3J7Yq

Structure of the large ribosomal subunit from human mitochondria
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
128
structure length
128
Chain Sequence
YRARPPPRRRPGPRWPDPEDLLTPRWQLGPRYAAKQFARYGAASGVVPGSLWPSPEQLRELEAEEREWYPSLATMQESLRVKQLAEEQKRREREQHIAECMAKMPQMIVNWQQQQRENWEKAQADKER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the large ribosomal subunit from human mitochondria.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 35
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
q PF10147 CR6_interact Growth arrest and DNA-damage-inducible proteins-interacting protein 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1430 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3j7yq00
4V1Av 3J7Yq
chains in the Genus database with same CATH superfamily
4GK5E 5FXVA 3ZEFB 4QX8B 3P4WA 4G2AA 3RF1A 3SFEA 2Z6EA 3N2GE 5CA0E 3F31A 1WCRA 3RIAA 1E2AA 3RIUC 1WYBA 3ZMSB 4DR3T 1OEDE 2QGSA 4HWDA 2NR4A 5LNKA 2B1EA 2UU9T 3B5MA 4JI0T 5HXEA 4O4HE 3EVYA 4IL4A 4JEHB 2V26A 2Y48B 3JAEA 5IUXA 5KXJA 1N34T 3BQKA 3MACA 5L3GB 1CHUA 3RIUA 1R8IA 1XWMA 4JV5T 2KNDA 1M7KA 2BS2A 1KNRA 4O8SA 3AE5A 4OFZA 2DNXA 3IF8B 4HWCA 1GQEA 4ILCA 2XQ4A 2VB6A 2N9DA 3A8YC 4ZZBA 1MNEA 4TX5A 2XASB 3Q9DA 5LBMA 2IMLA 2BBJA 3TLTA 2CLYB 5AQRB 5L3BB 3Q5XA 4AKGA 2VKHA 1BR0A 2CBJA 1WLXA 3PUAA 3PU8A 3Q5EA 3QOFA 2VWAA 4N78D 3NZQA 4WW0A 1UX5A 2I0MA 4CI2B 4ILAA 2HN2A 2SPCA 5HXRA 1OEDA 2CBIA 4JUYA 4AI6A 4AQFA 3ANWA 3J9X1 4H9OC 1X79A 1XNQT 4ERRA 4ASKA 5C3JA 1HS7A 4PK5A 2YDSA 3ZCJA 3PUWF 1HF8A 1O3XA 2XSBA 4PJNA 3FXEB 4IDZA 4X5TA 5F5WA 5HEOA 2J47A 2UXBT 1W0AA 2FJAA 4EGWA 5A1LA 5LJNA 4DR2T 2IHR1 1J1JA 2W4XA 5FL0A 4DBRA 3ONJA 2MAWA 1E1HB 1NAFA 3RHWA 5JR9A 3ZYMA 3AEGA 3X1DA 2NP9A 3EDVA 4F8HA 3RRCA 5AQOB 2J62A 4PJLA 5DABA 3RYFE 2YU1A 4YJ2E 4UEMA 5FXZA 3ZLIA 4B3TT 1LVKA 2BS3A 1MMNA 3VRBA 4EEBA 2E5VA 2C5IT 2JQHA 2CWYA 3P4RA 4EZHA 1XNRT 1W09A 4PFOA 3LDQB 3RKOA 2XQYA 2CMRA 4UV8B 2XTLA 5M4YA 1QSDA 2OA5A 4U33A 3ZCIA 4CXWA 4EZ4A 4CXXA 4AIUA 2CRBA 4LFBT 1AJ3A 4EXTA 1ZEEA 2X67A 4JI1T 2CHOA 2LLYA 3MJXA 2IDOB 1SUMB 4LF8T 2W67A 4TNVA 3VR9A 4ZI2D 2CHNA 3H37A 4PAGA 3ZC0A 4IDQA 5HAXA 5ETWA 2IAKA 4QHOA 3ZYLA 2ZM6T 4TNWA 5CB4E 4JYAT 1VCTA 3NRYA 2ACZA 3AA1B 5FXXA 2W63A 2IW5B 3N9QA 4O2AE 4NIQA 4ISTA 2E9XD 3MXZA 3QC9A 2JJ9A 3PTRB 5HWXA 5FKYA 3JCFA 3UU3A 1NEKA 1XMQT 2LHRA 4UVAB 4ADZA 3AE2A 2NTXA 2VVSA 2WZIA 4O2BE 3F2EA 4H9PC 2KXPB 3LBXA 3UTKA 4ZI7E 1IBLT 3FB2A 4WBNE 2LT3A 2HN1A 3IBPA 3RC8A 2X9XA 3FBZA 3PU3A 3ETUA 2WP9A 2E2AA 4I0UA 1G73A 3AE9A 2A2FX 3AAIA 5JR9B 4YY3T 1U5PA 5LMNT 5H6RB 3C64A 1HX8A 5LMUT 2LSJA 3NZPA 4HFVA 3PUQA 4TV9E 2H89A 1D0XA 4CI1B 3OTOT 4IE4A 4KX6A 3WAJA 4X64T 3UFGA 4DV7T 3CQXC 3ZT5A 1XZYA 1ZHCA 4CN6A 1Y01A 2N1GA 1D1AA 3L09A 3P4PA 4IE6A 4DV4T 3OKQA 1KFYA 3OPCA 1XMOT 4GKKT 2W0GA 1MMAA 3OBVE 3OVUA 3KV6A 1YD8G 2E8IA 1WYCA 2KWIB 1OXZA 1SHZC 4OYJA 4PJMA 5LGNB 4HWFA 2F4VT 4EIWA 4YSYA 2LSGA 4IDOA 1I94T 4EYUA 4KHPT 2ZM8A 1ZKEA 3I0OA 1UK5A 2WB5A 1N32T 4DV5T 2RA1A 4LFCT 3ZN0B 5FNVE 2XQ8A 3BQIA 3EAMA 3C51A 1FMVA 5FY0A 2XQ6A 4LF9T 2DCFA 2VL0A 4HWHA 4ANJA 5JRCA 1UUSA 5LHIB 1U4QA 5HEJA 4X66T 3HI2A 5FY1A 2W66A 4TV8E 2C5KT 1HR0T 3IEEA 5DQVA 2MYSA 3E0ZA 3O1HA 4I50E 3AEBA 1EZ3A 4COFA 1W0BA 4U7IA 1LRZA 2E9XC 3I0QA 1MMGA 3IHRA 1UGOA 1VOMA 4JI7T 4OYKA 4WYVA 4I43B 2I59A 3AE3A 3WI3A 5LG3A 2W00A 3RI5A 4CXYA 3GWHA 2LHNA 5ABFB 2WWUA 2XAQB 4B6XA 1YQ4A 2CXDA 2X0YA 3P4SA 2UXXB 5AQSB 4EYYR 3O1IA 5LOVE 4YHJA 1Z8UA 1ZV4X 5LG4A 4H9SE 3FXDB 3ZMVB 4LF4T 2KLQA 3CQCB 4MBQA 4DR5T 1T72A 4HFHA 3RGLA 4E7SA 3E22E 2YKSA 4H9QC 2HPLA 4IL9A 3CKDA 1JNZA 4DR4T 2LJLA 2YN6A 3P8CD 4I4TE 1YW0A 5AQPB 4O4JE 2W2UA 2IIUA 3JC6D 2AE9A 1XDPA 4MFRA 3RKGA 3ABVA 4DUZT 4NUUA 1Z0PA 2WCAA 4AKIA 2V5DA 4ISSA 5AQUB 4CN1A 5IWAT 4HFCA 3KFWX 3QK6A 3LJCA 3SWHA 3ZJ1A 4AXPA 3N9PA 5L3FB 4EAHA 3LSVA 1I6ZA 2WSSV 3CX7B 3HKEE 3AEEA 2VKJA 2XAGB 5L3EB 4JI3T 1FJGT 2E5LT 4H9RC 2CM0A 1NENA 2K48A 2ZMAA 2LSKA 5JDQA 2XPKA 4PW8A 4ZXLA 5JVDE 4BA9A 3ETVA 5LGTB 1VRBA 4P09A 1XDOA 4TZ4C 2VL8A 1HG5A 4AQYT 4A56A 3EHZA 1NWMX 3VKHA 3ZT7A 3UFEA 3RYHE 4AKHA 4UV9B 4DVDA 3ZT6A 4YSXA 5LJMA 4ZZCA 4YFSA 2OLTA 4X20E 3BK9A 4F6RC 3Q5DA 5LHHB 2X51A 2VQET 2DI4A 2WAUA 1US7B 4LMLA 1ZP0A 4NPPA 2LRLA 3AEAA 3FHNA 4PJJA 2MTQA 4U31A 4JI5T 5J1GA 3FZFB 5FVKA 4MALA 4DMWA 2WMNA 5AQVB 1UURA 2PFVA 4HE8A 2CXLA 3QNUA 2YOEA 4BJMA 5FL1A 2UUCT 2JQ9A 2JQQA 3J7Yq 4GKJT 2B76A 3PUYF 4U74A 2KMFA 3AEFA 1FEWA 2QVAA 5EZYE 2CWOA 5AFUL 1UCUA 5J2UE 2BVLA 2H7VC 3I9YA 2V8SV 4PK6A 4ZI3C 3MZKB 4QX7B 1QLBA 1L0VA 1G8XA 5ABHA 3C4XA 3AA7B 3NKZA 5LCYA 2W61A 2CA5A 4ZS3A 4DBQA 5AQLB 2OV9A 4LMKA 4TWDA 3O9XA 1HX1B 2PJQA 3OJAA 4YTPA 2FBWA 3KV4A 3L39A 4HGAA 3SOLA 1YQ3A 4OHFA 2QRXA 3K8PC 3ONLC 5IYZE 2DHRA 3UT5E 2WY2A 5FXWA 4YT0A 1J5WA 2CPTA 2QA7A 4KMCA 5JDMA 2WWVA 1LVFA 2V7IA 3C50A 3AA6B 4UIGA 3RYCE 4XBFB 4PNIA 4AKRB 4AQFC 3W15B 4MHCA 2ODUA 5JH7E 2BVMA 5C8YE 5AQHB 4ZHQE 2DL1A 2NTYA 1HNZT 2ODVA 3K3OA 4K0KT 2IUBA 2LM9A 3FZHB 5L4EA 4Q25A 1HNXT 2KWHA 2YU2A 2V7KA 4YJ3E 3TLWA 2IC6A 3AVSA 3SRZA 3AEDA 4JLEA 2XAHB 1OEDB 2L3LA 3VHLA 3DP7A 3ZN1B 4DR6T 1OEDC 2CCQA 2NW7A 2VURA 3AXJB 2XSAA 3EUHA 2X66A 2Q9QC 2V5CA 4IIJE 5IHYA 3RRWA 4YSZA 4QWNB 3AVRA 4I55E 5HXSA 2XJ7A 1VCSA 2L9QA 3QB5K 4YTMA 2LSYA 3RQWA 4A5XA 2I6HA 2XZEA 3CX8B 3OYXA 4C91A 1IBMT 4JI6T 4HEAA 4PFPA 2HHHT 3MA9A 5HEGA 1UX4A 3S4UA 3V5SA 5DJQC 3PUXF 4ZS2A 2Q9QA 2VVNA 2K24A 2MOZA 3L3PA 3PV0F 4Z91A 4GIWA 5ADXL 5L3DB 5L2LA 4JI4T 3GMIA 2XQ9A 4ILUA 2M6BA 1T8BA 5AQIB 5HYAA 1HCIA 2EHOB 4B3MT 4HFBA 3EABA 2IC9A 4LF7T 3AAEB 4JI2T 4DUYT 1YKHB 2BBHA 5AQJB 3SFDA 5BMVE 3O4XE 3TKLB 4GK0E 4HFEA 4KUMB 3LK3B 5FP3A 3B57A 4UR9A 3RQUA 3UUMA 2DWKA 3RPUA 2D0UA 1B7TA 2Y6XA 2NOXA 5JDGA 4LF5T 2BKOA 4O4LE 2BDEA 3GN5A 3AE4A 3LK2B 4ZEYA 3N2KE 5JTGA 4YLHA 3RIFA 4L0RA 4X1YE 2YDRA 3CPZA 3CVRA 3AECA 1MMDA 2HH7A 2BZBA 4IE7A 3OYZA 5E0OA 2JPFA 1J5ET 4DV2T 4EEDA 2BG9C 2G0UA 4HFDA 2A3DA 2WBLA 4PK4A 4UF0B 3JC6C 3CQGB 2XQAA 1S94A 3NRXA 3N9MA 3AA0B 3KDSE 4DNDA 1H7CA 5J0ZA 2KT9A 2X0HA 4M1PA 3NBXX 3UQ4A 1BR4A 4AISA 3JAFA 2YK0A 4IGUA 1HNWT 5AQNB 4X1IE 3UU8A 2Q9QB 1IJ6A 4IDPA 4IE0A 4CI3B 5CA1E 3ESLA 2D5UA 4CQIA 3FZLB 2YDQA 3QB5A 2XM1A 4KP3C 4WZXA 5L47A 1WFDA 5ABFA 3CX6B 4P1NA 4X65T 4ILBA 2UUBT 2XQ3A 4O4IE 2XM2A 5HWYA 3ZSTA 3AE6A 3JADA 3PUVF 2JMKA 5HEUA 2XAJB 4HWIB 4UVCB 2V1DB 4U2ZA 1X9BA 3AXJA 2LOSA 3ZMTB 5KX5E 4Z8XA 4P0AA 2KSRA 2WQYA 4NUVA 2CE7A 4U7YA 1KK7A 4U72A 2WDVA 5CGMA 5JDHA 3LG7A 1T7SA 4GYSA 1WR6A 4U3CA 1CUNA 4QKNA 4UXNB 3T8OA 3SS1A 4EB6E 4QH5A 5AQMB 5AQFB 3A5XA 3AE1A 5ABEA 3VKGA 5F3JA 2WMOA 1W9RA 3VRAA 1MIYA 2FJBA 2LE8A 2WZHA 1QUUA 4H9NC 2A9UA 3H3AA 4H63V 4MLKA 5BR8T 4B3ST 5HCJA 4NXMT 5HEHA 3A7MA 4JI8T 4NXNT 4X1KE 2J4GA 2FJDA 3TLVA 2XQ7A 1MIVA 2MPKA 3N5LA 3N2OA 2KINB 1D1BA 4ZI3D 3I1AA 3KBTA 5KDMC 3UQ7A 3ZYKA 3ZSSA 2UUAT 4UELA 1HTJF 2BS4A 4QXHB 3QUJA 4AKLA 5JDNA 3PUGA 3AAAB 3RX6A 2VQFT 2PG8A 3DJBA 4HN9A 2PTFA 2NWBA 1KNZA 4L5GA 1WRDA 2E9XB 5L3CB 5FYMA 3C98B 3IA3A 4QXCB 4V1Av 5LHGB 1KF6A 3K1SA 3K3NA 1BR1A 5AQQB 2WDRA 1M62A 2WM9A 3H3MA 2JRKA 3MK7C 3B13A 3RLFF 3ZMZB 2UXNB 3E08A 2EHOC 2PBIA 3KBUA 1IJ5A 3GA8A 1OWAA 2WU5A 3Q2MA 4KBMB 5LB7B 2NW9A 4EV6A 5JR9C 5LXTE 3C4WA 2LKHA 5FMNA 2V6YB 4YTNA 3AE8A 1MIWA 3PUZF 3T1HT 5J2TE 2X9WA 5KMGP 3HKDE 2K3WA 1N36T 1T98A 3PDYA 4OX9T 2YEVC 2X9YA 3L8RA 4LFAT 4FJOA 4YHHT 3GN5B 3LBXB 4IDNA 3ZPOA 2R6GF 4BAYB 4K0UA 4DIDB 2K5BB 4C90A 4DMVA 2Q9QD 2LRKA 3FBLA 3KV9A 3P50A 4OK0A 2V7MA 2XQ5A 2WS3A 3PUSA 2E9XA 3UUBA 2LOPA 5LGUB 5EK3A 2HPJA 3N9NA 1SE7A 1MNDA 1KEYA 4HFIA 5AQTB 2CLYC 5ABGA 3R84B 3K3QC 4KHZF 4UF0A 3V5UA 3KV5A 2EHOA 2XHEB 4QH1A 3EI0A 5H6QB 5JDLA 5FY7A 5LBQB 2ZM2A 4WNKA 5HCMA 3P4QA 2ZLYA 1DU2A 4DV3T 2V6YA 1IZNB 2V6XA 2H3RA 2RPAA 3AB3B 3RH3A 2ES0A 2W62A 2V7LA 3N9OA 3PURA 4XZCA 4AQGA 3HR0A 3NVOA 5CJ5A 1Y64B 4TWFA 2MBGA 2X68A 4DR1T 3M3ZB 3EDUA 5F8PA 4TUYE 1S35A 2D0TA 1BR2A 2XAFB 3HA4A 4LMJA 5TAOA 1LKXA 2CEAA 2CXFA 4Z90A 5FVLA 2Y8DA 3NWIA 5LP6E 2FJEA 2H7OA 3HL6A 2M67A 3KINB 2LKGA 4G63A 4L9IA 4TN7B 2DWGA 4IHJE 1D0YA 1FIOA 3D0TA 4JEUB 4ZOLE 1D0ZA 2D2SA 5AQGB 3RC3A 2V7JA 4GYRA 3R6NA 2EHOD 3G06A 2BG9A 3LK42 3UU6A 2D9DA 1IAPA 4DV6T 5JRCB 3PJAJ 2VK9A 4HKAA 1E7PA 3CIRA 4ZI2C 1FMWA 1HFAA 1WR0A 2QYWA 4KI0F 4WBOA 4EOZB 3T1YT 4XAXB 3TLUA 1ZOYA 1KNPA 3N9LA 4IT4A 4DV0T 2M6IA 1YXRA 2JQKA 3F57A 3UUNA 4BJNA 2JMHA 1SA0E 4TWHA 4HTEA 3U78A 3KVAA 2C5JA 3VR8A 2WDQA 3C4ZA 3M65A 1HG2A 2X9HA 5LYJE 4DV1T 4LF6T 2H88A 3TLSA 3UU4A 3ZC1A 3ZMUB 5GONE 3ANWB 2BG9E 3FZMB 3LFMA 5L4HA 4J2CA 2XY8B 1YKEB 3PJAA 2BG9B 2FUPA 4DR7T 4B3RT 5CFBA 2A72A 2NW8A 4U2YA 1V9DA 3MKDA 2BKPA 4E7ZA 4QH4A 2J1DG 2WU2A 3CK6A 3CMLA 3PE0A 4FI5A 4H63H 3ZKRA 4A97A 3BQLA 4UVBB 2L8KA 1N33T 2LEHA 3WAKA 5DQWA 4CZZB 3ZJ2A 3U3IA 5EK2A 4IREA 2C0SA 2RP4A 5JREA 2GK9A 2AXDS 3HKCE 5JQGE 2UXDT 3FZKB 3UUXB 4A98A 5C2TA 1IBKT 2YINA 2DLRA 5HXCA 4P0BA 2N2NA 2P9BA 3ONXA 3VU7H 4X62T 3I9WA 4DO0A 2XUEA 2LSIA 5AQKB 1D1CA 2BKNA 4JBWF 2VKDA 3UULA 5LA6E 4YXDA 3AE7A 2ACXA 2VASA 2ZM0A 2LM2A 4GOUA 2K9AA 3UU5A 5HXHA 4QXBB 3P7IA 4CN4A 5EK4A 3DTOA 3HKBE 2KZ7B 3O1JA 3RYIE 3Q5WA 3KVBA 2JIWA 3CWZB 5JDFA 4IE5A 1JNRA 2X0LB 2VKOA 2UXCT
chains in the Genus database with same CATH topology
4GK5E 5FXVA 3ZEFB 4QX8B 4G2AA 2Z6EA 3N2GE 5CA0E 3F31A 1WYBA 3ZMSB 5LNKA 2QGSA 2B1EA 5HXEA 4O4HE 3EVYA 4JEHB 2V26A 2Y48B 3BQKA 3MACA 5L3GB 2KNDA 4O8SA 4OFZA 2DNXA 3IF8B 2VB6A 2N9DA 1MNEA 4TX5A 2XASB 3Q9DA 5LBMA 2CLYB 5L3BB 4AKGA 3Q5XA 2VKHA 1BR0A 3WI3A 1WLXA 3PUAA 3PU8A 4CI2B 4WW0A 2VWAA 4N78D 3NZQA 1KNZA 1UX5A 2SPCA 5HXRA 4AI6A 4JUYA 4AQFA 3ANWA 3J9X1 4H9OC 1X79A 4ERRA 4ASKA 1HS7A 4PK5A 3ZCJA 1HF8A 1O3XA 4PJNA 3FXEB 4IDZA 5LJNA 5A1LA 4DBRA 1E1HB 1NAFA 5JR9A 3ZYMA 2NP9A 3EDVA 3RRCA 4PJLA 5DABA 3RYFE 2YU1A 4YJ2E 4UEMA 5FXZA 3ZLIA 1LVKA 5LHIB 1MMNA 4EZHA 2C5IT 2CWYA 4PFOA 3RKOA 2XQYA 2CMRA 4UV8B 2XTLA 5M4YA 1QSDA 2OA5A 3ZCIA 4EZ4A 4CXWA 4CXXA 1AJ3A 4EXTA 1ZEEA 2X67A 3MJXA 4ZI2D 3H37A 4PAGA 3ZC0A 5HAXA 2IAKA 4QHOA 3ZYLA 5CB4E 5FXXA 3NRYA 3AA1B 2IW5B 2W63A 3N9QA 4O2AE 4ISTA 2E9XD 3MXZA 3QC9A 2JJ9A 3PTRB 5HWXA 2LHRA 4UVAB 4ADZA 2NTXA 4O2BE 3UTKA 3F2EA 4H9PC 2KXPB 3LBXA 4ZI7E 3FB2A 4WBNE 2LT3A 3IBPA 3RC8A 2X9XA 3FBZA 3PU3A 3ETUA 1G73A 2A2FX 3AAIA 5JR9B 1U5PA 5H6RB 3C64A 1HX8A 2LSJA 3NZPA 4HFVA 3PUQA 4TV9E 1D0XA 4IE4A 3WAJA 3CQXC 1ZHCA 2N1GA 1D1AA 3L09A 4IE6A 3OKQA 2W0GA 1MMAA 3OBVE 3KV6A 1YD8G 2E8IA 1WYCA 2KWIB 1OXZA 1SHZC 4OYJA 4PJMA 5LGNB 4EIWA 2LSGA 4EYUA 2ZM8A 1ZKEA 3I0OA 2RA1A 3ZN0B 5FNVE 3BQIA 5FY0A 3C51A 1FMVA 2DCFA 4ANJA 5JRCA 1U4QA 3HI2A 5FY1A 4TV8E 2C5KT 3IEEA 5DQVA 2MYSA 3E0ZA 3O1HA 4I50E 1EZ3A 1LRZA 2E9XC 3I0QA 1MMGA 3IHRA 1VOMA 4OYKA 4I43B 2I59A 2W00A 4CXYA 3GWHA 2LHNA 2WWUA 2XAQB 4B6XA 2CXDA 2UXXB 4EYYR 3O1IA 5LOVE 4YHJA 5LG4A 1ZV4X 4H9SE 3FXDB 3ZMVB 2KLQA 3CQCB 4MBQA 4E7SA 3E22E 4H9QC 2HPLA 3CKDA 2LJLA 3P8CD 4I4TE 1YW0A 4O4JE 3JC6D 4MFRA 4NUUA 1Z0PA 4AKIA 4ISSA 3KFWX 3SWHA 3LJCA 4AXPA 3ZJ1A 5L3FB 3N9PA 4EAHA 3CX7B 2WSSV 3HKEE 5L3EB 2VKJA 2XAGB 4H9RC 2CM0A 2K48A 2ZMAA 2LSKA 5JDQA 4PW8A 5JVDE 5LGTB 4BA9A 3ETVA 1VRBA 4P09A 4TZ4C 2VL8A 1HG5A 4A56A 3VKHA 1NWMX 3UFEA 3RYHE 4AKHA 4UV9B 4DVDA 5LJMA 4YFSA 4X20E 4F6RC 3BK9A 5LHHB 2X51A 2DI4A 2WAUA 1US7B 4PJJA 3FHNA 2MTQA 5J1GA 4MALA 4DMWA 2WMNA 2PFVA 4HE8A 2CXLA 4BJMA 2JQQA 3J7Yq 4U74A 2KMFA 1FEWA 5EZYE 2CWOA 5AFUL 1UCUA 5J2UE 2BVLA 2H7VC 3I9YA 4PK6A 4ZI3C 3MZKB 4QX7B 1G8XA 3C4XA 3AA7B 5LCYA 2W61A 2CA5A 4ZS3A 4DBQA 2PJQA 3OJAA 3KV4A 4HGAA 3SOLA 4OHFA 5LHGB 3K8PC 5IYZE 2DHRA 3UT5E 5HXSA 5FXWA 5JDMA 2QA7A 4KMCA 1LVFA 2V7IA 3C50A 3AA6B 4UIGA 3RYCE 4XBFB 4PNIA 4AKRB 4AQFC 3W15B 4MHCA 2ODUA 5JH7E 2BVMA 5C8YE 4ZHQE 2NTYA 2ODVA 3K3OA 2LM9A 2KWHA 2YU2A 2V7KA 4YJ3E 2IC6A 3AVSA 3SRZA 4JLEA 2XAHB 2L3LA 3VHLA 3DP7A 3ZN1B 2CCQA 2NW7A 3EUHA 2X66A 2Q9QC 4IIJE 5IHYA 3RRWA 4QWNB 3AVRA 4I55E 2L9QA 2LSYA 3CX8B 3OYXA 4C91A 4HEAA 4PFPA 3MA9A 1UX4A 3S4UA 3V5SA 5DJQC 4ZS2A 2Q9QA 5ADXL 2K24A 2MOZA 3L3PA 5L2LA 4GIWA 5L3DB 3GMIA 4ILUA 5HYAA 1HCIA 2EHOB 2IC9A 3AAEB 1YKHB 5BMVE 3O4XE 3TKLB 4GK0E 4KUMB 3LK3B 5FP3A 3B57A 3UUMA 2DWKA 3RPUA 2D0UA 1B7TA 2Y6XA 2NOXA 5JDGA 4O4LE 2BDEA 3GN5A 3LK2B 3N2KE 4YLHA 4L0RA 4X1YE 3CPZA 3CVRA 1MMDA 2HH7A 2BZBA 4IE7A 3OYZA 5E0OA 2JPFA 2G0UA 2A3DA 2WBLA 4PK4A 4UF0B 3JC6C 3CQGB 1S94A 3NRXA 3N9MA 3AA0B 3KDSE 4DNDA 1H7CA 2KT9A 4CI1B 4M1PA 3NBXX 1BR4A 2YK0A 4IGUA 4CI3B 4X1IE 2Q9QB 1IJ6A 4IE0A 5CA1E 3ESLA 2D5UA 4CQIA 4KP3C 3CX6B 5HWYA 4O4IE 2JMKA 2XAJB 4UVCB 2V1DB 2LOSA 3ZMTB 5KX5E 4Z8XA 4P0AA 4NUVA 2CE7A 4U72A 1KK7A 5JDHA 3LG7A 4UXNB 4GYSA 1WR6A 3T8OA 1CUNA 4QKNA 4EB6E 3O9XA 3SS1A 3VKGA 3A5XA 5F3JA 2WMOA 1MIYA 2LE8A 4H9NC 1QUUA 4MLKA 3H3AA 4H63V 4X1KE 1MIVA 3N5LA 3N2OA 2KINB 1D1BA 4ZI3D 3I1AA 3KBTA 5KDMC 3ZYKA 4UELA 1HTJF 4QXHB 3QUJA 4AKLA 5JDNA 3PUGA 3AAAB 3RX6A 2PG8A 3DJBA 4HN9A 2NWBA 4L5GA 1WRDA 2E9XB 5L3CB 5FYMA 3C98B 4QXCB 4V1Av 3K3NA 1BR1A 2WM9A 2JRKA 3MK7C 3B13A 3ZMZB 2UXNB 3E08A 2EHOC 2PBIA 3KBUA 1IJ5A 3GA8A 1OWAA 3Q2MA 3ZPOA 4KBMB 2NW9A 5JR9C 5LXTE 3C4WA 5FMNA 1MIWA 5J2TE 2X9WA 5KMGP 3HKDE 1T98A 3PDYA 2YEVC 2X9YA 4FJOA 3GN5B 3LBXB 4BAYB 4K0UA 2K5BB 4C90A 4DMVA 2Q9QD 3KV9A 3FBLA 4OK0A 2V7MA 3PUSA 2E9XA 2LOPA 5LGUB 5EK3A 2HPJA 3N9NA 1MNDA 2CLYC 3R84B 3K3QC 4UF0A 3V5UA 3KV5A 2EHOA 2XHEB 5H6QB 5JDLA 5FY7A 5LBQB 2ZM2A 4WNKA 2ZLYA 1IZNB 2H3RA 3RH3A 3AB3B 4AQGA 2ES0A 2W62A 2V7LA 3N9OA 3PURA 4XZCA 3HR0A 1Y64B 2MBGA 2X68A 3EDUA 5F8PA 4TUYE 1S35A 2D0TA 1BR2A 2XAFB 3HA4A 5TAOA 1LKXA 2CEAA 2CXFA 5LP6E 2Y8DA 2H7OA 3HL6A 2M67A 3KINB 4G63A 4L9IA 4TN7B 5ETWA 2DWGA 4IHJE 1D0YA 1FIOA 3D0TA 4JEUB 4ZOLE 1D0ZA 2D2SA 3RC3A 2V7JA 4GYRA 3R6NA 2EHOD 3LK42 1IAPA 5JRCB 2VK9A 4HKAA 4ZI2C 1FMWA 1HFAA 4WBOA 4EOZB 4XAXB 3N9LA 3F57A 3UUNA 4BJNA 2JMHA 1SA0E 4HTEA 3U78A 3KVAA 2C5JA 3C4ZA 3M65A 1HG2A 2X9HA 5LYJE 3ZC1A 3ZMUB 5GONE 3ANWB 3LFMA 4J2CA 1YKEB 2A72A 2NW8A 1V9DA 3MKDA 4E7ZA 2J1DG 3PE0A 4FI5A 3CMLA 4H63H 3BQLA 4UVBB 2L8KA 2LEHA 3WAKA 5DQWA 4CZZB 3ZJ2A 3U3IA 5EK2A 2C0SA 2RP4A 5JREA 2GK9A 3HKCE 5JQGE 3UUXB 2YINA 2DLRA 5HXCA 4P0BA 2N2NA 2P9BA 3ONXA 3VU7H 3I9WA 4DO0A 2XUEA 2LSIA 3UULA 1D1CA 2VKDA 5LA6E 2ACXA 2VASA 2ZM0A 4GOUA 2K9AA 5HXHA 4QXBB 3P7IA 5EK4A 3DTOA 3HKBE 2KZ7B 3O1JA 3RYIE 3Q5WA 3KVBA 3CWZB 5JDFA 4IE5A 3QK6A 2X0LB 2VKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V1A v;  3J7Y q; 
#chains in the Genus database with same CATH topology
 4GK5 E;  5FXV A;  3ZEF B;  4QX8 B;  3P4W A;  4G2A A;  3RF1 A;  3SFE A;  2Z6E A;  3N2G E;  5CA0 E;  3F31 A;  1WCR A;  3RIA A;  1E2A A;  3RIU C;  1WYB A;  3ZMS B;  4DR3 T;  1OED E;  2QGS A;  4HWD A;  2NR4 A;  5LNK A;  2B1E A;  2UU9 T;  3B5M A;  4JI0 T;  5HXE A;  4O4H E;  3EVY A;  4IL4 A;  4JEH B;  2V26 A;  2Y48 B;  3JAE A;  5IUX A;  5KXJ A;  1N34 T;  3BQK A;  3MAC A;  5L3G B;  1CHU A;  3RIU A;  1R8I A;  1XWM A;  4JV5 T;  2KND A;  1M7K A;  2BS2 A;  1KNR A;  4O8S A;  3AE5 A;  4OFZ A;  2DNX A;  3IF8 B;  4HWC A;  1GQE A;  4ILC A;  2XQ4 A;  2VB6 A;  2N9D A;  3A8Y C;  4ZZB A;  1MNE A;  4TX5 A;  2XAS B;  3Q9D A;  5LBM A;  2IML A;  2BBJ A;  3TLT A;  2CLY B;  5AQR B;  5L3B B;  3Q5X A;  4AKG A;  2VKH A;  1BR0 A;  2CBJ A;  1WLX A;  3PUA A;  3PU8 A;  3Q5E A;  3QOF A;  2VWA A;  4N78 D;  3NZQ A;  4WW0 A;  1UX5 A;  2I0M A;  4CI2 B;  4ILA A;  2HN2 A;  2SPC A;  5HXR A;  1OED A;  2CBI A;  4JUY A;  4AI6 A;  4AQF A;  3ANW A;  3J9X 1;  4H9O C;  1X79 A;  1XNQ T;  4ERR A;  4ASK A;  5C3J A;  1HS7 A;  4PK5 A;  2YDS A;  3ZCJ A;  3PUW F;  1HF8 A;  1O3X A;  2XSB A;  4PJN A;  3FXE B;  4IDZ A;  4X5T A;  5F5W A;  5HEO A;  2J47 A;  2UXB T;  1W0A A;  2FJA A;  4EGW A;  5A1L A;  5LJN A;  4DR2 T;  2IHR 1;  1J1J A;  2W4X A;  5FL0 A;  4DBR A;  3ONJ A;  2MAW A;  1E1H B;  1NAF A;  3RHW A;  5JR9 A;  3ZYM A;  3AEG A;  3X1D A;  2NP9 A;  3EDV A;  4F8H A;  3RRC A;  5AQO B;  2J62 A;  4PJL A;  5DAB A;  3RYF E;  2YU1 A;  4YJ2 E;  4UEM A;  5FXZ A;  3ZLI A;  4B3T T;  1LVK A;  2BS3 A;  1MMN A;  3VRB A;  4EEB A;  2E5V A;  2C5I T;  2JQH A;  2CWY A;  3P4R A;  4EZH A;  1XNR T;  1W09 A;  4PFO A;  3LDQ B;  3RKO A;  2XQY A;  2CMR A;  4UV8 B;  2XTL A;  5M4Y A;  1QSD A;  2OA5 A;  4U33 A;  3ZCI A;  4CXW A;  4EZ4 A;  4CXX A;  4AIU A;  2CRB A;  4LFB T;  1AJ3 A;  4EXT A;  1ZEE A;  2X67 A;  4JI1 T;  2CHO A;  2LLY A;  3MJX A;  2IDO B;  1SUM B;  4LF8 T;  2W67 A;  4TNV A;  3VR9 A;  4ZI2 D;  2CHN A;  3H37 A;  4PAG A;  3ZC0 A;  4IDQ A;  5HAX A;  5ETW A;  2IAK A;  4QHO A;  3ZYL A;  2ZM6 T;  4TNW A;  5CB4 E;  4JYA T;  1VCT A;  3NRY A;  2ACZ A;  3AA1 B;  5FXX A;  2W63 A;  2IW5 B;  3N9Q A;  4O2A E;  4NIQ A;  4IST A;  2E9X D;  3MXZ A;  3QC9 A;  2JJ9 A;  3PTR B;  5HWX A;  5FKY A;  3JCF A;  3UU3 A;  1NEK A;  1XMQ T;  2LHR A;  4UVA B;  4ADZ A;  3AE2 A;  2NTX A;  2VVS A;  2WZI A;  4O2B E;  3F2E A;  4H9P C;  2KXP B;  3LBX A;  3UTK A;  4ZI7 E;  1IBL T;  3FB2 A;  4WBN E;  2LT3 A;  2HN1 A;  3IBP A;  3RC8 A;  2X9X A;  3FBZ A;  3PU3 A;  3ETU A;  2WP9 A;  2E2A A;  4I0U A;  1G73 A;  3AE9 A;  2A2F X;  3AAI A;  5JR9 B;  4YY3 T;  1U5P A;  5LMN T;  5H6R B;  3C64 A;  1HX8 A;  5LMU T;  2LSJ A;  3NZP A;  4HFV A;  3PUQ A;  4TV9 E;  2H89 A;  1D0X A;  4CI1 B;  3OTO T;  4IE4 A;  4KX6 A;  3WAJ A;  4X64 T;  3UFG A;  4DV7 T;  3CQX C;  3ZT5 A;  1XZY A;  1ZHC A;  4CN6 A;  1Y01 A;  2N1G A;  1D1A A;  3L09 A;  3P4P A;  4IE6 A;  4DV4 T;  3OKQ A;  1KFY A;  3OPC A;  1XMO T;  4GKK T;  2W0G A;  1MMA A;  3OBV E;  3OVU A;  3KV6 A;  1YD8 G;  2E8I A;  1WYC A;  2KWI B;  1OXZ A;  1SHZ C;  4OYJ A;  4PJM A;  5LGN B;  4HWF A;  2F4V T;  4EIW A;  4YSY A;  2LSG A;  4IDO A;  1I94 T;  4EYU A;  4KHP T;  2ZM8 A;  1ZKE A;  3I0O A;  1UK5 A;  2WB5 A;  1N32 T;  4DV5 T;  2RA1 A;  4LFC T;  3ZN0 B;  5FNV E;  2XQ8 A;  3BQI A;  3EAM A;  3C51 A;  1FMV A;  5FY0 A;  2XQ6 A;  4LF9 T;  2DCF A;  2VL0 A;  4HWH A;  4ANJ A;  5JRC A;  1UUS A;  5LHI B;  1U4Q A;  5HEJ A;  4X66 T;  3HI2 A;  5FY1 A;  2W66 A;  4TV8 E;  2C5K T;  1HR0 T;  3IEE A;  5DQV A;  2MYS A;  3E0Z A;  3O1H A;  4I50 E;  3AEB A;  1EZ3 A;  4COF A;  1W0B A;  4U7I A;  1LRZ A;  2E9X C;  3I0Q A;  1MMG A;  3IHR A;  1UGO A;  1VOM A;  4JI7 T;  4OYK A;  4WYV A;  4I43 B;  2I59 A;  3AE3 A;  3WI3 A;  5LG3 A;  2W00 A;  3RI5 A;  4CXY A;  3GWH A;  2LHN A;  5ABF B;  2WWU A;  2XAQ B;  4B6X A;  1YQ4 A;  2CXD A;  2X0Y A;  3P4S A;  2UXX B;  5AQS B;  4EYY R;  3O1I A;  5LOV E;  4YHJ A;  1Z8U A;  1ZV4 X;  5LG4 A;  4H9S E;  3FXD B;  3ZMV B;  4LF4 T;  2KLQ A;  3CQC B;  4MBQ A;  4DR5 T;  1T72 A;  4HFH A;  3RGL A;  4E7S A;  3E22 E;  2YKS A;  4H9Q C;  2HPL A;  4IL9 A;  3CKD A;  1JNZ A;  4DR4 T;  2LJL A;  2YN6 A;  3P8C D;  4I4T E;  1YW0 A;  5AQP B;  4O4J E;  2W2U A;  2IIU A;  3JC6 D;  2AE9 A;  1XDP A;  4MFR A;  3RKG A;  3ABV A;  4DUZ T;  4NUU A;  1Z0P A;  2WCA A;  4AKI A;  2V5D A;  4ISS A;  5AQU B;  4CN1 A;  5IWA T;  4HFC A;  3KFW X;  3QK6 A;  3LJC A;  3SWH A;  3ZJ1 A;  4AXP A;  3N9P A;  5L3F B;  4EAH A;  3LSV A;  1I6Z A;  2WSS V;  3CX7 B;  3HKE E;  3AEE A;  2VKJ A;  2XAG B;  5L3E B;  4JI3 T;  1FJG T;  2E5L T;  4H9R C;  2CM0 A;  1NEN A;  2K48 A;  2ZMA A;  2LSK A;  5JDQ A;  2XPK A;  4PW8 A;  4ZXL A;  5JVD E;  4BA9 A;  3ETV A;  5LGT B;  1VRB A;  4P09 A;  1XDO A;  4TZ4 C;  2VL8 A;  1HG5 A;  4AQY T;  4A56 A;  3EHZ A;  1NWM X;  3VKH A;  3ZT7 A;  3UFE A;  3RYH E;  4AKH A;  4UV9 B;  4DVD A;  3ZT6 A;  4YSX A;  5LJM A;  4ZZC A;  4YFS A;  2OLT A;  4X20 E;  3BK9 A;  4F6R C;  3Q5D A;  5LHH B;  2X51 A;  2VQE T;  2DI4 A;  2WAU A;  1US7 B;  4LML A;  1ZP0 A;  4NPP A;  2LRL A;  3AEA A;  3FHN A;  4PJJ A;  2MTQ A;  4U31 A;  4JI5 T;  5J1G A;  3FZF B;  5FVK A;  4MAL A;  4DMW A;  2WMN A;  5AQV B;  1UUR A;  2PFV A;  4HE8 A;  2CXL A;  3QNU A;  2YOE A;  4BJM A;  5FL1 A;  2UUC T;  2JQ9 A;  2JQQ A;  3J7Y q;  4GKJ T;  2B76 A;  3PUY F;  4U74 A;  2KMF A;  3AEF A;  1FEW A;  2QVA A;  5EZY E;  2CWO A;  5AFU L;  1UCU A;  5J2U E;  2BVL A;  2H7V C;  3I9Y A;  2V8S V;  4PK6 A;  4ZI3 C;  3MZK B;  4QX7 B;  1QLB A;  1L0V A;  1G8X A;  5ABH A;  3C4X A;  3AA7 B;  3NKZ A;  5LCY A;  2W61 A;  2CA5 A;  4ZS3 A;  4DBQ A;  5AQL B;  2OV9 A;  4LMK A;  4TWD A;  3O9X A;  1HX1 B;  2PJQ A;  3OJA A;  4YTP A;  2FBW A;  3KV4 A;  3L39 A;  4HGA A;  3SOL A;  1YQ3 A;  4OHF A;  2QRX A;  3K8P C;  3ONL C;  5IYZ E;  2DHR A;  3UT5 E;  2WY2 A;  5FXW A;  4YT0 A;  1J5W A;  2CPT A;  2QA7 A;  4KMC A;  5JDM A;  2WWV A;  1LVF A;  2V7I A;  3C50 A;  3AA6 B;  4UIG A;  3RYC E;  4XBF B;  4PNI A;  4AKR B;  4AQF C;  3W15 B;  4MHC A;  2ODU A;  5JH7 E;  2BVM A;  5C8Y E;  5AQH B;  4ZHQ E;  2DL1 A;  2NTY A;  1HNZ T;  2ODV A;  3K3O A;  4K0K T;  2IUB A;  2LM9 A;  3FZH B;  5L4E A;  4Q25 A;  1HNX T;  2KWH A;  2YU2 A;  2V7K A;  4YJ3 E;  3TLW A;  2IC6 A;  3AVS A;  3SRZ A;  3AED A;  4JLE A;  2XAH B;  1OED B;  2L3L A;  3VHL A;  3DP7 A;  3ZN1 B;  4DR6 T;  1OED C;  2CCQ A;  2NW7 A;  2VUR A;  3AXJ B;  2XSA A;  3EUH A;  2X66 A;  2Q9Q C;  2V5C A;  4IIJ E;  5IHY A;  3RRW A;  4YSZ A;  4QWN B;  3AVR A;  4I55 E;  5HXS A;  2XJ7 A;  1VCS A;  2L9Q A;  3QB5 K;  4YTM A;  2LSY A;  3RQW A;  4A5X A;  2I6H A;  2XZE A;  3CX8 B;  3OYX A;  4C91 A;  1IBM T;  4JI6 T;  4HEA A;  4PFP A;  2HHH T;  3MA9 A;  5HEG A;  1UX4 A;  3S4U A;  3V5S A;  5DJQ C;  3PUX F;  4ZS2 A;  2Q9Q A;  2VVN A;  2K24 A;  2MOZ A;  3L3P A;  3PV0 F;  4Z91 A;  4GIW A;  5ADX L;  5L3D B;  5L2L A;  4JI4 T;  3GMI A;  2XQ9 A;  4ILU A;  2M6B A;  1T8B A;  5AQI B;  5HYA A;  1HCI A;  2EHO B;  4B3M T;  4HFB A;  3EAB A;  2IC9 A;  4LF7 T;  3AAE B;  4JI2 T;  4DUY T;  1YKH B;  2BBH A;  5AQJ B;  3SFD A;  5BMV E;  3O4X E;  3TKL B;  4GK0 E;  4HFE A;  4KUM B;  3LK3 B;  5FP3 A;  3B57 A;  4UR9 A;  3RQU A;  3UUM A;  2DWK A;  3RPU A;  2D0U A;  1B7T A;  2Y6X A;  2NOX A;  5JDG A;  4LF5 T;  2BKO A;  4O4L E;  2BDE A;  3GN5 A;  3AE4 A;  3LK2 B;  4ZEY A;  3N2K E;  5JTG A;  4YLH A;  3RIF A;  4L0R A;  4X1Y E;  2YDR A;  3CPZ A;  3CVR A;  3AEC A;  1MMD A;  2HH7 A;  2BZB A;  4IE7 A;  3OYZ A;  5E0O A;  2JPF A;  1J5E T;  4DV2 T;  4EED A;  2BG9 C;  2G0U A;  4HFD A;  2A3D A;  2WBL A;  4PK4 A;  4UF0 B;  3JC6 C;  3CQG B;  2XQA A;  1S94 A;  3NRX A;  3N9M A;  3AA0 B;  3KDS E;  4DND A;  1H7C A;  5J0Z A;  2KT9 A;  2X0H A;  4M1P A;  3NBX X;  3UQ4 A;  1BR4 A;  4AIS A;  3JAF A;  2YK0 A;  4IGU A;  1HNW T;  5AQN B;  4X1I E;  3UU8 A;  2Q9Q B;  1IJ6 A;  4IDP A;  4IE0 A;  4CI3 B;  5CA1 E;  3ESL A;  2D5U A;  4CQI A;  3FZL B;  2YDQ A;  3QB5 A;  2XM1 A;  4KP3 C;  4WZX A;  5L47 A;  1WFD A;  5ABF A;  3CX6 B;  4P1N A;  4X65 T;  4ILB A;  2UUB T;  2XQ3 A;  4O4I E;  2XM2 A;  5HWY A;  3ZST A;  3AE6 A;  3JAD A;  3PUV F;  2JMK A;  5HEU A;  2XAJ B;  4HWI B;  4UVC B;  2V1D B;  4U2Z A;  1X9B A;  3AXJ A;  2LOS A;  3ZMT B;  5KX5 E;  4Z8X A;  4P0A A;  2KSR A;  2WQY A;  4NUV A;  2CE7 A;  4U7Y A;  1KK7 A;  4U72 A;  2WDV A;  5CGM A;  5JDH A;  3LG7 A;  1T7S A;  4GYS A;  1WR6 A;  4U3C A;  1CUN A;  4QKN A;  4UXN B;  3T8O A;  3SS1 A;  4EB6 E;  4QH5 A;  5AQM B;  5AQF B;  3A5X A;  3AE1 A;  5ABE A;  3VKG A;  5F3J A;  2WMO A;  1W9R A;  3VRA A;  1MIY A;  2FJB A;  2LE8 A;  2WZH A;  1QUU A;  4H9N C;  2A9U A;  3H3A A;  4H63 V;  4MLK A;  5BR8 T;  4B3S T;  5HCJ A;  4NXM T;  5HEH A;  3A7M A;  4JI8 T;  4NXN T;  4X1K E;  2J4G A;  2FJD A;  3TLV A;  2XQ7 A;  1MIV A;  2MPK A;  3N5L A;  3N2O A;  2KIN B;  1D1B A;  4ZI3 D;  3I1A A;  3KBT A;  5KDM C;  3UQ7 A;  3ZYK A;  3ZSS A;  2UUA T;  4UEL A;  1HTJ F;  2BS4 A;  4QXH B;  3QUJ A;  4AKL A;  5JDN A;  3PUG A;  3AAA B;  3RX6 A;  2VQF T;  2PG8 A;  3DJB A;  4HN9 A;  2PTF A;  2NWB A;  1KNZ A;  4L5G A;  1WRD A;  2E9X B;  5L3C B;  5FYM A;  3C98 B;  3IA3 A;  4QXC B;  4V1A v;  5LHG B;  1KF6 A;  3K1S A;  3K3N A;  1BR1 A;  5AQQ B;  2WDR A;  1M62 A;  2WM9 A;  3H3M A;  2JRK A;  3MK7 C;  3B13 A;  3RLF F;  3ZMZ B;  2UXN B;  3E08 A;  2EHO C;  2PBI A;  3KBU A;  1IJ5 A;  3GA8 A;  1OWA A;  2WU5 A;  3Q2M A;  4KBM B;  5LB7 B;  2NW9 A;  4EV6 A;  5JR9 C;  5LXT E;  3C4W A;  2LKH A;  5FMN A;  2V6Y B;  4YTN A;  3AE8 A;  1MIW A;  3PUZ F;  3T1H T;  5J2T E;  2X9W A;  5KMG P;  3HKD E;  2K3W A;  1N36 T;  1T98 A;  3PDY A;  4OX9 T;  2YEV C;  2X9Y A;  3L8R A;  4LFA T;  4FJO A;  4YHH T;  3GN5 B;  3LBX B;  4IDN A;  3ZPO A;  2R6G F;  4BAY B;  4K0U A;  4DID B;  2K5B B;  4C90 A;  4DMV A;  2Q9Q D;  2LRK A;  3FBL A;  3KV9 A;  3P50 A;  4OK0 A;  2V7M A;  2XQ5 A;  2WS3 A;  3PUS A;  2E9X A;  3UUB A;  2LOP A;  5LGU B;  5EK3 A;  2HPJ A;  3N9N A;  1SE7 A;  1MND A;  1KEY A;  4HFI A;  5AQT B;  2CLY C;  5ABG A;  3R84 B;  3K3Q C;  4KHZ F;  4UF0 A;  3V5U A;  3KV5 A;  2EHO A;  2XHE B;  4QH1 A;  3EI0 A;  5H6Q B;  5JDL A;  5FY7 A;  5LBQ B;  2ZM2 A;  4WNK A;  5HCM A;  3P4Q A;  2ZLY A;  1DU2 A;  4DV3 T;  2V6Y A;  1IZN B;  2V6X A;  2H3R A;  2RPA A;  3AB3 B;  3RH3 A;  2ES0 A;  2W62 A;  2V7L A;  3N9O A;  3PUR A;  4XZC A;  4AQG A;  3HR0 A;  3NVO A;  5CJ5 A;  1Y64 B;  4TWF A;  2MBG A;  2X68 A;  4DR1 T;  3M3Z B;  3EDU A;  5F8P A;  4TUY E;  1S35 A;  2D0T A;  1BR2 A;  2XAF B;  3HA4 A;  4LMJ A;  5TAO A;  1LKX A;  2CEA A;  2CXF A;  4Z90 A;  5FVL A;  2Y8D A;  3NWI A;  5LP6 E;  2FJE A;  2H7O A;  3HL6 A;  2M67 A;  3KIN B;  2LKG A;  4G63 A;  4L9I A;  4TN7 B;  2DWG A;  4IHJ E;  1D0Y A;  1FIO A;  3D0T A;  4JEU B;  4ZOL E;  1D0Z A;  2D2S A;  5AQG B;  3RC3 A;  2V7J A;  4GYR A;  3R6N A;  2EHO D;  3G06 A;  2BG9 A;  3LK4 2;  3UU6 A;  2D9D A;  1IAP A;  4DV6 T;  5JRC B;  3PJA J;  2VK9 A;  4HKA A;  1E7P A;  3CIR A;  4ZI2 C;  1FMW A;  1HFA A;  1WR0 A;  2QYW A;  4KI0 F;  4WBO A;  4EOZ B;  3T1Y T;  4XAX B;  3TLU A;  1ZOY A;  1KNP A;  3N9L A;  4IT4 A;  4DV0 T;  2M6I A;  1YXR A;  2JQK A;  3F57 A;  3UUN A;  4BJN A;  2JMH A;  1SA0 E;  4TWH A;  4HTE A;  3U78 A;  3KVA A;  2C5J A;  3VR8 A;  2WDQ A;  3C4Z A;  3M65 A;  1HG2 A;  2X9H A;  5LYJ E;  4DV1 T;  4LF6 T;  2H88 A;  3TLS A;  3UU4 A;  3ZC1 A;  3ZMU B;  5GON E;  3ANW B;  2BG9 E;  3FZM B;  3LFM A;  5L4H A;  4J2C A;  2XY8 B;  1YKE B;  3PJA A;  2BG9 B;  2FUP A;  4DR7 T;  4B3R T;  5CFB A;  2A72 A;  2NW8 A;  4U2Y A;  1V9D A;  3MKD A;  2BKP A;  4E7Z A;  4QH4 A;  2J1D G;  2WU2 A;  3CK6 A;  3CML A;  3PE0 A;  4FI5 A;  4H63 H;  3ZKR A;  4A97 A;  3BQL A;  4UVB B;  2L8K A;  1N33 T;  2LEH A;  3WAK A;  5DQW A;  4CZZ B;  3ZJ2 A;  3U3I A;  5EK2 A;  4IRE A;  2C0S A;  2RP4 A;  5JRE A;  2GK9 A;  2AXD S;  3HKC E;  5JQG E;  2UXD T;  3FZK B;  3UUX B;  4A98 A;  5C2T A;  1IBK T;  2YIN A;  2DLR A;  5HXC A;  4P0B A;  2N2N A;  2P9B A;  3ONX A;  3VU7 H;  4X62 T;  3I9W A;  4DO0 A;  2XUE A;  2LSI A;  5AQK B;  1D1C A;  2BKN A;  4JBW F;  2VKD A;  3UUL A;  5LA6 E;  4YXD A;  3AE7 A;  2ACX A;  2VAS A;  2ZM0 A;  2LM2 A;  4GOU A;  2K9A A;  3UU5 A;  5HXH A;  4QXB B;  3P7I A;  4CN4 A;  5EK4 A;  3DTO A;  3HKB E;  2KZ7 B;  3O1J A;  3RYI E;  3Q5W A;  3KVB A;  2JIW A;  3CWZ B;  5JDF A;  4IE5 A;  1JNR A;  2X0L B;  2VKO A;  2UXC T; 
#chains in the Genus database with same CATH homology
 4GK5 E;  5FXV A;  3ZEF B;  4QX8 B;  4G2A A;  2Z6E A;  3N2G E;  5CA0 E;  3F31 A;  1WYB A;  3ZMS B;  5LNK A;  2QGS A;  2B1E A;  5HXE A;  4O4H E;  3EVY A;  4JEH B;  2V26 A;  2Y48 B;  3BQK A;  3MAC A;  5L3G B;  2KND A;  4O8S A;  4OFZ A;  2DNX A;  3IF8 B;  2VB6 A;  2N9D A;  1MNE A;  4TX5 A;  2XAS B;  3Q9D A;  5LBM A;  2CLY B;  5L3B B;  4AKG A;  3Q5X A;  2VKH A;  1BR0 A;  3WI3 A;  1WLX A;  3PUA A;  3PU8 A;  4CI2 B;  4WW0 A;  2VWA A;  4N78 D;  3NZQ A;  1KNZ A;  1UX5 A;  2SPC A;  5HXR A;  4AI6 A;  4JUY A;  4AQF A;  3ANW A;  3J9X 1;  4H9O C;  1X79 A;  4ERR A;  4ASK A;  1HS7 A;  4PK5 A;  3ZCJ A;  1HF8 A;  1O3X A;  4PJN A;  3FXE B;  4IDZ A;  5LJN A;  5A1L A;  4DBR A;  1E1H B;  1NAF A;  5JR9 A;  3ZYM A;  2NP9 A;  3EDV A;  3RRC A;  4PJL A;  5DAB A;  3RYF E;  2YU1 A;  4YJ2 E;  4UEM A;  5FXZ A;  3ZLI A;  1LVK A;  5LHI B;  1MMN A;  4EZH A;  2C5I T;  2CWY A;  4PFO A;  3RKO A;  2XQY A;  2CMR A;  4UV8 B;  2XTL A;  5M4Y A;  1QSD A;  2OA5 A;  3ZCI A;  4EZ4 A;  4CXW A;  4CXX A;  1AJ3 A;  4EXT A;  1ZEE A;  2X67 A;  3MJX A;  4ZI2 D;  3H37 A;  4PAG A;  3ZC0 A;  5HAX A;  2IAK A;  4QHO A;  3ZYL A;  5CB4 E;  5FXX A;  3NRY A;  3AA1 B;  2IW5 B;  2W63 A;  3N9Q A;  4O2A E;  4IST A;  2E9X D;  3MXZ A;  3QC9 A;  2JJ9 A;  3PTR B;  5HWX A;  2LHR A;  4UVA B;  4ADZ A;  2NTX A;  4O2B E;  3UTK A;  3F2E A;  4H9P C;  2KXP B;  3LBX A;  4ZI7 E;  3FB2 A;  4WBN E;  2LT3 A;  3IBP A;  3RC8 A;  2X9X A;  3FBZ A;  3PU3 A;  3ETU A;  1G73 A;  2A2F X;  3AAI A;  5JR9 B;  1U5P A;  5H6R B;  3C64 A;  1HX8 A;  2LSJ A;  3NZP A;  4HFV A;  3PUQ A;  4TV9 E;  1D0X A;  4IE4 A;  3WAJ A;  3CQX C;  1ZHC A;  2N1G A;  1D1A A;  3L09 A;  4IE6 A;  3OKQ A;  2W0G A;  1MMA A;  3OBV E;  3KV6 A;  1YD8 G;  2E8I A;  1WYC A;  2KWI B;  1OXZ A;  1SHZ C;  4OYJ A;  4PJM A;  5LGN B;  4EIW A;  2LSG A;  4EYU A;  2ZM8 A;  1ZKE A;  3I0O A;  2RA1 A;  3ZN0 B;  5FNV E;  3BQI A;  5FY0 A;  3C51 A;  1FMV A;  2DCF A;  4ANJ A;  5JRC A;  1U4Q A;  3HI2 A;  5FY1 A;  4TV8 E;  2C5K T;  3IEE A;  5DQV A;  2MYS A;  3E0Z A;  3O1H A;  4I50 E;  1EZ3 A;  1LRZ A;  2E9X C;  3I0Q A;  1MMG A;  3IHR A;  1VOM A;  4OYK A;  4I43 B;  2I59 A;  2W00 A;  4CXY A;  3GWH A;  2LHN A;  2WWU A;  2XAQ B;  4B6X A;  2CXD A;  2UXX B;  4EYY R;  3O1I A;  5LOV E;  4YHJ A;  5LG4 A;  1ZV4 X;  4H9S E;  3FXD B;  3ZMV B;  2KLQ A;  3CQC B;  4MBQ A;  4E7S A;  3E22 E;  4H9Q C;  2HPL A;  3CKD A;  2LJL A;  3P8C D;  4I4T E;  1YW0 A;  4O4J E;  3JC6 D;  4MFR A;  4NUU A;  1Z0P A;  4AKI A;  4ISS A;  3KFW X;  3SWH A;  3LJC A;  4AXP A;  3ZJ1 A;  5L3F B;  3N9P A;  4EAH A;  3CX7 B;  2WSS V;  3HKE E;  5L3E B;  2VKJ A;  2XAG B;  4H9R C;  2CM0 A;  2K48 A;  2ZMA A;  2LSK A;  5JDQ A;  4PW8 A;  5JVD E;  5LGT B;  4BA9 A;  3ETV A;  1VRB A;  4P09 A;  4TZ4 C;  2VL8 A;  1HG5 A;  4A56 A;  3VKH A;  1NWM X;  3UFE A;  3RYH E;  4AKH A;  4UV9 B;  4DVD A;  5LJM A;  4YFS A;  4X20 E;  4F6R C;  3BK9 A;  5LHH B;  2X51 A;  2DI4 A;  2WAU A;  1US7 B;  4PJJ A;  3FHN A;  2MTQ A;  5J1G A;  4MAL A;  4DMW A;  2WMN A;  2PFV A;  4HE8 A;  2CXL A;  4BJM A;  2JQQ A;  3J7Y q;  4U74 A;  2KMF A;  1FEW A;  5EZY E;  2CWO A;  5AFU L;  1UCU A;  5J2U E;  2BVL A;  2H7V C;  3I9Y A;  4PK6 A;  4ZI3 C;  3MZK B;  4QX7 B;  1G8X A;  3C4X A;  3AA7 B;  5LCY A;  2W61 A;  2CA5 A;  4ZS3 A;  4DBQ A;  2PJQ A;  3OJA A;  3KV4 A;  4HGA A;  3SOL A;  4OHF A;  5LHG B;  3K8P C;  5IYZ E;  2DHR A;  3UT5 E;  5HXS A;  5FXW A;  5JDM A;  2QA7 A;  4KMC A;  1LVF A;  2V7I A;  3C50 A;  3AA6 B;  4UIG A;  3RYC E;  4XBF B;  4PNI A;  4AKR B;  4AQF C;  3W15 B;  4MHC A;  2ODU A;  5JH7 E;  2BVM A;  5C8Y E;  4ZHQ E;  2NTY A;  2ODV A;  3K3O A;  2LM9 A;  2KWH A;  2YU2 A;  2V7K A;  4YJ3 E;  2IC6 A;  3AVS A;  3SRZ A;  4JLE A;  2XAH B;  2L3L A;  3VHL A;  3DP7 A;  3ZN1 B;  2CCQ A;  2NW7 A;  3EUH A;  2X66 A;  2Q9Q C;  4IIJ E;  5IHY A;  3RRW A;  4QWN B;  3AVR A;  4I55 E;  2L9Q A;  2LSY A;  3CX8 B;  3OYX A;  4C91 A;  4HEA A;  4PFP A;  3MA9 A;  1UX4 A;  3S4U A;  3V5S A;  5DJQ C;  4ZS2 A;  2Q9Q A;  5ADX L;  2K24 A;  2MOZ A;  3L3P A;  5L2L A;  4GIW A;  5L3D B;  3GMI A;  4ILU A;  5HYA A;  1HCI A;  2EHO B;  2IC9 A;  3AAE B;  1YKH B;  5BMV E;  3O4X E;  3TKL B;  4GK0 E;  4KUM B;  3LK3 B;  5FP3 A;  3B57 A;  3UUM A;  2DWK A;  3RPU A;  2D0U A;  1B7T A;  2Y6X A;  2NOX A;  5JDG A;  4O4L E;  2BDE A;  3GN5 A;  3LK2 B;  3N2K E;  4YLH A;  4L0R A;  4X1Y E;  3CPZ A;  3CVR A;  1MMD A;  2HH7 A;  2BZB A;  4IE7 A;  3OYZ A;  5E0O A;  2JPF A;  2G0U A;  2A3D A;  2WBL A;  4PK4 A;  4UF0 B;  3JC6 C;  3CQG B;  1S94 A;  3NRX A;  3N9M A;  3AA0 B;  3KDS E;  4DND A;  1H7C A;  2KT9 A;  4CI1 B;  4M1P A;  3NBX X;  1BR4 A;  2YK0 A;  4IGU A;  4CI3 B;  4X1I E;  2Q9Q B;  1IJ6 A;  4IE0 A;  5CA1 E;  3ESL A;  2D5U A;  4CQI A;  4KP3 C;  3CX6 B;  5HWY A;  4O4I E;  2JMK A;  2XAJ B;  4UVC B;  2V1D B;  2LOS A;  3ZMT B;  5KX5 E;  4Z8X A;  4P0A A;  4NUV A;  2CE7 A;  4U72 A;  1KK7 A;  5JDH A;  3LG7 A;  4UXN B;  4GYS A;  1WR6 A;  3T8O A;  1CUN A;  4QKN A;  4EB6 E;  3O9X A;  3SS1 A;  3VKG A;  3A5X A;  5F3J A;  2WMO A;  1MIY A;  2LE8 A;  4H9N C;  1QUU A;  4MLK A;  3H3A A;  4H63 V;  4X1K E;  1MIV A;  3N5L A;  3N2O A;  2KIN B;  1D1B A;  4ZI3 D;  3I1A A;  3KBT A;  5KDM C;  3ZYK A;  4UEL A;  1HTJ F;  4QXH B;  3QUJ A;  4AKL A;  5JDN A;  3PUG A;  3AAA B;  3RX6 A;  2PG8 A;  3DJB A;  4HN9 A;  2NWB A;  4L5G A;  1WRD A;  2E9X B;  5L3C B;  5FYM A;  3C98 B;  4QXC B;  4V1A v;  3K3N A;  1BR1 A;  2WM9 A;  2JRK A;  3MK7 C;  3B13 A;  3ZMZ B;  2UXN B;  3E08 A;  2EHO C;  2PBI A;  3KBU A;  1IJ5 A;  3GA8 A;  1OWA A;  3Q2M A;  3ZPO A;  4KBM B;  2NW9 A;  5JR9 C;  5LXT E;  3C4W A;  5FMN A;  1MIW A;  5J2T E;  2X9W A;  5KMG P;  3HKD E;  1T98 A;  3PDY A;  2YEV C;  2X9Y A;  4FJO A;  3GN5 B;  3LBX B;  4BAY B;  4K0U A;  2K5B B;  4C90 A;  4DMV A;  2Q9Q D;  3KV9 A;  3FBL A;  4OK0 A;  2V7M A;  3PUS A;  2E9X A;  2LOP A;  5LGU B;  5EK3 A;  2HPJ A;  3N9N A;  1MND A;  2CLY C;  3R84 B;  3K3Q C;  4UF0 A;  3V5U A;  3KV5 A;  2EHO A;  2XHE B;  5H6Q B;  5JDL A;  5FY7 A;  5LBQ B;  2ZM2 A;  4WNK A;  2ZLY A;  1IZN B;  2H3R A;  3RH3 A;  3AB3 B;  4AQG A;  2ES0 A;  2W62 A;  2V7L A;  3N9O A;  3PUR A;  4XZC A;  3HR0 A;  1Y64 B;  2MBG A;  2X68 A;  3EDU A;  5F8P A;  4TUY E;  1S35 A;  2D0T A;  1BR2 A;  2XAF B;  3HA4 A;  5TAO A;  1LKX A;  2CEA A;  2CXF A;  5LP6 E;  2Y8D A;  2H7O A;  3HL6 A;  2M67 A;  3KIN B;  4G63 A;  4L9I A;  4TN7 B;  5ETW A;  2DWG A;  4IHJ E;  1D0Y A;  1FIO A;  3D0T A;  4JEU B;  4ZOL E;  1D0Z A;  2D2S A;  3RC3 A;  2V7J A;  4GYR A;  3R6N A;  2EHO D;  3LK4 2;  1IAP A;  5JRC B;  2VK9 A;  4HKA A;  4ZI2 C;  1FMW A;  1HFA A;  4WBO A;  4EOZ B;  4XAX B;  3N9L A;  3F57 A;  3UUN A;  4BJN A;  2JMH A;  1SA0 E;  4HTE A;  3U78 A;  3KVA A;  2C5J A;  3C4Z A;  3M65 A;  1HG2 A;  2X9H A;  5LYJ E;  3ZC1 A;  3ZMU B;  5GON E;  3ANW B;  3LFM A;  4J2C A;  1YKE B;  2A72 A;  2NW8 A;  1V9D A;  3MKD A;  4E7Z A;  2J1D G;  3PE0 A;  4FI5 A;  3CML A;  4H63 H;  3BQL A;  4UVB B;  2L8K A;  2LEH A;  3WAK A;  5DQW A;  4CZZ B;  3ZJ2 A;  3U3I A;  5EK2 A;  2C0S A;  2RP4 A;  5JRE A;  2GK9 A;  3HKC E;  5JQG E;  3UUX B;  2YIN A;  2DLR A;  5HXC A;  4P0B A;  2N2N A;  2P9B A;  3ONX A;  3VU7 H;  3I9W A;  4DO0 A;  2XUE A;  2LSI A;  3UUL A;  1D1C A;  2VKD A;  5LA6 E;  2ACX A;  2VAS A;  2ZM0 A;  4GOU A;  2K9A A;  5HXH A;  4QXB B;  3P7I A;  5EK4 A;  3DTO A;  3HKB E;  2KZ7 B;  3O1J A;  3RYI E;  3Q5W A;  3KVB A;  3CWZ B;  5JDF A;  4IE5 A;  3QK6 A;  2X0L B;  2VKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...