;  2JPF A;  2CCQ A;  2CM0 A;  4WW0 A;  3ZCI A;  3EDU A;  2XHE B;  5DJQ C;  4KP3 C;  2VWA A;  1U4Q A;  4CQI A;  3IBP A;  1ZHC A;  2Q9Q D;  1HG2 A;  4GIW A;  5HWY A;  5JH7 E;  4JEH B;  3F57 A;  5L3B B;  4Z8X A;  2D0T A;  1HTJ F;  3KVB A;  4P0B A;  2YU2 A;  2V7J A;  3CX6 B;  1FMV A;  4O4H E;  4OK0 A;  4AXP A;  4UF0 B;  1HX8 A;  4IGU A;  2DLR A;  4EXT A;  2KIN B;  3ZMT B;  2P9B A;  3KV9 A;  4TV8 E;  5F8P A;  3R6N A;  3UFE A;  2K5B B;  3B57 A;  3E0Z A;  4MBQ A;  1MND A;  3LK4 2;  3KV4 A;  4AKR B;  5J2T E;  2DNX A;  3S4U A;  4PK5 A;  2H7O A;  2XQY A;  4QX8 B;  5F3J A;  2CWY A;  1Z0P A;  4MLK A;  4AKG A;  2CWO A;  2NTY A;  3OYZ A;  2PFV A;  4YHJ A;  4OYJ A;  3MZK B;  4PJJ A;  2LEH A;  4O2A E;  3LG7 A;  4H9R C;  2K48 A;  2KWI B;  5ADX L;  1ZEE A;  5CA0 E;  3P7I A;  4X1K E;  2H3R A;  3E08 A;  4GK5 E;  3CML A;  4AKL A;  3BQL A;  3HI2 A;  5FP3 A;  3UTK A;  2Q9Q C;  3GN5 A;  4CZZ B;  5EK2 A;  2MBG A;  4E7S A;  5KMG P;  3OBV E;  5L3E B;  2VKH A;  2VB6 A;  4MAL A;  3ZMV B;  2ZLY A;  3Q2M A;  3LK2 B;  4ZS3 A;  4ZOL E;  4IST A;  3I0O A;  5M4Y A;  5EK3 A;  3CQX C;  5LG4 A;  2BVM A;  4QXH B;  3DP7 A;  3J7Y q;  2Y8D A;  3SRZ A;  3BQI A;  4YLH A;  2QA7 A;  1MMN A;  1T98 A;  3Q5W A;  3RC8 A;  3KBT A;  5JDF A;  2E9X D;  5LYJ E;  5JR9 A;  4AKH A;  4HN9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...