4HWCA

Structure of atbag1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
86
structure length
86
Chain Sequence
SASKAISDISLEVDRLGGRVSAFEMVTKKGGKIAEKDLVTVIELLMNELIKLDAIVAEGDVKLQRKMQVKRVQNYVETLDALKVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Apoptosis
molecule keywords BAG family molecular chaperone regulator 1
publication title Structural insight into plant programmed cell death mediated by BAG proteins in Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 37
structure length 86
sequence length 86
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 4hwcA00
3M3ZB 5AQIB 5AQQB 5AQTB 5AQNB 3FZHB 5AQUB 1M7KA 5AQPB 4HWHA 5AQRB 1T7SA 5AQGB 3FZMB 4HWFA 4HWCA 1UK5A 5AQVB 1I6ZA 2D9DA 5AQOB 5AQJB 4HWDA 4HWIB 3LDQB 5AQMB 1HX1B 1UGOA 3FZLB 3FZFB 5AQKB 5AQFB 1M62A 5AQLB 5AQHB 5AQSB 3A8YC 3FZKB
chains in the Genus database with same CATH superfamily
2VURA 2XQ5A 4JEHB 3IEEA 4DV1T 4BAYB 3AE9A 3OBVE 3GN5B 2VL8A 4DUZT 3UU8A 3Q5XA 3ZJ2A 2NR4A 3AA7B 3K1SA 4C90A 4O2BE 3PUVF 3IF8B 4ZEYA 5EZYE 2BS2A 4OHFA 2PG8A 3OYXA 4LMKA 1UX4A 1W9RA 2FUPA 1JNRA 4CQIA 2QYWA 4AKGA 2H88A 5LXTE 2WSSV 2V7MA 2IC6A 5JRCB 2VQFT 4JV5T 2ACZA 3BQKA 2HPJA 1WR0A 1NAFA 4EIWA 3TLUA 3N9MA 2WU5A 4HFIA 4HKAA 5FP3A 5FNVE 2HPLA 2BG9B 3AEAA 2N9DA 2XJ7A 1IBLT 3AE4A 3UULA 1W0AA 3AAIA 4O8SA 3ESLA 2WU2A 3EABA 4A56A 3FZKB 4U7IA 3P4PA 1WRDA 4IT4A 2UXBT 1US7B 4ERRA 1UCUA 5CA0E 1WYBA 5JREA 4OYKA 2IMLA 4DR5T 5A1LA 4UXNB 4XAXB 3LSVA 2ODVA 4JUYA 4QH1A 3ZYKA 2CLYC 3ZT6A 1N36T 1BR2A 3HKBE 4PAGA 5DQVA 3MJXA 4DR3T 2MTQA 2KSRA 4IE6A 3CX6B 3ZEFB 3RIAA 2EHOB 4YTPA 1LVKA 4YXDA 4YJ3E 2ODUA 4PNIA 2A72A 4QKNA 2Y48B 3VKHA 3Q2MA 3WAKA 3LJCA 3FBLA 4PFOA 2WS3A 5LP6E 4JYAT 2V1DB 2BZBA 1ZOYA 2BKOA 5FY7A 2J1DG 4FJOA 3EDVA 2C5IT 1OEDE 2YINA 2I59A 2H7OA 3CQCB 5AQRB 3Q9DA 2XAQB 3MXZA 3P8CD 5JDMA 5IWAT 4B3TT 1S94A 1N32T 3CPZA 2MPKA 4LF9T 2CHNA 5AFUL 3OYZA 2C5KT 4COFA 2QA7A 4DO0A 3TLTA 2W4XA 2A9UA 2H7VC 2J4GA 2BKPA 3F2EA 4B3RT 2ZM2A 4U33A 3RRCA 3ZCJA 4G2AA 3PJAA 2D2SA 2W62A 1X79A 4E7SA 5LJNA 3SWHA 1YW0A 4ILBA 4IIJE 5ABGA 3TKLB 4HWCA 3RH3A 1WLXA 5L4HA 4P0AA 1YD8G 3BQIA 2KWHA 3AE3A 3NZQA 2LRLA 3UUMA 5JR9B 4M1PA 1FMVA 5IHYA 3ETUA 4UF0A 2ZM6T 3JC6D 1U5PA 1XNRT 4F8HA 5HEGA 2UUAT 4HN9A 3ZJ1A 3ABVA 2J62A 5L3FB 2WM9A 3AXJB 2WP9A 4CXXA 2MYSA 2HN2A 3DJBA 5HCJA 3RPUA 2LM2A 2LSGA 3J7Yq 1XZYA 4QH4A 3GMIA 3ZT7A 3N5LA 4IL4A 5F5WA 3MZKB 2K48A 4HFBA 1QSDA 2Y6XA 4IDZA 3ZSTA 1WFDA 1YQ4A 5LA6E 5FY0A 2XAHB 3PE0A 1Z8UA 2LSIA 3O1IA 2VKHA 1KNZA 3QK6A 3ZKRA 2W2UA 5AQSB 3P50A 5CA1E 3P4QA 2LM9A 5IUXA 3EUHA 2IC9A 4BA9A 2X9XA 4MALA 2EHOD 4TUYE 2L3LA 2L8KA 4X20E 5IYZE 4YTMA 1YQ3A 3AE5A 2X9HA 4HFCA 2HH7A 4CN6A 4DV5T 1WCRA 3AE8A 1KFYA 2QRXA 4JI8T 4I55E 3AE7A 3R84B 4AQYT 4JLEA 2AE9A 2IUBA 1XDOA 5FVKA 2XQ3A 3ZLIA 5LOVE 1MMGA 5HCMA 2KXPB 4CXYA 4KI0F 4EGWA 4L9IA 2XAGB 2K5BB 2Q9QA 3QB5A 4AKLA 3IA3A 3SOLA 4K0KT 4NXMT 3HR0A 4ZS3A 2IAKA 4ZI7E 4B6XA 2D0TA 2X51A 4WBOA 2E9XB 2V8SV 5L3EB 5LBMA 4ZZCA 4XBFB 5EK2A 5KX5E 2OV9A 1UUSA 2N1GA 5LHGB 2DWKA 4X66T 4JI6T 2C5JA 1HG2A 2MAWA 2KZ7B 3DTOA 4UVCB 2ZMAA 2BS4A 2X9YA 4IHJE 3JCFA 4EXTA 1OWAA 5H6RB 2Q9QC 1O3XA 2RA1A 4QX7B 4HFDA 2BKNA 3ZMTB 4AQFA 2VQET 5CJ5A 2SPCA 1ZV4X 4UVBB 5JQGE 2CCQA 3HKDE 4WNKA 4AKHA 2BBHA 3NRYA 3L09A 4FI5A 4ZXLA 5KDMC 4LF4T 5AQMB 3FBZA 4U31A 3L39A 5AQKB 2X0HA 2FBWA 3BK9A 3CK6A 4U7YA 2X9WA 2CHOA 1IAPA 4YSXA 3KINB 4CI3B 2Z6EA 2EHOC 3A5XA 2UXDT 5FVLA 3WAJA 3CIRA 4DMWA 2BVMA 4O4IE 3A7MA 2ZM8A 2XUEA 2UU9T 4IE0A 2E5LT 5AQTB 5EK4A 2WZHA 1I94T 4PJLA 1MIYA 4AQFC 4KHZF 1XMOT 2WDVA 2XSBA 2E2AA 4LF8T 2XY8B 2VVNA 2CBIA 3I0QA 3AEEA 5ABHA 4DV2T 5JR9A 3F57A 3UT5E 3PUYF 3T1YT 3VR8A 3LG7A 3QB5K 2YK0A 4HWDA 3ONXA 3HA4A 3SS1A 4LFAT 4OYJA 1M7KA 2LHRA 2D0UA 4QXBB 3OKQA 5FXZA 5HEUA 3AEFA 2BDEA 5AQOB 3C98B 4I50E 2PBIA 3OPCA 2LJLA 2CA5A 1BR0A 4MFRA 5JDHA 3UUNA 3RLFF 4U74A 5JVDE 4MLKA 3VHLA 3JAFA 5JR9C 2K9AA 1HF8A 3PUXF 3NVOA 2NTYA 5ETWA 2JQ9A 4U2YA 4NUUA 4ANJA 5AQFB 3CX7B 3ONJA 3AEDA 3GWHA 3K3OA 4QH5A 3SRZA 2E9XD 3PU8A 5HEJA 1SA0E 5L4EA 2WWUA 3RGLA 5LGTB 5J0ZA 2XQYA 3HL6A 3HKEE 4KHPT 5FXVA 4H63H 2B1EA 3T1HT 1WR6A 3RYFE 1MMDA 3UQ4A 3AA6B 2KMFA 2LOSA 5L3BB 4QHOA 4TX5A 4AKIA 3ZSSA 1HNWT 5ABFA 2IHR1 4IGUA 1IJ6A 1VRBA 4DV6T 4JI7T 4KP3C 4HGAA 3OTOT 2R6GF 2PTFA 4IDPA 1HNXT 4UR9A 2XQ8A 1H7CA 3UU5A 4ZHQE 5FMNA 2VKOA 5L3GB 1MMNA 4PJMA 2N2NA 2LE8A 3E22E 2CM0A 4ADZA 2VWAA 2JIWA 4YTNA 2W66A 4EEDA 2J47A 1FEWA 4YY3T 1D1CA 4TN7B 4IREA 4ASKA 4JI2T 4KUMB 4B3ST 1T72A 2WCAA 3PU3A 2XHEB 3FB2A 4GKJT 5KMGP 3QOFA 4HTEA 3ZMZB 5DABA 4PK4A 4F6RC 1ZEEA 2H3RA 3C4ZA 4JI4T 3TLVA 3WI3A 4Z90A 3K8PC 2WY2A 5HAXA 2LEHA 4UEMA 1XWMA 2BG9E 4Z8XA 4PK6A 2JMHA 3ZYMA 5AQUB 1NENA 2RPAA 5LYJE 1UK5A 3AAAB 2PJQA 3AE6A 2WDRA 4U72A 1MNDA 5FXWA 1UURA 3NRXA 1DU2A 1IBKT 3KV4A 3VU7H 4IE5A 1HS7A 4OFZA 4CXWA 2X0YA 5HYAA 3ANWA 2JQKA 3AE2A 5FY1A 3ETVA 4KMCA 3MK7C 2F4VT 3X1DA 3FZFB 2BBJA 4P1NA 1HTJF 1W0BA 1SHZC 3C4XA 1X9BA 5JDNA 3GA8A 4UIGA 3SFEA 2HHHT 5CGMA 3P4RA 3L8RA 3B13A 4YFSA 1L0VA 1Y64B 4PW8A 3AAEB 5F3JA 3IBPA 3NZPA 4HWFA 4LMJA 2YDSA 3RYIE 2JRKA 3KVBA 2DLRA 1FIOA 2W00A 4YHJA 3LBXB 2DHRA 2WDQA 1UGOA 3GN5A 2X67A 4H9SE 2XTLA 3QC9A 4DBRA 3J9X1 4UVAB 4Q25A 5FL0A 1D0ZA 3M65A 3FXEB 2CEAA 4DVDA 4B3MT 3EAMA 3CQGB 4AQGA 4PJJA 2CRBA 4IDNA 3RQUA 3U78A 2NTXA 2KLQA 1OXZA 3ZC1A 1J5WA 1Y01A 5JRCA 2YN6A 1U4QA 3QUJA 3C4WA 3CX8B 4AKRB 2YEVC 3N2OA 3N9OA 2MBGA 4YT0A 3PURA 1XMQT 5FKYA 1EZ3A 2NOXA 4CN4A 2YOEA 2BG9A 2I6HA 2DCFA 1I6ZA 4H9RC 1GQEA 5M4YA 4GK5E 4TZ4C 4IDOA 4DUYT 2X66A 3HKCE 4CI2B 2LOPA 4IE7A 4YHHT 2MOZA 5AQNB 1SUMB 5CFBA 2E5VA 2XAJB 4NIQA 2V6YB 2VL0A 2NW7A 2LLYA 5HEOA 2YU1A 1YKEB 5FYMA 4L5GA 4QXHB 2M6BA 1ZKEA 5BMVE 1JNZA 5L2LA 3UU3A 3JC6C 1LRZA 3ZYLA 2JQHA 3K3QC 2M6IA 4LFBT 1MIVA 3KDSE 1HCIA 4LF5T 5AQJB 5E0OA 2BG9C 1HFAA 4ZI2D 2KT9A 2EHOA 3ZN0B 4JEUB 2WMNA 3UUBA 3AEBA 4XZCA 2FJDA 3K3NA 4H9PC 2I0MA 5HWYA 2IW5B 5HWXA 4O2AE 3RC8A 5LMUT 5LB7B 3PJAJ 4QXCB 4X64T 4KBMB 2XQ7A 1N33T 2LSJA 2WAUA 2FJBA 4DR1T 3A8YC 1CHUA 4X1YE 4OX9T 1FJGT 3N9PA 2KWIB 3C64A 1YXRA 5J2TE 1G8XA 4EB6E 3RC3A 1VOMA 4J2CA 3LDQB 2CWYA 5LGNB 3ONLC 3I9YA 3AECA 4TV9E 2V5DA 4WYVA 1IJ5A 3RF1A 4X5TA 2XASB 4KX6A 4UF0B 2WZIA 3FZLB 1Z0PA 2QVAA 4TWHA 5ADXL 3Q5WA 4CN1A 4P09A 5HXEA 3FZMB 3CQXC 3UQ7A 3CMLA 3N2GE 4YSYA 4JI3T 3ZMUB 1VCSA 4I4TE 1ZHCA 5FXXA 1T98A 2UXXB 3UFGA 3RYCE 2AXDS 2P9BA 5DJQC 3AXJA 4HWHA 4TNVA 3KVAA 2K3WA 5AQGB 2NW9A 4IE4A 2ZLYA 1D1BA 3EI0A 3I0OA 5JTGA 3ZPOA 2PFVA 4V1Av 3P7IA 2W67A 4BJMA 4ZI2C 3W15B 1KEYA 2DNXA 2LT3A 4NPPA 4IL9A 3LBXA 4NXNT 1T7SA 3R6NA 4JI0T 2CE7A 5JDGA 4P0BA 1FMWA 2CXDA 3JADA 3I9WA 5TAOA 5AQHB 3KV6A 3AE1A 4HFVA 5HXRA 2CMRA 1AJ3A 5LNKA 4EZ4A 1OEDB 3OVUA 2QGSA 4EYUA 2NW8A 3PUWF 4DR2T 1J5ET 2JMKA 4GKKT 2H89A 3KFWX 5J2UE 3UU4A 3VKGA 4YLHA 2XM2A 5KXJA 4X1IE 4BJNA 2V7JA 5AQIB 3RRWA 2ZM0A 1BR4A 4H9QC 2WBLA 2X68A 3TLWA 5HEHA 3KV9A 3TLSA 3VRBA 2A3DA 5CB4E 4TV8E 1ZP0A 3NBXX 5LHHB 1D0XA 4WW0A 2ACXA 3VRAA 2GK9A 4DR4T 4H9OC 2CPTA 4H9NC 1NEKA 4LFCT 3S4UA 2Q9QB 4GOUA 4EV6A 3AEGA 3AVRA 3AB3B 2YU2A 5C8YE 1IBMT 2WQYA 2V6YA 4DV0T 1MIWA 5L3CB 2JJ9A 2BS3A 2XAFB 2RP4A 4AXPA 4ZOLE 3EVYA 4UELA 1VCTA 2VK9A 4EAHA 3DP7A 5HXHA 3D0TA 2JPFA 5JH7E 4X62T 3PUQA 4OK0A 4HEAA 1NWMX 4AIUA 2E9XA 5LG4A 1HR0T 1S35A 3P4WA 1XNQT 4YJ2E 4U2ZA 2V7LA 2XQAA 1N34T 5AQQB 3B5MA 3C51A 5LBQB 4TWDA 3PDYA 4DV4T 3N2KE 1G73A 2XSAA 3L3PA 3RKGA 3RI5A 4Z91A 4ZI3D 4LF7T 2YDQA 3N9QA 2DI4A 5EK3A 4G63A 3UU6A 1D1AA 5LJMA 2L9QA 2W0GA 3B57A 4AI6A 1CUNA 4I43B 2JQQA 3LFMA 4GYRA 3QNUA 3PUGA 2E9XC 3N9LA 4NUVA 5ABEA 1SE7A 3MA9A 3UUXB 4DBQA 2XZEA 1E7PA 3AVSA 2UXNB 3CWZB 1E1HB 1MNEA 2BVLA 2NWBA 4E7ZA 4TWFA 4MBQA 5HXSA 1LVFA 3RKOA 4TNWA 3KBTA 3UTKA 3H3MA 2W63A 3RIUA 2CBJA 2D9DA 5GONE 3LK2B 3U3IA 5C2TA 4ZZBA 3PUAA 2A2FX 2VKJA 3RYHE 4X65T 3OJAA 2KNDA 3PTRB 4I0UA 2DWGA 4DIDB 2KINB 1WYCA 3CVRA 1D0YA 4C91A 5LMNT 2W61A 4HWIB 5HXCA 2D5UA 4HFEA 2CXLA 5LCYA 4U3CA 1KNRA 2NP9A 1HG5A 2FJAA 3O4XE 3UFEA 4DV7T 2WMOA 1HNZT 2M67A 4DV3T 3HI2A 5LG3A 2Q9QD 3PV0F 2LSKA 3RIUC 5BR8T 4QWNB 1IZNB 4DMVA 3CKDA 2OA5A 4JI5T 4GK0E 4ILAA 2CLYB 3E0ZA 2C0SA 4CZZB 2V26A 3ZC0A 2WWVA 3FXDB 4O4LE 2XPKA 4ZI3C 2V5CA 4EEBA 4CI1B 3RQWA 3KV5A 2Y8DA 4O4JE 2V7IA 1QUUA 2G0UA 5LHIB 2UUCT 3JAEA 2FJEA 3RIFA 2OLTA 1OEDA 3E08A 2E8IA 2LRKA 1HX1B 4JI1T 3ZMSB 2HN1A 1XDPA 2B76A 3C50A 5ABFB 4PJNA 1QLBA 5F8PA 2XQ9A 5LGUB 2DL1A 4EOZB 1YKHB 3V5SA 1BR1A 2XM1A 5H6QB 3BQLA 4ISSA 2X0LB 3ZT5A 4A5XA 3LK3B 2CXFA 3EHZA 2IIUA 4K0UA 2V7KA 4ZS2A 4X1KE 3I1AA 1HX8A 3P4SA 3EDUA 3M3ZB 2V6XA 4JBWF 5L47A 1LKXA 3H3AA 2UXCT 2LSYA 5L3DB 4GIWA 3H37A 1B7TA 1V9DA 2YKSA 1T8BA 3Q5EA 1KK7A 1M62A 3AA0B 1OEDC 5J1GA 3AA1B 5C3JA 1J1JA 2LKGA 3PUSA 3RX6A 5JDLA 2UUBT 1UX5A 2VASA 5JDFA 4HE8A 1E2AA 3LK42 3NWIA 3G06A 4O4HE 3MKDA 2K24A 3MACA 4UV9B 4EZHA 2VVSA 4YSZA 3SFDA 4UV8B 3Q5DA 3FHNA 4DR7T 2VB6A 4QX8B 4AISA 3NKZA 1W09A 4PK5A 4HFHA 4LMLA 3RHWA 2IDOB 2WB5A 1KNPA 2CWOA 1R8IA 3F31A 3FZHB 3T8OA 2YDRA 3O1HA 4ISTA 1MMAA 4L0RA 5DQWA 2LHNA 4N78D 3IHRA 3ANWB 3ZMVB 3PUZF 3VR9A 2ES0A 4DNDA 3O9XA 5JDQA 4GYSA 4WBNE 5AQVB 4DR6T 4H63V 3N9NA 5FL1A 3ZN1B 5AQLB 4ILCA 4ILUA 4EYYR 5AQPB 3O1JA 2XQ4A 3KBUA 2VKDA 2LKHA 4A98A 4IDQA 4WZXA 4LF6T 3ZCIA 4A97A 4MHCA 2XQ6A 4PFPA 3V5UA 1KF6A
chains in the Genus database with same CATH topology
3M3ZB 5AQIB 5AQQB 5AQTB 5AQNB 3FZHB 5AQUB 1M7KA 5AQPB 4HWHA 5AQRB 1T7SA 5AQGB 3FZMB 4HWFA 4HWCA 1UK5A 5AQVB 1I6ZA 2D9DA 5AQOB 5AQJB 4HWDA 4HWIB 3LDQB 5AQMB 1HX1B 1UGOA 3FZLB 3FZFB 5AQKB 5AQFB 1M62A 5AQLB 5AQHB 5AQSB 3A8YC 3FZKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M3Z B;  5AQI B;  5AQQ B;  5AQT B;  5AQN B;  3FZH B;  5AQU B;  1M7K A;  5AQP B;  4HWH A;  5AQR B;  1T7S A;  5AQG B;  3FZM B;  4HWF A;  4HWC A;  1UK5 A;  5AQV B;  1I6Z A;  2D9D A;  5AQO B;  5AQJ B;  4HWD A;  4HWI B;  3LDQ B;  5AQM B;  1HX1 B;  1UGO A;  3FZL B;  3FZF B;  5AQK B;  5AQF B;  1M62 A;  5AQL B;  5AQH B;  5AQS B;  3A8Y C;  3FZK B; 
#chains in the Genus database with same CATH topology
 2VUR A;  2XQ5 A;  4JEH B;  3IEE A;  4DV1 T;  4BAY B;  3AE9 A;  3OBV E;  3GN5 B;  2VL8 A;  4DUZ T;  3UU8 A;  3Q5X A;  3ZJ2 A;  2NR4 A;  3AA7 B;  3K1S A;  4C90 A;  4O2B E;  3PUV F;  3IF8 B;  4ZEY A;  5EZY E;  2BS2 A;  4OHF A;  2PG8 A;  3OYX A;  4LMK A;  1UX4 A;  1W9R A;  2FUP A;  1JNR A;  4CQI A;  2QYW A;  4AKG A;  2H88 A;  5LXT E;  2WSS V;  2V7M A;  2IC6 A;  5JRC B;  2VQF T;  4JV5 T;  2ACZ A;  3BQK A;  2HPJ A;  1WR0 A;  1NAF A;  4EIW A;  3TLU A;  3N9M A;  2WU5 A;  4HFI A;  4HKA A;  5FP3 A;  5FNV E;  2HPL A;  2BG9 B;  3AEA A;  2N9D A;  2XJ7 A;  1IBL T;  3AE4 A;  3UUL A;  1W0A A;  3AAI A;  4O8S A;  3ESL A;  2WU2 A;  3EAB A;  4A56 A;  3FZK B;  4U7I A;  3P4P A;  1WRD A;  4IT4 A;  2UXB T;  1US7 B;  4ERR A;  1UCU A;  5CA0 E;  1WYB A;  5JRE A;  4OYK A;  2IML A;  4DR5 T;  5A1L A;  4UXN B;  4XAX B;  3LSV A;  2ODV A;  4JUY A;  4QH1 A;  3ZYK A;  2CLY C;  3ZT6 A;  1N36 T;  1BR2 A;  3HKB E;  4PAG A;  5DQV A;  3MJX A;  4DR3 T;  2MTQ A;  2KSR A;  4IE6 A;  3CX6 B;  3ZEF B;  3RIA A;  2EHO B;  4YTP A;  1LVK A;  4YXD A;  4YJ3 E;  2ODU A;  4PNI A;  2A72 A;  4QKN A;  2Y48 B;  3VKH A;  3Q2M A;  3WAK A;  3LJC A;  3FBL A;  4PFO A;  2WS3 A;  5LP6 E;  4JYA T;  2V1D B;  2BZB A;  1ZOY A;  2BKO A;  5FY7 A;  2J1D G;  4FJO A;  3EDV A;  2C5I T;  1OED E;  2YIN A;  2I59 A;  2H7O A;  3CQC B;  5AQR B;  3Q9D A;  2XAQ B;  3MXZ A;  3P8C D;  5JDM A;  5IWA T;  4B3T T;  1S94 A;  1N32 T;  3CPZ A;  2MPK A;  4LF9 T;  2CHN A;  5AFU L;  3OYZ A;  2C5K T;  4COF A;  2QA7 A;  4DO0 A;  3TLT A;  2W4X A;  2A9U A;  2H7V C;  2J4G A;  2BKP A;  3F2E A;  4B3R T;  2ZM2 A;  4U33 A;  3RRC A;  3ZCJ A;  4G2A A;  3PJA A;  2D2S A;  2W62 A;  1X79 A;  4E7S A;  5LJN A;  3SWH A;  1YW0 A;  4ILB A;  4IIJ E;  5ABG A;  3TKL B;  4HWC A;  3RH3 A;  1WLX A;  5L4H A;  4P0A A;  1YD8 G;  3BQI A;  2KWH A;  3AE3 A;  3NZQ A;  2LRL A;  3UUM A;  5JR9 B;  4M1P A;  1FMV A;  5IHY A;  3ETU A;  4UF0 A;  2ZM6 T;  3JC6 D;  1U5P A;  1XNR T;  4F8H A;  5HEG A;  2UUA T;  4HN9 A;  3ZJ1 A;  3ABV A;  2J62 A;  5L3F B;  2WM9 A;  3AXJ B;  2WP9 A;  4CXX A;  2MYS A;  2HN2 A;  3DJB A;  5HCJ A;  3RPU A;  2LM2 A;  2LSG A;  3J7Y q;  1XZY A;  4QH4 A;  3GMI A;  3ZT7 A;  3N5L A;  4IL4 A;  5F5W A;  3MZK B;  2K48 A;  4HFB A;  1QSD A;  2Y6X A;  4IDZ A;  3ZST A;  1WFD A;  1YQ4 A;  5LA6 E;  5FY0 A;  2XAH B;  3PE0 A;  1Z8U A;  2LSI A;  3O1I A;  2VKH A;  1KNZ A;  3QK6 A;  3ZKR A;  2W2U A;  5AQS B;  3P50 A;  5CA1 E;  3P4Q A;  2LM9 A;  5IUX A;  3EUH A;  2IC9 A;  4BA9 A;  2X9X A;  4MAL A;  2EHO D;  4TUY E;  2L3L A;  2L8K A;  4X20 E;  5IYZ E;  4YTM A;  1YQ3 A;  3AE5 A;  2X9H A;  4HFC A;  2HH7 A;  4CN6 A;  4DV5 T;  1WCR A;  3AE8 A;  1KFY A;  2QRX A;  4JI8 T;  4I55 E;  3AE7 A;  3R84 B;  4AQY T;  4JLE A;  2AE9 A;  2IUB A;  1XDO A;  5FVK A;  2XQ3 A;  3ZLI A;  5LOV E;  1MMG A;  5HCM A;  2KXP B;  4CXY A;  4KI0 F;  4EGW A;  4L9I A;  2XAG B;  2K5B B;  2Q9Q A;  3QB5 A;  4AKL A;  3IA3 A;  3SOL A;  4K0K T;  4NXM T;  3HR0 A;  4ZS3 A;  2IAK A;  4ZI7 E;  4B6X A;  2D0T A;  2X51 A;  4WBO A;  2E9X B;  2V8S V;  5L3E B;  5LBM A;  4ZZC A;  4XBF B;  5EK2 A;  5KX5 E;  2OV9 A;  1UUS A;  2N1G A;  5LHG B;  2DWK A;  4X66 T;  4JI6 T;  2C5J A;  1HG2 A;  2MAW A;  2KZ7 B;  3DTO A;  4UVC B;  2ZMA A;  2BS4 A;  2X9Y A;  4IHJ E;  3JCF A;  4EXT A;  1OWA A;  5H6R B;  2Q9Q C;  1O3X A;  2RA1 A;  4QX7 B;  4HFD A;  2BKN A;  3ZMT B;  4AQF A;  2VQE T;  5CJ5 A;  2SPC A;  1ZV4 X;  4UVB B;  5JQG E;  2CCQ A;  3HKD E;  4WNK A;  4AKH A;  2BBH A;  3NRY A;  3L09 A;  4FI5 A;  4ZXL A;  5KDM C;  4LF4 T;  5AQM B;  3FBZ A;  4U31 A;  3L39 A;  5AQK B;  2X0H A;  2FBW A;  3BK9 A;  3CK6 A;  4U7Y A;  2X9W A;  2CHO A;  1IAP A;  4YSX A;  3KIN B;  4CI3 B;  2Z6E A;  2EHO C;  3A5X A;  2UXD T;  5FVL A;  3WAJ A;  3CIR A;  4DMW A;  2BVM A;  4O4I E;  3A7M A;  2ZM8 A;  2XUE A;  2UU9 T;  4IE0 A;  2E5L T;  5AQT B;  5EK4 A;  2WZH A;  1I94 T;  4PJL A;  1MIY A;  4AQF C;  4KHZ F;  1XMO T;  2WDV A;  2XSB A;  2E2A A;  4LF8 T;  2XY8 B;  2VVN A;  2CBI A;  3I0Q A;  3AEE A;  5ABH A;  4DV2 T;  5JR9 A;  3F57 A;  3UT5 E;  3PUY F;  3T1Y T;  3VR8 A;  3LG7 A;  3QB5 K;  2YK0 A;  4HWD A;  3ONX A;  3HA4 A;  3SS1 A;  4LFA T;  4OYJ A;  1M7K A;  2LHR A;  2D0U A;  4QXB B;  3OKQ A;  5FXZ A;  5HEU A;  3AEF A;  2BDE A;  5AQO B;  3C98 B;  4I50 E;  2PBI A;  3OPC A;  2LJL A;  2CA5 A;  1BR0 A;  4MFR A;  5JDH A;  3UUN A;  3RLF F;  4U74 A;  5JVD E;  4MLK A;  3VHL A;  3JAF A;  5JR9 C;  2K9A A;  1HF8 A;  3PUX F;  3NVO A;  2NTY A;  5ETW A;  2JQ9 A;  4U2Y A;  4NUU A;  4ANJ A;  5AQF B;  3CX7 B;  3ONJ A;  3AED A;  3GWH A;  3K3O A;  4QH5 A;  3SRZ A;  2E9X D;  3PU8 A;  5HEJ A;  1SA0 E;  5L4E A;  2WWU A;  3RGL A;  5LGT B;  5J0Z A;  2XQY A;  3HL6 A;  3HKE E;  4KHP T;  5FXV A;  4H63 H;  2B1E A;  3T1H T;  1WR6 A;  3RYF E;  1MMD A;  3UQ4 A;  3AA6 B;  2KMF A;  2LOS A;  5L3B B;  4QHO A;  4TX5 A;  4AKI A;  3ZSS A;  1HNW T;  5ABF A;  2IHR 1;  4IGU A;  1IJ6 A;  1VRB A;  4DV6 T;  4JI7 T;  4KP3 C;  4HGA A;  3OTO T;  2R6G F;  2PTF A;  4IDP A;  1HNX T;  4UR9 A;  2XQ8 A;  1H7C A;  3UU5 A;  4ZHQ E;  5FMN A;  2VKO A;  5L3G B;  1MMN A;  4PJM A;  2N2N A;  2LE8 A;  3E22 E;  2CM0 A;  4ADZ A;  2VWA A;  2JIW A;  4YTN A;  2W66 A;  4EED A;  2J47 A;  1FEW A;  4YY3 T;  1D1C A;  4TN7 B;  4IRE A;  4ASK A;  4JI2 T;  4KUM B;  4B3S T;  1T72 A;  2WCA A;  3PU3 A;  2XHE B;  3FB2 A;  4GKJ T;  5KMG P;  3QOF A;  4HTE A;  3ZMZ B;  5DAB A;  4PK4 A;  4F6R C;  1ZEE A;  2H3R A;  3C4Z A;  4JI4 T;  3TLV A;  3WI3 A;  4Z90 A;  3K8P C;  2WY2 A;  5HAX A;  2LEH A;  4UEM A;  1XWM A;  2BG9 E;  4Z8X A;  4PK6 A;  2JMH A;  3ZYM A;  5AQU B;  1NEN A;  2RPA A;  5LYJ E;  1UK5 A;  3AAA B;  2PJQ A;  3AE6 A;  2WDR A;  4U72 A;  1MND A;  5FXW A;  1UUR A;  3NRX A;  1DU2 A;  1IBK T;  3KV4 A;  3VU7 H;  4IE5 A;  1HS7 A;  4OFZ A;  4CXW A;  2X0Y A;  5HYA A;  3ANW A;  2JQK A;  3AE2 A;  5FY1 A;  3ETV A;  4KMC A;  3MK7 C;  2F4V T;  3X1D A;  3FZF B;  2BBJ A;  4P1N A;  1HTJ F;  1W0B A;  1SHZ C;  3C4X A;  1X9B A;  5JDN A;  3GA8 A;  4UIG A;  3SFE A;  2HHH T;  5CGM A;  3P4R A;  3L8R A;  3B13 A;  4YFS A;  1L0V A;  1Y64 B;  4PW8 A;  3AAE B;  5F3J A;  3IBP A;  3NZP A;  4HWF A;  4LMJ A;  2YDS A;  3RYI E;  2JRK A;  3KVB A;  2DLR A;  1FIO A;  2W00 A;  4YHJ A;  3LBX B;  2DHR A;  2WDQ A;  1UGO A;  3GN5 A;  2X67 A;  4H9S E;  2XTL A;  3QC9 A;  4DBR A;  3J9X 1;  4UVA B;  4Q25 A;  5FL0 A;  1D0Z A;  3M65 A;  3FXE B;  2CEA A;  4DVD A;  4B3M T;  3EAM A;  3CQG B;  4AQG A;  4PJJ A;  2CRB A;  4IDN A;  3RQU A;  3U78 A;  2NTX A;  2KLQ A;  1OXZ A;  3ZC1 A;  1J5W A;  1Y01 A;  5JRC A;  2YN6 A;  1U4Q A;  3QUJ A;  3C4W A;  3CX8 B;  4AKR B;  2YEV C;  3N2O A;  3N9O A;  2MBG A;  4YT0 A;  3PUR A;  1XMQ T;  5FKY A;  1EZ3 A;  2NOX A;  4CN4 A;  2YOE A;  2BG9 A;  2I6H A;  2DCF A;  1I6Z A;  4H9R C;  1GQE A;  5M4Y A;  4GK5 E;  4TZ4 C;  4IDO A;  4DUY T;  2X66 A;  3HKC E;  4CI2 B;  2LOP A;  4IE7 A;  4YHH T;  2MOZ A;  5AQN B;  1SUM B;  5CFB A;  2E5V A;  2XAJ B;  4NIQ A;  2V6Y B;  2VL0 A;  2NW7 A;  2LLY A;  5HEO A;  2YU1 A;  1YKE B;  5FYM A;  4L5G A;  4QXH B;  2M6B A;  1ZKE A;  5BMV E;  1JNZ A;  5L2L A;  3UU3 A;  3JC6 C;  1LRZ A;  3ZYL A;  2JQH A;  3K3Q C;  2M6I A;  4LFB T;  1MIV A;  3KDS E;  1HCI A;  4LF5 T;  5AQJ B;  5E0O A;  2BG9 C;  1HFA A;  4ZI2 D;  2KT9 A;  2EHO A;  3ZN0 B;  4JEU B;  2WMN A;  3UUB A;  3AEB A;  4XZC A;  2FJD A;  3K3N A;  4H9P C;  2I0M A;  5HWY A;  2IW5 B;  5HWX A;  4O2A E;  3RC8 A;  5LMU T;  5LB7 B;  3PJA J;  4QXC B;  4X64 T;  4KBM B;  2XQ7 A;  1N33 T;  2LSJ A;  2WAU A;  2FJB A;  4DR1 T;  3A8Y C;  1CHU A;  4X1Y E;  4OX9 T;  1FJG T;  3N9P A;  2KWI B;  3C64 A;  1YXR A;  5J2T E;  1G8X A;  4EB6 E;  3RC3 A;  1VOM A;  4J2C A;  3LDQ B;  2CWY A;  5LGN B;  3ONL C;  3I9Y A;  3AEC A;  4TV9 E;  2V5D A;  4WYV A;  1IJ5 A;  3RF1 A;  4X5T A;  2XAS B;  4KX6 A;  4UF0 B;  2WZI A;  3FZL B;  1Z0P A;  2QVA A;  4TWH A;  5ADX L;  3Q5W A;  4CN1 A;  4P09 A;  5HXE A;  3FZM B;  3CQX C;  3UQ7 A;  3CML A;  3N2G E;  4YSY A;  4JI3 T;  3ZMU B;  1VCS A;  4I4T E;  1ZHC A;  5FXX A;  1T98 A;  2UXX B;  3UFG A;  3RYC E;  2AXD S;  2P9B A;  5DJQ C;  3AXJ A;  4HWH A;  4TNV A;  3KVA A;  2K3W A;  5AQG B;  2NW9 A;  4IE4 A;  2ZLY A;  1D1B A;  3EI0 A;  3I0O A;  5JTG A;  3ZPO A;  2PFV A;  4V1A v;  3P7I A;  2W67 A;  4BJM A;  4ZI2 C;  3W15 B;  1KEY A;  2DNX A;  2LT3 A;  4NPP A;  4IL9 A;  3LBX A;  4NXN T;  1T7S A;  3R6N A;  4JI0 T;  2CE7 A;  5JDG A;  4P0B A;  1FMW A;  2CXD A;  3JAD A;  3I9W A;  5TAO A;  5AQH B;  3KV6 A;  3AE1 A;  4HFV A;  5HXR A;  2CMR A;  1AJ3 A;  5LNK A;  4EZ4 A;  1OED B;  3OVU A;  2QGS A;  4EYU A;  2NW8 A;  3PUW F;  4DR2 T;  1J5E T;  2JMK A;  4GKK T;  2H89 A;  3KFW X;  5J2U E;  3UU4 A;  3VKG A;  4YLH A;  2XM2 A;  5KXJ A;  4X1I E;  4BJN A;  2V7J A;  5AQI B;  3RRW A;  2ZM0 A;  1BR4 A;  4H9Q C;  2WBL A;  2X68 A;  3TLW A;  5HEH A;  3KV9 A;  3TLS A;  3VRB A;  2A3D A;  5CB4 E;  4TV8 E;  1ZP0 A;  3NBX X;  5LHH B;  1D0X A;  4WW0 A;  2ACX A;  3VRA A;  2GK9 A;  4DR4 T;  4H9O C;  2CPT A;  4H9N C;  1NEK A;  4LFC T;  3S4U A;  2Q9Q B;  4GOU A;  4EV6 A;  3AEG A;  3AVR A;  3AB3 B;  2YU2 A;  5C8Y E;  1IBM T;  2WQY A;  2V6Y A;  4DV0 T;  1MIW A;  5L3C B;  2JJ9 A;  2BS3 A;  2XAF B;  2RP4 A;  4AXP A;  4ZOL E;  3EVY A;  4UEL A;  1VCT A;  2VK9 A;  4EAH A;  3DP7 A;  5HXH A;  3D0T A;  2JPF A;  5JH7 E;  4X62 T;  3PUQ A;  4OK0 A;  4HEA A;  1NWM X;  4AIU A;  2E9X A;  5LG4 A;  1HR0 T;  1S35 A;  3P4W A;  1XNQ T;  4YJ2 E;  4U2Z A;  2V7L A;  2XQA A;  1N34 T;  5AQQ B;  3B5M A;  3C51 A;  5LBQ B;  4TWD A;  3PDY A;  4DV4 T;  3N2K E;  1G73 A;  2XSA A;  3L3P A;  3RKG A;  3RI5 A;  4Z91 A;  4ZI3 D;  4LF7 T;  2YDQ A;  3N9Q A;  2DI4 A;  5EK3 A;  4G63 A;  3UU6 A;  1D1A A;  5LJM A;  2L9Q A;  2W0G A;  3B57 A;  4AI6 A;  1CUN A;  4I43 B;  2JQQ A;  3LFM A;  4GYR A;  3QNU A;  3PUG A;  2E9X C;  3N9L A;  4NUV A;  5ABE A;  1SE7 A;  3MA9 A;  3UUX B;  4DBQ A;  2XZE A;  1E7P A;  3AVS A;  2UXN B;  3CWZ B;  1E1H B;  1MNE A;  2BVL A;  2NWB A;  4E7Z A;  4TWF A;  4MBQ A;  5HXS A;  1LVF A;  3RKO A;  4TNW A;  3KBT A;  3UTK A;  3H3M A;  2W63 A;  3RIU A;  2CBJ A;  2D9D A;  5GON E;  3LK2 B;  3U3I A;  5C2T A;  4ZZB A;  3PUA A;  2A2F X;  2VKJ A;  3RYH E;  4X65 T;  3OJA A;  2KND A;  3PTR B;  4I0U A;  2DWG A;  4DID B;  2KIN B;  1WYC A;  3CVR A;  1D0Y A;  4C91 A;  5LMN T;  2W61 A;  4HWI B;  5HXC A;  2D5U A;  4HFE A;  2CXL A;  5LCY A;  4U3C A;  1KNR A;  2NP9 A;  1HG5 A;  2FJA A;  3O4X E;  3UFE A;  4DV7 T;  2WMO A;  1HNZ T;  2M67 A;  4DV3 T;  3HI2 A;  5LG3 A;  2Q9Q D;  3PV0 F;  2LSK A;  3RIU C;  5BR8 T;  4QWN B;  1IZN B;  4DMV A;  3CKD A;  2OA5 A;  4JI5 T;  4GK0 E;  4ILA A;  2CLY B;  3E0Z A;  2C0S A;  4CZZ B;  2V26 A;  3ZC0 A;  2WWV A;  3FXD B;  4O4L E;  2XPK A;  4ZI3 C;  2V5C A;  4EEB A;  4CI1 B;  3RQW A;  3KV5 A;  2Y8D A;  4O4J E;  2V7I A;  1QUU A;  2G0U A;  5LHI B;  2UUC T;  3JAE A;  2FJE A;  3RIF A;  2OLT A;  1OED A;  3E08 A;  2E8I A;  2LRK A;  1HX1 B;  4JI1 T;  3ZMS B;  2HN1 A;  1XDP A;  2B76 A;  3C50 A;  5ABF B;  4PJN A;  1QLB A;  5F8P A;  2XQ9 A;  5LGU B;  2DL1 A;  4EOZ B;  1YKH B;  3V5S A;  1BR1 A;  2XM1 A;  5H6Q B;  3BQL A;  4ISS A;  2X0L B;  3ZT5 A;  4A5X A;  3LK3 B;  2CXF A;  3EHZ A;  2IIU A;  4K0U A;  2V7K A;  4ZS2 A;  4X1K E;  3I1A A;  1HX8 A;  3P4S A;  3EDU A;  3M3Z B;  2V6X A;  4JBW F;  5L47 A;  1LKX A;  3H3A A;  2UXC T;  2LSY A;  5L3D B;  4GIW A;  3H37 A;  1B7T A;  1V9D A;  2YKS A;  1T8B A;  3Q5E A;  1KK7 A;  1M62 A;  3AA0 B;  1OED C;  5J1G A;  3AA1 B;  5C3J A;  1J1J A;  2LKG A;  3PUS A;  3RX6 A;  5JDL A;  2UUB T;  1UX5 A;  2VAS A;  5JDF A;  4HE8 A;  1E2A A;  3LK4 2;  3NWI A;  3G06 A;  4O4H E;  3MKD A;  2K24 A;  3MAC A;  4UV9 B;  4EZH A;  2VVS A;  4YSZ A;  3SFD A;  4UV8 B;  3Q5D A;  3FHN A;  4DR7 T;  2VB6 A;  4QX8 B;  4AIS A;  3NKZ A;  1W09 A;  4PK5 A;  4HFH A;  4LML A;  3RHW A;  2IDO B;  2WB5 A;  1KNP A;  2CWO A;  1R8I A;  3F31 A;  3FZH B;  3T8O A;  2YDR A;  3O1H A;  4IST A;  1MMA A;  4L0R A;  5DQW A;  2LHN A;  4N78 D;  3IHR A;  3ANW B;  3ZMV B;  3PUZ F;  3VR9 A;  2ES0 A;  4DND A;  3O9X A;  5JDQ A;  4GYS A;  4WBN E;  5AQV B;  4DR6 T;  4H63 V;  3N9N A;  5FL1 A;  3ZN1 B;  5AQL B;  4ILC A;  4ILU A;  4EYY R;  5AQP B;  3O1J A;  2XQ4 A;  3KBU A;  2VKD A;  2LKH A;  4A98 A;  4IDQ A;  4WZX A;  4LF6 T;  3ZCI A;  4A97 A;  4MHC A;  2XQ6 A;  4PFP A;  3V5U A;  1KF6 A; 
#chains in the Genus database with same CATH homology
 3M3Z B;  5AQI B;  5AQQ B;  5AQT B;  5AQN B;  3FZH B;  5AQU B;  1M7K A;  5AQP B;  4HWH A;  5AQR B;  1T7S A;  5AQG B;  3FZM B;  4HWF A;  4HWC A;  1UK5 A;  5AQV B;  1I6Z A;  2D9D A;  5AQO B;  5AQJ B;  4HWD A;  4HWI B;  3LDQ B;  5AQM B;  1HX1 B;  1UGO A;  3FZL B;  3FZF B;  5AQK B;  5AQF B;  1M62 A;  5AQL B;  5AQH B;  5AQS B;  3A8Y C;  3FZK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...