3J7Yq

Structure of the large ribosomal subunit from human mitochondria
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
128
structure length
128
Chain Sequence
YRARPPPRRRPGPRWPDPEDLLTPRWQLGPRYAAKQFARYGAASGVVPGSLWPSPEQLRELEAEEREWYPSLATMQESLRVKQLAEEQKRREREQHIAECMAKMPQMIVNWQQQQRENWEKAQADKER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Structure of the large ribosomal subunit from human mitochondria.
pubmed doi rcsb
total genus 35
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
q PF10147 CR6_interact Growth arrest and DNA-damage-inducible proteins-interacting protein 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1430 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3j7yq00
4V1Av 3J7Yq
chains in the Genus database with same CATH superfamily
4HWIB 3TLUA 5HEGA 4QWNB 4UVAB 4KHZF 5F5WA 4DV1T 5H6QB 3ETVA 4QH1A 4MBQA 3GA8A 5HWYA 3HL6A 1KF6A 1UX5A 4H63H 4YSZA 1V9DA 4O8SA 3RQWA 2LRLA 2XAQB 3GN5B 5FNVE 1XMQT 4A97A 3RLFF 4DV6T 1OEDE 3Q5DA 2XQ5A 2QYWA 2CEAA 5IHYA 3UU8A 3VU7H 1WR6A 2KWHA 1CHUA 2V5CA 2CRBA 4ZI2C 3MK7C 5EZYE 1MNEA 1UX4A 1XDOA 4YTNA 1US7B 1OEDC 4LF4T 2W2UA 3K3QC 3HR0A 1I94T 4QHOA 4CN1A 2FUPA 4MALA 3ZSSA 3BK9A 1QLBA 5CB4E 4PK4A 3PUAA 4JYAT 4HN9A 2WQYA 3RI5A 4HGAA 3AE9A 4IDOA 4HEAA 1W9RA 5LBMA 1BR2A 3JAEA 2XM2A 3EHZA 5JDGA 3RYCE 4NXNT 3DJBA 1UCUA 5LGTB 2CPTA 4AKRB 2ZM6T 2WP9A 2X9HA 2FJBA 2G0UA 1NEKA 3AE5A 2BS3A 2DCFA 3ONXA 1T72A 4UR9A 2SPCA 3KV5A 2N1GA 3AEEA 2K5BB 4DV3T 1GQEA 3Q9DA 4EOZB 2P9BA 2Q9QA 1ZKEA 3CKDA 1LVFA 3N2KE 5A1LA 2L3LA 5ABGA 2V6YB 3P50A 2X9XA 1HS7A 3EVYA 2W0GA 1HX1B 3LK42 3BQIA 2VK9A 5L4HA 3KV9A 1T98A 4EZHA 3RIAA 4QX7B 2LKGA 4DBQA 3EUHA 2WWVA 4QH5A 2CA5A 3LSVA 3AE1A 5DQWA 2BS2A 5FY1A 2YINA 3S4UA 3N9OA 3ZPOA 2AE9A 2WMNA 3F57A 4LF9T 5KDMC 1B7TA 1SHZC 3UTKA 3FBZA 5BR8T 2LSYA 2VWAA 2IAKA 2V1DB 4P0AA 5HYAA 5HEJA 1WCRA 5JR9A 1XNRT 5HCMA 1ZHCA 3I0QA 1ZV4X 2WWUA 3I0OA 3PUGA 2Y8DA 3NKZA 1G73A 4CN6A 3MXZA 3PUWF 1N36T 4EIWA 5ABFA 1T8BA 2ES0A 3RIFA 2HPLA 3PUQA 3B13A 2HHHT 3I9YA 2X0YA 2V26A 5ETWA 5LP6E 4ZEYA 2IUBA 5FXZA 3W15B 2GK9A 2YDRA 5JDNA 2M67A 2I0MA 4UVBB 4WBNE 4KMCA 3RRWA 2DNXA 3CPZA 2XQ7A 2XSBA 5AQOB 4O4IE 3K1SA 3LBXB 2YDSA 3RC3A 4P1NA 4HKAA 5C8YE 5CA0E 5FKYA 3N2OA 3CMLA 3T8OA 2D0UA 2PJQA 1WR0A 5FL0A 4EYYR 1Y01A 1SA0E 2VKHA 3KDSE 5HEHA 2LT3A 4X5TA 4GYSA 2JIWA 5FP3A 2C5IT 3UT5E 3PUXF 4TZ4C 1KNRA 3NWIA 3MA9A 2LSJA 5JDQA 5EK3A 1H7CA 4EXTA 5J1GA 1D1BA 3K8PC 1YD8G 2E2AA 1WLXA 3FZFB 3C4XA 3HA4A 4JI0T 2KLQA 4ILBA 4H9SE 4DVDA 2FJAA 3NRXA 5JDHA 3ZC1A 4CI3B 4EZ4A 1M62A 4DV2T 2IMLA 2QGSA 2IHR1 3ZMZB 5CFBA 5AQUB 5LA6E 3LBXA 2UXDT 2N2NA 2XZEA 3KVAA 4EB6E 4DR2T 2L8KA 1LKXA 3LFMA 2WBLA 2A2FX 4NPPA 1IJ6A 4IGUA 2N9DA 2NW7A 1U4QA 4EGWA 2LSKA 3ZT5A 1DU2A 2NR4A 2Y6XA 3PV0F 2XHEB 4HFBA 5LYJE 3Q5XA 3PDYA 4EV6A 2XASB 4TX5A 4K0KT 3ZJ2A 4AXPA 3R6NA 4GKJT 2H3RA 1E2AA 4JI1T 3ETUA 1IBLT 4AQFC 2XTLA 4WNKA 2EHOA 3N2GE 5HXRA 2LEHA 4I0UA 5J2UE 2BBHA 4C90A 4YHJA 2BKNA 4O4JE 4H9PC 2CBIA 4XZCA 2JQ9A 1L0VA 2LE8A 2JQHA 2UUAT 4DV5T 4YXDA 1QUUA 1D0ZA 3PJAJ 4HE8A 1N32T 4WW0A 3FBLA 4IE0A 2CLYB 4JI8T 1BR0A 1W0AA 1O3XA 3HKBE 4ZI3D 3K3NA 5HWXA 2NW9A 2OV9A 2JRKA 1KNZA 4LFBT 1FIOA 2A72A 1MIVA 3CQCB 2UXBT 4V1Av 3FZKB 3AAIA 4HFHA 1ZEEA 2WCAA 2JMHA 3TLWA 5L3BB 4E7ZA 3IEEA 5FXXA 2JJ9A 4QXBB 2XJ7A 5FXWA 1IJ5A 4X66T 1ZP0A 2V7JA 1I6ZA 3ZYMA 2I6HA 1J5WA 2BG9B 3OYZA 1UK5A 4TWFA 3LDQB 3PJAA 3UFEA 3ZLIA 3K3OA 3TKLB 4X65T 3SFEA 4HWDA 1MMDA 4Q25A 3UUNA 5HAXA 2YN6A 5AQPB 2PG8A 3L8RA 3H3AA 3ZMSB 3PUYF 4U72A 5LNKA 2H7VC 3L3PA 4AKLA 5CA1E 4COFA 2K48A 2LOPA 2Q9QC 2OA5A 5EK4A 1CUNA 4M1PA 4EYUA 4U74A 4GIWA 2ZM0A 2IIUA 3ZMTB 1HF8A 4ZS3A 4UELA 3UU4A 1VCTA 2LKHA 3RGLA 5HXHA 2W66A 1LVKA 2B76A 2UXCT 3AE7A 3N5LA 4IHJE 3N9MA 1W09A 2R6GF 3NZQA 2VL0A 4TV9E 3P4RA 2BG9A 4OFZA 4X1YE 2E9XA 2D0TA 4AQGA 3QUJA 5TAOA 3QOFA 2UUBT 1OXZA 2BVMA 3CX7B 3ZN1B 3JADA 2WAUA 3IHRA 4WYVA 4LF7T 3VR8A 2EHOD 3LJCA 5ABHA 3EAMA 2FBWA 3RIUA 4ZI7E 3ZJ1A 5JRCA 3ONJA 1OEDB 3N9QA 1MNDA 3PE0A 5J0ZA 5JR9C 3MACA 2YOEA 1YXRA 4QXCB 4H9OC 3KFWX 1HX8A 3DTOA 4K0UA 1FMWA 5AQSB 2AXDS 2MTQA 3OBVE 5AQHB 2J47A 4CXYA 4AKGA 2KNDA 1Y64B 5AQTB 2JPFA 3GN5A 4YY3T 4GK0E 2H89A 5JDMA 3EABA 4GKKT 3UUBA 4DV7T 4ZXLA 2I59A 3AE3A 3KV4A 4HWCA 4PFOA 2X0HA 3ZT6A 5C3JA 5HXEA 2KMFA 4U2ZA 5DABA 1ZOYA 3KINB 1KK7A 3QB5K 4A98A 2HN2A 2LM9A 2VB6A 1MMAA 2J62A 4ISTA 2V7MA 4DR5T 1W0BA 4O4HE 4UV8B 5L3DB 4ZZBA 2DL1A 4DR1T 1OEDA 1JNRA 3RRCA 3I1AA 5F3JA 4U3CA 4GYRA 4O4LE 2JQKA 5LBQB 3T1YT 2LSGA 4DMWA 3N9NA 3RH3A 3AEFA 2WB5A 4P09A 4PJNA 4CI2B 2LOSA 5FVLA 2KZ7B 5H6RB 2ZM2A 5LG4A 4LMLA 4J2CA 3OVUA 1BR4A 2W61A 2V6YA 3P7IA 1BR1A 4NUUA 3AXJB 4CQIA 4MHCA 2CHNA 2YU1A 4YLHA 4QKNA 3PTRB 1EZ3A 4U7IA 3TLTA 4QX8B 3BQKA 4PJJA 5HXSA 5LOVE 3FZLB 2NWBA 1S94A 1E7PA 1HCIA 2ZLYA 3CX8B 3LK3B 4BAYB 1FJGT 3Q5WA 3OTOT 2V6XA 2PBIA 4IL9A 5LHHB 2BKOA 4YTPA 4N78D 2E9XD 4DBRA 5IYZE 1MMNA 3AA1B 4TN7B 4HFVA 1HNWT 4WZXA 2NTXA 1S35A 2MAWA 2W4XA 3A7MA 3ZC0A 4CN4A 2VL8A 4JUYA 4L5GA 4Z91A 4JI4T 4U31A 1R8IA 2CXLA 2J1DG 1WYBA 5L3CB 4DR7T 2JMKA 3C4WA 2YU2A 3WAJA 5HEOA 1NAFA 2WU2A 4YSXA 2EHOC 4HTEA 3ZKRA 3AA6B 4UIGA 2E8IA 4ANJA 5HXCA 2WZIA 3E22E 4X20E 4KX6A 2C0SA 4DIDB 3PU3A 4DUYT 4OK0A 4JI6T 3WAKA 3OPCA 2CBJA 5M4YA 1KNPA 3AEDA 5DQVA 5LCYA 3A5XA 4JI5T 3RKOA 3HI2A 3UQ7A 4HFCA 5HCJA 4PW8A 3H3MA 3FHNA 4UF0B 3P4WA 3AECA 3E08A 4AISA 3CX6B 3P8CD 2NOXA 1FEWA 1IBKT 3RKGA 2OLTA 4I4TE 1KFYA 4TV8E 1YKEB 1D1AA 2UU9T 3PUVF 4KP3C 4I55E 4BJMA 2V5DA 4Z90A 4IT4A 3DP7A 2FJEA 3AEGA 4NIQA 4UXNB 4AQYT 4A5XA 5FL1A 2E5LT 4CXWA 4YHHT 4HFIA 2XQ3A 4DV0T 2XM1A 5LB7B 3VRAA 5LHGB 3AA0B 2J4GA 2VVSA 5JVDE 4G2AA 3FXEB 5LMUT 4PK6A 3B57A 4NXMT 3B5MA 4KBMB 5CGMA 3O1IA 1IZNB 4H9QC 2CHOA 4CXXA 2HPJA 3O1JA 2K3WA 3AA7B 1D0YA 2BZBA 3JC6D 2BS4A 3CK6A 1HNXT 4BJNA 2UUCT 3NVOA 2WMOA 2XAJB 2V7KA 3HKCE 3RX6A 5IUXA 3ZN0B 3WI3A 4AKIA 3RYFE 4DO0A 2CWYA 2X9WA 4ASKA 2HH7A 4UV9B 3ZMVB 4XBFB 1XZYA 3EDVA 4OX9T 3VHLA 3IA3A 3ZEFB 3NZPA 2MOZA 3F31A 2WDQA 4H63V 3ONLC 3HKEE 2KINB 2E9XC 5L3EB 3PURA 4U2YA 4PJMA 3KVBA 5E0OA 2CM0A 2X68A 4P0BA 4UVCB 2IDOB 3UFGA 1JNZA 3AE8A 4YJ3E 3ANWB 4PK5A 3RIUC 3UU6A 3MZKB 1J1JA 5LJMA 2YK0A 1XMOT 1SE7A 2X9YA 4PNIA 1WRDA 3RC8A 2XAHB 3U78A 4AIUA 2X0LB 2WU5A 1D1CA 3LG7A 4G63A 4H9NC 3LK2B 2NP9A 3TLVA 2VKDA 1WYCA 3HKDE 4GK5E 5L47A 5AQKB 2YKSA 2BDEA 3SWHA 1HTJF 1G8XA 3P4PA 5L3GB 2Z6EA 1MIYA 2NTYA 2FJDA 5FY0A 2NW8A 2XAFB 2E5VA 5L2LA 4PJLA 3G06A 4JI7T 2XSAA 1HR0T 3BQLA 4HWFA 5KXJA 1HNZT 3E0ZA 4AI6A 3I9WA 4KI0F 4PFPA 2Q9QB 2XAGB 4LFAT 3IF8B 5AQJB 5ADXL 5HEUA 4HWHA 3JCFA 5JQGE 3M3ZB 5FYMA 3ANWA 4DV4T 2YEVC 4MLKA 2WDVA 3OKQA 2XPKA 2ODVA 2XY8B 1IBMT 2DWGA 3PUZF 4B3ST 3ZT7A 3ZCIA 4IL4A 2IC6A 4JI2T 3RQUA 4ERRA 4UEMA 2LRKA 5AQGB 5FMNA 5C2TA 4HFEA 1WFDA 4L9IA 2VKOA 2V7IA 3SFDA 4X64T 4U7YA 3VR9A 3F2EA 3V5UA 2X51A 2KWIB 4X62T 5DJQC 5JDFA 4BA9A 5JR9B 3C4ZA 4ZHQE 2MBGA 2RPAA 2W63A 3PU8A 4IDPA 2YDQA 3JC6C 1YKHB 2XQ4A 2MYSA 4U33A 4OYJA 3J9X1 5ABFB 1HFAA 5IWAT 5JTGA 4ZI3C 4YT0A 2QRXA 2XQ8A 3ZCJA 4MFRA 3VKHA 2WSSV 3SS1A 2WDRA 2KXPB 5AQIB 2M6BA 1MMGA 3PUSA 4Z8XA 2B1EA 5LMNT 3U3IA 2KSRA 2W67A 4TWDA 2DLRA 3ESLA 2H88A 5L4EA 1N34T 4FI5A 4IREA 3MJXA 4ILAA 5EK2A 2DWKA 2LJLA 1UUSA 4JI3T 1VCSA 4IE7A 5JREA 1VRBA 4YFSA 2ODUA 4B3MT 4I50E 1U5PA 3KBTA 3UUXB 1E1HB 4IE6A 3N9PA 2H7OA 4TNWA 4LF6T 2Y48B 4JEHB 4IE5A 3V5SA 3C50A 4HFDA 2BKPA 1KEYA 2RP4A 4KHPT 3UU5A 4AKHA 2C5KT 2LHNA 3CIRA 5JDLA 4EEDA 3Q5EA 5KMGP 3QC9A 2UXNB 4X1KE 4LF8T 5AQVB 4F6RC 4L0RA 2XQYA 3FB2A 3H37A 3AAAB 2A3DA 4DUZT 1FMVA 4QXHB 4JLEA 5L3FB 5ABEA 1IAPA 5LG3A 3QK6A 2LSIA 2QA7A 2BVLA 2L9QA 4DNDA 3R84B 2UXXB 2VURA 4X1IE 4XAXB 1XNQT 3UUMA 2ACXA 3M65A 1YW0A 3KV6A 3VRBA 2KT9A 1NENA 1XDPA 4O2AE 4TWHA 4ZOLE 4ISSA 3O4XE 4ILUA 4DR4T 5F8PA 2MPKA 3OYXA 4EAHA 4C91A 2DI4A 1NWMX 1J5ET 3RHWA 3AXJA 2WZHA 4LMKA 4YJ2E 2LM2A 2V8SV 3Q2MA 4B3TT 1AJ3A 4ZZCA 3VKGA 2HN1A 4H9RC 4DR6T 5AQLB 3P4SA 3JAFA 1HG5A 4FJOA 2LHRA 1X79A 2EHOB 1MIWA 2M6IA 4B3RT 3EI0A 3TLSA 2Q9QD 3ZYKA 3QNUA 3D0TA 2VASA 2DHRA 5JH7E 5AQMB 2W62A 4IIJE 3ZSTA 3AEBA 2VQFT 1LRZA 2WS3A 3RYHE 3AE6A 4OYKA 4LF5T 2WM9A 1SUMB 2PFVA 1Z8UA 3NRYA 4ZI2D 1Z0PA 2XQ6A 2K9AA 4TUYE 3O1HA 3AVSA 2XUEA 3QB5A 1X9BA 4EEBA 2CE7A 5LHIB 3N9LA 4KUMB 4YTMA 2JQQA 1OWAA 4IDZA 4O2BE 2VQET 4F8HA 1UGOA 3CQXC 3FXDB 4DR3T 4LFCT 3A8YC 3IBPA 5FXVA 4JBWF 2IC9A 5AQFB 3UULA 3J7Yq 3AE2A 4CZZB 1N33T 2D9DA 2CLYC 3AE4A 4JV5T 3AB3B 2D5UA 1D0XA 1HG2A 1QSDA 2W00A 3RYIE 5LJNA 4UF0A 3L39A 2XQ9A 3C64A 2A9UA 3MKDA 3C51A 3O9XA 3CWZB 2F4VT 3AVRA 3CVRA 5KX5E 2QVAA 5AQQB 4ZS2A 4E7SA 5AQRB 3SOLA 4WBOA 1VOMA 2VVNA 5GONE 1T7SA 3X1DA 5FY7A 5BMVE 2BG9E 2VKJA 2C5JA 2X67A 3GWHA 4JEUB 2CCQA 3KBUA 3UU3A 3C98B 3UQ4A 4A56A 2WY2A 2XQAA 4NUVA 5LXTE 3RPUA 2PTFA 5AFUL 4CI1B 3T1HT 2BG9C 4ADZA 3SRZA 3EDUA 2LLYA 3GMIA 3L09A 1M7KA 2BBJA 4IDQA 4OHFA 2IW5B 5AQNB 3NBXX 2ZMAA 2ACZA 2CXFA 1YQ4A 2CMRA 2X66A 3CQGB 2E9XB 2D2SA 4AQFA 1XWMA 4LMJA 2CXDA 2V7LA 4GOUA 2K24A 5CJ5A 5LGNB 4IDNA 2CWOA 2RA1A 3AAEB 4B6XA 4QH4A 5FVKA 3ABVA 4DMVA 3FZMB 1YQ3A 4TNVA 4PAGA 3FZHB 5JRCB 3ZMUB 4IE4A 3OJAA 5LGUB 4YSYA 1UURA 2ZM8A 4ILCA 4I43B 3ZYLA 3P4QA 5J2TE 3RF1A 3AEAA
chains in the Genus database with same CATH topology
4MFRA 4JUYA 4L5GA 5J2UE 3VKHA 2CXLA 4C90A 2J1DG 4QWNB 2WSSV 1WYBA 5L3CB 3SS1A 4UVAB 4YHJA 5H6QB 3ETVA 4O4JE 2JMKA 4MBQA 3C4WA 3GA8A 5HWYA 2KXPB 4H9PC 3HL6A 1UX5A 4H63H 1MMGA 4XZCA 3PUSA 4Z8XA 1V9DA 2YU2A 2B1EA 4O8SA 3WAJA 3U3IA 2LE8A 1NAFA 2XAQB 3GN5B 5FNVE 2EHOC 4HTEA 1QUUA 1D0ZA 4HE8A 2DLRA 3AA6B 4WW0A 4UIGA 3FBLA 4IE0A 3ESLA 2E8IA 4ANJA 5HXCA 2CEAA 4FI5A 2CLYB 3MJXA 5IHYA 1BR0A 3E22E 4X20E 1WR6A 3VU7H 2KWHA 1O3XA 5EK2A 2DWKA 3HKBE 2C0SA 2LJLA 3PU3A 4ZI2C 4ZI3D 3MK7C 5EZYE 4OK0A 1MNEA 4IE7A 5JREA 3K3NA 1UX4A 1VRBA 4YFSA 2NW9A 5HWXA 2JRKA 1KNZA 1US7B 3WAKA 2ODUA 5M4YA 1FIOA 3K3QC 1U5PA 3KBTA 4I50E 3HR0A 5DQVA 2A72A 4QHOA 3UUXB 1MIVA 4MALA 3CQCB 3BK9A 5LCYA 3A5XA 4V1Av 1E1HB 4IE6A 5CB4E 3N9PA 4PK4A 3PUAA 2H7OA 3AAIA 3RKOA 3HI2A 2Y48B 4HN9A 4JEHB 4HGAA 4IE5A 4PW8A 3V5SA 3FHNA 1ZEEA 2JMHA 5L3BB 4HEAA 4UF0B 3C50A 4E7ZA 2RP4A 5LBMA 3E08A 1BR2A 4AKHA 3IEEA 5FXXA 2C5KT 2LHNA 3CX6B 2JJ9A 3P8CD 5JDLA 5JDGA 4QXBB 2NOXA 5FXWA 3RYCE 1IJ5A 5KMGP 1FEWA 2V7JA 3DJBA 4I4TE 1UCUA 3ZYMA 5LGTB 4AKRB 3QC9A 2UXNB 4X1KE 4TV8E 1YKEB 3OYZA 4F6RC 4L0RA 2XQYA 1D1AA 2X9HA 3FB2A 2G0UA 3H37A 3AAAB 2DCFA 2A3DA 3ONXA 3UFEA 1FMVA 4KP3C 4QXHB 4JLEA 5L3FB 3ZLIA 2SPCA 3K3OA 4I55E 3KV5A 4BJMA 2N1GA 3TKLB 2K5BB 3Q9DA 1IAPA 3DP7A 4EOZB 1MMDA 2P9BA 3QK6A 4UXNB 2LSIA 2QA7A 2Q9QA 2BVLA 1ZKEA 3CKDA 2L9QA 4DNDA 3UUNA 5HAXA 3R84B 1LVFA 3N2KE 4CXWA 5A1LA 2UXXB 4X1IE 2L3LA 2PG8A 3H3AA 4XAXB 3UUMA 3ZMSB 5LHGB 3AA0B 2ACXA 5JVDE 4U72A 2X9XA 3M65A 5LNKA 4G2AA 3FXEB 1YW0A 2H7VC 3L3PA 4AKLA 1HS7A 5CA1E 3EVYA 3KV6A 4PK6A 2K48A 3B57A 2LOPA 2Q9QC 2KT9A 2W0GA 4KBMB 2OA5A 3LK42 1CUNA 3O1IA 4M1PA 5EK4A 4EYUA 1IZNB 3BQIA 4H9QC 4O2AE 2VK9A 4CXXA 2HPJA 3KV9A 1T98A 4U74A 4ZOLE 4GIWA 3O4XE 4ILUA 4ISSA 4EZHA 2ZM0A 3O1JA 3AA7B 5F8PA 3ZMTB 1D0YA 3OYXA 4QX7B 2BZBA 4EAHA 1HF8A 3JC6D 4ZS3A 4UELA 4C91A 4DBQA 2DI4A 3EUHA 1NWMX 5HXHA 1LVKA 2CA5A 5DQWA 5FY1A 4YJ2E 3Q2MA 2YINA 1AJ3A 4BJNA 3VKGA 3S4UA 3N5LA 3N9OA 3ZPOA 4IHJE 2WMOA 4H9RC 2XAJB 3N9MA 2V7KA 3NZQA 3HKCE 2WMNA 3F57A 1HG5A 5KDMC 3RX6A 1B7TA 1SHZC 4TV9E 3UTKA 3FBZA 4FJOA 4OFZA 2LSYA 4X1YE 2VWAA 2LHRA 1X79A 2E9XA 2EHOB 2IAKA 1MIWA 2V1DB 3ZN0B 4P0AA 3WI3A 2D0TA 4AQGA 5HYAA 4AKIA 5JR9A 3RYFE 3QUJA 5TAOA 2Q9QD 4DO0A 1OXZA 2BVMA 3ZYKA 2CWYA 3CX7B 2X9WA 1ZHCA 3ZN1B 2WAUA 3D0TA 4ASKA 3IHRA 2HH7A 2VASA 2DHRA 4UV9B 3ZMVB 5JH7E 4XBFB 3EDVA 3I0QA 1ZV4X 2EHOD 2W62A 2WWUA 3LJCA 3VHLA 3I0OA 3PUGA 2Y8DA 3NZPA 1G73A 3ZEFB 3MXZA 4IIJE 2MOZA 4ZI7E 3F31A 3ZJ1A 1LRZA 5JRCA 4H63V 3RYHE 4EIWA 4OYKA 3HKEE 2KINB 2E9XC 3N9QA 5L3EB 2WM9A 1MNDA 2ES0A 2PFVA 3PE0A 3PURA 5JR9C 3MACA 3NRYA 4PJMA 2HPLA 4ZI2D 3KVBA 5E0OA 1Z0PA 3PUQA 2CM0A 3B13A 2X68A 4QXCB 4P0BA 2K9AA 4TUYE 3I9YA 3O1HA 4UVCB 3AVSA 4H9OC 2XUEA 2V26A 5ETWA 3KFWX 1HX8A 2CE7A 3DTOA 5LP6E 5LHIB 4K0UA 1FMWA 3N9LA 4KUMB 4YJ3E 2MTQA 3ANWB 3OBVE 4PK5A 5FXZA 3W15B 2GK9A 2JQQA 1OWAA 4IDZA 4CXYA 4AKGA 2KNDA 1Y64B 5JDNA 2JPFA 3GN5A 2M67A 3MZKB 4O2BE 4GK0E 5JDMA 4UVBB 2YK0A 4WBNE 4KMCA 5LJMA 2X9YA 3RRWA 4PNIA 1WRDA 2DNXA 3CQXC 3RC8A 2XAHB 3CPZA 3U78A 2X0LB 4O4IE 1D1CA 3LG7A 3LBXB 2I59A 4G63A 4H9NC 3LK2B 3FXDB 2NP9A 3KV4A 2VKDA 1WYCA 3HKDE 3RC3A 4GK5E 4HKAA 4PFOA 5C8YE 5CA0E 2BDEA 3SWHA 3N2OA 5HXEA 1HTJF 3CMLA 1G8XA 3T8OA 2KMFA 5L3GB 2Z6EA 2D0UA 2PJQA 1MIYA 2NTYA 5FY0A 3IBPA 5FXVA 4EYYR 1SA0E 2IC9A 2VKHA 3KDSE 2NW8A 2LT3A 5DABA 2XAFB 4GYSA 3KINB 3UULA 1KK7A 3J7Yq 5FP3A 4CZZB 2C5IT 3UT5E 5L2LA 2LM9A 2VB6A 4TZ4C 1MMAA 4PJLA 2CLYC 3BQLA 3AB3B 2D5UA 4ISTA 1D0XA 1HG2A 1QSDA 2W00A 3RYIE 2V7MA 5LJNA 4UF0A 3MA9A 4O4HE 2LSJA 3C64A 5JDQA 3MKDA 4UV8B 3C51A 5L3DB 3O9XA 3CWZB 5EK3A 3E0ZA 1H7CA 4AI6A 4EXTA 3AVRA 3I9WA 3CVRA 4PFPA 2Q9QB 5KX5E 5J1GA 3RRCA 2XAGB 3I1AA 4ZS2A 4E7SA 3IF8B 1D1BA 3K8PC 1YD8G 5F3JA 1WLXA 3SOLA 4WBOA 3C4XA 5ADXL 1VOMA 4GYRA 3HA4A 5GONE 2KLQA 5FY7A 5BMVE 2VKJA 4O4LE 2C5JA 2X67A 3GWHA 4H9SE 4DVDA 5LBQB 4JEUB 5JQGE 2LSGA 2CCQA 3KBUA 5FYMA 4DMWA 3C98B 3NRXA 5JDHA 3ZC1A 3N9NA 3ANWA 4A56A 2YEVC 3RH3A 4CI3B 4EZ4A 4MLKA 4NUVA 5LXTE 3OKQA 4P09A 4PJNA 4CI2B 3RPUA 2LOSA 5AFUL 4CI1B 2KZ7B 5H6RB 2QGSA 2ODVA 3ZMZB 2ZM2A 2DWGA 4ADZA 3SRZA 5LG4A 5LA6E 4J2CA 3LBXA 1BR4A 3ZCIA 3EDUA 2W61A 2IC6A 2N2NA 3GMIA 1BR1A 3P7IA 4NUUA 4CQIA 4MHCA 3KVAA 4EB6E 3L09A 2YU1A 4YLHA 4ERRA 2L8KA 4OHFA 3PTRB 1LKXA 4QKNA 4UEMA 1EZ3A 2IW5B 4QX8B 3BQKA 3LFMA 2WBLA 5FMNA 4L9IA 2VKOA 2A2FX 2V7IA 3NBXX 4PJJA 1IJ6A 2ZMAA 5HXSA 2CXFA 2N9DA 4IGUA 5LOVE 3F2EA 3V5UA 2X51A 2CMRA 2NW7A 2NWBA 2KWIB 2X66A 3CQGB 1U4QA 2E9XB 2D2SA 1S94A 4AQFA 2ZLYA 1HCIA 2LSKA 3CX8B 3LK3B 5DJQC 2CXDA 2V7LA 2Y6XA 5JDFA 4BAYB 4BA9A 5JR9B 2XHEB 4GOUA 2K24A 5LYJE 3Q5XA 3Q5WA 3C4ZA 4ZHQE 3PDYA 5LGNB 2MBGA 2CWOA 2XASB 2W63A 2PBIA 3PU8A 5LHHB 2RA1A 3JC6C 3AAEB 1YKHB 2MYSA 4TX5A 4N78D 4B6XA 2E9XD 4DBRA 5IYZE 1MMNA 4DMVA 4OYJA 3ZCJA 4PAGA 3J9X1 3ZJ2A 4AXPA 3R6NA 2H3RA 3AA1B 5JRCB 4TN7B 3ETUA 3ZMUB 4HFVA 4IE4A 3OJAA 1S35A 1HFAA 2NTXA 5LGUB 4AQFC 2XTLA 4ZI3C 2ZM8A 4WNKA 3ZC0A 2EHOA 4I43B 3ZYLA 3N2GE 5HXRA 5J2TE 2LEHA 2VL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V1A v;  3J7Y q; 
#chains in the Genus database with same CATH topology
 4HWI B;  3TLU A;  5HEG A;  4QWN B;  4UVA B;  4KHZ F;  5F5W A;  4DV1 T;  5H6Q B;  3ETV A;  4QH1 A;  4MBQ A;  3GA8 A;  5HWY A;  3HL6 A;  1KF6 A;  1UX5 A;  4H63 H;  4YSZ A;  1V9D A;  4O8S A;  3RQW A;  2LRL A;  2XAQ B;  3GN5 B;  5FNV E;  1XMQ T;  4A97 A;  3RLF F;  4DV6 T;  1OED E;  3Q5D A;  2XQ5 A;  2QYW A;  2CEA A;  5IHY A;  3UU8 A;  3VU7 H;  1WR6 A;  2KWH A;  1CHU A;  2V5C A;  2CRB A;  4ZI2 C;  3MK7 C;  5EZY E;  1MNE A;  1UX4 A;  1XDO A;  4YTN A;  1US7 B;  1OED C;  4LF4 T;  2W2U A;  3K3Q C;  3HR0 A;  1I94 T;  4QHO A;  4CN1 A;  2FUP A;  4MAL A;  3ZSS A;  3BK9 A;  1QLB A;  5CB4 E;  4PK4 A;  3PUA A;  4JYA T;  4HN9 A;  2WQY A;  3RI5 A;  4HGA A;  3AE9 A;  4IDO A;  4HEA A;  1W9R A;  5LBM A;  1BR2 A;  3JAE A;  2XM2 A;  3EHZ A;  5JDG A;  3RYC E;  4NXN T;  3DJB A;  1UCU A;  5LGT B;  2CPT A;  4AKR B;  2ZM6 T;  2WP9 A;  2X9H A;  2FJB A;  2G0U A;  1NEK A;  3AE5 A;  2BS3 A;  2DCF A;  3ONX A;  1T72 A;  4UR9 A;  2SPC A;  3KV5 A;  2N1G A;  3AEE A;  2K5B B;  4DV3 T;  1GQE A;  3Q9D A;  4EOZ B;  2P9B A;  2Q9Q A;  1ZKE A;  3CKD A;  1LVF A;  3N2K E;  5A1L A;  2L3L A;  5ABG A;  2V6Y B;  3P50 A;  2X9X A;  1HS7 A;  3EVY A;  2W0G A;  1HX1 B;  3LK4 2;  3BQI A;  2VK9 A;  5L4H A;  3KV9 A;  1T98 A;  4EZH A;  3RIA A;  4QX7 B;  2LKG A;  4DBQ A;  3EUH A;  2WWV A;  4QH5 A;  2CA5 A;  3LSV A;  3AE1 A;  5DQW A;  2BS2 A;  5FY1 A;  2YIN A;  3S4U A;  3N9O A;  3ZPO A;  2AE9 A;  2WMN A;  3F57 A;  4LF9 T;  5KDM C;  1B7T A;  1SHZ C;  3UTK A;  3FBZ A;  5BR8 T;  2LSY A;  2VWA A;  2IAK A;  2V1D B;  4P0A A;  5HYA A;  5HEJ A;  1WCR A;  5JR9 A;  1XNR T;  5HCM A;  1ZHC A;  3I0Q A;  1ZV4 X;  2WWU A;  3I0O A;  3PUG A;  2Y8D A;  3NKZ A;  1G73 A;  4CN6 A;  3MXZ A;  3PUW F;  1N36 T;  4EIW A;  5ABF A;  1T8B A;  2ES0 A;  3RIF A;  2HPL A;  3PUQ A;  3B13 A;  2HHH T;  3I9Y A;  2X0Y A;  2V26 A;  5ETW A;  5LP6 E;  4ZEY A;  2IUB A;  5FXZ A;  3W15 B;  2GK9 A;  2YDR A;  5JDN A;  2M67 A;  2I0M A;  4UVB B;  4WBN E;  4KMC A;  3RRW A;  2DNX A;  3CPZ A;  2XQ7 A;  2XSB A;  5AQO B;  4O4I E;  3K1S A;  3LBX B;  2YDS A;  3RC3 A;  4P1N A;  4HKA A;  5C8Y E;  5CA0 E;  5FKY A;  3N2O A;  3CML A;  3T8O A;  2D0U A;  2PJQ A;  1WR0 A;  5FL0 A;  4EYY R;  1Y01 A;  1SA0 E;  2VKH A;  3KDS E;  5HEH A;  2LT3 A;  4X5T A;  4GYS A;  2JIW A;  5FP3 A;  2C5I T;  3UT5 E;  3PUX F;  4TZ4 C;  1KNR A;  3NWI A;  3MA9 A;  2LSJ A;  5JDQ A;  5EK3 A;  1H7C A;  4EXT A;  5J1G A;  1D1B A;  3K8P C;  1YD8 G;  2E2A A;  1WLX A;  3FZF B;  3C4X A;  3HA4 A;  4JI0 T;  2KLQ A;  4ILB A;  4H9S E;  4DVD A;  2FJA A;  3NRX A;  5JDH A;  3ZC1 A;  4CI3 B;  4EZ4 A;  1M62 A;  4DV2 T;  2IML A;  2QGS A;  2IHR 1;  3ZMZ B;  5CFB A;  5AQU B;  5LA6 E;  3LBX A;  2UXD T;  2N2N A;  2XZE A;  3KVA A;  4EB6 E;  4DR2 T;  2L8K A;  1LKX A;  3LFM A;  2WBL A;  2A2F X;  4NPP A;  1IJ6 A;  4IGU A;  2N9D A;  2NW7 A;  1U4Q A;  4EGW A;  2LSK A;  3ZT5 A;  1DU2 A;  2NR4 A;  2Y6X A;  3PV0 F;  2XHE B;  4HFB A;  5LYJ E;  3Q5X A;  3PDY A;  4EV6 A;  2XAS B;  4TX5 A;  4K0K T;  3ZJ2 A;  4AXP A;  3R6N A;  4GKJ T;  2H3R A;  1E2A A;  4JI1 T;  3ETU A;  1IBL T;  4AQF C;  2XTL A;  4WNK A;  2EHO A;  3N2G E;  5HXR A;  2LEH A;  4I0U A;  5J2U E;  2BBH A;  4C90 A;  4YHJ A;  2BKN A;  4O4J E;  4H9P C;  2CBI A;  4XZC A;  2JQ9 A;  1L0V A;  2LE8 A;  2JQH A;  2UUA T;  4DV5 T;  4YXD A;  1QUU A;  1D0Z A;  3PJA J;  4HE8 A;  1N32 T;  4WW0 A;  3FBL A;  4IE0 A;  2CLY B;  4JI8 T;  1BR0 A;  1W0A A;  1O3X A;  3HKB E;  4ZI3 D;  3K3N A;  5HWX A;  2NW9 A;  2OV9 A;  2JRK A;  1KNZ A;  4LFB T;  1FIO A;  2A72 A;  1MIV A;  3CQC B;  2UXB T;  4V1A v;  3FZK B;  3AAI A;  4HFH A;  1ZEE A;  2WCA A;  2JMH A;  3TLW A;  5L3B B;  4E7Z A;  3IEE A;  5FXX A;  2JJ9 A;  4QXB B;  2XJ7 A;  5FXW A;  1IJ5 A;  4X66 T;  1ZP0 A;  2V7J A;  1I6Z A;  3ZYM A;  2I6H A;  1J5W A;  2BG9 B;  3OYZ A;  1UK5 A;  4TWF A;  3LDQ B;  3PJA A;  3UFE A;  3ZLI A;  3K3O A;  3TKL B;  4X65 T;  3SFE A;  4HWD A;  1MMD A;  4Q25 A;  3UUN A;  5HAX A;  2YN6 A;  5AQP B;  2PG8 A;  3L8R A;  3H3A A;  3ZMS B;  3PUY F;  4U72 A;  5LNK A;  2H7V C;  3L3P A;  4AKL A;  5CA1 E;  4COF A;  2K48 A;  2LOP A;  2Q9Q C;  2OA5 A;  5EK4 A;  1CUN A;  4M1P A;  4EYU A;  4U74 A;  4GIW A;  2ZM0 A;  2IIU A;  3ZMT B;  1HF8 A;  4ZS3 A;  4UEL A;  3UU4 A;  1VCT A;  2LKH A;  3RGL A;  5HXH A;  2W66 A;  1LVK A;  2B76 A;  2UXC T;  3AE7 A;  3N5L A;  4IHJ E;  3N9M A;  1W09 A;  2R6G F;  3NZQ A;  2VL0 A;  4TV9 E;  3P4R A;  2BG9 A;  4OFZ A;  4X1Y E;  2E9X A;  2D0T A;  4AQG A;  3QUJ A;  5TAO A;  3QOF A;  2UUB T;  1OXZ A;  2BVM A;  3CX7 B;  3ZN1 B;  3JAD A;  2WAU A;  3IHR A;  4WYV A;  4LF7 T;  3VR8 A;  2EHO D;  3LJC A;  5ABH A;  3EAM A;  2FBW A;  3RIU A;  4ZI7 E;  3ZJ1 A;  5JRC A;  3ONJ A;  1OED B;  3N9Q A;  1MND A;  3PE0 A;  5J0Z A;  5JR9 C;  3MAC A;  2YOE A;  1YXR A;  4QXC B;  4H9O C;  3KFW X;  1HX8 A;  3DTO A;  4K0U A;  1FMW A;  5AQS B;  2AXD S;  2MTQ A;  3OBV E;  5AQH B;  2J47 A;  4CXY A;  4AKG A;  2KND A;  1Y64 B;  5AQT B;  2JPF A;  3GN5 A;  4YY3 T;  4GK0 E;  2H89 A;  5JDM A;  3EAB A;  4GKK T;  3UUB A;  4DV7 T;  4ZXL A;  2I59 A;  3AE3 A;  3KV4 A;  4HWC A;  4PFO A;  2X0H A;  3ZT6 A;  5C3J A;  5HXE A;  2KMF A;  4U2Z A;  5DAB A;  1ZOY A;  3KIN B;  1KK7 A;  3QB5 K;  4A98 A;  2HN2 A;  2LM9 A;  2VB6 A;  1MMA A;  2J62 A;  4IST A;  2V7M A;  4DR5 T;  1W0B A;  4O4H E;  4UV8 B;  5L3D B;  4ZZB A;  2DL1 A;  4DR1 T;  1OED A;  1JNR A;  3RRC A;  3I1A A;  5F3J A;  4U3C A;  4GYR A;  4O4L E;  2JQK A;  5LBQ B;  3T1Y T;  2LSG A;  4DMW A;  3N9N A;  3RH3 A;  3AEF A;  2WB5 A;  4P09 A;  4PJN A;  4CI2 B;  2LOS A;  5FVL A;  2KZ7 B;  5H6R B;  2ZM2 A;  5LG4 A;  4LML A;  4J2C A;  3OVU A;  1BR4 A;  2W61 A;  2V6Y A;  3P7I A;  1BR1 A;  4NUU A;  3AXJ B;  4CQI A;  4MHC A;  2CHN A;  2YU1 A;  4YLH A;  4QKN A;  3PTR B;  1EZ3 A;  4U7I A;  3TLT A;  4QX8 B;  3BQK A;  4PJJ A;  5HXS A;  5LOV E;  3FZL B;  2NWB A;  1S94 A;  1E7P A;  1HCI A;  2ZLY A;  3CX8 B;  3LK3 B;  4BAY B;  1FJG T;  3Q5W A;  3OTO T;  2V6X A;  2PBI A;  4IL9 A;  5LHH B;  2BKO A;  4YTP A;  4N78 D;  2E9X D;  4DBR A;  5IYZ E;  1MMN A;  3AA1 B;  4TN7 B;  4HFV A;  1HNW T;  4WZX A;  2NTX A;  1S35 A;  2MAW A;  2W4X A;  3A7M A;  3ZC0 A;  4CN4 A;  2VL8 A;  4JUY A;  4L5G A;  4Z91 A;  4JI4 T;  4U31 A;  1R8I A;  2CXL A;  2J1D G;  1WYB A;  5L3C B;  4DR7 T;  2JMK A;  3C4W A;  2YU2 A;  3WAJ A;  5HEO A;  1NAF A;  2WU2 A;  4YSX A;  2EHO C;  4HTE A;  3ZKR A;  3AA6 B;  4UIG A;  2E8I A;  4ANJ A;  5HXC A;  2WZI A;  3E22 E;  4X20 E;  4KX6 A;  2C0S A;  4DID B;  3PU3 A;  4DUY T;  4OK0 A;  4JI6 T;  3WAK A;  3OPC A;  2CBJ A;  5M4Y A;  1KNP A;  3AED A;  5DQV A;  5LCY A;  3A5X A;  4JI5 T;  3RKO A;  3HI2 A;  3UQ7 A;  4HFC A;  5HCJ A;  4PW8 A;  3H3M A;  3FHN A;  4UF0 B;  3P4W A;  3AEC A;  3E08 A;  4AIS A;  3CX6 B;  3P8C D;  2NOX A;  1FEW A;  1IBK T;  3RKG A;  2OLT A;  4I4T E;  1KFY A;  4TV8 E;  1YKE B;  1D1A A;  2UU9 T;  3PUV F;  4KP3 C;  4I55 E;  4BJM A;  2V5D A;  4Z90 A;  4IT4 A;  3DP7 A;  2FJE A;  3AEG A;  4NIQ A;  4UXN B;  4AQY T;  4A5X A;  5FL1 A;  2E5L T;  4CXW A;  4YHH T;  4HFI A;  2XQ3 A;  4DV0 T;  2XM1 A;  5LB7 B;  3VRA A;  5LHG B;  3AA0 B;  2J4G A;  2VVS A;  5JVD E;  4G2A A;  3FXE B;  5LMU T;  4PK6 A;  3B57 A;  4NXM T;  3B5M A;  4KBM B;  5CGM A;  3O1I A;  1IZN B;  4H9Q C;  2CHO A;  4CXX A;  2HPJ A;  3O1J A;  2K3W A;  3AA7 B;  1D0Y A;  2BZB A;  3JC6 D;  2BS4 A;  3CK6 A;  1HNX T;  4BJN A;  2UUC T;  3NVO A;  2WMO A;  2XAJ B;  2V7K A;  3HKC E;  3RX6 A;  5IUX A;  3ZN0 B;  3WI3 A;  4AKI A;  3RYF E;  4DO0 A;  2CWY A;  2X9W A;  4ASK A;  2HH7 A;  4UV9 B;  3ZMV B;  4XBF B;  1XZY A;  3EDV A;  4OX9 T;  3VHL A;  3IA3 A;  3ZEF B;  3NZP A;  2MOZ A;  3F31 A;  2WDQ A;  4H63 V;  3ONL C;  3HKE E;  2KIN B;  2E9X C;  5L3E B;  3PUR A;  4U2Y A;  4PJM A;  3KVB A;  5E0O A;  2CM0 A;  2X68 A;  4P0B A;  4UVC B;  2IDO B;  3UFG A;  1JNZ A;  3AE8 A;  4YJ3 E;  3ANW B;  4PK5 A;  3RIU C;  3UU6 A;  3MZK B;  1J1J A;  5LJM A;  2YK0 A;  1XMO T;  1SE7 A;  2X9Y A;  4PNI A;  1WRD A;  3RC8 A;  2XAH B;  3U78 A;  4AIU A;  2X0L B;  2WU5 A;  1D1C A;  3LG7 A;  4G63 A;  4H9N C;  3LK2 B;  2NP9 A;  3TLV A;  2VKD A;  1WYC A;  3HKD E;  4GK5 E;  5L47 A;  5AQK B;  2YKS A;  2BDE A;  3SWH A;  1HTJ F;  1G8X A;  3P4P A;  5L3G B;  2Z6E A;  1MIY A;  2NTY A;  2FJD A;  5FY0 A;  2NW8 A;  2XAF B;  2E5V A;  5L2L A;  4PJL A;  3G06 A;  4JI7 T;  2XSA A;  1HR0 T;  3BQL A;  4HWF A;  5KXJ A;  1HNZ T;  3E0Z A;  4AI6 A;  3I9W A;  4KI0 F;  4PFP A;  2Q9Q B;  2XAG B;  4LFA T;  3IF8 B;  5AQJ B;  5ADX L;  5HEU A;  4HWH A;  3JCF A;  5JQG E;  3M3Z B;  5FYM A;  3ANW A;  4DV4 T;  2YEV C;  4MLK A;  2WDV A;  3OKQ A;  2XPK A;  2ODV A;  2XY8 B;  1IBM T;  2DWG A;  3PUZ F;  4B3S T;  3ZT7 A;  3ZCI A;  4IL4 A;  2IC6 A;  4JI2 T;  3RQU A;  4ERR A;  4UEM A;  2LRK A;  5AQG B;  5FMN A;  5C2T A;  4HFE A;  1WFD A;  4L9I A;  2VKO A;  2V7I A;  3SFD A;  4X64 T;  4U7Y A;  3VR9 A;  3F2E A;  3V5U A;  2X51 A;  2KWI B;  4X62 T;  5DJQ C;  5JDF A;  4BA9 A;  5JR9 B;  3C4Z A;  4ZHQ E;  2MBG A;  2RPA A;  2W63 A;  3PU8 A;  4IDP A;  2YDQ A;  3JC6 C;  1YKH B;  2XQ4 A;  2MYS A;  4U33 A;  4OYJ A;  3J9X 1;  5ABF B;  1HFA A;  5IWA T;  5JTG A;  4ZI3 C;  4YT0 A;  2QRX A;  2XQ8 A;  3ZCJ A;  4MFR A;  3VKH A;  2WSS V;  3SS1 A;  2WDR A;  2KXP B;  5AQI B;  2M6B A;  1MMG A;  3PUS A;  4Z8X A;  2B1E A;  5LMN T;  3U3I A;  2KSR A;  2W67 A;  4TWD A;  2DLR A;  3ESL A;  2H88 A;  5L4E A;  1N34 T;  4FI5 A;  4IRE A;  3MJX A;  4ILA A;  5EK2 A;  2DWK A;  2LJL A;  1UUS A;  4JI3 T;  1VCS A;  4IE7 A;  5JRE A;  1VRB A;  4YFS A;  2ODU A;  4B3M T;  4I50 E;  1U5P A;  3KBT A;  3UUX B;  1E1H B;  4IE6 A;  3N9P A;  2H7O A;  4TNW A;  4LF6 T;  2Y48 B;  4JEH B;  4IE5 A;  3V5S A;  3C50 A;  4HFD A;  2BKP A;  1KEY A;  2RP4 A;  4KHP T;  3UU5 A;  4AKH A;  2C5K T;  2LHN A;  3CIR A;  5JDL A;  4EED A;  3Q5E A;  5KMG P;  3QC9 A;  2UXN B;  4X1K E;  4LF8 T;  5AQV B;  4F6R C;  4L0R A;  2XQY A;  3FB2 A;  3H37 A;  3AAA B;  2A3D A;  4DUZ T;  1FMV A;  4QXH B;  4JLE A;  5L3F B;  5ABE A;  1IAP A;  5LG3 A;  3QK6 A;  2LSI A;  2QA7 A;  2BVL A;  2L9Q A;  4DND A;  3R84 B;  2UXX B;  2VUR A;  4X1I E;  4XAX B;  1XNQ T;  3UUM A;  2ACX A;  3M65 A;  1YW0 A;  3KV6 A;  3VRB A;  2KT9 A;  1NEN A;  1XDP A;  4O2A E;  4TWH A;  4ZOL E;  4ISS A;  3O4X E;  4ILU A;  4DR4 T;  5F8P A;  2MPK A;  3OYX A;  4EAH A;  4C91 A;  2DI4 A;  1NWM X;  1J5E T;  3RHW A;  3AXJ A;  2WZH A;  4LMK A;  4YJ2 E;  2LM2 A;  2V8S V;  3Q2M A;  4B3T T;  1AJ3 A;  4ZZC A;  3VKG A;  2HN1 A;  4H9R C;  4DR6 T;  5AQL B;  3P4S A;  3JAF A;  1HG5 A;  4FJO A;  2LHR A;  1X79 A;  2EHO B;  1MIW A;  2M6I A;  4B3R T;  3EI0 A;  3TLS A;  2Q9Q D;  3ZYK A;  3QNU A;  3D0T A;  2VAS A;  2DHR A;  5JH7 E;  5AQM B;  2W62 A;  4IIJ E;  3ZST A;  3AEB A;  2VQF T;  1LRZ A;  2WS3 A;  3RYH E;  3AE6 A;  4OYK A;  4LF5 T;  2WM9 A;  1SUM B;  2PFV A;  1Z8U A;  3NRY A;  4ZI2 D;  1Z0P A;  2XQ6 A;  2K9A A;  4TUY E;  3O1H A;  3AVS A;  2XUE A;  3QB5 A;  1X9B A;  4EEB A;  2CE7 A;  5LHI B;  3N9L A;  4KUM B;  4YTM A;  2JQQ A;  1OWA A;  4IDZ A;  4O2B E;  2VQE T;  4F8H A;  1UGO A;  3CQX C;  3FXD B;  4DR3 T;  4LFC T;  3A8Y C;  3IBP A;  5FXV A;  4JBW F;  2IC9 A;  5AQF B;  3UUL A;  3J7Y q;  3AE2 A;  4CZZ B;  1N33 T;  2D9D A;  2CLY C;  3AE4 A;  4JV5 T;  3AB3 B;  2D5U A;  1D0X A;  1HG2 A;  1QSD A;  2W00 A;  3RYI E;  5LJN A;  4UF0 A;  3L39 A;  2XQ9 A;  3C64 A;  2A9U A;  3MKD A;  3C51 A;  3O9X A;  3CWZ B;  2F4V T;  3AVR A;  3CVR A;  5KX5 E;  2QVA A;  5AQQ B;  4ZS2 A;  4E7S A;  5AQR B;  3SOL A;  4WBO A;  1VOM A;  2VVN A;  5GON E;  1T7S A;  3X1D A;  5FY7 A;  5BMV E;  2BG9 E;  2VKJ A;  2C5J A;  2X67 A;  3GWH A;  4JEU B;  2CCQ A;  3KBU A;  3UU3 A;  3C98 B;  3UQ4 A;  4A56 A;  2WY2 A;  2XQA A;  4NUV A;  5LXT E;  3RPU A;  2PTF A;  5AFU L;  4CI1 B;  3T1H T;  2BG9 C;  4ADZ A;  3SRZ A;  3EDU A;  2LLY A;  3GMI A;  3L09 A;  1M7K A;  2BBJ A;  4IDQ A;  4OHF A;  2IW5 B;  5AQN B;  3NBX X;  2ZMA A;  2ACZ A;  2CXF A;  1YQ4 A;  2CMR A;  2X66 A;  3CQG B;  2E9X B;  2D2S A;  4AQF A;  1XWM A;  4LMJ A;  2CXD A;  2V7L A;  4GOU A;  2K24 A;  5CJ5 A;  5LGN B;  4IDN A;  2CWO A;  2RA1 A;  3AAE B;  4B6X A;  4QH4 A;  5FVK A;  3ABV A;  4DMV A;  3FZM B;  1YQ3 A;  4TNV A;  4PAG A;  3FZH B;  5JRC B;  3ZMU B;  4IE4 A;  3OJA A;  5LGU B;  4YSY A;  1UUR A;  2ZM8 A;  4ILC A;  4I43 B;  3ZYL A;  3P4Q A;  5J2T E;  3RF1 A;  3AEA A; 
#chains in the Genus database with same CATH homology
 4MFR A;  4JUY A;  4L5G A;  5J2U E;  3VKH A;  2CXL A;  4C90 A;  2J1D G;  4QWN B;  2WSS V;  1WYB A;  5L3C B;  3SS1 A;  4UVA B;  4YHJ A;  5H6Q B;  3ETV A;  4O4J E;  2JMK A;  4MBQ A;  3C4W A;  3GA8 A;  5HWY A;  2KXP B;  4H9P C;  3HL6 A;  1UX5 A;  4H63 H;  1MMG A;  4XZC A;  3PUS A;  4Z8X A;  1V9D A;  2YU2 A;  2B1E A;  4O8S A;  3WAJ A;  3U3I A;  2LE8 A;  1NAF A;  2XAQ B;  3GN5 B;  5FNV E;  2EHO C;  4HTE A;  1QUU A;  1D0Z A;  4HE8 A;  2DLR A;  3AA6 B;  4WW0 A;  4UIG A;  3FBL A;  4IE0 A;  3ESL A;  2E8I A;  4ANJ A;  5HXC A;  2CEA A;  4FI5 A;  2CLY B;  3MJX A;  5IHY A;  1BR0 A;  3E22 E;  4X20 E;  1WR6 A;  3VU7 H;  2KWH A;  1O3X A;  5EK2 A;  2DWK A;  3HKB E;  2C0S A;  2LJL A;  3PU3 A;  4ZI2 C;  4ZI3 D;  3MK7 C;  5EZY E;  4OK0 A;  1MNE A;  4IE7 A;  5JRE A;  3K3N A;  1UX4 A;  1VRB A;  4YFS A;  2NW9 A;  5HWX A;  2JRK A;  1KNZ A;  1US7 B;  3WAK A;  2ODU A;  5M4Y A;  1FIO A;  3K3Q C;  1U5P A;  3KBT A;  4I50 E;  3HR0 A;  5DQV A;  2A72 A;  4QHO A;  3UUX B;  1MIV A;  4MAL A;  3CQC B;  3BK9 A;  5LCY A;  3A5X A;  4V1A v;  1E1H B;  4IE6 A;  5CB4 E;  3N9P A;  4PK4 A;  3PUA A;  2H7O A;  3AAI A;  3RKO A;  3HI2 A;  2Y48 B;  4HN9 A;  4JEH B;  4HGA A;  4IE5 A;  4PW8 A;  3V5S A;  3FHN A;  1ZEE A;  2JMH A;  5L3B B;  4HEA A;  4UF0 B;  3C50 A;  4E7Z A;  2RP4 A;  5LBM A;  3E08 A;  1BR2 A;  4AKH A;  3IEE A;  5FXX A;  2C5K T;  2LHN A;  3CX6 B;  2JJ9 A;  3P8C D;  5JDL A;  5JDG A;  4QXB B;  2NOX A;  5FXW A;  3RYC E;  1IJ5 A;  5KMG P;  1FEW A;  2V7J A;  3DJB A;  4I4T E;  1UCU A;  3ZYM A;  5LGT B;  4AKR B;  3QC9 A;  2UXN B;  4X1K E;  4TV8 E;  1YKE B;  3OYZ A;  4F6R C;  4L0R A;  2XQY A;  1D1A A;  2X9H A;  3FB2 A;  2G0U A;  3H37 A;  3AAA B;  2DCF A;  2A3D A;  3ONX A;  3UFE A;  1FMV A;  4KP3 C;  4QXH B;  4JLE A;  5L3F B;  3ZLI A;  2SPC A;  3K3O A;  4I55 E;  3KV5 A;  4BJM A;  2N1G A;  3TKL B;  2K5B B;  3Q9D A;  1IAP A;  3DP7 A;  4EOZ B;  1MMD A;  2P9B A;  3QK6 A;  4UXN B;  2LSI A;  2QA7 A;  2Q9Q A;  2BVL A;  1ZKE A;  3CKD A;  2L9Q A;  4DND A;  3UUN A;  5HAX A;  3R84 B;  1LVF A;  3N2K E;  4CXW A;  5A1L A;  2UXX B;  4X1I E;  2L3L A;  2PG8 A;  3H3A A;  4XAX B;  3UUM A;  3ZMS B;  5LHG B;  3AA0 B;  2ACX A;  5JVD E;  4U72 A;  2X9X A;  3M65 A;  5LNK A;  4G2A A;  3FXE B;  1YW0 A;  2H7V C;  3L3P A;  4AKL A;  1HS7 A;  5CA1 E;  3EVY A;  3KV6 A;  4PK6 A;  2K48 A;  3B57 A;  2LOP A;  2Q9Q C;  2KT9 A;  2W0G A;  4KBM B;  2OA5 A;  3LK4 2;  1CUN A;  3O1I A;  4M1P A;  5EK4 A;  4EYU A;  1IZN B;  3BQI A;  4H9Q C;  4O2A E;  2VK9 A;  4CXX A;  2HPJ A;  3KV9 A;  1T98 A;  4U74 A;  4ZOL E;  4GIW A;  3O4X E;  4ILU A;  4ISS A;  4EZH A;  2ZM0 A;  3O1J A;  3AA7 B;  5F8P A;  3ZMT B;  1D0Y A;  3OYX A;  4QX7 B;  2BZB A;  4EAH A;  1HF8 A;  3JC6 D;  4ZS3 A;  4UEL A;  4C91 A;  4DBQ A;  2DI4 A;  3EUH A;  1NWM X;  5HXH A;  1LVK A;  2CA5 A;  5DQW A;  5FY1 A;  4YJ2 E;  3Q2M A;  2YIN A;  1AJ3 A;  4BJN A;  3VKG A;  3S4U A;  3N5L A;  3N9O A;  3ZPO A;  4IHJ E;  2WMO A;  4H9R C;  2XAJ B;  3N9M A;  2V7K A;  3NZQ A;  3HKC E;  2WMN A;  3F57 A;  1HG5 A;  5KDM C;  3RX6 A;  1B7T A;  1SHZ C;  4TV9 E;  3UTK A;  3FBZ A;  4FJO A;  4OFZ A;  2LSY A;  4X1Y E;  2VWA A;  2LHR A;  1X79 A;  2E9X A;  2EHO B;  2IAK A;  1MIW A;  2V1D B;  3ZN0 B;  4P0A A;  3WI3 A;  2D0T A;  4AQG A;  5HYA A;  4AKI A;  5JR9 A;  3RYF E;  3QUJ A;  5TAO A;  2Q9Q D;  4DO0 A;  1OXZ A;  2BVM A;  3ZYK A;  2CWY A;  3CX7 B;  2X9W A;  1ZHC A;  3ZN1 B;  2WAU A;  3D0T A;  4ASK A;  3IHR A;  2HH7 A;  2VAS A;  2DHR A;  4UV9 B;  3ZMV B;  5JH7 E;  4XBF B;  3EDV A;  3I0Q A;  1ZV4 X;  2EHO D;  2W62 A;  2WWU A;  3LJC A;  3VHL A;  3I0O A;  3PUG A;  2Y8D A;  3NZP A;  1G73 A;  3ZEF B;  3MXZ A;  4IIJ E;  2MOZ A;  4ZI7 E;  3F31 A;  3ZJ1 A;  1LRZ A;  5JRC A;  4H63 V;  3RYH E;  4EIW A;  4OYK A;  3HKE E;  2KIN B;  2E9X C;  3N9Q A;  5L3E B;  2WM9 A;  1MND A;  2ES0 A;  2PFV A;  3PE0 A;  3PUR A;  5JR9 C;  3MAC A;  3NRY A;  4PJM A;  2HPL A;  4ZI2 D;  3KVB A;  5E0O A;  1Z0P A;  3PUQ A;  2CM0 A;  3B13 A;  2X68 A;  4QXC B;  4P0B A;  2K9A A;  4TUY E;  3I9Y A;  3O1H A;  4UVC B;  3AVS A;  4H9O C;  2XUE A;  2V26 A;  5ETW A;  3KFW X;  1HX8 A;  2CE7 A;  3DTO A;  5LP6 E;  5LHI B;  4K0U A;  1FMW A;  3N9L A;  4KUM B;  4YJ3 E;  2MTQ A;  3ANW B;  3OBV E;  4PK5 A;  5FXZ A;  3W15 B;  2GK9 A;  2JQQ A;  1OWA A;  4IDZ A;  4CXY A;  4AKG A;  2KND A;  1Y64 B;  5JDN A;  2JPF A;  3GN5 A;  2M67 A;  3MZK B;  4O2B E;  4GK0 E;  5JDM A;  4UVB B;  2YK0 A;  4WBN E;  4KMC A;  5LJM A;  2X9Y A;  3RRW A;  4PNI A;  1WRD A;  2DNX A;  3CQX C;  3RC8 A;  2XAH B;  3CPZ A;  3U78 A;  2X0L B;  4O4I E;  1D1C A;  3LG7 A;  3LBX B;  2I59 A;  4G63 A;  4H9N C;  3LK2 B;  3FXD B;  2NP9 A;  3KV4 A;  2VKD A;  1WYC A;  3HKD E;  3RC3 A;  4GK5 E;  4HKA A;  4PFO A;  5C8Y E;  5CA0 E;  2BDE A;  3SWH A;  3N2O A;  5HXE A;  1HTJ F;  3CML A;  1G8X A;  3T8O A;  2KMF A;  5L3G B;  2Z6E A;  2D0U A;  2PJQ A;  1MIY A;  2NTY A;  5FY0 A;  3IBP A;  5FXV A;  4EYY R;  1SA0 E;  2IC9 A;  2VKH A;  3KDS E;  2NW8 A;  2LT3 A;  5DAB A;  2XAF B;  4GYS A;  3KIN B;  3UUL A;  1KK7 A;  3J7Y q;  5FP3 A;  4CZZ B;  2C5I T;  3UT5 E;  5L2L A;  2LM9 A;  2VB6 A;  4TZ4 C;  1MMA A;  4PJL A;  2CLY C;  3BQL A;  3AB3 B;  2D5U A;  4IST A;  1D0X A;  1HG2 A;  1QSD A;  2W00 A;  3RYI E;  2V7M A;  5LJN A;  4UF0 A;  3MA9 A;  4O4H E;  2LSJ A;  3C64 A;  5JDQ A;  3MKD A;  4UV8 B;  3C51 A;  5L3D B;  3O9X A;  3CWZ B;  5EK3 A;  3E0Z A;  1H7C A;  4AI6 A;  4EXT A;  3AVR A;  3I9W A;  3CVR A;  4PFP A;  2Q9Q B;  5KX5 E;  5J1G A;  3RRC A;  2XAG B;  3I1A A;  4ZS2 A;  4E7S A;  3IF8 B;  1D1B A;  3K8P C;  1YD8 G;  5F3J A;  1WLX A;  3SOL A;  4WBO A;  3C4X A;  5ADX L;  1VOM A;  4GYR A;  3HA4 A;  5GON E;  2KLQ A;  5FY7 A;  5BMV E;  2VKJ A;  4O4L E;  2C5J A;  2X67 A;  3GWH A;  4H9S E;  4DVD A;  5LBQ B;  4JEU B;  5JQG E;  2LSG A;  2CCQ A;  3KBU A;  5FYM A;  4DMW A;  3C98 B;  3NRX A;  5JDH A;  3ZC1 A;  3N9N A;  3ANW A;  4A56 A;  2YEV C;  3RH3 A;  4CI3 B;  4EZ4 A;  4MLK A;  4NUV A;  5LXT E;  3OKQ A;  4P09 A;  4PJN A;  4CI2 B;  3RPU A;  2LOS A;  5AFU L;  4CI1 B;  2KZ7 B;  5H6R B;  2QGS A;  2ODV A;  3ZMZ B;  2ZM2 A;  2DWG A;  4ADZ A;  3SRZ A;  5LG4 A;  5LA6 E;  4J2C A;  3LBX A;  1BR4 A;  3ZCI A;  3EDU A;  2W61 A;  2IC6 A;  2N2N A;  3GMI A;  1BR1 A;  3P7I A;  4NUU A;  4CQI A;  4MHC A;  3KVA A;  4EB6 E;  3L09 A;  2YU1 A;  4YLH A;  4ERR A;  2L8K A;  4OHF A;  3PTR B;  1LKX A;  4QKN A;  4UEM A;  1EZ3 A;  2IW5 B;  4QX8 B;  3BQK A;  3LFM A;  2WBL A;  5FMN A;  4L9I A;  2VKO A;  2A2F X;  2V7I A;  3NBX X;  4PJJ A;  1IJ6 A;  2ZMA A;  5HXS A;  2CXF A;  2N9D A;  4IGU A;  5LOV E;  3F2E A;  3V5U A;  2X51 A;  2CMR A;  2NW7 A;  2NWB A;  2KWI B;  2X66 A;  3CQG B;  1U4Q A;  2E9X B;  2D2S A;  1S94 A;  4AQF A;  2ZLY A;  1HCI A;  2LSK A;  3CX8 B;  3LK3 B;  5DJQ C;  2CXD A;  2V7L A;  2Y6X A;  5JDF A;  4BAY B;  4BA9 A;  5JR9 B;  2XHE B;  4GOU A;  2K24 A;  5LYJ E;  3Q5X A;  3Q5W A;  3C4Z A;  4ZHQ E;  3PDY A;  5LGN B;  2MBG A;  2CWO A;  2XAS B;  2W63 A;  2PBI A;  3PU8 A;  5LHH B;  2RA1 A;  3JC6 C;  3AAE B;  1YKH B;  2MYS A;  4TX5 A;  4N78 D;  4B6X A;  2E9X D;  4DBR A;  5IYZ E;  1MMN A;  4DMV A;  4OYJ A;  3ZCJ A;  4PAG A;  3J9X 1;  3ZJ2 A;  4AXP A;  3R6N A;  2H3R A;  3AA1 B;  5JRC B;  4TN7 B;  3ETU A;  3ZMU B;  4HFV A;  4IE4 A;  3OJA A;  1S35 A;  1HFA A;  2NTX A;  5LGU B;  4AQF C;  2XTL A;  4ZI3 C;  2ZM8 A;  4WNK A;  3ZC0 A;  2EHO A;  4I43 B;  3ZYL A;  3N2G E;  5HXR A;  5J2T E;  2LEH A;  2VL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...