3AAIA

X-ray crystal structure of csor from thermus thermophilus hb8
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
86
structure length
78
Chain Sequence
HLDPKVREEARRRLLSAKGHLEGILRMLEDEKVYCVDVLKQLKAVEGALDRVGEMVLRAHLKDHDVEEIVEELMEALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Copper homeostasis operon regulatory protein
publication title Structural and functional characterization of the transcriptional repressor CsoR from Thermus thermophilus HB8
pubmed doi rcsb
source organism Thermus thermophilus
total genus 25
structure length 78
sequence length 86
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02583 Trns_repr_metal Metal-sensitive transcriptional repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1000 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3aaiA00
3AAIA 5LBMA 4UIGA 4M1PA 4ADZA 5LCYA 5FMNA 2HH7A
chains in the Genus database with same CATH superfamily
3ONLC 4NUVA 4QX7B 2MOZA 2DWKA 2OA5A 4EGWA 2BG9A 3RYHE 3PUVF 4Z91A 3P4RA 3F31A 4BAYB 4CQIA 5JTGA 2YU2A 4CXYA 3N9MA 3FZHB 2LSYA 2I59A 5LJNA 4TNVA 4QKNA 3ZYLA 3AEAA 2LRLA 5CA1E 3CMLA 3PUGA 4U3CA 5AQJB 2BDEA 4JBWF 3LDQB 4IE5A 2JMHA 2V7MA 4UV8B 3MJXA 3N2GE 3P4QA 4I50E 5JR9A 2V26A 4AQFC 3QNUA 2PTFA 2WU2A 3RI5A 3VHLA 1M62A 2DI4A 4KMCA 2WDQA 2AE9A 5C8YE 4TNWA 2E9XC 4HE8A 4HGAA 2N2NA 1ZV4X 5DQVA 4DUZT 2Q9QD 3ZEFB 3AVSA 4NXMT 2OLTA 3EHZA 2WP9A 4LFCT 3E08A 1WCRA 1HNWT 5HXRA 2CXDA 2HPLA 4X1IE 4ADZA 4H9QC 3LSVA 5LB7B 2AXDS 3O9XA 5EK3A 4HFHA 3FB2A 3RQUA 4H9OC 3CQXC 3GN5A 1HX1B 1LVFA 3O1JA 2XSBA 2MYSA 2V7IA 3NVOA 2WM9A 3AE8A 3QC9A 2WDVA 1VCSA 3RF1A 5LBQB 3AE4A 3KV9A 3N2KE 4U74A 4KBMB 3WI3A 5L47A 4E7ZA 3B13A 3QOFA 3L8RA 2IUBA 4PW8A 4WZXA 4DO0A 4YXDA 1N32T 1CUNA 2LM2A 2V8SV 3DTOA 1ZKEA 2B76A 2FJEA 2VURA 2VVSA 1JNRA 3RRCA 3O1HA 5LNKA 1MMAA 3V5SA 4XZCA 3AA1B 3VRBA 3E22E 4LMJA 4QWNB 3C98B 5J2TE 1FIOA 1N36T 5IUXA 2BBHA 4TWFA 4WBOA 2XQYA 3AE5A 5TAOA 2YEVC 3ZT5A 3BQKA 3OYZA 2FBWA 3LK3B 1BR1A 4F6RC 4ZZCA 3UQ7A 5AQIB 4J2CA 5M4YA 1EZ3A 5LGUB 4GK0E 1FMVA 4YJ2E 2V5CA 2XAFB 4JV5T 2EHOA 3KDSE 5FMNA 1WFDA 2SPCA 1XNRT 5AQGB 4GKJT 2LRKA 4B6XA 4EYYR 2QYWA 4TUYE 1D0XA 3NBXX 4KHZF 4QXBB 4UELA 2ACZA 3RIUA 2XAQB 1D0YA 5ETWA 3RQWA 1G73A 4AKHA 3MZKB 2YINA 3FXDB 4HN9A 4DV5T 3P8CD 3UFGA 3AAIA 1FEWA 3DP7A 3N9LA 2FJAA 2V6YA 4EZ4A 2LHNA 4IL4A 3PUYF 3ZSSA 3J7Yq 4CXWA 4CI3B 1YKEB 3M65A 3JAFA 3IA3A 4MFRA 3AB3B 3IEEA 4IL9A 4UR9A 3LBXA 4FJOA 4X5TA 1LVKA 4YTNA 3UQ4A 4O4LE 2XQ8A 5IHYA 2NWBA 3MKDA 1E7PA 3T8OA 3LG7A 4DBRA 2VL0A 1OXZA 1FJGT 2MPKA 2E5VA 2M6IA 4UIGA 5AQVB 4X1YE 2VASA 3P50A 1HS7A 2HPJA 3L39A 3L3PA 3PJAJ 4X66T 3ONXA 1AJ3A 3N9PA 4WNKA 2V1DB 4JI0T 2WWVA 3QK6A 1S35A 5CJ5A 2GK9A 1D0ZA 2E8IA 2J47A 3PUWF 5L3DB 4O4JE 2YOEA 5KX5E 5ABEA 4DMVA 4I43B 4WBNE 1UURA 3J9X1 4NPPA 3JC6C 4PFOA 3K1SA 5HEJA 5LMUT 3AEDA 4PAGA 3WAJA 4HFEA 5FXVA 2JQKA 5LG3A 3UT5E 1U5PA 4JUYA 4EV6A 5AFUL 5EZYE 2VQFT 1XWMA 2LSIA 4ZXLA 1OEDB 3TLUA 4CN1A 5HEGA 2M67A 2NW8A 2WDRA 3C50A 2BZBA 3ZMVB 2NP9A 1NENA 4AKGA 2W63A 4LMKA 3ESLA 2XZEA 4P09A 4EEBA 3P4PA 4Z90A 1MIVA 2UXCT 4ZEYA 4H9RC 2H7VC 5HXHA 5LJMA 3OYXA 3X1DA 1QUUA 4L0RA 2WWUA 3ZN1B 2CWOA 2X0YA 1T8BA 3OPCA 4C90A 2IDOB 3CWZB 2WB5A 3JAEA 1D1CA 1M7KA 3UULA 2PG8A 3UFEA 2EHOD 4XBFB 3ETVA 2Y6XA 2X9HA 4YHHT 2D0TA 2WS3A 2XM1A 5FY7A 1X79A 1I94T 2X9XA 2VKDA 1OEDC 2QRXA 3FZLB 1XZYA 5AQSB 2W66A 4COFA 4P0AA 2BS2A 1NAFA 1HTJF 4GYSA 3GWHA 4YSXA 2Y48B 4BJNA 2VQET 3N9QA 4UV9B 1IBMT 5JDQA 3RX6A 3ZSTA 4JI6T 3PTRB 2WY2A 2XQ3A 2A72A 3HA4A 2V6XA 4LF6T 1QLBA 2NW9A 2I6HA 3ZCJA 4CZZB 2IAKA 3ZJ1A 2LOSA 1H7CA 3A7MA 1ZHCA 5AQMB 2XTLA 3JC6D 2A2FX 3O4XE 3CX7B 1VRBA 5AQLB 3Q9DA 3FZMB 2BG9B 2ZM8A 2LM9A 2K3WA 4IE7A 1SUMB 4AKRB 4OFZA 4JEUB 1ZEEA 3H37A 3QB5K 4TV9E 2WZHA 1XDOA 5H6RB 2UXNB 3CX6B 3DJBA 3FBZA 5AQNB 3F2EA 2P9BA 3ONJA 2I0MA 4UVCB 3OVUA 4HWFA 2YN6A 3B57A 3Q2MA 3I0QA 4I4TE 3ZC1A 2VVNA 4A97A 4DR1T 3AVRA 4A98A 2OV9A 2LKGA 3ZJ2A 4H63V 5LG4A 4AKIA 1HR0T 5JR9B 4QXCB 5HEHA 4DNDA 4U33A 4LF5T 5EK2A 4I55E 4L9IA 5HYAA 3EDUA 4EYUA 5JDLA 2RP4A 4H63H 2DL1A 3NZQA 5DABA 2BG9C 2XHEB 1W0AA 2XY8B 4Q25A 4H9NC 1HG5A 3RYFE 2XPKA 1UGOA 2BKNA 3AE2A 2LSJA 2XQ6A 2B1EA 3PUXF 4MBQA 4DV6T 2X68A 3NZPA 4PK4A 4Z8XA 4GK5E 1V9DA 2W67A 4QXHB 1T98A 1HNXT 4QH4A 2CXFA 1KNPA 4HKAA 1OWAA 3N2OA 4ZS2A 5LHHB 3VR9A 3GN5B 3KVAA 3VKGA 5LMNT 3EAMA 5FL0A 3LK42 3BK9A 5HCMA 5JR9C 3Q5WA 2C5IT 1HX8A 1SA0E 3T1YT 4LF8T 3HKEE 3AE7A 3C4ZA 3RC3A 4HWCA 4DR5T 2XAGB 5GONE 3RLFF 3FZFB 1Y64B 3L09A 3BQIA 3UUBA 3ZYMA 4ZI2C 1GQEA 2Z6EA 4O8SA 4IDNA 3PDYA 4AXPA 2IW5B 4PJLA 4YT0A 2W61A 5FP3A 1WR6A 2JRKA 3EABA 5JVDE 3KV6A 5HCJA 2JQQA 4ILAA 3R84B 3HR0A 3BQLA 4YSYA 3GA8A 2KINB 5FXZA 1MNEA 1WRDA 3QUJA 5AQFB 2G0UA 2J62A 5JDMA 2VL8A 2KT9A 5JQGE 2W62A 1S94A 3RIAA 2H89A 4AKLA 3AE6A 5J0ZA 1JNZA 2A9UA 2WMNA 3O1IA 3B5MA 2CHNA 3RH3A 1KFYA 4IREA 2QA7A 3ZLIA 3RGLA 1J5WA 3HKCE 1B7TA 3I9YA 4C91A 4YLHA 4B3TT 2MTQA 2BVMA 5BR8T 3RKOA 1BR4A 4AI6A 3ZT7A 1UX4A 5HXEA 5HEOA 2EHOB 2FJDA 5HEUA 2M6BA 5F8PA 3UUMA 1WLXA 4NUUA 1YQ4A 4HEAA 3PU8A 2C0SA 4OK0A 4MALA 4UF0A 4X62T 5DJQC 5ABFA 5FVLA 3MACA 4IGUA 4ERRA 5FKYA 4P0BA 4G63A 1YW0A 2LOPA 4EEDA 1KEYA 4QH5A 3UUXB 3EUHA 4KX6A 4HFCA 4N78D 2KZ7B 3RPUA 4PK6A 5JRCA 4JI8T 1KF6A 2KSRA 4EOZB 4ZZBA 2UXXB 2YDSA 3GMIA 3NWIA 3SOLA 4P1NA 3FHNA 4TV8E 4IDZA 2N9DA 5JH7E 2L3LA 2ZMAA 5FY1A 5FNVE 3RYCE 2KNDA 5HWYA 1MIYA 5LCYA 2X66A 3CVRA 2V6YB 5KXJA 2X51A 3K3OA 2LHRA 4K0UA 2XQAA 5FYMA 5IYZE 1UUSA 5JDFA 3SFEA 2NTXA 2EHOC 4ZI2D 4LMLA 2JJ9A 5KMGP 4IDQA 4JI7T 3MA9A 4AQGA 3AEEA 3N9NA 3RC8A 4JI4T 1KK7A 2XUEA 1HG2A 2KXPB 3LBXB 2RPAA 1XMOT 1J1JA 3AA7B 3D0TA 3AEBA 2WMOA 4ILUA 5AQKB 4IHJE 3RIUC 4B3MT 4AIUA 4U7IA 2Q9QA 2X9WA 2LEHA 2DWGA 4YTMA 2WQYA 2KLQA 1Z8UA 3AE9A 1R8IA 4IIJE 2BS4A 1YKHB 3VKHA 4M1PA 4ILCA 2NTYA 4QH1A 4ZHQE 1HFAA 2KWHA 1IZNB 4DR6T 1UX5A 3AA0B 2E5LT 2XQ4A 3TLSA 4DV3T 3Q5DA 4ZI7E 1BR0A 2VWAA 2X0LB 1UK5A 4IE6A 5L4HA 2WAUA 2UU9T 3I0OA 3AE3A 2X0HA 2XQ9A 4YJ3E 2D2SA 3I9WA 3KV4A 2V7JA 4ZI3C 2PBIA 4X65T 4DR4T 4LFBT 4HFBA 2W2UA 4X64T 4O4IE 1MNDA 4X1KE 3JADA 5KDMC 2VK9A 1KNRA 3W15B 5HAXA 3ANWA 5LA6E 3CKDA 4K0KT 2YKSA 1SHZC 4TWDA 4KI0F 3M3ZB 5JDNA 4ISSA 2CCQA 3OKQA 4B3ST 1E2AA 2CM0A 3CX8B 4HTEA 4OHFA 3AAEB 5F3JA 2D0UA 4JEHB 4YTPA 1QSDA 4U2ZA 1W9RA 3CIRA 4GIWA 5AQOB 2XASB 3UUNA 1SE7A 2HN1A 4OX9T 5AQUB 3MK7C 4PK5A 5LHGB 4AQFA 2IMLA 3UTKA 2XM2A 2C5JA 2N1GA 2K48A 4DV2T 1ZOYA 3PJAA 3IBPA 3LFMA 3N5LA 2E9XA 5CB4E 4LF9T 5JDGA 4CXXA 1WYCA 3T1HT 5DQWA 4DV0T 3AXJA 3CQGB 2ODUA 5L3GB 3AECA 3UU3A 4HFIA 4KHPT 3KBUA 5AQHB 4GYRA 1IAPA 3EI0A 2CMRA 4LF7T 5HXCA 4GKKT 3FXEB 5AQRB 2E9XB 3QB5A 4ANJA 3AAAB 3UU8A 5L3FB 3ZPOA 2ACXA 1WR0A 2JIWA 2J4GA 3RKGA 4ZS3A 4EXTA 4CN4A 4JYAT 4UVBB 1LKXA 3AXJB 4ZI3D 5HXSA 2DHRA 2V7KA 4B3RT 2X67A 4JI1T 2IIUA 3WAKA 1IBKT 3AEFA 2DLRA 1Z0PA 1U4QA 2VB6A 2PFVA 3MXZA 2LSGA 2IC9A 1T72A 5L3EB 4BA9A 5LP6E 3E0ZA 4WW0A 3K3NA 3UU5A 4NIQA 4TWHA 4DV4T 2LT3A 2CA5A 4PJNA 1YQ3A 3HKDE 2W4XA 5FL1A 4ISTA 5ABHA 2WU5A 1WYBA 4G2AA 2FUPA 3NKZA 4HWHA 4F8HA 4X20E 4PJMA 5LBMA 4HWDA 4OYJA 4U72A 2L8KA 2F4VT 5AQQB 4WYVA 3PUAA 5AQTB 3CQCB 3PUSA 4AQYT 5IWAT 2RA1A 4O4HE 4UEMA 2K5BB 3FZKB 3C51A 1NWMX 2YDQA 1VCTA 2D9DA 5F5WA 3IF8B 2ZM6T 4ASKA 5FXWA 2BVLA 4LFAT 4AISA 3UU4A 2XJ7A 2YU1A 2V7LA 1T7SA 4BJMA 3Q5XA 3EVYA 3HKBE 1OEDE 3VR8A 3A8YC 2CBIA 2ODVA 3C4WA 2LJLA 4O2BE 2E2AA 1XDPA 3I1AA 2CRBA 4IDPA 4YSZA 4V1Av 2R6GF 3ZMTB 3TLTA 2HHHT 1D1AA 2W00A 3OJAA 4ILBA 5AQPB 3KINB 4IE0A 1US7B 4JLEA 4CN6A 2H88A 1E1HB 4DIDB 4UVAB 2CXLA 2K24A 4MHCA 1XMQT 2BKPA 3IHRA 4LF4T 4U7YA 2CE7A 2BKOA 4KUMB 1UCUA 2VKOA 4TZ4C 3JCFA 3R6NA 4EZHA 1MMGA 1MMNA 3P4WA 4HFVA 4U2YA 4EAHA 2XAJB 2HN2A 2YK0A 4MLKA 4JI3T 4QHOA 3ZYKA 1MIWA 1J5ET 2LE8A 3VU7H 4IT4A 4DR2T 5FXXA 4E7SA 2JQHA 2MAWA 2W0GA 3AEGA 3PU3A 4GOUA 3KVBA 3VRAA 2V5DA 3F57A 4DMWA 5ADXL 3EDVA 1VOMA 2CWYA 2ZM0A 2WBLA 2E9XD 3H3AA 4FI5A 4OYKA 3H3MA 4HWIB 1G8XA 4YHJA 4DR7T 2BBJA 2JQ9A 4O2AE 1I6ZA 3U3IA 1IJ6A 4I0UA 3S4UA 4H9SE 4EIWA 2D5UA 2KMFA 3ZCIA 2WCAA 1IJ5A 5HWXA 2JPFA 2ES0A 4ZOLE 5E0OA 3UU6A 2IHR1 1O3XA 2YDRA 3TKLB 4A5XA 4HFDA 3SRZA 5CFBA 2BG9E 3ETUA 1X9BA 2DNXA 1HNZT 2ZLYA 3A5XA 4QX8B 4H9PC 2FJBA 2JMKA 4KP3C 1YD8G 5LGNB 1FMWA 3HI2A 5J2UE 4UF0B 3RIFA 3P4SA 5ABFB 2CLYB 1Y01A 3PUQA 3Q5EA 4UXNB 4JI5T 5JDHA 2UUCT 2XSAA 3K8PC 4YY3T 4JI2T 2XQ5A 1HCIA 3CPZA 5JRCB 1NEKA 3ZC0A 2DCFA 3ZMSB 3PV0F 4CI1B 3ZMUB 5ABGA 3RRWA 2K9AA 4IDOA 4DV7T 2QVAA 3N9OA 2C5KT 3ZMZB 5A1LA 2CEAA 5BMVE 1ZP0A 5J1GA 3KBTA 3KFWX 2XAHB 1CHUA 4EB6E 3OTOT 5L4EA 5L2LA 2CBJA 2H7OA 4DBQA 5CGMA 3RHWA 3AE1A 5L3BB 2HH7A 2UXBT 3ZN0B 1KNZA 5LGTB 5LHIB 2VKJA 4PJJA 1XNQT 3SS1A 2CLYC 2J1DG 3RYIE 5EK4A 2NR4A 2PJQA 1YXRA 3V5UA 2KWIB 5JREA 1OEDA 5C3JA 2NW7A 2QGSA 2LLYA 3CK6A 4YFSA 1HF8A 2Q9QB 5FY0A 2VKHA 4U31A 3NRYA 2LKHA 3SFDA 2UUBT 4DVDA 2WSSV 5CA0E 4IE4A 5FVKA 4NXNT 2L9QA 2NOXA 3LJCA 3U78A 3HL6A 2CHOA 3LK2B 3OBVE 3PURA 2A3DA 3ZT6A 3K3QC 3SWHA 1N34T 3G06A 3PUZF 4DR3T 3ZKRA 2UUAT 5C2TA 3C4XA 1LRZA 4XAXB 5L3CB 2IC6A 2Y8DA 1N33T 1W09A 2CPTA 5LYJE 1BR2A 2MBGA 1D1BA 1DU2A 4DV1T 3TLWA 3ABVA 1W0BA 4A56A 3P7IA 3KV5A 3ANWB 4CI2B 3FBLA 2Q9QC 2WZIA 2LSKA 5LOVE 4PNIA 4DUYT 5LXTE 4L5GA 1IBLT 3TLVA 3C64A 2ZM2A 2BS3A 1L0VA 2H3RA 3AA6B 4TX5A 4TN7B 2XQ7A 4PFPA 2UXDT 2X9YA 5H6QB 3NRXA 3PE0A 1MMDA
chains in the Genus database with same CATH topology
3RKOA 1BR4A 4DMVA 4AI6A 4NUVA 1UX4A 5HXEA 4I43B 4QX7B 2MOZA 3IF8B 4WBNE 2EHOB 4ASKA 2DWKA 2OA5A 5FXWA 5F8PA 3UUMA 2BVLA 1WLXA 4NUUA 4HEAA 2YU1A 2V7LA 3PU8A 2C0SA 4OK0A 4MALA 3RYHE 4UF0A 4BJMA 5DJQC 3J9X1 3Q5XA 3JC6C 4PFOA 3EVYA 3HKBE 4PAGA 3MACA 4IGUA 4ERRA 4P0BA 3WAJA 4G63A 1YW0A 2LOPA 3F31A 5FXVA 4BAYB 3UUXB 2ODVA 3EUHA 3UT5E 4CQIA 3C4WA 1U5PA 2LJLA 4O2BE 4JUYA 4N78D 2KZ7B 5AFUL 2YU2A 5EZYE 4CXYA 2LSIA 3N9MA 3RPUA 3I1AA 4PK6A 5JRCA 2LSYA 4EOZB 2I59A 5LJNA 2M67A 2NW8A 4V1Av 2UXXB 3GMIA 3C50A 4QKNA 3ZMTB 3SOLA 2BZBA 3ZMVB 2NP9A 3ZYLA 1D1AA 4AKGA 3FHNA 2W63A 2W00A 3ESLA 3OJAA 3CMLA 3PUGA 5CA1E 4TV8E 3KINB 4IDZA 4P09A 2BDEA 2N9DA 5JH7E 4IE5A 2L3LA 4IE0A 1US7B 2JMHA 2ZMAA 5FY1A 5FNVE 2V7MA 4JLEA 3RYCE 2KNDA 4UV8B 5HWYA 1E1HB 1MIYA 5LCYA 4UVAB 3MJXA 2CXLA 2X66A 3N2GE 2K24A 4MHCA 3CVRA 1MIVA 2X51A 3K3OA 4I50E 3IHRA 4H9RC 2H7VC 2LHRA 5HXHA 5LJMA 2CE7A 3OYXA 4K0UA 4KUMB 5FYMA 5IYZE 1UCUA 2VKOA 5JDFA 1QUUA 5JR9A 4TZ4C 2V26A 2NTXA 4L0RA 4AQFC 3R6NA 4EZHA 2WWUA 3ZN1B 2EHOC 3VHLA 4ZI2D 5KMGP 2JJ9A 2CWOA 1MMGA 1MMNA 4HFVA 4EAHA 2DI4A 2XAJB 4C90A 3MA9A 2YK0A 4KMCA 3CWZB 4MLKA 4AQGA 3N9NA 4QHOA 3ZYKA 5C8YE 3RC8A 1MIWA 2LE8A 3VU7H 5FXXA 1KK7A 2XUEA 1D1CA 1HG2A 2E9XC 4HE8A 2W0GA 3UULA 2PG8A 4E7SA 3UFEA 2KXPB 3LBXB 2EHOD 4HGAA 4XBFB 2N2NA 3ETVA 1ZV4X 3PU3A 4GOUA 2Q9QD 5DQVA 2Y6XA 3ZEFB 2X9HA 3AVSA 3KVBA 3AA7B 3F57A 3D0TA 4DMWA 2D0TA 5ADXL 2WMOA 3EDVA 5FY7A 1X79A 4ILUA 1VOMA 2X9XA 2CWYA 3E08A 2ZM0A 4IHJE 2VKDA 2WBLA 2E9XD 2CXDA 2HPLA 3H3AA 4FI5A 5HXRA 4P0AA 4X1IE 4ADZA 4H9QC 2Q9QA 2X9WA 4OYKA 2LEHA 3O9XA 1NAFA 2DWGA 5EK3A 1G8XA 1HTJF 2KLQA 4GYSA 4YHJA 3FB2A 4IIJE 1YKHB 3VKHA 4M1PA 3GWHA 2NTYA 4H9OC 4O2AE 2Y48B 4ZHQE 3CQXC 3U3IA 4BJNA 1HFAA 3GN5A 1IJ6A 2KWHA 1LVFA 1IZNB 3N9QA 3S4UA 3O1JA 4UV9B 1UX5A 4H9SE 2MYSA 3AA0B 4EIWA 5JDQA 3RX6A 2D5UA 2KMFA 3ZCIA 2V7IA 1IJ5A 5HWXA 3PTRB 4ZI7E 1BR0A 2JPFA 2WM9A 2ES0A 2VWAA 4ZOLE 2A72A 2X0LB 3HA4A 5E0OA 3QC9A 4IE6A 2NW9A 2WAUA 1O3XA 3I0OA 3ZCJA 4CZZB 3TKLB 2IAKA 5LBQB 3KV9A 3N2KE 4U74A 4KBMB 3WI3A 3SRZA 3ZJ1A 2LOSA 1H7CA 4YJ3E 4E7ZA 2D2SA 3I9WA 3ETUA 3KV4A 3B13A 1ZHCA 2DNXA 2V7JA 2XTLA 4ZI3C 2ZLYA 2PBIA 3A5XA 3JC6D 4PW8A 4QX8B 4H9PC 2A2FX 4DO0A 2JMKA 3O4XE 4KP3C 3CX7B 1CUNA 1VRBA 1YD8G 3DTOA 4O4IE 3Q9DA 5LGNB 1MNDA 1ZKEA 4X1KE 5KDMC 1FMWA 2ZM8A 3HI2A 5J2UE 4UF0B 2LM9A 3RRCA 4IE7A 3O1HA 2VK9A 5LNKA 1MMAA 3V5SA 2CLYB 3W15B 4AKRB 5HAXA 4XZCA 3PUQA 4OFZA 3ANWA 4UXNB 3AA1B 5LA6E 5JDHA 3PE0A 3E22E 4JEUB 1ZEEA 3CKDA 3K8PC 3H37A 1SHZC 4TV9E 4QWNB 5H6RB 5JDNA 2UXNB 3C98B 3CX6B 3DJBA 3FBZA 1HCIA 4ISSA 5J2TE 1FIOA 3CPZA 5JRCB 2CCQA 3F2EA 2P9BA 3ZC0A 2DCFA 3OKQA 4WBOA 3ZMSB 2XQYA 2CM0A 4CI1B 3ZMUB 3CX8B 5TAOA 3RRWA 4UVCB 4HTEA 2YEVC 2K9AA 3B57A 3Q2MA 3I0QA 3N9OA 3BQKA 3AAEB 3OYZA 4OHFA 2C5KT 4I4TE 3ZMZB 3ZC1A 5F3JA 3LK3B 5A1LA 2D0UA 1BR1A 4JEHB 2CEAA 3AVRA 4F6RC 5BMVE 1QSDA 5J1GA 3KBTA 3ZJ2A 4H63V 4GIWA 3KFWX 2XAHB 2XASB 4J2CA 5LG4A 1EZ3A 4EB6E 5M4YA 5LGUB 5L2LA 3UUNA 4AKIA 2H7OA 4GK0E 1FMVA 4YJ2E 3MK7C 4PK5A 4DBQA 5LHGB 5JR9B 2XAFB 4AQFA 4QXCB 4DNDA 3UTKA 2EHOA 3KDSE 5L3BB 5EK2A 5FMNA 4I55E 4L9IA 2C5JA 2HH7A 5HYAA 3EDUA 4EYUA 2N1GA 2K48A 3ZN0B 5JDLA 2RP4A 4H63H 1KNZA 3NZQA 5LGTB 2SPCA 5DABA 5LHIB 2XHEB 3IBPA 3LFMA 2VKJA 4H9NC 1HG5A 3N5LA 4B6XA 3RYFE 2E9XA 4PJJA 5CB4E 3SS1A 2CLYC 2J1DG 3RYIE 4EYYR 5EK4A 2LSJA 4TUYE 1D0XA 5JDGA 4CXXA 2B1EA 2PJQA 3NBXX 4MBQA 1WYCA 2X68A 5DQWA 3NZPA 4QXBB 4UELA 4PK4A 3V5UA 3CQGB 4Z8XA 2KWIB 2ODUA 5L3GB 5JREA 2XAQB 1D0YA 4GK5E 5ETWA 1V9DA 2NW7A 2QGSA 4QXHB 1G73A 4YFSA 1HF8A 2Q9QB 4AKHA 1T98A 5FY0A 3KBUA 2VKHA 3MZKB 1IAPA 4GYRA 2YINA 3NRYA 3FXDB 4DVDA 2WSSV 5CA0E 4IE4A 2CXFA 4HN9A 2CMRA 5HXCA 4HKAA 3FXEB 3P8CD 1OWAA 3N2OA 4ZS2A 2E9XB 5LHHB 3AAIA 4ANJA 1FEWA 2L9QA 3GN5B 3KVAA 3DP7A 3N9LA 3AAAB 5L3FB 2NOXA 3ZPOA 3VKGA 2ACXA 3LJCA 4EZ4A 3U78A 3HL6A 3LK2B 3LK42 3BK9A 4ZS3A 2LHNA 4EXTA 3OBVE 4UVBB 1LKXA 3PURA 4ZI3D 5JR9C 5HXSA 2A3DA 2DHRA 3Q5WA 2C5IT 3K3QC 3SWHA 2V7KA 1HX8A 1SA0E 3J7Yq 4CXWA 3HKEE 4CI3B 1YKEB 3M65A 3C4ZA 3RC3A 2X67A 3C4XA 2XAGB 5GONE 1LRZA 4XAXB 5L3CB 2IC6A 1Y64B 3L09A 2Y8DA 3WAKA 2DLRA 3BQIA 4MFRA 1Z0PA 1U4QA 3AB3B 3IEEA 3ZYMA 2VB6A 4ZI2C 2Z6EA 3LBXA 4FJOA 4O8SA 2PFVA 3PDYA 3MXZA 4AXPA 1LVKA 2LSGA 2IC9A 2IW5B 5LYJE 1BR2A 5L3EB 4BA9A 4PJLA 5LP6E 3E0ZA 4WW0A 2MBGA 2W61A 4O4LE 1D1BA 5FP3A 5IHYA 2NWBA 3K3NA 1WR6A 3MKDA 2JRKA 2LT3A 3T8OA 4A56A 3P7IA 3KV5A 2CA5A 3LG7A 3ANWB 3HKDE 3KV6A 4PJNA 2JQQA 5JVDE 3R84B 3FBLA 4CI2B 3HR0A 4DBRA 1OXZA 2Q9QC 2LSKA 3BQLA 5LOVE 4ISTA 4PNIA 4UIGA 3GA8A 4L5GA 2KINB 5FXZA 5LXTE 1WYBA 1MNEA 1WRDA 4G2AA 4X1YE 3QUJA 2G0UA 2VASA 3C64A 4X20E 5JDMA 4PJMA 5LBMA 2VL8A 2KT9A 1HS7A 2HPJA 5JQGE 2W62A 1S94A 3L3PA 4AKLA 4OYJA 3ONXA 1AJ3A 4U72A 2L8KA 3N9PA 4WNKA 2V1DB 2ZM2A 2H3RA 3AA6B 4TX5A 3PUAA 2WMNA 3QK6A 1S35A 4TN7B 3O1IA 3CQCB 2GK9A 3RH3A 3PUSA 2QA7A 1D0ZA 3ZLIA 2E8IA 3HKCE 1B7TA 3I9YA 4C91A 4YLHA 4PFPA 2X9YA 5L3DB 4O4JE 5H6QB 2RA1A 4O4HE 2MTQA 2BVMA 4UEMA 3NRXA 2K5BB 3C51A 1NWMX 1MMDA 5KX5E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AAI A;  5LBM A;  4UIG A;  4M1P A;  4ADZ A;  5LCY A;  5FMN A;  2HH7 A; 
#chains in the Genus database with same CATH topology
 3ONL C;  4NUV A;  4QX7 B;  2MOZ A;  2DWK A;  2OA5 A;  4EGW A;  2BG9 A;  3RYH E;  3PUV F;  4Z91 A;  3P4R A;  3F31 A;  4BAY B;  4CQI A;  5JTG A;  2YU2 A;  4CXY A;  3N9M A;  3FZH B;  2LSY A;  2I59 A;  5LJN A;  4TNV A;  4QKN A;  3ZYL A;  3AEA A;  2LRL A;  5CA1 E;  3CML A;  3PUG A;  4U3C A;  5AQJ B;  2BDE A;  4JBW F;  3LDQ B;  4IE5 A;  2JMH A;  2V7M A;  4UV8 B;  3MJX A;  3N2G E;  3P4Q A;  4I50 E;  5JR9 A;  2V26 A;  4AQF C;  3QNU A;  2PTF A;  2WU2 A;  3RI5 A;  3VHL A;  1M62 A;  2DI4 A;  4KMC A;  2WDQ A;  2AE9 A;  5C8Y E;  4TNW A;  2E9X C;  4HE8 A;  4HGA A;  2N2N A;  1ZV4 X;  5DQV A;  4DUZ T;  2Q9Q D;  3ZEF B;  3AVS A;  4NXM T;  2OLT A;  3EHZ A;  2WP9 A;  4LFC T;  3E08 A;  1WCR A;  1HNW T;  5HXR A;  2CXD A;  2HPL A;  4X1I E;  4ADZ A;  4H9Q C;  3LSV A;  5LB7 B;  2AXD S;  3O9X A;  5EK3 A;  4HFH A;  3FB2 A;  3RQU A;  4H9O C;  3CQX C;  3GN5 A;  1HX1 B;  1LVF A;  3O1J A;  2XSB A;  2MYS A;  2V7I A;  3NVO A;  2WM9 A;  3AE8 A;  3QC9 A;  2WDV A;  1VCS A;  3RF1 A;  5LBQ B;  3AE4 A;  3KV9 A;  3N2K E;  4U74 A;  4KBM B;  3WI3 A;  5L47 A;  4E7Z A;  3B13 A;  3QOF A;  3L8R A;  2IUB A;  4PW8 A;  4WZX A;  4DO0 A;  4YXD A;  1N32 T;  1CUN A;  2LM2 A;  2V8S V;  3DTO A;  1ZKE A;  2B76 A;  2FJE A;  2VUR A;  2VVS A;  1JNR A;  3RRC A;  3O1H A;  5LNK A;  1MMA A;  3V5S A;  4XZC A;  3AA1 B;  3VRB A;  3E22 E;  4LMJ A;  4QWN B;  3C98 B;  5J2T E;  1FIO A;  1N36 T;  5IUX A;  2BBH A;  4TWF A;  4WBO A;  2XQY A;  3AE5 A;  5TAO A;  2YEV C;  3ZT5 A;  3BQK A;  3OYZ A;  2FBW A;  3LK3 B;  1BR1 A;  4F6R C;  4ZZC A;  3UQ7 A;  5AQI B;  4J2C A;  5M4Y A;  1EZ3 A;  5LGU B;  4GK0 E;  1FMV A;  4YJ2 E;  2V5C A;  2XAF B;  4JV5 T;  2EHO A;  3KDS E;  5FMN A;  1WFD A;  2SPC A;  1XNR T;  5AQG B;  4GKJ T;  2LRK A;  4B6X A;  4EYY R;  2QYW A;  4TUY E;  1D0X A;  3NBX X;  4KHZ F;  4QXB B;  4UEL A;  2ACZ A;  3RIU A;  2XAQ B;  1D0Y A;  5ETW A;  3RQW A;  1G73 A;  4AKH A;  3MZK B;  2YIN A;  3FXD B;  4HN9 A;  4DV5 T;  3P8C D;  3UFG A;  3AAI A;  1FEW A;  3DP7 A;  3N9L A;  2FJA A;  2V6Y A;  4EZ4 A;  2LHN A;  4IL4 A;  3PUY F;  3ZSS A;  3J7Y q;  4CXW A;  4CI3 B;  1YKE B;  3M65 A;  3JAF A;  3IA3 A;  4MFR A;  3AB3 B;  3IEE A;  4IL9 A;  4UR9 A;  3LBX A;  4FJO A;  4X5T A;  1LVK A;  4YTN A;  3UQ4 A;  4O4L E;  2XQ8 A;  5IHY A;  2NWB A;  3MKD A;  1E7P A;  3T8O A;  3LG7 A;  4DBR A;  2VL0 A;  1OXZ A;  1FJG T;  2MPK A;  2E5V A;  2M6I A;  4UIG A;  5AQV B;  4X1Y E;  2VAS A;  3P50 A;  1HS7 A;  2HPJ A;  3L39 A;  3L3P A;  3PJA J;  4X66 T;  3ONX A;  1AJ3 A;  3N9P A;  4WNK A;  2V1D B;  4JI0 T;  2WWV A;  3QK6 A;  1S35 A;  5CJ5 A;  2GK9 A;  1D0Z A;  2E8I A;  2J47 A;  3PUW F;  5L3D B;  4O4J E;  2YOE A;  5KX5 E;  5ABE A;  4DMV A;  4I43 B;  4WBN E;  1UUR A;  3J9X 1;  4NPP A;  3JC6 C;  4PFO A;  3K1S A;  5HEJ A;  5LMU T;  3AED A;  4PAG A;  3WAJ A;  4HFE A;  5FXV A;  2JQK A;  5LG3 A;  3UT5 E;  1U5P A;  4JUY A;  4EV6 A;  5AFU L;  5EZY E;  2VQF T;  1XWM A;  2LSI A;  4ZXL A;  1OED B;  3TLU A;  4CN1 A;  5HEG A;  2M67 A;  2NW8 A;  2WDR A;  3C50 A;  2BZB A;  3ZMV B;  2NP9 A;  1NEN A;  4AKG A;  2W63 A;  4LMK A;  3ESL A;  2XZE A;  4P09 A;  4EEB A;  3P4P A;  4Z90 A;  1MIV A;  2UXC T;  4ZEY A;  4H9R C;  2H7V C;  5HXH A;  5LJM A;  3OYX A;  3X1D A;  1QUU A;  4L0R A;  2WWU A;  3ZN1 B;  2CWO A;  2X0Y A;  1T8B A;  3OPC A;  4C90 A;  2IDO B;  3CWZ B;  2WB5 A;  3JAE A;  1D1C A;  1M7K A;  3UUL A;  2PG8 A;  3UFE A;  2EHO D;  4XBF B;  3ETV A;  2Y6X A;  2X9H A;  4YHH T;  2D0T A;  2WS3 A;  2XM1 A;  5FY7 A;  1X79 A;  1I94 T;  2X9X A;  2VKD A;  1OED C;  2QRX A;  3FZL B;  1XZY A;  5AQS B;  2W66 A;  4COF A;  4P0A A;  2BS2 A;  1NAF A;  1HTJ F;  4GYS A;  3GWH A;  4YSX A;  2Y48 B;  4BJN A;  2VQE T;  3N9Q A;  4UV9 B;  1IBM T;  5JDQ A;  3RX6 A;  3ZST A;  4JI6 T;  3PTR B;  2WY2 A;  2XQ3 A;  2A72 A;  3HA4 A;  2V6X A;  4LF6 T;  1QLB A;  2NW9 A;  2I6H A;  3ZCJ A;  4CZZ B;  2IAK A;  3ZJ1 A;  2LOS A;  1H7C A;  3A7M A;  1ZHC A;  5AQM B;  2XTL A;  3JC6 D;  2A2F X;  3O4X E;  3CX7 B;  1VRB A;  5AQL B;  3Q9D A;  3FZM B;  2BG9 B;  2ZM8 A;  2LM9 A;  2K3W A;  4IE7 A;  1SUM B;  4AKR B;  4OFZ A;  4JEU B;  1ZEE A;  3H37 A;  3QB5 K;  4TV9 E;  2WZH A;  1XDO A;  5H6R B;  2UXN B;  3CX6 B;  3DJB A;  3FBZ A;  5AQN B;  3F2E A;  2P9B A;  3ONJ A;  2I0M A;  4UVC B;  3OVU A;  4HWF A;  2YN6 A;  3B57 A;  3Q2M A;  3I0Q A;  4I4T E;  3ZC1 A;  2VVN A;  4A97 A;  4DR1 T;  3AVR A;  4A98 A;  2OV9 A;  2LKG A;  3ZJ2 A;  4H63 V;  5LG4 A;  4AKI A;  1HR0 T;  5JR9 B;  4QXC B;  5HEH A;  4DND A;  4U33 A;  4LF5 T;  5EK2 A;  4I55 E;  4L9I A;  5HYA A;  3EDU A;  4EYU A;  5JDL A;  2RP4 A;  4H63 H;  2DL1 A;  3NZQ A;  5DAB A;  2BG9 C;  2XHE B;  1W0A A;  2XY8 B;  4Q25 A;  4H9N C;  1HG5 A;  3RYF E;  2XPK A;  1UGO A;  2BKN A;  3AE2 A;  2LSJ A;  2XQ6 A;  2B1E A;  3PUX F;  4MBQ A;  4DV6 T;  2X68 A;  3NZP A;  4PK4 A;  4Z8X A;  4GK5 E;  1V9D A;  2W67 A;  4QXH B;  1T98 A;  1HNX T;  4QH4 A;  2CXF A;  1KNP A;  4HKA A;  1OWA A;  3N2O A;  4ZS2 A;  5LHH B;  3VR9 A;  3GN5 B;  3KVA A;  3VKG A;  5LMN T;  3EAM A;  5FL0 A;  3LK4 2;  3BK9 A;  5HCM A;  5JR9 C;  3Q5W A;  2C5I T;  1HX8 A;  1SA0 E;  3T1Y T;  4LF8 T;  3HKE E;  3AE7 A;  3C4Z A;  3RC3 A;  4HWC A;  4DR5 T;  2XAG B;  5GON E;  3RLF F;  3FZF B;  1Y64 B;  3L09 A;  3BQI A;  3UUB A;  3ZYM A;  4ZI2 C;  1GQE A;  2Z6E A;  4O8S A;  4IDN A;  3PDY A;  4AXP A;  2IW5 B;  4PJL A;  4YT0 A;  2W61 A;  5FP3 A;  1WR6 A;  2JRK A;  3EAB A;  5JVD E;  3KV6 A;  5HCJ A;  2JQQ A;  4ILA A;  3R84 B;  3HR0 A;  3BQL A;  4YSY A;  3GA8 A;  2KIN B;  5FXZ A;  1MNE A;  1WRD A;  3QUJ A;  5AQF B;  2G0U A;  2J62 A;  5JDM A;  2VL8 A;  2KT9 A;  5JQG E;  2W62 A;  1S94 A;  3RIA A;  2H89 A;  4AKL A;  3AE6 A;  5J0Z A;  1JNZ A;  2A9U A;  2WMN A;  3O1I A;  3B5M A;  2CHN A;  3RH3 A;  1KFY A;  4IRE A;  2QA7 A;  3ZLI A;  3RGL A;  1J5W A;  3HKC E;  1B7T A;  3I9Y A;  4C91 A;  4YLH A;  4B3T T;  2MTQ A;  2BVM A;  5BR8 T;  3RKO A;  1BR4 A;  4AI6 A;  3ZT7 A;  1UX4 A;  5HXE A;  5HEO A;  2EHO B;  2FJD A;  5HEU A;  2M6B A;  5F8P A;  3UUM A;  1WLX A;  4NUU A;  1YQ4 A;  4HEA A;  3PU8 A;  2C0S A;  4OK0 A;  4MAL A;  4UF0 A;  4X62 T;  5DJQ C;  5ABF A;  5FVL A;  3MAC A;  4IGU A;  4ERR A;  5FKY A;  4P0B A;  4G63 A;  1YW0 A;  2LOP A;  4EED A;  1KEY A;  4QH5 A;  3UUX B;  3EUH A;  4KX6 A;  4HFC A;  4N78 D;  2KZ7 B;  3RPU A;  4PK6 A;  5JRC A;  4JI8 T;  1KF6 A;  2KSR A;  4EOZ B;  4ZZB A;  2UXX B;  2YDS A;  3GMI A;  3NWI A;  3SOL A;  4P1N A;  3FHN A;  4TV8 E;  4IDZ A;  2N9D A;  5JH7 E;  2L3L A;  2ZMA A;  5FY1 A;  5FNV E;  3RYC E;  2KND A;  5HWY A;  1MIY A;  5LCY A;  2X66 A;  3CVR A;  2V6Y B;  5KXJ A;  2X51 A;  3K3O A;  2LHR A;  4K0U A;  2XQA A;  5FYM A;  5IYZ E;  1UUS A;  5JDF A;  3SFE A;  2NTX A;  2EHO C;  4ZI2 D;  4LML A;  2JJ9 A;  5KMG P;  4IDQ A;  4JI7 T;  3MA9 A;  4AQG A;  3AEE A;  3N9N A;  3RC8 A;  4JI4 T;  1KK7 A;  2XUE A;  1HG2 A;  2KXP B;  3LBX B;  2RPA A;  1XMO T;  1J1J A;  3AA7 B;  3D0T A;  3AEB A;  2WMO A;  4ILU A;  5AQK B;  4IHJ E;  3RIU C;  4B3M T;  4AIU A;  4U7I A;  2Q9Q A;  2X9W A;  2LEH A;  2DWG A;  4YTM A;  2WQY A;  2KLQ A;  1Z8U A;  3AE9 A;  1R8I A;  4IIJ E;  2BS4 A;  1YKH B;  3VKH A;  4M1P A;  4ILC A;  2NTY A;  4QH1 A;  4ZHQ E;  1HFA A;  2KWH A;  1IZN B;  4DR6 T;  1UX5 A;  3AA0 B;  2E5L T;  2XQ4 A;  3TLS A;  4DV3 T;  3Q5D A;  4ZI7 E;  1BR0 A;  2VWA A;  2X0L B;  1UK5 A;  4IE6 A;  5L4H A;  2WAU A;  2UU9 T;  3I0O A;  3AE3 A;  2X0H A;  2XQ9 A;  4YJ3 E;  2D2S A;  3I9W A;  3KV4 A;  2V7J A;  4ZI3 C;  2PBI A;  4X65 T;  4DR4 T;  4LFB T;  4HFB A;  2W2U A;  4X64 T;  4O4I E;  1MND A;  4X1K E;  3JAD A;  5KDM C;  2VK9 A;  1KNR A;  3W15 B;  5HAX A;  3ANW A;  5LA6 E;  3CKD A;  4K0K T;  2YKS A;  1SHZ C;  4TWD A;  4KI0 F;  3M3Z B;  5JDN A;  4ISS A;  2CCQ A;  3OKQ A;  4B3S T;  1E2A A;  2CM0 A;  3CX8 B;  4HTE A;  4OHF A;  3AAE B;  5F3J A;  2D0U A;  4JEH B;  4YTP A;  1QSD A;  4U2Z A;  1W9R A;  3CIR A;  4GIW A;  5AQO B;  2XAS B;  3UUN A;  1SE7 A;  2HN1 A;  4OX9 T;  5AQU B;  3MK7 C;  4PK5 A;  5LHG B;  4AQF A;  2IML A;  3UTK A;  2XM2 A;  2C5J A;  2N1G A;  2K48 A;  4DV2 T;  1ZOY A;  3PJA A;  3IBP A;  3LFM A;  3N5L A;  2E9X A;  5CB4 E;  4LF9 T;  5JDG A;  4CXX A;  1WYC A;  3T1H T;  5DQW A;  4DV0 T;  3AXJ A;  3CQG B;  2ODU A;  5L3G B;  3AEC A;  3UU3 A;  4HFI A;  4KHP T;  3KBU A;  5AQH B;  4GYR A;  1IAP A;  3EI0 A;  2CMR A;  4LF7 T;  5HXC A;  4GKK T;  3FXE B;  5AQR B;  2E9X B;  3QB5 A;  4ANJ A;  3AAA B;  3UU8 A;  5L3F B;  3ZPO A;  2ACX A;  1WR0 A;  2JIW A;  2J4G A;  3RKG A;  4ZS3 A;  4EXT A;  4CN4 A;  4JYA T;  4UVB B;  1LKX A;  3AXJ B;  4ZI3 D;  5HXS A;  2DHR A;  2V7K A;  4B3R T;  2X67 A;  4JI1 T;  2IIU A;  3WAK A;  1IBK T;  3AEF A;  2DLR A;  1Z0P A;  1U4Q A;  2VB6 A;  2PFV A;  3MXZ A;  2LSG A;  2IC9 A;  1T72 A;  5L3E B;  4BA9 A;  5LP6 E;  3E0Z A;  4WW0 A;  3K3N A;  3UU5 A;  4NIQ A;  4TWH A;  4DV4 T;  2LT3 A;  2CA5 A;  4PJN A;  1YQ3 A;  3HKD E;  2W4X A;  5FL1 A;  4IST A;  5ABH A;  2WU5 A;  1WYB A;  4G2A A;  2FUP A;  3NKZ A;  4HWH A;  4F8H A;  4X20 E;  4PJM A;  5LBM A;  4HWD A;  4OYJ A;  4U72 A;  2L8K A;  2F4V T;  5AQQ B;  4WYV A;  3PUA A;  5AQT B;  3CQC B;  3PUS A;  4AQY T;  5IWA T;  2RA1 A;  4O4H E;  4UEM A;  2K5B B;  3FZK B;  3C51 A;  1NWM X;  2YDQ A;  1VCT A;  2D9D A;  5F5W A;  3IF8 B;  2ZM6 T;  4ASK A;  5FXW A;  2BVL A;  4LFA T;  4AIS A;  3UU4 A;  2XJ7 A;  2YU1 A;  2V7L A;  1T7S A;  4BJM A;  3Q5X A;  3EVY A;  3HKB E;  1OED E;  3VR8 A;  3A8Y C;  2CBI A;  2ODV A;  3C4W A;  2LJL A;  4O2B E;  2E2A A;  1XDP A;  3I1A A;  2CRB A;  4IDP A;  4YSZ A;  4V1A v;  2R6G F;  3ZMT B;  3TLT A;  2HHH T;  1D1A A;  2W00 A;  3OJA A;  4ILB A;  5AQP B;  3KIN B;  4IE0 A;  1US7 B;  4JLE A;  4CN6 A;  2H88 A;  1E1H B;  4DID B;  4UVA B;  2CXL A;  2K24 A;  4MHC A;  1XMQ T;  2BKP A;  3IHR A;  4LF4 T;  4U7Y A;  2CE7 A;  2BKO A;  4KUM B;  1UCU A;  2VKO A;  4TZ4 C;  3JCF A;  3R6N A;  4EZH A;  1MMG A;  1MMN A;  3P4W A;  4HFV A;  4U2Y A;  4EAH A;  2XAJ B;  2HN2 A;  2YK0 A;  4MLK A;  4JI3 T;  4QHO A;  3ZYK A;  1MIW A;  1J5E T;  2LE8 A;  3VU7 H;  4IT4 A;  4DR2 T;  5FXX A;  4E7S A;  2JQH A;  2MAW A;  2W0G A;  3AEG A;  3PU3 A;  4GOU A;  3KVB A;  3VRA A;  2V5D A;  3F57 A;  4DMW A;  5ADX L;  3EDV A;  1VOM A;  2CWY A;  2ZM0 A;  2WBL A;  2E9X D;  3H3A A;  4FI5 A;  4OYK A;  3H3M A;  4HWI B;  1G8X A;  4YHJ A;  4DR7 T;  2BBJ A;  2JQ9 A;  4O2A E;  1I6Z A;  3U3I A;  1IJ6 A;  4I0U A;  3S4U A;  4H9S E;  4EIW A;  2D5U A;  2KMF A;  3ZCI A;  2WCA A;  1IJ5 A;  5HWX A;  2JPF A;  2ES0 A;  4ZOL E;  5E0O A;  3UU6 A;  2IHR 1;  1O3X A;  2YDR A;  3TKL B;  4A5X A;  4HFD A;  3SRZ A;  5CFB A;  2BG9 E;  3ETU A;  1X9B A;  2DNX A;  1HNZ T;  2ZLY A;  3A5X A;  4QX8 B;  4H9P C;  2FJB A;  2JMK A;  4KP3 C;  1YD8 G;  5LGN B;  1FMW A;  3HI2 A;  5J2U E;  4UF0 B;  3RIF A;  3P4S A;  5ABF B;  2CLY B;  1Y01 A;  3PUQ A;  3Q5E A;  4UXN B;  4JI5 T;  5JDH A;  2UUC T;  2XSA A;  3K8P C;  4YY3 T;  4JI2 T;  2XQ5 A;  1HCI A;  3CPZ A;  5JRC B;  1NEK A;  3ZC0 A;  2DCF A;  3ZMS B;  3PV0 F;  4CI1 B;  3ZMU B;  5ABG A;  3RRW A;  2K9A A;  4IDO A;  4DV7 T;  2QVA A;  3N9O A;  2C5K T;  3ZMZ B;  5A1L A;  2CEA A;  5BMV E;  1ZP0 A;  5J1G A;  3KBT A;  3KFW X;  2XAH B;  1CHU A;  4EB6 E;  3OTO T;  5L4E A;  5L2L A;  2CBJ A;  2H7O A;  4DBQ A;  5CGM A;  3RHW A;  3AE1 A;  5L3B B;  2HH7 A;  2UXB T;  3ZN0 B;  1KNZ A;  5LGT B;  5LHI B;  2VKJ A;  4PJJ A;  1XNQ T;  3SS1 A;  2CLY C;  2J1D G;  3RYI E;  5EK4 A;  2NR4 A;  2PJQ A;  1YXR A;  3V5U A;  2KWI B;  5JRE A;  1OED A;  5C3J A;  2NW7 A;  2QGS A;  2LLY A;  3CK6 A;  4YFS A;  1HF8 A;  2Q9Q B;  5FY0 A;  2VKH A;  4U31 A;  3NRY A;  2LKH A;  3SFD A;  2UUB T;  4DVD A;  2WSS V;  5CA0 E;  4IE4 A;  5FVK A;  4NXN T;  2L9Q A;  2NOX A;  3LJC A;  3U78 A;  3HL6 A;  2CHO A;  3LK2 B;  3OBV E;  3PUR A;  2A3D A;  3ZT6 A;  3K3Q C;  3SWH A;  1N34 T;  3G06 A;  3PUZ F;  4DR3 T;  3ZKR A;  2UUA T;  5C2T A;  3C4X A;  1LRZ A;  4XAX B;  5L3C B;  2IC6 A;  2Y8D A;  1N33 T;  1W09 A;  2CPT A;  5LYJ E;  1BR2 A;  2MBG A;  1D1B A;  1DU2 A;  4DV1 T;  3TLW A;  3ABV A;  1W0B A;  4A56 A;  3P7I A;  3KV5 A;  3ANW B;  4CI2 B;  3FBL A;  2Q9Q C;  2WZI A;  2LSK A;  5LOV E;  4PNI A;  4DUY T;  5LXT E;  4L5G A;  1IBL T;  3TLV A;  3C64 A;  2ZM2 A;  2BS3 A;  1L0V A;  2H3R A;  3AA6 B;  4TX5 A;  4TN7 B;  2XQ7 A;  4PFP A;  2UXD T;  2X9Y A;  5H6Q B;  3NRX A;  3PE0 A;  1MMD A; 
#chains in the Genus database with same CATH homology
 3RKO A;  1BR4 A;  4DMV A;  4AI6 A;  4NUV A;  1UX4 A;  5HXE A;  4I43 B;  4QX7 B;  2MOZ A;  3IF8 B;  4WBN E;  2EHO B;  4ASK A;  2DWK A;  2OA5 A;  5FXW A;  5F8P A;  3UUM A;  2BVL A;  1WLX A;  4NUU A;  4HEA A;  2YU1 A;  2V7L A;  3PU8 A;  2C0S A;  4OK0 A;  4MAL A;  3RYH E;  4UF0 A;  4BJM A;  5DJQ C;  3J9X 1;  3Q5X A;  3JC6 C;  4PFO A;  3EVY A;  3HKB E;  4PAG A;  3MAC A;  4IGU A;  4ERR A;  4P0B A;  3WAJ A;  4G63 A;  1YW0 A;  2LOP A;  3F31 A;  5FXV A;  4BAY B;  3UUX B;  2ODV A;  3EUH A;  3UT5 E;  4CQI A;  3C4W A;  1U5P A;  2LJL A;  4O2B E;  4JUY A;  4N78 D;  2KZ7 B;  5AFU L;  2YU2 A;  5EZY E;  4CXY A;  2LSI A;  3N9M A;  3RPU A;  3I1A A;  4PK6 A;  5JRC A;  2LSY A;  4EOZ B;  2I59 A;  5LJN A;  2M67 A;  2NW8 A;  4V1A v;  2UXX B;  3GMI A;  3C50 A;  4QKN A;  3ZMT B;  3SOL A;  2BZB A;  3ZMV B;  2NP9 A;  3ZYL A;  1D1A A;  4AKG A;  3FHN A;  2W63 A;  2W00 A;  3ESL A;  3OJA A;  3CML A;  3PUG A;  5CA1 E;  4TV8 E;  3KIN B;  4IDZ A;  4P09 A;  2BDE A;  2N9D A;  5JH7 E;  4IE5 A;  2L3L A;  4IE0 A;  1US7 B;  2JMH A;  2ZMA A;  5FY1 A;  5FNV E;  2V7M A;  4JLE A;  3RYC E;  2KND A;  4UV8 B;  5HWY A;  1E1H B;  1MIY A;  5LCY A;  4UVA B;  3MJX A;  2CXL A;  2X66 A;  3N2G E;  2K24 A;  4MHC A;  3CVR A;  1MIV A;  2X51 A;  3K3O A;  4I50 E;  3IHR A;  4H9R C;  2H7V C;  2LHR A;  5HXH A;  5LJM A;  2CE7 A;  3OYX A;  4K0U A;  4KUM B;  5FYM A;  5IYZ E;  1UCU A;  2VKO A;  5JDF A;  1QUU A;  5JR9 A;  4TZ4 C;  2V26 A;  2NTX A;  4L0R A;  4AQF C;  3R6N A;  4EZH A;  2WWU A;  3ZN1 B;  2EHO C;  3VHL A;  4ZI2 D;  5KMG P;  2JJ9 A;  2CWO A;  1MMG A;  1MMN A;  4HFV A;  4EAH A;  2DI4 A;  2XAJ B;  4C90 A;  3MA9 A;  2YK0 A;  4KMC A;  3CWZ B;  4MLK A;  4AQG A;  3N9N A;  4QHO A;  3ZYK A;  5C8Y E;  3RC8 A;  1MIW A;  2LE8 A;  3VU7 H;  5FXX A;  1KK7 A;  2XUE A;  1D1C A;  1HG2 A;  2E9X C;  4HE8 A;  2W0G A;  3UUL A;  2PG8 A;  4E7S A;  3UFE A;  2KXP B;  3LBX B;  2EHO D;  4HGA A;  4XBF B;  2N2N A;  3ETV A;  1ZV4 X;  3PU3 A;  4GOU A;  2Q9Q D;  5DQV A;  2Y6X A;  3ZEF B;  2X9H A;  3AVS A;  3KVB A;  3AA7 B;  3F57 A;  3D0T A;  4DMW A;  2D0T A;  5ADX L;  2WMO A;  3EDV A;  5FY7 A;  1X79 A;  4ILU A;  1VOM A;  2X9X A;  2CWY A;  3E08 A;  2ZM0 A;  4IHJ E;  2VKD A;  2WBL A;  2E9X D;  2CXD A;  2HPL A;  3H3A A;  4FI5 A;  5HXR A;  4P0A A;  4X1I E;  4ADZ A;  4H9Q C;  2Q9Q A;  2X9W A;  4OYK A;  2LEH A;  3O9X A;  1NAF A;  2DWG A;  5EK3 A;  1G8X A;  1HTJ F;  2KLQ A;  4GYS A;  4YHJ A;  3FB2 A;  4IIJ E;  1YKH B;  3VKH A;  4M1P A;  3GWH A;  2NTY A;  4H9O C;  4O2A E;  2Y48 B;  4ZHQ E;  3CQX C;  3U3I A;  4BJN A;  1HFA A;  3GN5 A;  1IJ6 A;  2KWH A;  1LVF A;  1IZN B;  3N9Q A;  3S4U A;  3O1J A;  4UV9 B;  1UX5 A;  4H9S E;  2MYS A;  3AA0 B;  4EIW A;  5JDQ A;  3RX6 A;  2D5U A;  2KMF A;  3ZCI A;  2V7I A;  1IJ5 A;  5HWX A;  3PTR B;  4ZI7 E;  1BR0 A;  2JPF A;  2WM9 A;  2ES0 A;  2VWA A;  4ZOL E;  2A72 A;  2X0L B;  3HA4 A;  5E0O A;  3QC9 A;  4IE6 A;  2NW9 A;  2WAU A;  1O3X A;  3I0O A;  3ZCJ A;  4CZZ B;  3TKL B;  2IAK A;  5LBQ B;  3KV9 A;  3N2K E;  4U74 A;  4KBM B;  3WI3 A;  3SRZ A;  3ZJ1 A;  2LOS A;  1H7C A;  4YJ3 E;  4E7Z A;  2D2S A;  3I9W A;  3ETU A;  3KV4 A;  3B13 A;  1ZHC A;  2DNX A;  2V7J A;  2XTL A;  4ZI3 C;  2ZLY A;  2PBI A;  3A5X A;  3JC6 D;  4PW8 A;  4QX8 B;  4H9P C;  2A2F X;  4DO0 A;  2JMK A;  3O4X E;  4KP3 C;  3CX7 B;  1CUN A;  1VRB A;  1YD8 G;  3DTO A;  4O4I E;  3Q9D A;  5LGN B;  1MND A;  1ZKE A;  4X1K E;  5KDM C;  1FMW A;  2ZM8 A;  3HI2 A;  5J2U E;  4UF0 B;  2LM9 A;  3RRC A;  4IE7 A;  3O1H A;  2VK9 A;  5LNK A;  1MMA A;  3V5S A;  2CLY B;  3W15 B;  4AKR B;  5HAX A;  4XZC A;  3PUQ A;  4OFZ A;  3ANW A;  4UXN B;  3AA1 B;  5LA6 E;  5JDH A;  3PE0 A;  3E22 E;  4JEU B;  1ZEE A;  3CKD A;  3K8P C;  3H37 A;  1SHZ C;  4TV9 E;  4QWN B;  5H6R B;  5JDN A;  2UXN B;  3C98 B;  3CX6 B;  3DJB A;  3FBZ A;  1HCI A;  4ISS A;  5J2T E;  1FIO A;  3CPZ A;  5JRC B;  2CCQ A;  3F2E A;  2P9B A;  3ZC0 A;  2DCF A;  3OKQ A;  4WBO A;  3ZMS B;  2XQY A;  2CM0 A;  4CI1 B;  3ZMU B;  3CX8 B;  5TAO A;  3RRW A;  4UVC B;  4HTE A;  2YEV C;  2K9A A;  3B57 A;  3Q2M A;  3I0Q A;  3N9O A;  3BQK A;  3AAE B;  3OYZ A;  4OHF A;  2C5K T;  4I4T E;  3ZMZ B;  3ZC1 A;  5F3J A;  3LK3 B;  5A1L A;  2D0U A;  1BR1 A;  4JEH B;  2CEA A;  3AVR A;  4F6R C;  5BMV E;  1QSD A;  5J1G A;  3KBT A;  3ZJ2 A;  4H63 V;  4GIW A;  3KFW X;  2XAH B;  2XAS B;  4J2C A;  5LG4 A;  1EZ3 A;  4EB6 E;  5M4Y A;  5LGU B;  5L2L A;  3UUN A;  4AKI A;  2H7O A;  4GK0 E;  1FMV A;  4YJ2 E;  3MK7 C;  4PK5 A;  4DBQ A;  5LHG B;  5JR9 B;  2XAF B;  4AQF A;  4QXC B;  4DND A;  3UTK A;  2EHO A;  3KDS E;  5L3B B;  5EK2 A;  5FMN A;  4I55 E;  4L9I A;  2C5J A;  2HH7 A;  5HYA A;  3EDU A;  4EYU A;  2N1G A;  2K48 A;  3ZN0 B;  5JDL A;  2RP4 A;  4H63 H;  1KNZ A;  3NZQ A;  5LGT B;  2SPC A;  5DAB A;  5LHI B;  2XHE B;  3IBP A;  3LFM A;  2VKJ A;  4H9N C;  1HG5 A;  3N5L A;  4B6X A;  3RYF E;  2E9X A;  4PJJ A;  5CB4 E;  3SS1 A;  2CLY C;  2J1D G;  3RYI E;  4EYY R;  5EK4 A;  2LSJ A;  4TUY E;  1D0X A;  5JDG A;  4CXX A;  2B1E A;  2PJQ A;  3NBX X;  4MBQ A;  1WYC A;  2X68 A;  5DQW A;  3NZP A;  4QXB B;  4UEL A;  4PK4 A;  3V5U A;  3CQG B;  4Z8X A;  2KWI B;  2ODU A;  5L3G B;  5JRE A;  2XAQ B;  1D0Y A;  4GK5 E;  5ETW A;  1V9D A;  2NW7 A;  2QGS A;  4QXH B;  1G73 A;  4YFS A;  1HF8 A;  2Q9Q B;  4AKH A;  1T98 A;  5FY0 A;  3KBU A;  2VKH A;  3MZK B;  1IAP A;  4GYR A;  2YIN A;  3NRY A;  3FXD B;  4DVD A;  2WSS V;  5CA0 E;  4IE4 A;  2CXF A;  4HN9 A;  2CMR A;  5HXC A;  4HKA A;  3FXE B;  3P8C D;  1OWA A;  3N2O A;  4ZS2 A;  2E9X B;  5LHH B;  3AAI A;  4ANJ A;  1FEW A;  2L9Q A;  3GN5 B;  3KVA A;  3DP7 A;  3N9L A;  3AAA B;  5L3F B;  2NOX A;  3ZPO A;  3VKG A;  2ACX A;  3LJC A;  4EZ4 A;  3U78 A;  3HL6 A;  3LK2 B;  3LK4 2;  3BK9 A;  4ZS3 A;  2LHN A;  4EXT A;  3OBV E;  4UVB B;  1LKX A;  3PUR A;  4ZI3 D;  5JR9 C;  5HXS A;  2A3D A;  2DHR A;  3Q5W A;  2C5I T;  3K3Q C;  3SWH A;  2V7K A;  1HX8 A;  1SA0 E;  3J7Y q;  4CXW A;  3HKE E;  4CI3 B;  1YKE B;  3M65 A;  3C4Z A;  3RC3 A;  2X67 A;  3C4X A;  2XAG B;  5GON E;  1LRZ A;  4XAX B;  5L3C B;  2IC6 A;  1Y64 B;  3L09 A;  2Y8D A;  3WAK A;  2DLR A;  3BQI A;  4MFR A;  1Z0P A;  1U4Q A;  3AB3 B;  3IEE A;  3ZYM A;  2VB6 A;  4ZI2 C;  2Z6E A;  3LBX A;  4FJO A;  4O8S A;  2PFV A;  3PDY A;  3MXZ A;  4AXP A;  1LVK A;  2LSG A;  2IC9 A;  2IW5 B;  5LYJ E;  1BR2 A;  5L3E B;  4BA9 A;  4PJL A;  5LP6 E;  3E0Z A;  4WW0 A;  2MBG A;  2W61 A;  4O4L E;  1D1B A;  5FP3 A;  5IHY A;  2NWB A;  3K3N A;  1WR6 A;  3MKD A;  2JRK A;  2LT3 A;  3T8O A;  4A56 A;  3P7I A;  3KV5 A;  2CA5 A;  3LG7 A;  3ANW B;  3HKD E;  3KV6 A;  4PJN A;  2JQQ A;  5JVD E;  3R84 B;  3FBL A;  4CI2 B;  3HR0 A;  4DBR A;  1OXZ A;  2Q9Q C;  2LSK A;  3BQL A;  5LOV E;  4IST A;  4PNI A;  4UIG A;  3GA8 A;  4L5G A;  2KIN B;  5FXZ A;  5LXT E;  1WYB A;  1MNE A;  1WRD A;  4G2A A;  4X1Y E;  3QUJ A;  2G0U A;  2VAS A;  3C64 A;  4X20 E;  5JDM A;  4PJM A;  5LBM A;  2VL8 A;  2KT9 A;  1HS7 A;  2HPJ A;  5JQG E;  2W62 A;  1S94 A;  3L3P A;  4AKL A;  4OYJ A;  3ONX A;  1AJ3 A;  4U72 A;  2L8K A;  3N9P A;  4WNK A;  2V1D B;  2ZM2 A;  2H3R A;  3AA6 B;  4TX5 A;  3PUA A;  2WMN A;  3QK6 A;  1S35 A;  4TN7 B;  3O1I A;  3CQC B;  2GK9 A;  3RH3 A;  3PUS A;  2QA7 A;  1D0Z A;  3ZLI A;  2E8I A;  3HKC E;  1B7T A;  3I9Y A;  4C91 A;  4YLH A;  4PFP A;  2X9Y A;  5L3D B;  4O4J E;  5H6Q B;  2RA1 A;  4O4H E;  2MTQ A;  2BVM A;  4UEM A;  3NRX A;  2K5B B;  3C51 A;  1NWM X;  1MMD A;  5KX5 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...