4HWCA

Structure of atbag1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
86
structure length
86
Chain Sequence
SASKAISDISLEVDRLGGRVSAFEMVTKKGGKIAEKDLVTVIELLMNELIKLDAIVAEGDVKLQRKMQVKRVQNYVETLDALKVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insight into plant programmed cell death mediated by BAG proteins in Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Apoptosis
molecule keywords BAG family molecular chaperone regulator 1
total genus 37
structure length 86
sequence length 86
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 4hwcA00
1M62A 1M7KA 5AQJB 5AQHB 5AQMB 5AQKB 5AQNB 2D9DA 3FZLB 5AQVB 5AQGB 1HX1B 5AQIB 1UK5A 4HWDA 4HWIB 4HWFA 4HWHA 3LDQB 3A8YC 4HWCA 5AQQB 3FZMB 5AQTB 5AQUB 1I6ZA 3FZFB 5AQLB 3FZHB 1UGOA 5AQPB 5AQRB 3FZKB 5AQSB 3M3ZB 5AQFB 1T7SA 5AQOB
chains in the Genus database with same CATH superfamily
1IBKT 1M7KA 5HWXA 2VQFT 1LVFA 4YT0A 2M6BA 2H89A 5FY0A 3WAJA 5EK4A 4GKKT 3O4XE 4LFBT 3AEBA 2CPTA 3FB2A 3KVAA 2UUCT 1IJ5A 4DR2T 4IIJE 4DR1T 2X9WA 1T72A 3GWHA 1J1JA 3EHZA 4PJNA 2VWAA 4X20E 3VR8A 4L5GA 4CZZB 4YTNA 4GKJT 4B3TT 3AE7A 3H3AA 5JRCB 4TUYE 4AISA 4IREA 4WZXA 3J7Yq 2W67A 4KBMB 2VVNA 3NZPA 1UGOA 3CX8B 2IW5B 5ABHA 5CA1E 1QUUA 2JQHA 3LBXB 4IE0A 2N9DA 4QX8B 2JRKA 5FXVA 4GIWA 4LF4T 1VRBA 3EI0A 3N9QA 3U78A 4DBRA 2YU1A 2DHRA 4EOZB 2IC6A 4BJNA 2DCFA 2CM0A 3CPZA 2HH7A 2LSGA 3C98B 1WR0A 2WAUA 1FMWA 3N2GE 5FMNA 4EZHA 2C0SA 3SWHA 3WAKA 4IE4A 2H88A 5HEUA 2D9DA 1BR2A 2LSYA 5KMGP 4AI6A 2CA5A 3QOFA 3AAIA 3T8OA 5EK2A 4DV7T 4NXMT 4G63A 4DUZT 1E2AA 5JQGE 2NP9A 1WRDA 2V26A 2ACZA 4AQFA 5IYZE 5L3GB 4H9QC 2LKGA 2V1DB 2WM9A 2WMNA 3K8PC 2HN2A 5JDFA 3ZJ1A 3HKBE 3UQ7A 4X62T 3FXDB 1I6ZA 2XQ4A 2Y8DA 2NOXA 2W63A 2KLQA 1ZOYA 4EIWA 4QWNB 1W9RA 3ESLA 3N9PA 1WYCA 4YTMA 2FBWA 1VCSA 2R6GF 3PUGA 2ZM8A 4ZXLA 3C51A 4IE7A 4ZI3C 2B1EA 3OVUA 2XQ3A 2XPKA 3CWZB 3UUNA 4DR4T 2MPKA 3CQGB 2CHNA 4PK4A 4YJ3E 2VL0A 3PUWF 3BQKA 2LOSA 4DV3T 1XDPA 4PJMA 4MBQA 3RPUA 1MIYA 2YINA 3UUBA 5FXZA 5HXEA 5M4YA 3RIFA 3UUXB 1QLBA 2PJQA 2VL8A 4GYRA 3NWIA 2E8IA 3RRCA 1O3XA 5LOVE 1D1CA 2CRBA 4AXPA 5L4EA 1VCTA 5L3FB 3AEFA 3C64A 1Z0PA 2BG9A 4CXXA 2VKDA 2PTFA 3DTOA 2A2FX 4H9OC 2YN6A 2ES0A 2N1GA 4EYUA 4AQYT 1OXZA 3T1HT 4DV6T 3ZYMA 3ZYLA 3LBXA 4Z8XA 4X1KE 4E7ZA 4FI5A 3VRAA 2X51A 2WBLA 3PU8A 4H9PC 3RIAA 3RC8A 1HNZT 5L47A 1VOMA 4AQGA 5JDNA 3D0TA 5FNVE 3ZMVB 4EEBA 4XBFB 2IMLA 1OEDA 5LG3A 4PFOA 2C5JA 3F57A 5F3JA 1IZNB 3AECA 2IDOB 4JEHB 3PV0F 5LNKA 2WDRA 2W0GA 1H7CA 3VR9A 3KDSE 3QC9A 1X9BA 3AEGA 5E0OA 5IUXA 2FUPA 3EUHA 3QB5K 5HCJA 4DIDB 5LP6E 5DQWA 4EB6E 3GN5A 3UU5A 2OLTA 2NWBA 2YU2A 2E5VA 3A8YC 5KX5E 4ZHQE 2LHNA 3O1JA 5AQUB 1HS7A 3KV6A 4LMKA 4U72A 2QVAA 3NBXX 2ZMAA 1HTJF 2BKOA 4TNWA 5AQPB 2WZHA 2YOEA 5CB4E 4AQFC 5LGNB 5LHGB 1HNWT 3L09A 2M6IA 3PUYF 2KNDA 2UXXB 3A7MA 3P8CD 5CA0E 5CJ5A 3AE9A 4GYSA 2WP9A 1HG5A 2WZIA 5HXCA 3VHLA 3HL6A 4MLKA 2MTQA 3ONJA 2VKJA 4X66T 2HHHT 4X1IE 4JUYA 4IE6A 4QHOA 2Q9QD 1ZV4X 2Y48B 3N5LA 4DVDA 3ZMTB 2CXDA 2ZM2A 2XAQB 5JR9B 3PUAA 2LSIA 4ISTA 5LGTB 2KWHA 3K3QC 2NW9A 3O1IA 1OEDC 3W15B 1B7TA 3RX6A 4ZZBA 3HR0A 5C2TA 4GOUA 3JAFA 3P4PA 3FZMB 2E9XB 4J2CA 5BMVE 4UV8B 1WCRA 1SE7A 1NAFA 2L8KA 1IBMT 1XNQT 3IHRA 1S35A 3UFGA 2W62A 1HG2A 2J62A 3A5XA 4UIGA 1HNXT 1XDOA 2M67A 2XQYA 1BR1A 5DABA 2WSSV 2ACXA 4NUUA 2W4XA 1ZHCA 2RPAA 2GK9A 2JJ9A 4H9SE 2X0YA 4H9RC 5ADXL 3ETVA 3NKZA 5HEGA 3CKDA 3FHNA 4HTEA 1M62A 3C4XA 3RI5A 3U3IA 5ABFB 5FP3A 3ZN0B 2NTYA 4H9NC 4HEAA 5ABGA 5EZYE 1UX5A 4QH1A 1V9DA 3RQUA 3ZYKA 3JCFA 1LKXA 4ZI3D 5HYAA 4EV6A 3Q5XA 4IDNA 1MMNA 4U2YA 5HEJA 5IHYA 5LJNA 4YXDA 2P9BA 3K1SA 2V5CA 4JV5T 1Y64B 2HPJA 2V5DA 3P4QA 4U3CA 1E7PA 3ZCJA 4EEDA 4DBQA 2NTXA 4HWHA 5AQTB 3RRWA 4HWFA 2LRLA 4X64T 4ANJA 4DV2T 3P4RA 2XQ8A 3KFWX 1UCUA 4UVBB 5FVKA 4LFCT 2CWOA 3T1YT 3CIRA 3K3NA 1ZEEA 1AJ3A 2IC9A 1NEKA 2DLRA 2JMKA 3ZN1B 2QRXA 4PK6A 2BDEA 3AA0B 2XM2A 2V6YB 2VVSA 3UTKA 3JC6D 3ZJ2A 3QUJA 4DV4T 1XMOT 4PNIA 3RIUA 3MACA 4AKRB 4LF7T 5LBQB 2BBHA 5HXSA 4LF9T 3AE4A 3FBLA 3B13A 5FKYA 4K0UA 2XSBA 4OFZA 4TX5A 2Q9QA 4IDOA 4YSZA 3AE2A 3UT5E 4KX6A 4KHZF 4UV9B 1D0YA 5HAXA 4L0RA 4A98A 4QKNA 5LYJE 2E9XC 4CN4A 2YKSA 4IGUA 4HWDA 2XTLA 4DV5T 4JI6T 2V6XA 3HKCE 3LDQB 3NVOA 3PDYA 3KBUA 3GMIA 4NIQA 4OYKA 2LEHA 1IJ6A 4JI8T 3Q5DA 5JDQA 2L3LA 3O1HA 3ZMUB 5AQRB 2WB5A 3I9YA 3KV4A 4PK5A 3PE0A 1ZKEA 1MIVA 4OYJA 1YQ4A 5ABFA 2PBIA 2X9YA 2XQAA 2MBGA 4YHJA 4DNDA 3CVRA 4CN1A 4EXTA 3ZC0A 2E9XD 2KXPB 4DV0T 3N9MA 2VURA 3L39A 4YY3T 4BAYB 3I0OA 2X66A 4G2AA 5J2TE 3AXJA 3OJAA 4WW0A 3VKGA 4ISSA 2YEVC 3KV9A 4QXBB 4AKLA 4EAHA 3IF8B 4QX7B 5AQJB 4LFAT 4KHPT 4L9IA 2LHRA 1I94T 2A3DA 2XY8B 3E08A 4C90A 2XASB 2MAWA 3IBPA 4HGAA 2H7OA 2I59A 1MMDA 2YK0A 2DWGA 2K9AA 4C91A 2CXLA 1XWMA 3QNUA 1D0XA 5L4HA 4BA9A 4Z90A 3R6NA 4ILUA 2WU2A 4ZZCA 3ZPOA 4CXWA 1IBLT 5IWAT 2IAKA 3UU8A 2Q9QC 2V6YA 1KF6A 2D5UA 4AIUA 2LM2A 4HFIA 4MHCA 1MMGA 4QH4A 3UULA 5FL0A 2VQET 3AA1B 4IDZA 4DR7T 2KT9A 3MJXA 1WYBA 5JDLA 3X1DA 4QH5A 1YD8G 2K5BB 3Q9DA 5LXTE 4PW8A 2LOPA 3VU7H 4OK0A 4YTPA 4DO0A 2ODVA 4LF6T 3CX7B 1MNDA 4JLEA 4U7YA 2FJBA 4CI3B 3H3MA 4P0BA 5LMNT 5L3BB 3ZKRA 1HF8A 2WDVA 5CFBA 4DR6T 4WNKA 2ZM0A 2BS3A 2XM1A 2C5IT 1SUMB 3FBZA 3OBVE 4IL9A 4NPPA 5EK3A 3PURA 5LGUB 2H3RA 3PUVF 3PJAA 2BS4A 3LK3B 3RIUC 2X0LB 3RYFE 2J4GA 4CI1B 2UUBT 4TZ4C 2WQYA 3AB3B 2J47A 2WY2A 4AKHA 2EHOD 1QSDA 1UURA 1DU2A 3VKHA 2W61A 2WWUA 4UXNB 4IE5A 4ILAA 1GQEA 2Z6EA 1J5ET 4ZOLE 4IDPA 5J0ZA 3PUSA 3BK9A 1OEDE 2DWKA 3RYCE 4EYYR 3IEEA 3TLUA 4CN6A 4JI1T 4JI5T 3Q5EA 5AQMB 3JADA 4O2BE 4TN7B 3AEEA 2EHOC 3EDVA 3HKEE 1FEWA 1WR6A 5J1GA 4IT4A 4UELA 1FIOA 3AA7B 1JNRA 1L0VA 3GA8A 3O9XA 3QB5A 1YKHB 3RF1A 5C8YE 5HXHA 1KEYA 5LJMA 1LRZA 4JI7T 1HX8A 1NENA 5F5WA 1KNRA 1SA0E 1UK5A 2X68A 3LFMA 3N2OA 4TWHA 5L2LA 3JC6C 2X9XA 1FJGT 3SRZA 5JVDE 3P50A 2WWVA 1U4QA 3ETUA 2CLYC 2KWIB 2LKHA 4Z91A 3FZHB 3ZSTA 2SPCA 5FY7A 3AEDA 3PUQA 4HFEA 2OV9A 2BG9C 3VRBA 2D0UA 3R84B 2VKHA 3JAEA 2RP4A 2N2NA 3HKDE 3M3ZB 4NUVA 3I1AA 3IA3A 2C5KT 2A9UA 4U74A 4EZ4A 4HFVA 4U33A 4V1Av 3AA6B 5HEHA 4B3ST 2FJEA 3AVRA 3M65A 4OHFA 5FXXA 2WMOA 5HEOA 2BKPA 2V8SV 4ZI2C 2CLYB 2G0UA 5JDHA 4JI3T 4K0KT 4OX9T 1IAPA 3N9OA 2V7IA 5AQVB 3KV5A 4YJ2E 3CK6A 4X65T 1XMQT 1UX4A 2UU9T 3ZT7A 2WCAA 5F8PA 4MFRA 5BR8T 2BVLA 3EVYA 3Q5WA 2LT3A 2KSRA 2XQ6A 2Y6XA 3AVSA 3AEAA 3CX6B 4O4IE 3OKQA 2LJLA 2YDSA 4AKIA 4A5XA 4ZI2D 2DL1A 1E1HB 3LG7A 4U31A 5LMUT 4ZS3A 2JQQA 3LSVA 3OPCA 3ZC1A 1HCIA 4F8HA 1G8XA 3MKDA 4AKGA 3LK2B 2DI4A 4PAGA 4PFPA 4CQIA 2ZM6T 4ZEYA 5FY1A 2LSKA 3I0QA 2BVMA 2WDQA 4UF0A 2K24A 4QXCB 1HR0T 4YFSA 2AE9A 2EHOB 5JR9C 2XAGB 2D2SA 2QGSA 5AQHB 2XZEA 2BZBA 1OEDB 1YXRA 4HKAA 3ZMZB 3AXJB 4PJJA 2UXDT 4DV1T 4O4HE 4O8SA 4ERRA 3UUMA 4I55E 3G06A 4TNVA 2BG9E 3ANWA 3CQCB 4KUMB 4ILBA 4KMCA 4O4JE 5AQIB 5AQGB 5LA6E 4X5TA 5JTGA 4HWIB 1MNEA 4HWCA 1D1BA 3EABA 2HN1A 4DR3T 1WFDA 3PTRB 3ABVA 5FXWA 3TKLB 5DQVA 3TLTA 4ZS2A 4LMLA 3ONLC 2V7MA 2IIUA 3KINB 3ONXA 1FMVA 1OWAA 2CXFA 1G73A 2CEAA 2HPLA 2X9HA 3KVBA 1D0ZA 2XQ9A 1R8IA 2QYWA 3FZKB 3QK6A 4UVCB 5AQSB 5LBMA 4B6XA 3ZSSA 4JI4T 2W2UA 5KDMC 4UVAB 4HFCA 2XAFB 3SOLA 4I0UA 5LHIB 1EZ3A 3RGLA 5DJQC 2LE8A 4JYAT 1MIWA 3AE5A 4HFDA 5AQKB 2E2AA 1US7B 4HE8A 2H7VC 4TWDA 5AQNB 3RH3A 3UFEA 4DUYT 2MYSA 3PJAJ 5JRCA 2VB6A 4YLHA 3FZLB 1WLXA 2JIWA 2IHR1 3ZCIA 5JDGA 2JQ9A 2LLYA 4B3MT 4A56A 2E5LT 3N9NA 5LHHB 2WU5A 5J2UE 4JI0T 4BJMA 2XJ7A 3FXEB 4LF8T 3CQXC 5JR9A 3RYHE 2KINB 2LRKA 2YDQA 3AE1A 3N2KE 4HFBA 4DMWA 2CBIA 2QA7A 4P1NA 4P0AA 4UR9A 4P09A 3RHWA 2VASA 2E9XA 2XUEA 3OYXA 3SS1A 3K3OA 2EHOA 4I43B 2LSJA 3RLFF 2KZ7B 4TV9E 1XNRT 4MALA 1BR0A 4N78D 1Z8UA 2BKNA 1T7SA 2XQ5A 5AQOB 4JI2T 5JH7E 4QXHB 4H63V 3E0ZA 4ASKA 2VKOA 3PU3A 4U2ZA 2NW7A 4LMJA 3ZLIA 3ANWB 1T98A 1KNPA 2K3WA 3AAEB 3B57A 2KMFA 3V5UA 3PUXF 2CHOA 3N9LA 4IL4A 3BQLA 3F31A 3P7IA 4FJOA 4U7IA 4YSYA 5L3CB 1YKEB 1ZP0A 2D0TA 3EAMA 4WYVA 4COFA 4M1PA 3OTOT 1XZYA 1J5WA 3AE6A 4XZCA 1W0BA 3RYIE 2FJDA 3OYZA 2DNXA 2XQ7A 1BR4A 3C50A 3CMLA 5AQLB 5AQQB 4YHHT 5FYMA 3ZMSB 5HCMA 3L8RA 4GK5E 3V5SA 2I6HA 5LCYA 3GN5B 5FVLA 4KP3C 1N36T 2ODUA 4XAXB 3Q2MA 2CWYA 3RQWA 2UXCT 4A97A 3ZT6A 1X79A 3KBTA 1KK7A 5GONE 1N32T 2V7JA 5L3DB 2B76A 1NWMX 1Y01A 2W00A 4EGWA 4NXNT 4CI2B 4LF5T 3E22E 2F4VT 3RC3A 2IUBA 1YQ3A 1YW0A 4I4TE 2JQKA 2BG9B 3LJCA 3TLSA 5KXJA 1JNZA 1SHZC 4HFHA 3LK42 4O4LE 1LVKA 4I50E 5ETWA 3AAAB 2OA5A 1MMAA 5H6RB 3SFDA 5L3EB 3P4SA 2UXNB 5H6QB 5FL1A 2YDRA 2CMRA 1N33T 2L9QA 3NRYA 2LM9A 3RKGA 3L3PA 4WBOA 1CHUA 2NR4A 2CE7A 4JBWF 2BBJA 3MZKB 3NRXA 3ZT5A 4DMVA 1T8BA 2Q9QB 1HFAA 2V7KA 1W09A 2XHEB 4PJLA 3MA9A 1KFYA 5JDMA 3PUZF 2AXDS 3AE3A 2JPFA 3P4WA 2FJAA 3UU3A 1W0AA 2J1DG 2XAHB 2K48A 5HXRA 4O2AE 3C4WA 5AQFB 5C3JA 3J9X1 2CCQA 2CBJA 4YSXA 2UUAT 1D1AA 1S94A 4ILCA 5TAOA 3UQ4A 3ZEFB 2MOZA 2WS3A 3AE8A 3NZQA 3I9WA 2RA1A 1U5PA 4Q25A 2PG8A 4X1YE 2I0MA 2X0HA 2VK9A 2X67A 4TWFA 4E7SA 2UXBT 4ADZA 4H63H 4UEMA 3C4ZA 3HI2A 4UF0B 3MK7C 4B3RT 3MXZA 3DJBA 3DP7A 4JEUB 3RKOA 5AFUL 2PFVA 1HX1B 2V7LA 5CGMA 1CUNA 2NW8A 1KNZA 4IDQA 4TV8E 3TLWA 3UU4A 3WI3A 5LG4A 4GK0E 4DR5T 3FZFB 3H37A 4WBNE 5A1LA 3TLVA 5JREA 5HWYA 4HN9A 3UU6A 1N34T 2XAJB 4F6RC 3SFEA 5LB7B 1UUSA 2A72A 2JMHA 5ABEA 2W66A 2ZLYA 4KI0F 2BS2A 3B5MA 4IHJE 2XSAA 3F2EA 4CXYA 3HA4A 4ZI7E 3S4UA 3BQIA 3EDUA
chains in the Genus database with same CATH topology
1M62A 1M7KA 5AQJB 5AQHB 5AQMB 5AQKB 5AQNB 2D9DA 3FZLB 5AQVB 5AQGB 1HX1B 5AQIB 1UK5A 4HWDA 4HWIB 4HWFA 4HWHA 3LDQB 3A8YC 4HWCA 5AQQB 3FZMB 5AQTB 5AQUB 1I6ZA 3FZFB 5AQLB 3FZHB 1UGOA 5AQPB 5AQRB 3FZKB 5AQSB 3M3ZB 5AQFB 1T7SA 5AQOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M62 A;  1M7K A;  5AQJ B;  5AQH B;  5AQM B;  5AQK B;  5AQN B;  2D9D A;  3FZL B;  5AQV B;  5AQG B;  1HX1 B;  5AQI B;  1UK5 A;  4HWD A;  4HWI B;  4HWF A;  4HWH A;  3LDQ B;  3A8Y C;  4HWC A;  5AQQ B;  3FZM B;  5AQT B;  5AQU B;  1I6Z A;  3FZF B;  5AQL B;  3FZH B;  1UGO A;  5AQP B;  5AQR B;  3FZK B;  5AQS B;  3M3Z B;  5AQF B;  1T7S A;  5AQO B; 
#chains in the Genus database with same CATH topology
 1IBK T;  1M7K A;  5HWX A;  2VQF T;  1LVF A;  4YT0 A;  2M6B A;  2H89 A;  5FY0 A;  3WAJ A;  5EK4 A;  4GKK T;  3O4X E;  4LFB T;  3AEB A;  2CPT A;  3FB2 A;  3KVA A;  2UUC T;  1IJ5 A;  4DR2 T;  4IIJ E;  4DR1 T;  2X9W A;  1T72 A;  3GWH A;  1J1J A;  3EHZ A;  4PJN A;  2VWA A;  4X20 E;  3VR8 A;  4L5G A;  4CZZ B;  4YTN A;  4GKJ T;  4B3T T;  3AE7 A;  3H3A A;  5JRC B;  4TUY E;  4AIS A;  4IRE A;  4WZX A;  3J7Y q;  2W67 A;  4KBM B;  2VVN A;  3NZP A;  1UGO A;  3CX8 B;  2IW5 B;  5ABH A;  5CA1 E;  1QUU A;  2JQH A;  3LBX B;  4IE0 A;  2N9D A;  4QX8 B;  2JRK A;  5FXV A;  4GIW A;  4LF4 T;  1VRB A;  3EI0 A;  3N9Q A;  3U78 A;  4DBR A;  2YU1 A;  2DHR A;  4EOZ B;  2IC6 A;  4BJN A;  2DCF A;  2CM0 A;  3CPZ A;  2HH7 A;  2LSG A;  3C98 B;  1WR0 A;  2WAU A;  1FMW A;  3N2G E;  5FMN A;  4EZH A;  2C0S A;  3SWH A;  3WAK A;  4IE4 A;  2H88 A;  5HEU A;  2D9D A;  1BR2 A;  2LSY A;  5KMG P;  4AI6 A;  2CA5 A;  3QOF A;  3AAI A;  3T8O A;  5EK2 A;  4DV7 T;  4NXM T;  4G63 A;  4DUZ T;  1E2A A;  5JQG E;  2NP9 A;  1WRD A;  2V26 A;  2ACZ A;  4AQF A;  5IYZ E;  5L3G B;  4H9Q C;  2LKG A;  2V1D B;  2WM9 A;  2WMN A;  3K8P C;  2HN2 A;  5JDF A;  3ZJ1 A;  3HKB E;  3UQ7 A;  4X62 T;  3FXD B;  1I6Z A;  2XQ4 A;  2Y8D A;  2NOX A;  2W63 A;  2KLQ A;  1ZOY A;  4EIW A;  4QWN B;  1W9R A;  3ESL A;  3N9P A;  1WYC A;  4YTM A;  2FBW A;  1VCS A;  2R6G F;  3PUG A;  2ZM8 A;  4ZXL A;  3C51 A;  4IE7 A;  4ZI3 C;  2B1E A;  3OVU A;  2XQ3 A;  2XPK A;  3CWZ B;  3UUN A;  4DR4 T;  2MPK A;  3CQG B;  2CHN A;  4PK4 A;  4YJ3 E;  2VL0 A;  3PUW F;  3BQK A;  2LOS A;  4DV3 T;  1XDP A;  4PJM A;  4MBQ A;  3RPU A;  1MIY A;  2YIN A;  3UUB A;  5FXZ A;  5HXE A;  5M4Y A;  3RIF A;  3UUX B;  1QLB A;  2PJQ A;  2VL8 A;  4GYR A;  3NWI A;  2E8I A;  3RRC A;  1O3X A;  5LOV E;  1D1C A;  2CRB A;  4AXP A;  5L4E A;  1VCT A;  5L3F B;  3AEF A;  3C64 A;  1Z0P A;  2BG9 A;  4CXX A;  2VKD A;  2PTF A;  3DTO A;  2A2F X;  4H9O C;  2YN6 A;  2ES0 A;  2N1G A;  4EYU A;  4AQY T;  1OXZ A;  3T1H T;  4DV6 T;  3ZYM A;  3ZYL A;  3LBX A;  4Z8X A;  4X1K E;  4E7Z A;  4FI5 A;  3VRA A;  2X51 A;  2WBL A;  3PU8 A;  4H9P C;  3RIA A;  3RC8 A;  1HNZ T;  5L47 A;  1VOM A;  4AQG A;  5JDN A;  3D0T A;  5FNV E;  3ZMV B;  4EEB A;  4XBF B;  2IML A;  1OED A;  5LG3 A;  4PFO A;  2C5J A;  3F57 A;  5F3J A;  1IZN B;  3AEC A;  2IDO B;  4JEH B;  3PV0 F;  5LNK A;  2WDR A;  2W0G A;  1H7C A;  3VR9 A;  3KDS E;  3QC9 A;  1X9B A;  3AEG A;  5E0O A;  5IUX A;  2FUP A;  3EUH A;  3QB5 K;  5HCJ A;  4DID B;  5LP6 E;  5DQW A;  4EB6 E;  3GN5 A;  3UU5 A;  2OLT A;  2NWB A;  2YU2 A;  2E5V A;  3A8Y C;  5KX5 E;  4ZHQ E;  2LHN A;  3O1J A;  5AQU B;  1HS7 A;  3KV6 A;  4LMK A;  4U72 A;  2QVA A;  3NBX X;  2ZMA A;  1HTJ F;  2BKO A;  4TNW A;  5AQP B;  2WZH A;  2YOE A;  5CB4 E;  4AQF C;  5LGN B;  5LHG B;  1HNW T;  3L09 A;  2M6I A;  3PUY F;  2KND A;  2UXX B;  3A7M A;  3P8C D;  5CA0 E;  5CJ5 A;  3AE9 A;  4GYS A;  2WP9 A;  1HG5 A;  2WZI A;  5HXC A;  3VHL A;  3HL6 A;  4MLK A;  2MTQ A;  3ONJ A;  2VKJ A;  4X66 T;  2HHH T;  4X1I E;  4JUY A;  4IE6 A;  4QHO A;  2Q9Q D;  1ZV4 X;  2Y48 B;  3N5L A;  4DVD A;  3ZMT B;  2CXD A;  2ZM2 A;  2XAQ B;  5JR9 B;  3PUA A;  2LSI A;  4IST A;  5LGT B;  2KWH A;  3K3Q C;  2NW9 A;  3O1I A;  1OED C;  3W15 B;  1B7T A;  3RX6 A;  4ZZB A;  3HR0 A;  5C2T A;  4GOU A;  3JAF A;  3P4P A;  3FZM B;  2E9X B;  4J2C A;  5BMV E;  4UV8 B;  1WCR A;  1SE7 A;  1NAF A;  2L8K A;  1IBM T;  1XNQ T;  3IHR A;  1S35 A;  3UFG A;  2W62 A;  1HG2 A;  2J62 A;  3A5X A;  4UIG A;  1HNX T;  1XDO A;  2M67 A;  2XQY A;  1BR1 A;  5DAB A;  2WSS V;  2ACX A;  4NUU A;  2W4X A;  1ZHC A;  2RPA A;  2GK9 A;  2JJ9 A;  4H9S E;  2X0Y A;  4H9R C;  5ADX L;  3ETV A;  3NKZ A;  5HEG A;  3CKD A;  3FHN A;  4HTE A;  1M62 A;  3C4X A;  3RI5 A;  3U3I A;  5ABF B;  5FP3 A;  3ZN0 B;  2NTY A;  4H9N C;  4HEA A;  5ABG A;  5EZY E;  1UX5 A;  4QH1 A;  1V9D A;  3RQU A;  3ZYK A;  3JCF A;  1LKX A;  4ZI3 D;  5HYA A;  4EV6 A;  3Q5X A;  4IDN A;  1MMN A;  4U2Y A;  5HEJ A;  5IHY A;  5LJN A;  4YXD A;  2P9B A;  3K1S A;  2V5C A;  4JV5 T;  1Y64 B;  2HPJ A;  2V5D A;  3P4Q A;  4U3C A;  1E7P A;  3ZCJ A;  4EED A;  4DBQ A;  2NTX A;  4HWH A;  5AQT B;  3RRW A;  4HWF A;  2LRL A;  4X64 T;  4ANJ A;  4DV2 T;  3P4R A;  2XQ8 A;  3KFW X;  1UCU A;  4UVB B;  5FVK A;  4LFC T;  2CWO A;  3T1Y T;  3CIR A;  3K3N A;  1ZEE A;  1AJ3 A;  2IC9 A;  1NEK A;  2DLR A;  2JMK A;  3ZN1 B;  2QRX A;  4PK6 A;  2BDE A;  3AA0 B;  2XM2 A;  2V6Y B;  2VVS A;  3UTK A;  3JC6 D;  3ZJ2 A;  3QUJ A;  4DV4 T;  1XMO T;  4PNI A;  3RIU A;  3MAC A;  4AKR B;  4LF7 T;  5LBQ B;  2BBH A;  5HXS A;  4LF9 T;  3AE4 A;  3FBL A;  3B13 A;  5FKY A;  4K0U A;  2XSB A;  4OFZ A;  4TX5 A;  2Q9Q A;  4IDO A;  4YSZ A;  3AE2 A;  3UT5 E;  4KX6 A;  4KHZ F;  4UV9 B;  1D0Y A;  5HAX A;  4L0R A;  4A98 A;  4QKN A;  5LYJ E;  2E9X C;  4CN4 A;  2YKS A;  4IGU A;  4HWD A;  2XTL A;  4DV5 T;  4JI6 T;  2V6X A;  3HKC E;  3LDQ B;  3NVO A;  3PDY A;  3KBU A;  3GMI A;  4NIQ A;  4OYK A;  2LEH A;  1IJ6 A;  4JI8 T;  3Q5D A;  5JDQ A;  2L3L A;  3O1H A;  3ZMU B;  5AQR B;  2WB5 A;  3I9Y A;  3KV4 A;  4PK5 A;  3PE0 A;  1ZKE A;  1MIV A;  4OYJ A;  1YQ4 A;  5ABF A;  2PBI A;  2X9Y A;  2XQA A;  2MBG A;  4YHJ A;  4DND A;  3CVR A;  4CN1 A;  4EXT A;  3ZC0 A;  2E9X D;  2KXP B;  4DV0 T;  3N9M A;  2VUR A;  3L39 A;  4YY3 T;  4BAY B;  3I0O A;  2X66 A;  4G2A A;  5J2T E;  3AXJ A;  3OJA A;  4WW0 A;  3VKG A;  4ISS A;  2YEV C;  3KV9 A;  4QXB B;  4AKL A;  4EAH A;  3IF8 B;  4QX7 B;  5AQJ B;  4LFA T;  4KHP T;  4L9I A;  2LHR A;  1I94 T;  2A3D A;  2XY8 B;  3E08 A;  4C90 A;  2XAS B;  2MAW A;  3IBP A;  4HGA A;  2H7O A;  2I59 A;  1MMD A;  2YK0 A;  2DWG A;  2K9A A;  4C91 A;  2CXL A;  1XWM A;  3QNU A;  1D0X A;  5L4H A;  4BA9 A;  4Z90 A;  3R6N A;  4ILU A;  2WU2 A;  4ZZC A;  3ZPO A;  4CXW A;  1IBL T;  5IWA T;  2IAK A;  3UU8 A;  2Q9Q C;  2V6Y A;  1KF6 A;  2D5U A;  4AIU A;  2LM2 A;  4HFI A;  4MHC A;  1MMG A;  4QH4 A;  3UUL A;  5FL0 A;  2VQE T;  3AA1 B;  4IDZ A;  4DR7 T;  2KT9 A;  3MJX A;  1WYB A;  5JDL A;  3X1D A;  4QH5 A;  1YD8 G;  2K5B B;  3Q9D A;  5LXT E;  4PW8 A;  2LOP A;  3VU7 H;  4OK0 A;  4YTP A;  4DO0 A;  2ODV A;  4LF6 T;  3CX7 B;  1MND A;  4JLE A;  4U7Y A;  2FJB A;  4CI3 B;  3H3M A;  4P0B A;  5LMN T;  5L3B B;  3ZKR A;  1HF8 A;  2WDV A;  5CFB A;  4DR6 T;  4WNK A;  2ZM0 A;  2BS3 A;  2XM1 A;  2C5I T;  1SUM B;  3FBZ A;  3OBV E;  4IL9 A;  4NPP A;  5EK3 A;  3PUR A;  5LGU B;  2H3R A;  3PUV F;  3PJA A;  2BS4 A;  3LK3 B;  3RIU C;  2X0L B;  3RYF E;  2J4G A;  4CI1 B;  2UUB T;  4TZ4 C;  2WQY A;  3AB3 B;  2J47 A;  2WY2 A;  4AKH A;  2EHO D;  1QSD A;  1UUR A;  1DU2 A;  3VKH A;  2W61 A;  2WWU A;  4UXN B;  4IE5 A;  4ILA A;  1GQE A;  2Z6E A;  1J5E T;  4ZOL E;  4IDP A;  5J0Z A;  3PUS A;  3BK9 A;  1OED E;  2DWK A;  3RYC E;  4EYY R;  3IEE A;  3TLU A;  4CN6 A;  4JI1 T;  4JI5 T;  3Q5E A;  5AQM B;  3JAD A;  4O2B E;  4TN7 B;  3AEE A;  2EHO C;  3EDV A;  3HKE E;  1FEW A;  1WR6 A;  5J1G A;  4IT4 A;  4UEL A;  1FIO A;  3AA7 B;  1JNR A;  1L0V A;  3GA8 A;  3O9X A;  3QB5 A;  1YKH B;  3RF1 A;  5C8Y E;  5HXH A;  1KEY A;  5LJM A;  1LRZ A;  4JI7 T;  1HX8 A;  1NEN A;  5F5W A;  1KNR A;  1SA0 E;  1UK5 A;  2X68 A;  3LFM A;  3N2O A;  4TWH A;  5L2L A;  3JC6 C;  2X9X A;  1FJG T;  3SRZ A;  5JVD E;  3P50 A;  2WWV A;  1U4Q A;  3ETU A;  2CLY C;  2KWI B;  2LKH A;  4Z91 A;  3FZH B;  3ZST A;  2SPC A;  5FY7 A;  3AED A;  3PUQ A;  4HFE A;  2OV9 A;  2BG9 C;  3VRB A;  2D0U A;  3R84 B;  2VKH A;  3JAE A;  2RP4 A;  2N2N A;  3HKD E;  3M3Z B;  4NUV A;  3I1A A;  3IA3 A;  2C5K T;  2A9U A;  4U74 A;  4EZ4 A;  4HFV A;  4U33 A;  4V1A v;  3AA6 B;  5HEH A;  4B3S T;  2FJE A;  3AVR A;  3M65 A;  4OHF A;  5FXX A;  2WMO A;  5HEO A;  2BKP A;  2V8S V;  4ZI2 C;  2CLY B;  2G0U A;  5JDH A;  4JI3 T;  4K0K T;  4OX9 T;  1IAP A;  3N9O A;  2V7I A;  5AQV B;  3KV5 A;  4YJ2 E;  3CK6 A;  4X65 T;  1XMQ T;  1UX4 A;  2UU9 T;  3ZT7 A;  2WCA A;  5F8P A;  4MFR A;  5BR8 T;  2BVL A;  3EVY A;  3Q5W A;  2LT3 A;  2KSR A;  2XQ6 A;  2Y6X A;  3AVS A;  3AEA A;  3CX6 B;  4O4I E;  3OKQ A;  2LJL A;  2YDS A;  4AKI A;  4A5X A;  4ZI2 D;  2DL1 A;  1E1H B;  3LG7 A;  4U31 A;  5LMU T;  4ZS3 A;  2JQQ A;  3LSV A;  3OPC A;  3ZC1 A;  1HCI A;  4F8H A;  1G8X A;  3MKD A;  4AKG A;  3LK2 B;  2DI4 A;  4PAG A;  4PFP A;  4CQI A;  2ZM6 T;  4ZEY A;  5FY1 A;  2LSK A;  3I0Q A;  2BVM A;  2WDQ A;  4UF0 A;  2K24 A;  4QXC B;  1HR0 T;  4YFS A;  2AE9 A;  2EHO B;  5JR9 C;  2XAG B;  2D2S A;  2QGS A;  5AQH B;  2XZE A;  2BZB A;  1OED B;  1YXR A;  4HKA A;  3ZMZ B;  3AXJ B;  4PJJ A;  2UXD T;  4DV1 T;  4O4H E;  4O8S A;  4ERR A;  3UUM A;  4I55 E;  3G06 A;  4TNV A;  2BG9 E;  3ANW A;  3CQC B;  4KUM B;  4ILB A;  4KMC A;  4O4J E;  5AQI B;  5AQG B;  5LA6 E;  4X5T A;  5JTG A;  4HWI B;  1MNE A;  4HWC A;  1D1B A;  3EAB A;  2HN1 A;  4DR3 T;  1WFD A;  3PTR B;  3ABV A;  5FXW A;  3TKL B;  5DQV A;  3TLT A;  4ZS2 A;  4LML A;  3ONL C;  2V7M A;  2IIU A;  3KIN B;  3ONX A;  1FMV A;  1OWA A;  2CXF A;  1G73 A;  2CEA A;  2HPL A;  2X9H A;  3KVB A;  1D0Z A;  2XQ9 A;  1R8I A;  2QYW A;  3FZK B;  3QK6 A;  4UVC B;  5AQS B;  5LBM A;  4B6X A;  3ZSS A;  4JI4 T;  2W2U A;  5KDM C;  4UVA B;  4HFC A;  2XAF B;  3SOL A;  4I0U A;  5LHI B;  1EZ3 A;  3RGL A;  5DJQ C;  2LE8 A;  4JYA T;  1MIW A;  3AE5 A;  4HFD A;  5AQK B;  2E2A A;  1US7 B;  4HE8 A;  2H7V C;  4TWD A;  5AQN B;  3RH3 A;  3UFE A;  4DUY T;  2MYS A;  3PJA J;  5JRC A;  2VB6 A;  4YLH A;  3FZL B;  1WLX A;  2JIW A;  2IHR 1;  3ZCI A;  5JDG A;  2JQ9 A;  2LLY A;  4B3M T;  4A56 A;  2E5L T;  3N9N A;  5LHH B;  2WU5 A;  5J2U E;  4JI0 T;  4BJM A;  2XJ7 A;  3FXE B;  4LF8 T;  3CQX C;  5JR9 A;  3RYH E;  2KIN B;  2LRK A;  2YDQ A;  3AE1 A;  3N2K E;  4HFB A;  4DMW A;  2CBI A;  2QA7 A;  4P1N A;  4P0A A;  4UR9 A;  4P09 A;  3RHW A;  2VAS A;  2E9X A;  2XUE A;  3OYX A;  3SS1 A;  3K3O A;  2EHO A;  4I43 B;  2LSJ A;  3RLF F;  2KZ7 B;  4TV9 E;  1XNR T;  4MAL A;  1BR0 A;  4N78 D;  1Z8U A;  2BKN A;  1T7S A;  2XQ5 A;  5AQO B;  4JI2 T;  5JH7 E;  4QXH B;  4H63 V;  3E0Z A;  4ASK A;  2VKO A;  3PU3 A;  4U2Z A;  2NW7 A;  4LMJ A;  3ZLI A;  3ANW B;  1T98 A;  1KNP A;  2K3W A;  3AAE B;  3B57 A;  2KMF A;  3V5U A;  3PUX F;  2CHO A;  3N9L A;  4IL4 A;  3BQL A;  3F31 A;  3P7I A;  4FJO A;  4U7I A;  4YSY A;  5L3C B;  1YKE B;  1ZP0 A;  2D0T A;  3EAM A;  4WYV A;  4COF A;  4M1P A;  3OTO T;  1XZY A;  1J5W A;  3AE6 A;  4XZC A;  1W0B A;  3RYI E;  2FJD A;  3OYZ A;  2DNX A;  2XQ7 A;  1BR4 A;  3C50 A;  3CML A;  5AQL B;  5AQQ B;  4YHH T;  5FYM A;  3ZMS B;  5HCM A;  3L8R A;  4GK5 E;  3V5S A;  2I6H A;  5LCY A;  3GN5 B;  5FVL A;  4KP3 C;  1N36 T;  2ODU A;  4XAX B;  3Q2M A;  2CWY A;  3RQW A;  2UXC T;  4A97 A;  3ZT6 A;  1X79 A;  3KBT A;  1KK7 A;  5GON E;  1N32 T;  2V7J A;  5L3D B;  2B76 A;  1NWM X;  1Y01 A;  2W00 A;  4EGW A;  4NXN T;  4CI2 B;  4LF5 T;  3E22 E;  2F4V T;  3RC3 A;  2IUB A;  1YQ3 A;  1YW0 A;  4I4T E;  2JQK A;  2BG9 B;  3LJC A;  3TLS A;  5KXJ A;  1JNZ A;  1SHZ C;  4HFH A;  3LK4 2;  4O4L E;  1LVK A;  4I50 E;  5ETW A;  3AAA B;  2OA5 A;  1MMA A;  5H6R B;  3SFD A;  5L3E B;  3P4S A;  2UXN B;  5H6Q B;  5FL1 A;  2YDR A;  2CMR A;  1N33 T;  2L9Q A;  3NRY A;  2LM9 A;  3RKG A;  3L3P A;  4WBO A;  1CHU A;  2NR4 A;  2CE7 A;  4JBW F;  2BBJ A;  3MZK B;  3NRX A;  3ZT5 A;  4DMV A;  1T8B A;  2Q9Q B;  1HFA A;  2V7K A;  1W09 A;  2XHE B;  4PJL A;  3MA9 A;  1KFY A;  5JDM A;  3PUZ F;  2AXD S;  3AE3 A;  2JPF A;  3P4W A;  2FJA A;  3UU3 A;  1W0A A;  2J1D G;  2XAH B;  2K48 A;  5HXR A;  4O2A E;  3C4W A;  5AQF B;  5C3J A;  3J9X 1;  2CCQ A;  2CBJ A;  4YSX A;  2UUA T;  1D1A A;  1S94 A;  4ILC A;  5TAO A;  3UQ4 A;  3ZEF B;  2MOZ A;  2WS3 A;  3AE8 A;  3NZQ A;  3I9W A;  2RA1 A;  1U5P A;  4Q25 A;  2PG8 A;  4X1Y E;  2I0M A;  2X0H A;  2VK9 A;  2X67 A;  4TWF A;  4E7S A;  2UXB T;  4ADZ A;  4H63 H;  4UEM A;  3C4Z A;  3HI2 A;  4UF0 B;  3MK7 C;  4B3R T;  3MXZ A;  3DJB A;  3DP7 A;  4JEU B;  3RKO A;  5AFU L;  2PFV A;  1HX1 B;  2V7L A;  5CGM A;  1CUN A;  2NW8 A;  1KNZ A;  4IDQ A;  4TV8 E;  3TLW A;  3UU4 A;  3WI3 A;  5LG4 A;  4GK0 E;  4DR5 T;  3FZF B;  3H37 A;  4WBN E;  5A1L A;  3TLV A;  5JRE A;  5HWY A;  4HN9 A;  3UU6 A;  1N34 T;  2XAJ B;  4F6R C;  3SFE A;  5LB7 B;  1UUS A;  2A72 A;  2JMH A;  5ABE A;  2W66 A;  2ZLY A;  4KI0 F;  2BS2 A;  3B5M A;  4IHJ E;  2XSA A;  3F2E A;  4CXY A;  3HA4 A;  4ZI7 E;  3S4U A;  3BQI A;  3EDU A; 
#chains in the Genus database with same CATH homology
 1M62 A;  1M7K A;  5AQJ B;  5AQH B;  5AQM B;  5AQK B;  5AQN B;  2D9D A;  3FZL B;  5AQV B;  5AQG B;  1HX1 B;  5AQI B;  1UK5 A;  4HWD A;  4HWI B;  4HWF A;  4HWH A;  3LDQ B;  3A8Y C;  4HWC A;  5AQQ B;  3FZM B;  5AQT B;  5AQU B;  1I6Z A;  3FZF B;  5AQL B;  3FZH B;  1UGO A;  5AQP B;  5AQR B;  3FZK B;  5AQS B;  3M3Z B;  5AQF B;  1T7S A;  5AQO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...