3UUMA

Crystal structure of n-terminal first spectrin repeat of utrophin
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
122
structure length
122
Chain Sequence
MDLDSYQIALEEVLTWLLSAEDTFQEQDDISDDVEDVKEQFATHETFMMELSAHQSSVGSVLQAGNQLMTQGTLSDEEEFEIQEQMTLLNARWEALRVESMERQSRLHDALMELQKKQLQQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords utrophin
publication title The crystal structures of dystrophin and utrophin spectrin repeats: implications for domain boundaries
pubmed doi rcsb
source organism Rattus norvegicus
total genus 57
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00435 Spectrin Spectrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.60 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3uumA00
1U4QA 1WLXA 3UUMA 3PE0A 3F31A 3LBXB 1S35A 1OWAA 2ODUA 3EDVA 1QUUA 3UUNA 1HCIA 2SPCA 1AJ3A 3UULA 3LBXA 2ODVA 3FB2A 1CUNA 1U5PA
chains in the Genus database with same CATH superfamily
4DV4T 3KV5A 1MIVA 5EZYE 3ZYMA 1MNEA 1WR6A 4AQYT 3AE7A 4PK6A 4UELA 5LGNB 4X1YE 4AIUA 4DV3T 2VVSA 3OYXA 1MNDA 2CLYC 4UR9A 2V5CA 2CA5A 2VWAA 3ETUA 2VL0A 3ZN1B 2V8SV 1ZHCA 2M67A 1N33T 4UF0B 4EYUA 4CZZB 1D0YA 4JI0T 3P7IA 4Z91A 5J0ZA 3ZMTB 3ZT5A 2HN2A 1ZP0A 2CXDA 3C51A 5JR9C 2K9AA 1SE7A 2UUCT 3AEDA 1WYBA 4MBQA 4TN7B 5AQLB 4UIGA 3I9WA 2CRBA 5L3BB 2LSGA 3ZYKA 3M65A 2Q9QD 4B3MT 4LFAT 3UU6A 4OX9T 4TX5A 5BMVE 4NUVA 4TV8E 4AI6A 3UU5A 2AXDS 3AXJB 2QYWA 3K3NA 3F31A 3RI5A 2BG9B 3UUBA 2OLTA 3AE9A 1R8IA 1IJ6A 3AEBA 3PUSA 3WAJA 2W67A 2CBJA 3FB2A 3ZCIA 1OEDA 4YFSA 5AQTB 5F3JA 5KX5E 2IW5B 2JMHA 4H63H 2X9HA 1WFDA 3ZPOA 1ZV4X 4QWNB 2YDRA 2V6XA 3HA4A 3CQXC 4IE5A 3EVYA 3PU8A 3C4ZA 1SUMB 2GK9A 3TLUA 3O4XE 2WMOA 5L3DB 4JV5T 3TLWA 3AEEA 1SHZC 2RPAA 2LSJA 3N2KE 3ZJ2A 3AA6B 2YDSA 1H7CA 4WBOA 2D2SA 1YKHB 5AQPB 4XBFB 1VCTA 1MMAA 4YSXA 2N9DA 3AA0B 3C50A 3K8PC 3PUXF 4GYSA 2MAWA 3L8RA 5AQHB 4ZXLA 4JI5T 3P8CD 1FMWA 4DUYT 4TWFA 3RYFE 3H3AA 3JADA 3ZKRA 2K5BB 2XQ6A 1KK7A 3B5MA 1IJ5A 2EHOA 4I50E 3ZC0A 1UURA 3A8YC 3QB5A 5IHYA 5FL0A 2LE8A 2W63A 2NWBA 5FL1A 3L09A 2R6GF 1HG5A 2ODUA 5DQWA 5HXCA 1J1JA 5DJQC 1KNRA 2XSBA 3DP7A 3RIAA 3C98B 4Z8XA 5DABA 3AAIA 2XQ4A 5FKYA 2ZMAA 2BKPA 1XDOA 4DR5T 5AQMB 1FMVA 2D5UA 2JRKA 1G8XA 2UUAT 3GN5B 1XZYA 2UUBT 2X0YA 3KV9A 3ZN0B 4LF6T 4UXNB 2QGSA 4DR1T 3ANWB 3N9QA 5CB4E 3EDUA 1M62A 3HKBE 3AEFA 2WZIA 2CE7A 2D0TA 5AQVB 1FEWA 3CPZA 2D9DA 2B1EA 4U31A 3C4XA 3K3QC 2QA7A 3Q2MA 3CVRA 5EK3A 4P09A 3QUJA 4ZS3A 5CJ5A 2HH7A 2LHRA 5LYJE 2V26A 3UQ7A 1WYCA 3KVBA 1HG2A 2DHRA 4I4TE 4HWIB 1M7KA 3ABVA 4QX8B 3QNUA 3MZKB 4ZI2C 1WRDA 3I0OA 4GK5E 3AE1A 4DVDA 2FJBA 5LXTE 2HHHT 1U5PA 2CHOA 2V6YB 2XQAA 5ADXL 1VOMA 1XNQT 4WZXA 4IIJE 1W0BA 4U7YA 5LGUB 3VRBA 4DV0T 4K0KT 1Y64B 3H37A 3HL6A 2ACZA 2W62A 4JI3T 3T1YT 5CFBA 2YEVC 4HFHA 4FJOA 4OK0A 4ASKA 2BVLA 2I59A 1MMNA 3ZC1A 2ODVA 4B6XA 1L0VA 1GQEA 1S94A 1VRBA 2P9BA 2XAGB 3MKDA 4CN6A 3SOLA 4IDNA 1E7PA 3CX8B 4JBWF 1D0ZA 4O4HE 1UX4A 2CWYA 2BG9C 2VKOA 4CI3B 4MFRA 3KV4A 4DNDA 2XSAA 2VK9A 3E0ZA 1JNZA 2E8IA 2HPJA 3FZFB 2BS4A 3LK2B 2H89A 3NRXA 4ZI7E 3J7Yq 3VU7H 2VB6A 5LMNT 2LSYA 2A2FX 2YKSA 4EAHA 1U4QA 4DBRA 4X62T 2CXFA 4H9PC 3G06A 2E5LT 3RIUC 3ZT6A 3JAEA 2WS3A 2X68A 4K0UA 2ZM8A 2LLYA 5FP3A 4QH4A 2Y6XA 4A56A 2X0HA 3PJAJ 1NEKA 2V7IA 4GIWA 2XHEB 5JR9A 2WDRA 3UUXB 4LFCT 2BBJA 4H9QC 1OWAA 1OEDE 5C8YE 4KMCA 5L47A 2X9WA 1OXZA 5ABEA 2YU1A 4DR3T 2WDVA 1MIWA 3IA3A 4JLEA 1E2AA 3HKDE 4QXBB 3TLVA 3PUGA 1BR2A 2UXNB 5C3JA 2X67A 4BJMA 2LJLA 1D0XA 3NZPA 3EABA 5HXSA 5H6RB 3QOFA 3EAMA 4IDOA 4DV1T 3RGLA 4PJLA 4ZZBA 5AQOB 4A97A 4YY3T 2UXBT 2IMLA 3N9LA 3O1IA 2DCFA 3IF8B 1HF8A 2XAJB 3ZMUB 4EZHA 2Q9QB 4N78D 2FJDA 4ADZA 4E7ZA 3MJXA 2X66A 3FXEB 4HWCA 4L9IA 4YSZA 4AQGA 3AEAA 4COFA 3EI0A 3LSVA 3QK6A 4ISSA 1MMGA 5JRCA 4B3ST 3IBPA 3U78A 4KX6A 4ZEYA 4PFOA 1W09A 4QXCB 4O2AE 5ETWA 2M6BA 4IHJE 4IGUA 2BZBA 3I9YA 3RF1A 4DMWA 3KV6A 4EZ4A 5LHIB 2JJ9A 3NZQA 2VQET 2X9YA 2BBHA 1XMQT 2YU2A 3ETVA 3ZT7A 5AFUL 4IE7A 4X1IE 2JMKA 4WNKA 3TLTA 1HX1B 1ZEEA 4IDZA 2ZM6T 4X1KE 3GA8A 3JC6D 2L3LA 4AKHA 3P4QA 2QVAA 2IC6A 2E9XC 4FI5A 2IIUA 4L0RA 4TV9E 3AA7B 3I0QA 2A72A 4YTNA 2ZLYA 3ZEFB 3N2GE 4LFBT 1BR1A 4AQFA 4DV7T 5FXVA 3F57A 2NP9A 4YHJA 3UUMA 2NW9A 3O1HA 4WW0A 4KHPT 1XDPA 5LBQB 5IUXA 2KWIB 4ILUA 4B3TT 4LF9T 2DLRA 5JQGE 2X51A 2NR4A 2JIWA 2WP9A 3OJAA 2EHOD 4ERRA 3PUVF 3PUYF 2MYSA 3AVRA 4L5GA 5LB7B 4IT4A 3A5XA 4KP3C 3ZMVB 3T1HT 2WWUA 5LG3A 4F6RC 2W4XA 4DMVA 3PUAA 5JDLA 3RC3A 4G2AA 4IREA 2CCQA 2WY2A 3UFGA 3BQIA 4UV9B 1CHUA 4ANJA 1CUNA 3UU8A 4ZOLE 2KSRA 4O4JE 3FBLA 4U72A 5FXWA 4BJNA 4V1Av 2OA5A 3Q5WA 2YINA 4X20E 3LDQB 5HEJA 4GKKT 4EV6A 2VASA 2XTLA 3AA1B 4JI8T 2LOSA 3EDVA 4LF4T 4HGAA 4I55E 4PW8A 1KEYA 2Y48B 4U3CA 2WWVA 4YSYA 4ILAA 3KBUA 5AQJB 3RHWA 5L3CB 4CQIA 4AKGA 3RQUA 4GKJT 3VHLA 1YQ3A 2NTYA 2HPLA 2FJEA 2V7MA 2LT3A 4HKAA 3UTKA 2JQHA 1Z8UA 4P1NA 3M3ZB 5FMNA 3P4RA 2B76A 4U2YA 2A9UA 3UT5E 4UF0A 5LP6E 4Z90A 3OYZA 3ZLIA 3FZMB 3CIRA 1HR0T 1KNPA 4XAXB 1B7TA 4HTEA 3L39A 3AE5A 2UU9T 5ABFB 1OEDC 4PAGA 4YTPA 3P4SA 1KNZA 2XM1A 4X64T 2BS2A 1KF6A 1WLXA 3F2EA 2CMRA 4PJMA 1J5WA 3VR9A 2LHNA 4IE0A 3E08A 4C91A 3AEGA 2I6HA 5HCJA 2G0UA 4LMJA 3A7MA 3AXJA 4ILBA 3VR8A 2BG9A 3ZJ1A 2E9XB 4UVBB 3EHZA 3N9MA 4HWFA 2XM2A 3D0TA 4EB6E 5FY0A 2C5JA 3KINB 2Q9QC 4NXMT 1WR0A 5JVDE 5AQSB 3SFDA 2VKDA 4E7SA 3AE8A 5AQUB 2H7VC 2UXCT 2NW8A 3B13A 4EXTA 1JNRA 2W66A 3VRAA 4TUYE 2IDOB 4U33A 1MIYA 5KDMC 1T7SA 3FBZA 3BQLA 4HFEA 1LVFA 2XQ3A 3MK7C 3RIUA 4HE8A 3KVAA 5AQRB 2OV9A 4JUYA 4ZS2A 3CX6B 3LBXB 3NKZA 2XQ5A 2KMFA 1LRZA 1NWMX 3BK9A 2KLQA 1XMOT 4ZHQE 3UU4A 5L3EB 5LNKA 2V7LA 1I94T 4Q25A 4XZCA 1J5ET 5HEHA 3AB3B 3FZHB 1QSDA 1UGOA 2F4VT 2BS3A 4LMKA 2H7OA 2MOZA 2VL8A 5L4HA 2IC9A 4X5TA 2DWGA 3CKDA 3P50A 4WYVA 2VKHA 4UEMA 2C0SA 4U7IA 3L3PA 1Z0PA 3AE3A 3UULA 4DUZT 2UXXB 4TWDA 3ONXA 4IL9A 2NW7A 2K24A 2V7KA 3AAEB 3UU3A 5JDQA 3RIFA 4YXDA 1QLBA 5ABHA 3ZYLA 1IAPA 4HFDA 1ZOYA 2XAFB 2JPFA 5HXEA 2HN1A 5BR8T 2LRLA 4AXPA 3P4WA 4X65T 3V5UA 3HI2A 4CN1A 5HXHA 3PJAA 1LVKA 3GN5A 4KI0F 1YQ4A 2N2NA 3LK42 1LKXA 3RYIE 5IYZE 3AECA 3ANWA 3RC8A 3ZCJA 3PURA 3ESLA 3HKCE 5HAXA 4JI4T 4J2CA 4EGWA 2KNDA 4YJ3E 3AE2A 3PE0A 4HFCA 3E22E 1OEDB 2XUEA 1WCRA 1DU2A 4EEBA 3IHRA 1QUUA 2WZHA 3N5LA 3RYHE 2LSKA 1YW0A 2WCAA 2CHNA 3OVUA 4JYAT 3ONLC 1HS7A 1D1BA 4YHHT 2BDEA 4HFVA 2H3RA 1FJGT 2YDQA 5AQFB 4IDPA 4IDQA 4UVAB 2XZEA 2LKGA 3N2OA 1HCIA 5AQNB 2C5KT 3MXZA 3UQ4A 3VKGA 2XQ9A 4EEDA 3FZKB 4TWHA 3CWZB 4OHFA 4M1PA 2CXLA 4CXWA 2LEHA 4PK5A 1NENA 4O4IE 5EK2A 1KFYA 1E1HB 3Q5DA 1YXRA 1SA0E 1US7B 2V6YA 3CQGB 1ZKEA 3LBXA 1XNRT 4O4LE 4IE6A 3JCFA 2X9XA 4ILCA 1IBKT 3K3OA 5J2UE 2MTQA 1T98A 4U2ZA 1YD8G 2Z6EA 3GWHA 4CXXA 5M4YA 4YLHA 5KMGP 4ISTA 5JH7E 3T8OA 2AE9A 2LKHA 4QKNA 2E5VA 3I1AA 4HWHA 2KXPB 4QXHB 2EHOB 5HXRA 2CM0A 3SFEA 1N32T 4HWDA 1T72A 3QB5K 5FYMA 3NVOA 5L3FB 2K3WA 4QH5A 3Q5XA 1HNZT 4MHCA 3UFEA 3RPUA 5FY7A 4DR7T 3TKLB 3RRCA 3SRZA 4JI7T 3LK3B 5JDHA 2WU5A 4U74A 3DTOA 1HNXT 5FVKA 3EUHA 2L8KA 5IWAT 2WU2A 3KBTA 4GK0E 4WBNE 4TZ4C 2ZM2A 4DV5T 2VQFT 3OTOT 4G63A 2KT9A 5JDGA 2DL1A 1BR4A 2WB5A 5HEOA 5LGTB 5H6QB 3LFMA 1O3XA 4EYYR 3ZSSA 4CI2B 4AISA 2W61A 2XY8B 2WQYA 4GOUA 4AKLA 1FIOA 5CA1E 2W2UA 3OBVE 4YTMA 4HEAA 3R6NA 3RQWA 2BVMA 2BG9E 1N36T 3W15B 4UV8B 2BKOA 2WBLA 2JQQA 4TNVA 2VVNA 3MACA 5LHGB 2BKNA 4X66T 4HN9A 4ZI2D 2YK0A 5LJNA 1UK5A 1UX5A 3MA9A 2N1GA 2H88A 1BR0A 3IEEA 1IBMT 4ZI3D 3CMLA 4DV6T 3P4PA 3S4UA 3B57A 3O9XA 5HEGA 4PNIA 4DR6T 3O1JA 5ABGA 2MBGA 1IZNB 3H3MA 5JDFA 5AQIB 5JDNA 5HCMA 2Q9QA 5C2TA 2CPTA 2I0MA 4H9SE 2XAQB 2WMNA 4I43B 4A98A 2FBWA 4JI1T 5EK4A 1D1CA 3K1SA 3LJCA 4JEHB 2V5DA 2A3DA 2LM2A 5KXJA 5FXXA 3C64A 5LHHB 2C5IT 2D0UA 2CBIA 4PK4A 3JAFA 4CN4A 2DI4A 5CGMA 2WDQA 4AQFC 3SWHA 3RYCE 3ZMZB 4NUUA 3PUQA 4LF5T 4H9OC 2ES0A 4H9NC 5JTGA 3Q9DA 5F8PA 5LG4A 4KBMB 1XWMA 4EOZB 5LMUT 2NOXA 3FXDB 3SS1A 4O2BE 5FXZA 3UUNA 1W0AA 4P0BA 3BQKA 3X1DA 1G73A 2CLYB 2LM9A 4KHZF 2XPKA 4PJNA 3KDSE 1X79A 1HNWT 3HKEE 3DJBA 2LRKA 2L9QA 5GONE 5J2TE 3JC6C 2V7JA 4IE4A 5FY1A 5LA6E 3RRWA 3OPCA 2IAKA 2NTXA 4H9RC 2DWKA 4OYJA 5HEUA 3WAKA 5JR9B 4GYRA 4UVCB 3PTRB 4MALA 5J1GA 2SPCA 2M6IA 2J1DG 2W00A 2XQ7A 3HR0A 3RH3A 4LMLA 1UUSA 4JEUB 4H63V 3PUWF 5HWYA 4B3RT 4PJJA 1NAFA 5A1LA 5LBMA 4DR4T 5LCYA 4A5XA 3PU3A 2LOPA 5E0OA 2CEAA 2CWOA 2EHOC 4NXNT 2J62A 2KZ7B 2W0GA 5L3GB 2J47A 2XJ7A 2X0LB 3N9PA 2Y8DA 3U3IA 1IBLT 1I6ZA 2XQYA 3LG7A 2PTFA 2YN6A 2V1DB 2PBIA 2JQ9A 3ONJA 3TLSA 2QRXA 4ZI3C 5JRCB 3RX6A 4LF7T 3VKHA 3RKOA 3AE6A 2XQ8A 5FVLA 3PV0F 4CXYA 3WI3A 3C4WA 4NIQA 3ZMSB 3PDYA 2VURA 1S35A 1VCSA 3FZLB 3N9NA 2E9XD 2KINB 1EZ3A 4NPPA 1X9BA 1V9DA 3AAAB 3RLFF 2FUPA 3OKQA 5HYAA 1HTJF 5L4EA 4OYKA 4CI1B 2RA1A 4MLKA 1D1AA 2YOEA 1YKEB 1N34T 2WM9A 3AVSA 4BA9A 4C90A 2IUBA 2XAHB 4IL4A 3KFWX 5L2LA 4YJ2E 4O8SA 5AQKB 2ZM0A 5FNVE 2JQKA 3CK6A 2LSIA 5ABFA 5CA0E 5AQGB 4DBQA 3AE4A 5DQVA 2VKJA 4QH1A 3J9X1 4DIDB 3QC9A 1HFAA 2IHR1 4YT0A 2RP4A 4LF8T 4HFBA 4I0UA 4TNWA 5TAOA 4OFZA 2FJAA 5LJMA 3N9OA 1Y01A 2KWHA 3CX7B 3FHNA 4AKRB 1W9RA 2E9XA 1AJ3A 2UXDT 2PG8A 3NBXX 4EIWA 2E2AA 4DO0A 4DR2T 3V5SA 3GMIA 2MPKA 2WSSV 3R84B 2ACXA 3Q5EA 4DV2T 5HWXA 1MMDA 2XASB 3NWIA 2PJQA 2DNXA 5LOVE 4HFIA 4AKIA 5F5WA 4F8HA 2WAUA 2K48A 5JREA 4KUMB 2PFVA 4BAYB 4PFPA 3NRYA 1UCUA 5JDMA 4P0AA 1T8BA 1HX8A 3CQCB 3RKGA 4ZZCA 4QX7B 2J4GA 3ZSTA 4JI6T 3PUZF 4QHOA 4JI2T 5AQQB
chains in the Genus database with same CATH topology
2P9BA 2XAGB 2YK0A 3KV5A 1MIVA 5LJNA 1WLXA 3F2EA 3MKDA 3SOLA 2CMRA 1UX5A 4PJMA 3MA9A 2LHNA 4IE0A 2N1GA 3E08A 5EZYE 3ZYMA 3CX8B 4C91A 1D0ZA 1BR0A 1MNEA 3IEEA 1WR6A 4ZI3D 4O4HE 1UX4A 2CWYA 2G0UA 2VKOA 4CI3B 3CMLA 4PK6A 3S4UA 3B57A 4MFRA 3KV4A 4DNDA 4UELA 2VK9A 3E0ZA 2E9XB 4X1YE 3ZJ1A 5LGNB 4UVBB 3N9MA 3O9XA 3D0TA 4PNIA 4EB6E 3O1JA 5FY0A 2C5JA 3OYXA 1MNDA 2MBGA 1IZNB 2E8IA 2HPJA 2CLYC 5JDFA 3KINB 2Q9QC 3LK2B 2CA5A 5JDNA 5JVDE 2Q9QA 2VKDA 2VWAA 3NRXA 4E7SA 3ETUA 4ZI7E 3J7Yq 2H7VC 4H9SE 2NW8A 3B13A 3VU7H 2VB6A 2XAQB 4EXTA 2WMNA 3ZN1B 4I43B 2LSYA 2A2FX 1ZHCA 2M67A 4EAHA 4TUYE 4UF0B 1U4QA 4EYUA 4CZZB 1D0YA 5EK4A 1D1CA 3P7IA 1MIYA 4DBRA 2CXFA 4H9PC 5KDMC 3LJCA 4JEHB 3ZMTB 3FBZA 3BQLA 1LVFA 2X68A 4K0UA 2ZM8A 2CXDA 2A3DA 3MK7C 5FP3A 3C51A 4HE8A 5JR9C 2K9AA 2Y6XA 3KVAA 4A56A 2V7IA 4GIWA 2XHEB 5JR9A 5FXXA 3C64A 5LHHB 3UUXB 2C5IT 1WYBA 4JUYA 4ZS2A 3CX6B 2D0UA 4MBQA 4PK4A 3LBXB 4H9QC 1OWAA 4TN7B 2DI4A 4KMCA 5C8YE 4UIGA 3I9WA 5L3BB 2X9WA 2LSGA 1OXZA 2YU1A 1MIWA 3ZYKA 3M65A 4AQFC 4JLEA 2KMFA 2Q9QD 3SWHA 3HKDE 3RYCE 1LRZA 4QXBB 3PUGA 1BR2A 1NWMX 2UXNB 4TX5A 3BK9A 4NUVA 3ZMZB 5BMVE 4NUUA 4TV8E 3PUQA 2KLQA 4H9OC 2X67A 4BJMA 2LJLA 4ZHQE 2ES0A 1D0XA 4AI6A 3NZPA 4H9NC 5HXSA 5H6RB 3Q9DA 5L3EB 5F8PA 3K3NA 5LG4A 4KBMB 3F31A 4PJLA 2V7LA 5LNKA 4EOZB 4XZCA 2NOXA 3FXDB 3SS1A 1IJ6A 4O2BE 5FXZA 3UUNA 3AB3B 3PUSA 3WAJA 1QSDA 4P0BA 3N9LA 3FB2A 3ZCIA 2DCFA 2H7OA 3BQKA 3O1IA 3IF8B 1G73A 2CLYB 1HF8A 2MOZA 2XAJB 4YFSA 5F3JA 2VL8A 5KX5E 3ZMUB 4EZHA 2Q9QB 2IW5B 2JMHA 4N78D 2LM9A 2IC9A 4ADZA 2DWGA 3CKDA 4E7ZA 4PJNA 3KDSE 3MJXA 1X79A 2X66A 4H63H 2X9HA 2VKHA 3FXEB 3HKEE 4UEMA 4L9IA 3DJBA 3ZPOA 1ZV4X 4QWNB 4AQGA 2L9QA 2C0SA 5GONE 3HA4A 3CQXC 3L3PA 1Z0PA 5J2TE 3JC6C 2V7JA 2UXXB 3UULA 4IE5A 4IE4A 3EVYA 5FY1A 3PU8A 5LA6E 3ONXA 3C4ZA 3RRWA 2NW7A 3QK6A 4ISSA 2IAKA 1MMGA 2GK9A 2NTXA 5JRCA 2K24A 2V7KA 3AAEB 3IBPA 3O4XE 4H9RC 2WMOA 2DWKA 5JDQA 5L3DB 3U78A 4OYJA 1SHZC 3WAKA 4PFOA 5JR9B 3ZYLA 2LSJA 3N2KE 3ZJ2A 4GYRA 3AA6B 4UVCB 4QXCB 4O2AE 1IAPA 3PTRB 5ETWA 4MALA 4IHJE 2XAFB 4IGUA 2JPFA 2BZBA 3I9YA 1H7CA 4WBOA 5J1GA 2SPCA 5HXEA 4DMWA 2D2SA 2J1DG 3KV6A 4AXPA 2W00A 4EZ4A 1YKHB 5LHIB 2JJ9A 3NZQA 4XBFB 3V5UA 3HI2A 1MMAA 3HR0A 2X9YA 5HXHA 3RH3A 2YU2A 3ETVA 4JEUB 1LVKA 4H63V 5AFUL 3GN5A 2N9DA 3AA0B 3C50A 5HWYA 3LK42 2N2NA 4IE7A 4X1IE 3K8PC 2JMKA 4GYSA 1LKXA 4PJJA 4WNKA 3RYIE 1NAFA 5IYZE 1ZEEA 4IDZA 3ANWA 5A1LA 5LBMA 3RC8A 3ZCJA 3PURA 3ESLA 3HKCE 4X1KE 5HAXA 3GA8A 3JC6D 4J2CA 5LCYA 2KNDA 2L3LA 4AKHA 3P8CD 1FMWA 4YJ3E 3PU3A 2LOPA 3RYFE 3PE0A 2IC6A 5E0OA 2CEAA 2CWOA 3E22E 2EHOC 2E9XC 3H3AA 2XUEA 4FI5A 2K5BB 4TV9E 4L0RA 1KK7A 2KZ7B 2W0GA 3AA7B 3I0QA 1IJ5A 2A72A 3IHRA 1QUUA 2EHOA 3N5LA 2X0LB 4I50E 5L3GB 3RYHE 3ZC0A 3N9PA 2Y8DA 2LSKA 1YW0A 2ZLYA 3U3IA 3ZEFB 3N2GE 5IHYA 2W63A 2LE8A 1BR1A 1D1BA 2NWBA 2XQYA 3LG7A 4AQFA 1HS7A 2BDEA 5FXVA 4HFVA 2H3RA 3F57A 2V1DB 3L09A 2NP9A 2PBIA 4YHJA 3UUMA 2NW9A 1HG5A 2ODUA 5DQWA 4ZI3C 5HXCA 5DJQC 5JRCB 3O1HA 4UVAB 3RX6A 4WW0A 3VKHA 3DP7A 3RKOA 3N2OA 1HCIA 3C98B 4Z8XA 2C5KT 3MXZA 5LBQB 5DABA 3VKGA 2KWIB 3AAIA 4ILUA 4CXYA 3WI3A 2DLRA 3CWZB 4OHFA 3C4WA 4M1PA 5JQGE 2CXLA 3ZMSB 4CXWA 2X51A 3PDYA 3OJAA 1S35A 2ZMAA 2LEHA 4PK5A 4O4IE 3N9NA 5EK2A 1E1HB 2E9XD 2EHOD 4ERRA 1FMVA 2MYSA 2KINB 2D5UA 3AVRA 4L5GA 1EZ3A 1SA0E 1US7B 3CQGB 2JRKA 1G8XA 3A5XA 3GN5B 4KP3C 1ZKEA 3ZMVB 3LBXA 1V9DA 4O4LE 3AAAB 3KV9A 4IE6A 2WWUA 3ZN0B 2X9XA 4UXNB 3OKQA 4F6RC 2QGSA 3K3OA 3ANWB 5HYAA 4DMVA 1HTJF 5J2UE 2MTQA 1T98A 1YD8G 3PUAA 4OYKA 5JDLA 2Z6EA 3GWHA 2RA1A 4CI1B 4CXXA 5M4YA 4MLKA 4YLHA 5KMGP 1D1AA 3N9QA 4ISTA 1YKEB 5CB4E 5JH7E 3EDUA 3RC3A 3T8OA 3HKBE 4G2AA 2WM9A 3AVSA 4BA9A 4C90A 4QKNA 2CCQA 2XAHB 2CE7A 2D0TA 3I1AA 3KFWX 4YJ2E 5L2LA 2KXPB 1FEWA 3CPZA 4O8SA 4QXHB 3BQIA 4UV9B 2EHOB 5HXRA 2CM0A 4ANJA 2B1EA 1CUNA 2ZM0A 5FNVE 3C4XA 3K3QC 4ZOLE 2QA7A 3Q2MA 4O4JE 5FYMA 5L3FB 2LSIA 5CA0E 3CVRA 5EK3A 3Q5XA 3FBLA 4DBQA 4U72A 5FXWA 4MHCA 3UFEA 3RPUA 4P09A 5DQVA 1VRBA 5FY7A 4BJNA 3QUJA 4V1Av 2VKJA 4ZS3A 2OA5A 3TKLB 3Q5WA 2HH7A 3J9X1 2YINA 3QC9A 2LHRA 4X20E 5LYJE 1HFAA 3RRCA 3SRZA 2V26A 1WYCA 3LK3B 2RP4A 2VASA 3KVBA 5TAOA 5JDHA 4OFZA 1HG2A 4U74A 3DTOA 2XTLA 3AA1B 2DHRA 2LOSA 3EUHA 5LJMA 3N9OA 4I4TE 2L8KA 3EDVA 2KWHA 3CX7B 4QX8B 4HGAA 4I55E 3KBTA 4GK0E 4PW8A 3FHNA 4AKRB 4WBNE 2Y48B 4TZ4C 2E9XA 2ZM2A 3MZKB 4ZI2C 1WRDA 3I0OA 4GK5E 4DVDA 4G63A 5LXTE 1AJ3A 2KT9A 5JDGA 2PG8A 3NBXX 3KBUA 4EIWA 5L3CB 4CQIA 1U5PA 4AKGA 4DO0A 1BR4A 3V5SA 3VHLA 3GMIA 5ADXL 2WSSV 3R84B 2NTYA 5LGTB 1VOMA 2HPLA 2ACXA 2V7MA 5H6QB 2LT3A 3LFMA 4HKAA 4IIJE 1O3XA 3UTKA 5HWXA 1MMDA 5LGUB 2XASB 5FMNA 2PJQA 2DNXA 5LOVE 3UT5E 4AKIA 4UF0A 5LP6E 4EYYR 3OYZA 3ZLIA 1Y64B 4CI2B 2W61A 3H37A 2WAUA 3HL6A 2K48A 4KUMB 5JREA 2PFVA 4GOUA 4XAXB 4AKLA 1FIOA 2W62A 1B7TA 5CA1E 4BAYB 3OBVE 4PFPA 4HEAA 3R6NA 2BVMA 2YEVC 4HTEA 3NRYA 1UCUA 5JDMA 4P0AA 3W15B 4UV8B 1HX8A 3CQCB 2WBLA 4FJOA 4QX7B 2JQQA 4OK0A 4PAGA 4ASKA 2BVLA 2I59A 3MACA 1MMNA 5LHGB 3ZC1A 2ODVA 4HN9A 4ZI2D 1KNZA 4QHOA 4B6XA 1S94A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U4Q A;  1WLX A;  3UUM A;  3PE0 A;  3F31 A;  3LBX B;  1S35 A;  1OWA A;  2ODU A;  3EDV A;  1QUU A;  3UUN A;  1HCI A;  2SPC A;  1AJ3 A;  3UUL A;  3LBX A;  2ODV A;  3FB2 A;  1CUN A;  1U5P A; 
#chains in the Genus database with same CATH topology
 4DV4 T;  3KV5 A;  1MIV A;  5EZY E;  3ZYM A;  1MNE A;  1WR6 A;  4AQY T;  3AE7 A;  4PK6 A;  4UEL A;  5LGN B;  4X1Y E;  4AIU A;  4DV3 T;  2VVS A;  3OYX A;  1MND A;  2CLY C;  4UR9 A;  2V5C A;  2CA5 A;  2VWA A;  3ETU A;  2VL0 A;  3ZN1 B;  2V8S V;  1ZHC A;  2M67 A;  1N33 T;  4UF0 B;  4EYU A;  4CZZ B;  1D0Y A;  4JI0 T;  3P7I A;  4Z91 A;  5J0Z A;  3ZMT B;  3ZT5 A;  2HN2 A;  1ZP0 A;  2CXD A;  3C51 A;  5JR9 C;  2K9A A;  1SE7 A;  2UUC T;  3AED A;  1WYB A;  4MBQ A;  4TN7 B;  5AQL B;  4UIG A;  3I9W A;  2CRB A;  5L3B B;  2LSG A;  3ZYK A;  3M65 A;  2Q9Q D;  4B3M T;  4LFA T;  3UU6 A;  4OX9 T;  4TX5 A;  5BMV E;  4NUV A;  4TV8 E;  4AI6 A;  3UU5 A;  2AXD S;  3AXJ B;  2QYW A;  3K3N A;  3F31 A;  3RI5 A;  2BG9 B;  3UUB A;  2OLT A;  3AE9 A;  1R8I A;  1IJ6 A;  3AEB A;  3PUS A;  3WAJ A;  2W67 A;  2CBJ A;  3FB2 A;  3ZCI A;  1OED A;  4YFS A;  5AQT B;  5F3J A;  5KX5 E;  2IW5 B;  2JMH A;  4H63 H;  2X9H A;  1WFD A;  3ZPO A;  1ZV4 X;  4QWN B;  2YDR A;  2V6X A;  3HA4 A;  3CQX C;  4IE5 A;  3EVY A;  3PU8 A;  3C4Z A;  1SUM B;  2GK9 A;  3TLU A;  3O4X E;  2WMO A;  5L3D B;  4JV5 T;  3TLW A;  3AEE A;  1SHZ C;  2RPA A;  2LSJ A;  3N2K E;  3ZJ2 A;  3AA6 B;  2YDS A;  1H7C A;  4WBO A;  2D2S A;  1YKH B;  5AQP B;  4XBF B;  1VCT A;  1MMA A;  4YSX A;  2N9D A;  3AA0 B;  3C50 A;  3K8P C;  3PUX F;  4GYS A;  2MAW A;  3L8R A;  5AQH B;  4ZXL A;  4JI5 T;  3P8C D;  1FMW A;  4DUY T;  4TWF A;  3RYF E;  3H3A A;  3JAD A;  3ZKR A;  2K5B B;  2XQ6 A;  1KK7 A;  3B5M A;  1IJ5 A;  2EHO A;  4I50 E;  3ZC0 A;  1UUR A;  3A8Y C;  3QB5 A;  5IHY A;  5FL0 A;  2LE8 A;  2W63 A;  2NWB A;  5FL1 A;  3L09 A;  2R6G F;  1HG5 A;  2ODU A;  5DQW A;  5HXC A;  1J1J A;  5DJQ C;  1KNR A;  2XSB A;  3DP7 A;  3RIA A;  3C98 B;  4Z8X A;  5DAB A;  3AAI A;  2XQ4 A;  5FKY A;  2ZMA A;  2BKP A;  1XDO A;  4DR5 T;  5AQM B;  1FMV A;  2D5U A;  2JRK A;  1G8X A;  2UUA T;  3GN5 B;  1XZY A;  2UUB T;  2X0Y A;  3KV9 A;  3ZN0 B;  4LF6 T;  4UXN B;  2QGS A;  4DR1 T;  3ANW B;  3N9Q A;  5CB4 E;  3EDU A;  1M62 A;  3HKB E;  3AEF A;  2WZI A;  2CE7 A;  2D0T A;  5AQV B;  1FEW A;  3CPZ A;  2D9D A;  2B1E A;  4U31 A;  3C4X A;  3K3Q C;  2QA7 A;  3Q2M A;  3CVR A;  5EK3 A;  4P09 A;  3QUJ A;  4ZS3 A;  5CJ5 A;  2HH7 A;  2LHR A;  5LYJ E;  2V26 A;  3UQ7 A;  1WYC A;  3KVB A;  1HG2 A;  2DHR A;  4I4T E;  4HWI B;  1M7K A;  3ABV A;  4QX8 B;  3QNU A;  3MZK B;  4ZI2 C;  1WRD A;  3I0O A;  4GK5 E;  3AE1 A;  4DVD A;  2FJB A;  5LXT E;  2HHH T;  1U5P A;  2CHO A;  2V6Y B;  2XQA A;  5ADX L;  1VOM A;  1XNQ T;  4WZX A;  4IIJ E;  1W0B A;  4U7Y A;  5LGU B;  3VRB A;  4DV0 T;  4K0K T;  1Y64 B;  3H37 A;  3HL6 A;  2ACZ A;  2W62 A;  4JI3 T;  3T1Y T;  5CFB A;  2YEV C;  4HFH A;  4FJO A;  4OK0 A;  4ASK A;  2BVL A;  2I59 A;  1MMN A;  3ZC1 A;  2ODV A;  4B6X A;  1L0V A;  1GQE A;  1S94 A;  1VRB A;  2P9B A;  2XAG B;  3MKD A;  4CN6 A;  3SOL A;  4IDN A;  1E7P A;  3CX8 B;  4JBW F;  1D0Z A;  4O4H E;  1UX4 A;  2CWY A;  2BG9 C;  2VKO A;  4CI3 B;  4MFR A;  3KV4 A;  4DND A;  2XSA A;  2VK9 A;  3E0Z A;  1JNZ A;  2E8I A;  2HPJ A;  3FZF B;  2BS4 A;  3LK2 B;  2H89 A;  3NRX A;  4ZI7 E;  3J7Y q;  3VU7 H;  2VB6 A;  5LMN T;  2LSY A;  2A2F X;  2YKS A;  4EAH A;  1U4Q A;  4DBR A;  4X62 T;  2CXF A;  4H9P C;  3G06 A;  2E5L T;  3RIU C;  3ZT6 A;  3JAE A;  2WS3 A;  2X68 A;  4K0U A;  2ZM8 A;  2LLY A;  5FP3 A;  4QH4 A;  2Y6X A;  4A56 A;  2X0H A;  3PJA J;  1NEK A;  2V7I A;  4GIW A;  2XHE B;  5JR9 A;  2WDR A;  3UUX B;  4LFC T;  2BBJ A;  4H9Q C;  1OWA A;  1OED E;  5C8Y E;  4KMC A;  5L47 A;  2X9W A;  1OXZ A;  5ABE A;  2YU1 A;  4DR3 T;  2WDV A;  1MIW A;  3IA3 A;  4JLE A;  1E2A A;  3HKD E;  4QXB B;  3TLV A;  3PUG A;  1BR2 A;  2UXN B;  5C3J A;  2X67 A;  4BJM A;  2LJL A;  1D0X A;  3NZP A;  3EAB A;  5HXS A;  5H6R B;  3QOF A;  3EAM A;  4IDO A;  4DV1 T;  3RGL A;  4PJL A;  4ZZB A;  5AQO B;  4A97 A;  4YY3 T;  2UXB T;  2IML A;  3N9L A;  3O1I A;  2DCF A;  3IF8 B;  1HF8 A;  2XAJ B;  3ZMU B;  4EZH A;  2Q9Q B;  4N78 D;  2FJD A;  4ADZ A;  4E7Z A;  3MJX A;  2X66 A;  3FXE B;  4HWC A;  4L9I A;  4YSZ A;  4AQG A;  3AEA A;  4COF A;  3EI0 A;  3LSV A;  3QK6 A;  4ISS A;  1MMG A;  5JRC A;  4B3S T;  3IBP A;  3U78 A;  4KX6 A;  4ZEY A;  4PFO A;  1W09 A;  4QXC B;  4O2A E;  5ETW A;  2M6B A;  4IHJ E;  4IGU A;  2BZB A;  3I9Y A;  3RF1 A;  4DMW A;  3KV6 A;  4EZ4 A;  5LHI B;  2JJ9 A;  3NZQ A;  2VQE T;  2X9Y A;  2BBH A;  1XMQ T;  2YU2 A;  3ETV A;  3ZT7 A;  5AFU L;  4IE7 A;  4X1I E;  2JMK A;  4WNK A;  3TLT A;  1HX1 B;  1ZEE A;  4IDZ A;  2ZM6 T;  4X1K E;  3GA8 A;  3JC6 D;  2L3L A;  4AKH A;  3P4Q A;  2QVA A;  2IC6 A;  2E9X C;  4FI5 A;  2IIU A;  4L0R A;  4TV9 E;  3AA7 B;  3I0Q A;  2A72 A;  4YTN A;  2ZLY A;  3ZEF B;  3N2G E;  4LFB T;  1BR1 A;  4AQF A;  4DV7 T;  5FXV A;  3F57 A;  2NP9 A;  4YHJ A;  3UUM A;  2NW9 A;  3O1H A;  4WW0 A;  4KHP T;  1XDP A;  5LBQ B;  5IUX A;  2KWI B;  4ILU A;  4B3T T;  4LF9 T;  2DLR A;  5JQG E;  2X51 A;  2NR4 A;  2JIW A;  2WP9 A;  3OJA A;  2EHO D;  4ERR A;  3PUV F;  3PUY F;  2MYS A;  3AVR A;  4L5G A;  5LB7 B;  4IT4 A;  3A5X A;  4KP3 C;  3ZMV B;  3T1H T;  2WWU A;  5LG3 A;  4F6R C;  2W4X A;  4DMV A;  3PUA A;  5JDL A;  3RC3 A;  4G2A A;  4IRE A;  2CCQ A;  2WY2 A;  3UFG A;  3BQI A;  4UV9 B;  1CHU A;  4ANJ A;  1CUN A;  3UU8 A;  4ZOL E;  2KSR A;  4O4J E;  3FBL A;  4U72 A;  5FXW A;  4BJN A;  4V1A v;  2OA5 A;  3Q5W A;  2YIN A;  4X20 E;  3LDQ B;  5HEJ A;  4GKK T;  4EV6 A;  2VAS A;  2XTL A;  3AA1 B;  4JI8 T;  2LOS A;  3EDV A;  4LF4 T;  4HGA A;  4I55 E;  4PW8 A;  1KEY A;  2Y48 B;  4U3C A;  2WWV A;  4YSY A;  4ILA A;  3KBU A;  5AQJ B;  3RHW A;  5L3C B;  4CQI A;  4AKG A;  3RQU A;  4GKJ T;  3VHL A;  1YQ3 A;  2NTY A;  2HPL A;  2FJE A;  2V7M A;  2LT3 A;  4HKA A;  3UTK A;  2JQH A;  1Z8U A;  4P1N A;  3M3Z B;  5FMN A;  3P4R A;  2B76 A;  4U2Y A;  2A9U A;  3UT5 E;  4UF0 A;  5LP6 E;  4Z90 A;  3OYZ A;  3ZLI A;  3FZM B;  3CIR A;  1HR0 T;  1KNP A;  4XAX B;  1B7T A;  4HTE A;  3L39 A;  3AE5 A;  2UU9 T;  5ABF B;  1OED C;  4PAG A;  4YTP A;  3P4S A;  1KNZ A;  2XM1 A;  4X64 T;  2BS2 A;  1KF6 A;  1WLX A;  3F2E A;  2CMR A;  4PJM A;  1J5W A;  3VR9 A;  2LHN A;  4IE0 A;  3E08 A;  4C91 A;  3AEG A;  2I6H A;  5HCJ A;  2G0U A;  4LMJ A;  3A7M A;  3AXJ A;  4ILB A;  3VR8 A;  2BG9 A;  3ZJ1 A;  2E9X B;  4UVB B;  3EHZ A;  3N9M A;  4HWF A;  2XM2 A;  3D0T A;  4EB6 E;  5FY0 A;  2C5J A;  3KIN B;  2Q9Q C;  4NXM T;  1WR0 A;  5JVD E;  5AQS B;  3SFD A;  2VKD A;  4E7S A;  3AE8 A;  5AQU B;  2H7V C;  2UXC T;  2NW8 A;  3B13 A;  4EXT A;  1JNR A;  2W66 A;  3VRA A;  4TUY E;  2IDO B;  4U33 A;  1MIY A;  5KDM C;  1T7S A;  3FBZ A;  3BQL A;  4HFE A;  1LVF A;  2XQ3 A;  3MK7 C;  3RIU A;  4HE8 A;  3KVA A;  5AQR B;  2OV9 A;  4JUY A;  4ZS2 A;  3CX6 B;  3LBX B;  3NKZ A;  2XQ5 A;  2KMF A;  1LRZ A;  1NWM X;  3BK9 A;  2KLQ A;  1XMO T;  4ZHQ E;  3UU4 A;  5L3E B;  5LNK A;  2V7L A;  1I94 T;  4Q25 A;  4XZC A;  1J5E T;  5HEH A;  3AB3 B;  3FZH B;  1QSD A;  1UGO A;  2F4V T;  2BS3 A;  4LMK A;  2H7O A;  2MOZ A;  2VL8 A;  5L4H A;  2IC9 A;  4X5T A;  2DWG A;  3CKD A;  3P50 A;  4WYV A;  2VKH A;  4UEM A;  2C0S A;  4U7I A;  3L3P A;  1Z0P A;  3AE3 A;  3UUL A;  4DUZ T;  2UXX B;  4TWD A;  3ONX A;  4IL9 A;  2NW7 A;  2K24 A;  2V7K A;  3AAE B;  3UU3 A;  5JDQ A;  3RIF A;  4YXD A;  1QLB A;  5ABH A;  3ZYL A;  1IAP A;  4HFD A;  1ZOY A;  2XAF B;  2JPF A;  5HXE A;  2HN1 A;  5BR8 T;  2LRL A;  4AXP A;  3P4W A;  4X65 T;  3V5U A;  3HI2 A;  4CN1 A;  5HXH A;  3PJA A;  1LVK A;  3GN5 A;  4KI0 F;  1YQ4 A;  2N2N A;  3LK4 2;  1LKX A;  3RYI E;  5IYZ E;  3AEC A;  3ANW A;  3RC8 A;  3ZCJ A;  3PUR A;  3ESL A;  3HKC E;  5HAX A;  4JI4 T;  4J2C A;  4EGW A;  2KND A;  4YJ3 E;  3AE2 A;  3PE0 A;  4HFC A;  3E22 E;  1OED B;  2XUE A;  1WCR A;  1DU2 A;  4EEB A;  3IHR A;  1QUU A;  2WZH A;  3N5L A;  3RYH E;  2LSK A;  1YW0 A;  2WCA A;  2CHN A;  3OVU A;  4JYA T;  3ONL C;  1HS7 A;  1D1B A;  4YHH T;  2BDE A;  4HFV A;  2H3R A;  1FJG T;  2YDQ A;  5AQF B;  4IDP A;  4IDQ A;  4UVA B;  2XZE A;  2LKG A;  3N2O A;  1HCI A;  5AQN B;  2C5K T;  3MXZ A;  3UQ4 A;  3VKG A;  2XQ9 A;  4EED A;  3FZK B;  4TWH A;  3CWZ B;  4OHF A;  4M1P A;  2CXL A;  4CXW A;  2LEH A;  4PK5 A;  1NEN A;  4O4I E;  5EK2 A;  1KFY A;  1E1H B;  3Q5D A;  1YXR A;  1SA0 E;  1US7 B;  2V6Y A;  3CQG B;  1ZKE A;  3LBX A;  1XNR T;  4O4L E;  4IE6 A;  3JCF A;  2X9X A;  4ILC A;  1IBK T;  3K3O A;  5J2U E;  2MTQ A;  1T98 A;  4U2Z A;  1YD8 G;  2Z6E A;  3GWH A;  4CXX A;  5M4Y A;  4YLH A;  5KMG P;  4IST A;  5JH7 E;  3T8O A;  2AE9 A;  2LKH A;  4QKN A;  2E5V A;  3I1A A;  4HWH A;  2KXP B;  4QXH B;  2EHO B;  5HXR A;  2CM0 A;  3SFE A;  1N32 T;  4HWD A;  1T72 A;  3QB5 K;  5FYM A;  3NVO A;  5L3F B;  2K3W A;  4QH5 A;  3Q5X A;  1HNZ T;  4MHC A;  3UFE A;  3RPU A;  5FY7 A;  4DR7 T;  3TKL B;  3RRC A;  3SRZ A;  4JI7 T;  3LK3 B;  5JDH A;  2WU5 A;  4U74 A;  3DTO A;  1HNX T;  5FVK A;  3EUH A;  2L8K A;  5IWA T;  2WU2 A;  3KBT A;  4GK0 E;  4WBN E;  4TZ4 C;  2ZM2 A;  4DV5 T;  2VQF T;  3OTO T;  4G63 A;  2KT9 A;  5JDG A;  2DL1 A;  1BR4 A;  2WB5 A;  5HEO A;  5LGT B;  5H6Q B;  3LFM A;  1O3X A;  4EYY R;  3ZSS A;  4CI2 B;  4AIS A;  2W61 A;  2XY8 B;  2WQY A;  4GOU A;  4AKL A;  1FIO A;  5CA1 E;  2W2U A;  3OBV E;  4YTM A;  4HEA A;  3R6N A;  3RQW A;  2BVM A;  2BG9 E;  1N36 T;  3W15 B;  4UV8 B;  2BKO A;  2WBL A;  2JQQ A;  4TNV A;  2VVN A;  3MAC A;  5LHG B;  2BKN A;  4X66 T;  4HN9 A;  4ZI2 D;  2YK0 A;  5LJN A;  1UK5 A;  1UX5 A;  3MA9 A;  2N1G A;  2H88 A;  1BR0 A;  3IEE A;  1IBM T;  4ZI3 D;  3CML A;  4DV6 T;  3P4P A;  3S4U A;  3B57 A;  3O9X A;  5HEG A;  4PNI A;  4DR6 T;  3O1J A;  5ABG A;  2MBG A;  1IZN B;  3H3M A;  5JDF A;  5AQI B;  5JDN A;  5HCM A;  2Q9Q A;  5C2T A;  2CPT A;  2I0M A;  4H9S E;  2XAQ B;  2WMN A;  4I43 B;  4A98 A;  2FBW A;  4JI1 T;  5EK4 A;  1D1C A;  3K1S A;  3LJC A;  4JEH B;  2V5D A;  2A3D A;  2LM2 A;  5KXJ A;  5FXX A;  3C64 A;  5LHH B;  2C5I T;  2D0U A;  2CBI A;  4PK4 A;  3JAF A;  4CN4 A;  2DI4 A;  5CGM A;  2WDQ A;  4AQF C;  3SWH A;  3RYC E;  3ZMZ B;  4NUU A;  3PUQ A;  4LF5 T;  4H9O C;  2ES0 A;  4H9N C;  5JTG A;  3Q9D A;  5F8P A;  5LG4 A;  4KBM B;  1XWM A;  4EOZ B;  5LMU T;  2NOX A;  3FXD B;  3SS1 A;  4O2B E;  5FXZ A;  3UUN A;  1W0A A;  4P0B A;  3BQK A;  3X1D A;  1G73 A;  2CLY B;  2LM9 A;  4KHZ F;  2XPK A;  4PJN A;  3KDS E;  1X79 A;  1HNW T;  3HKE E;  3DJB A;  2LRK A;  2L9Q A;  5GON E;  5J2T E;  3JC6 C;  2V7J A;  4IE4 A;  5FY1 A;  5LA6 E;  3RRW A;  3OPC A;  2IAK A;  2NTX A;  4H9R C;  2DWK A;  4OYJ A;  5HEU A;  3WAK A;  5JR9 B;  4GYR A;  4UVC B;  3PTR B;  4MAL A;  5J1G A;  2SPC A;  2M6I A;  2J1D G;  2W00 A;  2XQ7 A;  3HR0 A;  3RH3 A;  4LML A;  1UUS A;  4JEU B;  4H63 V;  3PUW F;  5HWY A;  4B3R T;  4PJJ A;  1NAF A;  5A1L A;  5LBM A;  4DR4 T;  5LCY A;  4A5X A;  3PU3 A;  2LOP A;  5E0O A;  2CEA A;  2CWO A;  2EHO C;  4NXN T;  2J62 A;  2KZ7 B;  2W0G A;  5L3G B;  2J47 A;  2XJ7 A;  2X0L B;  3N9P A;  2Y8D A;  3U3I A;  1IBL T;  1I6Z A;  2XQY A;  3LG7 A;  2PTF A;  2YN6 A;  2V1D B;  2PBI A;  2JQ9 A;  3ONJ A;  3TLS A;  2QRX A;  4ZI3 C;  5JRC B;  3RX6 A;  4LF7 T;  3VKH A;  3RKO A;  3AE6 A;  2XQ8 A;  5FVL A;  3PV0 F;  4CXY A;  3WI3 A;  3C4W A;  4NIQ A;  3ZMS B;  3PDY A;  2VUR A;  1S35 A;  1VCS A;  3FZL B;  3N9N A;  2E9X D;  2KIN B;  1EZ3 A;  4NPP A;  1X9B A;  1V9D A;  3AAA B;  3RLF F;  2FUP A;  3OKQ A;  5HYA A;  1HTJ F;  5L4E A;  4OYK A;  4CI1 B;  2RA1 A;  4MLK A;  1D1A A;  2YOE A;  1YKE B;  1N34 T;  2WM9 A;  3AVS A;  4BA9 A;  4C90 A;  2IUB A;  2XAH B;  4IL4 A;  3KFW X;  5L2L A;  4YJ2 E;  4O8S A;  5AQK B;  2ZM0 A;  5FNV E;  2JQK A;  3CK6 A;  2LSI A;  5ABF A;  5CA0 E;  5AQG B;  4DBQ A;  3AE4 A;  5DQV A;  2VKJ A;  4QH1 A;  3J9X 1;  4DID B;  3QC9 A;  1HFA A;  2IHR 1;  4YT0 A;  2RP4 A;  4LF8 T;  4HFB A;  4I0U A;  4TNW A;  5TAO A;  4OFZ A;  2FJA A;  5LJM A;  3N9O A;  1Y01 A;  2KWH A;  3CX7 B;  3FHN A;  4AKR B;  1W9R A;  2E9X A;  1AJ3 A;  2UXD T;  2PG8 A;  3NBX X;  4EIW A;  2E2A A;  4DO0 A;  4DR2 T;  3V5S A;  3GMI A;  2MPK A;  2WSS V;  3R84 B;  2ACX A;  3Q5E A;  4DV2 T;  5HWX A;  1MMD A;  2XAS B;  3NWI A;  2PJQ A;  2DNX A;  5LOV E;  4HFI A;  4AKI A;  5F5W A;  4F8H A;  2WAU A;  2K48 A;  5JRE A;  4KUM B;  2PFV A;  4BAY B;  4PFP A;  3NRY A;  1UCU A;  5JDM A;  4P0A A;  1T8B A;  1HX8 A;  3CQC B;  3RKG A;  4ZZC A;  4QX7 B;  2J4G A;  3ZST A;  4JI6 T;  3PUZ F;  4QHO A;  4JI2 T;  5AQQ B; 
#chains in the Genus database with same CATH homology
 2P9B A;  2XAG B;  2YK0 A;  3KV5 A;  1MIV A;  5LJN A;  1WLX A;  3F2E A;  3MKD A;  3SOL A;  2CMR A;  1UX5 A;  4PJM A;  3MA9 A;  2LHN A;  4IE0 A;  2N1G A;  3E08 A;  5EZY E;  3ZYM A;  3CX8 B;  4C91 A;  1D0Z A;  1BR0 A;  1MNE A;  3IEE A;  1WR6 A;  4ZI3 D;  4O4H E;  1UX4 A;  2CWY A;  2G0U A;  2VKO A;  4CI3 B;  3CML A;  4PK6 A;  3S4U A;  3B57 A;  4MFR A;  3KV4 A;  4DND A;  4UEL A;  2VK9 A;  3E0Z A;  2E9X B;  4X1Y E;  3ZJ1 A;  5LGN B;  4UVB B;  3N9M A;  3O9X A;  3D0T A;  4PNI A;  4EB6 E;  3O1J A;  5FY0 A;  2C5J A;  3OYX A;  1MND A;  2MBG A;  1IZN B;  2E8I A;  2HPJ A;  2CLY C;  5JDF A;  3KIN B;  2Q9Q C;  3LK2 B;  2CA5 A;  5JDN A;  5JVD E;  2Q9Q A;  2VKD A;  2VWA A;  3NRX A;  4E7S A;  3ETU A;  4ZI7 E;  3J7Y q;  2H7V C;  4H9S E;  2NW8 A;  3B13 A;  3VU7 H;  2VB6 A;  2XAQ B;  4EXT A;  2WMN A;  3ZN1 B;  4I43 B;  2LSY A;  2A2F X;  1ZHC A;  2M67 A;  4EAH A;  4TUY E;  4UF0 B;  1U4Q A;  4EYU A;  4CZZ B;  1D0Y A;  5EK4 A;  1D1C A;  3P7I A;  1MIY A;  4DBR A;  2CXF A;  4H9P C;  5KDM C;  3LJC A;  4JEH B;  3ZMT B;  3FBZ A;  3BQL A;  1LVF A;  2X68 A;  4K0U A;  2ZM8 A;  2CXD A;  2A3D A;  3MK7 C;  5FP3 A;  3C51 A;  4HE8 A;  5JR9 C;  2K9A A;  2Y6X A;  3KVA A;  4A56 A;  2V7I A;  4GIW A;  2XHE B;  5JR9 A;  5FXX A;  3C64 A;  5LHH B;  3UUX B;  2C5I T;  1WYB A;  4JUY A;  4ZS2 A;  3CX6 B;  2D0U A;  4MBQ A;  4PK4 A;  3LBX B;  4H9Q C;  1OWA A;  4TN7 B;  2DI4 A;  4KMC A;  5C8Y E;  4UIG A;  3I9W A;  5L3B B;  2X9W A;  2LSG A;  1OXZ A;  2YU1 A;  1MIW A;  3ZYK A;  3M65 A;  4AQF C;  4JLE A;  2KMF A;  2Q9Q D;  3SWH A;  3HKD E;  3RYC E;  1LRZ A;  4QXB B;  3PUG A;  1BR2 A;  1NWM X;  2UXN B;  4TX5 A;  3BK9 A;  4NUV A;  3ZMZ B;  5BMV E;  4NUU A;  4TV8 E;  3PUQ A;  2KLQ A;  4H9O C;  2X67 A;  4BJM A;  2LJL A;  4ZHQ E;  2ES0 A;  1D0X A;  4AI6 A;  3NZP A;  4H9N C;  5HXS A;  5H6R B;  3Q9D A;  5L3E B;  5F8P A;  3K3N A;  5LG4 A;  4KBM B;  3F31 A;  4PJL A;  2V7L A;  5LNK A;  4EOZ B;  4XZC A;  2NOX A;  3FXD B;  3SS1 A;  1IJ6 A;  4O2B E;  5FXZ A;  3UUN A;  3AB3 B;  3PUS A;  3WAJ A;  1QSD A;  4P0B A;  3N9L A;  3FB2 A;  3ZCI A;  2DCF A;  2H7O A;  3BQK A;  3O1I A;  3IF8 B;  1G73 A;  2CLY B;  1HF8 A;  2MOZ A;  2XAJ B;  4YFS A;  5F3J A;  2VL8 A;  5KX5 E;  3ZMU B;  4EZH A;  2Q9Q B;  2IW5 B;  2JMH A;  4N78 D;  2LM9 A;  2IC9 A;  4ADZ A;  2DWG A;  3CKD A;  4E7Z A;  4PJN A;  3KDS E;  3MJX A;  1X79 A;  2X66 A;  4H63 H;  2X9H A;  2VKH A;  3FXE B;  3HKE E;  4UEM A;  4L9I A;  3DJB A;  3ZPO A;  1ZV4 X;  4QWN B;  4AQG A;  2L9Q A;  2C0S A;  5GON E;  3HA4 A;  3CQX C;  3L3P A;  1Z0P A;  5J2T E;  3JC6 C;  2V7J A;  2UXX B;  3UUL A;  4IE5 A;  4IE4 A;  3EVY A;  5FY1 A;  3PU8 A;  5LA6 E;  3ONX A;  3C4Z A;  3RRW A;  2NW7 A;  3QK6 A;  4ISS A;  2IAK A;  1MMG A;  2GK9 A;  2NTX A;  5JRC A;  2K24 A;  2V7K A;  3AAE B;  3IBP A;  3O4X E;  4H9R C;  2WMO A;  2DWK A;  5JDQ A;  5L3D B;  3U78 A;  4OYJ A;  1SHZ C;  3WAK A;  4PFO A;  5JR9 B;  3ZYL A;  2LSJ A;  3N2K E;  3ZJ2 A;  4GYR A;  3AA6 B;  4UVC B;  4QXC B;  4O2A E;  1IAP A;  3PTR B;  5ETW A;  4MAL A;  4IHJ E;  2XAF B;  4IGU A;  2JPF A;  2BZB A;  3I9Y A;  1H7C A;  4WBO A;  5J1G A;  2SPC A;  5HXE A;  4DMW A;  2D2S A;  2J1D G;  3KV6 A;  4AXP A;  2W00 A;  4EZ4 A;  1YKH B;  5LHI B;  2JJ9 A;  3NZQ A;  4XBF B;  3V5U A;  3HI2 A;  1MMA A;  3HR0 A;  2X9Y A;  5HXH A;  3RH3 A;  2YU2 A;  3ETV A;  4JEU B;  1LVK A;  4H63 V;  5AFU L;  3GN5 A;  2N9D A;  3AA0 B;  3C50 A;  5HWY A;  3LK4 2;  2N2N A;  4IE7 A;  4X1I E;  3K8P C;  2JMK A;  4GYS A;  1LKX A;  4PJJ A;  4WNK A;  3RYI E;  1NAF A;  5IYZ E;  1ZEE A;  4IDZ A;  3ANW A;  5A1L A;  5LBM A;  3RC8 A;  3ZCJ A;  3PUR A;  3ESL A;  3HKC E;  4X1K E;  5HAX A;  3GA8 A;  3JC6 D;  4J2C A;  5LCY A;  2KND A;  2L3L A;  4AKH A;  3P8C D;  1FMW A;  4YJ3 E;  3PU3 A;  2LOP A;  3RYF E;  3PE0 A;  2IC6 A;  5E0O A;  2CEA A;  2CWO A;  3E22 E;  2EHO C;  2E9X C;  3H3A A;  2XUE A;  4FI5 A;  2K5B B;  4TV9 E;  4L0R A;  1KK7 A;  2KZ7 B;  2W0G A;  3AA7 B;  3I0Q A;  1IJ5 A;  2A72 A;  3IHR A;  1QUU A;  2EHO A;  3N5L A;  2X0L B;  4I50 E;  5L3G B;  3RYH E;  3ZC0 A;  3N9P A;  2Y8D A;  2LSK A;  1YW0 A;  2ZLY A;  3U3I A;  3ZEF B;  3N2G E;  5IHY A;  2W63 A;  2LE8 A;  1BR1 A;  1D1B A;  2NWB A;  2XQY A;  3LG7 A;  4AQF A;  1HS7 A;  2BDE A;  5FXV A;  4HFV A;  2H3R A;  3F57 A;  2V1D B;  3L09 A;  2NP9 A;  2PBI A;  4YHJ A;  3UUM A;  2NW9 A;  1HG5 A;  2ODU A;  5DQW A;  4ZI3 C;  5HXC A;  5DJQ C;  5JRC B;  3O1H A;  4UVA B;  3RX6 A;  4WW0 A;  3VKH A;  3DP7 A;  3RKO A;  3N2O A;  1HCI A;  3C98 B;  4Z8X A;  2C5K T;  3MXZ A;  5LBQ B;  5DAB A;  3VKG A;  2KWI B;  3AAI A;  4ILU A;  4CXY A;  3WI3 A;  2DLR A;  3CWZ B;  4OHF A;  3C4W A;  4M1P A;  5JQG E;  2CXL A;  3ZMS B;  4CXW A;  2X51 A;  3PDY A;  3OJA A;  1S35 A;  2ZMA A;  2LEH A;  4PK5 A;  4O4I E;  3N9N A;  5EK2 A;  1E1H B;  2E9X D;  2EHO D;  4ERR A;  1FMV A;  2MYS A;  2KIN B;  2D5U A;  3AVR A;  4L5G A;  1EZ3 A;  1SA0 E;  1US7 B;  3CQG B;  2JRK A;  1G8X A;  3A5X A;  3GN5 B;  4KP3 C;  1ZKE A;  3ZMV B;  3LBX A;  1V9D A;  4O4L E;  3AAA B;  3KV9 A;  4IE6 A;  2WWU A;  3ZN0 B;  2X9X A;  4UXN B;  3OKQ A;  4F6R C;  2QGS A;  3K3O A;  3ANW B;  5HYA A;  4DMV A;  1HTJ F;  5J2U E;  2MTQ A;  1T98 A;  1YD8 G;  3PUA A;  4OYK A;  5JDL A;  2Z6E A;  3GWH A;  2RA1 A;  4CI1 B;  4CXX A;  5M4Y A;  4MLK A;  4YLH A;  5KMG P;  1D1A A;  3N9Q A;  4IST A;  1YKE B;  5CB4 E;  5JH7 E;  3EDU A;  3RC3 A;  3T8O A;  3HKB E;  4G2A A;  2WM9 A;  3AVS A;  4BA9 A;  4C90 A;  4QKN A;  2CCQ A;  2XAH B;  2CE7 A;  2D0T A;  3I1A A;  3KFW X;  4YJ2 E;  5L2L A;  2KXP B;  1FEW A;  3CPZ A;  4O8S A;  4QXH B;  3BQI A;  4UV9 B;  2EHO B;  5HXR A;  2CM0 A;  4ANJ A;  2B1E A;  1CUN A;  2ZM0 A;  5FNV E;  3C4X A;  3K3Q C;  4ZOL E;  2QA7 A;  3Q2M A;  4O4J E;  5FYM A;  5L3F B;  2LSI A;  5CA0 E;  3CVR A;  5EK3 A;  3Q5X A;  3FBL A;  4DBQ A;  4U72 A;  5FXW A;  4MHC A;  3UFE A;  3RPU A;  4P09 A;  5DQV A;  1VRB A;  5FY7 A;  4BJN A;  3QUJ A;  4V1A v;  2VKJ A;  4ZS3 A;  2OA5 A;  3TKL B;  3Q5W A;  2HH7 A;  3J9X 1;  2YIN A;  3QC9 A;  2LHR A;  4X20 E;  5LYJ E;  1HFA A;  3RRC A;  3SRZ A;  2V26 A;  1WYC A;  3LK3 B;  2RP4 A;  2VAS A;  3KVB A;  5TAO A;  5JDH A;  4OFZ A;  1HG2 A;  4U74 A;  3DTO A;  2XTL A;  3AA1 B;  2DHR A;  2LOS A;  3EUH A;  5LJM A;  3N9O A;  4I4T E;  2L8K A;  3EDV A;  2KWH A;  3CX7 B;  4QX8 B;  4HGA A;  4I55 E;  3KBT A;  4GK0 E;  4PW8 A;  3FHN A;  4AKR B;  4WBN E;  2Y48 B;  4TZ4 C;  2E9X A;  2ZM2 A;  3MZK B;  4ZI2 C;  1WRD A;  3I0O A;  4GK5 E;  4DVD A;  4G63 A;  5LXT E;  1AJ3 A;  2KT9 A;  5JDG A;  2PG8 A;  3NBX X;  3KBU A;  4EIW A;  5L3C B;  4CQI A;  1U5P A;  4AKG A;  4DO0 A;  1BR4 A;  3V5S A;  3VHL A;  3GMI A;  5ADX L;  2WSS V;  3R84 B;  2NTY A;  5LGT B;  1VOM A;  2HPL A;  2ACX A;  2V7M A;  5H6Q B;  2LT3 A;  3LFM A;  4HKA A;  4IIJ E;  1O3X A;  3UTK A;  5HWX A;  1MMD A;  5LGU B;  2XAS B;  5FMN A;  2PJQ A;  2DNX A;  5LOV E;  3UT5 E;  4AKI A;  4UF0 A;  5LP6 E;  4EYY R;  3OYZ A;  3ZLI A;  1Y64 B;  4CI2 B;  2W61 A;  3H37 A;  2WAU A;  3HL6 A;  2K48 A;  4KUM B;  5JRE A;  2PFV A;  4GOU A;  4XAX B;  4AKL A;  1FIO A;  2W62 A;  1B7T A;  5CA1 E;  4BAY B;  3OBV E;  4PFP A;  4HEA A;  3R6N A;  2BVM A;  2YEV C;  4HTE A;  3NRY A;  1UCU A;  5JDM A;  4P0A A;  3W15 B;  4UV8 B;  1HX8 A;  3CQC B;  2WBL A;  4FJO A;  4QX7 B;  2JQQ A;  4OK0 A;  4PAG A;  4ASK A;  2BVL A;  2I59 A;  3MAC A;  1MMN A;  5LHG B;  3ZC1 A;  2ODV A;  4HN9 A;  4ZI2 D;  1KNZ A;  4QHO A;  4B6X A;  1S94 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...