4HWCA

Structure of atbag1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
86
structure length
86
Chain Sequence
SASKAISDISLEVDRLGGRVSAFEMVTKKGGKIAEKDLVTVIELLMNELIKLDAIVAEGDVKLQRKMQVKRVQNYVETLDALKVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insight into plant programmed cell death mediated by BAG proteins in Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Apoptosis
molecule keywords BAG family molecular chaperone regulator 1
total genus 37
structure length 86
sequence length 86
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 4hwcA00
5AQJB 3FZHB 5AQIB 5AQUB 3M3ZB 2D9DA 1M7KA 1M62A 3FZKB 1T7SA 3FZFB 3A8YC 5AQVB 4HWIB 5AQHB 3FZMB 5AQFB 5AQPB 3LDQB 1UK5A 4HWFA 5AQMB 5AQOB 1I6ZA 5AQSB 1HX1B 5AQLB 5AQGB 5AQQB 4HWCA 5AQNB 5AQTB 1UGOA 4HWDA 4HWHA 3FZLB 5AQRB 5AQKB
chains in the Genus database with same CATH superfamily
1XDOA 2FJBA 3OKQA 4UVBB 3P4QA 2LKGA 5FXWA 1M7KA 4QHOA 2WWVA 4JI7T 2CXLA 2KMFA 2VKJA 2XSAA 4WYVA 3B13A 4LFAT 4EXTA 1DU2A 3K3QC 4PK5A 3UFGA 2MOZA 2CHOA 4X65T 2YDQA 3F31A 1NENA 3MZKB 2YDSA 5HEJA 3J9X1 4A56A 4EGWA 2VURA 2XM1A 2VVSA 2YN6A 4WNKA 4ZS3A 3IEEA 3UFEA 4WZXA 4TV8E 5AQSB 4UF0A 2KT9A 5AQLB 1HX8A 3SS1A 2W67A 2XQ8A 2CM0A 2W61A 4V1Av 2XQAA 3MK7C 3AA7B 3AAEB 4G2AA 1IBLT 1UURA 4ILBA 2XTLA 3OVUA 3JC6C 4QX8B 3ZJ1A 2VK9A 3RKGA 4CQIA 3ZSSA 3OTOT 5DJQC 2E5LT 5AQJB 2OV9A 4ZHQE 4PFOA 5J2UE 1MIVA 4TNVA 3E08A 3HL6A 2XAGB 1JNRA 1XWMA 3OYXA 4KBMB 4DV4T 1E2AA 3FZFB 4B3MT 2DCFA 3J7Yq 2DL1A 5FY0A 4YHHT 4DR3T 2UXXB 3FXEB 4TUYE 5CA1E 4AKGA 5FY7A 2A9UA 4EZHA 3GWHA 5AQPB 3NRYA 5E0OA 3RYHE 3K3OA 2VKHA 2VL8A 4U2ZA 2NTYA 3P4WA 5ADXL 2V7MA 5JTGA 3O1IA 4Z90A 4O2BE 1EZ3A 1T72A 4EV6A 2QA7A 4PJJA 1IBMT 5AQGB 3UQ4A 3BQIA 3UU6A 5LHHB 4JUYA 4JYAT 1MMGA 3UU3A 3P50A 1HF8A 2JQQA 3K8PC 1YD8G 3CK6A 5L47A 5A1LA 3X1DA 4EYUA 1KFYA 2PG8A 1SA0E 2XQ3A 2Z6EA 4HFBA 4U33A 5AQKB 4DR4T 4GKJT 2JMHA 2UUBT 4N78D 3ZMTB 4O4JE 2HN1A 3JADA 2MBGA 3ONJA 1MNEA 5DABA 1N34T 3LK2B 3SOLA 2L3LA 2LM2A 2WDRA 5C8YE 4MFRA 1I94T 4GYRA 3EVYA 5FVLA 3I0QA 1KNRA 5IYZE 5ABFB 1YQ3A 4UIGA 4U2YA 5AQFB 2BS4A 2VWAA 3MXZA 4H63V 4IL4A 3H3AA 4TWFA 1AJ3A 2K24A 2KLQA 5GONE 1HS7A 3PV0F 3OBVE 3B5MA 5FMNA 1MMNA 2K3WA 2LHRA 2VASA 5ABGA 2F4VT 3PTRB 4A5XA 1YW0A 4DMVA 2WDVA 2NW8A 2YU2A 4AQFA 4DR2T 4H9RC 5LGTB 1MIYA 1UGOA 4UVAB 5L4HA 3ZC0A 2D5UA 4DIDB 3QK6A 2CEAA 4Z8XA 2X0LB 4AQYT 4CI1B 3KBUA 4TN7B 4EAHA 4IIJE 2PTFA 1FIOA 1D1BA 1HG5A 2VL0A 3FZKB 3LBXA 1T7SA 2IMLA 1HR0T 4H9SE 1X9BA 5J2TE 1X79A 2C0SA 3AEGA 3HA4A 3PUVF 1KK7A 1YXRA 5H6QB 3AE4A 4QX7B 2KSRA 3IA3A 5EK4A 3RI5A 4AQGA 1SHZC 4PK6A 3AXJB 5LG4A 3PUXF 2E9XC 3KVAA 4LFCT 2JIWA 2KZ7B 2K5BB 4FI5A 4QWNB 2ODUA 2BG9B 2A3DA 4ZXLA 3GN5B 4DV6T 1HX1B 3IF8B 4L5GA 4BJMA 2NP9A 3NKZA 4IDOA 3T1HT 3KV5A 4JI2T 3ZCIA 4BAYB 3K3NA 5ABFA 3ANWA 3PUQA 4F8HA 4O8SA 3ZN1B 2JQ9A 2WM9A 2IUBA 5FP3A 5JR9B 4PW8A 3AAIA 3AVSA 2X9WA 3HI2A 4IE0A 3ZMUB 4EEBA 2BG9C 3FBLA 4ERRA 3Q5WA 1LKXA 3A8YC 3O9XA 3RF1A 3ETVA 2FJDA 1G8XA 2V7LA 3DJBA 5AQVB 4HWIB 3U78A 2I59A 2V26A 3MA9A 4X20E 3VRAA 2CCQA 3P4PA 3HKBE 3NRXA 4B3TT 2Q9QC 1HFAA 4KX6A 4M1PA 4U7IA 4WW0A 3VHLA 3N2GE 5KDMC 2XQ6A 1G73A 3RLFF 5JDQA 4IREA 2VQET 1T98A 2LSGA 4NXNT 2XQYA 4YSYA 5KMGP 2Q9QD 5KX5E 3NZPA 4F6RC 4JI0T 2CXFA 2XAQB 4JEHB 4HFIA 4YTMA 3RIUA 1LVKA 2NOXA 2X67A 4H9QC 3C98B 4DV3T 2ZM6T 3Q2MA 4JI6T 1XNQT 5AQRB 4AISA 1CUNA 2B76A 2AE9A 4ISTA 2BVMA 3NZQA 5AQIB 5L4EA 4AKIA 2D9DA 2JQHA 3KV6A 3OJAA 4CI3B 4XAXB 3FXDB 4MHCA 2DI4A 4OYKA 3LFMA 1IAPA 4IGUA 5F5WA 5IHYA 4OFZA 3RYFE 3E0ZA 3VR8A 3L8RA 3RRWA 5FKYA 4TV9E 5LBQB 1D0XA 5JDNA 2LEHA 1LVFA 2EHOA 2FUPA 1ZEEA 2J1DG 5HAXA 1FMWA 1US7B 3P8CD 5HXHA 4KHPT 3T8OA 4GK5E 2YK0A 1UK5A 2HH7A 2LOSA 2XASB 3BQKA 3CVRA 4YFSA 4MLKA 3TLTA 5L3CB 2WQYA 4JI5T 1KEYA 2ACXA 3U3IA 3CQGB 3DTOA 4QKNA 1OWAA 5TAOA 5LGNB 4TNWA 1BR2A 1E7PA 1OEDA 1T8BA 1H7CA 1QSDA 4KP3C 3SWHA 3UUXB 5HWXA 5AQTB 4LF5T 2UXCT 4IDQA 3RHWA 4I55E 2LSJA 3N9LA 2DWGA 4ILAA 1IJ6A 4Q25A 4PJMA 4QXBB 5JVDE 4JI1T 2FJAA 1S94A 3PUWF 3N9MA 1YKHB 3C4XA 4P0AA 3PDYA 3RIFA 1Z0PA 2KXPB 1MIWA 1D0ZA 1IBKT 4AXPA 2XY8B 1SE7A 4YSZA 3CMLA 4NUUA 2VB6A 3M65A 3UUNA 2CLYC 3AA1B 4KMCA 1ZHCA 3PJAJ 5AQHB 3RH3A 3PU8A 5LA6E 2BKNA 2CBJA 4NIQA 4BA9A 1HNZT 1J5ET 4LF9T 4PFPA 2R6GF 4X64T 4H63H 3AAAB 4OHFA 3R6NA 5FXZA 5JDLA 2LLYA 4OYJA 1D1CA 1MMAA 3GA8A 4IDZA 4JBWF 3RC3A 4L9IA 5JDGA 3LK42 3EABA 3MJXA 2JJ9A 2UXBT 2E9XD 3HKEE 2LRLA 2PJQA 2Y8DA 2JRKA 2BG9E 4CZZB 4XZCA 4ZZCA 5EZYE 1YQ4A 1Y64B 4K0UA 5KXJA 1N33T 4P09A 2ACZA 2V7JA 3M3ZB 4A97A 3AEDA 5FVKA 2XAJB 3PUGA 4CXWA 1J1JA 1FEWA 4EEDA 4HFEA 3P4RA 3ETUA 2VKDA 3RQWA 2WWUA 2DHRA 5M4YA 4DV2T 5ABEA 2MTQA 1WLXA 3OYZA 2V5DA 3PUAA 3A7MA 4HE8A 4YSXA 5LJMA 2NR4A 4MBQA 4LF4T 3C64A 2EHOD 3N5LA 4EYYR 1U5PA 2XZEA 5L3EB 1ZP0A 4IE7A 3UTKA 3F57A 5LNKA 2CLYB 5FXXA 1WYCA 4GKKT 4KI0F 5HXSA 1UCUA 4JV5T 4AKHA 4H9OC 5DQWA 3KBTA 5IWAT 2FJEA 4CI2B 5CA0E 2N2NA 2W0GA 5AQNB 4COFA 4AQFC 4B3RT 3AA0B 4QXHB 3AE6A 3WAJA 4ZEYA 5LG3A 3EDVA 3O1JA 5FXVA 2CBIA 3AE7A 2BBJA 5HYAA 4U72A 2XSBA 1GQEA 2JQKA 4EIWA 5CGMA 3VR9A 2Q9QA 1OXZA 2YOEA 2UUAT 4CN6A 1M62A 3E22E 4UF0B 5JREA 1ZKEA 4DV1T 2BKPA 3IBPA 2W00A 5FYMA 2C5JA 3UUMA 1YKEB 2LM9A 3SFDA 2Q9QB 4GK0E 4AKRB 2X0HA 2CWYA 3PU3A 3Q5EA 4PNIA 4YY3T 3ABVA 3K1SA 3LK3B 4H9NC 3KV4A 2LE8A 2A72A 3UUBA 3LDQB 1S35A 2MPKA 3N9PA 3ZCJA 1Y01A 3W15B 2L8KA 2IC9A 4ADZA 5JR9C 2KWHA 3EAMA 5AQQB 3ANWB 3LJCA 5L2LA 2LKHA 4ILUA 2WY2A 2YINA 2HHHT 2CHNA 1U4QA 2WZIA 2QRXA 3CQCB 3JC6D 2YU1A 3D0TA 4IDNA 5BR8T 2XUEA 3FZHB 2E8IA 4GIWA 4UEMA 3CIRA 5J1GA 2JPFA 3ZYKA 3P7IA 5L3GB 4DV7T 2JMKA 3LSVA 4O2AE 4PAGA 3AXJA 2X9YA 2WP9A 4HGAA 1R8IA 3AEFA 4NUVA 5EK3A 3QUJA 1NAFA 3I1AA 3WAKA 3DP7A 4AIUA 2M67A 1O3XA 3T1YT 2HPLA 3Q9DA 5DQVA 3ZPOA 2A2FX 4DNDA 2V8SV 3N9NA 2IDOB 4TX5A 2LJLA 3RPUA 1HTJF 2I6HA 1LRZA 4DVDA 5LXTE 4X1KE 2XQ5A 5LMUT 4Z91A 2OA5A 4B3ST 4KUMB 2YKSA 5LJNA 5FL1A 5HXEA 2LHNA 3V5SA 2C5IT 2ES0A 2FBWA 3NWIA 3PURA 5LHGB 3AE1A 2QGSA 2WB5A 2Y6XA 5HWYA 4HFDA 2KINB 2W66A 3EUHA 4UELA 4C90A 5L3DB 3RYIE 2D0UA 3ONLC 1XNRT 1N32T 3AE3A 2DLRA 4JI3T 1HNWT 1N36T 3ZC1A 2XM2A 2UUCT 3N2KE 2LOPA 2NWBA 3KV9A 4ANJA 3EHZA 4DO0A 1HCIA 2M6IA 3UU4A 2X9XA 3F2EA 5LGUB 4DMWA 3RC8A 1WR6A 4NXMT 4K0KT 2C5KT 4HN9A 3A5XA 3ZSTA 2E9XB 5JRCA 1VCTA 2RPAA 3AEBA 2N1GA 1WFDA 1UUSA 2BS3A 3UU8A 4JI4T 3KDSE 2MYSA 1VRBA 3MACA 2IHR1 2OLTA 3ONXA 3P4SA 4L0RA 3ZT7A 4DBRA 1WRDA 5J0ZA 5AQMB 5FL0A 1KF6A 2W2UA 3KINB 1L0VA 2BKOA 4DUYT 3CX7B 4YJ2E 5LP6E 4AI6A 3NBXX 1FMVA 4LMLA 3TLVA 3ZKRA 4CN1A 2DWKA 2KWIB 1IZNB 3FHNA 2LSIA 3PUZF 4I4TE 1ZOYA 4PJNA 3Q5XA 4X62T 3ZLIA 3JAFA 2XAHB 3ZMSB 4TWDA 5HXRA 3I0OA 2CMRA 3FBZA 1WYBA 4J2CA 5FNVE 4QXCB 4QH4A 3VRBA 5C2TA 1Z8UA 4C91A 4YHJA 4HKAA 1SUMB 3AVRA 3CWZB 1KNZA 2J47A 4IL9A 3NVOA 1FJGT 3HKCE 1XMOT 3BK9A 3AE9A 3EDUA 4IE6A 4MALA 2WSSV 1UX4A 3S4UA 5F3JA 3QOFA 2ZM2A 5HXCA 4XBFB 4GOUA 3ZYLA 3RKOA 4UVCB 3CX8B 1ZV4X 4P0BA 5LYJE 4YLHA 3AA6B 4TZ4C 3HR0A 4E7ZA 3L09A 5JDMA 3MKDA 5LB7B 4HTEA 2XQ4A 3O4XE 3Q5DA 3ZN0B 3ZYMA 2AXDS 3UQ7A 4ZI7E 4IT4A 1WCRA 4DV5T 4HWDA 4X1IE 4DR5T 4OK0A 4FJOA 2PBIA 1HNXT 4H9PC 3AE2A 4IE4A 2E9XA 2CE7A 3V5UA 4WBOA 2ODVA 2RA1A 3GMIA 3QNUA 5HCMA 1MNDA 3AB3B 1UX5A 1W09A 2W63A 5JDHA 2LSYA 5CB4E 1JNZA 5LOVE 5CFBA 2J4GA 2MAWA 3BQLA 2WCAA 4I0UA 4G63A 1XDPA 2BVLA 2KNDA 2ZLYA 2GK9A 3RYCE 5ABHA 2LSKA 3CQXC 2XQ9A 4HFVA 3N2OA 1IJ5A 2V7IA 4JLEA 4UXNB 2BZBA 2QYWA 3TLSA 3O1HA 3TLWA 4UV9B 2HPJA 3N9OA 4YTNA 4DR1T 2WMNA 3ZMVB 3GN5A 5LHIB 4BJNA 4IE5A 4EZ4A 4HWCA 4DV0T 2LRKA 4DBQA 5BMVE 1E1HB 3ESLA 5JRCB 5CJ5A 1WR0A 2NW7A 4LF7T 3LG7A 1BR4A 3AE8A 2ZMAA 4X1YE 3ZT5A 5AQUB 4PK4A 5LBMA 1W0AA 3H37A 2IIUA 3CKDA 2D0TA 2DNXA 2V1DB 3RGLA 5EK2A 3JCFA 2L9QA 1QUUA 3EI0A 2SPCA 3PE0A 3RX6A 2X51A 4JI8T 4HEAA 4IDPA 2X9HA 4X66T 4ASKA 3G06A 4NPPA 2EHOB 4U7YA 2WDQA 2E2AA 2H3RA 2P9BA 3VKHA 2XQ7A 2NW9A 4UR9A 3B57A 1CHUA 3AECA 5HEHA 3JAEA 4U3CA 4LMKA 3HKDE 4LFBT 2UXDT 2WU2A 1I6ZA 1QLBA 2H88A 1BR1A 3RQUA 4U74A 1KNPA 4I43B 4ZI2D 2J62A 4CXXA 3ZEFB 3QB5K 4GYSA 4LMJA 3AEEA 4LF6T 2IAKA 4HWHA 4U31A 2HN2A 2IC6A 2CPTA 2PFVA 2WMOA 3FZLB 2E5VA 2N9DA 2WS3A 3PUYF 5FY1A 3TKLB 2NTXA 4EOZB 5IUXA 2WAUA 1MMDA 1VCSA 2CWOA 2V5CA 2H7OA 4HFCA 5H6RB 5HCJA 2WZHA 1OEDC 4QH5A 4YXDA 1NEKA 3ZT6A 2ZM8A 2UXNB 3AEAA 3I9YA 4WBNE 4O4LE 3SRZA 2UU9T 4AKLA 3SFEA 2QVAA 2X68A 3UT5E 1J5WA 1D1AA 2M6BA 2XAFB 3C4ZA 5AFUL 2H7VC 3ZJ2A 3VU7H 4E7SA 1OEDE 4ZI2C 2VQFT 2BS2A 2X0YA 2CA5A 5JDFA 4B6XA 2IW5B 4O4IE 4IHJE 1NWMX 2LT3A 5AQOB 4HWFA 4JEUB 5C3JA 5JR9A 4OX9T 4PJLA 2RP4A 2WBLA 4ZS2A 1XZYA 3TLUA 2Y48B 3IHRA 4LF8T 1V9DA 2W4XA 2BBHA 3CX6B 3C51A 2XHEB 3N9QA 4TWHA 4DR6T 4X5TA 4UV8B 3KFWX 4CN4A 5HEGA 4DR7T 1D0YA 2B1EA 4ZI3C 3VKGA 4P1NA 1B7TA 2V7KA 2BG9A 2XJ7A 2CXDA 4YJ3E 3ZMZB 3UU5A 2V6YB 3H3MA 3CPZA 3PUSA 1W0BA 4YT0A 2ZM0A 4YTPA 2W62A 4ISSA 2YEVC 3L39A 3RIAA 1W9RA 2EHOC 5ETWA 4EB6E 3FZMB 2VKOA 3OPCA 1OEDB 2VVNA 2WU5A 2K9AA 3AE5A 3RRCA 4CXYA 4QH1A 2H89A 3C4WA 3KVBA 3QC9A 5L3BB 4DUZT 3C50A 1XMQT 4ZOLE 5HEOA 3UULA 3L3PA 3LBXB 3QB5A 2V6XA 2YDRA 4A98A 1HG2A 2K48A 4KHZF 5L3FB 4ZZBA 2G0UA 5F8PA 2I0MA 2D2SA 3PJAA 3RIUC 2CRBA 4ILCA 4O4HE 4ZI3D 5JH7E 2X66A 3R84B 4HFHA 5HEUA 2XPKA 3FB2A 1BR0A 3WI3A 2BDEA 5LCYA 2V6YA 3I9WA 5LMNT 1VOMA 4I50E 5JQGE
chains in the Genus database with same CATH topology
5AQJB 3FZHB 5AQIB 5AQUB 3M3ZB 2D9DA 1M7KA 1M62A 3FZKB 1T7SA 3FZFB 3A8YC 5AQVB 4HWIB 5AQHB 3FZMB 5AQFB 5AQPB 3LDQB 1UK5A 4HWFA 5AQMB 5AQOB 1I6ZA 5AQSB 1HX1B 5AQLB 5AQGB 5AQQB 4HWCA 5AQNB 5AQTB 1UGOA 4HWDA 4HWHA 3FZLB 5AQRB 5AQKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQJ B;  3FZH B;  5AQI B;  5AQU B;  3M3Z B;  2D9D A;  1M7K A;  1M62 A;  3FZK B;  1T7S A;  3FZF B;  3A8Y C;  5AQV B;  4HWI B;  5AQH B;  3FZM B;  5AQF B;  5AQP B;  3LDQ B;  1UK5 A;  4HWF A;  5AQM B;  5AQO B;  1I6Z A;  5AQS B;  1HX1 B;  5AQL B;  5AQG B;  5AQQ B;  4HWC A;  5AQN B;  5AQT B;  1UGO A;  4HWD A;  4HWH A;  3FZL B;  5AQR B;  5AQK B; 
#chains in the Genus database with same CATH topology
 1XDO A;  2FJB A;  3OKQ A;  4UVB B;  3P4Q A;  2LKG A;  5FXW A;  1M7K A;  4QHO A;  2WWV A;  4JI7 T;  2CXL A;  2KMF A;  2VKJ A;  2XSA A;  4WYV A;  3B13 A;  4LFA T;  4EXT A;  1DU2 A;  3K3Q C;  4PK5 A;  3UFG A;  2MOZ A;  2CHO A;  4X65 T;  2YDQ A;  3F31 A;  1NEN A;  3MZK B;  2YDS A;  5HEJ A;  3J9X 1;  4A56 A;  4EGW A;  2VUR A;  2XM1 A;  2VVS A;  2YN6 A;  4WNK A;  4ZS3 A;  3IEE A;  3UFE A;  4WZX A;  4TV8 E;  5AQS B;  4UF0 A;  2KT9 A;  5AQL B;  1HX8 A;  3SS1 A;  2W67 A;  2XQ8 A;  2CM0 A;  2W61 A;  4V1A v;  2XQA A;  3MK7 C;  3AA7 B;  3AAE B;  4G2A A;  1IBL T;  1UUR A;  4ILB A;  2XTL A;  3OVU A;  3JC6 C;  4QX8 B;  3ZJ1 A;  2VK9 A;  3RKG A;  4CQI A;  3ZSS A;  3OTO T;  5DJQ C;  2E5L T;  5AQJ B;  2OV9 A;  4ZHQ E;  4PFO A;  5J2U E;  1MIV A;  4TNV A;  3E08 A;  3HL6 A;  2XAG B;  1JNR A;  1XWM A;  3OYX A;  4KBM B;  4DV4 T;  1E2A A;  3FZF B;  4B3M T;  2DCF A;  3J7Y q;  2DL1 A;  5FY0 A;  4YHH T;  4DR3 T;  2UXX B;  3FXE B;  4TUY E;  5CA1 E;  4AKG A;  5FY7 A;  2A9U A;  4EZH A;  3GWH A;  5AQP B;  3NRY A;  5E0O A;  3RYH E;  3K3O A;  2VKH A;  2VL8 A;  4U2Z A;  2NTY A;  3P4W A;  5ADX L;  2V7M A;  5JTG A;  3O1I A;  4Z90 A;  4O2B E;  1EZ3 A;  1T72 A;  4EV6 A;  2QA7 A;  4PJJ A;  1IBM T;  5AQG B;  3UQ4 A;  3BQI A;  3UU6 A;  5LHH B;  4JUY A;  4JYA T;  1MMG A;  3UU3 A;  3P50 A;  1HF8 A;  2JQQ A;  3K8P C;  1YD8 G;  3CK6 A;  5L47 A;  5A1L A;  3X1D A;  4EYU A;  1KFY A;  2PG8 A;  1SA0 E;  2XQ3 A;  2Z6E A;  4HFB A;  4U33 A;  5AQK B;  4DR4 T;  4GKJ T;  2JMH A;  2UUB T;  4N78 D;  3ZMT B;  4O4J E;  2HN1 A;  3JAD A;  2MBG A;  3ONJ A;  1MNE A;  5DAB A;  1N34 T;  3LK2 B;  3SOL A;  2L3L A;  2LM2 A;  2WDR A;  5C8Y E;  4MFR A;  1I94 T;  4GYR A;  3EVY A;  5FVL A;  3I0Q A;  1KNR A;  5IYZ E;  5ABF B;  1YQ3 A;  4UIG A;  4U2Y A;  5AQF B;  2BS4 A;  2VWA A;  3MXZ A;  4H63 V;  4IL4 A;  3H3A A;  4TWF A;  1AJ3 A;  2K24 A;  2KLQ A;  5GON E;  1HS7 A;  3PV0 F;  3OBV E;  3B5M A;  5FMN A;  1MMN A;  2K3W A;  2LHR A;  2VAS A;  5ABG A;  2F4V T;  3PTR B;  4A5X A;  1YW0 A;  4DMV A;  2WDV A;  2NW8 A;  2YU2 A;  4AQF A;  4DR2 T;  4H9R C;  5LGT B;  1MIY A;  1UGO A;  4UVA B;  5L4H A;  3ZC0 A;  2D5U A;  4DID B;  3QK6 A;  2CEA A;  4Z8X A;  2X0L B;  4AQY T;  4CI1 B;  3KBU A;  4TN7 B;  4EAH A;  4IIJ E;  2PTF A;  1FIO A;  1D1B A;  1HG5 A;  2VL0 A;  3FZK B;  3LBX A;  1T7S A;  2IML A;  1HR0 T;  4H9S E;  1X9B A;  5J2T E;  1X79 A;  2C0S A;  3AEG A;  3HA4 A;  3PUV F;  1KK7 A;  1YXR A;  5H6Q B;  3AE4 A;  4QX7 B;  2KSR A;  3IA3 A;  5EK4 A;  3RI5 A;  4AQG A;  1SHZ C;  4PK6 A;  3AXJ B;  5LG4 A;  3PUX F;  2E9X C;  3KVA A;  4LFC T;  2JIW A;  2KZ7 B;  2K5B B;  4FI5 A;  4QWN B;  2ODU A;  2BG9 B;  2A3D A;  4ZXL A;  3GN5 B;  4DV6 T;  1HX1 B;  3IF8 B;  4L5G A;  4BJM A;  2NP9 A;  3NKZ A;  4IDO A;  3T1H T;  3KV5 A;  4JI2 T;  3ZCI A;  4BAY B;  3K3N A;  5ABF A;  3ANW A;  3PUQ A;  4F8H A;  4O8S A;  3ZN1 B;  2JQ9 A;  2WM9 A;  2IUB A;  5FP3 A;  5JR9 B;  4PW8 A;  3AAI A;  3AVS A;  2X9W A;  3HI2 A;  4IE0 A;  3ZMU B;  4EEB A;  2BG9 C;  3FBL A;  4ERR A;  3Q5W A;  1LKX A;  3A8Y C;  3O9X A;  3RF1 A;  3ETV A;  2FJD A;  1G8X A;  2V7L A;  3DJB A;  5AQV B;  4HWI B;  3U78 A;  2I59 A;  2V26 A;  3MA9 A;  4X20 E;  3VRA A;  2CCQ A;  3P4P A;  3HKB E;  3NRX A;  4B3T T;  2Q9Q C;  1HFA A;  4KX6 A;  4M1P A;  4U7I A;  4WW0 A;  3VHL A;  3N2G E;  5KDM C;  2XQ6 A;  1G73 A;  3RLF F;  5JDQ A;  4IRE A;  2VQE T;  1T98 A;  2LSG A;  4NXN T;  2XQY A;  4YSY A;  5KMG P;  2Q9Q D;  5KX5 E;  3NZP A;  4F6R C;  4JI0 T;  2CXF A;  2XAQ B;  4JEH B;  4HFI A;  4YTM A;  3RIU A;  1LVK A;  2NOX A;  2X67 A;  4H9Q C;  3C98 B;  4DV3 T;  2ZM6 T;  3Q2M A;  4JI6 T;  1XNQ T;  5AQR B;  4AIS A;  1CUN A;  2B76 A;  2AE9 A;  4IST A;  2BVM A;  3NZQ A;  5AQI B;  5L4E A;  4AKI A;  2D9D A;  2JQH A;  3KV6 A;  3OJA A;  4CI3 B;  4XAX B;  3FXD B;  4MHC A;  2DI4 A;  4OYK A;  3LFM A;  1IAP A;  4IGU A;  5F5W A;  5IHY A;  4OFZ A;  3RYF E;  3E0Z A;  3VR8 A;  3L8R A;  3RRW A;  5FKY A;  4TV9 E;  5LBQ B;  1D0X A;  5JDN A;  2LEH A;  1LVF A;  2EHO A;  2FUP A;  1ZEE A;  2J1D G;  5HAX A;  1FMW A;  1US7 B;  3P8C D;  5HXH A;  4KHP T;  3T8O A;  4GK5 E;  2YK0 A;  1UK5 A;  2HH7 A;  2LOS A;  2XAS B;  3BQK A;  3CVR A;  4YFS A;  4MLK A;  3TLT A;  5L3C B;  2WQY A;  4JI5 T;  1KEY A;  2ACX A;  3U3I A;  3CQG B;  3DTO A;  4QKN A;  1OWA A;  5TAO A;  5LGN B;  4TNW A;  1BR2 A;  1E7P A;  1OED A;  1T8B A;  1H7C A;  1QSD A;  4KP3 C;  3SWH A;  3UUX B;  5HWX A;  5AQT B;  4LF5 T;  2UXC T;  4IDQ A;  3RHW A;  4I55 E;  2LSJ A;  3N9L A;  2DWG A;  4ILA A;  1IJ6 A;  4Q25 A;  4PJM A;  4QXB B;  5JVD E;  4JI1 T;  2FJA A;  1S94 A;  3PUW F;  3N9M A;  1YKH B;  3C4X A;  4P0A A;  3PDY A;  3RIF A;  1Z0P A;  2KXP B;  1MIW A;  1D0Z A;  1IBK T;  4AXP A;  2XY8 B;  1SE7 A;  4YSZ A;  3CML A;  4NUU A;  2VB6 A;  3M65 A;  3UUN A;  2CLY C;  3AA1 B;  4KMC A;  1ZHC A;  3PJA J;  5AQH B;  3RH3 A;  3PU8 A;  5LA6 E;  2BKN A;  2CBJ A;  4NIQ A;  4BA9 A;  1HNZ T;  1J5E T;  4LF9 T;  4PFP A;  2R6G F;  4X64 T;  4H63 H;  3AAA B;  4OHF A;  3R6N A;  5FXZ A;  5JDL A;  2LLY A;  4OYJ A;  1D1C A;  1MMA A;  3GA8 A;  4IDZ A;  4JBW F;  3RC3 A;  4L9I A;  5JDG A;  3LK4 2;  3EAB A;  3MJX A;  2JJ9 A;  2UXB T;  2E9X D;  3HKE E;  2LRL A;  2PJQ A;  2Y8D A;  2JRK A;  2BG9 E;  4CZZ B;  4XZC A;  4ZZC A;  5EZY E;  1YQ4 A;  1Y64 B;  4K0U A;  5KXJ A;  1N33 T;  4P09 A;  2ACZ A;  2V7J A;  3M3Z B;  4A97 A;  3AED A;  5FVK A;  2XAJ B;  3PUG A;  4CXW A;  1J1J A;  1FEW A;  4EED A;  4HFE A;  3P4R A;  3ETU A;  2VKD A;  3RQW A;  2WWU A;  2DHR A;  5M4Y A;  4DV2 T;  5ABE A;  2MTQ A;  1WLX A;  3OYZ A;  2V5D A;  3PUA A;  3A7M A;  4HE8 A;  4YSX A;  5LJM A;  2NR4 A;  4MBQ A;  4LF4 T;  3C64 A;  2EHO D;  3N5L A;  4EYY R;  1U5P A;  2XZE A;  5L3E B;  1ZP0 A;  4IE7 A;  3UTK A;  3F57 A;  5LNK A;  2CLY B;  5FXX A;  1WYC A;  4GKK T;  4KI0 F;  5HXS A;  1UCU A;  4JV5 T;  4AKH A;  4H9O C;  5DQW A;  3KBT A;  5IWA T;  2FJE A;  4CI2 B;  5CA0 E;  2N2N A;  2W0G A;  5AQN B;  4COF A;  4AQF C;  4B3R T;  3AA0 B;  4QXH B;  3AE6 A;  3WAJ A;  4ZEY A;  5LG3 A;  3EDV A;  3O1J A;  5FXV A;  2CBI A;  3AE7 A;  2BBJ A;  5HYA A;  4U72 A;  2XSB A;  1GQE A;  2JQK A;  4EIW A;  5CGM A;  3VR9 A;  2Q9Q A;  1OXZ A;  2YOE A;  2UUA T;  4CN6 A;  1M62 A;  3E22 E;  4UF0 B;  5JRE A;  1ZKE A;  4DV1 T;  2BKP A;  3IBP A;  2W00 A;  5FYM A;  2C5J A;  3UUM A;  1YKE B;  2LM9 A;  3SFD A;  2Q9Q B;  4GK0 E;  4AKR B;  2X0H A;  2CWY A;  3PU3 A;  3Q5E A;  4PNI A;  4YY3 T;  3ABV A;  3K1S A;  3LK3 B;  4H9N C;  3KV4 A;  2LE8 A;  2A72 A;  3UUB A;  3LDQ B;  1S35 A;  2MPK A;  3N9P A;  3ZCJ A;  1Y01 A;  3W15 B;  2L8K A;  2IC9 A;  4ADZ A;  5JR9 C;  2KWH A;  3EAM A;  5AQQ B;  3ANW B;  3LJC A;  5L2L A;  2LKH A;  4ILU A;  2WY2 A;  2YIN A;  2HHH T;  2CHN A;  1U4Q A;  2WZI A;  2QRX A;  3CQC B;  3JC6 D;  2YU1 A;  3D0T A;  4IDN A;  5BR8 T;  2XUE A;  3FZH B;  2E8I A;  4GIW A;  4UEM A;  3CIR A;  5J1G A;  2JPF A;  3ZYK A;  3P7I A;  5L3G B;  4DV7 T;  2JMK A;  3LSV A;  4O2A E;  4PAG A;  3AXJ A;  2X9Y A;  2WP9 A;  4HGA A;  1R8I A;  3AEF A;  4NUV A;  5EK3 A;  3QUJ A;  1NAF A;  3I1A A;  3WAK A;  3DP7 A;  4AIU A;  2M67 A;  1O3X A;  3T1Y T;  2HPL A;  3Q9D A;  5DQV A;  3ZPO A;  2A2F X;  4DND A;  2V8S V;  3N9N A;  2IDO B;  4TX5 A;  2LJL A;  3RPU A;  1HTJ F;  2I6H A;  1LRZ A;  4DVD A;  5LXT E;  4X1K E;  2XQ5 A;  5LMU T;  4Z91 A;  2OA5 A;  4B3S T;  4KUM B;  2YKS A;  5LJN A;  5FL1 A;  5HXE A;  2LHN A;  3V5S A;  2C5I T;  2ES0 A;  2FBW A;  3NWI A;  3PUR A;  5LHG B;  3AE1 A;  2QGS A;  2WB5 A;  2Y6X A;  5HWY A;  4HFD A;  2KIN B;  2W66 A;  3EUH A;  4UEL A;  4C90 A;  5L3D B;  3RYI E;  2D0U A;  3ONL C;  1XNR T;  1N32 T;  3AE3 A;  2DLR A;  4JI3 T;  1HNW T;  1N36 T;  3ZC1 A;  2XM2 A;  2UUC T;  3N2K E;  2LOP A;  2NWB A;  3KV9 A;  4ANJ A;  3EHZ A;  4DO0 A;  1HCI A;  2M6I A;  3UU4 A;  2X9X A;  3F2E A;  5LGU B;  4DMW A;  3RC8 A;  1WR6 A;  4NXM T;  4K0K T;  2C5K T;  4HN9 A;  3A5X A;  3ZST A;  2E9X B;  5JRC A;  1VCT A;  2RPA A;  3AEB A;  2N1G A;  1WFD A;  1UUS A;  2BS3 A;  3UU8 A;  4JI4 T;  3KDS E;  2MYS A;  1VRB A;  3MAC A;  2IHR 1;  2OLT A;  3ONX A;  3P4S A;  4L0R A;  3ZT7 A;  4DBR A;  1WRD A;  5J0Z A;  5AQM B;  5FL0 A;  1KF6 A;  2W2U A;  3KIN B;  1L0V A;  2BKO A;  4DUY T;  3CX7 B;  4YJ2 E;  5LP6 E;  4AI6 A;  3NBX X;  1FMV A;  4LML A;  3TLV A;  3ZKR A;  4CN1 A;  2DWK A;  2KWI B;  1IZN B;  3FHN A;  2LSI A;  3PUZ F;  4I4T E;  1ZOY A;  4PJN A;  3Q5X A;  4X62 T;  3ZLI A;  3JAF A;  2XAH B;  3ZMS B;  4TWD A;  5HXR A;  3I0O A;  2CMR A;  3FBZ A;  1WYB A;  4J2C A;  5FNV E;  4QXC B;  4QH4 A;  3VRB A;  5C2T A;  1Z8U A;  4C91 A;  4YHJ A;  4HKA A;  1SUM B;  3AVR A;  3CWZ B;  1KNZ A;  2J47 A;  4IL9 A;  3NVO A;  1FJG T;  3HKC E;  1XMO T;  3BK9 A;  3AE9 A;  3EDU A;  4IE6 A;  4MAL A;  2WSS V;  1UX4 A;  3S4U A;  5F3J A;  3QOF A;  2ZM2 A;  5HXC A;  4XBF B;  4GOU A;  3ZYL A;  3RKO A;  4UVC B;  3CX8 B;  1ZV4 X;  4P0B A;  5LYJ E;  4YLH A;  3AA6 B;  4TZ4 C;  3HR0 A;  4E7Z A;  3L09 A;  5JDM A;  3MKD A;  5LB7 B;  4HTE A;  2XQ4 A;  3O4X E;  3Q5D A;  3ZN0 B;  3ZYM A;  2AXD S;  3UQ7 A;  4ZI7 E;  4IT4 A;  1WCR A;  4DV5 T;  4HWD A;  4X1I E;  4DR5 T;  4OK0 A;  4FJO A;  2PBI A;  1HNX T;  4H9P C;  3AE2 A;  4IE4 A;  2E9X A;  2CE7 A;  3V5U A;  4WBO A;  2ODV A;  2RA1 A;  3GMI A;  3QNU A;  5HCM A;  1MND A;  3AB3 B;  1UX5 A;  1W09 A;  2W63 A;  5JDH A;  2LSY A;  5CB4 E;  1JNZ A;  5LOV E;  5CFB A;  2J4G A;  2MAW A;  3BQL A;  2WCA A;  4I0U A;  4G63 A;  1XDP A;  2BVL A;  2KND A;  2ZLY A;  2GK9 A;  3RYC E;  5ABH A;  2LSK A;  3CQX C;  2XQ9 A;  4HFV A;  3N2O A;  1IJ5 A;  2V7I A;  4JLE A;  4UXN B;  2BZB A;  2QYW A;  3TLS A;  3O1H A;  3TLW A;  4UV9 B;  2HPJ A;  3N9O A;  4YTN A;  4DR1 T;  2WMN A;  3ZMV B;  3GN5 A;  5LHI B;  4BJN A;  4IE5 A;  4EZ4 A;  4HWC A;  4DV0 T;  2LRK A;  4DBQ A;  5BMV E;  1E1H B;  3ESL A;  5JRC B;  5CJ5 A;  1WR0 A;  2NW7 A;  4LF7 T;  3LG7 A;  1BR4 A;  3AE8 A;  2ZMA A;  4X1Y E;  3ZT5 A;  5AQU B;  4PK4 A;  5LBM A;  1W0A A;  3H37 A;  2IIU A;  3CKD A;  2D0T A;  2DNX A;  2V1D B;  3RGL A;  5EK2 A;  3JCF A;  2L9Q A;  1QUU A;  3EI0 A;  2SPC A;  3PE0 A;  3RX6 A;  2X51 A;  4JI8 T;  4HEA A;  4IDP A;  2X9H A;  4X66 T;  4ASK A;  3G06 A;  4NPP A;  2EHO B;  4U7Y A;  2WDQ A;  2E2A A;  2H3R A;  2P9B A;  3VKH A;  2XQ7 A;  2NW9 A;  4UR9 A;  3B57 A;  1CHU A;  3AEC A;  5HEH A;  3JAE A;  4U3C A;  4LMK A;  3HKD E;  4LFB T;  2UXD T;  2WU2 A;  1I6Z A;  1QLB A;  2H88 A;  1BR1 A;  3RQU A;  4U74 A;  1KNP A;  4I43 B;  4ZI2 D;  2J62 A;  4CXX A;  3ZEF B;  3QB5 K;  4GYS A;  4LMJ A;  3AEE A;  4LF6 T;  2IAK A;  4HWH A;  4U31 A;  2HN2 A;  2IC6 A;  2CPT A;  2PFV A;  2WMO A;  3FZL B;  2E5V A;  2N9D A;  2WS3 A;  3PUY F;  5FY1 A;  3TKL B;  2NTX A;  4EOZ B;  5IUX A;  2WAU A;  1MMD A;  1VCS A;  2CWO A;  2V5C A;  2H7O A;  4HFC A;  5H6R B;  5HCJ A;  2WZH A;  1OED C;  4QH5 A;  4YXD A;  1NEK A;  3ZT6 A;  2ZM8 A;  2UXN B;  3AEA A;  3I9Y A;  4WBN E;  4O4L E;  3SRZ A;  2UU9 T;  4AKL A;  3SFE A;  2QVA A;  2X68 A;  3UT5 E;  1J5W A;  1D1A A;  2M6B A;  2XAF B;  3C4Z A;  5AFU L;  2H7V C;  3ZJ2 A;  3VU7 H;  4E7S A;  1OED E;  4ZI2 C;  2VQF T;  2BS2 A;  2X0Y A;  2CA5 A;  5JDF A;  4B6X A;  2IW5 B;  4O4I E;  4IHJ E;  1NWM X;  2LT3 A;  5AQO B;  4HWF A;  4JEU B;  5C3J A;  5JR9 A;  4OX9 T;  4PJL A;  2RP4 A;  2WBL A;  4ZS2 A;  1XZY A;  3TLU A;  2Y48 B;  3IHR A;  4LF8 T;  1V9D A;  2W4X A;  2BBH A;  3CX6 B;  3C51 A;  2XHE B;  3N9Q A;  4TWH A;  4DR6 T;  4X5T A;  4UV8 B;  3KFW X;  4CN4 A;  5HEG A;  4DR7 T;  1D0Y A;  2B1E A;  4ZI3 C;  3VKG A;  4P1N A;  1B7T A;  2V7K A;  2BG9 A;  2XJ7 A;  2CXD A;  4YJ3 E;  3ZMZ B;  3UU5 A;  2V6Y B;  3H3M A;  3CPZ A;  3PUS A;  1W0B A;  4YT0 A;  2ZM0 A;  4YTP A;  2W62 A;  4ISS A;  2YEV C;  3L39 A;  3RIA A;  1W9R A;  2EHO C;  5ETW A;  4EB6 E;  3FZM B;  2VKO A;  3OPC A;  1OED B;  2VVN A;  2WU5 A;  2K9A A;  3AE5 A;  3RRC A;  4CXY A;  4QH1 A;  2H89 A;  3C4W A;  3KVB A;  3QC9 A;  5L3B B;  4DUZ T;  3C50 A;  1XMQ T;  4ZOL E;  5HEO A;  3UUL A;  3L3P A;  3LBX B;  3QB5 A;  2V6X A;  2YDR A;  4A98 A;  1HG2 A;  2K48 A;  4KHZ F;  5L3F B;  4ZZB A;  2G0U A;  5F8P A;  2I0M A;  2D2S A;  3PJA A;  3RIU C;  2CRB A;  4ILC A;  4O4H E;  4ZI3 D;  5JH7 E;  2X66 A;  3R84 B;  4HFH A;  5HEU A;  2XPK A;  3FB2 A;  1BR0 A;  3WI3 A;  2BDE A;  5LCY A;  2V6Y A;  3I9W A;  5LMN T;  1VOM A;  4I50 E;  5JQG E; 
#chains in the Genus database with same CATH homology
 5AQJ B;  3FZH B;  5AQI B;  5AQU B;  3M3Z B;  2D9D A;  1M7K A;  1M62 A;  3FZK B;  1T7S A;  3FZF B;  3A8Y C;  5AQV B;  4HWI B;  5AQH B;  3FZM B;  5AQF B;  5AQP B;  3LDQ B;  1UK5 A;  4HWF A;  5AQM B;  5AQO B;  1I6Z A;  5AQS B;  1HX1 B;  5AQL B;  5AQG B;  5AQQ B;  4HWC A;  5AQN B;  5AQT B;  1UGO A;  4HWD A;  4HWH A;  3FZL B;  5AQR B;  5AQK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...