4ZI2C

Bart-like domain of bartl1/ccdc104 in complex with arl3fl bound to gppnhp in p21 21 21
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
131
structure length
131
Chain Sequence
b'AAEEEDEVEWVVESIAGFLRGPDWSIPILDFVEQKCEVFDDEEESKLTYTEIHQEYKELVEKLLESYLKEIGINEDQFQEACTSPLAKTRTSQAILQPVLAAEDFTIFKAMMVQKNIEMQLQAIRIIQERN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor-like protein 3
publication title The Interaction of CCDC104/BARTL1 with Arl3 and Implications for Ciliary Function.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 56
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2015-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11527 ARL2_Bind_BART The ARF-like 2 binding protein BART
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1900 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4zi2C00
4ZI2C 4ZI2D 2K9AA 4ZI3C 4ZI3D
chains in the Genus database with same CATH superfamily
4IT4A 5L3GB 2NW9A 2H3RA 3SFDA 2H7OA 5KDMC 2ZM0A 4GOUA 1NEKA 1E7PA 5LYJE 3KV6A 2LOSA 4B3MT 1MIVA 3F31A 5KX5E 2MOZA 5FP3A 3UT5E 1D0XA 4IL4A 1W0BA 1LRZA 5AQKB 1AJ3A 2XZEA 2W67A 3K3QC 4B6XA 4U33A 3LBXB 5FVLA 1OEDA 5HWYA 4YHHT 3V5SA 2K9AA 2K48A 4UV8B 1YQ4A 3N9LA 4TV8E 4AKHA 2XQ6A 2VQET 2NWBA 4OK0A 3RYHE 4ERRA 4K0KT 3N9OA 2V6YA 3C4WA 1T7SA 4I55E 4JI2T 2XJ7A 4FJOA 4EZ4A 3H3MA 4ASKA 1MMNA 3ABVA 2LSYA 1VRBA 2V7IA 5HXEA 2BG9E 4C90A 1J1JA 4QH1A 4JBWF 5LP6E 3PU3A 1XDOA 3V5UA 4YXDA 4X1IE 3N9QA 3VKHA 4OYKA 5A1LA 3IA3A 3J7Yq 3CMLA 1HF8A 1IAPA 2UXDT 2YINA 2BVMA 2JPFA 3ZYMA 3BK9A 3QOFA 5DQVA 2LEHA 2LRKA 2BG9A 3N9NA 5HXRA 4HFVA 4UVBB 2E5VA 5DABA 1HS7A 3TLTA 2JQQA 4UIGA 3JC6D 2LKGA 3RC3A 4DBQA 3NWIA 2LSKA 4U7YA 2JIWA 4YT0A 2NP9A 4KBMB 1VCSA 3Q5DA 5H6QB 2XQ4A 2XQ7A 4N78D 4NXMT 4AQYT 3NRXA 5EK2A 4LF5T 3WAJA 2IIUA 4NPPA 1WYCA 2XTLA 1UX4A 1OXZA 3KFWX 4TZ4C 2FJBA 4P0AA 4AKGA 5AQRB 3K1SA 3LK2B 3AE4A 3UU4A 3KINB 4G2AA 2MTQA 2CHNA 3B57A 4DR3T 4DUYT 3ONXA 3EDVA 1FMWA 3PUSA 4AISA 1W9RA 2X9YA 2HPLA 3HKEE 4DV3T 4O2BE 2VWAA 3RKOA 5JR9A 4LMKA 2L8KA 2BZBA 5FXXA 3CPZA 4OFZA 2W61A 4EOZB 2CWOA 2AXDS 5J2UE 1LVKA 5F8PA 4DUZT 4LF4T 2ZM6T 3SFEA 1Y64B 3I0OA 4YSZA 5HAXA 4ZI2C 2DCFA 5HEOA 3IF8B 1HNXT 1G73A 5FMNA 3K8PC 2DI4A 4GYRA 3IEEA 5ABGA 2W4XA 4WBOA 2BVLA 5LGTB 3P4RA 1MIWA 4O8SA 5JTGA 2MBGA 3HKDE 5KMGP 3T1HT 4EIWA 3PUVF 4IREA 4E7SA 2M67A 3MKDA 4JV5T 4EEDA 2VL0A 2UXBT 5JVDE 1FMVA 4O4JE 4MBQA 1ZOYA 4P1NA 1XDPA 3VRBA 4EAHA 3H3AA 5HEUA 2K5BB 5LJNA 3I9WA 3TLVA 4ADZA 2E9XC 3AE7A 3KBUA 4DO0A 4COFA 2P9BA 3C64A 3HKCE 2CBIA 2W0GA 4H9OC 2CE7A 4MHCA 2XAHB 5HYAA 1X79A 1HR0T 2DNXA 1O3XA 2LSGA 1L0VA 2JJ9A 4DV5T 1KK7A 5HXSA 4IDPA 3N2KE 4AQFC 3JADA 1H7CA 3CX7B 3JC6C 3HL6A 4UR9A 3CQCB 1IJ5A 4YTPA 3DP7A 2JQHA 4EEBA 4GK5E 3RIUA 5L3DB 5JRCB 3ESLA 4ZI7E 4TUYE 5HEJA 2EHOC 4UF0A 4IL9A 1WR0A 1W0AA 4HKAA 3ETVA 1I94T 2PJQA 3AEDA 1D1CA 1VCTA 2ES0A 4H9PC 3FBZA 2GK9A 2ZM2A 3CIRA 2FJEA 4PNIA 2KNDA 5FXWA 5ABHA 4AXPA 4HFHA 4YTNA 4WW0A 2NW8A 2D0UA 3K3NA 4YHJA 5LHIB 3VHLA 4ZI3D 4ILAA 2X9XA 4YFSA 2MYSA 4H63H 4PAGA 4CI1B 2RP4A 4QH5A 4A5XA 3HKBE 3LBXA 4HFDA 3OJAA 3OYZA 4DR4T 1S35A 5J1GA 3M3ZB 4UVCB 4QWNB 4HFBA 3CX6B 3UUMA 2WDRA 4UVAB 4MLKA 4EZHA 3AB3B 2X0YA 2QVAA 1KNRA 1SA0E 3EUHA 3AXJB 3NKZA 3ZJ1A 2Y48B 4JI5T 4PJMA 2X67A 4IHJE 2WAUA 3J9X1 4DR5T 3ZT7A 1D0YA 3SOLA 4PK5A 2DWGA 2KWIB 3EDUA 1HNZT 5ETWA 3C98B 3CKDA 2V6XA 3GWHA 2WSSV 3X1DA 2Q9QB 1UK5A 1YXRA 4HEAA 3RI5A 1FJGT 4HTEA 2BS3A 2XAFB 1N36T 2PTFA 4E7ZA 4GIWA 2UUBT 2EHOB 4YJ3E 3AAIA 4DV4T 2BS4A 2WS3A 3PV0F 3VU7H 3GMIA 3ZC1A 3L3PA 3UULA 4X5TA 2RPAA 4CN1A 1MNEA 3GN5B 4UV9B 1U5PA 5EK4A 4NUVA 3FZHB 3L39A 2QYWA 2CEAA 1V9DA 3MXZA 1BR1A 3AE6A 3T8OA 3RF1A 5HEHA 3P4SA 1NWMX 2I0MA 4V1Av 4O4LE 5CJ5A 2WWUA 4LF9T 3C51A 5AQHB 3LSVA 3ZMZB 2LSIA 4TV9E 3O9XA 3NRYA 2FUPA 3OVUA 4AQGA 4OX9T 3C4ZA 2V8SV 5AQLB 3Q2MA 3E0ZA 3AEFA 2I6HA 2V5DA 2ZM8A 5AQJB 2WP9A 5AQFB 4PJJA 3FHNA 4DMWA 3ZLIA 5L3FB 4DR1T 3KV4A 3AE5A 4DMVA 5J0ZA 3ZKRA 3BQKA 2XQ5A 4ZS3A 4KI0F 4XBFB 3UTKA 3O1JA 4HWHA 5CGMA 4JI6T 4WYVA 3PU8A 4GKJT 1OEDC 1CHUA 3EHZA 3AE9A 1YW0A 5LCYA 2J47A 4JLEA 4YJ2E 3AA0B 4L0RA 3R84B 3SS1A 2QGSA 5LMNT 1S94A 3KVBA 5JDNA 5FXZA 4YY3T 1ZHCA 2C0SA 4HWIB 4H9RC 2D9DA 4KMCA 4JI1T 2XM1A 4U3CA 2JMHA 3D0TA 5C3JA 5ADXL 4PK6A 5L2LA 4BA9A 3FXEB 3O4XE 1XZYA 2XQ3A 1U4QA 1MMDA 5EZYE 4H9SE 3UU3A 2JQ9A 3IHRA 2ZLYA 4QXHB 1UUSA 2A9UA 4JI4T 3FZKB 2BG9C 1SUMB 2J1DG 4ZZBA 2CLYC 5FNVE 5IHYA 2MPKA 2BKPA 3ZC0A 3QK6A 5AQGB 1E1HB 5HCMA 5E0OA 2IHR1 4U72A 4J2CA 3P4WA 2KINB 2K24A 3VR9A 5DJQC 2AE9A 3UU8A 3CWZB 2NTYA 3IBPA 3HR0A 4HN9A 4ILBA 2C5KT 2XASB 1IBKT 4A56A 2UU9T 4GK0E 1D1BA 3EAMA 3UQ7A 4X65T 4PJLA 5L47A 2RA1A 4TWFA 4MALA 4B3ST 4OHFA 5L3EB 5AQQB 5AQTB 1HNWT 2YEVC 4QHOA 4PFOA 2CRBA 4CXWA 2SPCA 3G06A 3ONLC 2IUBA 3HI2A 4X1YE 2X9HA 3I1AA 4H9QC 5JDQA 2VVNA 1BR2A 2XY8B 4YSYA 5JR9C 1UURA 2V6YB 3LK3B 2M6IA 1KF6A 1FEWA 1YQ3A 2XQ9A 1WLXA 4UXNB 2IAKA 1JNRA 3FZMB 4ISSA 4CN6A 2DL1A 3LFMA 4DR2T 2NR4A 4EYYR 3PUQA 4YTMA 4I4TE 1UCUA 4U2YA 4WBNE 3MZKB 3ZMSB 1DU2A 2X0HA 3C50A 5JDGA 4YSXA 1SHZC 4UELA 2HHHT 4AKRB 4O2AE 4ILUA 2WB5A 4TNVA 2UUAT 2CA5A 4HWCA 3KV5A 4DV7T 2X51A 5LG3A 3RIFA 5IWAT 2CLYB 4DNDA 2CXDA 2C5JA 4BAYB 2Y6XA 4JI3T 4X62T 2DWKA 2R6GF 2YDRA 2QRXA 1BR4A 3AAAB 3UU6A 2YK0A 2BBJA 2IW5B 4A98A 1N32T 4PW8A 3CK6A 2Q9QA 2VL8A 4LMLA 3LJCA 2W63A 2V7JA 4EYUA 2YKSA 3ONJA 2E5LT 1WRDA 4L5GA 2UUCT 3PUGA 5KXJA 4B3TT 5HWXA 4JYAT 3LG7A 2LM2A 3ZPOA 5LG4A 2XQAA 1N33T 4F8HA 3UU5A 5ABFB 2HN1A 3UQ4A 1I6ZA 5FXVA 5AQSB 4ILCA 3UUXB 3P7IA 4PK4A 1KNPA 1Z0PA 1WCRA 2Z6EA 3GN5A 3PJAJ 3FBLA 2JQKA 2G0UA 4JEUB 4LFAT 1NENA 2IMLA 3RIUC 1YKEB 2ODUA 2WZIA 1N34T 2W2UA 5JDHA 2CWYA 5HEGA 2NW7A 3P50A 4HGAA 3UFEA 3PUAA 5F3JA 3QB5K 1QLBA 2YOEA 1HTJF 1KEYA 2YN6A 2PBIA 2BBHA 3SWHA 3ZJ2A 2KZ7B 3OKQA 5JH7E 2X9WA 1HCIA 2X0LB 4MFRA 3RQWA 3RRWA 2KT9A 5TAOA 3NZPA 5LHHB 2DHRA 5M4YA 2XAGB 2A2FX 4X20E 3FZLB 3VR8A 1SE7A 1YD8G 3S4UA 4O4HE 1J5WA 3MK7C 3FXDB 3L09A 2D0TA 4U31A 5AQOB 2E9XB 3CQGB 1KNZA 1J5ET 2OV9A 3QB5A 4ZHQE 5LXTE 4ZZCA 4DVDA 2CMRA 3W15B 2XQYA 3PURA 2WCAA 4ZXLA 3RC8A 3P4PA 5L3BB 2XUEA 2H88A 2VQFT 4QX7B 4I50E 2FJDA 3RYIE 4DV6T 4Q25A 3AEAA 2KSRA 3ZMUB 3T1YT 3RKGA 3OYXA 4JI8T 5L4EA 5FY0A 2VVSA 3ETUA 3GA8A 4EB6E 2XQ8A 2XM2A 1X9BA 4JI0T 3ZT6A 4IE0A 3MACA 2IC9A 2L3LA 3RQUA 4H9NC 2NOXA 1T72A 3ZYKA 4X64T 2LLYA 3JCFA 3B13A 3FZFB 3AEBA 3WI3A 3PUZF 2V1DB 2JRKA 5AQVB 3L8RA 1HG2A 4JI7T 1IBMT 5LGNB 5H6RB 4JEHB 5IYZE 1OEDE 3AA7B 1ZKEA 3JAEA 5JQGE 5LA6E 3NBXX 1M7KA 4IDNA 4Z8XA 4CXYA 5HXHA 5FL0A 3ANWB 2XAQB 2IDOB 4ZI2D 2LSJA 2L9QA 1WFDA 3NZQA 1XWMA 4WNKA 3RH3A 3QNUA 4DV1T 2V26A 2WDQA 1IBLT 5HXCA 2D5UA 3ZMTB 2HN2A 4ISTA 2CHOA 5LMUT 1XNQT 2J62A 1D1AA 5LB7B 3N5LA 2UXNB 5IUXA 1G8XA 2CPTA 4UEMA 3KDSE 4ZI3C 3BQIA 3ZSTA 1GQEA 3AEEA 5GONE 4C91A 2CXLA 2WY2A 5CA1E 1XMOT 4GYSA 3N2OA 3TLSA 3RYCE 4K0UA 3AE2A 4XAXB 5DQWA 1XNRT 2WU5A 4AKIA 1Y01A 4ZOLE 2W62A 1ZV4X 2E8IA 4CI3B 2XPKA 2E9XD 2N1GA 5LOVE 3RHWA 4EGWA 5C8YE 4BJNA 2BDEA 3EI0A 1LVFA 3SRZA 4KHPT 2KMFA 2YDSA 4IE5A 2PG8A 2ODVA 2KWHA 1D0ZA 2LHRA 4CN4A 2Q9QD 3NVOA 3TLWA 2X66A 5JREA 1UGOA 2LRLA 2DLRA 4JUYA 2KLQA 3ZN1B 5J2TE 3ZCJA 1T98A 4BJMA 3ZT5A 3MJXA 3DTOA 2JMKA 2QA7A 2W66A 5AQNB 2EHOD 3A7MA 4TX5A 5FY1A 3DJBA 2CM0A 4HWFA 1WYBA 2LM9A 3PUXF 4IDQA 3B5MA 5FKYA 3RX6A 2A3DA 4IIJE 2WMNA 3P4QA 3AEGA 4XZCA 5JRCA 3CX8B 5ABFA 3AE8A 4QX8B 5LBMA 2W00A 2VKJA 5JDFA 4X1KE 2FBWA 1W09A 1VOMA 3ZSSA 3AA6B 3Q9DA 4DIDB 3Q5XA 1OEDB 1MIYA 2IC6A 4TWHA 3PE0A 4EV6A 2CCQA 5CFBA 2UXXB 3RGLA 2WM9A 4Z90A 4ZS2A 3F2EA 3EVYA 2BKOA 4KHZF 2UXCT 5FL1A 1WR6A 4DV2T 3P8CD 2A72A 3QC9A 3UUNA 3H37A 3EABA 5FYMA 2LKHA 5ABEA 1QUUA 2H89A 3VRAA 1KFYA 5LNKA 4QXCB 4HE8A 3Q5EA 4I0UA 5AQPB 4LF7T 4LFCT 2X68A 3O1IA 2N9DA 3U78A 2HH7A 4F6RC 4DR6T 3WAKA 4HWDA 4CXXA 2D2SA 3OTOT 1HFAA 2VKOA 2K3WA 3AVRA 2XAJB 5LJMA 1YKHB 1IJ6A 3AXJA 3LK42 2HPJA 2BG9B 5LHGB 1OWAA 1MMAA 5LBQB 3AVSA 1LKXA 2E9XA 3RYFE 3AAEB 2WWVA 3MA9A 2MAWA 2V5CA 4QH4A 4CI2B 3KBTA 2CBJA 3AE1A 3R6NA 2J4GA 4TWDA 3KV9A 4U7IA 2B1EA 4TNWA 4AQFA 2VASA 2WMOA 4U2ZA 4NXNT 3HA4A 3PTRB 3Q5WA 2KXPB 4KX6A 4LMJA 3I0QA 1ZEEA 2VKDA 3JAFA 1MMGA 3K3OA 2EHOA 3PUWF 2LE8A 5AQMB 2Q9QC 1US7B 1B7TA 1NAFA 2CXFA 1BR0A 1ZP0A 4P09A 3AECA 5L3CB 2V7MA 4QXBB 4IE4A 4FI5A 2VK9A 1E2AA 4LF6T 5AFUL 1XMQT 2YU1A 2XHEB 4B3RT 4HFEA 4WZXA 2XSAA 2VKHA 4KP3C 4IDZA 5HCJA 5JR9B 5L4HA 3CQXC 1FIOA 3ZCIA 4QKNA 5AQUB 3CVRA 4ZEYA 4H63V 4P0BA 3TLUA 2WDVA 1IZNB 5CB4E 3M65A 2ZMAA 3TKLB 2PFVA 2I59A 4IE6A 3RRCA 2WZHA 4A97A 3ANWA 4AI6A 3PJAA 2WU2A 3O1HA 2VURA 4AKLA 3A5XA 1UX5A 3LDQB 3UFGA 4DV0T 5CA0E 5EK3A 2ACZA 4TN7B 4Z91A 4CZZB 5JDMA 2WQYA 3VKGA 3PDYA 4NUUA 3N2GE 2B76A 1JNZA 2F4VT 2ACXA 2E2AA 3I9YA 3OPCA 3ZYLA 2LT3A 3U3IA 3AA1B 2YDQA 2OA5A 4OYJA 5FY7A 2WBLA 3ZN0B 2VB6A 1HX1B 3ZEFB 2LHNA 5C2TA 2YU2A 3FB2A 2M6BA 4CQIA 3RLFF 4IDOA 4PFPA 1MNDA 3A8YC 3UUBA 4AIUA 1QSDA 2FJAA 2LJLA 2V7LA 2OLTA 4X66T 4IGUA 3RIAA 5BR8T 4PJNA 4LFBT 2BKNA 4NIQA 1HX8A 3KVAA 4O4IE 3BQLA 5FVKA 5AQIB 4G63A 4HFIA 1M62A 4ANJA 3AE3A 4I43B 1CUNA 1EZ3A 3PUYF 3ZMVB 3F57A 1R8IA 3N9MA 2V7KA 4HFCA 4LF8T 5BMVE 5F5WA 4U74A 2N2NA 2BS2A 4EXTA 3E08A 3N9PA 2NTXA 2Y8DA 1Z8UA 3QUJA 4GKKT 4UF0B 3OBVE 4DR7T 4L9IA 4IE7A 3RPUA 2H7VC 3C4XA 4M1PA 2C5IT 5JDLA 5LGUB 2LOPA 1HG5A 4YLHA 3E22E 2XSBA 1T8BA 4KUMB 4DBRA
chains in the Genus database with same CATH topology
3K3NA 2X66A 3MZKB 4YHJA 5L3GB 5LHIB 3ZMSB 2NW9A 5JREA 3VHLA 3C50A 4ZI3D 5JDGA 1SHZC 2H3RA 2X9XA 4YFSA 2H7OA 2DLRA 2MYSA 4JUYA 5KDMC 2ZM0A 4UELA 2KLQA 3ZN1B 5J2TE 4GOUA 4H63H 4PAGA 1T98A 3ZCJA 4O2AE 4AKRB 3MJXA 3DTOA 4BJMA 4CI1B 4ILUA 2JMKA 2QA7A 2RP4A 5LYJE 3HKBE 3LBXA 2CA5A 3KV6A 3OJAA 3OYZA 2EHOD 2LOSA 1S35A 1MIVA 4TX5A 5FY1A 3KV5A 3DJBA 5J1GA 2X51A 2CLYB 4UVCB 4QWNB 3F31A 4DNDA 2CM0A 5KX5E 1WYBA 2LM9A 2CXDA 3CX6B 2MOZA 5FP3A 3UUMA 2C5JA 3UT5E 4BAYB 1D0XA 4UVAB 2Y6XA 4MLKA 2DWKA 3RX6A 4EZHA 3AB3B 1LRZA 2A3DA 1BR4A 1AJ3A 3K3QC 3AAAB 4B6XA 3LBXB 4IIJE 1SA0E 2YK0A 3EUHA 2WMNA 2IW5B 5HWYA 4XZCA 5JRCA 3V5SA 3ZJ1A 2Y48B 2K9AA 4PW8A 3CX8B 2K48A 4UV8B 2Q9QA 4QX8B 4PJMA 3N9LA 2VL8A 4TV8E 5LBMA 2W00A 2X67A 3LJCA 2VKJA 2W63A 4IHJE 2V7JA 2WAUA 4EYUA 4AKHA 5JDFA 4X1KE 3J9X1 1WRDA 1VOMA 2NWBA 4L5GA 3AA6B 3PUGA 1D0YA 3SOLA 3Q9DA 4OK0A 4PK5A 3RYHE 4ERRA 5HWXA 3N9OA 2DWGA 3LG7A 3C4WA 2KWIB 3EDUA 4I55E 3Q5XA 5ETWA 3C98B 1MIYA 3CKDA 3ZPOA 5LG4A 2IC6A 4FJOA 3PE0A 3GWHA 2WSSV 2CCQA 4EZ4A 4ASKA 2Q9QB 1MMNA 2UXXB 5FXVA 3UUXB 3P7IA 2LSYA 1VRBA 2V7IA 4PK4A 1Z0PA 2WM9A 5HXEA 2Z6EA 4HEAA 4ZS2A 3GN5A 4HTEA 3F2EA 4C90A 3FBLA 3EVYA 2G0UA 2XAFB 5LP6E 4JEUB 3PU3A 3V5UA 4X1IE 4E7ZA 4GIWA 3N9QA 1YKEB 2ODUA 1WR6A 3VKHA 4OYKA 5A1LA 5JDHA 2CWYA 2EHOB 4YJ3E 3J7Yq 3AAIA 3CMLA 1HF8A 2NW7A 2A72A 1IAPA 3P8CD 3QC9A 3UUNA 3H37A 4HGAA 3GMIA 3VU7H 2YINA 5FYMA 3ZC1A 2BVMA 2JPFA 3L3PA 3UULA 1QUUA 3ZYMA 3UFEA 5LNKA 1MNEA 3BK9A 3GN5B 3PUAA 4QXCB 4UV9B 4HE8A 5F3JA 1U5PA 5EK4A 5DQVA 2LEHA 4NUVA 3N9NA 5HXRA 4HFVA 4UVBB 1HTJF 5DABA 2X68A 3O1IA 1HS7A 2PBIA 2JQQA 3SWHA 2N9DA 2CEAA 3ZJ2A 4UIGA 2KZ7B 3OKQA 1V9DA 3JC6D 3MXZA 5JH7E 1BR1A 2X9WA 3U78A 3RC3A 4DBQA 3T8OA 2HH7A 1HCIA 2X0LB 4MFRA 4F6RC 1NWMX 4V1Av 3WAKA 4O4LE 2LSKA 4CXXA 2WWUA 2D2SA 1HFAA 2NP9A 3C51A 4KBMB 2VKOA 3AVRA 2XAJB 5LJMA 3RRWA 2KT9A 5H6QB 1YKHB 5TAOA 3NZPA 3ZMZB 1IJ6A 5LHHB 2LSIA 3LK42 2HPJA 4TV9E 3O9XA 4N78D 2DHRA 5LHGB 5M4YA 3NRXA 5EK2A 2XAGB 1OWAA 3NRYA 3WAJA 1MMAA 2A2FX 4AQGA 3C4ZA 5LBQB 4X20E 3Q2MA 3AVSA 1LKXA 2E9XA 3E0ZA 3RYFE 3AAEB 3MA9A 1YD8G 3S4UA 1WYCA 2XTLA 2ZM8A 1UX4A 4O4HE 1OXZA 3KFWX 4PJJA 3FHNA 4TZ4C 4DMWA 4CI2B 4P0AA 4AKGA 3ZLIA 3KBTA 5L3FB 3LK2B 3KV4A 3MK7C 3FXDB 3L09A 2D0TA 3KINB 4DMVA 3R6NA 4G2AA 3BQKA 3KV9A 2MTQA 4ZS3A 2E9XB 3CQGB 2B1EA 3B57A 4AQFA 4XBFB 2VASA 3UTKA 2WMOA 1KNZA 3O1JA 3HA4A 3PTRB 3Q5WA 2KXPB 4ZHQE 3I0QA 5LXTE 3PU8A 1ZEEA 4DVDA 2VKDA 2CMRA 3EDVA 3ONXA 3W15B 1FMWA 3PUSA 2XQYA 1MMGA 3K3OA 1YW0A 2EHOA 3PURA 5LCYA 2X9YA 2HPLA 2LE8A 2Q9QC 3HKEE 3RC8A 5L3BB 1US7B 4O2BE 2XUEA 1B7TA 2VWAA 3RKOA 1NAFA 4JLEA 2CXFA 5JR9A 4YJ2E 1BR0A 3AA0B 4QX7B 4L0RA 3R84B 4I50E 2L8KA 4P09A 2BZBA 5FXXA 3SS1A 5L3CB 2V7MA 2QGSA 3RYIE 4QXBB 4IE4A 3CPZA 4FI5A 4OFZA 2W61A 4EOZB 2VK9A 2CWOA 5AFUL 1S94A 2YU1A 3KVBA 5JDNA 5FXZA 5J2UE 3ZMUB 1ZHCA 2XHEB 1LVKA 5F8PA 3OYXA 2C0SA 4H9RC 2VKHA 4KMCA 4KP3C 4IDZA 1Y64B 3I0OA 4ZI2C 5HAXA 2JMHA 5JR9B 3D0TA 5ADXL 2DCFA 4PK6A 3CQXC 1FIOA 5FY0A 3ZCIA 3IF8B 4QKNA 3ETUA 3CVRA 3GA8A 4EB6E 1G73A 5L2LA 5FMNA 4H63V 4BA9A 4P0BA 3FXEB 3O4XE 3K8PC 1IZNB 1U4QA 2DI4A 4IE0A 4GYRA 3MACA 5CB4E 3IEEA 2ZMAA 3M65A 2IC9A 1MMDA 5EZYE 2L3LA 4WBOA 4H9SE 3TKLB 2BVLA 5LGTB 2PFVA 4H9NC 1MIWA 2NOXA 4O8SA 3IHRA 2I59A 4IE6A 2MBGA 3HKDE 3RRCA 3ZYKA 2ZLYA 5KMGP 4QXHB 3B13A 3WI3A 4EIWA 2V1DB 3ANWA 4AI6A 2JRKA 4E7SA 2M67A 3MKDA 3O1HA 2J1DG 4AKLA 1HG2A 3A5XA 2CLYC 1UX5A 5FNVE 5IHYA 5LGNB 5H6RB 4JEHB 5CA0E 5EK3A 5IYZE 3AA7B 3ZC0A 1ZKEA 5JVDE 3QK6A 1E1HB 5JQGE 1FMVA 5E0OA 5LA6E 3NBXX 4O4JE 4U72A 4Z8XA 4TN7B 4J2CA 4CZZB 5JDMA 4CXYA 5HXHA 3ANWB 4MBQA 3VKGA 3PDYA 2XAQB 2KINB 2K24A 4NUUA 3N2GE 4ZI2D 2LSJA 4EAHA 2L9QA 2ACXA 5DJQC 3H3AA 2K5BB 5LJNA 3I9WA 3I9YA 3NZQA 3ZYLA 4ADZA 2E9XC 3CWZB 4WNKA 3RH3A 3KBUA 2NTYA 3IBPA 2LT3A 3HR0A 3U3IA 4DO0A 3AA1B 4HN9A 2OA5A 4OYJA 5FY7A 2P9BA 2V26A 2C5KT 3C64A 3HKCE 2WBLA 2W0GA 2XASB 4A56A 5HXCA 3ZN0B 2VB6A 4H9OC 2CE7A 2D5UA 4GK0E 3ZEFB 2LHNA 1D1BA 3ZMTB 4MHCA 2YU2A 3FB2A 4CQIA 2XAHB 4ISTA 5HYAA 1X79A 4PJLA 4PFPA 1MNDA 2RA1A 4MALA 1D1AA 2DNXA 4OHFA 1O3XA 2LSGA 2JJ9A 3N5LA 5L3EB 2UXNB 1G8XA 4UEMA 1KK7A 5HXSA 3KDSE 3N2KE 4AQFC 1QSDA 2LJLA 2V7LA 1H7CA 3CX7B 4ZI3C 3BQIA 2YEVC 4IGUA 4QHOA 4PFOA 3JC6C 4PJNA 1HX8A 3HL6A 3CQCB 2SPCA 3KVAA 4O4IE 1IJ5A 3BQLA 5GONE 4CXWA 3DP7A 4C91A 4G63A 4GK5E 5L3DB 2CXLA 5JRCB 3HI2A 3ESLA 4ZI7E 5CA1E 4X1YE 4ANJA 4TUYE 4I43B 2X9HA 3I1AA 1CUNA 1EZ3A 3ZMVB 3F57A 4GYSA 2EHOC 3N2OA 4UF0A 3RYCE 4H9QC 4K0UA 3N9MA 4HKAA 2V7KA 5JDQA 1BR2A 3ETVA 4XAXB 5DQWA 5BMVE 5JR9C 4AKIA 3LK3B 4ZOLE 4U74A 2W62A 2N2NA 1FEWA 2PJQA 1ZV4X 2E8IA 4CI3B 1D1CA 2E9XD 2N1GA 5LOVE 4EXTA 3E08A 3N9PA 2ES0A 4H9PC 5C8YE 3FBZA 2BDEA 2NTXA 1WLXA 2Y8DA 4BJNA 4UXNB 2IAKA 3QUJA 2GK9A 4ISSA 2ZM2A 4UF0B 1LVFA 4PNIA 2KNDA 3OBVE 3SRZA 5FXWA 3LFMA 2KMFA 4IE5A 4IE7A 4L9IA 4AXPA 3RPUA 2H7VC 3C4XA 2PG8A 3PUQA 4EYYR 4M1PA 2C5IT 5JDLA 2ODVA 4WW0A 2KWHA 5LGUB 1D0ZA 2NW8A 2LHRA 2LOPA 1HG5A 1UCUA 4I4TE 4YLHA 3E22E 4KUMB 4DBRA 2D0UA 4WBNE 2Q9QD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZI2 C;  4ZI2 D;  2K9A A;  4ZI3 C;  4ZI3 D; 
#chains in the Genus database with same CATH topology
 4IT4 A;  5L3G B;  2NW9 A;  2H3R A;  3SFD A;  2H7O A;  5KDM C;  2ZM0 A;  4GOU A;  1NEK A;  1E7P A;  5LYJ E;  3KV6 A;  2LOS A;  4B3M T;  1MIV A;  3F31 A;  5KX5 E;  2MOZ A;  5FP3 A;  3UT5 E;  1D0X A;  4IL4 A;  1W0B A;  1LRZ A;  5AQK B;  1AJ3 A;  2XZE A;  2W67 A;  3K3Q C;  4B6X A;  4U33 A;  3LBX B;  5FVL A;  1OED A;  5HWY A;  4YHH T;  3V5S A;  2K9A A;  2K48 A;  4UV8 B;  1YQ4 A;  3N9L A;  4TV8 E;  4AKH A;  2XQ6 A;  2VQE T;  2NWB A;  4OK0 A;  3RYH E;  4ERR A;  4K0K T;  3N9O A;  2V6Y A;  3C4W A;  1T7S A;  4I55 E;  4JI2 T;  2XJ7 A;  4FJO A;  4EZ4 A;  3H3M A;  4ASK A;  1MMN A;  3ABV A;  2LSY A;  1VRB A;  2V7I A;  5HXE A;  2BG9 E;  4C90 A;  1J1J A;  4QH1 A;  4JBW F;  5LP6 E;  3PU3 A;  1XDO A;  3V5U A;  4YXD A;  4X1I E;  3N9Q A;  3VKH A;  4OYK A;  5A1L A;  3IA3 A;  3J7Y q;  3CML A;  1HF8 A;  1IAP A;  2UXD T;  2YIN A;  2BVM A;  2JPF A;  3ZYM A;  3BK9 A;  3QOF A;  5DQV A;  2LEH A;  2LRK A;  2BG9 A;  3N9N A;  5HXR A;  4HFV A;  4UVB B;  2E5V A;  5DAB A;  1HS7 A;  3TLT A;  2JQQ A;  4UIG A;  3JC6 D;  2LKG A;  3RC3 A;  4DBQ A;  3NWI A;  2LSK A;  4U7Y A;  2JIW A;  4YT0 A;  2NP9 A;  4KBM B;  1VCS A;  3Q5D A;  5H6Q B;  2XQ4 A;  2XQ7 A;  4N78 D;  4NXM T;  4AQY T;  3NRX A;  5EK2 A;  4LF5 T;  3WAJ A;  2IIU A;  4NPP A;  1WYC A;  2XTL A;  1UX4 A;  1OXZ A;  3KFW X;  4TZ4 C;  2FJB A;  4P0A A;  4AKG A;  5AQR B;  3K1S A;  3LK2 B;  3AE4 A;  3UU4 A;  3KIN B;  4G2A A;  2MTQ A;  2CHN A;  3B57 A;  4DR3 T;  4DUY T;  3ONX A;  3EDV A;  1FMW A;  3PUS A;  4AIS A;  1W9R A;  2X9Y A;  2HPL A;  3HKE E;  4DV3 T;  4O2B E;  2VWA A;  3RKO A;  5JR9 A;  4LMK A;  2L8K A;  2BZB A;  5FXX A;  3CPZ A;  4OFZ A;  2W61 A;  4EOZ B;  2CWO A;  2AXD S;  5J2U E;  1LVK A;  5F8P A;  4DUZ T;  4LF4 T;  2ZM6 T;  3SFE A;  1Y64 B;  3I0O A;  4YSZ A;  5HAX A;  4ZI2 C;  2DCF A;  5HEO A;  3IF8 B;  1HNX T;  1G73 A;  5FMN A;  3K8P C;  2DI4 A;  4GYR A;  3IEE A;  5ABG A;  2W4X A;  4WBO A;  2BVL A;  5LGT B;  3P4R A;  1MIW A;  4O8S A;  5JTG A;  2MBG A;  3HKD E;  5KMG P;  3T1H T;  4EIW A;  3PUV F;  4IRE A;  4E7S A;  2M67 A;  3MKD A;  4JV5 T;  4EED A;  2VL0 A;  2UXB T;  5JVD E;  1FMV A;  4O4J E;  4MBQ A;  1ZOY A;  4P1N A;  1XDP A;  3VRB A;  4EAH A;  3H3A A;  5HEU A;  2K5B B;  5LJN A;  3I9W A;  3TLV A;  4ADZ A;  2E9X C;  3AE7 A;  3KBU A;  4DO0 A;  4COF A;  2P9B A;  3C64 A;  3HKC E;  2CBI A;  2W0G A;  4H9O C;  2CE7 A;  4MHC A;  2XAH B;  5HYA A;  1X79 A;  1HR0 T;  2DNX A;  1O3X A;  2LSG A;  1L0V A;  2JJ9 A;  4DV5 T;  1KK7 A;  5HXS A;  4IDP A;  3N2K E;  4AQF C;  3JAD A;  1H7C A;  3CX7 B;  3JC6 C;  3HL6 A;  4UR9 A;  3CQC B;  1IJ5 A;  4YTP A;  3DP7 A;  2JQH A;  4EEB A;  4GK5 E;  3RIU A;  5L3D B;  5JRC B;  3ESL A;  4ZI7 E;  4TUY E;  5HEJ A;  2EHO C;  4UF0 A;  4IL9 A;  1WR0 A;  1W0A A;  4HKA A;  3ETV A;  1I94 T;  2PJQ A;  3AED A;  1D1C A;  1VCT A;  2ES0 A;  4H9P C;  3FBZ A;  2GK9 A;  2ZM2 A;  3CIR A;  2FJE A;  4PNI A;  2KND A;  5FXW A;  5ABH A;  4AXP A;  4HFH A;  4YTN A;  4WW0 A;  2NW8 A;  2D0U A;  3K3N A;  4YHJ A;  5LHI B;  3VHL A;  4ZI3 D;  4ILA A;  2X9X A;  4YFS A;  2MYS A;  4H63 H;  4PAG A;  4CI1 B;  2RP4 A;  4QH5 A;  4A5X A;  3HKB E;  3LBX A;  4HFD A;  3OJA A;  3OYZ A;  4DR4 T;  1S35 A;  5J1G A;  3M3Z B;  4UVC B;  4QWN B;  4HFB A;  3CX6 B;  3UUM A;  2WDR A;  4UVA B;  4MLK A;  4EZH A;  3AB3 B;  2X0Y A;  2QVA A;  1KNR A;  1SA0 E;  3EUH A;  3AXJ B;  3NKZ A;  3ZJ1 A;  2Y48 B;  4JI5 T;  4PJM A;  2X67 A;  4IHJ E;  2WAU A;  3J9X 1;  4DR5 T;  3ZT7 A;  1D0Y A;  3SOL A;  4PK5 A;  2DWG A;  2KWI B;  3EDU A;  1HNZ T;  5ETW A;  3C98 B;  3CKD A;  2V6X A;  3GWH A;  2WSS V;  3X1D A;  2Q9Q B;  1UK5 A;  1YXR A;  4HEA A;  3RI5 A;  1FJG T;  4HTE A;  2BS3 A;  2XAF B;  1N36 T;  2PTF A;  4E7Z A;  4GIW A;  2UUB T;  2EHO B;  4YJ3 E;  3AAI A;  4DV4 T;  2BS4 A;  2WS3 A;  3PV0 F;  3VU7 H;  3GMI A;  3ZC1 A;  3L3P A;  3UUL A;  4X5T A;  2RPA A;  4CN1 A;  1MNE A;  3GN5 B;  4UV9 B;  1U5P A;  5EK4 A;  4NUV A;  3FZH B;  3L39 A;  2QYW A;  2CEA A;  1V9D A;  3MXZ A;  1BR1 A;  3AE6 A;  3T8O A;  3RF1 A;  5HEH A;  3P4S A;  1NWM X;  2I0M A;  4V1A v;  4O4L E;  5CJ5 A;  2WWU A;  4LF9 T;  3C51 A;  5AQH B;  3LSV A;  3ZMZ B;  2LSI A;  4TV9 E;  3O9X A;  3NRY A;  2FUP A;  3OVU A;  4AQG A;  4OX9 T;  3C4Z A;  2V8S V;  5AQL B;  3Q2M A;  3E0Z A;  3AEF A;  2I6H A;  2V5D A;  2ZM8 A;  5AQJ B;  2WP9 A;  5AQF B;  4PJJ A;  3FHN A;  4DMW A;  3ZLI A;  5L3F B;  4DR1 T;  3KV4 A;  3AE5 A;  4DMV A;  5J0Z A;  3ZKR A;  3BQK A;  2XQ5 A;  4ZS3 A;  4KI0 F;  4XBF B;  3UTK A;  3O1J A;  4HWH A;  5CGM A;  4JI6 T;  4WYV A;  3PU8 A;  4GKJ T;  1OED C;  1CHU A;  3EHZ A;  3AE9 A;  1YW0 A;  5LCY A;  2J47 A;  4JLE A;  4YJ2 E;  3AA0 B;  4L0R A;  3R84 B;  3SS1 A;  2QGS A;  5LMN T;  1S94 A;  3KVB A;  5JDN A;  5FXZ A;  4YY3 T;  1ZHC A;  2C0S A;  4HWI B;  4H9R C;  2D9D A;  4KMC A;  4JI1 T;  2XM1 A;  4U3C A;  2JMH A;  3D0T A;  5C3J A;  5ADX L;  4PK6 A;  5L2L A;  4BA9 A;  3FXE B;  3O4X E;  1XZY A;  2XQ3 A;  1U4Q A;  1MMD A;  5EZY E;  4H9S E;  3UU3 A;  2JQ9 A;  3IHR A;  2ZLY A;  4QXH B;  1UUS A;  2A9U A;  4JI4 T;  3FZK B;  2BG9 C;  1SUM B;  2J1D G;  4ZZB A;  2CLY C;  5FNV E;  5IHY A;  2MPK A;  2BKP A;  3ZC0 A;  3QK6 A;  5AQG B;  1E1H B;  5HCM A;  5E0O A;  2IHR 1;  4U72 A;  4J2C A;  3P4W A;  2KIN B;  2K24 A;  3VR9 A;  5DJQ C;  2AE9 A;  3UU8 A;  3CWZ B;  2NTY A;  3IBP A;  3HR0 A;  4HN9 A;  4ILB A;  2C5K T;  2XAS B;  1IBK T;  4A56 A;  2UU9 T;  4GK0 E;  1D1B A;  3EAM A;  3UQ7 A;  4X65 T;  4PJL A;  5L47 A;  2RA1 A;  4TWF A;  4MAL A;  4B3S T;  4OHF A;  5L3E B;  5AQQ B;  5AQT B;  1HNW T;  2YEV C;  4QHO A;  4PFO A;  2CRB A;  4CXW A;  2SPC A;  3G06 A;  3ONL C;  2IUB A;  3HI2 A;  4X1Y E;  2X9H A;  3I1A A;  4H9Q C;  5JDQ A;  2VVN A;  1BR2 A;  2XY8 B;  4YSY A;  5JR9 C;  1UUR A;  2V6Y B;  3LK3 B;  2M6I A;  1KF6 A;  1FEW A;  1YQ3 A;  2XQ9 A;  1WLX A;  4UXN B;  2IAK A;  1JNR A;  3FZM B;  4ISS A;  4CN6 A;  2DL1 A;  3LFM A;  4DR2 T;  2NR4 A;  4EYY R;  3PUQ A;  4YTM A;  4I4T E;  1UCU A;  4U2Y A;  4WBN E;  3MZK B;  3ZMS B;  1DU2 A;  2X0H A;  3C50 A;  5JDG A;  4YSX A;  1SHZ C;  4UEL A;  2HHH T;  4AKR B;  4O2A E;  4ILU A;  2WB5 A;  4TNV A;  2UUA T;  2CA5 A;  4HWC A;  3KV5 A;  4DV7 T;  2X51 A;  5LG3 A;  3RIF A;  5IWA T;  2CLY B;  4DND A;  2CXD A;  2C5J A;  4BAY B;  2Y6X A;  4JI3 T;  4X62 T;  2DWK A;  2R6G F;  2YDR A;  2QRX A;  1BR4 A;  3AAA B;  3UU6 A;  2YK0 A;  2BBJ A;  2IW5 B;  4A98 A;  1N32 T;  4PW8 A;  3CK6 A;  2Q9Q A;  2VL8 A;  4LML A;  3LJC A;  2W63 A;  2V7J A;  4EYU A;  2YKS A;  3ONJ A;  2E5L T;  1WRD A;  4L5G A;  2UUC T;  3PUG A;  5KXJ A;  4B3T T;  5HWX A;  4JYA T;  3LG7 A;  2LM2 A;  3ZPO A;  5LG4 A;  2XQA A;  1N33 T;  4F8H A;  3UU5 A;  5ABF B;  2HN1 A;  3UQ4 A;  1I6Z A;  5FXV A;  5AQS B;  4ILC A;  3UUX B;  3P7I A;  4PK4 A;  1KNP A;  1Z0P A;  1WCR A;  2Z6E A;  3GN5 A;  3PJA J;  3FBL A;  2JQK A;  2G0U A;  4JEU B;  4LFA T;  1NEN A;  2IML A;  3RIU C;  1YKE B;  2ODU A;  2WZI A;  1N34 T;  2W2U A;  5JDH A;  2CWY A;  5HEG A;  2NW7 A;  3P50 A;  4HGA A;  3UFE A;  3PUA A;  5F3J A;  3QB5 K;  1QLB A;  2YOE A;  1HTJ F;  1KEY A;  2YN6 A;  2PBI A;  2BBH A;  3SWH A;  3ZJ2 A;  2KZ7 B;  3OKQ A;  5JH7 E;  2X9W A;  1HCI A;  2X0L B;  4MFR A;  3RQW A;  3RRW A;  2KT9 A;  5TAO A;  3NZP A;  5LHH B;  2DHR A;  5M4Y A;  2XAG B;  2A2F X;  4X20 E;  3FZL B;  3VR8 A;  1SE7 A;  1YD8 G;  3S4U A;  4O4H E;  1J5W A;  3MK7 C;  3FXD B;  3L09 A;  2D0T A;  4U31 A;  5AQO B;  2E9X B;  3CQG B;  1KNZ A;  1J5E T;  2OV9 A;  3QB5 A;  4ZHQ E;  5LXT E;  4ZZC A;  4DVD A;  2CMR A;  3W15 B;  2XQY A;  3PUR A;  2WCA A;  4ZXL A;  3RC8 A;  3P4P A;  5L3B B;  2XUE A;  2H88 A;  2VQF T;  4QX7 B;  4I50 E;  2FJD A;  3RYI E;  4DV6 T;  4Q25 A;  3AEA A;  2KSR A;  3ZMU B;  3T1Y T;  3RKG A;  3OYX A;  4JI8 T;  5L4E A;  5FY0 A;  2VVS A;  3ETU A;  3GA8 A;  4EB6 E;  2XQ8 A;  2XM2 A;  1X9B A;  4JI0 T;  3ZT6 A;  4IE0 A;  3MAC A;  2IC9 A;  2L3L A;  3RQU A;  4H9N C;  2NOX A;  1T72 A;  3ZYK A;  4X64 T;  2LLY A;  3JCF A;  3B13 A;  3FZF B;  3AEB A;  3WI3 A;  3PUZ F;  2V1D B;  2JRK A;  5AQV B;  3L8R A;  1HG2 A;  4JI7 T;  1IBM T;  5LGN B;  5H6R B;  4JEH B;  5IYZ E;  1OED E;  3AA7 B;  1ZKE A;  3JAE A;  5JQG E;  5LA6 E;  3NBX X;  1M7K A;  4IDN A;  4Z8X A;  4CXY A;  5HXH A;  5FL0 A;  3ANW B;  2XAQ B;  2IDO B;  4ZI2 D;  2LSJ A;  2L9Q A;  1WFD A;  3NZQ A;  1XWM A;  4WNK A;  3RH3 A;  3QNU A;  4DV1 T;  2V26 A;  2WDQ A;  1IBL T;  5HXC A;  2D5U A;  3ZMT B;  2HN2 A;  4IST A;  2CHO A;  5LMU T;  1XNQ T;  2J62 A;  1D1A A;  5LB7 B;  3N5L A;  2UXN B;  5IUX A;  1G8X A;  2CPT A;  4UEM A;  3KDS E;  4ZI3 C;  3BQI A;  3ZST A;  1GQE A;  3AEE A;  5GON E;  4C91 A;  2CXL A;  2WY2 A;  5CA1 E;  1XMO T;  4GYS A;  3N2O A;  3TLS A;  3RYC E;  4K0U A;  3AE2 A;  4XAX B;  5DQW A;  1XNR T;  2WU5 A;  4AKI A;  1Y01 A;  4ZOL E;  2W62 A;  1ZV4 X;  2E8I A;  4CI3 B;  2XPK A;  2E9X D;  2N1G A;  5LOV E;  3RHW A;  4EGW A;  5C8Y E;  4BJN A;  2BDE A;  3EI0 A;  1LVF A;  3SRZ A;  4KHP T;  2KMF A;  2YDS A;  4IE5 A;  2PG8 A;  2ODV A;  2KWH A;  1D0Z A;  2LHR A;  4CN4 A;  2Q9Q D;  3NVO A;  3TLW A;  2X66 A;  5JRE A;  1UGO A;  2LRL A;  2DLR A;  4JUY A;  2KLQ A;  3ZN1 B;  5J2T E;  3ZCJ A;  1T98 A;  4BJM A;  3ZT5 A;  3MJX A;  3DTO A;  2JMK A;  2QA7 A;  2W66 A;  5AQN B;  2EHO D;  3A7M A;  4TX5 A;  5FY1 A;  3DJB A;  2CM0 A;  4HWF A;  1WYB A;  2LM9 A;  3PUX F;  4IDQ A;  3B5M A;  5FKY A;  3RX6 A;  2A3D A;  4IIJ E;  2WMN A;  3P4Q A;  3AEG A;  4XZC A;  5JRC A;  3CX8 B;  5ABF A;  3AE8 A;  4QX8 B;  5LBM A;  2W00 A;  2VKJ A;  5JDF A;  4X1K E;  2FBW A;  1W09 A;  1VOM A;  3ZSS A;  3AA6 B;  3Q9D A;  4DID B;  3Q5X A;  1OED B;  1MIY A;  2IC6 A;  4TWH A;  3PE0 A;  4EV6 A;  2CCQ A;  5CFB A;  2UXX B;  3RGL A;  2WM9 A;  4Z90 A;  4ZS2 A;  3F2E A;  3EVY A;  2BKO A;  4KHZ F;  2UXC T;  5FL1 A;  1WR6 A;  4DV2 T;  3P8C D;  2A72 A;  3QC9 A;  3UUN A;  3H37 A;  3EAB A;  5FYM A;  2LKH A;  5ABE A;  1QUU A;  2H89 A;  3VRA A;  1KFY A;  5LNK A;  4QXC B;  4HE8 A;  3Q5E A;  4I0U A;  5AQP B;  4LF7 T;  4LFC T;  2X68 A;  3O1I A;  2N9D A;  3U78 A;  2HH7 A;  4F6R C;  4DR6 T;  3WAK A;  4HWD A;  4CXX A;  2D2S A;  3OTO T;  1HFA A;  2VKO A;  2K3W A;  3AVR A;  2XAJ B;  5LJM A;  1YKH B;  1IJ6 A;  3AXJ A;  3LK4 2;  2HPJ A;  2BG9 B;  5LHG B;  1OWA A;  1MMA A;  5LBQ B;  3AVS A;  1LKX A;  2E9X A;  3RYF E;  3AAE B;  2WWV A;  3MA9 A;  2MAW A;  2V5C A;  4QH4 A;  4CI2 B;  3KBT A;  2CBJ A;  3AE1 A;  3R6N A;  2J4G A;  4TWD A;  3KV9 A;  4U7I A;  2B1E A;  4TNW A;  4AQF A;  2VAS A;  2WMO A;  4U2Z A;  4NXN T;  3HA4 A;  3PTR B;  3Q5W A;  2KXP B;  4KX6 A;  4LMJ A;  3I0Q A;  1ZEE A;  2VKD A;  3JAF A;  1MMG A;  3K3O A;  2EHO A;  3PUW F;  2LE8 A;  5AQM B;  2Q9Q C;  1US7 B;  1B7T A;  1NAF A;  2CXF A;  1BR0 A;  1ZP0 A;  4P09 A;  3AEC A;  5L3C B;  2V7M A;  4QXB B;  4IE4 A;  4FI5 A;  2VK9 A;  1E2A A;  4LF6 T;  5AFU L;  1XMQ T;  2YU1 A;  2XHE B;  4B3R T;  4HFE A;  4WZX A;  2XSA A;  2VKH A;  4KP3 C;  4IDZ A;  5HCJ A;  5JR9 B;  5L4H A;  3CQX C;  1FIO A;  3ZCI A;  4QKN A;  5AQU B;  3CVR A;  4ZEY A;  4H63 V;  4P0B A;  3TLU A;  2WDV A;  1IZN B;  5CB4 E;  3M65 A;  2ZMA A;  3TKL B;  2PFV A;  2I59 A;  4IE6 A;  3RRC A;  2WZH A;  4A97 A;  3ANW A;  4AI6 A;  3PJA A;  2WU2 A;  3O1H A;  2VUR A;  4AKL A;  3A5X A;  1UX5 A;  3LDQ B;  3UFG A;  4DV0 T;  5CA0 E;  5EK3 A;  2ACZ A;  4TN7 B;  4Z91 A;  4CZZ B;  5JDM A;  2WQY A;  3VKG A;  3PDY A;  4NUU A;  3N2G E;  2B76 A;  1JNZ A;  2F4V T;  2ACX A;  2E2A A;  3I9Y A;  3OPC A;  3ZYL A;  2LT3 A;  3U3I A;  3AA1 B;  2YDQ A;  2OA5 A;  4OYJ A;  5FY7 A;  2WBL A;  3ZN0 B;  2VB6 A;  1HX1 B;  3ZEF B;  2LHN A;  5C2T A;  2YU2 A;  3FB2 A;  2M6B A;  4CQI A;  3RLF F;  4IDO A;  4PFP A;  1MND A;  3A8Y C;  3UUB A;  4AIU A;  1QSD A;  2FJA A;  2LJL A;  2V7L A;  2OLT A;  4X66 T;  4IGU A;  3RIA A;  5BR8 T;  4PJN A;  4LFB T;  2BKN A;  4NIQ A;  1HX8 A;  3KVA A;  4O4I E;  3BQL A;  5FVK A;  5AQI B;  4G63 A;  4HFI A;  1M62 A;  4ANJ A;  3AE3 A;  4I43 B;  1CUN A;  1EZ3 A;  3PUY F;  3ZMV B;  3F57 A;  1R8I A;  3N9M A;  2V7K A;  4HFC A;  4LF8 T;  5BMV E;  5F5W A;  4U74 A;  2N2N A;  2BS2 A;  4EXT A;  3E08 A;  3N9P A;  2NTX A;  2Y8D A;  1Z8U A;  3QUJ A;  4GKK T;  4UF0 B;  3OBV E;  4DR7 T;  4L9I A;  4IE7 A;  3RPU A;  2H7V C;  3C4X A;  4M1P A;  2C5I T;  5JDL A;  5LGU B;  2LOP A;  1HG5 A;  4YLH A;  3E22 E;  2XSB A;  1T8B A;  4KUM B;  4DBR A; 
#chains in the Genus database with same CATH homology
 3K3N A;  2X66 A;  3MZK B;  4YHJ A;  5L3G B;  5LHI B;  3ZMS B;  2NW9 A;  5JRE A;  3VHL A;  3C50 A;  4ZI3 D;  5JDG A;  1SHZ C;  2H3R A;  2X9X A;  4YFS A;  2H7O A;  2DLR A;  2MYS A;  4JUY A;  5KDM C;  2ZM0 A;  4UEL A;  2KLQ A;  3ZN1 B;  5J2T E;  4GOU A;  4H63 H;  4PAG A;  1T98 A;  3ZCJ A;  4O2A E;  4AKR B;  3MJX A;  3DTO A;  4BJM A;  4CI1 B;  4ILU A;  2JMK A;  2QA7 A;  2RP4 A;  5LYJ E;  3HKB E;  3LBX A;  2CA5 A;  3KV6 A;  3OJA A;  3OYZ A;  2EHO D;  2LOS A;  1S35 A;  1MIV A;  4TX5 A;  5FY1 A;  3KV5 A;  3DJB A;  5J1G A;  2X51 A;  2CLY B;  4UVC B;  4QWN B;  3F31 A;  4DND A;  2CM0 A;  5KX5 E;  1WYB A;  2LM9 A;  2CXD A;  3CX6 B;  2MOZ A;  5FP3 A;  3UUM A;  2C5J A;  3UT5 E;  4BAY B;  1D0X A;  4UVA B;  2Y6X A;  4MLK A;  2DWK A;  3RX6 A;  4EZH A;  3AB3 B;  1LRZ A;  2A3D A;  1BR4 A;  1AJ3 A;  3K3Q C;  3AAA B;  4B6X A;  3LBX B;  4IIJ E;  1SA0 E;  2YK0 A;  3EUH A;  2WMN A;  2IW5 B;  5HWY A;  4XZC A;  5JRC A;  3V5S A;  3ZJ1 A;  2Y48 B;  2K9A A;  4PW8 A;  3CX8 B;  2K48 A;  4UV8 B;  2Q9Q A;  4QX8 B;  4PJM A;  3N9L A;  2VL8 A;  4TV8 E;  5LBM A;  2W00 A;  2X67 A;  3LJC A;  2VKJ A;  2W63 A;  4IHJ E;  2V7J A;  2WAU A;  4EYU A;  4AKH A;  5JDF A;  4X1K E;  3J9X 1;  1WRD A;  1VOM A;  2NWB A;  4L5G A;  3AA6 B;  3PUG A;  1D0Y A;  3SOL A;  3Q9D A;  4OK0 A;  4PK5 A;  3RYH E;  4ERR A;  5HWX A;  3N9O A;  2DWG A;  3LG7 A;  3C4W A;  2KWI B;  3EDU A;  4I55 E;  3Q5X A;  5ETW A;  3C98 B;  1MIY A;  3CKD A;  3ZPO A;  5LG4 A;  2IC6 A;  4FJO A;  3PE0 A;  3GWH A;  2WSS V;  2CCQ A;  4EZ4 A;  4ASK A;  2Q9Q B;  1MMN A;  2UXX B;  5FXV A;  3UUX B;  3P7I A;  2LSY A;  1VRB A;  2V7I A;  4PK4 A;  1Z0P A;  2WM9 A;  5HXE A;  2Z6E A;  4HEA A;  4ZS2 A;  3GN5 A;  4HTE A;  3F2E A;  4C90 A;  3FBL A;  3EVY A;  2G0U A;  2XAF B;  5LP6 E;  4JEU B;  3PU3 A;  3V5U A;  4X1I E;  4E7Z A;  4GIW A;  3N9Q A;  1YKE B;  2ODU A;  1WR6 A;  3VKH A;  4OYK A;  5A1L A;  5JDH A;  2CWY A;  2EHO B;  4YJ3 E;  3J7Y q;  3AAI A;  3CML A;  1HF8 A;  2NW7 A;  2A72 A;  1IAP A;  3P8C D;  3QC9 A;  3UUN A;  3H37 A;  4HGA A;  3GMI A;  3VU7 H;  2YIN A;  5FYM A;  3ZC1 A;  2BVM A;  2JPF A;  3L3P A;  3UUL A;  1QUU A;  3ZYM A;  3UFE A;  5LNK A;  1MNE A;  3BK9 A;  3GN5 B;  3PUA A;  4QXC B;  4UV9 B;  4HE8 A;  5F3J A;  1U5P A;  5EK4 A;  5DQV A;  2LEH A;  4NUV A;  3N9N A;  5HXR A;  4HFV A;  4UVB B;  1HTJ F;  5DAB A;  2X68 A;  3O1I A;  1HS7 A;  2PBI A;  2JQQ A;  3SWH A;  2N9D A;  2CEA A;  3ZJ2 A;  4UIG A;  2KZ7 B;  3OKQ A;  1V9D A;  3JC6 D;  3MXZ A;  5JH7 E;  1BR1 A;  2X9W A;  3U78 A;  3RC3 A;  4DBQ A;  3T8O A;  2HH7 A;  1HCI A;  2X0L B;  4MFR A;  4F6R C;  1NWM X;  4V1A v;  3WAK A;  4O4L E;  2LSK A;  4CXX A;  2WWU A;  2D2S A;  1HFA A;  2NP9 A;  3C51 A;  4KBM B;  2VKO A;  3AVR A;  2XAJ B;  5LJM A;  3RRW A;  2KT9 A;  5H6Q B;  1YKH B;  5TAO A;  3NZP A;  3ZMZ B;  1IJ6 A;  5LHH B;  2LSI A;  3LK4 2;  2HPJ A;  4TV9 E;  3O9X A;  4N78 D;  2DHR A;  5LHG B;  5M4Y A;  3NRX A;  5EK2 A;  2XAG B;  1OWA A;  3NRY A;  3WAJ A;  1MMA A;  2A2F X;  4AQG A;  3C4Z A;  5LBQ B;  4X20 E;  3Q2M A;  3AVS A;  1LKX A;  2E9X A;  3E0Z A;  3RYF E;  3AAE B;  3MA9 A;  1YD8 G;  3S4U A;  1WYC A;  2XTL A;  2ZM8 A;  1UX4 A;  4O4H E;  1OXZ A;  3KFW X;  4PJJ A;  3FHN A;  4TZ4 C;  4DMW A;  4CI2 B;  4P0A A;  4AKG A;  3ZLI A;  3KBT A;  5L3F B;  3LK2 B;  3KV4 A;  3MK7 C;  3FXD B;  3L09 A;  2D0T A;  3KIN B;  4DMV A;  3R6N A;  4G2A A;  3BQK A;  3KV9 A;  2MTQ A;  4ZS3 A;  2E9X B;  3CQG B;  2B1E A;  3B57 A;  4AQF A;  4XBF B;  2VAS A;  3UTK A;  2WMO A;  1KNZ A;  3O1J A;  3HA4 A;  3PTR B;  3Q5W A;  2KXP B;  4ZHQ E;  3I0Q A;  5LXT E;  3PU8 A;  1ZEE A;  4DVD A;  2VKD A;  2CMR A;  3EDV A;  3ONX A;  3W15 B;  1FMW A;  3PUS A;  2XQY A;  1MMG A;  3K3O A;  1YW0 A;  2EHO A;  3PUR A;  5LCY A;  2X9Y A;  2HPL A;  2LE8 A;  2Q9Q C;  3HKE E;  3RC8 A;  5L3B B;  1US7 B;  4O2B E;  2XUE A;  1B7T A;  2VWA A;  3RKO A;  1NAF A;  4JLE A;  2CXF A;  5JR9 A;  4YJ2 E;  1BR0 A;  3AA0 B;  4QX7 B;  4L0R A;  3R84 B;  4I50 E;  2L8K A;  4P09 A;  2BZB A;  5FXX A;  3SS1 A;  5L3C B;  2V7M A;  2QGS A;  3RYI E;  4QXB B;  4IE4 A;  3CPZ A;  4FI5 A;  4OFZ A;  2W61 A;  4EOZ B;  2VK9 A;  2CWO A;  5AFU L;  1S94 A;  2YU1 A;  3KVB A;  5JDN A;  5FXZ A;  5J2U E;  3ZMU B;  1ZHC A;  2XHE B;  1LVK A;  5F8P A;  3OYX A;  2C0S A;  4H9R C;  2VKH A;  4KMC A;  4KP3 C;  4IDZ A;  1Y64 B;  3I0O A;  4ZI2 C;  5HAX A;  2JMH A;  5JR9 B;  3D0T A;  5ADX L;  2DCF A;  4PK6 A;  3CQX C;  1FIO A;  5FY0 A;  3ZCI A;  3IF8 B;  4QKN A;  3ETU A;  3CVR A;  3GA8 A;  4EB6 E;  1G73 A;  5L2L A;  5FMN A;  4H63 V;  4BA9 A;  4P0B A;  3FXE B;  3O4X E;  3K8P C;  1IZN B;  1U4Q A;  2DI4 A;  4IE0 A;  4GYR A;  3MAC A;  5CB4 E;  3IEE A;  2ZMA A;  3M65 A;  2IC9 A;  1MMD A;  5EZY E;  2L3L A;  4WBO A;  4H9S E;  3TKL B;  2BVL A;  5LGT B;  2PFV A;  4H9N C;  1MIW A;  2NOX A;  4O8S A;  3IHR A;  2I59 A;  4IE6 A;  2MBG A;  3HKD E;  3RRC A;  3ZYK A;  2ZLY A;  5KMG P;  4QXH B;  3B13 A;  3WI3 A;  4EIW A;  2V1D B;  3ANW A;  4AI6 A;  2JRK A;  4E7S A;  2M67 A;  3MKD A;  3O1H A;  2J1D G;  4AKL A;  1HG2 A;  3A5X A;  2CLY C;  1UX5 A;  5FNV E;  5IHY A;  5LGN B;  5H6R B;  4JEH B;  5CA0 E;  5EK3 A;  5IYZ E;  3AA7 B;  3ZC0 A;  1ZKE A;  5JVD E;  3QK6 A;  1E1H B;  5JQG E;  1FMV A;  5E0O A;  5LA6 E;  3NBX X;  4O4J E;  4U72 A;  4Z8X A;  4TN7 B;  4J2C A;  4CZZ B;  5JDM A;  4CXY A;  5HXH A;  3ANW B;  4MBQ A;  3VKG A;  3PDY A;  2XAQ B;  2KIN B;  2K24 A;  4NUU A;  3N2G E;  4ZI2 D;  2LSJ A;  4EAH A;  2L9Q A;  2ACX A;  5DJQ C;  3H3A A;  2K5B B;  5LJN A;  3I9W A;  3I9Y A;  3NZQ A;  3ZYL A;  4ADZ A;  2E9X C;  3CWZ B;  4WNK A;  3RH3 A;  3KBU A;  2NTY A;  3IBP A;  2LT3 A;  3HR0 A;  3U3I A;  4DO0 A;  3AA1 B;  4HN9 A;  2OA5 A;  4OYJ A;  5FY7 A;  2P9B A;  2V26 A;  2C5K T;  3C64 A;  3HKC E;  2WBL A;  2W0G A;  2XAS B;  4A56 A;  5HXC A;  3ZN0 B;  2VB6 A;  4H9O C;  2CE7 A;  2D5U A;  4GK0 E;  3ZEF B;  2LHN A;  1D1B A;  3ZMT B;  4MHC A;  2YU2 A;  3FB2 A;  4CQI A;  2XAH B;  4IST A;  5HYA A;  1X79 A;  4PJL A;  4PFP A;  1MND A;  2RA1 A;  4MAL A;  1D1A A;  2DNX A;  4OHF A;  1O3X A;  2LSG A;  2JJ9 A;  3N5L A;  5L3E B;  2UXN B;  1G8X A;  4UEM A;  1KK7 A;  5HXS A;  3KDS E;  3N2K E;  4AQF C;  1QSD A;  2LJL A;  2V7L A;  1H7C A;  3CX7 B;  4ZI3 C;  3BQI A;  2YEV C;  4IGU A;  4QHO A;  4PFO A;  3JC6 C;  4PJN A;  1HX8 A;  3HL6 A;  3CQC B;  2SPC A;  3KVA A;  4O4I E;  1IJ5 A;  3BQL A;  5GON E;  4CXW A;  3DP7 A;  4C91 A;  4G63 A;  4GK5 E;  5L3D B;  2CXL A;  5JRC B;  3HI2 A;  3ESL A;  4ZI7 E;  5CA1 E;  4X1Y E;  4ANJ A;  4TUY E;  4I43 B;  2X9H A;  3I1A A;  1CUN A;  1EZ3 A;  3ZMV B;  3F57 A;  4GYS A;  2EHO C;  3N2O A;  4UF0 A;  3RYC E;  4H9Q C;  4K0U A;  3N9M A;  4HKA A;  2V7K A;  5JDQ A;  1BR2 A;  3ETV A;  4XAX B;  5DQW A;  5BMV E;  5JR9 C;  4AKI A;  3LK3 B;  4ZOL E;  4U74 A;  2W62 A;  2N2N A;  1FEW A;  2PJQ A;  1ZV4 X;  2E8I A;  4CI3 B;  1D1C A;  2E9X D;  2N1G A;  5LOV E;  4EXT A;  3E08 A;  3N9P A;  2ES0 A;  4H9P C;  5C8Y E;  3FBZ A;  2BDE A;  2NTX A;  1WLX A;  2Y8D A;  4BJN A;  4UXN B;  2IAK A;  3QUJ A;  2GK9 A;  4ISS A;  2ZM2 A;  4UF0 B;  1LVF A;  4PNI A;  2KND A;  3OBV E;  3SRZ A;  5FXW A;  3LFM A;  2KMF A;  4IE5 A;  4IE7 A;  4L9I A;  4AXP A;  3RPU A;  2H7V C;  3C4X A;  2PG8 A;  3PUQ A;  4EYY R;  4M1P A;  2C5I T;  5JDL A;  2ODV A;  4WW0 A;  2KWH A;  5LGU B;  1D0Z A;  2NW8 A;  2LHR A;  2LOP A;  1HG5 A;  1UCU A;  4I4T E;  4YLH A;  3E22 E;  4KUM B;  4DBR A;  2D0U A;  4WBN E;  2Q9Q D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...