4HWCA

Structure of atbag1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
86
structure length
86
Chain Sequence
SASKAISDISLEVDRLGGRVSAFEMVTKKGGKIAEKDLVTVIELLMNELIKLDAIVAEGDVKLQRKMQVKRVQNYVETLDALKVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BAG family molecular chaperone regulator 1
publication title Structural insight into plant programmed cell death mediated by BAG proteins in Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Apoptosis
total genus 37
structure length 86
sequence length 86
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 4hwcA00
5AQNB 5AQUB 3LDQB 4HWHA 5AQGB 5AQFB 5AQSB 5AQTB 5AQHB 2D9DA 1I6ZA 1UK5A 4HWFA 5AQVB 1M7KA 3A8YC 3FZHB 5AQKB 1HX1B 4HWCA 5AQLB 4HWDA 5AQQB 5AQMB 5AQIB 3M3ZB 5AQJB 1UGOA 5AQRB 3FZKB 4HWIB 5AQOB 3FZFB 5AQPB 1M62A 3FZMB 3FZLB 1T7SA
chains in the Genus database with same CATH superfamily
4QX7B 2EHOC 4AQGA 2UUCT 3CQXC 3F2EA 5FYMA 5H6RB 3AEFA 4DIDB 1XNRT 5L3DB 1IBMT 2VL8A 2X9YA 1LVKA 5AQPB 2MBGA 2CE7A 5LXTE 3ZT5A 2BKPA 2WDVA 4MLKA 2D0TA 4IREA 3LJCA 3VKGA 5HEUA 2W66A 3AA1B 4HE8A 4EOZB 1IBLT 1R8IA 3KV4A 4ZZCA 2ACZA 2ZM2A 2QA7A 3JAEA 3RYHE 4MFRA 2W63A 5KXJA 5FY0A 3BQLA 2LLYA 4L0RA 3ZYKA 2L9QA 2NP9A 3MXZA 4PJNA 4PFPA 5ABEA 3RF1A 3MKDA 3AE3A 3TLUA 3OVUA 2V7KA 4YLHA 2YKSA 4DBQA 2D5UA 4CQIA 4UVCB 4IHJE 4EYYR 5JDGA 2CXFA 3ANWA 2H7OA 5L3CB 2JMHA 3TKLB 2H7VC 3ZN0B 3TLTA 1N36T 5LGNB 4KBMB 4KMCA 1AJ3A 3AE9A 4O4IE 3FHNA 2IUBA 3IHRA 3I0QA 5JRCA 3OYZA 2K24A 3NRYA 4C91A 3P4RA 2NTYA 5JR9B 4YSZA 1BR4A 5AQVB 2XQ6A 3FZHB 5AQQB 2IAKA 3J7Yq 4I50E 1HFAA 3C50A 2LT3A 4O8SA 4O2AE 1MIVA 1SA0E 4O4JE 5LB7B 3H37A 3NZPA 2BG9C 4G63A 3ZMTB 4YJ2E 2V7MA 2A72A 2A9UA 3N9MA 4ASKA 1OEDB 3ZYMA 4KI0F 5FY7A 5FXWA 2BKOA 5L2LA 4OYKA 3N9NA 1BR2A 3AEGA 4V1Av 2LEHA 4IDQA 4MALA 5LYJE 4U31A 2I6HA 2DWGA 2CA5A 2E9XB 4EGWA 3P4PA 2WS3A 1D1AA 4UELA 3OJAA 3RH3A 2XJ7A 5DQWA 4Z8XA 3U78A 4YSYA 5CGMA 2IC9A 4JEHB 4GKJT 2K3WA 2BS4A 3BQKA 1XNQT 2NW9A 2KSRA 2XQ9A 2C5KT 2HPJA 2M6BA 4ZZBA 2NOXA 4M1PA 3KV9A 2KWIB 5IWAT 3O4XE 2Y48B 1GQEA 2WQYA 1WR0A 3VKHA 4HFEA 2OA5A 2Z6EA 3O1IA 2VQET 2V5CA 3A7MA 2CRBA 3SS1A 3BK9A 3KINB 3CWZB 2CBJA 4ISTA 5LNKA 4LFBT 1KEYA 1WYBA 2CLYC 2DI4A 2VKOA 2I0MA 3N2OA 2CBIA 5E0OA 5JDFA 2CMRA 4LMKA 3ZEFB 4EV6A 4CI1B 3PE0A 2H89A 3FB2A 1KNZA 4A56A 4XAXB 3NKZA 4Z90A 2HN1A 4DUYT 3CX6B 3Q2MA 3RYIE 1S35A 2XZEA 4QKNA 2Q9QD 3UUMA 2JRKA 4JI6T 2F4VT 2GK9A 1HX8A 4NPPA 3ZN1B 3VRAA 3I0OA 2VQFT 2HHHT 2J47A 2B1EA 4X1YE 3SWHA 4PK5A 2WMOA 2DNXA 5FVKA 3AXJA 2FJBA 5HXEA 2WCAA 4DV2T 2CHOA 4DV0T 3LK42 4JI0T 3AE4A 3RQUA 3U3IA 3RIAA 2J1DG 2JJ9A 2C5JA 3ZYLA 3IBPA 1YXRA 4KX6A 2VASA 3ZT6A 4DVDA 5F3JA 2JQKA 3Q5WA 2HH7A 2XAHB 4CXWA 5CA0E 2V8SV 3AECA 3RI5A 4DV1T 1MNDA 3R6NA 3F31A 3L3PA 3N9QA 3LK2B 2WDRA 1Y01A 4NXNT 5AQNB 5FKYA 3AE8A 2R6GF 3UQ7A 1MMGA 2XSBA 2KNDA 2LOSA 5IUXA 4JI4T 4HFVA 3ZCIA 3CX8B 1U4QA 3CQCB 1J5ET 3F57A 2Q9QA 4P1NA 4HWFA 1NAFA 1WYCA 3UU4A 4ILCA 2WMNA 3AE7A 4ISSA 4EB6E 3PUVF 5ABFB 2D2SA 2UXBT 4L9IA 5JVDE 4EEDA 3PUYF 4HWDA 5AQMB 2LE8A 2UUAT 2KINB 1Z0PA 4I55E 3KVAA 2W61A 2KT9A 3ABVA 2LHRA 3K3OA 5L4HA 2DL1A 1X79A 3C4WA 3EAMA 5JDQA 3VU7H 2N9DA 2DWKA 3K3NA 1JNZA 3WAKA 4LF4T 4IE0A 5J0ZA 4BAYB 3RC3A 2VKJA 4O4LE 5KMGP 1US7B 2ES0A 3G06A 3X1DA 4DBRA 3CQGB 3AA0B 4QH4A 4CXYA 1MMDA 4ANJA 5KX5E 5FNVE 3B57A 3N2KE 2WZIA 1XDOA 2ODUA 4QXCB 4B3MT 1IAPA 3MZKB 3KV6A 4PNIA 4TN7B 4U33A 2V7LA 2X0YA 3RRWA 4JLEA 1LRZA 2Y6XA 3O9XA 4B3TT 2C0SA 2HPLA 4EZHA 3C64A 2JMKA 4IE7A 5HWYA 4PJLA 3AAAB 4UIGA 4DV4T 2MTQA 4AKRB 5FVLA 1T72A 1X9BA 4DR4T 4ZI2D 4YSXA 1G73A 3OBVE 4WBOA 4CXXA 1LKXA 1MMNA 4YTMA 2J4GA 1SE7A 3ZJ1A 2FBWA 1T8BA 2BZBA 3O1HA 3C4ZA 1KFYA 4LMLA 5AQUB 4HGAA 1IJ5A 2LSJA 5LBMA 4K0UA 4CZZB 4X1IE 5DQVA 5EZYE 4OFZA 4ZS3A 2XAFB 5HEJA 5LMUT 1HCIA 4F8HA 4NXMT 2BKNA 5JR9C 5LOVE 1ZKEA 2C5IT 3MA9A 2QVAA 4MHCA 1WLXA 4X64T 4IDPA 1OEDA 3DTOA 3PDYA 4OYJA 4H63V 3UQ4A 3Q9DA 3HL6A 1HX1B 3EDVA 2PG8A 2ACXA 1CUNA 4Q25A 4TV9E 5JDLA 2L8KA 3N9LA 3FZLB 1OEDC 4JUYA 5A1LA 2PTFA 1W0BA 5HXCA 3L09A 4ZHQE 3QK6A 2E2AA 2V1DB 3AEAA 3LBXB 2VB6A 4H9PC 3ZSTA 1KF6A 1HS7A 2CXLA 5IHYA 2G0UA 5HXSA 2BG9A 3PV0F 3J9X1 2Y8DA 4I4TE 4DNDA 4EIWA 5JDMA 2ZM0A 2LKGA 4AKLA 4ZI2C 4DMWA 4DR3T 4ZI7E 5H6QB 3M65A 3PU3A 2ZLYA 3PTRB 5LA6E 4DO0A 2NW8A 4JI8T 1XMOT 1U5PA 2FUPA 3OYXA 2CWOA 4NUVA 1EZ3A 3EVYA 3VR8A 4AKGA 4BJNA 3ANWB 1NEKA 2IHR1 2UXCT 1D0ZA 3I1AA 2XQ8A 2CHNA 4DR5T 2PFVA 4U2YA 1YKEB 3UU3A 3I9WA 4YT0A 4X65T 5JRCB 5TAOA 2D9DA 3WI3A 4N78D 3TLSA 2MOZA 1XWMA 2X0HA 4OHFA 1WFDA 3RIFA 2P9BA 2E5VA 1FJGT 4U2ZA 5HYAA 3AEDA 4HFIA 2I59A 1J1JA 4PW8A 4HN9A 2LJLA 1O3XA 3TLWA 4F6RC 5HCJA 4A98A 4DV7T 4UF0A 4PJJA 4WW0A 3RPUA 1M7KA 3A8YC 3KBTA 5JDNA 4I0UA 2YINA 4AISA 2X51A 3RHWA 3OTOT 5LP6E 1QSDA 2MPKA 4PK6A 2ODVA 1ZP0A 1I6ZA 3P7IA 2WM9A 4BJMA 1MNEA 3ZMSB 2CXDA 3UU6A 2RP4A 3CPZA 4J2CA 2K48A 4U74A 3AB3B 2BS2A 4AKHA 3AE6A 3KV5A 2MAWA 1HG2A 3LG7A 3EDUA 3QOFA 4X20E 4AXPA 2WAUA 4ZEYA 4PAGA 4JYAT 4AI6A 3FBLA 3RIUA 3LK3B 4JEUB 3UFGA 4CN4A 3GN5A 5HXHA 1W0AA 2WWUA 2WZHA 4JV5T 5EK3A 4E7ZA 3RIUC 2NWBA 4YXDA 1XMQT 4X5TA 4AIUA 5LCYA 1J5WA 2SPCA 2X0LB 2LM2A 2W2UA 2LSIA 2KLQA 3PJAJ 4PK4A 2XM1A 3AAEB 2VVSA 4ZOLE 2V26A 4QH5A 3GMIA 3SRZA 3UU8A 3P4WA 4IDNA 3IEEA 4H9NC 3HR0A 3V5SA 4HEAA 4NUUA 3CIRA 5AQLB 1FMVA 4GIWA 2JQHA 4U7YA 1HG5A 4HTEA 3ZC1A 2W0GA 3RYCE 3LDQB 2VKDA 5FXVA 2NTXA 5JDHA 2V6YB 3L39A 2YU2A 5C3JA 1OWAA 2KMFA 3C4XA 3NZQA 5ABFA 2RPAA 4AQFC 1W9RA 3FZFB 3JAFA 2HN2A 2KZ7B 5LG3A 2OV9A 5L3EB 5CFBA 1T98A 5JTGA 3UUNA 3EHZA 3LFMA 3H3MA 4GK0E 2UXDT 3BQIA 4HFCA 1VRBA 4OK0A 3P50A 1KNRA 3B13A 1IBKT 2RA1A 4HWHA 4QXHB 4H9RC 3H3AA 5JREA 2LSYA 2V7JA 2ZM6T 4ILUA 4HFDA 4X62T 1HNZT 3Q5DA 3GWHA 3CVRA 3OPCA 2WBLA 3ESLA 1MIYA 2CCQA 4TNWA 4LF8T 4JI5T 4B3ST 5LMNT 4L5GA 5AQIB 5AQRB 4GOUA 2FJDA 5BR8T 2VKHA 2IIUA 1T7SA 1QLBA 2IDOB 3FBZA 3ZMZB 1MMAA 1E7PA 5L3FB 3AE1A 5HEOA 3UTKA 4EYUA 1HNWT 1FMWA 4K0KT 3DP7A 2H88A 2N1GA 4TX5A 3ZCJA 2XUEA 3UULA 2XQ4A 5J1GA 5JQGE 3ZJ2A 3C51A 4LFAT 3V5UA 4MBQA 5AQKB 3K1SA 1WRDA 4UV9B 2XM2A 4G2AA 2Q9QB 1E2AA 3O1JA 5F5WA 5ABGA 2WY2A 1UX5A 4IL9A 2VURA 3OKQA 4UVAB 4X66T 2VK9A 1ZEEA 3K8PC 5C8YE 4PFOA 2VVNA 2BDEA 3N9OA 3RQWA 2YU1A 3HKBE 2E9XD 3FZMB 3CK6A 3CKDA 4ADZA 1IZNB 3CMLA 2MYSA 3QC9A 4YTPA 1Y64B 1N32T 3UFEA 2WP9A 5GONE 4TWFA 2E5LT 4U7IA 4GK5E 2OLTA 3L8RA 4JBWF 3UU5A 3QB5A 2M67A 5EK4A 2V5DA 1ZOYA 2DCFA 5LG4A 2WWVA 3AEBA 5LGUB 3AEEA 2PBIA 3JADA 4GYRA 5AQOB 5CB4E 2YEVC 1XZYA 2UXNB 5JR9A 2K9AA 4IE6A 2AXDS 3LBXA 3MACA 4UV8B 3NVOA 2FJAA 4COFA 3AE5A 2K5BB 3AAIA 1JNRA 4EAHA 3FZKB 2LHNA 1M62A 2NW7A 2KWHA 5FL0A 2D0UA 2IC6A 5HCMA 1YW0A 2EHOB 5BMVE 2ZM8A 2NR4A 3HI2A 3PUAA 4P0BA 1H7CA 5HEGA 1I94T 2XSAA 4DV6T 3PUXF 5LJMA 3HKCE 1D0XA 1UUSA 3HA4A 4KUMB 2VL0A 4ZI3D 4UVBB 4JI7T 2XAGB 3T1YT 5AQFB 1D0YA 4AKIA 2DLRA 1S94A 2BVMA 4CN1A 4H9OC 2E9XA 3UUBA 3P8CD 4HFBA 5C2TA 4YJ3E 3HKEE 2JIWA 4C90A 2FJEA 4IDOA 2IMLA 4DR2T 2E9XC 2LOPA 4TUYE 1YQ4A 4O4HE 4JI1T 2XQ5A 3NRXA 4QX8B 1IJ6A 4CI3B 3ZSSA 4A5XA 4XBFB 5ADXL 3KVBA 5F8PA 4LF5T 1UGOA 4HWIB 1E1HB 3QNUA 5L3BB 3JCFA 5AQHB 4EEBA 4IL4A 4DR1T 3NWIA 2XQYA 3AA7B 4UR9A 2IW5B 1HF8A 3ONLC 4X1KE 2YDQA 4QH1A 4IIJE 2WB5A 3JC6D 4LMJA 4DV3T 4NIQA 3PJAA 4O2BE 3AA6B 3MJXA 2BS3A 2X68A 4KP3C 5DJQC 2BG9B 4TZ4C 3AE2A 2CM0A 2BVLA 1N34T 3MK7C 2A2FX 4LF9T 3UT5E 1HR0T 2UXXB 3IA3A 2ZMAA 3ZC0A 2V6XA 2X9WA 2LKHA 2KXPB 4P09A 4ZI3C 2UU9T 2JQ9A 4DV5T 1V9DA 3N9PA 3R84B 2V7IA 5J2TE 4KHPT 4FJOA 5LJNA 2CEAA 3RGLA 1FIOA 1B7TA 4IE5A 3NBXX 1BR1A 5AQTB 2QRXA 3RC8A 2LRLA 1LVFA 2XY8B 3RYFE 2N2NA 1NWMX 4A97A 3N5LA 3ONJA 3S4UA 3ZT7A 2QGSA 2LSGA 3SFDA 2QYWA 1YQ3A 2XTLA 2LRKA 4ILBA 4U3CA 3ZMVB 5FMNA 4DR7T 1XDPA 4DUZT 2JQQA 1UX4A 5AFUL 4UF0B 3T8OA 2XHEB 3PU8A 2V6YA 3RX6A 1WR6A 3FXDB 5HEHA 4QXBB 2AE9A 3ONXA 4HKAA 3I9YA 4YHJA 1HNXT 3QB5K 3VHLA 4ILAA 3ZKRA 1G8XA 2W00A 3AVRA 2YDRA 3GA8A 1ZV4X 3QUJA 5IYZE 2A3DA 1L0VA 5LHGB 2CLYB 1QUUA 4ZXLA 1UCUA 3D0TA 3P4QA 3RRCA 3P4SA 3RLFF 2LM9A 4IE4A 2X66A 3ETUA 3JC6C 2XQ7A 4UEMA 3N2GE 1D1CA 2PJQA 5FP3A 3PUWF 1SUMB 2L3LA 4CI2B 5CA1E 5AQJB 2WSSV 2M6IA 2LSKA 4P0AA 3E22E 1YD8G 2X9XA 2YOEA 5FXZA 3B5MA 2XAJB 3EI0A 4TNVA 4AQFA 4ZS2A 4FI5A 4WZXA 1OEDE 5FL1A 5J2UE 1KNPA 3LSVA 5FY1A 1UK5A 2XPKA 4GYSA 3SOLA 3HKDE 3PUSA 3VR9A 3EABA 1NENA 3PUGA 2YN6A 5EK2A 4WNKA 3PUQA 1HTJF 3EUHA 1W09A 5HAXA 3GN5B 3KBUA 3K3QC 3ETVA 2B76A 4YY3T 5AQSB 3PUZF 1Z8UA 4QWNB 2X67A 1BR0A 5CJ5A 3E08A 4HWCA 4HFHA 3ZPOA 2W67A 4PJMA 3IF8B 2WU5A 2BG9E 4TV8E 4IDZA 3Q5EA 5L4EA 2J62A 4AQYT 3PURA 4LF6T 3A5XA 3AXJB 4B6XA 3KFWX 2XASB 2CPTA 3FXEB 4H9SE 2XAQB 2E8IA 5KDMC 4YHHT 2EHOD 5JH7E 3UUXB 4GKKT 5LBQB 4JI3T 4WYVA 2W62A 4QHOA 4ERRA 5ABHA 4KHZF 1D1BA 2CWYA 3SFEA 3VRBA 2W4XA 4U72A 5HWXA 3ZLIA 3T1HT 2WDQA 3TLVA 1YKHB 2Q9QC 2X9HA 2XQ3A 3C98B 2WU2A 4DMVA 2UUBT 1N33T 4CN6A 5DABA 3E0ZA 5LHHB 1OXZA 4IGUA 5L3GB 1VOMA 3DJBA 2XQAA 4E7SA 4H9QC 4YFSA 2DHRA 2BBJA 1ZHCA 3AVSA 1DU2A 3RKGA 4DR6T 2VWAA 5M4YA 5LHIB 3CX7B 4Z91A 3ZMUB 3KDSE 4EZ4A 1WCRA 3M3ZB 4EXTA 4I43B 4YTNA 4TWDA 4LFCT 3RKOA 1FEWA 4LF7T 4OX9T 1VCTA 4WBNE 2YDSA 4XZCA 5L47A 2H3RA 2JPFA 1KK7A 2BBHA 4BA9A 1VCSA 4UXNB 4JI2T 5AQGB 5ETWA 4H63H 5FXXA 1MIWA 1UURA 2YK0A 5HXRA 4IT4A 2EHOA 3W15B 4TWHA 4B3RT 5LGTB 1SHZC 3Q5XA 3WAJA 1CHUA
chains in the Genus database with same CATH topology
5AQNB 5AQUB 3LDQB 4HWHA 5AQGB 5AQFB 5AQSB 5AQTB 5AQHB 2D9DA 1I6ZA 1UK5A 4HWFA 5AQVB 1M7KA 3A8YC 3FZHB 5AQKB 1HX1B 4HWCA 5AQLB 4HWDA 5AQQB 5AQMB 5AQIB 3M3ZB 5AQJB 1UGOA 5AQRB 3FZKB 4HWIB 5AQOB 3FZFB 5AQPB 1M62A 3FZMB 3FZLB 1T7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQN B;  5AQU B;  3LDQ B;  4HWH A;  5AQG B;  5AQF B;  5AQS B;  5AQT B;  5AQH B;  2D9D A;  1I6Z A;  1UK5 A;  4HWF A;  5AQV B;  1M7K A;  3A8Y C;  3FZH B;  5AQK B;  1HX1 B;  4HWC A;  5AQL B;  4HWD A;  5AQQ B;  5AQM B;  5AQI B;  3M3Z B;  5AQJ B;  1UGO A;  5AQR B;  3FZK B;  4HWI B;  5AQO B;  3FZF B;  5AQP B;  1M62 A;  3FZM B;  3FZL B;  1T7S A; 
#chains in the Genus database with same CATH topology
 4QX7 B;  2EHO C;  4AQG A;  2UUC T;  3CQX C;  3F2E A;  5FYM A;  5H6R B;  3AEF A;  4DID B;  1XNR T;  5L3D B;  1IBM T;  2VL8 A;  2X9Y A;  1LVK A;  5AQP B;  2MBG A;  2CE7 A;  5LXT E;  3ZT5 A;  2BKP A;  2WDV A;  4MLK A;  2D0T A;  4IRE A;  3LJC A;  3VKG A;  5HEU A;  2W66 A;  3AA1 B;  4HE8 A;  4EOZ B;  1IBL T;  1R8I A;  3KV4 A;  4ZZC A;  2ACZ A;  2ZM2 A;  2QA7 A;  3JAE A;  3RYH E;  4MFR A;  2W63 A;  5KXJ A;  5FY0 A;  3BQL A;  2LLY A;  4L0R A;  3ZYK A;  2L9Q A;  2NP9 A;  3MXZ A;  4PJN A;  4PFP A;  5ABE A;  3RF1 A;  3MKD A;  3AE3 A;  3TLU A;  3OVU A;  2V7K A;  4YLH A;  2YKS A;  4DBQ A;  2D5U A;  4CQI A;  4UVC B;  4IHJ E;  4EYY R;  5JDG A;  2CXF A;  3ANW A;  2H7O A;  5L3C B;  2JMH A;  3TKL B;  2H7V C;  3ZN0 B;  3TLT A;  1N36 T;  5LGN B;  4KBM B;  4KMC A;  1AJ3 A;  3AE9 A;  4O4I E;  3FHN A;  2IUB A;  3IHR A;  3I0Q A;  5JRC A;  3OYZ A;  2K24 A;  3NRY A;  4C91 A;  3P4R A;  2NTY A;  5JR9 B;  4YSZ A;  1BR4 A;  5AQV B;  2XQ6 A;  3FZH B;  5AQQ B;  2IAK A;  3J7Y q;  4I50 E;  1HFA A;  3C50 A;  2LT3 A;  4O8S A;  4O2A E;  1MIV A;  1SA0 E;  4O4J E;  5LB7 B;  3H37 A;  3NZP A;  2BG9 C;  4G63 A;  3ZMT B;  4YJ2 E;  2V7M A;  2A72 A;  2A9U A;  3N9M A;  4ASK A;  1OED B;  3ZYM A;  4KI0 F;  5FY7 A;  5FXW A;  2BKO A;  5L2L A;  4OYK A;  3N9N A;  1BR2 A;  3AEG A;  4V1A v;  2LEH A;  4IDQ A;  4MAL A;  5LYJ E;  4U31 A;  2I6H A;  2DWG A;  2CA5 A;  2E9X B;  4EGW A;  3P4P A;  2WS3 A;  1D1A A;  4UEL A;  3OJA A;  3RH3 A;  2XJ7 A;  5DQW A;  4Z8X A;  3U78 A;  4YSY A;  5CGM A;  2IC9 A;  4JEH B;  4GKJ T;  2K3W A;  2BS4 A;  3BQK A;  1XNQ T;  2NW9 A;  2KSR A;  2XQ9 A;  2C5K T;  2HPJ A;  2M6B A;  4ZZB A;  2NOX A;  4M1P A;  3KV9 A;  2KWI B;  5IWA T;  3O4X E;  2Y48 B;  1GQE A;  2WQY A;  1WR0 A;  3VKH A;  4HFE A;  2OA5 A;  2Z6E A;  3O1I A;  2VQE T;  2V5C A;  3A7M A;  2CRB A;  3SS1 A;  3BK9 A;  3KIN B;  3CWZ B;  2CBJ A;  4IST A;  5LNK A;  4LFB T;  1KEY A;  1WYB A;  2CLY C;  2DI4 A;  2VKO A;  2I0M A;  3N2O A;  2CBI A;  5E0O A;  5JDF A;  2CMR A;  4LMK A;  3ZEF B;  4EV6 A;  4CI1 B;  3PE0 A;  2H89 A;  3FB2 A;  1KNZ A;  4A56 A;  4XAX B;  3NKZ A;  4Z90 A;  2HN1 A;  4DUY T;  3CX6 B;  3Q2M A;  3RYI E;  1S35 A;  2XZE A;  4QKN A;  2Q9Q D;  3UUM A;  2JRK A;  4JI6 T;  2F4V T;  2GK9 A;  1HX8 A;  4NPP A;  3ZN1 B;  3VRA A;  3I0O A;  2VQF T;  2HHH T;  2J47 A;  2B1E A;  4X1Y E;  3SWH A;  4PK5 A;  2WMO A;  2DNX A;  5FVK A;  3AXJ A;  2FJB A;  5HXE A;  2WCA A;  4DV2 T;  2CHO A;  4DV0 T;  3LK4 2;  4JI0 T;  3AE4 A;  3RQU A;  3U3I A;  3RIA A;  2J1D G;  2JJ9 A;  2C5J A;  3ZYL A;  3IBP A;  1YXR A;  4KX6 A;  2VAS A;  3ZT6 A;  4DVD A;  5F3J A;  2JQK A;  3Q5W A;  2HH7 A;  2XAH B;  4CXW A;  5CA0 E;  2V8S V;  3AEC A;  3RI5 A;  4DV1 T;  1MND A;  3R6N A;  3F31 A;  3L3P A;  3N9Q A;  3LK2 B;  2WDR A;  1Y01 A;  4NXN T;  5AQN B;  5FKY A;  3AE8 A;  2R6G F;  3UQ7 A;  1MMG A;  2XSB A;  2KND A;  2LOS A;  5IUX A;  4JI4 T;  4HFV A;  3ZCI A;  3CX8 B;  1U4Q A;  3CQC B;  1J5E T;  3F57 A;  2Q9Q A;  4P1N A;  4HWF A;  1NAF A;  1WYC A;  3UU4 A;  4ILC A;  2WMN A;  3AE7 A;  4ISS A;  4EB6 E;  3PUV F;  5ABF B;  2D2S A;  2UXB T;  4L9I A;  5JVD E;  4EED A;  3PUY F;  4HWD A;  5AQM B;  2LE8 A;  2UUA T;  2KIN B;  1Z0P A;  4I55 E;  3KVA A;  2W61 A;  2KT9 A;  3ABV A;  2LHR A;  3K3O A;  5L4H A;  2DL1 A;  1X79 A;  3C4W A;  3EAM A;  5JDQ A;  3VU7 H;  2N9D A;  2DWK A;  3K3N A;  1JNZ A;  3WAK A;  4LF4 T;  4IE0 A;  5J0Z A;  4BAY B;  3RC3 A;  2VKJ A;  4O4L E;  5KMG P;  1US7 B;  2ES0 A;  3G06 A;  3X1D A;  4DBR A;  3CQG B;  3AA0 B;  4QH4 A;  4CXY A;  1MMD A;  4ANJ A;  5KX5 E;  5FNV E;  3B57 A;  3N2K E;  2WZI A;  1XDO A;  2ODU A;  4QXC B;  4B3M T;  1IAP A;  3MZK B;  3KV6 A;  4PNI A;  4TN7 B;  4U33 A;  2V7L A;  2X0Y A;  3RRW A;  4JLE A;  1LRZ A;  2Y6X A;  3O9X A;  4B3T T;  2C0S A;  2HPL A;  4EZH A;  3C64 A;  2JMK A;  4IE7 A;  5HWY A;  4PJL A;  3AAA B;  4UIG A;  4DV4 T;  2MTQ A;  4AKR B;  5FVL A;  1T72 A;  1X9B A;  4DR4 T;  4ZI2 D;  4YSX A;  1G73 A;  3OBV E;  4WBO A;  4CXX A;  1LKX A;  1MMN A;  4YTM A;  2J4G A;  1SE7 A;  3ZJ1 A;  2FBW A;  1T8B A;  2BZB A;  3O1H A;  3C4Z A;  1KFY A;  4LML A;  5AQU B;  4HGA A;  1IJ5 A;  2LSJ A;  5LBM A;  4K0U A;  4CZZ B;  4X1I E;  5DQV A;  5EZY E;  4OFZ A;  4ZS3 A;  2XAF B;  5HEJ A;  5LMU T;  1HCI A;  4F8H A;  4NXM T;  2BKN A;  5JR9 C;  5LOV E;  1ZKE A;  2C5I T;  3MA9 A;  2QVA A;  4MHC A;  1WLX A;  4X64 T;  4IDP A;  1OED A;  3DTO A;  3PDY A;  4OYJ A;  4H63 V;  3UQ4 A;  3Q9D A;  3HL6 A;  1HX1 B;  3EDV A;  2PG8 A;  2ACX A;  1CUN A;  4Q25 A;  4TV9 E;  5JDL A;  2L8K A;  3N9L A;  3FZL B;  1OED C;  4JUY A;  5A1L A;  2PTF A;  1W0B A;  5HXC A;  3L09 A;  4ZHQ E;  3QK6 A;  2E2A A;  2V1D B;  3AEA A;  3LBX B;  2VB6 A;  4H9P C;  3ZST A;  1KF6 A;  1HS7 A;  2CXL A;  5IHY A;  2G0U A;  5HXS A;  2BG9 A;  3PV0 F;  3J9X 1;  2Y8D A;  4I4T E;  4DND A;  4EIW A;  5JDM A;  2ZM0 A;  2LKG A;  4AKL A;  4ZI2 C;  4DMW A;  4DR3 T;  4ZI7 E;  5H6Q B;  3M65 A;  3PU3 A;  2ZLY A;  3PTR B;  5LA6 E;  4DO0 A;  2NW8 A;  4JI8 T;  1XMO T;  1U5P A;  2FUP A;  3OYX A;  2CWO A;  4NUV A;  1EZ3 A;  3EVY A;  3VR8 A;  4AKG A;  4BJN A;  3ANW B;  1NEK A;  2IHR 1;  2UXC T;  1D0Z A;  3I1A A;  2XQ8 A;  2CHN A;  4DR5 T;  2PFV A;  4U2Y A;  1YKE B;  3UU3 A;  3I9W A;  4YT0 A;  4X65 T;  5JRC B;  5TAO A;  2D9D A;  3WI3 A;  4N78 D;  3TLS A;  2MOZ A;  1XWM A;  2X0H A;  4OHF A;  1WFD A;  3RIF A;  2P9B A;  2E5V A;  1FJG T;  4U2Z A;  5HYA A;  3AED A;  4HFI A;  2I59 A;  1J1J A;  4PW8 A;  4HN9 A;  2LJL A;  1O3X A;  3TLW A;  4F6R C;  5HCJ A;  4A98 A;  4DV7 T;  4UF0 A;  4PJJ A;  4WW0 A;  3RPU A;  1M7K A;  3A8Y C;  3KBT A;  5JDN A;  4I0U A;  2YIN A;  4AIS A;  2X51 A;  3RHW A;  3OTO T;  5LP6 E;  1QSD A;  2MPK A;  4PK6 A;  2ODV A;  1ZP0 A;  1I6Z A;  3P7I A;  2WM9 A;  4BJM A;  1MNE A;  3ZMS B;  2CXD A;  3UU6 A;  2RP4 A;  3CPZ A;  4J2C A;  2K48 A;  4U74 A;  3AB3 B;  2BS2 A;  4AKH A;  3AE6 A;  3KV5 A;  2MAW A;  1HG2 A;  3LG7 A;  3EDU A;  3QOF A;  4X20 E;  4AXP A;  2WAU A;  4ZEY A;  4PAG A;  4JYA T;  4AI6 A;  3FBL A;  3RIU A;  3LK3 B;  4JEU B;  3UFG A;  4CN4 A;  3GN5 A;  5HXH A;  1W0A A;  2WWU A;  2WZH A;  4JV5 T;  5EK3 A;  4E7Z A;  3RIU C;  2NWB A;  4YXD A;  1XMQ T;  4X5T A;  4AIU A;  5LCY A;  1J5W A;  2SPC A;  2X0L B;  2LM2 A;  2W2U A;  2LSI A;  2KLQ A;  3PJA J;  4PK4 A;  2XM1 A;  3AAE B;  2VVS A;  4ZOL E;  2V26 A;  4QH5 A;  3GMI A;  3SRZ A;  3UU8 A;  3P4W A;  4IDN A;  3IEE A;  4H9N C;  3HR0 A;  3V5S A;  4HEA A;  4NUU A;  3CIR A;  5AQL B;  1FMV A;  4GIW A;  2JQH A;  4U7Y A;  1HG5 A;  4HTE A;  3ZC1 A;  2W0G A;  3RYC E;  3LDQ B;  2VKD A;  5FXV A;  2NTX A;  5JDH A;  2V6Y B;  3L39 A;  2YU2 A;  5C3J A;  1OWA A;  2KMF A;  3C4X A;  3NZQ A;  5ABF A;  2RPA A;  4AQF C;  1W9R A;  3FZF B;  3JAF A;  2HN2 A;  2KZ7 B;  5LG3 A;  2OV9 A;  5L3E B;  5CFB A;  1T98 A;  5JTG A;  3UUN A;  3EHZ A;  3LFM A;  3H3M A;  4GK0 E;  2UXD T;  3BQI A;  4HFC A;  1VRB A;  4OK0 A;  3P50 A;  1KNR A;  3B13 A;  1IBK T;  2RA1 A;  4HWH A;  4QXH B;  4H9R C;  3H3A A;  5JRE A;  2LSY A;  2V7J A;  2ZM6 T;  4ILU A;  4HFD A;  4X62 T;  1HNZ T;  3Q5D A;  3GWH A;  3CVR A;  3OPC A;  2WBL A;  3ESL A;  1MIY A;  2CCQ A;  4TNW A;  4LF8 T;  4JI5 T;  4B3S T;  5LMN T;  4L5G A;  5AQI B;  5AQR B;  4GOU A;  2FJD A;  5BR8 T;  2VKH A;  2IIU A;  1T7S A;  1QLB A;  2IDO B;  3FBZ A;  3ZMZ B;  1MMA A;  1E7P A;  5L3F B;  3AE1 A;  5HEO A;  3UTK A;  4EYU A;  1HNW T;  1FMW A;  4K0K T;  3DP7 A;  2H88 A;  2N1G A;  4TX5 A;  3ZCJ A;  2XUE A;  3UUL A;  2XQ4 A;  5J1G A;  5JQG E;  3ZJ2 A;  3C51 A;  4LFA T;  3V5U A;  4MBQ A;  5AQK B;  3K1S A;  1WRD A;  4UV9 B;  2XM2 A;  4G2A A;  2Q9Q B;  1E2A A;  3O1J A;  5F5W A;  5ABG A;  2WY2 A;  1UX5 A;  4IL9 A;  2VUR A;  3OKQ A;  4UVA B;  4X66 T;  2VK9 A;  1ZEE A;  3K8P C;  5C8Y E;  4PFO A;  2VVN A;  2BDE A;  3N9O A;  3RQW A;  2YU1 A;  3HKB E;  2E9X D;  3FZM B;  3CK6 A;  3CKD A;  4ADZ A;  1IZN B;  3CML A;  2MYS A;  3QC9 A;  4YTP A;  1Y64 B;  1N32 T;  3UFE A;  2WP9 A;  5GON E;  4TWF A;  2E5L T;  4U7I A;  4GK5 E;  2OLT A;  3L8R A;  4JBW F;  3UU5 A;  3QB5 A;  2M67 A;  5EK4 A;  2V5D A;  1ZOY A;  2DCF A;  5LG4 A;  2WWV A;  3AEB A;  5LGU B;  3AEE A;  2PBI A;  3JAD A;  4GYR A;  5AQO B;  5CB4 E;  2YEV C;  1XZY A;  2UXN B;  5JR9 A;  2K9A A;  4IE6 A;  2AXD S;  3LBX A;  3MAC A;  4UV8 B;  3NVO A;  2FJA A;  4COF A;  3AE5 A;  2K5B B;  3AAI A;  1JNR A;  4EAH A;  3FZK B;  2LHN A;  1M62 A;  2NW7 A;  2KWH A;  5FL0 A;  2D0U A;  2IC6 A;  5HCM A;  1YW0 A;  2EHO B;  5BMV E;  2ZM8 A;  2NR4 A;  3HI2 A;  3PUA A;  4P0B A;  1H7C A;  5HEG A;  1I94 T;  2XSA A;  4DV6 T;  3PUX F;  5LJM A;  3HKC E;  1D0X A;  1UUS A;  3HA4 A;  4KUM B;  2VL0 A;  4ZI3 D;  4UVB B;  4JI7 T;  2XAG B;  3T1Y T;  5AQF B;  1D0Y A;  4AKI A;  2DLR A;  1S94 A;  2BVM A;  4CN1 A;  4H9O C;  2E9X A;  3UUB A;  3P8C D;  4HFB A;  5C2T A;  4YJ3 E;  3HKE E;  2JIW A;  4C90 A;  2FJE A;  4IDO A;  2IML A;  4DR2 T;  2E9X C;  2LOP A;  4TUY E;  1YQ4 A;  4O4H E;  4JI1 T;  2XQ5 A;  3NRX A;  4QX8 B;  1IJ6 A;  4CI3 B;  3ZSS A;  4A5X A;  4XBF B;  5ADX L;  3KVB A;  5F8P A;  4LF5 T;  1UGO A;  4HWI B;  1E1H B;  3QNU A;  5L3B B;  3JCF A;  5AQH B;  4EEB A;  4IL4 A;  4DR1 T;  3NWI A;  2XQY A;  3AA7 B;  4UR9 A;  2IW5 B;  1HF8 A;  3ONL C;  4X1K E;  2YDQ A;  4QH1 A;  4IIJ E;  2WB5 A;  3JC6 D;  4LMJ A;  4DV3 T;  4NIQ A;  3PJA A;  4O2B E;  3AA6 B;  3MJX A;  2BS3 A;  2X68 A;  4KP3 C;  5DJQ C;  2BG9 B;  4TZ4 C;  3AE2 A;  2CM0 A;  2BVL A;  1N34 T;  3MK7 C;  2A2F X;  4LF9 T;  3UT5 E;  1HR0 T;  2UXX B;  3IA3 A;  2ZMA A;  3ZC0 A;  2V6X A;  2X9W A;  2LKH A;  2KXP B;  4P09 A;  4ZI3 C;  2UU9 T;  2JQ9 A;  4DV5 T;  1V9D A;  3N9P A;  3R84 B;  2V7I A;  5J2T E;  4KHP T;  4FJO A;  5LJN A;  2CEA A;  3RGL A;  1FIO A;  1B7T A;  4IE5 A;  3NBX X;  1BR1 A;  5AQT B;  2QRX A;  3RC8 A;  2LRL A;  1LVF A;  2XY8 B;  3RYF E;  2N2N A;  1NWM X;  4A97 A;  3N5L A;  3ONJ A;  3S4U A;  3ZT7 A;  2QGS A;  2LSG A;  3SFD A;  2QYW A;  1YQ3 A;  2XTL A;  2LRK A;  4ILB A;  4U3C A;  3ZMV B;  5FMN A;  4DR7 T;  1XDP A;  4DUZ T;  2JQQ A;  1UX4 A;  5AFU L;  4UF0 B;  3T8O A;  2XHE B;  3PU8 A;  2V6Y A;  3RX6 A;  1WR6 A;  3FXD B;  5HEH A;  4QXB B;  2AE9 A;  3ONX A;  4HKA A;  3I9Y A;  4YHJ A;  1HNX T;  3QB5 K;  3VHL A;  4ILA A;  3ZKR A;  1G8X A;  2W00 A;  3AVR A;  2YDR A;  3GA8 A;  1ZV4 X;  3QUJ A;  5IYZ E;  2A3D A;  1L0V A;  5LHG B;  2CLY B;  1QUU A;  4ZXL A;  1UCU A;  3D0T A;  3P4Q A;  3RRC A;  3P4S A;  3RLF F;  2LM9 A;  4IE4 A;  2X66 A;  3ETU A;  3JC6 C;  2XQ7 A;  4UEM A;  3N2G E;  1D1C A;  2PJQ A;  5FP3 A;  3PUW F;  1SUM B;  2L3L A;  4CI2 B;  5CA1 E;  5AQJ B;  2WSS V;  2M6I A;  2LSK A;  4P0A A;  3E22 E;  1YD8 G;  2X9X A;  2YOE A;  5FXZ A;  3B5M A;  2XAJ B;  3EI0 A;  4TNV A;  4AQF A;  4ZS2 A;  4FI5 A;  4WZX A;  1OED E;  5FL1 A;  5J2U E;  1KNP A;  3LSV A;  5FY1 A;  1UK5 A;  2XPK A;  4GYS A;  3SOL A;  3HKD E;  3PUS A;  3VR9 A;  3EAB A;  1NEN A;  3PUG A;  2YN6 A;  5EK2 A;  4WNK A;  3PUQ A;  1HTJ F;  3EUH A;  1W09 A;  5HAX A;  3GN5 B;  3KBU A;  3K3Q C;  3ETV A;  2B76 A;  4YY3 T;  5AQS B;  3PUZ F;  1Z8U A;  4QWN B;  2X67 A;  1BR0 A;  5CJ5 A;  3E08 A;  4HWC A;  4HFH A;  3ZPO A;  2W67 A;  4PJM A;  3IF8 B;  2WU5 A;  2BG9 E;  4TV8 E;  4IDZ A;  3Q5E A;  5L4E A;  2J62 A;  4AQY T;  3PUR A;  4LF6 T;  3A5X A;  3AXJ B;  4B6X A;  3KFW X;  2XAS B;  2CPT A;  3FXE B;  4H9S E;  2XAQ B;  2E8I A;  5KDM C;  4YHH T;  2EHO D;  5JH7 E;  3UUX B;  4GKK T;  5LBQ B;  4JI3 T;  4WYV A;  2W62 A;  4QHO A;  4ERR A;  5ABH A;  4KHZ F;  1D1B A;  2CWY A;  3SFE A;  3VRB A;  2W4X A;  4U72 A;  5HWX A;  3ZLI A;  3T1H T;  2WDQ A;  3TLV A;  1YKH B;  2Q9Q C;  2X9H A;  2XQ3 A;  3C98 B;  2WU2 A;  4DMV A;  2UUB T;  1N33 T;  4CN6 A;  5DAB A;  3E0Z A;  5LHH B;  1OXZ A;  4IGU A;  5L3G B;  1VOM A;  3DJB A;  2XQA A;  4E7S A;  4H9Q C;  4YFS A;  2DHR A;  2BBJ A;  1ZHC A;  3AVS A;  1DU2 A;  3RKG A;  4DR6 T;  2VWA A;  5M4Y A;  5LHI B;  3CX7 B;  4Z91 A;  3ZMU B;  3KDS E;  4EZ4 A;  1WCR A;  3M3Z B;  4EXT A;  4I43 B;  4YTN A;  4TWD A;  4LFC T;  3RKO A;  1FEW A;  4LF7 T;  4OX9 T;  1VCT A;  4WBN E;  2YDS A;  4XZC A;  5L47 A;  2H3R A;  2JPF A;  1KK7 A;  2BBH A;  4BA9 A;  1VCS A;  4UXN B;  4JI2 T;  5AQG B;  5ETW A;  4H63 H;  5FXX A;  1MIW A;  1UUR A;  2YK0 A;  5HXR A;  4IT4 A;  2EHO A;  3W15 B;  4TWH A;  4B3R T;  5LGT B;  1SHZ C;  3Q5X A;  3WAJ A;  1CHU A; 
#chains in the Genus database with same CATH homology
 5AQN B;  5AQU B;  3LDQ B;  4HWH A;  5AQG B;  5AQF B;  5AQS B;  5AQT B;  5AQH B;  2D9D A;  1I6Z A;  1UK5 A;  4HWF A;  5AQV B;  1M7K A;  3A8Y C;  3FZH B;  5AQK B;  1HX1 B;  4HWC A;  5AQL B;  4HWD A;  5AQQ B;  5AQM B;  5AQI B;  3M3Z B;  5AQJ B;  1UGO A;  5AQR B;  3FZK B;  4HWI B;  5AQO B;  3FZF B;  5AQP B;  1M62 A;  3FZM B;  3FZL B;  1T7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...