4ZI2C

Bart-like domain of bartl1/ccdc104 in complex with arl3fl bound to gppnhp in p21 21 21
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
131
structure length
131
Chain Sequence
AAEEEDEVEWVVESIAGFLRGPDWSIPILDFVEQKCEVFDDEEESKLTYTEIHQEYKELVEKLLESYLKEIGINEDQFQEACTSPLAKTRTSQAILQPVLAAEDFTIFKAMMVQKNIEMQLQAIRIIQERN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor-like protein 3
publication title The Interaction of CCDC104/BARTL1 with Arl3 and Implications for Ciliary Function.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 56
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2015-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11527 ARL2_Bind_BART The ARF-like 2 binding protein BART
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1900 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4zi2C00
4ZI2C 4ZI2D 4ZI3C 4ZI3D 2K9AA
chains in the Genus database with same CATH superfamily
3N9OA 5CFBA 2X51A 1UURA 4HWIB 2H88A 2FJDA 5DJQC 3CQCB 1XMQT 2R6GF 3AE6A 3ZSSA 2IHR1 4DMVA 5JDNA 1WCRA 2KZ7B 4PJMA 4E7SA 2XAHB 2BKNA 4HFBA 3SFEA 2IDOB 4B6XA 5JR9B 3RYFE 3U78A 4GKKT 1HS7A 2X68A 5HEHA 3JAFA 1IBLT 4JI1T 3AAEB 2M6BA 4L9IA 3ZYKA 2HH7A 3FB2A 2UUCT 4KUMB 2CBJA 3N9QA 5EZYE 3KVAA 2BKPA 2CEAA 2IAKA 3UU3A 2BZBA 2X9XA 4UVCB 3QUJA 3AE9A 4O4HE 4JUYA 2DHRA 2WP9A 2YDQA 3ESLA 3CPZA 4COFA 3V5SA 4IDQA 3RKOA 4X64T 2N9DA 3QOFA 5KMGP 2YDSA 2Z6EA 4O4IE 4NUVA 4H9SE 4DO0A 3PUGA 2F4VT 2A72A 3AA0B 3ABVA 4KI0F 5LCYA 2WQYA 2BG9E 1ZV4X 3I0QA 3AXJB 4HEAA 4EEBA 2BG9B 1IBKT 3TLUA 4QX7B 1XNRT 3N2GE 1US7B 2LSIA 3ZN0B 1XMOT 2V6YA 4ILAA 4WZXA 2VWAA 3IA3A 4MLKA 1ZEEA 3AE1A 1MMNA 3VR9A 5IUXA 2DL1A 2UXBT 4EZHA 3C51A 3RPUA 4JI3T 5LG3A 3N9PA 3HI2A 4H9PC 4XZCA 3E22E 3MK7C 5FYMA 1R8IA 1NWMX 3PV0F 5JREA 5L4EA 2E9XD 5AQFB 4OFZA 4JEUB 4X62T 1W0BA 4AKIA 5FL0A 4TWHA 4P0BA 4QXHB 1LVKA 2VL0A 2ZLYA 3RH3A 5L3FB 4JI4T 2JQKA 2ACZA 3AE4A 2IW5B 4UVAB 1UX5A 4B3MT 2WCAA 1B7TA 2K48A 3K3NA 3PUZF 3P4WA 3X1DA 2LT3A 2V6XA 4DV4T 2CHNA 2CWYA 2OLTA 2LSKA 2BDEA 3ANWA 4TX5A 4GOUA 4E7ZA 4GIWA 2PTFA 4KP3C 2BS2A 4TN7B 3RIUA 1WR6A 2EHOA 4CXXA 2W67A 3QB5K 5JDMA 3W15B 4JLEA 3TKLB 5JTGA 3RI5A 1X79A 1XNQT 2M67A 2XQAA 1IBMT 4ZZBA 5A1LA 3P4QA 1KFYA 4X65T 1S35A 1BR1A 2CWOA 2QVAA 4OK0A 1HFAA 5AQGB 2XUEA 2ZM0A 3MA9A 3EI0A 2XQYA 1YD8G 3TLWA 2FJEA 4WW0A 4IT4A 5LP6E 3UUBA 3EAMA 4O2AE 1SA0E 3HKBE 5L3EB 4O2BE 2A9UA 1WLXA 2W4XA 4ISSA 3LSVA 3H37A 2VL8A 3AAIA 3PDYA 3PUSA 3CX7B 1H7CA 2MYSA 2WMNA 5JQGE 2QYWA 2XAQB 3AAAB 5EK4A 2FBWA 2E5VA 4PAGA 1D0ZA 3ZC0A 2K5BB 3FBLA 4EZ4A 1G73A 4ZS3A 2WU5A 5DQWA 2WM9A 2HN2A 1AJ3A 3P4SA 1I6ZA 2M6IA 4IGUA 4JI5T 2QGSA 3Q9DA 2VKDA 3K3QC 3AEBA 4PJJA 3RC3A 5LJMA 4B3RT 2CA5A 1NEKA 2RA1A 3ZT6A 3FZKB 5KX5E 3ZMSB 2Q9QC 4ANJA 3FZLB 3ZCIA 4L5GA 3AA1B 4YHHT 3PUAA 2HPJA 3FXEB 3G06A 5AQIB 2VB6A 3BK9A 3AE7A 2CXFA 5F5WA 2WWVA 3B13A 4YY3T 3HKCE 4HFEA 2WS3A 3JCFA 4ZI2C 4X1KE 5CGMA 1NENA 1KNPA 5FMNA 3AA7B 3ZKRA 1MMGA 4IL9A 2C5JA 5FVLA 2E2AA 4U31A 2E8IA 3O9XA 4HKAA 3IHRA 4YLHA 4DV1T 1SHZC 2K9AA 2VKHA 4JBWF 2I0MA 4TV8E 4X20E 3M65A 2A3DA 2BKOA 2QA7A 1OEDB 4AKLA 2DI4A 1GQEA 3CMLA 5FNVE 1DU2A 2LJLA 3GWHA 5HWYA 2VKOA 3H3MA 2W66A 3O4XE 3OYXA 3K8PC 5ABHA 5HXRA 3RLFF 3LJCA 4ILBA 3R84B 4HFVA 3R6NA 5LOVE 2ZMAA 4F6RC 3F57A 5ADXL 2WZHA 4DBRA 1I94T 4QHOA 2LLYA 4OYKA 3VRAA 4UR9A 3CX6B 3WAKA 4EV6A 2WMOA 1YQ3A 4ZXLA 4EIWA 3I9YA 1T72A 3HKEE 3IF8B 4UF0B 4LF5T 4DNDA 5HCJA 2KWIB 2XJ7A 4IHJE 3DTOA 1T8BA 2CBIA 2WDQA 4C90A 4ASKA 5AQVB 1SUMB 3LBXB 1L0VA 5IYZE 1WFDA 3C50A 1ZOYA 3MACA 5ABFB 3AE2A 2HHHT 3HL6A 3OTOT 3DJBA 2YK0A 4OHFA 2DLRA 2LHRA 3LK42 3K1SA 3RKGA 2LSJA 4U7YA 3RIUC 5JR9A 1MMAA 2W2UA 5AQQB 2J4GA 3LFMA 4DUYT 5JRCB 5L3BB 2CMRA 4YTMA 2ODUA 3ZJ2A 3UULA 4F8HA 2E9XB 2ZM2A 4DV6T 2Y48B 3TLVA 1QLBA 4UIGA 4YJ3E 2D0TA 2NP9A 3E0ZA 2JPFA 2C5KT 3UUMA 4ZHQE 3BQIA 4NXNT 1MMDA 3ZEFB 3P50A 4EAHA 2PFVA 4ZOLE 4G63A 3N2KE 2H89A 2CLYC 3UFEA 5HYAA 4LF7T 3VU7H 2JIWA 3S4UA 5H6RB 5AFUL 5HCMA 4HGAA 1FJGT 2KT9A 2XQ9A 2KINB 5FP3A 4H63H 2ES0A 4LFBT 3AXJA 2BG9A 4JYAT 2Q9QB 3KV4A 1E1HB 4OYJA 2BBHA 3NZPA 5E0OA 1OXZA 5C2TA 2VK9A 2H7VC 2IMLA 1HG5A 4ZI3C 3UUNA 5HXHA 3UU4A 3LK3B 2OV9A 1XWMA 1V9DA 3C4XA 4IE4A 3RF1A 1ZKEA 5JVDE 3ZYMA 3GA8A 5HXEA 4B3ST 1IZNB 5L3CB 2KNDA 2RPAA 1Z0PA 4KBMB 4LF6T 3BQKA 5L47A 3FZMB 3SS1A 4P1NA 4I55E 1MIVA 4HWCA 4TNWA 3IBPA 1WYBA 2W00A 4YXDA 2OA5A 3ZT5A 3AEDA 1LVFA 4JI6T 1JNRA 1MNEA 4DR5T 2BS3A 5FY7A 3L8RA 4WBOA 2PJQA 3Q5WA 5F8PA 1T98A 5LGTB 4LMKA 3QC9A 2D9DA 2RP4A 2VASA 4HFHA 1XZYA 4PJNA 2FJBA 1WR0A 3DP7A 4DR2T 2PBIA 5HEGA 4TUYE 5HEJA 1HNZT 1VRBA 5L2LA 3K3OA 5LMNT 1HG2A 2W62A 5CJ5A 3OJAA 4LMLA 4AKGA 1M7KA 3KFWX 3NVOA 3WAJA 4AQFA 2UU9T 2IC9A 1N33T 2XHEB 3GN5B 2UXXB 4YTNA 3PURA 3B57A 2Q9QD 3L39A 4YTPA 2ACXA 2SPCA 3HR0A 3KVBA 3RGLA 4G2AA 3BQLA 4J2CA 3AB3B 4GK0E 2DNXA 1FEWA 4PK4A 4PK6A 2LEHA 3A8YC 1NAFA 4ZI2D 3NWIA 1MIYA 1QSDA 3Q2MA 4AKRB 3KBUA 3FHNA 5FL1A 4DR3T 4IDOA 5KDMC 4DR6T 4XBFB 4Z8XA 5HEUA 4CXWA 2BS4A 2N1GA 3UT5E 3EHZA 3O1IA 2XQ4A 4EGWA 3ZYLA 4X5TA 4HN9A 1UCUA 1VOMA 4JI8T 4BJMA 4NIQA 5CB4E 1W09A 5FXXA 3ZSTA 5LA6E 2G0UA 4ZZCA 4UXNB 4KHZF 2AE9A 4I0UA 4PK5A 5LHIB 3P4PA 2NWBA 3PUVF 2V7IA 4U7IA 1IAPA 3RRCA 2JMHA 3EDUA 3AE5A 4TWFA 5J2TE 5ABGA 5JDLA 4X1YE 5AQSB 5FY1A 3O1HA 4H9OC 2CLYB 2XQ5A 3UQ4A 4I50E 4IE6A 2DCFA 3ZPOA 3IEEA 2WDRA 2YU2A 4QH1A 5M4YA 3CVRA 2XAJB 4QXCB 4AQGA 3F31A 3FZHB 1FMWA 2IC6A 5JR9C 4P09A 3J7Yq 1J5ET 4CI1B 4Z90A 4A97A 2JJ9A 4QH5A 4O4JE 2X67A 4UVBB 3RIFA 1E2AA 4CZZB 3LDQB 4BAYB 2N2NA 1Z8UA 4M1PA 4I43B 4CN1A 3F2EA 1FMVA 4IDNA 4PFPA 5J0ZA 4DV2T 1ZHCA 5CA0E 3UU6A 2V7JA 1IJ6A 4LF9T 3I0OA 5LYJE 4PFOA 2ODVA 4KHPT 3RRWA 2YEVC 4ZI7E 5AQJB 5LHGB 2H3RA 2LM2A 3ETUA 3QK6A 4GKJT 2JQQA 1HCIA 4GYSA 4PW8A 5HXCA 1E7PA 1X9BA 3NKZA 5TAOA 2BG9C 5AQOB 5LNKA 4QH4A 1JNZA 5EK2A 4QX8B 2V1DB 4QWNB 2XZEA 1OEDA 3OBVE 3QNUA 5L3GB 4N78D 4DV7T 4YJ2E 4TWDA 5AQNB 3I1AA 3FZFB 3C4ZA 1N32T 3OKQA 5J2UE 5ETWA 2UXCT 2LKGA 2J1DG 1CHUA 3OPCA 1UK5A 2E5LT 1O3XA 5LGUB 2KXPB 1CUNA 3UU5A 3M3ZB 3VRBA 3AA6B 2WAUA 4ZI3D 3N9MA 2MTQA 4YT0A 4ERRA 5JDHA 2NW7A 1IJ5A 2XM1A 4YHJA 4MBQA 3N9NA 3SFDA 5AQUB 4K0UA 2XQ3A 3LK2B 1HTJF 5AQMB 3UU8A 3PJAJ 2XAFB 5HWXA 2UUBT 4DBQA 2YU1A 2X0HA 3KV9A 3PTRB 5HAXA 3T1YT 2YDRA 2VURA 2GK9A 3LBXA 2Y8DA 2XQ8A 2I59A 5ABFA 3H3AA 2V26A 2KLQA 3MKDA 5LG4A 4TZ4C 1Y64B 3AECA 1D1CA 2BBJA 4AQFC 4A5XA 2I6HA 3CX8B 2J47A 2K24A 3GMIA 3NRXA 5JDGA 4XAXB 2WU2A 4PJLA 2WBLA 2WB5A 2NR4A 1VCTA 3T8OA 3NZQA 4CI2B 2LRLA 4P0AA 4B3TT 4I4TE 1MNDA 3OVUA 3ZMUB 4Q25A 2E9XA 3ETVA 3JC6C 2EHOC 4HFIA 5C3JA 2V5DA 3KDSE 4EB6E 3RYIE 1HNWT 4CQIA 4X1IE 2XY8B 1J5WA 2CHOA 3MXZA 3L09A 4TNVA 4O8SA 1LKXA 4FJOA 5AQRB 5LB7B 1WRDA 4IE5A 3RQUA 5LBMA 4DV0T 3PU8A 2V5CA 4H9RC 1YQ4A 2WZIA 3SWHA 4H9NC 4ILUA 1UGOA 2KWHA 1KEYA 5EK3A 2X9WA 5LJNA 3ZT7A 2Q9QA 2NOXA 2WWUA 3NBXX 5GONE 5AQPB 4YSZA 3FXDB 4AI6A 4Z91A 1Y01A 4FI5A 2XSAA 2VQFT 4CXYA 5AQTB 3RYCE 3UQ7A 3QB5A 4MALA 2V7LA 2CXLA 5HEOA 5BMVE 5LBQB 2ZM8A 5FKYA 3RYHE 4LFCT 4PNIA 3CWZB 3JADA 2JMKA 2C5IT 1YKHB 4ILCA 3AE8A 2D0UA 3NRYA 3C98B 2NTXA 4AQYT 1HX8A 4A56A 3PE0A 2X0LB 2UUAT 1SE7A 2DWKA 3SOLA 2W63A 3FBZA 2W0GA 4UV9B 3D0TA 2X0YA 1J1JA 2YINA 3HA4A 5L3DB 3MZKB 4DV5T 1XDOA 4HWFA 3CQGB 5L4HA 1W0AA 3Q5EA 2XM2A 4YSYA 1W9RA 1N34T 5LHHB 5C8YE 3AE3A 1KF6A 5FXWA 3VR8A 2XQ7A 2V6YB 2YN6A 4CN6A 2NW9A 5BR8T 2P9BA 3C4WA 4LMJA 3PJAA 4WYVA 4HWDA 4H9QC 4BA9A 4LFAT 1D1BA 1YW0A 4UV8B 2XAGB 3PUWF 1UX4A 3GN5A 3Q5XA 4H63V 3ZMVB 4ZEYA 3LG7A 5FVKA 4HFCA 4AISA 4GYRA 3P8CD 3ZMZB 4IIJE 3VKHA 4JI2T 3RIAA 3RQWA 3OYZA 2FUPA 1MIWA 3ZMTB 1OEDC 2WY2A 2XSBA 1U4QA 5LGNB 4HWHA 4GK5E 3AEEA 4IDPA 3WI3A 1ZP0A 3UTKA 3TLTA 3UFGA 1BR4A 5FXVA 4JI0T 3RHWA 2VQET 3A7MA 5FXZA 4BJNA 2ZM6T 2A2FX 4QKNA 3ZLIA 4WNKA 4C91A 4MHCA 3L3PA 1VCSA 3ANWB 2MBGA 3P4RA 3C64A 3ZC1A 2VVNA 3B5MA 3Q5DA 4KX6A 4EEDA 2LHNA 3TLSA 4NPPA 2JRKA 2EHOB 4KMCA 2C0SA 1G8XA 2CE7A 2FJAA 3AEFA 1KK7A 5CA1E 3CQXC 4JI7T 3CKDA 3E08A 2JQHA 2D2SA 4EYYR 2V8SV 3I9WA 5HXSA 3EDVA 2LOSA 3ZCJA 3EABA 2PG8A 3PUYF 5ABEA 3UUXB 2MAWA 3RC8A 1BR0A 2J62A 3N9LA 1HR0T 2KMFA 4V1Av 2BVMA 1N36T 3PUXF 2LSYA 5AQHB 2LKHA 2X9YA 3CIRA 1LRZA 1FIOA 1XDPA 1EZ3A 4HTEA 2X9HA 2IUBA 3ONXA 1QUUA 1HX1B 2NW8A 3ZN1B 3KV5A 3A5XA 1YKEB 2HN1A 5J1GA 3PUQA 2VKJA 2V7KA 2E9XC 1UUSA 2CRBA 2DWGA 2LRKA 2UXNB 3AVRA 2WSSV 1OWAA 4UEMA 4U33A 4DUZT 2CXDA 3ONLC 3MJXA 5AQLB 3PU3A 5H6QB 2L3LA 4NUUA 3AEAA 2YOEA 5LMUT 3VHLA 2MPKA 4MFRA 1HF8A 3T1HT 3VKGA 4ADZA 3N2OA 4IE7A 2XQ6A 4DR1T 2L8KA 4AXPA 2LM9A 2K3WA 4IDZA 1D1AA 4DMWA 3JAEA 4EXTA 2NTYA 3JC6D 3KV6A 2EHOD 3KINB 2B76A 2VVSA 5JDQA 2XPKA 3N5LA 2MOZA 4JEHB 5LXTE 1BR2A 1S94A 1D0YA 3HKDE 4NXMT 1HNXT 4L0RA 5IHYA 5F3JA 2LE8A 2IIUA 4DR4T 4QXBB 4DVDA 2Y6XA 3U3IA 4U2ZA 5DABA 2CM0A 4X66T 5FY0A 2KSRA 4DV3T 2LSGA 1U5PA 2D5UA 3CK6A 3AVSA 1KNZA 4JV5T 4ZS2A 1OEDE 4YFSA 2YKSA 2X66A 2AXDS 4TV9E 4OX9T 1T7SA 2H7OA 2CPTA 3KBTA 3V5UA 2W61A 5JDFA 4IREA 4DR7T 2LOPA 4UF0A 4EYUA 1WYCA 1KNRA 2WDVA 5DQVA 2QRXA 2B1EA 4A98A 4AKHA 4HE8A 1YXRA 3AEGA 2XTLA 1D0XA 3J9X1 2HPLA 4LF8T 4WBNE 2V7MA 3ONJA 3EUHA 2UXDT 4IL4A 3P7IA 4K0KT 2CCQA 4HFDA 4U72A 3ZJ1A 4IE0A 2L9QA 2XASB 3RX6A 4CN4A 3O1JA 5AQKB 4YSXA 4EOZB 3EVYA 4UELA 4DIDB 3SRZA 4U2YA 1M62A 2BVLA 5JRCA 4O4LE 5IWAT 4U74A 4U3CA 4ISTA 4CI3B 2JQ9A 5KXJA 4LF4T 5JH7E 4AIUA
chains in the Genus database with same CATH topology
3N9OA 5FMNA 5FXXA 3AA7B 5LA6E 2G0UA 2X51A 1MMGA 4UXNB 5LHHB 5C8YE 2C5JA 4PK5A 5LHIB 5FXWA 5DJQC 2E8IA 3CQCB 3O9XA 2NWBA 4HKAA 2NW9A 2P9BA 2V7IA 3C4WA 3IHRA 1IAPA 3RRCA 4YLHA 2JMHA 3EDUA 4H9QC 4BA9A 1SHZC 1D1BA 4DMVA 1YW0A 2K9AA 5J2TE 5JDNA 2VKHA 4UV8B 2KZ7B 2XAGB 4PJMA 5JDLA 4X1YE 1UX4A 3GN5A 4TV8E 3Q5XA 2XAHB 4X20E 3M65A 3O1HA 4H63V 5FY1A 4E7SA 3ZMVB 3LG7A 4B6XA 5JR9B 2A3DA 2QA7A 4H9OC 3RYFE 3U78A 4AKLA 2CLYB 4I50E 4IE6A 1HS7A 2DI4A 2X68A 2DCFA 3ZPOA 3CMLA 4GYRA 3IEEA 3P8CD 5FNVE 2LJLA 3AAEB 3GWHA 5HWYA 2VKOA 4L9IA 2YU2A 3ZMZB 3ZYKA 2HH7A 4IIJE 3VKHA 3O4XE 3OYXA 5M4YA 3CVRA 2XAJB 3FB2A 4KUMB 3N9QA 3OYZA 3KVAA 4QXCB 5EZYE 1MIWA 3K8PC 4AQGA 2CEAA 2IAKA 3F31A 5HXRA 1FMWA 2BZBA 2IC6A 5JR9C 4P09A 3ZMTB 3J7Yq 2X9XA 4UVCB 4CI1B 3LJCA 3QUJA 1U4QA 2JJ9A 4O4HE 4JUYA 3R84B 5LGNB 2DHRA 4HFVA 3R6NA 5LOVE 2ZMAA 4F6RC 3F57A 4GK5E 5ADXL 3ESLA 3CPZA 3V5SA 4O4JE 4DBRA 3RKOA 3WI3A 2N9DA 2X67A 4QHOA 4UVBB 4OYKA 5KMGP 4CZZB 3CX6B 3UTKA 3WAKA 4BAYB 2N2NA 2Z6EA 2WMOA 4M1PA 4NUVA 4O4IE 4I43B 4EIWA 1BR4A 3F2EA 3I9YA 4H9SE 1FMVA 5FXVA 4DO0A 3PUGA 4PFPA 2A72A 3HKEE 1ZHCA 3IF8B 4UF0B 3AA0B 5LCYA 4DNDA 5CA0E 5FXZA 4BJNA 2KWIB 2V7JA 2A2FX 1IJ6A 4IHJE 3DTOA 4QKNA 3ZLIA 3I0OA 1ZV4X 5LYJE 4WNKA 4C91A 3I0QA 4HEAA 4PFOA 4MHCA 2ODVA 3L3PA 4C90A 4ASKA 3RRWA 3ANWB 4QX7B 2MBGA 2YEVC 4ZI7E 3N2GE 3C64A 1US7B 3ZC1A 2LSIA 3LBXB 3ZN0B 5LHGB 2H3RA 5IYZE 2LHNA 2VWAA 3ETUA 2JRKA 3C50A 2JQQA 3QK6A 4MLKA 1HCIA 2EHOB 4KMCA 4GYSA 3MACA 4PW8A 1ZEEA 5HXCA 2C0SA 1G8XA 2CE7A 1MMNA 3HL6A 1KK7A 5CA1E 5TAOA 3CQXC 3DJBA 5LNKA 3CKDA 2YK0A 3E08A 2D2SA 4EYYR 4EZHA 3I9WA 4OHFA 2DLRA 2LHRA 5EK2A 5HXSA 3LK42 3EDVA 3C51A 4QX8B 2LSJA 3RPUA 2LOSA 2V1DB 4QWNB 3ZCJA 5JR9A 1MMAA 3N9PA 2PG8A 3OBVE 3HI2A 4H9PC 3UUXB 3LFMA 4XZCA 3RC8A 1BR0A 3E22E 5L3GB 5JRCB 3N9LA 4N78D 4YJ2E 2KMFA 4V1Av 2BVMA 3MK7C 5FYMA 5L3BB 2CMRA 2LSYA 1NWMX 3I1AA 5JREA 2E9XD 4OFZA 4DBQA 4JEUB 3ZJ2A 2ODUA 3UULA 3C4ZA 3OKQA 2E9XB 5J2UE 2ZM2A 4AKIA 2Y48B 2X9YA 5ETWA 4UIGA 4YJ3E 2D0TA 1LRZA 2NP9A 3E0ZA 1FIOA 2J1DG 2JPFA 2C5KT 3UUMA 4ZHQE 3BQIA 1EZ3A 4P0BA 4HTEA 1MMDA 1LVKA 1O3XA 2X9HA 4QXHB 3ZEFB 5LGUB 3ONXA 1QUUA 2KXPB 5L3FB 2ZLYA 3RH3A 2NW8A 1CUNA 3ZN1B 3KV5A 2IW5B 3A5XA 4UVAB 1YKEB 3AA6B 1UX5A 2PFVA 2WAUA 3N9MA 2VKJA 3PUQA 4ZOLE 4G63A 5J1GA 4EAHA 2MTQA 4ZI3D 1B7TA 3N2KE 2CLYC 2V7KA 4ERRA 3UFEA 5JDHA 2NW7A 2E9XC 5HYAA 1IJ5A 3VU7H 2UXNB 2DWGA 2K48A 3AVRA 4YHJA 3K3NA 4MBQA 2WSSV 3N9NA 3S4UA 1OWAA 4UEMA 5H6RB 2CXDA 4K0UA 5AFUL 2LT3A 4HGAA 2KT9A 2KINB 3MJXA 4H63H 5FP3A 3LK2B 3PU3A 2ES0A 5H6QB 1HTJF 2L3LA 2Q9QB 3KV4A 1E1HB 4NUUA 4OYJA 2XAFB 2CWYA 5HWXA 2LSKA 2BDEA 2YU1A 3KV9A 3ANWA 3NZPA 3PTRB 4TX5A 4GOUA 1OXZA 5E0OA 2VK9A 2H7VC 3VHLA 5HAXA 4E7ZA 4GIWA 1HG5A 4ZI3C 4MFRA 3UUNA 2GK9A 1HF8A 5HXHA 3LBXA 4KP3C 3VKGA 4TN7B 4ADZA 1WR6A 3N2OA 4IE7A 3LK3B 2Y8DA 2EHOA 2I59A 4CXXA 1V9DA 3C4XA 4IE4A 5JDMA 3W15B 1ZKEA 2L8KA 3H3AA 5JVDE 2V26A 4AXPA 3ZYMA 2LM9A 2KLQA 3GA8A 4JLEA 5HXEA 4IDZA 3MKDA 3TKLB 1D1AA 1IZNB 4DMWA 5L3CB 5LG4A 4TZ4C 1X79A 1Y64B 2KNDA 4EXTA 1Z0PA 2NTYA 1D1CA 4KBMB 4AQFC 3JC6D 3KV6A 2EHOD 2M67A 3KINB 3BQKA 3CX8B 2K24A 3GMIA 3SS1A 3NRXA 5JDQA 5JDGA 5A1LA 4XAXB 4I55E 1MIVA 3IBPA 4PJLA 3N5LA 2MOZA 2WBLA 4JEHB 5LXTE 1BR2A 1S94A 1D0YA 1S35A 1WYBA 2W00A 3HKDE 1BR1A 2OA5A 2CWOA 3T8OA 3NZQA 4CI2B 4OK0A 1LVFA 1HFAA 4P0AA 4I4TE 4L0RA 1MNDA 1MNEA 2XUEA 3ZMUB 2ZM0A 3MA9A 2E9XA 3ETVA 3JC6C 2EHOC 2XQYA 1YD8G 5IHYA 5FY7A 4WBOA 5F3JA 2LE8A 2PJQA 3KDSE 4EB6E 3Q5WA 3RYIE 5F8PA 4WW0A 4CQIA 4X1IE 1T98A 5LGTB 3QC9A 4QXBB 4DVDA 3MXZA 5LP6E 2Y6XA 2RP4A 2VASA 3U3IA 4O2AE 5DABA 1SA0E 2CM0A 3L09A 3HKBE 5L3EB 4O2BE 4O8SA 1LKXA 1WLXA 5FY0A 4FJOA 4ISSA 4PJNA 1WRDA 3DP7A 4IE5A 5LBMA 2LSGA 3H37A 1U5PA 3PU8A 2D5UA 2PBIA 2VL8A 4H9RC 3AAIA 3PDYA 3AVSA 1KNZA 4ZS2A 3SWHA 3PUSA 4H9NC 4ILUA 4TUYE 3CX7B 1H7CA 2KWHA 4YFSA 5EK3A 1VRBA 2MYSA 2X66A 2WMNA 2X9WA 5L2LA 5LJNA 3K3OA 4TV9E 5JQGE 2XAQB 3AAAB 2H7OA 3KBTA 5EK4A 2Q9QA 1HG2A 3V5UA 4PAGA 1D0ZA 2NOXA 2W62A 2WWUA 3NBXX 3OJAA 5GONE 3ZC0A 4AKGA 2W61A 2K5BB 3FBLA 5JDFA 4EZ4A 1G73A 3KFWX 3WAJA 2LOPA 4UF0A 4AQFA 3FXDB 4EYUA 2IC9A 4ZS3A 1WYCA 4AI6A 4FI5A 5DQWA 2WM9A 2XHEB 2UXXB 3GN5B 5DQVA 1AJ3A 3PURA 4CXYA 3B57A 2Q9QD 3RYCE 2ACXA 4IGUA 2B1EA 4AKHA 4MALA 2SPCA 2CXLA 2V7LA 4HE8A 5BMVE 3HR0A 2QGSA 3Q9DA 2VKDA 2XTLA 3KVBA 3K3QC 2ZM8A 5LBQB 4G2AA 1D0XA 3BQLA 3RYHE 4PJJA 3RC3A 5LJMA 4J2CA 2CA5A 3J9X1 2HPLA 2RA1A 3AB3B 4PNIA 4GK0E 3CWZB 4WBNE 2DNXA 2V7MA 3EUHA 1FEWA 4PK4A 2JMKA 2C5IT 1YKHB 4PK6A 2D0UA 2LEHA 3NRYA 5KX5E 3P7IA 3ZMSB 3C98B 1NAFA 2NTXA 4ZI2D 2CCQA 2Q9QC 4U72A 1HX8A 3ZJ1A 1MIYA 4IE0A 4A56A 4ANJA 3ZCIA 3PE0A 1QSDA 3Q2MA 2L9QA 2X0LB 4L5GA 3AA1B 4AKRB 3KBUA 2XASB 3PUAA 3RX6A 3FHNA 2DWKA 3O1JA 2HPJA 3SOLA 2W63A 3FXEB 5KDMC 4EOZB 3FBZA 2W0GA 3EVYA 4UELA 4XBFB 2VB6A 3BK9A 4UV9B 4Z8XA 4CXWA 2CXFA 3D0TA 2N1GA 3SRZA 3UT5E 3O1IA 2BVLA 3B13A 2YINA 5JRCA 4O4LE 3ZYLA 4U74A 3HA4A 3HKCE 5L3DB 4HN9A 1UCUA 1VOMA 3MZKB 4ISTA 4ZI2C 4CI3B 4X1KE 4BJMA 5CB4E 5JH7E 3CQGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZI2 C;  4ZI2 D;  4ZI3 C;  4ZI3 D;  2K9A A; 
#chains in the Genus database with same CATH topology
 3N9O A;  5CFB A;  2X51 A;  1UUR A;  4HWI B;  2H88 A;  2FJD A;  5DJQ C;  3CQC B;  1XMQ T;  2R6G F;  3AE6 A;  3ZSS A;  2IHR 1;  4DMV A;  5JDN A;  1WCR A;  2KZ7 B;  4PJM A;  4E7S A;  2XAH B;  2BKN A;  4HFB A;  3SFE A;  2IDO B;  4B6X A;  5JR9 B;  3RYF E;  3U78 A;  4GKK T;  1HS7 A;  2X68 A;  5HEH A;  3JAF A;  1IBL T;  4JI1 T;  3AAE B;  2M6B A;  4L9I A;  3ZYK A;  2HH7 A;  3FB2 A;  2UUC T;  4KUM B;  2CBJ A;  3N9Q A;  5EZY E;  3KVA A;  2BKP A;  2CEA A;  2IAK A;  3UU3 A;  2BZB A;  2X9X A;  4UVC B;  3QUJ A;  3AE9 A;  4O4H E;  4JUY A;  2DHR A;  2WP9 A;  2YDQ A;  3ESL A;  3CPZ A;  4COF A;  3V5S A;  4IDQ A;  3RKO A;  4X64 T;  2N9D A;  3QOF A;  5KMG P;  2YDS A;  2Z6E A;  4O4I E;  4NUV A;  4H9S E;  4DO0 A;  3PUG A;  2F4V T;  2A72 A;  3AA0 B;  3ABV A;  4KI0 F;  5LCY A;  2WQY A;  2BG9 E;  1ZV4 X;  3I0Q A;  3AXJ B;  4HEA A;  4EEB A;  2BG9 B;  1IBK T;  3TLU A;  4QX7 B;  1XNR T;  3N2G E;  1US7 B;  2LSI A;  3ZN0 B;  1XMO T;  2V6Y A;  4ILA A;  4WZX A;  2VWA A;  3IA3 A;  4MLK A;  1ZEE A;  3AE1 A;  1MMN A;  3VR9 A;  5IUX A;  2DL1 A;  2UXB T;  4EZH A;  3C51 A;  3RPU A;  4JI3 T;  5LG3 A;  3N9P A;  3HI2 A;  4H9P C;  4XZC A;  3E22 E;  3MK7 C;  5FYM A;  1R8I A;  1NWM X;  3PV0 F;  5JRE A;  5L4E A;  2E9X D;  5AQF B;  4OFZ A;  4JEU B;  4X62 T;  1W0B A;  4AKI A;  5FL0 A;  4TWH A;  4P0B A;  4QXH B;  1LVK A;  2VL0 A;  2ZLY A;  3RH3 A;  5L3F B;  4JI4 T;  2JQK A;  2ACZ A;  3AE4 A;  2IW5 B;  4UVA B;  1UX5 A;  4B3M T;  2WCA A;  1B7T A;  2K48 A;  3K3N A;  3PUZ F;  3P4W A;  3X1D A;  2LT3 A;  2V6X A;  4DV4 T;  2CHN A;  2CWY A;  2OLT A;  2LSK A;  2BDE A;  3ANW A;  4TX5 A;  4GOU A;  4E7Z A;  4GIW A;  2PTF A;  4KP3 C;  2BS2 A;  4TN7 B;  3RIU A;  1WR6 A;  2EHO A;  4CXX A;  2W67 A;  3QB5 K;  5JDM A;  3W15 B;  4JLE A;  3TKL B;  5JTG A;  3RI5 A;  1X79 A;  1XNQ T;  2M67 A;  2XQA A;  1IBM T;  4ZZB A;  5A1L A;  3P4Q A;  1KFY A;  4X65 T;  1S35 A;  1BR1 A;  2CWO A;  2QVA A;  4OK0 A;  1HFA A;  5AQG B;  2XUE A;  2ZM0 A;  3MA9 A;  3EI0 A;  2XQY A;  1YD8 G;  3TLW A;  2FJE A;  4WW0 A;  4IT4 A;  5LP6 E;  3UUB A;  3EAM A;  4O2A E;  1SA0 E;  3HKB E;  5L3E B;  4O2B E;  2A9U A;  1WLX A;  2W4X A;  4ISS A;  3LSV A;  3H37 A;  2VL8 A;  3AAI A;  3PDY A;  3PUS A;  3CX7 B;  1H7C A;  2MYS A;  2WMN A;  5JQG E;  2QYW A;  2XAQ B;  3AAA B;  5EK4 A;  2FBW A;  2E5V A;  4PAG A;  1D0Z A;  3ZC0 A;  2K5B B;  3FBL A;  4EZ4 A;  1G73 A;  4ZS3 A;  2WU5 A;  5DQW A;  2WM9 A;  2HN2 A;  1AJ3 A;  3P4S A;  1I6Z A;  2M6I A;  4IGU A;  4JI5 T;  2QGS A;  3Q9D A;  2VKD A;  3K3Q C;  3AEB A;  4PJJ A;  3RC3 A;  5LJM A;  4B3R T;  2CA5 A;  1NEK A;  2RA1 A;  3ZT6 A;  3FZK B;  5KX5 E;  3ZMS B;  2Q9Q C;  4ANJ A;  3FZL B;  3ZCI A;  4L5G A;  3AA1 B;  4YHH T;  3PUA A;  2HPJ A;  3FXE B;  3G06 A;  5AQI B;  2VB6 A;  3BK9 A;  3AE7 A;  2CXF A;  5F5W A;  2WWV A;  3B13 A;  4YY3 T;  3HKC E;  4HFE A;  2WS3 A;  3JCF A;  4ZI2 C;  4X1K E;  5CGM A;  1NEN A;  1KNP A;  5FMN A;  3AA7 B;  3ZKR A;  1MMG A;  4IL9 A;  2C5J A;  5FVL A;  2E2A A;  4U31 A;  2E8I A;  3O9X A;  4HKA A;  3IHR A;  4YLH A;  4DV1 T;  1SHZ C;  2K9A A;  2VKH A;  4JBW F;  2I0M A;  4TV8 E;  4X20 E;  3M65 A;  2A3D A;  2BKO A;  2QA7 A;  1OED B;  4AKL A;  2DI4 A;  1GQE A;  3CML A;  5FNV E;  1DU2 A;  2LJL A;  3GWH A;  5HWY A;  2VKO A;  3H3M A;  2W66 A;  3O4X E;  3OYX A;  3K8P C;  5ABH A;  5HXR A;  3RLF F;  3LJC A;  4ILB A;  3R84 B;  4HFV A;  3R6N A;  5LOV E;  2ZMA A;  4F6R C;  3F57 A;  5ADX L;  2WZH A;  4DBR A;  1I94 T;  4QHO A;  2LLY A;  4OYK A;  3VRA A;  4UR9 A;  3CX6 B;  3WAK A;  4EV6 A;  2WMO A;  1YQ3 A;  4ZXL A;  4EIW A;  3I9Y A;  1T72 A;  3HKE E;  3IF8 B;  4UF0 B;  4LF5 T;  4DND A;  5HCJ A;  2KWI B;  2XJ7 A;  4IHJ E;  3DTO A;  1T8B A;  2CBI A;  2WDQ A;  4C90 A;  4ASK A;  5AQV B;  1SUM B;  3LBX B;  1L0V A;  5IYZ E;  1WFD A;  3C50 A;  1ZOY A;  3MAC A;  5ABF B;  3AE2 A;  2HHH T;  3HL6 A;  3OTO T;  3DJB A;  2YK0 A;  4OHF A;  2DLR A;  2LHR A;  3LK4 2;  3K1S A;  3RKG A;  2LSJ A;  4U7Y A;  3RIU C;  5JR9 A;  1MMA A;  2W2U A;  5AQQ B;  2J4G A;  3LFM A;  4DUY T;  5JRC B;  5L3B B;  2CMR A;  4YTM A;  2ODU A;  3ZJ2 A;  3UUL A;  4F8H A;  2E9X B;  2ZM2 A;  4DV6 T;  2Y48 B;  3TLV A;  1QLB A;  4UIG A;  4YJ3 E;  2D0T A;  2NP9 A;  3E0Z A;  2JPF A;  2C5K T;  3UUM A;  4ZHQ E;  3BQI A;  4NXN T;  1MMD A;  3ZEF B;  3P50 A;  4EAH A;  2PFV A;  4ZOL E;  4G63 A;  3N2K E;  2H89 A;  2CLY C;  3UFE A;  5HYA A;  4LF7 T;  3VU7 H;  2JIW A;  3S4U A;  5H6R B;  5AFU L;  5HCM A;  4HGA A;  1FJG T;  2KT9 A;  2XQ9 A;  2KIN B;  5FP3 A;  4H63 H;  2ES0 A;  4LFB T;  3AXJ A;  2BG9 A;  4JYA T;  2Q9Q B;  3KV4 A;  1E1H B;  4OYJ A;  2BBH A;  3NZP A;  5E0O A;  1OXZ A;  5C2T A;  2VK9 A;  2H7V C;  2IML A;  1HG5 A;  4ZI3 C;  3UUN A;  5HXH A;  3UU4 A;  3LK3 B;  2OV9 A;  1XWM A;  1V9D A;  3C4X A;  4IE4 A;  3RF1 A;  1ZKE A;  5JVD E;  3ZYM A;  3GA8 A;  5HXE A;  4B3S T;  1IZN B;  5L3C B;  2KND A;  2RPA A;  1Z0P A;  4KBM B;  4LF6 T;  3BQK A;  5L47 A;  3FZM B;  3SS1 A;  4P1N A;  4I55 E;  1MIV A;  4HWC A;  4TNW A;  3IBP A;  1WYB A;  2W00 A;  4YXD A;  2OA5 A;  3ZT5 A;  3AED A;  1LVF A;  4JI6 T;  1JNR A;  1MNE A;  4DR5 T;  2BS3 A;  5FY7 A;  3L8R A;  4WBO A;  2PJQ A;  3Q5W A;  5F8P A;  1T98 A;  5LGT B;  4LMK A;  3QC9 A;  2D9D A;  2RP4 A;  2VAS A;  4HFH A;  1XZY A;  4PJN A;  2FJB A;  1WR0 A;  3DP7 A;  4DR2 T;  2PBI A;  5HEG A;  4TUY E;  5HEJ A;  1HNZ T;  1VRB A;  5L2L A;  3K3O A;  5LMN T;  1HG2 A;  2W62 A;  5CJ5 A;  3OJA A;  4LML A;  4AKG A;  1M7K A;  3KFW X;  3NVO A;  3WAJ A;  4AQF A;  2UU9 T;  2IC9 A;  1N33 T;  2XHE B;  3GN5 B;  2UXX B;  4YTN A;  3PUR A;  3B57 A;  2Q9Q D;  3L39 A;  4YTP A;  2ACX A;  2SPC A;  3HR0 A;  3KVB A;  3RGL A;  4G2A A;  3BQL A;  4J2C A;  3AB3 B;  4GK0 E;  2DNX A;  1FEW A;  4PK4 A;  4PK6 A;  2LEH A;  3A8Y C;  1NAF A;  4ZI2 D;  3NWI A;  1MIY A;  1QSD A;  3Q2M A;  4AKR B;  3KBU A;  3FHN A;  5FL1 A;  4DR3 T;  4IDO A;  5KDM C;  4DR6 T;  4XBF B;  4Z8X A;  5HEU A;  4CXW A;  2BS4 A;  2N1G A;  3UT5 E;  3EHZ A;  3O1I A;  2XQ4 A;  4EGW A;  3ZYL A;  4X5T A;  4HN9 A;  1UCU A;  1VOM A;  4JI8 T;  4BJM A;  4NIQ A;  5CB4 E;  1W09 A;  5FXX A;  3ZST A;  5LA6 E;  2G0U A;  4ZZC A;  4UXN B;  4KHZ F;  2AE9 A;  4I0U A;  4PK5 A;  5LHI B;  3P4P A;  2NWB A;  3PUV F;  2V7I A;  4U7I A;  1IAP A;  3RRC A;  2JMH A;  3EDU A;  3AE5 A;  4TWF A;  5J2T E;  5ABG A;  5JDL A;  4X1Y E;  5AQS B;  5FY1 A;  3O1H A;  4H9O C;  2CLY B;  2XQ5 A;  3UQ4 A;  4I50 E;  4IE6 A;  2DCF A;  3ZPO A;  3IEE A;  2WDR A;  2YU2 A;  4QH1 A;  5M4Y A;  3CVR A;  2XAJ B;  4QXC B;  4AQG A;  3F31 A;  3FZH B;  1FMW A;  2IC6 A;  5JR9 C;  4P09 A;  3J7Y q;  1J5E T;  4CI1 B;  4Z90 A;  4A97 A;  2JJ9 A;  4QH5 A;  4O4J E;  2X67 A;  4UVB B;  3RIF A;  1E2A A;  4CZZ B;  3LDQ B;  4BAY B;  2N2N A;  1Z8U A;  4M1P A;  4I43 B;  4CN1 A;  3F2E A;  1FMV A;  4IDN A;  4PFP A;  5J0Z A;  4DV2 T;  1ZHC A;  5CA0 E;  3UU6 A;  2V7J A;  1IJ6 A;  4LF9 T;  3I0O A;  5LYJ E;  4PFO A;  2ODV A;  4KHP T;  3RRW A;  2YEV C;  4ZI7 E;  5AQJ B;  5LHG B;  2H3R A;  2LM2 A;  3ETU A;  3QK6 A;  4GKJ T;  2JQQ A;  1HCI A;  4GYS A;  4PW8 A;  5HXC A;  1E7P A;  1X9B A;  3NKZ A;  5TAO A;  2BG9 C;  5AQO B;  5LNK A;  4QH4 A;  1JNZ A;  5EK2 A;  4QX8 B;  2V1D B;  4QWN B;  2XZE A;  1OED A;  3OBV E;  3QNU A;  5L3G B;  4N78 D;  4DV7 T;  4YJ2 E;  4TWD A;  5AQN B;  3I1A A;  3FZF B;  3C4Z A;  1N32 T;  3OKQ A;  5J2U E;  5ETW A;  2UXC T;  2LKG A;  2J1D G;  1CHU A;  3OPC A;  1UK5 A;  2E5L T;  1O3X A;  5LGU B;  2KXP B;  1CUN A;  3UU5 A;  3M3Z B;  3VRB A;  3AA6 B;  2WAU A;  4ZI3 D;  3N9M A;  2MTQ A;  4YT0 A;  4ERR A;  5JDH A;  2NW7 A;  1IJ5 A;  2XM1 A;  4YHJ A;  4MBQ A;  3N9N A;  3SFD A;  5AQU B;  4K0U A;  2XQ3 A;  3LK2 B;  1HTJ F;  5AQM B;  3UU8 A;  3PJA J;  2XAF B;  5HWX A;  2UUB T;  4DBQ A;  2YU1 A;  2X0H A;  3KV9 A;  3PTR B;  5HAX A;  3T1Y T;  2YDR A;  2VUR A;  2GK9 A;  3LBX A;  2Y8D A;  2XQ8 A;  2I59 A;  5ABF A;  3H3A A;  2V26 A;  2KLQ A;  3MKD A;  5LG4 A;  4TZ4 C;  1Y64 B;  3AEC A;  1D1C A;  2BBJ A;  4AQF C;  4A5X A;  2I6H A;  3CX8 B;  2J47 A;  2K24 A;  3GMI A;  3NRX A;  5JDG A;  4XAX B;  2WU2 A;  4PJL A;  2WBL A;  2WB5 A;  2NR4 A;  1VCT A;  3T8O A;  3NZQ A;  4CI2 B;  2LRL A;  4P0A A;  4B3T T;  4I4T E;  1MND A;  3OVU A;  3ZMU B;  4Q25 A;  2E9X A;  3ETV A;  3JC6 C;  2EHO C;  4HFI A;  5C3J A;  2V5D A;  3KDS E;  4EB6 E;  3RYI E;  1HNW T;  4CQI A;  4X1I E;  2XY8 B;  1J5W A;  2CHO A;  3MXZ A;  3L09 A;  4TNV A;  4O8S A;  1LKX A;  4FJO A;  5AQR B;  5LB7 B;  1WRD A;  4IE5 A;  3RQU A;  5LBM A;  4DV0 T;  3PU8 A;  2V5C A;  4H9R C;  1YQ4 A;  2WZI A;  3SWH A;  4H9N C;  4ILU A;  1UGO A;  2KWH A;  1KEY A;  5EK3 A;  2X9W A;  5LJN A;  3ZT7 A;  2Q9Q A;  2NOX A;  2WWU A;  3NBX X;  5GON E;  5AQP B;  4YSZ A;  3FXD B;  4AI6 A;  4Z91 A;  1Y01 A;  4FI5 A;  2XSA A;  2VQF T;  4CXY A;  5AQT B;  3RYC E;  3UQ7 A;  3QB5 A;  4MAL A;  2V7L A;  2CXL A;  5HEO A;  5BMV E;  5LBQ B;  2ZM8 A;  5FKY A;  3RYH E;  4LFC T;  4PNI A;  3CWZ B;  3JAD A;  2JMK A;  2C5I T;  1YKH B;  4ILC A;  3AE8 A;  2D0U A;  3NRY A;  3C98 B;  2NTX A;  4AQY T;  1HX8 A;  4A56 A;  3PE0 A;  2X0L B;  2UUA T;  1SE7 A;  2DWK A;  3SOL A;  2W63 A;  3FBZ A;  2W0G A;  4UV9 B;  3D0T A;  2X0Y A;  1J1J A;  2YIN A;  3HA4 A;  5L3D B;  3MZK B;  4DV5 T;  1XDO A;  4HWF A;  3CQG B;  5L4H A;  1W0A A;  3Q5E A;  2XM2 A;  4YSY A;  1W9R A;  1N34 T;  5LHH B;  5C8Y E;  3AE3 A;  1KF6 A;  5FXW A;  3VR8 A;  2XQ7 A;  2V6Y B;  2YN6 A;  4CN6 A;  2NW9 A;  5BR8 T;  2P9B A;  3C4W A;  4LMJ A;  3PJA A;  4WYV A;  4HWD A;  4H9Q C;  4BA9 A;  4LFA T;  1D1B A;  1YW0 A;  4UV8 B;  2XAG B;  3PUW F;  1UX4 A;  3GN5 A;  3Q5X A;  4H63 V;  3ZMV B;  4ZEY A;  3LG7 A;  5FVK A;  4HFC A;  4AIS A;  4GYR A;  3P8C D;  3ZMZ B;  4IIJ E;  3VKH A;  4JI2 T;  3RIA A;  3RQW A;  3OYZ A;  2FUP A;  1MIW A;  3ZMT B;  1OED C;  2WY2 A;  2XSB A;  1U4Q A;  5LGN B;  4HWH A;  4GK5 E;  3AEE A;  4IDP A;  3WI3 A;  1ZP0 A;  3UTK A;  3TLT A;  3UFG A;  1BR4 A;  5FXV A;  4JI0 T;  3RHW A;  2VQE T;  3A7M A;  5FXZ A;  4BJN A;  2ZM6 T;  2A2F X;  4QKN A;  3ZLI A;  4WNK A;  4C91 A;  4MHC A;  3L3P A;  1VCS A;  3ANW B;  2MBG A;  3P4R A;  3C64 A;  3ZC1 A;  2VVN A;  3B5M A;  3Q5D A;  4KX6 A;  4EED A;  2LHN A;  3TLS A;  4NPP A;  2JRK A;  2EHO B;  4KMC A;  2C0S A;  1G8X A;  2CE7 A;  2FJA A;  3AEF A;  1KK7 A;  5CA1 E;  3CQX C;  4JI7 T;  3CKD A;  3E08 A;  2JQH A;  2D2S A;  4EYY R;  2V8S V;  3I9W A;  5HXS A;  3EDV A;  2LOS A;  3ZCJ A;  3EAB A;  2PG8 A;  3PUY F;  5ABE A;  3UUX B;  2MAW A;  3RC8 A;  1BR0 A;  2J62 A;  3N9L A;  1HR0 T;  2KMF A;  4V1A v;  2BVM A;  1N36 T;  3PUX F;  2LSY A;  5AQH B;  2LKH A;  2X9Y A;  3CIR A;  1LRZ A;  1FIO A;  1XDP A;  1EZ3 A;  4HTE A;  2X9H A;  2IUB A;  3ONX A;  1QUU A;  1HX1 B;  2NW8 A;  3ZN1 B;  3KV5 A;  3A5X A;  1YKE B;  2HN1 A;  5J1G A;  3PUQ A;  2VKJ A;  2V7K A;  2E9X C;  1UUS A;  2CRB A;  2DWG A;  2LRK A;  2UXN B;  3AVR A;  2WSS V;  1OWA A;  4UEM A;  4U33 A;  4DUZ T;  2CXD A;  3ONL C;  3MJX A;  5AQL B;  3PU3 A;  5H6Q B;  2L3L A;  4NUU A;  3AEA A;  2YOE A;  5LMU T;  3VHL A;  2MPK A;  4MFR A;  1HF8 A;  3T1H T;  3VKG A;  4ADZ A;  3N2O A;  4IE7 A;  2XQ6 A;  4DR1 T;  2L8K A;  4AXP A;  2LM9 A;  2K3W A;  4IDZ A;  1D1A A;  4DMW A;  3JAE A;  4EXT A;  2NTY A;  3JC6 D;  3KV6 A;  2EHO D;  3KIN B;  2B76 A;  2VVS A;  5JDQ A;  2XPK A;  3N5L A;  2MOZ A;  4JEH B;  5LXT E;  1BR2 A;  1S94 A;  1D0Y A;  3HKD E;  4NXM T;  1HNX T;  4L0R A;  5IHY A;  5F3J A;  2LE8 A;  2IIU A;  4DR4 T;  4QXB B;  4DVD A;  2Y6X A;  3U3I A;  4U2Z A;  5DAB A;  2CM0 A;  4X66 T;  5FY0 A;  2KSR A;  4DV3 T;  2LSG A;  1U5P A;  2D5U A;  3CK6 A;  3AVS A;  1KNZ A;  4JV5 T;  4ZS2 A;  1OED E;  4YFS A;  2YKS A;  2X66 A;  2AXD S;  4TV9 E;  4OX9 T;  1T7S A;  2H7O A;  2CPT A;  3KBT A;  3V5U A;  2W61 A;  5JDF A;  4IRE A;  4DR7 T;  2LOP A;  4UF0 A;  4EYU A;  1WYC A;  1KNR A;  2WDV A;  5DQV A;  2QRX A;  2B1E A;  4A98 A;  4AKH A;  4HE8 A;  1YXR A;  3AEG A;  2XTL A;  1D0X A;  3J9X 1;  2HPL A;  4LF8 T;  4WBN E;  2V7M A;  3ONJ A;  3EUH A;  2UXD T;  4IL4 A;  3P7I A;  4K0K T;  2CCQ A;  4HFD A;  4U72 A;  3ZJ1 A;  4IE0 A;  2L9Q A;  2XAS B;  3RX6 A;  4CN4 A;  3O1J A;  5AQK B;  4YSX A;  4EOZ B;  3EVY A;  4UEL A;  4DID B;  3SRZ A;  4U2Y A;  1M62 A;  2BVL A;  5JRC A;  4O4L E;  5IWA T;  4U74 A;  4U3C A;  4IST A;  4CI3 B;  2JQ9 A;  5KXJ A;  4LF4 T;  5JH7 E;  4AIU A; 
#chains in the Genus database with same CATH homology
 3N9O A;  5FMN A;  5FXX A;  3AA7 B;  5LA6 E;  2G0U A;  2X51 A;  1MMG A;  4UXN B;  5LHH B;  5C8Y E;  2C5J A;  4PK5 A;  5LHI B;  5FXW A;  5DJQ C;  2E8I A;  3CQC B;  3O9X A;  2NWB A;  4HKA A;  2NW9 A;  2P9B A;  2V7I A;  3C4W A;  3IHR A;  1IAP A;  3RRC A;  4YLH A;  2JMH A;  3EDU A;  4H9Q C;  4BA9 A;  1SHZ C;  1D1B A;  4DMV A;  1YW0 A;  2K9A A;  5J2T E;  5JDN A;  2VKH A;  4UV8 B;  2KZ7 B;  2XAG B;  4PJM A;  5JDL A;  4X1Y E;  1UX4 A;  3GN5 A;  4TV8 E;  3Q5X A;  2XAH B;  4X20 E;  3M65 A;  3O1H A;  4H63 V;  5FY1 A;  4E7S A;  3ZMV B;  3LG7 A;  4B6X A;  5JR9 B;  2A3D A;  2QA7 A;  4H9O C;  3RYF E;  3U78 A;  4AKL A;  2CLY B;  4I50 E;  4IE6 A;  1HS7 A;  2DI4 A;  2X68 A;  2DCF A;  3ZPO A;  3CML A;  4GYR A;  3IEE A;  3P8C D;  5FNV E;  2LJL A;  3AAE B;  3GWH A;  5HWY A;  2VKO A;  4L9I A;  2YU2 A;  3ZMZ B;  3ZYK A;  2HH7 A;  4IIJ E;  3VKH A;  3O4X E;  3OYX A;  5M4Y A;  3CVR A;  2XAJ B;  3FB2 A;  4KUM B;  3N9Q A;  3OYZ A;  3KVA A;  4QXC B;  5EZY E;  1MIW A;  3K8P C;  4AQG A;  2CEA A;  2IAK A;  3F31 A;  5HXR A;  1FMW A;  2BZB A;  2IC6 A;  5JR9 C;  4P09 A;  3ZMT B;  3J7Y q;  2X9X A;  4UVC B;  4CI1 B;  3LJC A;  3QUJ A;  1U4Q A;  2JJ9 A;  4O4H E;  4JUY A;  3R84 B;  5LGN B;  2DHR A;  4HFV A;  3R6N A;  5LOV E;  2ZMA A;  4F6R C;  3F57 A;  4GK5 E;  5ADX L;  3ESL A;  3CPZ A;  3V5S A;  4O4J E;  4DBR A;  3RKO A;  3WI3 A;  2N9D A;  2X67 A;  4QHO A;  4UVB B;  4OYK A;  5KMG P;  4CZZ B;  3CX6 B;  3UTK A;  3WAK A;  4BAY B;  2N2N A;  2Z6E A;  2WMO A;  4M1P A;  4NUV A;  4O4I E;  4I43 B;  4EIW A;  1BR4 A;  3F2E A;  3I9Y A;  4H9S E;  1FMV A;  5FXV A;  4DO0 A;  3PUG A;  4PFP A;  2A72 A;  3HKE E;  1ZHC A;  3IF8 B;  4UF0 B;  3AA0 B;  5LCY A;  4DND A;  5CA0 E;  5FXZ A;  4BJN A;  2KWI B;  2V7J A;  2A2F X;  1IJ6 A;  4IHJ E;  3DTO A;  4QKN A;  3ZLI A;  3I0O A;  1ZV4 X;  5LYJ E;  4WNK A;  4C91 A;  3I0Q A;  4HEA A;  4PFO A;  4MHC A;  2ODV A;  3L3P A;  4C90 A;  4ASK A;  3RRW A;  3ANW B;  4QX7 B;  2MBG A;  2YEV C;  4ZI7 E;  3N2G E;  3C64 A;  1US7 B;  3ZC1 A;  2LSI A;  3LBX B;  3ZN0 B;  5LHG B;  2H3R A;  5IYZ E;  2LHN A;  2VWA A;  3ETU A;  2JRK A;  3C50 A;  2JQQ A;  3QK6 A;  4MLK A;  1HCI A;  2EHO B;  4KMC A;  4GYS A;  3MAC A;  4PW8 A;  1ZEE A;  5HXC A;  2C0S A;  1G8X A;  2CE7 A;  1MMN A;  3HL6 A;  1KK7 A;  5CA1 E;  5TAO A;  3CQX C;  3DJB A;  5LNK A;  3CKD A;  2YK0 A;  3E08 A;  2D2S A;  4EYY R;  4EZH A;  3I9W A;  4OHF A;  2DLR A;  2LHR A;  5EK2 A;  5HXS A;  3LK4 2;  3EDV A;  3C51 A;  4QX8 B;  2LSJ A;  3RPU A;  2LOS A;  2V1D B;  4QWN B;  3ZCJ A;  5JR9 A;  1MMA A;  3N9P A;  2PG8 A;  3OBV E;  3HI2 A;  4H9P C;  3UUX B;  3LFM A;  4XZC A;  3RC8 A;  1BR0 A;  3E22 E;  5L3G B;  5JRC B;  3N9L A;  4N78 D;  4YJ2 E;  2KMF A;  4V1A v;  2BVM A;  3MK7 C;  5FYM A;  5L3B B;  2CMR A;  2LSY A;  1NWM X;  3I1A A;  5JRE A;  2E9X D;  4OFZ A;  4DBQ A;  4JEU B;  3ZJ2 A;  2ODU A;  3UUL A;  3C4Z A;  3OKQ A;  2E9X B;  5J2U E;  2ZM2 A;  4AKI A;  2Y48 B;  2X9Y A;  5ETW A;  4UIG A;  4YJ3 E;  2D0T A;  1LRZ A;  2NP9 A;  3E0Z A;  1FIO A;  2J1D G;  2JPF A;  2C5K T;  3UUM A;  4ZHQ E;  3BQI A;  1EZ3 A;  4P0B A;  4HTE A;  1MMD A;  1LVK A;  1O3X A;  2X9H A;  4QXH B;  3ZEF B;  5LGU B;  3ONX A;  1QUU A;  2KXP B;  5L3F B;  2ZLY A;  3RH3 A;  2NW8 A;  1CUN A;  3ZN1 B;  3KV5 A;  2IW5 B;  3A5X A;  4UVA B;  1YKE B;  3AA6 B;  1UX5 A;  2PFV A;  2WAU A;  3N9M A;  2VKJ A;  3PUQ A;  4ZOL E;  4G63 A;  5J1G A;  4EAH A;  2MTQ A;  4ZI3 D;  1B7T A;  3N2K E;  2CLY C;  2V7K A;  4ERR A;  3UFE A;  5JDH A;  2NW7 A;  2E9X C;  5HYA A;  1IJ5 A;  3VU7 H;  2UXN B;  2DWG A;  2K48 A;  3AVR A;  4YHJ A;  3K3N A;  4MBQ A;  2WSS V;  3N9N A;  3S4U A;  1OWA A;  4UEM A;  5H6R B;  2CXD A;  4K0U A;  5AFU L;  2LT3 A;  4HGA A;  2KT9 A;  2KIN B;  3MJX A;  4H63 H;  5FP3 A;  3LK2 B;  3PU3 A;  2ES0 A;  5H6Q B;  1HTJ F;  2L3L A;  2Q9Q B;  3KV4 A;  1E1H B;  4NUU A;  4OYJ A;  2XAF B;  2CWY A;  5HWX A;  2LSK A;  2BDE A;  2YU1 A;  3KV9 A;  3ANW A;  3NZP A;  3PTR B;  4TX5 A;  4GOU A;  1OXZ A;  5E0O A;  2VK9 A;  2H7V C;  3VHL A;  5HAX A;  4E7Z A;  4GIW A;  1HG5 A;  4ZI3 C;  4MFR A;  3UUN A;  2GK9 A;  1HF8 A;  5HXH A;  3LBX A;  4KP3 C;  3VKG A;  4TN7 B;  4ADZ A;  1WR6 A;  3N2O A;  4IE7 A;  3LK3 B;  2Y8D A;  2EHO A;  2I59 A;  4CXX A;  1V9D A;  3C4X A;  4IE4 A;  5JDM A;  3W15 B;  1ZKE A;  2L8K A;  3H3A A;  5JVD E;  2V26 A;  4AXP A;  3ZYM A;  2LM9 A;  2KLQ A;  3GA8 A;  4JLE A;  5HXE A;  4IDZ A;  3MKD A;  3TKL B;  1D1A A;  1IZN B;  4DMW A;  5L3C B;  5LG4 A;  4TZ4 C;  1X79 A;  1Y64 B;  2KND A;  4EXT A;  1Z0P A;  2NTY A;  1D1C A;  4KBM B;  4AQF C;  3JC6 D;  3KV6 A;  2EHO D;  2M67 A;  3KIN B;  3BQK A;  3CX8 B;  2K24 A;  3GMI A;  3SS1 A;  3NRX A;  5JDQ A;  5JDG A;  5A1L A;  4XAX B;  4I55 E;  1MIV A;  3IBP A;  4PJL A;  3N5L A;  2MOZ A;  2WBL A;  4JEH B;  5LXT E;  1BR2 A;  1S94 A;  1D0Y A;  1S35 A;  1WYB A;  2W00 A;  3HKD E;  1BR1 A;  2OA5 A;  2CWO A;  3T8O A;  3NZQ A;  4CI2 B;  4OK0 A;  1LVF A;  1HFA A;  4P0A A;  4I4T E;  4L0R A;  1MND A;  1MNE A;  2XUE A;  3ZMU B;  2ZM0 A;  3MA9 A;  2E9X A;  3ETV A;  3JC6 C;  2EHO C;  2XQY A;  1YD8 G;  5IHY A;  5FY7 A;  4WBO A;  5F3J A;  2LE8 A;  2PJQ A;  3KDS E;  4EB6 E;  3Q5W A;  3RYI E;  5F8P A;  4WW0 A;  4CQI A;  4X1I E;  1T98 A;  5LGT B;  3QC9 A;  4QXB B;  4DVD A;  3MXZ A;  5LP6 E;  2Y6X A;  2RP4 A;  2VAS A;  3U3I A;  4O2A E;  5DAB A;  1SA0 E;  2CM0 A;  3L09 A;  3HKB E;  5L3E B;  4O2B E;  4O8S A;  1LKX A;  1WLX A;  5FY0 A;  4FJO A;  4ISS A;  4PJN A;  1WRD A;  3DP7 A;  4IE5 A;  5LBM A;  2LSG A;  3H37 A;  1U5P A;  3PU8 A;  2D5U A;  2PBI A;  2VL8 A;  4H9R C;  3AAI A;  3PDY A;  3AVS A;  1KNZ A;  4ZS2 A;  3SWH A;  3PUS A;  4H9N C;  4ILU A;  4TUY E;  3CX7 B;  1H7C A;  2KWH A;  4YFS A;  5EK3 A;  1VRB A;  2MYS A;  2X66 A;  2WMN A;  2X9W A;  5L2L A;  5LJN A;  3K3O A;  4TV9 E;  5JQG E;  2XAQ B;  3AAA B;  2H7O A;  3KBT A;  5EK4 A;  2Q9Q A;  1HG2 A;  3V5U A;  4PAG A;  1D0Z A;  2NOX A;  2W62 A;  2WWU A;  3NBX X;  3OJA A;  5GON E;  3ZC0 A;  4AKG A;  2W61 A;  2K5B B;  3FBL A;  5JDF A;  4EZ4 A;  1G73 A;  3KFW X;  3WAJ A;  2LOP A;  4UF0 A;  4AQF A;  3FXD B;  4EYU A;  2IC9 A;  4ZS3 A;  1WYC A;  4AI6 A;  4FI5 A;  5DQW A;  2WM9 A;  2XHE B;  2UXX B;  3GN5 B;  5DQV A;  1AJ3 A;  3PUR A;  4CXY A;  3B57 A;  2Q9Q D;  3RYC E;  2ACX A;  4IGU A;  2B1E A;  4AKH A;  4MAL A;  2SPC A;  2CXL A;  2V7L A;  4HE8 A;  5BMV E;  3HR0 A;  2QGS A;  3Q9D A;  2VKD A;  2XTL A;  3KVB A;  3K3Q C;  2ZM8 A;  5LBQ B;  4G2A A;  1D0X A;  3BQL A;  3RYH E;  4PJJ A;  3RC3 A;  5LJM A;  4J2C A;  2CA5 A;  3J9X 1;  2HPL A;  2RA1 A;  3AB3 B;  4PNI A;  4GK0 E;  3CWZ B;  4WBN E;  2DNX A;  2V7M A;  3EUH A;  1FEW A;  4PK4 A;  2JMK A;  2C5I T;  1YKH B;  4PK6 A;  2D0U A;  2LEH A;  3NRY A;  5KX5 E;  3P7I A;  3ZMS B;  3C98 B;  1NAF A;  2NTX A;  4ZI2 D;  2CCQ A;  2Q9Q C;  4U72 A;  1HX8 A;  3ZJ1 A;  1MIY A;  4IE0 A;  4A56 A;  4ANJ A;  3ZCI A;  3PE0 A;  1QSD A;  3Q2M A;  2L9Q A;  2X0L B;  4L5G A;  3AA1 B;  4AKR B;  3KBU A;  2XAS B;  3PUA A;  3RX6 A;  3FHN A;  2DWK A;  3O1J A;  2HPJ A;  3SOL A;  2W63 A;  3FXE B;  5KDM C;  4EOZ B;  3FBZ A;  2W0G A;  3EVY A;  4UEL A;  4XBF B;  2VB6 A;  3BK9 A;  4UV9 B;  4Z8X A;  4CXW A;  2CXF A;  3D0T A;  2N1G A;  3SRZ A;  3UT5 E;  3O1I A;  2BVL A;  3B13 A;  2YIN A;  5JRC A;  4O4L E;  3ZYL A;  4U74 A;  3HA4 A;  3HKC E;  5L3D B;  4HN9 A;  1UCU A;  1VOM A;  3MZK B;  4IST A;  4ZI2 C;  4CI3 B;  4X1K E;  4BJM A;  5CB4 E;  5JH7 E;  3CQG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...