4HWCA

Structure of atbag1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
86
structure length
86
Chain Sequence
b'SASKAISDISLEVDRLGGRVSAFEMVTKKGGKIAEKDLVTVIELLMNELIKLDAIVAEGDVKLQRKMQVKRVQNYVETLDALKVKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BAG family molecular chaperone regulator 1
publication title Structural insight into plant programmed cell death mediated by BAG proteins in Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Apoptosis
total genus 37
structure length 86
sequence length 86
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 4hwcA00
3M3ZB 5AQIB 5AQSB 5AQTB 1M62A 1UK5A 1HX1B 3FZHB 4HWHA 5AQLB 3FZKB 1T7SA 3FZMB 5AQMB 5AQKB 4HWFA 5AQQB 5AQRB 4HWCA 5AQJB 5AQNB 5AQHB 5AQVB 3LDQB 5AQGB 1UGOA 2D9DA 3A8YC 4HWIB 4HWDA 3FZLB 5AQPB 5AQOB 1M7KA 3FZFB 5AQFB 1I6ZA 5AQUB
chains in the Genus database with same CATH superfamily
3UUXB 1Y01A 3EHZA 2V7LA 5AQLB 2X9HA 2VURA 3AE5A 5FY0A 2XAQB 2XAJB 5AQVB 2KT9A 3PUXF 1XMQT 1EZ3A 4YT0A 3F31A 2WCAA 3ZMVB 5AQUB 2CEAA 2FJEA 4LF6T 5JTGA 3UFEA 2XQ7A 2B1EA 4AXPA 1HG5A 4PW8A 2W4XA 3PUAA 2BG9B 2LM9A 3KVAA 2YN6A 2E2AA 3RH3A 4GYSA 4EEBA 3N2GE 4PK6A 2YKSA 4IE6A 4QXCB 1X79A 4F6RC 2NTYA 2HPJA 5HEOA 5AQKB 1V9DA 4YHJA 2NW7A 4U7YA 5EZYE 4DR1T 1MNEA 3RRCA 2IAKA 4DBRA 4GKJT 3H37A 3O4XE 2V7IA 2UXXB 2WDRA 2WMNA 2EHOC 5ABFA 4DV3T 5HEHA 3OPCA 5JDMA 2J47A 4DR4T 2ODVA 5KX5E 3RGLA 4H9QC 3C98B 5HWXA 2NOXA 4LF9T 4TWDA 2V7KA 5L3EB 3C51A 1D0ZA 4AKIA 5FXZA 3N2OA 2A9UA 3RIFA 2W0GA 3N2KE 2Q9QA 1NENA 2CE7A 3I1AA 4U7IA 3P8CD 4M1PA 5KMGP 2FJDA 1XZYA 4LF7T 2C5KT 4L5GA 4JI8T 4KX6A 4G2AA 1WR6A 5C2TA 4ZI2D 1Y64B 2ZM8A 3B13A 4PNIA 4YLHA 3ZMUB 5LJMA 4OFZA 5M4YA 5IYZE 4ZXLA 3EABA 3PTRB 1LVFA 2V26A 2XQAA 3OKQA 1KNRA 3ZPOA 3CKDA 3FBZA 2CWYA 3NKZA 3J7Yq 5JDGA 3O1IA 4KMCA 1SA0E 5FVLA 5H6QB 2WZIA 4WYVA 4PFOA 2HHHT 5E0OA 3NZPA 2I59A 4HFIA 5LXTE 3DTOA 2WU2A 1D0XA 4CN6A 2SPCA 3P4PA 3TLWA 1WRDA 3O1JA 1IJ5A 3EI0A 4B6XA 1D1CA 3PE0A 4ZS3A 4AQYT 2CHNA 4U74A 4OK0A 2E9XC 4CXYA 5FKYA 3B57A 2DWKA 5ADXL 2CRBA 5CA1E 2HH7A 4HFBA 4LFAT 5ABGA 1NWMX 2JIWA 4UVCB 1KNZA 1BR4A 3G06A 2EHOA 2QVAA 1KF6A 4TNVA 3GN5B 2LLYA 3BQIA 5HXSA 3UU8A 3RIUC 5AQHB 3MACA 4DUZT 2YEVC 2XQ9A 4K0UA 4UXNB 4DBQA 2BBHA 4JI7T 3VU7H 4U3CA 5DQWA 2XUEA 1FMVA 4XBFB 4HWHA 1UURA 4FJOA 5AQMB 1HF8A 4AKLA 3ZC0A 2YOEA 2AXDS 5FNVE 2Q9QD 2HPLA 3AAAB 3OYZA 2H7VC 4WBOA 2P9BA 2VL0A 2YINA 4YSXA 4DR7T 3N5LA 1J5ET 2VWAA 2A2FX 1XDPA 3LBXB 4EIWA 2KWHA 3C4XA 4ZOLE 3RQUA 4ILCA 1FEWA 3KDSE 3HKCE 3P4RA 1HG2A 3F57A 2J4GA 3ZJ2A 4HWFA 4XZCA 2D0UA 3HI2A 4TUYE 2WSSV 2K48A 2PFVA 4LMKA 2W67A 3IBPA 3NZQA 4DIDB 4JI3T 3LSVA 2LEHA 4H9OC 1U4QA 5CA0E 3Q5DA 2UUCT 4DV6T 2ODUA 5TAOA 3AXJB 4EAHA 2LM2A 5FP3A 5HXCA 4MHCA 3NWIA 3ZT7A 2BS3A 2Y6XA 5LCYA 4IDPA 2ZLYA 2E9XA 3OTOT 2NW9A 3WAJA 5CB4E 1UX5A 1YQ3A 4WBNE 2LE8A 4ZI2C 1ZOYA 1SHZC 4ZZCA 3ZJ1A 2H89A 2XZEA 2A72A 4OHFA 4AIUA 3E08A 2WAUA 4IDNA 2WDQA 3ANWB 4KP3C 1IBMT 3RKOA 3K3OA 4IE5A 1I6ZA 4X62T 3KINB 4ERRA 5FXWA 4H9NC 5DQVA 3RIUA 3N9OA 4DR3T 4YTNA 3AAIA 2E5LT 4IT4A 4DR6T 2I0MA 2JQHA 3KBUA 3AAEB 5LBQB 1MMGA 4E7SA 3RYIE 2XAHB 5EK3A 4U33A 3K3QC 5FXVA 3MZKB 4HKAA 3ZEFB 2DCFA 3SFEA 4DV4T 2V6YB 3H3AA 3AVSA 4YHHT 3PUVF 3QK6A 2CXLA 1VOMA 2HN2A 2OV9A 4JV5T 5JREA 4LF5T 1HX1B 2K5BB 5JDQA 4LFBT 4K0KT 2M6BA 3NVOA 2X0YA 5BMVE 3RQWA 3ETVA 3ZLIA 1HFAA 3I9WA 4AISA 3I0OA 3H3MA 2K24A 4HTEA 3IF8B 3CMLA 4ZI7E 3Q2MA 1B7TA 3LG7A 2XY8B 4OX9T 3N9LA 5CJ5A 3VKGA 3AVRA 4DV2T 5C3JA 2BVLA 2QA7A 5LNKA 4P0AA 2RP4A 4JEHB 4IE0A 2LSGA 1MIVA 1OEDB 4DR5T 3ZT5A 2BG9C 4TZ4C 3AE9A 4CQIA 4P1NA 3ZKRA 3M65A 2NW8A 3C64A 4A5XA 2XQYA 3T1YT 2NR4A 2VASA 4MALA 4CXXA 3RPUA 2M67A 2BS4A 3UUNA 2V6XA 3PUWF 2IIUA 4GOUA 4JEUB 5LJNA 1H7CA 2CPTA 5LGTB 1NEKA 5JRCA 3ZSTA 3SRZA 4A98A 5HEGA 4I4TE 2KWIB 3AE3A 4KHPT 4BJMA 4YY3T 5HEUA 1LVKA 1XNQT 5F5WA 2D0TA 3N9QA 4TX5A 4B3ST 2WBLA 2CHOA 3U78A 2MAWA 3GWHA 2QYWA 5JR9B 4O4IE 2MBGA 4QX7B 1W9RA 2LRLA 3AE8A 1NAFA 4H9PC 3PDYA 4ZHQE 3VRBA 3RYHE 4DV7T 1MMAA 3BK9A 2LSYA 1BR2A 4OYJA 1IBLT 3EUHA 4YJ3E 4EYYR 4L9IA 5L3GB 3F2EA 4B3MT 2LHNA 2JQQA 4HN9A 1T72A 4DMWA 3V5SA 3O1HA 4C91A 1D1BA 1N36T 3RKGA 3NRYA 4U31A 4UV9B 3V5UA 1WFDA 5HWYA 1LRZA 3ZN1B 3QB5K 1WYCA 1WR0A 4GYRA 3KBTA 2XTLA 3LFMA 4CN1A 4ASKA 3SOLA 4UV8B 5GONE 1W0AA 4BJNA 2MOZA 1G73A 1JNZA 1MNDA 2DLRA 4UF0B 3TLUA 1UCUA 1YKHB 2Y8DA 2JPFA 4UIGA 2BG9A 5A1LA 3FBLA 4WW0A 1IAPA 3ZYLA 3N9MA 3L39A 3RI5A 4C90A 2ZMAA 3OYXA 1XNRT 1MIYA 3RRWA 2W00A 4H63V 2BKPA 2IC6A 1N32T 5JQGE 3BQKA 4ISTA 3AE6A 3HKEE 3N9PA 3UUMA 3CQCB 2X9YA 2VKHA 2XQ3A 5HXHA 1SUMB 4YXDA 2WY2A 2CXDA 2VL8A 3I0QA 4IHJE 5AQQB 3JC6C 2IHR1 4ZI3D 3MA9A 3RC8A 3CWZB 2WMOA 3MXZA 3ONXA 2UXBT 3J9X1 4EXTA 5J2UE 3UT5E 2VK9A 3LDQB 5F3JA 2UU9T 2QGSA 2VKJA 4E7ZA 3HKBE 4DR2T 1HR0T 2UXNB 2XAGB 5AQSB 4ZS2A 2KSRA 2X0HA 3R6NA 4GK5E 5HEJA 1US7B 3JCFA 1OXZA 2LSIA 2WDVA 2YDRA 2NTXA 2N1GA 2V7JA 4IREA 5J1GA 2KNDA 1MMDA 3AEAA 4EOZB 4KUMB 2ACXA 2R6GF 5AQRB 3ZT6A 5F8PA 3PUGA 2WWVA 5KDMC 2XSAA 4YTMA 2XHEB 3C4WA 3LJCA 1M7KA 5L47A 4P09A 4MFRA 4ILUA 5ABEA 3DP7A 1UK5A 3LK2B 3IEEA 1E1HB 5ABHA 1D1AA 2V8SV 5AQGB 5FYMA 2V1DB 2X68A 2FBWA 2PTFA 5AFUL 3RC3A 4LMJA 3AE1A 3CK6A 3IA3A 4UVBB 2HN1A 2CLYB 2W2UA 3GA8A 4KI0F 1Z8UA 3VKHA 2WB5A 2JQKA 3AE2A 4OYKA 1HS7A 1KK7A 4NXNT 1D0YA 4KHZF 3VR9A 3JAEA 5J0ZA 3AEDA 3GN5A 2IUBA 4Z91A 2VQFT 4JYAT 4LF8T 1N33T 1M62A 1KEYA 2YDQA 3WI3A 2RPAA 2J1DG 4QH1A 3UUBA 1UX4A 2X0LB 1T8BA 1HNWT 4TWFA 1WYBA 3UU6A 2V7MA 4YTPA 2WQYA 2YU2A 1LKXA 3P50A 3S4UA 4YFSA 4EYUA 3FZMB 3FB2A 2YU1A 3KFWX 5L4HA 2WP9A 2IDOB 4CZZB 2LHRA 3PURA 4HFVA 5L4EA 3CX6B 2CMRA 3LBXA 4NPPA 2BDEA 3BQLA 3KVBA 2XPKA 3ABVA 4AKRB 1HX8A 4JI6T 5LMNT 3SWHA 4TNWA 3ZYKA 3AE7A 3AEBA 3X1DA 1JNRA 2UUBT 2RA1A 2XQ5A 4U72A 1YKEB 3FZKB 2PJQA 4QKNA 2CA5A 4ZI3C 2LKGA 5LG4A 1J1JA 3RX6A 4CI1B 5AQPB 3CQXC 3AXJA 4X66T 4DV1T 1OEDC 2BBJA 3AA7B 1DU2A 4HEAA 3AA1B 2E8IA 1OWAA 4IL4A 4EGWA 4IDQA 4IDOA 1U5PA 4HWIB 1MMNA 4I43B 3P4WA 2PG8A 4AKHA 5DJQC 4IGUA 3FXDB 4EZHA 4NXMT 3VHLA 4Z8XA 1T7SA 4NUUA 4J2CA 3ANWA 3ESLA 4HWCA 1HTJF 4MLKA 2JMKA 2C5IT 2KINB 3D0TA 4P0BA 4H63H 1WLXA 4IE7A 2NWBA 3PV0F 3ONLC 3L09A 2XQ8A 1X9BA 5FXXA 5AQJB 5L3DB 1S94A 3JC6D 5JR9C 1N34T 4CXWA 2V6YA 5HCMA 1GQEA 2K9AA 2LT3A 3MKDA 4O2AE 3NBXX 3EDUA 4JI4T 3AEFA 3PU8A 4A56A 3JAFA 1IJ6A 3CPZA 3TLSA 4F8HA 3N9NA 5CGMA 3K3NA 4H9RC 2VVNA 4ILAA 4QWNB 4X1IE 3AA0B 2L9QA 3EDVA 2D5UA 3ZMSB 2D2SA 2LOPA 2X9XA 4UR9A 4GIWA 4AKGA 5FL0A 2XASB 4YSZA 1E7PA 3ZC1A 1ZP0A 3I9YA 5L3FB 4TV8E 4QXHB 4PK4A 4ISSA 4BA9A 1OEDA 3UFGA 1YXRA 4TN7B 3L3PA 3NRXA 4CI2B 2CM0A 2BG9E 5ABFB 1ZV4X 5L2LA 4B3TT 2I6HA 2W63A 3UU4A 4HFCA 3HKDE 3QOFA 3HL6A 2DI4A 2CBIA 3SS1A 1J5WA 2ZM2A 3ZMZB 3QC9A 2XSBA 3Q5EA 3EAMA 3ZYMA 4CN4A 1UGOA 2X9WA 5EK2A 3LK42 2Q9QB 4O8SA 1YD8G 5AQOB 2BS2A 2G0UA 4V1Av 3QUJA 4HFDA 4DO0A 5LYJE 1QSDA 3W15B 3K8PC 2XQ6A 4O4LE 2ACZA 2Z6EA 5LHGB 1W0BA 2K3WA 4IE4A 5HYAA 5JR9A 2V5DA 4UVAB 2VKDA 1QLBA 3A5XA 4TV9E 2Y48B 2X51A 4HFHA 4EV6A 3PJAA 3KV9A 2GK9A 2WS3A 5LGUB 2PBIA 2L8KA 3P4QA 4ADZA 3QNUA 5FY1A 3AEGA 2MYSA 4PK5A 3PU3A 4U2ZA 1SE7A 2CCQA 4X65T 4JLEA 2W62A 1FIOA 4JI1T 3ZCJA 5BR8T 3UULA 1S35A 4PJMA 2W66A 2YDSA 4ANJA 2D9DA 4XAXB 3HR0A 5DABA 1W09A 2KXPB 3ZN0B 5HXRA 4UELA 3CX8B 2NP9A 4Z90A 3RYFE 2BKOA 2VQET 4EZ4A 3FZHB 5LMUT 2J62A 5AQNB 4NUVA 1YW0A 3E0ZA 3VRAA 3FHNA 4HFEA 2L3LA 4PAGA 4UF0A 4ZZBA 5HXEA 4QXBB 3PUQA 3Q5WA 1R8IA 5AQTB 2XQ4A 3ZSSA 2ZM0A 3GMIA 2EHOB 5JDFA 2VVSA 3RF1A 4LFCT 4IIJE 3A7MA 3DJBA 4TWHA 4X1KE 1UUSA 1MIWA 2CLYC 3ZMTB 3AB3B 2ES0A 3VR8A 5LOVE 1FMWA 2LJLA 1CHUA 3CQGB 5FMNA 3FXEB 3PUYF 2XM1A 1AJ3A 3ZCIA 3CVRA 4GKKT 2OA5A 2C0SA 2H7OA 3PUSA 4QH5A 2DL1A 3T1HT 4JI0T 4IL9A 2AE9A 3B5MA 1IZNB 4I50E 1VRBA 1Z0PA 2YK0A 3JADA 3UTKA 3UU3A 2JRKA 3C4ZA 2FUPA 4B3RT 4JUYA 4X64T 3OBVE 3AEEA 3O9XA 2UUAT 4DV5T 3OVUA 4EEDA 4GK0E 2X67A 4L0RA 1VCSA 4DMVA 4CI3B 4QHOA 2LRKA 3PUZF 4O4HE 2JJ9A 1HCIA 2ZM6T 4WNKA 3RLFF 2FJAA 4PJJA 1L0VA 2DHRA 3QB5A 5J2TE 3HA4A 1XDOA 4DUYT 4O2BE 5LGNB 2JMHA 4H9SE 5L3CB 2BZBA 1KNPA 4JBWF 5FY7A 1E2AA 4I55E 4EB6E 2E9XB 2IMLA 3RHWA 2N9DA 3E22E 4ZEYA 2KLQA 5LBMA 3CIRA 2LOSA 4HE8A 4KBMB 1KFYA 1ZKEA 2WWUA 3UU5A 2CWOA 3R84B 3KV4A 3PJAJ 4X5TA 5AQFB 1T98A 5LB7B 3MJXA 4DVDA 3K1SA 4LMLA 4U2YA 3WAKA 2KZ7B 2UXDT 4DV0T 4YJ2E 4X1YE 2LSKA 3AA6B 3AECA 4JI5T 1O3XA 5CFBA 2DWGA 3C50A 2M6IA 2WM9A 2UXCT 2H3RA 2XM2A 3LK3B 3P4SA 4BAYB 1XWMA 1FJGT 2VKOA 5LA6E 4O4JE 4I0UA 5FVKA 5IHYA 4PJNA 2B76A 2JQ9A 2FJBA 1WCRA 3TLVA 3UQ7A 2V5CA 5JH7E 4MBQA 3KV5A 5LHIB 5IUXA 2XJ7A 5EK4A 4AQFC 2BVMA 4PJLA 2EHOD 4LF4T 2KMFA 5FL1A 2W61A 2DNXA 5JDNA 3KV6A 4QX8B 2E5VA 3A8YC 2LKHA 1ZEEA 1BR0A 2WU5A 5L3BB 2MTQA 5LHHB 5H6RB 1IBKT 2XAFB 2CBJA 2QRXA 2C5JA 4PFPA 2IC9A 1HNZT 1XMOT 3UQ4A 3Q5XA 1ZHCA 3Q9DA 1I94T 4COFA 4DNDA 5HAXA 1CUNA 5LG3A 2X66A 5ETWA 3L8RA 3ONJA 4N78D 4A97A 5IWAT 4AI6A 1BR1A 3RYCE 2CXFA 3RIAA 5LP6E 3EVYA 4QH4A 1QUUA 5HCJA 3AE4A 1VCTA 2VB6A 2MPKA 4HGAA 2LSJA 3M3ZB 5JDHA 4FI5A 5JVDE 5JRCB 1OEDE 2A3DA 3CX7B 4Q25A 3ETUA 2WZHA 2OLTA 3P7IA 2F4VT 2BKNA 3TKLB 4X20E 1YQ4A 4WZXA 2Q9QC 5C8YE 4AQGA 5KXJA 4HWDA 1G8XA 4JI2T 3FZFB 4NIQA 2E9XD 4ILBA 2H88A 5AQIB 4IDZA 3U3IA 1HNXT 3MK7C 2N2NA 3SFDA 3T8OA 4G63A 3IHRA 4YSYA 3TLTA 2IW5B 3OJAA 3FZLB 4UEMA 5JDLA 4AQFA
chains in the Genus database with same CATH topology
3M3ZB 5AQIB 5AQSB 5AQTB 1M62A 1UK5A 1HX1B 3FZHB 4HWHA 5AQLB 3FZKB 1T7SA 3FZMB 5AQMB 5AQKB 4HWFA 5AQQB 5AQRB 4HWCA 5AQJB 5AQNB 5AQHB 5AQVB 3LDQB 5AQGB 1UGOA 2D9DA 3A8YC 4HWIB 4HWDA 3FZLB 5AQPB 5AQOB 1M7KA 3FZFB 5AQFB 1I6ZA 5AQUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M3Z B;  5AQI B;  5AQS B;  5AQT B;  1M62 A;  1UK5 A;  1HX1 B;  3FZH B;  4HWH A;  5AQL B;  3FZK B;  1T7S A;  3FZM B;  5AQM B;  5AQK B;  4HWF A;  5AQQ B;  5AQR B;  4HWC A;  5AQJ B;  5AQN B;  5AQH B;  5AQV B;  3LDQ B;  5AQG B;  1UGO A;  2D9D A;  3A8Y C;  4HWI B;  4HWD A;  3FZL B;  5AQP B;  5AQO B;  1M7K A;  3FZF B;  5AQF B;  1I6Z A;  5AQU B; 
#chains in the Genus database with same CATH topology
 3UUX B;  1Y01 A;  3EHZ A;  2V7L A;  5AQL B;  2X9H A;  2VUR A;  3AE5 A;  5FY0 A;  2XAQ B;  2XAJ B;  5AQV B;  2KT9 A;  3PUX F;  1XMQ T;  1EZ3 A;  4YT0 A;  3F31 A;  2WCA A;  3ZMV B;  5AQU B;  2CEA A;  2FJE A;  4LF6 T;  5JTG A;  3UFE A;  2XQ7 A;  2B1E A;  4AXP A;  1HG5 A;  4PW8 A;  2W4X A;  3PUA A;  2BG9 B;  2LM9 A;  3KVA A;  2YN6 A;  2E2A A;  3RH3 A;  4GYS A;  4EEB A;  3N2G E;  4PK6 A;  2YKS A;  4IE6 A;  4QXC B;  1X79 A;  4F6R C;  2NTY A;  2HPJ A;  5HEO A;  5AQK B;  1V9D A;  4YHJ A;  2NW7 A;  4U7Y A;  5EZY E;  4DR1 T;  1MNE A;  3RRC A;  2IAK A;  4DBR A;  4GKJ T;  3H37 A;  3O4X E;  2V7I A;  2UXX B;  2WDR A;  2WMN A;  2EHO C;  5ABF A;  4DV3 T;  5HEH A;  3OPC A;  5JDM A;  2J47 A;  4DR4 T;  2ODV A;  5KX5 E;  3RGL A;  4H9Q C;  3C98 B;  5HWX A;  2NOX A;  4LF9 T;  4TWD A;  2V7K A;  5L3E B;  3C51 A;  1D0Z A;  4AKI A;  5FXZ A;  3N2O A;  2A9U A;  3RIF A;  2W0G A;  3N2K E;  2Q9Q A;  1NEN A;  2CE7 A;  3I1A A;  4U7I A;  3P8C D;  4M1P A;  5KMG P;  2FJD A;  1XZY A;  4LF7 T;  2C5K T;  4L5G A;  4JI8 T;  4KX6 A;  4G2A A;  1WR6 A;  5C2T A;  4ZI2 D;  1Y64 B;  2ZM8 A;  3B13 A;  4PNI A;  4YLH A;  3ZMU B;  5LJM A;  4OFZ A;  5M4Y A;  5IYZ E;  4ZXL A;  3EAB A;  3PTR B;  1LVF A;  2V26 A;  2XQA A;  3OKQ A;  1KNR A;  3ZPO A;  3CKD A;  3FBZ A;  2CWY A;  3NKZ A;  3J7Y q;  5JDG A;  3O1I A;  4KMC A;  1SA0 E;  5FVL A;  5H6Q B;  2WZI A;  4WYV A;  4PFO A;  2HHH T;  5E0O A;  3NZP A;  2I59 A;  4HFI A;  5LXT E;  3DTO A;  2WU2 A;  1D0X A;  4CN6 A;  2SPC A;  3P4P A;  3TLW A;  1WRD A;  3O1J A;  1IJ5 A;  3EI0 A;  4B6X A;  1D1C A;  3PE0 A;  4ZS3 A;  4AQY T;  2CHN A;  4U74 A;  4OK0 A;  2E9X C;  4CXY A;  5FKY A;  3B57 A;  2DWK A;  5ADX L;  2CRB A;  5CA1 E;  2HH7 A;  4HFB A;  4LFA T;  5ABG A;  1NWM X;  2JIW A;  4UVC B;  1KNZ A;  1BR4 A;  3G06 A;  2EHO A;  2QVA A;  1KF6 A;  4TNV A;  3GN5 B;  2LLY A;  3BQI A;  5HXS A;  3UU8 A;  3RIU C;  5AQH B;  3MAC A;  4DUZ T;  2YEV C;  2XQ9 A;  4K0U A;  4UXN B;  4DBQ A;  2BBH A;  4JI7 T;  3VU7 H;  4U3C A;  5DQW A;  2XUE A;  1FMV A;  4XBF B;  4HWH A;  1UUR A;  4FJO A;  5AQM B;  1HF8 A;  4AKL A;  3ZC0 A;  2YOE A;  2AXD S;  5FNV E;  2Q9Q D;  2HPL A;  3AAA B;  3OYZ A;  2H7V C;  4WBO A;  2P9B A;  2VL0 A;  2YIN A;  4YSX A;  4DR7 T;  3N5L A;  1J5E T;  2VWA A;  2A2F X;  1XDP A;  3LBX B;  4EIW A;  2KWH A;  3C4X A;  4ZOL E;  3RQU A;  4ILC A;  1FEW A;  3KDS E;  3HKC E;  3P4R A;  1HG2 A;  3F57 A;  2J4G A;  3ZJ2 A;  4HWF A;  4XZC A;  2D0U A;  3HI2 A;  4TUY E;  2WSS V;  2K48 A;  2PFV A;  4LMK A;  2W67 A;  3IBP A;  3NZQ A;  4DID B;  4JI3 T;  3LSV A;  2LEH A;  4H9O C;  1U4Q A;  5CA0 E;  3Q5D A;  2UUC T;  4DV6 T;  2ODU A;  5TAO A;  3AXJ B;  4EAH A;  2LM2 A;  5FP3 A;  5HXC A;  4MHC A;  3NWI A;  3ZT7 A;  2BS3 A;  2Y6X A;  5LCY A;  4IDP A;  2ZLY A;  2E9X A;  3OTO T;  2NW9 A;  3WAJ A;  5CB4 E;  1UX5 A;  1YQ3 A;  4WBN E;  2LE8 A;  4ZI2 C;  1ZOY A;  1SHZ C;  4ZZC A;  3ZJ1 A;  2H89 A;  2XZE A;  2A72 A;  4OHF A;  4AIU A;  3E08 A;  2WAU A;  4IDN A;  2WDQ A;  3ANW B;  4KP3 C;  1IBM T;  3RKO A;  3K3O A;  4IE5 A;  1I6Z A;  4X62 T;  3KIN B;  4ERR A;  5FXW A;  4H9N C;  5DQV A;  3RIU A;  3N9O A;  4DR3 T;  4YTN A;  3AAI A;  2E5L T;  4IT4 A;  4DR6 T;  2I0M A;  2JQH A;  3KBU A;  3AAE B;  5LBQ B;  1MMG A;  4E7S A;  3RYI E;  2XAH B;  5EK3 A;  4U33 A;  3K3Q C;  5FXV A;  3MZK B;  4HKA A;  3ZEF B;  2DCF A;  3SFE A;  4DV4 T;  2V6Y B;  3H3A A;  3AVS A;  4YHH T;  3PUV F;  3QK6 A;  2CXL A;  1VOM A;  2HN2 A;  2OV9 A;  4JV5 T;  5JRE A;  4LF5 T;  1HX1 B;  2K5B B;  5JDQ A;  4LFB T;  4K0K T;  2M6B A;  3NVO A;  2X0Y A;  5BMV E;  3RQW A;  3ETV A;  3ZLI A;  1HFA A;  3I9W A;  4AIS A;  3I0O A;  3H3M A;  2K24 A;  4HTE A;  3IF8 B;  3CML A;  4ZI7 E;  3Q2M A;  1B7T A;  3LG7 A;  2XY8 B;  4OX9 T;  3N9L A;  5CJ5 A;  3VKG A;  3AVR A;  4DV2 T;  5C3J A;  2BVL A;  2QA7 A;  5LNK A;  4P0A A;  2RP4 A;  4JEH B;  4IE0 A;  2LSG A;  1MIV A;  1OED B;  4DR5 T;  3ZT5 A;  2BG9 C;  4TZ4 C;  3AE9 A;  4CQI A;  4P1N A;  3ZKR A;  3M65 A;  2NW8 A;  3C64 A;  4A5X A;  2XQY A;  3T1Y T;  2NR4 A;  2VAS A;  4MAL A;  4CXX A;  3RPU A;  2M67 A;  2BS4 A;  3UUN A;  2V6X A;  3PUW F;  2IIU A;  4GOU A;  4JEU B;  5LJN A;  1H7C A;  2CPT A;  5LGT B;  1NEK A;  5JRC A;  3ZST A;  3SRZ A;  4A98 A;  5HEG A;  4I4T E;  2KWI B;  3AE3 A;  4KHP T;  4BJM A;  4YY3 T;  5HEU A;  1LVK A;  1XNQ T;  5F5W A;  2D0T A;  3N9Q A;  4TX5 A;  4B3S T;  2WBL A;  2CHO A;  3U78 A;  2MAW A;  3GWH A;  2QYW A;  5JR9 B;  4O4I E;  2MBG A;  4QX7 B;  1W9R A;  2LRL A;  3AE8 A;  1NAF A;  4H9P C;  3PDY A;  4ZHQ E;  3VRB A;  3RYH E;  4DV7 T;  1MMA A;  3BK9 A;  2LSY A;  1BR2 A;  4OYJ A;  1IBL T;  3EUH A;  4YJ3 E;  4EYY R;  4L9I A;  5L3G B;  3F2E A;  4B3M T;  2LHN A;  2JQQ A;  4HN9 A;  1T72 A;  4DMW A;  3V5S A;  3O1H A;  4C91 A;  1D1B A;  1N36 T;  3RKG A;  3NRY A;  4U31 A;  4UV9 B;  3V5U A;  1WFD A;  5HWY A;  1LRZ A;  3ZN1 B;  3QB5 K;  1WYC A;  1WR0 A;  4GYR A;  3KBT A;  2XTL A;  3LFM A;  4CN1 A;  4ASK A;  3SOL A;  4UV8 B;  5GON E;  1W0A A;  4BJN A;  2MOZ A;  1G73 A;  1JNZ A;  1MND A;  2DLR A;  4UF0 B;  3TLU A;  1UCU A;  1YKH B;  2Y8D A;  2JPF A;  4UIG A;  2BG9 A;  5A1L A;  3FBL A;  4WW0 A;  1IAP A;  3ZYL A;  3N9M A;  3L39 A;  3RI5 A;  4C90 A;  2ZMA A;  3OYX A;  1XNR T;  1MIY A;  3RRW A;  2W00 A;  4H63 V;  2BKP A;  2IC6 A;  1N32 T;  5JQG E;  3BQK A;  4IST A;  3AE6 A;  3HKE E;  3N9P A;  3UUM A;  3CQC B;  2X9Y A;  2VKH A;  2XQ3 A;  5HXH A;  1SUM B;  4YXD A;  2WY2 A;  2CXD A;  2VL8 A;  3I0Q A;  4IHJ E;  5AQQ B;  3JC6 C;  2IHR 1;  4ZI3 D;  3MA9 A;  3RC8 A;  3CWZ B;  2WMO A;  3MXZ A;  3ONX A;  2UXB T;  3J9X 1;  4EXT A;  5J2U E;  3UT5 E;  2VK9 A;  3LDQ B;  5F3J A;  2UU9 T;  2QGS A;  2VKJ A;  4E7Z A;  3HKB E;  4DR2 T;  1HR0 T;  2UXN B;  2XAG B;  5AQS B;  4ZS2 A;  2KSR A;  2X0H A;  3R6N A;  4GK5 E;  5HEJ A;  1US7 B;  3JCF A;  1OXZ A;  2LSI A;  2WDV A;  2YDR A;  2NTX A;  2N1G A;  2V7J A;  4IRE A;  5J1G A;  2KND A;  1MMD A;  3AEA A;  4EOZ B;  4KUM B;  2ACX A;  2R6G F;  5AQR B;  3ZT6 A;  5F8P A;  3PUG A;  2WWV A;  5KDM C;  2XSA A;  4YTM A;  2XHE B;  3C4W A;  3LJC A;  1M7K A;  5L47 A;  4P09 A;  4MFR A;  4ILU A;  5ABE A;  3DP7 A;  1UK5 A;  3LK2 B;  3IEE A;  1E1H B;  5ABH A;  1D1A A;  2V8S V;  5AQG B;  5FYM A;  2V1D B;  2X68 A;  2FBW A;  2PTF A;  5AFU L;  3RC3 A;  4LMJ A;  3AE1 A;  3CK6 A;  3IA3 A;  4UVB B;  2HN1 A;  2CLY B;  2W2U A;  3GA8 A;  4KI0 F;  1Z8U A;  3VKH A;  2WB5 A;  2JQK A;  3AE2 A;  4OYK A;  1HS7 A;  1KK7 A;  4NXN T;  1D0Y A;  4KHZ F;  3VR9 A;  3JAE A;  5J0Z A;  3AED A;  3GN5 A;  2IUB A;  4Z91 A;  2VQF T;  4JYA T;  4LF8 T;  1N33 T;  1M62 A;  1KEY A;  2YDQ A;  3WI3 A;  2RPA A;  2J1D G;  4QH1 A;  3UUB A;  1UX4 A;  2X0L B;  1T8B A;  1HNW T;  4TWF A;  1WYB A;  3UU6 A;  2V7M A;  4YTP A;  2WQY A;  2YU2 A;  1LKX A;  3P50 A;  3S4U A;  4YFS A;  4EYU A;  3FZM B;  3FB2 A;  2YU1 A;  3KFW X;  5L4H A;  2WP9 A;  2IDO B;  4CZZ B;  2LHR A;  3PUR A;  4HFV A;  5L4E A;  3CX6 B;  2CMR A;  3LBX A;  4NPP A;  2BDE A;  3BQL A;  3KVB A;  2XPK A;  3ABV A;  4AKR B;  1HX8 A;  4JI6 T;  5LMN T;  3SWH A;  4TNW A;  3ZYK A;  3AE7 A;  3AEB A;  3X1D A;  1JNR A;  2UUB T;  2RA1 A;  2XQ5 A;  4U72 A;  1YKE B;  3FZK B;  2PJQ A;  4QKN A;  2CA5 A;  4ZI3 C;  2LKG A;  5LG4 A;  1J1J A;  3RX6 A;  4CI1 B;  5AQP B;  3CQX C;  3AXJ A;  4X66 T;  4DV1 T;  1OED C;  2BBJ A;  3AA7 B;  1DU2 A;  4HEA A;  3AA1 B;  2E8I A;  1OWA A;  4IL4 A;  4EGW A;  4IDQ A;  4IDO A;  1U5P A;  4HWI B;  1MMN A;  4I43 B;  3P4W A;  2PG8 A;  4AKH A;  5DJQ C;  4IGU A;  3FXD B;  4EZH A;  4NXM T;  3VHL A;  4Z8X A;  1T7S A;  4NUU A;  4J2C A;  3ANW A;  3ESL A;  4HWC A;  1HTJ F;  4MLK A;  2JMK A;  2C5I T;  2KIN B;  3D0T A;  4P0B A;  4H63 H;  1WLX A;  4IE7 A;  2NWB A;  3PV0 F;  3ONL C;  3L09 A;  2XQ8 A;  1X9B A;  5FXX A;  5AQJ B;  5L3D B;  1S94 A;  3JC6 D;  5JR9 C;  1N34 T;  4CXW A;  2V6Y A;  5HCM A;  1GQE A;  2K9A A;  2LT3 A;  3MKD A;  4O2A E;  3NBX X;  3EDU A;  4JI4 T;  3AEF A;  3PU8 A;  4A56 A;  3JAF A;  1IJ6 A;  3CPZ A;  3TLS A;  4F8H A;  3N9N A;  5CGM A;  3K3N A;  4H9R C;  2VVN A;  4ILA A;  4QWN B;  4X1I E;  3AA0 B;  2L9Q A;  3EDV A;  2D5U A;  3ZMS B;  2D2S A;  2LOP A;  2X9X A;  4UR9 A;  4GIW A;  4AKG A;  5FL0 A;  2XAS B;  4YSZ A;  1E7P A;  3ZC1 A;  1ZP0 A;  3I9Y A;  5L3F B;  4TV8 E;  4QXH B;  4PK4 A;  4ISS A;  4BA9 A;  1OED A;  3UFG A;  1YXR A;  4TN7 B;  3L3P A;  3NRX A;  4CI2 B;  2CM0 A;  2BG9 E;  5ABF B;  1ZV4 X;  5L2L A;  4B3T T;  2I6H A;  2W63 A;  3UU4 A;  4HFC A;  3HKD E;  3QOF A;  3HL6 A;  2DI4 A;  2CBI A;  3SS1 A;  1J5W A;  2ZM2 A;  3ZMZ B;  3QC9 A;  2XSB A;  3Q5E A;  3EAM A;  3ZYM A;  4CN4 A;  1UGO A;  2X9W A;  5EK2 A;  3LK4 2;  2Q9Q B;  4O8S A;  1YD8 G;  5AQO B;  2BS2 A;  2G0U A;  4V1A v;  3QUJ A;  4HFD A;  4DO0 A;  5LYJ E;  1QSD A;  3W15 B;  3K8P C;  2XQ6 A;  4O4L E;  2ACZ A;  2Z6E A;  5LHG B;  1W0B A;  2K3W A;  4IE4 A;  5HYA A;  5JR9 A;  2V5D A;  4UVA B;  2VKD A;  1QLB A;  3A5X A;  4TV9 E;  2Y48 B;  2X51 A;  4HFH A;  4EV6 A;  3PJA A;  3KV9 A;  2GK9 A;  2WS3 A;  5LGU B;  2PBI A;  2L8K A;  3P4Q A;  4ADZ A;  3QNU A;  5FY1 A;  3AEG A;  2MYS A;  4PK5 A;  3PU3 A;  4U2Z A;  1SE7 A;  2CCQ A;  4X65 T;  4JLE A;  2W62 A;  1FIO A;  4JI1 T;  3ZCJ A;  5BR8 T;  3UUL A;  1S35 A;  4PJM A;  2W66 A;  2YDS A;  4ANJ A;  2D9D A;  4XAX B;  3HR0 A;  5DAB A;  1W09 A;  2KXP B;  3ZN0 B;  5HXR A;  4UEL A;  3CX8 B;  2NP9 A;  4Z90 A;  3RYF E;  2BKO A;  2VQE T;  4EZ4 A;  3FZH B;  5LMU T;  2J62 A;  5AQN B;  4NUV A;  1YW0 A;  3E0Z A;  3VRA A;  3FHN A;  4HFE A;  2L3L A;  4PAG A;  4UF0 A;  4ZZB A;  5HXE A;  4QXB B;  3PUQ A;  3Q5W A;  1R8I A;  5AQT B;  2XQ4 A;  3ZSS A;  2ZM0 A;  3GMI A;  2EHO B;  5JDF A;  2VVS A;  3RF1 A;  4LFC T;  4IIJ E;  3A7M A;  3DJB A;  4TWH A;  4X1K E;  1UUS A;  1MIW A;  2CLY C;  3ZMT B;  3AB3 B;  2ES0 A;  3VR8 A;  5LOV E;  1FMW A;  2LJL A;  1CHU A;  3CQG B;  5FMN A;  3FXE B;  3PUY F;  2XM1 A;  1AJ3 A;  3ZCI A;  3CVR A;  4GKK T;  2OA5 A;  2C0S A;  2H7O A;  3PUS A;  4QH5 A;  2DL1 A;  3T1H T;  4JI0 T;  4IL9 A;  2AE9 A;  3B5M A;  1IZN B;  4I50 E;  1VRB A;  1Z0P A;  2YK0 A;  3JAD A;  3UTK A;  3UU3 A;  2JRK A;  3C4Z A;  2FUP A;  4B3R T;  4JUY A;  4X64 T;  3OBV E;  3AEE A;  3O9X A;  2UUA T;  4DV5 T;  3OVU A;  4EED A;  4GK0 E;  2X67 A;  4L0R A;  1VCS A;  4DMV A;  4CI3 B;  4QHO A;  2LRK A;  3PUZ F;  4O4H E;  2JJ9 A;  1HCI A;  2ZM6 T;  4WNK A;  3RLF F;  2FJA A;  4PJJ A;  1L0V A;  2DHR A;  3QB5 A;  5J2T E;  3HA4 A;  1XDO A;  4DUY T;  4O2B E;  5LGN B;  2JMH A;  4H9S E;  5L3C B;  2BZB A;  1KNP A;  4JBW F;  5FY7 A;  1E2A A;  4I55 E;  4EB6 E;  2E9X B;  2IML A;  3RHW A;  2N9D A;  3E22 E;  4ZEY A;  2KLQ A;  5LBM A;  3CIR A;  2LOS A;  4HE8 A;  4KBM B;  1KFY A;  1ZKE A;  2WWU A;  3UU5 A;  2CWO A;  3R84 B;  3KV4 A;  3PJA J;  4X5T A;  5AQF B;  1T98 A;  5LB7 B;  3MJX A;  4DVD A;  3K1S A;  4LML A;  4U2Y A;  3WAK A;  2KZ7 B;  2UXD T;  4DV0 T;  4YJ2 E;  4X1Y E;  2LSK A;  3AA6 B;  3AEC A;  4JI5 T;  1O3X A;  5CFB A;  2DWG A;  3C50 A;  2M6I A;  2WM9 A;  2UXC T;  2H3R A;  2XM2 A;  3LK3 B;  3P4S A;  4BAY B;  1XWM A;  1FJG T;  2VKO A;  5LA6 E;  4O4J E;  4I0U A;  5FVK A;  5IHY A;  4PJN A;  2B76 A;  2JQ9 A;  2FJB A;  1WCR A;  3TLV A;  3UQ7 A;  2V5C A;  5JH7 E;  4MBQ A;  3KV5 A;  5LHI B;  5IUX A;  2XJ7 A;  5EK4 A;  4AQF C;  2BVM A;  4PJL A;  2EHO D;  4LF4 T;  2KMF A;  5FL1 A;  2W61 A;  2DNX A;  5JDN A;  3KV6 A;  4QX8 B;  2E5V A;  3A8Y C;  2LKH A;  1ZEE A;  1BR0 A;  2WU5 A;  5L3B B;  2MTQ A;  5LHH B;  5H6R B;  1IBK T;  2XAF B;  2CBJ A;  2QRX A;  2C5J A;  4PFP A;  2IC9 A;  1HNZ T;  1XMO T;  3UQ4 A;  3Q5X A;  1ZHC A;  3Q9D A;  1I94 T;  4COF A;  4DND A;  5HAX A;  1CUN A;  5LG3 A;  2X66 A;  5ETW A;  3L8R A;  3ONJ A;  4N78 D;  4A97 A;  5IWA T;  4AI6 A;  1BR1 A;  3RYC E;  2CXF A;  3RIA A;  5LP6 E;  3EVY A;  4QH4 A;  1QUU A;  5HCJ A;  3AE4 A;  1VCT A;  2VB6 A;  2MPK A;  4HGA A;  2LSJ A;  3M3Z B;  5JDH A;  4FI5 A;  5JVD E;  5JRC B;  1OED E;  2A3D A;  3CX7 B;  4Q25 A;  3ETU A;  2WZH A;  2OLT A;  3P7I A;  2F4V T;  2BKN A;  3TKL B;  4X20 E;  1YQ4 A;  4WZX A;  2Q9Q C;  5C8Y E;  4AQG A;  5KXJ A;  4HWD A;  1G8X A;  4JI2 T;  3FZF B;  4NIQ A;  2E9X D;  4ILB A;  2H88 A;  5AQI B;  4IDZ A;  3U3I A;  1HNX T;  3MK7 C;  2N2N A;  3SFD A;  3T8O A;  4G63 A;  3IHR A;  4YSY A;  3TLT A;  2IW5 B;  3OJA A;  3FZL B;  4UEM A;  5JDL A;  4AQF A; 
#chains in the Genus database with same CATH homology
 3M3Z B;  5AQI B;  5AQS B;  5AQT B;  1M62 A;  1UK5 A;  1HX1 B;  3FZH B;  4HWH A;  5AQL B;  3FZK B;  1T7S A;  3FZM B;  5AQM B;  5AQK B;  4HWF A;  5AQQ B;  5AQR B;  4HWC A;  5AQJ B;  5AQN B;  5AQH B;  5AQV B;  3LDQ B;  5AQG B;  1UGO A;  2D9D A;  3A8Y C;  4HWI B;  4HWD A;  3FZL B;  5AQP B;  5AQO B;  1M7K A;  3FZF B;  5AQF B;  1I6Z A;  5AQU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...