3UUMA

Crystal structure of n-terminal first spectrin repeat of utrophin
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
122
structure length
122
Chain Sequence
b'MDLDSYQIALEEVLTWLLSAEDTFQEQDDISDDVEDVKEQFATHETFMMELSAHQSSVGSVLQAGNQLMTQGTLSDEEEFEIQEQMTLLNARWEALRVESMERQSRLHDALMELQKKQLQQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords utrophin
publication title The crystal structures of dystrophin and utrophin spectrin repeats: implications for domain boundaries
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein
total genus 57
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00435 Spectrin Spectrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.60 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3uumA00
3PE0A 1OWAA 1QUUA 3EDVA 2ODVA 3UULA 1U4QA 3F31A 3UUMA 1HCIA 3FB2A 1U5PA 1CUNA 3LBXB 1AJ3A 2ODUA 2SPCA 1S35A 1WLXA 3LBXA 3UUNA
chains in the Genus database with same CATH superfamily
5HXEA 3TLWA 4MHCA 1H7CA 4AIUA 2BZBA 2M6BA 2C5KT 3GMIA 2W66A 3AA1B 4H9NC 4YSYA 5FNVE 2FJBA 3IA3A 2V7MA 2D2SA 3ZT6A 5LCYA 3KFWX 3AEGA 4B3TT 4KX6A 3IF8B 5JDMA 3CQXC 4PJJA 4DV1T 1MNDA 2KINB 5FVLA 3KVBA 2YU1A 4UF0B 2BKNA 3J7Yq 4QH1A 3PJAA 4ADZA 2W00A 3KV6A 3O1IA 3D0TA 4QX8B 2W4XA 4EIWA 2G0UA 1FMWA 3QC9A 4LFAT 3ZMVB 4M1PA 3ZJ2A 3MK7C 3JAEA 5F8PA 1J5ET 3PU8A 3ABVA 2WDVA 3CQGB 3RIFA 3WI3A 1QLBA 5JREA 1UGOA 2WWUA 1R8IA 4XAXB 3VR8A 4X5TA 1YD8G 3M3ZB 2BG9C 4K0KT 3AXJA 1SE7A 3ZN0B 3GN5B 2JJ9A 2UXXB 1OWAA 2N9DA 4WYVA 3PUVF 3PJAJ 5IWAT 2LLYA 4QWNB 4DMWA 5LYJE 2LM9A 5BR8T 3FZKB 5CGMA 4WZXA 2XAFB 2CXDA 2LHNA 3NBXX 4YT0A 1J5WA 1HFAA 4QHOA 3LBXA 4I55E 5AQLB 5HEGA 2QYWA 1I6ZA 2A72A 4CI1B 5HWXA 1E2AA 3SRZA 4UXNB 4BAYB 2ZM2A 2YKSA 2XASB 1D1BA 1S94A 3OTOT 4O4JE 5ADXL 2RA1A 2PG8A 2WDRA 3CMLA 1MIWA 1YQ4A 5LG3A 3ANWB 4YJ3E 3LG7A 3KV9A 3RRWA 1ZKEA 4U7YA 3AEDA 2HPJA 3KDSE 1LVKA 4EZHA 2NWBA 3LJCA 4ZI7E 5LMUT 2NP9A 1MMGA 4UV9B 3AECA 3SOLA 2V5CA 5L3EB 2V7IA 5JVDE 4CQIA 3N2GE 2PTFA 2UU9T 2XQYA 4ZEYA 2W0GA 2NTYA 5FY1A 4LF9T 4O8SA 4HFCA 4DV7T 4Z90A 2XQ4A 4IDPA 1CHUA 5KMGP 5JDQA 2ZLYA 4CXYA 2LSIA 2UUCT 5LGUB 3VU7H 3KV5A 4DR3T 2LSYA 3OVUA 3UUBA 2ODUA 1D1CA 3KV4A 3T1YT 5L2LA 4DV0T 2JPFA 2LKGA 3NRXA 3C64A 4DO0A 2XQ5A 5LBMA 4AKHA 3PUZF 2ACZA 4YHHT 5HYAA 4TUYE 2ODVA 1HG2A 2V7JA 3P8CD 1HCIA 3FZMB 3SS1A 3K1SA 1UK5A 4DUZT 2XQ6A 1YXRA 4ZS2A 3NKZA 4V1Av 4OYJA 4JYAT 3EVYA 5LB7B 5AFUL 3L39A 2HPLA 4U72A 2VKJA 1HS7A 1Z0PA 3QUJA 5FL0A 3ZPOA 5L47A 3CX7B 3AXJB 1KK7A 2VKHA 2Q9QA 5AQIB 3PTRB 4A97A 4JI0T 3ZCJA 2D9DA 3P4WA 5IUXA 3ZMSB 1X79A 1KNZA 2JMHA 3F31A 2N2NA 2YK0A 3RRCA 4DIDB 2BVLA 3LBXB 2BKOA 2VL8A 2OV9A 4X62T 4ZZCA 3AE1A 3I0QA 3O1HA 2WZIA 3O1JA 3MXZA 3PUAA 2Z6EA 3O4XE 3L8RA 5IHYA 3B13A 3B57A 3SWHA 2W61A 3UT5E 1I94T 4LFBT 4X65T 4OHFA 4U2ZA 3T8OA 4NUVA 2XQAA 2JRKA 2VKOA 4YTMA 4DV3T 3N2KE 5CJ5A 2MBGA 2L8KA 5LHIB 1SHZC 4JI8T 3GA8A 5LJNA 2WQYA 1MMAA 2YINA 3O9XA 4AKRB 4CN6A 4IE0A 2UUBT 4IDOA 3RIUC 5CA0E 2XPKA 4HWCA 3Q5EA 3PE0A 5FXWA 4CXXA 5LG4A 3AVSA 1IJ5A 4CN4A 3I9YA 2DNXA 3QK6A 3PUGA 3H3AA 3OYXA 5DQVA 4LFCT 2ZMAA 4HKAA 3UUXB 4ZI3D 3MZKB 1HNWT 2I0MA 1N32T 4L5GA 1HNZT 2XAHB 2WB5A 3IEEA 4UEMA 2VKDA 3ZYLA 5L4EA 2YDRA 2J1DG 5FY0A 2BG9A 3ZMTB 3ETVA 4LF7T 3FZHB 4ANJA 2E2AA 2CA5A 2WU5A 3GN5A 4AI6A 2H7VC 5ABHA 3MA9A 2WY2A 3AE4A 1OEDC 2H89A 2BG9E 2CM0A 3EHZA 5EZYE 2X9YA 3ZSTA 3N5LA 4ASKA 4QKNA 2E9XA 4EV6A 3NWIA 4P09A 3K3OA 2I59A 3AB3B 3RC3A 2KXPB 1ZHCA 4H9QC 4G63A 3ZEFB 4TV9E 3N9NA 3RQWA 3ZT5A 2MTQA 2Q9QB 2CWYA 3N9LA 2XQ3A 2KLQA 4WNKA 4UELA 5M4YA 2JMKA 3RF1A 4L0RA 2XAJB 4GIWA 1XMQT 5JQGE 2WAUA 4HE8A 4N78D 4LMKA 3FBLA 3AVRA 3P4PA 3DTOA 3RLFF 4DR2T 2I6HA 4TZ4C 2A2FX 4H9PC 4HEAA 3L09A 2W67A 5LA6E 3CK6A 4AQFA 3PUXF 5AQQB 3BQIA 3LDQB 2L9QA 2YDQA 3Q5DA 2JQ9A 3RC8A 2VQFT 1U4QA 4CN1A 1W9RA 2XAQB 2VB6A 1BR0A 4O4LE 2XSAA 1WFDA 5L3GB 5AQRB 1WR0A 3E22E 4UVCB 4PK4A 1NENA 4ZS3A 2X9WA 5HEOA 2XZEA 4J2CA 2YDSA 1D1AA 4TNVA 4CI3B 5ABGA 3LSVA 2WMOA 5JTGA 2ZM6T 3ZN1B 2FJAA 2UXBT 3TKLB 3AE9A 1KNRA 4TNWA 2B1EA 3VR9A 3AEAA 2LKHA 3RYFE 3SFDA 4PW8A 2LRLA 5FL1A 4GKJT 4UIGA 1HF8A 4ZI3C 3UFGA 2M6IA 1Y64B 4X64T 1MIVA 3Q9DA 5KDMC 4DUYT 1ZOYA 2IIUA 5CFBA 2IHR1 2QVAA 1G73A 3QB5K 4DV2T 4QXCB 3UQ7A 2OLTA 2PJQA 4TX5A 1MIYA 4LF5T 2BG9B 4PFPA 1T8BA 2K48A 3JAFA 4I43B 2XTLA 5A1LA 2V7LA 3RKGA 2XSBA 1HR0T 4P1NA 2MPKA 4IT4A 4Q25A 1L0VA 2VK9A 2OA5A 2RPAA 2J4GA 4YY3T 3RI5A 5JR9C 4AKGA 5AQSB 4U33A 4DR4T 1HX8A 2E9XB 2UXCT 4IDQA 1E1HB 2VURA 2KMFA 1IBMT 4IGUA 2LJLA 1QSDA 3A5XA 2X9HA 2X66A 2EHOA 2WS3A 3KVAA 3EDUA 1XZYA 2IMLA 4H9OC 4Z91A 3T1HT 5LMNT 4QH5A 4ILAA 1MMDA 4C90A 3ZMZB 2WP9A 4P0BA 4H9SE 5LJMA 4KHZF 4AQGA 2V7KA 3EAMA 1D0XA 2F4VT 3UU8A 5FXVA 4U74A 3UFEA 1KFYA 3AE7A 3UUMA 2B76A 1XWMA 4HWHA 4PJLA 3UU3A 5FXXA 5L4HA 2VQET 3RYIE 1S35A 4IE6A 3AAAB 4LF4T 3PDYA 3OBVE 5JDGA 2CCQA 3C4XA 4X1IE 4NXNT 4DVDA 1XDPA 2ZM8A 4P0AA 3ONXA 2WCAA 2PFVA 3IHRA 2WWVA 2HN1A 1T7SA 4DR7T 3N9OA 4TWFA 3CVRA 4Z8XA 1VCTA 4IREA 4AISA 2W63A 2RP4A 4UVAB 2DLRA 2HN2A 2XM1A 5JRCB 4HGAA 5FYMA 2C5IT 5KXJA 3FZLB 2ZM0A 5AQFB 3KBUA 4NIQA 2FJDA 2CE7A 2BKPA 4JLEA 3N9PA 1MMNA 4LMJA 4HFBA 4TWDA 5HXSA 2Y6XA 3ZYMA 3UULA 2R6GF 3A8YC 2CRBA 3KBTA 5FXZA 4O4IE 5DABA 3HR0A 3RQUA 2KT9A 5J2UE 5AQGB 4EOZB 3RGLA 4JBWF 1WYBA 1KF6A 5FMNA 4H63V 3HI2A 4YLHA 2CPTA 3EI0A 3ZLIA 4L9IA 1T72A 5HXRA 2IUBA 4JUYA 3CPZA 4GOUA 1IJ6A 5AQUB 5AQKB 3OJAA 3NVOA 3RKOA 1WYCA 1SA0E 2V6YA 4GYRA 3S4UA 2Q9QD 4A98A 5AQJB 5HAXA 2K3WA 5CA1E 4F6RC 1XMOT 5AQOB 2Y48B 4ZHQE 4B3RT 3VKGA 5AQMB 2V26A 2X0HA 2EHOB 3P4RA 4IL9A 2X68A 4UR9A 5ETWA 2H7OA 1JNRA 4HFHA 4CXWA 5HXHA 1IZNB 3ZT7A 3ESLA 5H6QB 4IE7A 4DNDA 3PUYF 2M67A 2MAWA 3FXDB 4CI2B 4HWIB 4E7SA 3V5UA 5AQNB 2LRKA 1UUSA 2LE8A 2XHEB 3ONLC 3C98B 4X1KE 4EYUA 5FKYA 4EYYR 2XQ7A 4TN7B 3AEEA 4KP3C 2L3LA 3CX6B 2VL0A 3HKEE 4QX7B 3P4SA 5DQWA 2ACXA 3PURA 3VRAA 2XQ9A 3AA7B 4TWHA 4PJNA 4OYKA 2LEHA 4OK0A 1EZ3A 1N33T 2BDEA 4GKKT 3DP7A 1XNQT 4COFA 2WSSV 4WBNE 3EABA 2P9BA 4AKIA 1ZV4X 2GK9A 2E8IA 1YKHB 5LGTB 5JR9A 1GQEA 3ZC0A 3H37A 3X1DA 3LFMA 3AEBA 2KWHA 1T98A 4X66T 5EK3A 4ZZBA 1BR4A 4PJMA 3JCFA 2K24A 3K3QC 1W0BA 2IC6A 2QA7A 5C3JA 3E0ZA 4ZXLA 1UX4A 1SUMB 4U3CA 3ZSSA 2CXLA 5EK4A 3MKDA 5J1GA 4EB6E 1J1JA 3KINB 1BR1A 3GWHA 2CLYC 1HX1B 4GYSA 3RYCE 2E9XD 5LOVE 2E5VA 5GONE 5JDHA 5L3FB 1W09A 1O3XA 4QH4A 2NW8A 4BA9A 3CKDA 5AQPB 4IHJE 4ILCA 3ZYKA 4HFVA 1LKXA 4CZZB 2V6YB 4H63H 4DR1T 2Q9QC 4JI2T 1W0AA 4IE4A 3ZJ1A 5FY7A 4DR6T 3C4WA 3MACA 2LT3A 2IAKA 3OYZA 2LOSA 3UU5A 1V9DA 1G8XA 1BR2A 3JC6D 2X0LB 4LMLA 4C91A 4ISTA 2W62A 1HTJF 5AQVB 3MJXA 5EK2A 4MALA 4EZ4A 1Z8UA 3IBPA 4ISSA 3HKBE 5HEJA 2LSGA 4FI5A 3F2EA 2NTXA 5JRCA 2YEVC 4JI6T 2J62A 4HN9A 2BVMA 3FXEB 5JDLA 4U31A 2DL1A 4ZOLE 2V5DA 2CBJA 4NUUA 2JQKA 3FHNA 2IW5B 4BJMA 3K8PC 3CWZB 3FBZA 2JQQA 5HEUA 3RPUA 3U78A 3HKDE 2FBWA 5C2TA 3ZCIA 2YN6A 3FB2A 2K5BB 3NZPA 3PUQA 3UU4A 2MOZA 3A7MA 4DR5T 5HXCA 4OFZA 2CBIA 2HH7A 4AXPA 3AAIA 3TLUA 2XM2A 1XDOA 1M7KA 1MNEA 2KWIB 5HEHA 4EAHA 2N1GA 3W15B 2CHOA 5JR9B 2D5UA 2WBLA 3K3NA 3I9WA 4DV6T 3VKHA 2AE9A 3ONJA 4PAGA 1LRZA 3Q5WA 4WBOA 2W2UA 3QB5A 5F3JA 2XAGB 4ILBA 2NOXA 3U3IA 2DCFA 3AAEB 5JDNA 3RX6A 4B3MT 5LXTE 4G2AA 5TAOA 4PK6A 4WW0A 4IIJE 2VVSA 2XQ8A 2E9XC 3EDVA 2LSJA 2QGSA 4K0UA 2IDOB 1M62A 2LOPA 2HHHT 3AE2A 2UUAT 2J47A 2YOEA 3ZC1A 4JEHB 2EHOD 3RIUA 3HA4A 4I4TE 4O2AE 4YSZA 1ZEEA 3C51A 2E5LT 2WMNA 2CEAA 2V8SV 5ABEA 4QXHB 4UVBB 1WCRA 4PFOA 3R84B 4HFIA 3P50A 5L3BB 4NPPA 4ERRA 2JIWA 3QOFA 2CWOA 5LGNB 3E08A 4XZCA 2YU2A 4IL4A 5L3CB 4DBQA 1NWMX 2WU2A 3JC6C 2LM2A 2H3RA 1HNXT 1FEWA 3G06A 1IBLT 4HWFA 3AEFA 4AQFC 2JQHA 2X67A 3UU6A 4QXBB 2DHRA 3LK3B 4DMVA 1N36T 4TV8E 2QRXA 4A56A 4KBMB 2UXDT 2A9UA 1XNRT 4JEUB 4UV8B 5IYZE 4JI1T 3RHWA 1OEDA 3NRYA 2WM9A 1ZP0A 1E7PA 1FMVA 3I0OA 4I50E 1KNPA 3Q5XA 1UX5A 4HWDA 2KNDA 3ZMUB 3L3PA 3TLSA 5DJQC 4FJOA 3N2OA 4ZI2D 5L3DB 2NR4A 2BS2A 1OEDE 1B7TA 4PK5A 3PV0F 3JADA 1YQ3A 4B6XA 5HWYA 1IBKT 1WR6A 1OXZA 1HG5A 4BJNA 2ES0A 5JH7E 4KMCA 3V5SA 4I0UA 1UURA 3AA6B 3AE5A 5JDFA 1DU2A 4PNIA 5AQTB 2KZ7B 2X51A 2AXDS 1LVFA 1US7B 3R6NA 5LBQB 5ABFA 1U5PA 4LF8T 1D0ZA 2CXFA 2LHRA 5HCJA 3UQ4A 2FUPA 1WLXA 3M65A 3PU3A 3WAJA 3F57A 3WAKA 4YSXA 3J9X1 1X9BA 4EXTA 4DV4T 2VASA 1IAPA 4U7IA 3P7IA 2CMRA 5FVKA 3ETUA 3QNUA 4JI3T 5LP6E 3C4ZA 3CQCB 5H6RB 4XBFB 4YXDA 3B5MA 5HCMA 2A3DA 5CB4E 4B3ST 3BQKA 5LHHB 1AJ3A 2NW9A 2EHOC 5BMVE 4IDZA 4EEDA 1UCUA 4YHJA 4IDNA 4YFSA 3TLTA 3BQLA 4X20E 3UTKA 4LF6T 2KSRA 2BS3A 4O2BE 2X0YA 1FIOA 2V6XA 3LK42 2SPCA 4UF0A 3HKCE 2PBIA 2DWGA 4ILUA 4YTNA 1FJGT 2FJEA 3CX8B 2WDQA 4EGWA 3AA0B 3DJBA 3TLVA 4GK5E 4MBQA 3PUSA 2MYSA 4O4HE 4KI0F 4DV5T 2DWKA 3OPCA 4YJ2E 3NZQA 2D0UA 5LHGB 5J2TE 1NAFA 1QUUA 2C5JA 4JI7T 3PUWF 4HFEA 3CIRA 4A5XA 3RYHE 5KX5E 1N34T 3RIAA 1OEDB 1D0YA 3EUHA 4GK0E 1NEKA 4U2YA 2BBHA 4DBRA 3HL6A 4H9RC 4E7ZA 2V1DB 2WZHA 3LK2B 5AQHB 1KEYA 4EEBA 5FP3A 4JI5T 2H88A 3I1AA 2VWAA 4ZI2C 5J0ZA 2DI4A 3FZFB 2XUEA 4AQYT 1Y01A 4F8HA 2CLYB 3VRBA 3OKQA 3BK9A 3N9QA 2BBJA 1WRDA 4OX9T 1VRBA 2K9AA 3N9MA 2UXNB 3VHLA 2XY8B 4JV5T 3UUNA 4MFRA 3AE8A 5C8YE 4MLKA 4KUMB 4JI4T 2LSKA 5ABFB 3Q2MA 3RH3A 2XJ7A 1YW0A 2D0TA 5F5WA 3ZKRA 3ANWA 4AKLA 2C0SA 2Y8DA 2X9XA 4X1YE 4HFDA 2NW7A 3H3MA 1VOMA 4KHPT 3P4QA 4IE5A 3AE6A 5LNKA 3C50A 2VVNA 4HTEA 5E0OA 1YKEB 1VCSA 1CUNA 2IC9A 4NXMT 3AE3A 2BS4A 1JNZA 2CHNA 4YTPA 3SFEA
chains in the Genus database with same CATH topology
3MZKB 5LXTE 4G2AA 5TAOA 4PK6A 2KT9A 4L5GA 5J2UE 4WW0A 2XAHB 4EOZB 4IIJE 4ZI3D 5HXEA 2E9XC 3EDVA 1WYBA 4MHCA 1H7CA 3IEEA 2BZBA 2LSJA 4UEMA 2C5KT 2QGSA 4K0UA 5FMNA 3GMIA 2VKDA 4H63V 3HI2A 3ZYLA 4YLHA 2J1DG 2LOPA 5FY0A 3AA1B 4H9NC 3ZLIA 4L9IA 3ETVA 5FNVE 3ZC1A 3ZMTB 5HXRA 4JEHB 2EHOD 2V7MA 2D2SA 3HA4A 4I4TE 4O2AE 5LCYA 3KFWX 4ANJA 1ZEEA 3C51A 2WMNA 4JUYA 3IF8B 2CEAA 3CQXC 4PJJA 5JDMA 1MNDA 3CPZA 4GOUA 1IJ6A 2CA5A 2KINB 3GN5A 4AI6A 2H7VC 3OJAA 4QXHB 4UVBB 3MA9A 3KVBA 4PFOA 3R84B 2YU1A 4UF0B 3RKOA 1WYCA 1SA0E 5L3BB 4ERRA 4GYRA 3J7Yq 4ADZA 3S4UA 2W00A 3KV6A 3O1IA 2Q9QD 3D0TA 4QX8B 2CWOA 2CM0A 5EZYE 4EIWA 5LGNB 2G0UA 1FMWA 2X9YA 3QC9A 3E08A 3ZMVB 5HAXA 4XZCA 4M1PA 4F6RC 5CA1E 2YU2A 3ZJ2A 5L3CB 2Y48B 3MK7C 3N5LA 4ASKA 5F8PA 4DBQA 4QKNA 4ZHQE 2E9XA 1NWMX 3JC6C 2H3RA 3PU8A 3VKGA 4P09A 3K3OA 1FEWA 2V26A 2EHOB 2I59A 3CQGB 4AQFC 2X68A 5ETWA 3AB3B 3RC3A 2H7OA 2KXPB 1ZHCA 4CXWA 2X67A 3WI3A 5HXHA 4QXBB 2DHRA 3LK3B 4DMVA 5JREA 2WWUA 1IZNB 4H9QC 3ESLA 4G63A 4TV8E 4IE7A 5H6QB 3ZEFB 4A56A 4DNDA 4KBMB 2M67A 4TV9E 4XAXB 3N9NA 1YD8G 3FXDB 4CI2B 2MTQA 2Q9QB 4JEUB 2CWYA 4UV8B 3N9LA 2KLQA 4WNKA 4UELA 5M4YA 4E7SA 5IYZE 2JMKA 3V5UA 4L0RA 2XAJB 4GIWA 3ZN0B 3GN5B 2LE8A 5JQGE 3NRYA 2JJ9A 2UXXB 1OWAA 2N9DA 2WM9A 2XHEB 1FMVA 3I0OA 3C98B 4I50E 2WAUA 4HE8A 4X1KE 4N78D 4EYUA 4EYYR 3FBLA 4DMWA 4QWNB 4TN7B 3Q5XA 3AVRA 1UX5A 2LM9A 5LYJE 3DTOA 4KP3C 2KNDA 4TZ4C 3ZMUB 2L3LA 2A2FX 2XAFB 3CX6B 3L3PA 2CXDA 2LHNA 3HKEE 3NBXX 5DJQC 1HFAA 4FJOA 3N2OA 4H9PC 4HEAA 4ZI2D 5L3DB 3L09A 4QHOA 3LBXA 4I55E 4QX7B 5LA6E 1B7TA 4PK5A 4AQFA 5DQWA 4B6XA 2ACXA 3BQIA 3PURA 5HWYA 2A72A 4CI1B 2L9QA 3RC8A 1WR6A 1OXZA 1U4QA 5HWXA 2XAQB 1HG5A 3SRZA 4UXNB 3AA7B 4BJNA 4BAYB 2VB6A 2ZM2A 4O4LE 1BR0A 4PJNA 4OYKA 2ES0A 2LEHA 2XASB 1D1BA 1S94A 5JH7E 4KMCA 3V5SA 4O4JE 5ADXL 5L3GB 4OK0A 2RA1A 3E22E 1EZ3A 3AA6B 2BDEA 2PG8A 4UVCB 3CMLA 4PK4A 1MIWA 3DP7A 5JDFA 4PNIA 2KZ7B 2X9WA 4ZS3A 2X51A 2WSSV 4WBNE 3ANWB 1LVFA 1US7B 2P9BA 4AKIA 4YJ3E 3R6NA 1ZV4X 3LG7A 4J2CA 5LBQB 1U5PA 1D0ZA 2CXFA 2LHRA 3KV9A 3RRWA 1ZKEA 1D1AA 1WLXA 2GK9A 2E8IA 1YKHB 3M65A 5LGTB 3PU3A 4CI3B 2WMOA 3WAJA 2HPJA 3KDSE 5JR9A 3F57A 3WAKA 1LVKA 4EZHA 3ZN1B 3J9X1 3ZC0A 3H37A 2NWBA 3TKLB 3LFMA 3LJCA 2KWHA 4EXTA 1T98A 4ZI7E 2VASA 5EK3A 2B1EA 1IAPA 1BR4A 3RYFE 3P7IA 4PJMA 4PW8A 2NP9A 4UIGA 1MMGA 4UV9B 1HF8A 2K24A 3K3QC 4ZI3C 3SOLA 2CMRA 5L3EB 2V7IA 3ETUA 1Y64B 2IC6A 5JVDE 2QA7A 4CQIA 3E0ZA 3N2GE 1UX4A 5LP6E 1MIVA 2CXLA 3Q9DA 3MKDA 5EK4A 5J1GA 5KDMC 4EB6E 3C4ZA 3CQCB 2XQYA 1G73A 3KINB 5H6RB 4QXCB 4XBFB 1BR1A 2W0GA 3GWHA 2CLYC 2NTYA 4GYSA 5FY1A 2PJQA 3RYCE 2A3DA 4TX5A 5CB4E 1MIYA 2E9XD 5LOVE 4O8SA 5GONE 5JDHA 3BQKA 5LHHB 5L3FB 1AJ3A 2NW9A 4PFPA 2EHOC 2K48A 4I43B 5BMVE 2XTLA 4IDZA 5A1LA 2V7LA 5KMGP 1UCUA 1O3XA 2ZLYA 5JDQA 2NW8A 4BA9A 4YHJA 4YFSA 3CKDA 4IHJE 3ZYKA 4HFVA 1LKXA 4CXYA 4CZZB 3BQLA 2LSIA 4X20E 3UTKA 4H63H 2VK9A 5LGUB 4O2BE 3VU7H 3KV5A 1FIOA 2LSYA 2OA5A 2Q9QC 3LK42 2ODUA 2SPCA 1D1CA 4UF0A 3KV4A 3HKCE 5L2LA 2PBIA 2DWGA 4ILUA 5JR9C 4AKGA 2JPFA 3NRXA 3C64A 4IE4A 3ZJ1A 3CX8B 4DO0A 5FY7A 5LBMA 4AKHA 1HX8A 2E9XB 5HYAA 4TUYE 3C4WA 3MACA 2ODVA 1HG2A 2V7JA 3P8CD 2LT3A 3AA0B 2IAKA 3DJBA 3OYZA 4GK5E 1E1HB 1HCIA 2LOSA 1V9DA 2KMFA 4MBQA 3SS1A 3PUSA 2MYSA 1G8XA 1BR2A 3JC6D 4IGUA 4O4HE 2LJLA 2X0LB 4C91A 1QSDA 4ISTA 4ZS2A 2DWKA 3A5XA 2X9HA 2X66A 4YJ2E 2W62A 2EHOA 3NZQA 1HTJF 2D0UA 3KVAA 4V1Av 4OYJA 3EVYA 3MJXA 5EK2A 3EDUA 4MALA 4EZ4A 3IBPA 5AFUL 4ISSA 3HKBE 2HPLA 5LHGB 4U72A 2VKJA 5J2TE 1NAFA 1HS7A 1QUUA 1Z0PA 2C5JA 3QUJA 2LSGA 4H9OC 3ZPOA 4FI5A 3F2EA 3RYHE 5KX5E 1MMDA 2NTXA 3CX7B 4C90A 3ZMZB 4P0BA 5JRCA 1KK7A 4H9SE 2VKHA 2Q9QA 1D0YA 3PTRB 2YEVC 5LJMA 3EUHA 4GK0E 4AQGA 2V7KA 1D0XA 4HN9A 3ZCJA 2BVMA 3FXEB 4DBRA 3HL6A 5JDLA 4H9RC 3ZMSB 4ZOLE 1X79A 4E7ZA 1KNZA 2V1DB 5FXVA 2JMHA 4U74A 3LK2B 3UFEA 3F31A 4NUUA 5FP3A 2N2NA 3I1AA 2YK0A 3UUMA 2VWAA 3RRCA 4PJLA 4ZI2C 5FXXA 2BVLA 3FHNA 3LBXB 2DI4A 2IW5B 4BJMA 3RYIE 1S35A 3K8PC 3CWZB 3AAAB 2VL8A 4IE6A 3PDYA 3OBVE 3FBZA 3I0QA 5JDGA 2JQQA 3O1HA 2CCQA 2XUEA 3C4XA 3RPUA 3U78A 3HKDE 3O1JA 4X1IE 4DVDA 3MXZA 3ZCIA 2CLYB 2ZM8A 3PUAA 2Z6EA 3O4XE 5IHYA 3OKQA 4P0AA 3B13A 3FB2A 3B57A 3ONXA 2K5BB 3SWHA 2W61A 3NZPA 3UT5E 3BK9A 3N9QA 3PUQA 2MOZA 2PFVA 5HXCA 3IHRA 1WRDA 1VRBA 2K9AA 3N9MA 4OFZA 4OHFA 2UXNB 3T8OA 3VHLA 2HH7A 4MFRA 3N9OA 4NUVA 3UUNA 4AXPA 3CVRA 2JRKA 2VKOA 5C8YE 3AAIA 4MLKA 4KUMB 4Z8XA 3N2KE 2LSKA 2MBGA 2L8KA 2W63A 2RP4A 1SHZC 5LHIB 4UVAB 3Q2MA 3RH3A 1MNEA 1YW0A 2DLRA 2D0TA 3GA8A 2KWIB 5JRCB 4EAHA 4HGAA 2N1GA 3W15B 5LJNA 3ANWA 5FYMA 1MMAA 2YINA 3O9XA 4AKRB 2C5IT 4IE0A 4AKLA 5JR9B 2ZM0A 2Y8DA 2C0SA 2D5UA 3KBUA 2WBLA 5CA0E 3K3NA 3I9WA 3VKHA 2X9XA 4X1YE 2CE7A 2NW7A 3PE0A 1VOMA 4JLEA 5FXWA 4CXXA 3N9PA 1MMNA 4PAGA 1LRZA 4IE5A 5LG4A 5LNKA 5HXSA 3AVSA 3Q5WA 1IJ5A 2Y6XA 4WBOA 3ZYMA 3C50A 4HTEA 5F3JA 3UULA 5E0OA 2XAGB 3I9YA 2DNXA 1YKEB 3QK6A 2NOXA 3H3AA 3PUGA 3U3IA 1CUNA 3KBTA 2IC9A 2DCFA 3AAEB 5FXZA 5JDNA 3RX6A 3OYXA 5DQVA 2ZMAA 4O4IE 5DABA 4HKAA 3UUXB 3HR0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PE0 A;  1OWA A;  1QUU A;  3EDV A;  2ODV A;  3UUL A;  1U4Q A;  3F31 A;  3UUM A;  1HCI A;  3FB2 A;  1U5P A;  1CUN A;  3LBX B;  1AJ3 A;  2ODU A;  2SPC A;  1S35 A;  1WLX A;  3LBX A;  3UUN A; 
#chains in the Genus database with same CATH topology
 5HXE A;  3TLW A;  4MHC A;  1H7C A;  4AIU A;  2BZB A;  2M6B A;  2C5K T;  3GMI A;  2W66 A;  3AA1 B;  4H9N C;  4YSY A;  5FNV E;  2FJB A;  3IA3 A;  2V7M A;  2D2S A;  3ZT6 A;  5LCY A;  3KFW X;  3AEG A;  4B3T T;  4KX6 A;  3IF8 B;  5JDM A;  3CQX C;  4PJJ A;  4DV1 T;  1MND A;  2KIN B;  5FVL A;  3KVB A;  2YU1 A;  4UF0 B;  2BKN A;  3J7Y q;  4QH1 A;  3PJA A;  4ADZ A;  2W00 A;  3KV6 A;  3O1I A;  3D0T A;  4QX8 B;  2W4X A;  4EIW A;  2G0U A;  1FMW A;  3QC9 A;  4LFA T;  3ZMV B;  4M1P A;  3ZJ2 A;  3MK7 C;  3JAE A;  5F8P A;  1J5E T;  3PU8 A;  3ABV A;  2WDV A;  3CQG B;  3RIF A;  3WI3 A;  1QLB A;  5JRE A;  1UGO A;  2WWU A;  1R8I A;  4XAX B;  3VR8 A;  4X5T A;  1YD8 G;  3M3Z B;  2BG9 C;  4K0K T;  3AXJ A;  1SE7 A;  3ZN0 B;  3GN5 B;  2JJ9 A;  2UXX B;  1OWA A;  2N9D A;  4WYV A;  3PUV F;  3PJA J;  5IWA T;  2LLY A;  4QWN B;  4DMW A;  5LYJ E;  2LM9 A;  5BR8 T;  3FZK B;  5CGM A;  4WZX A;  2XAF B;  2CXD A;  2LHN A;  3NBX X;  4YT0 A;  1J5W A;  1HFA A;  4QHO A;  3LBX A;  4I55 E;  5AQL B;  5HEG A;  2QYW A;  1I6Z A;  2A72 A;  4CI1 B;  5HWX A;  1E2A A;  3SRZ A;  4UXN B;  4BAY B;  2ZM2 A;  2YKS A;  2XAS B;  1D1B A;  1S94 A;  3OTO T;  4O4J E;  5ADX L;  2RA1 A;  2PG8 A;  2WDR A;  3CML A;  1MIW A;  1YQ4 A;  5LG3 A;  3ANW B;  4YJ3 E;  3LG7 A;  3KV9 A;  3RRW A;  1ZKE A;  4U7Y A;  3AED A;  2HPJ A;  3KDS E;  1LVK A;  4EZH A;  2NWB A;  3LJC A;  4ZI7 E;  5LMU T;  2NP9 A;  1MMG A;  4UV9 B;  3AEC A;  3SOL A;  2V5C A;  5L3E B;  2V7I A;  5JVD E;  4CQI A;  3N2G E;  2PTF A;  2UU9 T;  2XQY A;  4ZEY A;  2W0G A;  2NTY A;  5FY1 A;  4LF9 T;  4O8S A;  4HFC A;  4DV7 T;  4Z90 A;  2XQ4 A;  4IDP A;  1CHU A;  5KMG P;  5JDQ A;  2ZLY A;  4CXY A;  2LSI A;  2UUC T;  5LGU B;  3VU7 H;  3KV5 A;  4DR3 T;  2LSY A;  3OVU A;  3UUB A;  2ODU A;  1D1C A;  3KV4 A;  3T1Y T;  5L2L A;  4DV0 T;  2JPF A;  2LKG A;  3NRX A;  3C64 A;  4DO0 A;  2XQ5 A;  5LBM A;  4AKH A;  3PUZ F;  2ACZ A;  4YHH T;  5HYA A;  4TUY E;  2ODV A;  1HG2 A;  2V7J A;  3P8C D;  1HCI A;  3FZM B;  3SS1 A;  3K1S A;  1UK5 A;  4DUZ T;  2XQ6 A;  1YXR A;  4ZS2 A;  3NKZ A;  4V1A v;  4OYJ A;  4JYA T;  3EVY A;  5LB7 B;  5AFU L;  3L39 A;  2HPL A;  4U72 A;  2VKJ A;  1HS7 A;  1Z0P A;  3QUJ A;  5FL0 A;  3ZPO A;  5L47 A;  3CX7 B;  3AXJ B;  1KK7 A;  2VKH A;  2Q9Q A;  5AQI B;  3PTR B;  4A97 A;  4JI0 T;  3ZCJ A;  2D9D A;  3P4W A;  5IUX A;  3ZMS B;  1X79 A;  1KNZ A;  2JMH A;  3F31 A;  2N2N A;  2YK0 A;  3RRC A;  4DID B;  2BVL A;  3LBX B;  2BKO A;  2VL8 A;  2OV9 A;  4X62 T;  4ZZC A;  3AE1 A;  3I0Q A;  3O1H A;  2WZI A;  3O1J A;  3MXZ A;  3PUA A;  2Z6E A;  3O4X E;  3L8R A;  5IHY A;  3B13 A;  3B57 A;  3SWH A;  2W61 A;  3UT5 E;  1I94 T;  4LFB T;  4X65 T;  4OHF A;  4U2Z A;  3T8O A;  4NUV A;  2XQA A;  2JRK A;  2VKO A;  4YTM A;  4DV3 T;  3N2K E;  5CJ5 A;  2MBG A;  2L8K A;  5LHI B;  1SHZ C;  4JI8 T;  3GA8 A;  5LJN A;  2WQY A;  1MMA A;  2YIN A;  3O9X A;  4AKR B;  4CN6 A;  4IE0 A;  2UUB T;  4IDO A;  3RIU C;  5CA0 E;  2XPK A;  4HWC A;  3Q5E A;  3PE0 A;  5FXW A;  4CXX A;  5LG4 A;  3AVS A;  1IJ5 A;  4CN4 A;  3I9Y A;  2DNX A;  3QK6 A;  3PUG A;  3H3A A;  3OYX A;  5DQV A;  4LFC T;  2ZMA A;  4HKA A;  3UUX B;  4ZI3 D;  3MZK B;  1HNW T;  2I0M A;  1N32 T;  4L5G A;  1HNZ T;  2XAH B;  2WB5 A;  3IEE A;  4UEM A;  2VKD A;  3ZYL A;  5L4E A;  2YDR A;  2J1D G;  5FY0 A;  2BG9 A;  3ZMT B;  3ETV A;  4LF7 T;  3FZH B;  4ANJ A;  2E2A A;  2CA5 A;  2WU5 A;  3GN5 A;  4AI6 A;  2H7V C;  5ABH A;  3MA9 A;  2WY2 A;  3AE4 A;  1OED C;  2H89 A;  2BG9 E;  2CM0 A;  3EHZ A;  5EZY E;  2X9Y A;  3ZST A;  3N5L A;  4ASK A;  4QKN A;  2E9X A;  4EV6 A;  3NWI A;  4P09 A;  3K3O A;  2I59 A;  3AB3 B;  3RC3 A;  2KXP B;  1ZHC A;  4H9Q C;  4G63 A;  3ZEF B;  4TV9 E;  3N9N A;  3RQW A;  3ZT5 A;  2MTQ A;  2Q9Q B;  2CWY A;  3N9L A;  2XQ3 A;  2KLQ A;  4WNK A;  4UEL A;  5M4Y A;  2JMK A;  3RF1 A;  4L0R A;  2XAJ B;  4GIW A;  1XMQ T;  5JQG E;  2WAU A;  4HE8 A;  4N78 D;  4LMK A;  3FBL A;  3AVR A;  3P4P A;  3DTO A;  3RLF F;  4DR2 T;  2I6H A;  4TZ4 C;  2A2F X;  4H9P C;  4HEA A;  3L09 A;  2W67 A;  5LA6 E;  3CK6 A;  4AQF A;  3PUX F;  5AQQ B;  3BQI A;  3LDQ B;  2L9Q A;  2YDQ A;  3Q5D A;  2JQ9 A;  3RC8 A;  2VQF T;  1U4Q A;  4CN1 A;  1W9R A;  2XAQ B;  2VB6 A;  1BR0 A;  4O4L E;  2XSA A;  1WFD A;  5L3G B;  5AQR B;  1WR0 A;  3E22 E;  4UVC B;  4PK4 A;  1NEN A;  4ZS3 A;  2X9W A;  5HEO A;  2XZE A;  4J2C A;  2YDS A;  1D1A A;  4TNV A;  4CI3 B;  5ABG A;  3LSV A;  2WMO A;  5JTG A;  2ZM6 T;  3ZN1 B;  2FJA A;  2UXB T;  3TKL B;  3AE9 A;  1KNR A;  4TNW A;  2B1E A;  3VR9 A;  3AEA A;  2LKH A;  3RYF E;  3SFD A;  4PW8 A;  2LRL A;  5FL1 A;  4GKJ T;  4UIG A;  1HF8 A;  4ZI3 C;  3UFG A;  2M6I A;  1Y64 B;  4X64 T;  1MIV A;  3Q9D A;  5KDM C;  4DUY T;  1ZOY A;  2IIU A;  5CFB A;  2IHR 1;  2QVA A;  1G73 A;  3QB5 K;  4DV2 T;  4QXC B;  3UQ7 A;  2OLT A;  2PJQ A;  4TX5 A;  1MIY A;  4LF5 T;  2BG9 B;  4PFP A;  1T8B A;  2K48 A;  3JAF A;  4I43 B;  2XTL A;  5A1L A;  2V7L A;  3RKG A;  2XSB A;  1HR0 T;  4P1N A;  2MPK A;  4IT4 A;  4Q25 A;  1L0V A;  2VK9 A;  2OA5 A;  2RPA A;  2J4G A;  4YY3 T;  3RI5 A;  5JR9 C;  4AKG A;  5AQS B;  4U33 A;  4DR4 T;  1HX8 A;  2E9X B;  2UXC T;  4IDQ A;  1E1H B;  2VUR A;  2KMF A;  1IBM T;  4IGU A;  2LJL A;  1QSD A;  3A5X A;  2X9H A;  2X66 A;  2EHO A;  2WS3 A;  3KVA A;  3EDU A;  1XZY A;  2IML A;  4H9O C;  4Z91 A;  3T1H T;  5LMN T;  4QH5 A;  4ILA A;  1MMD A;  4C90 A;  3ZMZ B;  2WP9 A;  4P0B A;  4H9S E;  5LJM A;  4KHZ F;  4AQG A;  2V7K A;  3EAM A;  1D0X A;  2F4V T;  3UU8 A;  5FXV A;  4U74 A;  3UFE A;  1KFY A;  3AE7 A;  3UUM A;  2B76 A;  1XWM A;  4HWH A;  4PJL A;  3UU3 A;  5FXX A;  5L4H A;  2VQE T;  3RYI E;  1S35 A;  4IE6 A;  3AAA B;  4LF4 T;  3PDY A;  3OBV E;  5JDG A;  2CCQ A;  3C4X A;  4X1I E;  4NXN T;  4DVD A;  1XDP A;  2ZM8 A;  4P0A A;  3ONX A;  2WCA A;  2PFV A;  3IHR A;  2WWV A;  2HN1 A;  1T7S A;  4DR7 T;  3N9O A;  4TWF A;  3CVR A;  4Z8X A;  1VCT A;  4IRE A;  4AIS A;  2W63 A;  2RP4 A;  4UVA B;  2DLR A;  2HN2 A;  2XM1 A;  5JRC B;  4HGA A;  5FYM A;  2C5I T;  5KXJ A;  3FZL B;  2ZM0 A;  5AQF B;  3KBU A;  4NIQ A;  2FJD A;  2CE7 A;  2BKP A;  4JLE A;  3N9P A;  1MMN A;  4LMJ A;  4HFB A;  4TWD A;  5HXS A;  2Y6X A;  3ZYM A;  3UUL A;  2R6G F;  3A8Y C;  2CRB A;  3KBT A;  5FXZ A;  4O4I E;  5DAB A;  3HR0 A;  3RQU A;  2KT9 A;  5J2U E;  5AQG B;  4EOZ B;  3RGL A;  4JBW F;  1WYB A;  1KF6 A;  5FMN A;  4H63 V;  3HI2 A;  4YLH A;  2CPT A;  3EI0 A;  3ZLI A;  4L9I A;  1T72 A;  5HXR A;  2IUB A;  4JUY A;  3CPZ A;  4GOU A;  1IJ6 A;  5AQU B;  5AQK B;  3OJA A;  3NVO A;  3RKO A;  1WYC A;  1SA0 E;  2V6Y A;  4GYR A;  3S4U A;  2Q9Q D;  4A98 A;  5AQJ B;  5HAX A;  2K3W A;  5CA1 E;  4F6R C;  1XMO T;  5AQO B;  2Y48 B;  4ZHQ E;  4B3R T;  3VKG A;  5AQM B;  2V26 A;  2X0H A;  2EHO B;  3P4R A;  4IL9 A;  2X68 A;  4UR9 A;  5ETW A;  2H7O A;  1JNR A;  4HFH A;  4CXW A;  5HXH A;  1IZN B;  3ZT7 A;  3ESL A;  5H6Q B;  4IE7 A;  4DND A;  3PUY F;  2M67 A;  2MAW A;  3FXD B;  4CI2 B;  4HWI B;  4E7S A;  3V5U A;  5AQN B;  2LRK A;  1UUS A;  2LE8 A;  2XHE B;  3ONL C;  3C98 B;  4X1K E;  4EYU A;  5FKY A;  4EYY R;  2XQ7 A;  4TN7 B;  3AEE A;  4KP3 C;  2L3L A;  3CX6 B;  2VL0 A;  3HKE E;  4QX7 B;  3P4S A;  5DQW A;  2ACX A;  3PUR A;  3VRA A;  2XQ9 A;  3AA7 B;  4TWH A;  4PJN A;  4OYK A;  2LEH A;  4OK0 A;  1EZ3 A;  1N33 T;  2BDE A;  4GKK T;  3DP7 A;  1XNQ T;  4COF A;  2WSS V;  4WBN E;  3EAB A;  2P9B A;  4AKI A;  1ZV4 X;  2GK9 A;  2E8I A;  1YKH B;  5LGT B;  5JR9 A;  1GQE A;  3ZC0 A;  3H37 A;  3X1D A;  3LFM A;  3AEB A;  2KWH A;  1T98 A;  4X66 T;  5EK3 A;  4ZZB A;  1BR4 A;  4PJM A;  3JCF A;  2K24 A;  3K3Q C;  1W0B A;  2IC6 A;  2QA7 A;  5C3J A;  3E0Z A;  4ZXL A;  1UX4 A;  1SUM B;  4U3C A;  3ZSS A;  2CXL A;  5EK4 A;  3MKD A;  5J1G A;  4EB6 E;  1J1J A;  3KIN B;  1BR1 A;  3GWH A;  2CLY C;  1HX1 B;  4GYS A;  3RYC E;  2E9X D;  5LOV E;  2E5V A;  5GON E;  5JDH A;  5L3F B;  1W09 A;  1O3X A;  4QH4 A;  2NW8 A;  4BA9 A;  3CKD A;  5AQP B;  4IHJ E;  4ILC A;  3ZYK A;  4HFV A;  1LKX A;  4CZZ B;  2V6Y B;  4H63 H;  4DR1 T;  2Q9Q C;  4JI2 T;  1W0A A;  4IE4 A;  3ZJ1 A;  5FY7 A;  4DR6 T;  3C4W A;  3MAC A;  2LT3 A;  2IAK A;  3OYZ A;  2LOS A;  3UU5 A;  1V9D A;  1G8X A;  1BR2 A;  3JC6 D;  2X0L B;  4LML A;  4C91 A;  4IST A;  2W62 A;  1HTJ F;  5AQV B;  3MJX A;  5EK2 A;  4MAL A;  4EZ4 A;  1Z8U A;  3IBP A;  4ISS A;  3HKB E;  5HEJ A;  2LSG A;  4FI5 A;  3F2E A;  2NTX A;  5JRC A;  2YEV C;  4JI6 T;  2J62 A;  4HN9 A;  2BVM A;  3FXE B;  5JDL A;  4U31 A;  2DL1 A;  4ZOL E;  2V5D A;  2CBJ A;  4NUU A;  2JQK A;  3FHN A;  2IW5 B;  4BJM A;  3K8P C;  3CWZ B;  3FBZ A;  2JQQ A;  5HEU A;  3RPU A;  3U78 A;  3HKD E;  2FBW A;  5C2T A;  3ZCI A;  2YN6 A;  3FB2 A;  2K5B B;  3NZP A;  3PUQ A;  3UU4 A;  2MOZ A;  3A7M A;  4DR5 T;  5HXC A;  4OFZ A;  2CBI A;  2HH7 A;  4AXP A;  3AAI A;  3TLU A;  2XM2 A;  1XDO A;  1M7K A;  1MNE A;  2KWI B;  5HEH A;  4EAH A;  2N1G A;  3W15 B;  2CHO A;  5JR9 B;  2D5U A;  2WBL A;  3K3N A;  3I9W A;  4DV6 T;  3VKH A;  2AE9 A;  3ONJ A;  4PAG A;  1LRZ A;  3Q5W A;  4WBO A;  2W2U A;  3QB5 A;  5F3J A;  2XAG B;  4ILB A;  2NOX A;  3U3I A;  2DCF A;  3AAE B;  5JDN A;  3RX6 A;  4B3M T;  5LXT E;  4G2A A;  5TAO A;  4PK6 A;  4WW0 A;  4IIJ E;  2VVS A;  2XQ8 A;  2E9X C;  3EDV A;  2LSJ A;  2QGS A;  4K0U A;  2IDO B;  1M62 A;  2LOP A;  2HHH T;  3AE2 A;  2UUA T;  2J47 A;  2YOE A;  3ZC1 A;  4JEH B;  2EHO D;  3RIU A;  3HA4 A;  4I4T E;  4O2A E;  4YSZ A;  1ZEE A;  3C51 A;  2E5L T;  2WMN A;  2CEA A;  2V8S V;  5ABE A;  4QXH B;  4UVB B;  1WCR A;  4PFO A;  3R84 B;  4HFI A;  3P50 A;  5L3B B;  4NPP A;  4ERR A;  2JIW A;  3QOF A;  2CWO A;  5LGN B;  3E08 A;  4XZC A;  2YU2 A;  4IL4 A;  5L3C B;  4DBQ A;  1NWM X;  2WU2 A;  3JC6 C;  2LM2 A;  2H3R A;  1HNX T;  1FEW A;  3G06 A;  1IBL T;  4HWF A;  3AEF A;  4AQF C;  2JQH A;  2X67 A;  3UU6 A;  4QXB B;  2DHR A;  3LK3 B;  4DMV A;  1N36 T;  4TV8 E;  2QRX A;  4A56 A;  4KBM B;  2UXD T;  2A9U A;  1XNR T;  4JEU B;  4UV8 B;  5IYZ E;  4JI1 T;  3RHW A;  1OED A;  3NRY A;  2WM9 A;  1ZP0 A;  1E7P A;  1FMV A;  3I0O A;  4I50 E;  1KNP A;  3Q5X A;  1UX5 A;  4HWD A;  2KND A;  3ZMU B;  3L3P A;  3TLS A;  5DJQ C;  4FJO A;  3N2O A;  4ZI2 D;  5L3D B;  2NR4 A;  2BS2 A;  1OED E;  1B7T A;  4PK5 A;  3PV0 F;  3JAD A;  1YQ3 A;  4B6X A;  5HWY A;  1IBK T;  1WR6 A;  1OXZ A;  1HG5 A;  4BJN A;  2ES0 A;  5JH7 E;  4KMC A;  3V5S A;  4I0U A;  1UUR A;  3AA6 B;  3AE5 A;  5JDF A;  1DU2 A;  4PNI A;  5AQT B;  2KZ7 B;  2X51 A;  2AXD S;  1LVF A;  1US7 B;  3R6N A;  5LBQ B;  5ABF A;  1U5P A;  4LF8 T;  1D0Z A;  2CXF A;  2LHR A;  5HCJ A;  3UQ4 A;  2FUP A;  1WLX A;  3M65 A;  3PU3 A;  3WAJ A;  3F57 A;  3WAK A;  4YSX A;  3J9X 1;  1X9B A;  4EXT A;  4DV4 T;  2VAS A;  1IAP A;  4U7I A;  3P7I A;  2CMR A;  5FVK A;  3ETU A;  3QNU A;  4JI3 T;  5LP6 E;  3C4Z A;  3CQC B;  5H6R B;  4XBF B;  4YXD A;  3B5M A;  5HCM A;  2A3D A;  5CB4 E;  4B3S T;  3BQK A;  5LHH B;  1AJ3 A;  2NW9 A;  2EHO C;  5BMV E;  4IDZ A;  4EED A;  1UCU A;  4YHJ A;  4IDN A;  4YFS A;  3TLT A;  3BQL A;  4X20 E;  3UTK A;  4LF6 T;  2KSR A;  2BS3 A;  4O2B E;  2X0Y A;  1FIO A;  2V6X A;  3LK4 2;  2SPC A;  4UF0 A;  3HKC E;  2PBI A;  2DWG A;  4ILU A;  4YTN A;  1FJG T;  2FJE A;  3CX8 B;  2WDQ A;  4EGW A;  3AA0 B;  3DJB A;  3TLV A;  4GK5 E;  4MBQ A;  3PUS A;  2MYS A;  4O4H E;  4KI0 F;  4DV5 T;  2DWK A;  3OPC A;  4YJ2 E;  3NZQ A;  2D0U A;  5LHG B;  5J2T E;  1NAF A;  1QUU A;  2C5J A;  4JI7 T;  3PUW F;  4HFE A;  3CIR A;  4A5X A;  3RYH E;  5KX5 E;  1N34 T;  3RIA A;  1OED B;  1D0Y A;  3EUH A;  4GK0 E;  1NEK A;  4U2Y A;  2BBH A;  4DBR A;  3HL6 A;  4H9R C;  4E7Z A;  2V1D B;  2WZH A;  3LK2 B;  5AQH B;  1KEY A;  4EEB A;  5FP3 A;  4JI5 T;  2H88 A;  3I1A A;  2VWA A;  4ZI2 C;  5J0Z A;  2DI4 A;  3FZF B;  2XUE A;  4AQY T;  1Y01 A;  4F8H A;  2CLY B;  3VRB A;  3OKQ A;  3BK9 A;  3N9Q A;  2BBJ A;  1WRD A;  4OX9 T;  1VRB A;  2K9A A;  3N9M A;  2UXN B;  3VHL A;  2XY8 B;  4JV5 T;  3UUN A;  4MFR A;  3AE8 A;  5C8Y E;  4MLK A;  4KUM B;  4JI4 T;  2LSK A;  5ABF B;  3Q2M A;  3RH3 A;  2XJ7 A;  1YW0 A;  2D0T A;  5F5W A;  3ZKR A;  3ANW A;  4AKL A;  2C0S A;  2Y8D A;  2X9X A;  4X1Y E;  4HFD A;  2NW7 A;  3H3M A;  1VOM A;  4KHP T;  3P4Q A;  4IE5 A;  3AE6 A;  5LNK A;  3C50 A;  2VVN A;  4HTE A;  5E0O A;  1YKE B;  1VCS A;  1CUN A;  2IC9 A;  4NXM T;  3AE3 A;  2BS4 A;  1JNZ A;  2CHN A;  4YTP A;  3SFE A; 
#chains in the Genus database with same CATH homology
 3MZK B;  5LXT E;  4G2A A;  5TAO A;  4PK6 A;  2KT9 A;  4L5G A;  5J2U E;  4WW0 A;  2XAH B;  4EOZ B;  4IIJ E;  4ZI3 D;  5HXE A;  2E9X C;  3EDV A;  1WYB A;  4MHC A;  1H7C A;  3IEE A;  2BZB A;  2LSJ A;  4UEM A;  2C5K T;  2QGS A;  4K0U A;  5FMN A;  3GMI A;  2VKD A;  4H63 V;  3HI2 A;  3ZYL A;  4YLH A;  2J1D G;  2LOP A;  5FY0 A;  3AA1 B;  4H9N C;  3ZLI A;  4L9I A;  3ETV A;  5FNV E;  3ZC1 A;  3ZMT B;  5HXR A;  4JEH B;  2EHO D;  2V7M A;  2D2S A;  3HA4 A;  4I4T E;  4O2A E;  5LCY A;  3KFW X;  4ANJ A;  1ZEE A;  3C51 A;  2WMN A;  4JUY A;  3IF8 B;  2CEA A;  3CQX C;  4PJJ A;  5JDM A;  1MND A;  3CPZ A;  4GOU A;  1IJ6 A;  2CA5 A;  2KIN B;  3GN5 A;  4AI6 A;  2H7V C;  3OJA A;  4QXH B;  4UVB B;  3MA9 A;  3KVB A;  4PFO A;  3R84 B;  2YU1 A;  4UF0 B;  3RKO A;  1WYC A;  1SA0 E;  5L3B B;  4ERR A;  4GYR A;  3J7Y q;  4ADZ A;  3S4U A;  2W00 A;  3KV6 A;  3O1I A;  2Q9Q D;  3D0T A;  4QX8 B;  2CWO A;  2CM0 A;  5EZY E;  4EIW A;  5LGN B;  2G0U A;  1FMW A;  2X9Y A;  3QC9 A;  3E08 A;  3ZMV B;  5HAX A;  4XZC A;  4M1P A;  4F6R C;  5CA1 E;  2YU2 A;  3ZJ2 A;  5L3C B;  2Y48 B;  3MK7 C;  3N5L A;  4ASK A;  5F8P A;  4DBQ A;  4QKN A;  4ZHQ E;  2E9X A;  1NWM X;  3JC6 C;  2H3R A;  3PU8 A;  3VKG A;  4P09 A;  3K3O A;  1FEW A;  2V26 A;  2EHO B;  2I59 A;  3CQG B;  4AQF C;  2X68 A;  5ETW A;  3AB3 B;  3RC3 A;  2H7O A;  2KXP B;  1ZHC A;  4CXW A;  2X67 A;  3WI3 A;  5HXH A;  4QXB B;  2DHR A;  3LK3 B;  4DMV A;  5JRE A;  2WWU A;  1IZN B;  4H9Q C;  3ESL A;  4G63 A;  4TV8 E;  4IE7 A;  5H6Q B;  3ZEF B;  4A56 A;  4DND A;  4KBM B;  2M67 A;  4TV9 E;  4XAX B;  3N9N A;  1YD8 G;  3FXD B;  4CI2 B;  2MTQ A;  2Q9Q B;  4JEU B;  2CWY A;  4UV8 B;  3N9L A;  2KLQ A;  4WNK A;  4UEL A;  5M4Y A;  4E7S A;  5IYZ E;  2JMK A;  3V5U A;  4L0R A;  2XAJ B;  4GIW A;  3ZN0 B;  3GN5 B;  2LE8 A;  5JQG E;  3NRY A;  2JJ9 A;  2UXX B;  1OWA A;  2N9D A;  2WM9 A;  2XHE B;  1FMV A;  3I0O A;  3C98 B;  4I50 E;  2WAU A;  4HE8 A;  4X1K E;  4N78 D;  4EYU A;  4EYY R;  3FBL A;  4DMW A;  4QWN B;  4TN7 B;  3Q5X A;  3AVR A;  1UX5 A;  2LM9 A;  5LYJ E;  3DTO A;  4KP3 C;  2KND A;  4TZ4 C;  3ZMU B;  2L3L A;  2A2F X;  2XAF B;  3CX6 B;  3L3P A;  2CXD A;  2LHN A;  3HKE E;  3NBX X;  5DJQ C;  1HFA A;  4FJO A;  3N2O A;  4H9P C;  4HEA A;  4ZI2 D;  5L3D B;  3L09 A;  4QHO A;  3LBX A;  4I55 E;  4QX7 B;  5LA6 E;  1B7T A;  4PK5 A;  4AQF A;  5DQW A;  4B6X A;  2ACX A;  3BQI A;  3PUR A;  5HWY A;  2A72 A;  4CI1 B;  2L9Q A;  3RC8 A;  1WR6 A;  1OXZ A;  1U4Q A;  5HWX A;  2XAQ B;  1HG5 A;  3SRZ A;  4UXN B;  3AA7 B;  4BJN A;  4BAY B;  2VB6 A;  2ZM2 A;  4O4L E;  1BR0 A;  4PJN A;  4OYK A;  2ES0 A;  2LEH A;  2XAS B;  1D1B A;  1S94 A;  5JH7 E;  4KMC A;  3V5S A;  4O4J E;  5ADX L;  5L3G B;  4OK0 A;  2RA1 A;  3E22 E;  1EZ3 A;  3AA6 B;  2BDE A;  2PG8 A;  4UVC B;  3CML A;  4PK4 A;  1MIW A;  3DP7 A;  5JDF A;  4PNI A;  2KZ7 B;  2X9W A;  4ZS3 A;  2X51 A;  2WSS V;  4WBN E;  3ANW B;  1LVF A;  1US7 B;  2P9B A;  4AKI A;  4YJ3 E;  3R6N A;  1ZV4 X;  3LG7 A;  4J2C A;  5LBQ B;  1U5P A;  1D0Z A;  2CXF A;  2LHR A;  3KV9 A;  3RRW A;  1ZKE A;  1D1A A;  1WLX A;  2GK9 A;  2E8I A;  1YKH B;  3M65 A;  5LGT B;  3PU3 A;  4CI3 B;  2WMO A;  3WAJ A;  2HPJ A;  3KDS E;  5JR9 A;  3F57 A;  3WAK A;  1LVK A;  4EZH A;  3ZN1 B;  3J9X 1;  3ZC0 A;  3H37 A;  2NWB A;  3TKL B;  3LFM A;  3LJC A;  2KWH A;  4EXT A;  1T98 A;  4ZI7 E;  2VAS A;  5EK3 A;  2B1E A;  1IAP A;  1BR4 A;  3RYF E;  3P7I A;  4PJM A;  4PW8 A;  2NP9 A;  4UIG A;  1MMG A;  4UV9 B;  1HF8 A;  2K24 A;  3K3Q C;  4ZI3 C;  3SOL A;  2CMR A;  5L3E B;  2V7I A;  3ETU A;  1Y64 B;  2IC6 A;  5JVD E;  2QA7 A;  4CQI A;  3E0Z A;  3N2G E;  1UX4 A;  5LP6 E;  1MIV A;  2CXL A;  3Q9D A;  3MKD A;  5EK4 A;  5J1G A;  5KDM C;  4EB6 E;  3C4Z A;  3CQC B;  2XQY A;  1G73 A;  3KIN B;  5H6R B;  4QXC B;  4XBF B;  1BR1 A;  2W0G A;  3GWH A;  2CLY C;  2NTY A;  4GYS A;  5FY1 A;  2PJQ A;  3RYC E;  2A3D A;  4TX5 A;  5CB4 E;  1MIY A;  2E9X D;  5LOV E;  4O8S A;  5GON E;  5JDH A;  3BQK A;  5LHH B;  5L3F B;  1AJ3 A;  2NW9 A;  4PFP A;  2EHO C;  2K48 A;  4I43 B;  5BMV E;  2XTL A;  4IDZ A;  5A1L A;  2V7L A;  5KMG P;  1UCU A;  1O3X A;  2ZLY A;  5JDQ A;  2NW8 A;  4BA9 A;  4YHJ A;  4YFS A;  3CKD A;  4IHJ E;  3ZYK A;  4HFV A;  1LKX A;  4CXY A;  4CZZ B;  3BQL A;  2LSI A;  4X20 E;  3UTK A;  4H63 H;  2VK9 A;  5LGU B;  4O2B E;  3VU7 H;  3KV5 A;  1FIO A;  2LSY A;  2OA5 A;  2Q9Q C;  3LK4 2;  2ODU A;  2SPC A;  1D1C A;  4UF0 A;  3KV4 A;  3HKC E;  5L2L A;  2PBI A;  2DWG A;  4ILU A;  5JR9 C;  4AKG A;  2JPF A;  3NRX A;  3C64 A;  4IE4 A;  3ZJ1 A;  3CX8 B;  4DO0 A;  5FY7 A;  5LBM A;  4AKH A;  1HX8 A;  2E9X B;  5HYA A;  4TUY E;  3C4W A;  3MAC A;  2ODV A;  1HG2 A;  2V7J A;  3P8C D;  2LT3 A;  3AA0 B;  2IAK A;  3DJB A;  3OYZ A;  4GK5 E;  1E1H B;  1HCI A;  2LOS A;  1V9D A;  2KMF A;  4MBQ A;  3SS1 A;  3PUS A;  2MYS A;  1G8X A;  1BR2 A;  3JC6 D;  4IGU A;  4O4H E;  2LJL A;  2X0L B;  4C91 A;  1QSD A;  4IST A;  4ZS2 A;  2DWK A;  3A5X A;  2X9H A;  2X66 A;  4YJ2 E;  2W62 A;  2EHO A;  3NZQ A;  1HTJ F;  2D0U A;  3KVA A;  4V1A v;  4OYJ A;  3EVY A;  3MJX A;  5EK2 A;  3EDU A;  4MAL A;  4EZ4 A;  3IBP A;  5AFU L;  4ISS A;  3HKB E;  2HPL A;  5LHG B;  4U72 A;  2VKJ A;  5J2T E;  1NAF A;  1HS7 A;  1QUU A;  1Z0P A;  2C5J A;  3QUJ A;  2LSG A;  4H9O C;  3ZPO A;  4FI5 A;  3F2E A;  3RYH E;  5KX5 E;  1MMD A;  2NTX A;  3CX7 B;  4C90 A;  3ZMZ B;  4P0B A;  5JRC A;  1KK7 A;  4H9S E;  2VKH A;  2Q9Q A;  1D0Y A;  3PTR B;  2YEV C;  5LJM A;  3EUH A;  4GK0 E;  4AQG A;  2V7K A;  1D0X A;  4HN9 A;  3ZCJ A;  2BVM A;  3FXE B;  4DBR A;  3HL6 A;  5JDL A;  4H9R C;  3ZMS B;  4ZOL E;  1X79 A;  4E7Z A;  1KNZ A;  2V1D B;  5FXV A;  2JMH A;  4U74 A;  3LK2 B;  3UFE A;  3F31 A;  4NUU A;  5FP3 A;  2N2N A;  3I1A A;  2YK0 A;  3UUM A;  2VWA A;  3RRC A;  4PJL A;  4ZI2 C;  5FXX A;  2BVL A;  3FHN A;  3LBX B;  2DI4 A;  2IW5 B;  4BJM A;  3RYI E;  1S35 A;  3K8P C;  3CWZ B;  3AAA B;  2VL8 A;  4IE6 A;  3PDY A;  3OBV E;  3FBZ A;  3I0Q A;  5JDG A;  2JQQ A;  3O1H A;  2CCQ A;  2XUE A;  3C4X A;  3RPU A;  3U78 A;  3HKD E;  3O1J A;  4X1I E;  4DVD A;  3MXZ A;  3ZCI A;  2CLY B;  2ZM8 A;  3PUA A;  2Z6E A;  3O4X E;  5IHY A;  3OKQ A;  4P0A A;  3B13 A;  3FB2 A;  3B57 A;  3ONX A;  2K5B B;  3SWH A;  2W61 A;  3NZP A;  3UT5 E;  3BK9 A;  3N9Q A;  3PUQ A;  2MOZ A;  2PFV A;  5HXC A;  3IHR A;  1WRD A;  1VRB A;  2K9A A;  3N9M A;  4OFZ A;  4OHF A;  2UXN B;  3T8O A;  3VHL A;  2HH7 A;  4MFR A;  3N9O A;  4NUV A;  3UUN A;  4AXP A;  3CVR A;  2JRK A;  2VKO A;  5C8Y E;  3AAI A;  4MLK A;  4KUM B;  4Z8X A;  3N2K E;  2LSK A;  2MBG A;  2L8K A;  2W63 A;  2RP4 A;  1SHZ C;  5LHI B;  4UVA B;  3Q2M A;  3RH3 A;  1MNE A;  1YW0 A;  2DLR A;  2D0T A;  3GA8 A;  2KWI B;  5JRC B;  4EAH A;  4HGA A;  2N1G A;  3W15 B;  5LJN A;  3ANW A;  5FYM A;  1MMA A;  2YIN A;  3O9X A;  4AKR B;  2C5I T;  4IE0 A;  4AKL A;  5JR9 B;  2ZM0 A;  2Y8D A;  2C0S A;  2D5U A;  3KBU A;  2WBL A;  5CA0 E;  3K3N A;  3I9W A;  3VKH A;  2X9X A;  4X1Y E;  2CE7 A;  2NW7 A;  3PE0 A;  1VOM A;  4JLE A;  5FXW A;  4CXX A;  3N9P A;  1MMN A;  4PAG A;  1LRZ A;  4IE5 A;  5LG4 A;  5LNK A;  5HXS A;  3AVS A;  3Q5W A;  1IJ5 A;  2Y6X A;  4WBO A;  3ZYM A;  3C50 A;  4HTE A;  5F3J A;  3UUL A;  5E0O A;  2XAG B;  3I9Y A;  2DNX A;  1YKE B;  3QK6 A;  2NOX A;  3H3A A;  3PUG A;  3U3I A;  1CUN A;  3KBT A;  2IC9 A;  2DCF A;  3AAE B;  5FXZ A;  5JDN A;  3RX6 A;  3OYX A;  5DQV A;  2ZMA A;  4O4I E;  5DAB A;  4HKA A;  3UUX B;  3HR0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...