3J7Yq

Structure of the large ribosomal subunit from human mitochondria
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
128
structure length
128
Chain Sequence
b'YRARPPPRRRPGPRWPDPEDLLTPRWQLGPRYAAKQFARYGAASGVVPGSLWPSPEQLRELEAEEREWYPSLATMQESLRVKQLAEEQKRREREQHIAECMAKMPQMIVNWQQQQRENWEKAQADKER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Structure of the large ribosomal subunit from human mitochondria.
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
q PF10147 CR6_interact Growth arrest and DNA-damage-inducible proteins-interacting protein 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1430 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3j7yq00
3J7Yq 4V1Av
chains in the Genus database with same CATH superfamily
2JPFA 2K5BB 1H7CA 1QUUA 4WBNE 2NTYA 3AXJA 2W0GA 2Y6XA 3O9XA 4JI1T 2FJEA 3RGLA 4JEUB 4X66T 4HWHA 3HR0A 4N78D 3NZQA 3GMIA 3HKDE 4E7ZA 4ZHQE 4ZZBA 4PJNA 4ANJA 1T98A 3RI5A 4TUYE 3CQGB 1XDOA 2BS4A 2IC6A 5IYZE 2JQQA 3EABA 1ZHCA 4IDPA 2B76A 5L2LA 4LF8T 2FJBA 1E2AA 3N9OA 3TLTA 2YK0A 1HFAA 4YHHT 1OEDE 5KMGP 1MMAA 5DABA 2LE8A 4YSXA 1Z0PA 3N9MA 4IE7A 2XUEA 3FBZA 4TV9E 2BS2A 4U2YA 2LLYA 2V26A 4GK5E 3ESLA 5AQHB 5FNVE 5J2TE 4TWHA 3AE7A 2PFVA 4JI3T 2W63A 3L8RA 3KVBA 4PW8A 3T8OA 5LJNA 5ABHA 2XAQB 3AE8A 5J1GA 1U4QA 4GKKT 5CGMA 4H63V 4V1Av 3BQLA 3JCFA 2DLRA 3ZYMA 2IDOB 3M3ZB 4EZHA 4U2ZA 4QWNB 3PE0A 3UFEA 2X67A 5F5WA 2M6IA 1XDPA 1ZV4X 1D0XA 2N2NA 1WYBA 1EZ3A 3J9X1 2BG9E 3IA3A 4Z90A 3UUXB 3TKLB 2JQ9A 5F3JA 1UK5A 2W4XA 1Z8UA 4B3TT 5AQUB 3V5SA 5KDMC 2KZ7B 3PU3A 4GIWA 4DMWA 5AQFB 3ANWB 4P0AA 3HKCE 4HTEA 1J1JA 1US7B 2UUCT 3GN5B 3Q9DA 4AIUA 4DR5T 3G06A 4YSYA 4UXNB 5F8PA 4IE5A 2LKGA 4TN7B 1ZEEA 3X1DA 2LSKA 1N36T 1T72A 2QYWA 2VKOA 1S94A 3Q5DA 3OPCA 4HEAA 1WLXA 2MPKA 1LVFA 5FXWA 3OTOT 3DTOA 4GKJT 2XAJB 2DWGA 2H7OA 4LF5T 2LSYA 4EAHA 4PAGA 1W09A 4ILCA 3I1AA 4QH4A 4PNIA 3P8CD 3TLWA 2WY2A 3UU6A 1BR4A 3RF1A 4IE6A 5LNKA 4JI5T 4DV6T 3AA0B 1U5PA 2Q9QB 2QVAA 4AKRB 1X9BA 2X51A 1GQEA 3PTRB 4YJ3E 5CFBA 3PJAJ 3L09A 2HN1A 1AJ3A 3HI2A 2CXLA 4AKHA 4OYKA 5JR9A 4OK0A 4O4HE 2VL0A 4AQYT 2YDQA 3A5XA 4ZI3C 2LRLA 3GA8A 3AECA 3UU3A 2KWHA 2XQ3A 2KWIB 3AAAB 1BR1A 4X65T 3LBXB 3CX6B 3N9LA 4DNDA 3A8YC 4X1KE 2BKPA 4XBFB 4DV1T 4EYUA 2UXXB 4EXTA 1LKXA 4JBWF 3EHZA 4YXDA 4MLKA 5J2UE 1UX5A 1LRZA 4NXMT 4OHFA 3VKGA 4M1PA 2W66A 2EHOA 2N9DA 4CI3B 1VOMA 2V8SV 2IC9A 3UUNA 5LG3A 5AQTB 4LF6T 1IBLT 2D0TA 3SS1A 5AQPB 2LSJA 3OVUA 3BQKA 1MNDA 3N2KE 2E9XD 4UF0B 2HPJA 4H9OC 2LSIA 4JI0T 2KLQA 3VHLA 3RLFF 2XQ4A 5ABFA 1MIYA 5IUXA 5HWXA 2XQ6A 2KXPB 3HKEE 5LMNT 3RKGA 2LHNA 2V5DA 2VL8A 4F8HA 3DJBA 3Q5WA 2JQHA 2BDEA 5AQLB 5JDHA 5DJQC 4U31A 3A7MA 4JI6T 3IEEA 4CXWA 4YY3T 3IHRA 1G73A 2XAGB 2V7LA 3P4SA 3J7Yq 2VK9A 1MIVA 2DHRA 5FY0A 4X5TA 3P4RA 2Q9QD 2V6YB 2YDSA 3AE4A 3HA4A 4B3MT 3AEGA 4ZXLA 3N2OA 2JMHA 5HCJA 4PK4A 4AQFC 2Y48B 5AQVB 1KK7A 3VR8A 1J5WA 2JRKA 2E5LT 3M65A 3NWIA 2XAFB 4JUYA 3KBTA 1WRDA 4IIJE 2ACXA 5AQQB 2OV9A 2WS3A 5JQGE 2GK9A 5JDLA 4HE8A 3N5LA 4GOUA 4ZOLE 3SRZA 3UTKA 2W00A 1VCTA 5AQJB 4LMLA 4UEMA 3ONLC 3SFDA 4UIGA 1R8IA 3PU8A 2UXBT 2OA5A 2R6GF 2WCAA 3C50A 4EGWA 4QHOA 3ZYLA 3AEAA 3B57A 3E0ZA 5L3GB 3QB5A 5KXJA 1BR0A 4PFPA 3N9NA 1NENA 2YDRA 2UXNB 4L9IA 2KSRA 3MZKB 5E0OA 5FXZA 2BVMA 1Y01A 2XHEB 2WDQA 4C90A 4CI1B 2XM2A 3BK9A 4AXPA 3NRYA 1SA0E 5JREA 2CM0A 2OLTA 3FZMB 5LOVE 4TNWA 4G2AA 1QLBA 2LM9A 2HN2A 3I0OA 1OXZA 3ZMVB 2BVLA 5AQMB 4QKNA 2WZIA 4UELA 2LEHA 2C5JA 2W61A 2C5KT 3LJCA 1QSDA 3ANWA 3L39A 2HHHT 3WI3A 4CN6A 5L3FB 3GN5A 2MBGA 4WYVA 4WBOA 1YQ3A 1DU2A 5M4YA 3Q2MA 4DV4T 4JI2T 4DV3T 1MIWA 1WR0A 4A56A 4KX6A 3RIAA 1ZOYA 2CMRA 4HWIB 2A3DA 2I6HA 2PJQA 3AVRA 4X64T 2VKHA 4K0KT 2LRKA 5DQWA 5IHYA 4MFRA 5FXXA 5C8YE 3OKQA 4NUVA 3KV4A 3CX8B 1UX4A 4QH5A 2LOSA 4BJMA 1G8XA 2ZLYA 3PUAA 2DL1A 2M6BA 5HEGA 1J5ET 2YU2A 3ABVA 3UQ7A 4DR1T 3FBLA 3AVSA 5DQVA 3TLUA 2Q9QA 1T8BA 3PJAA 3C98B 3FHNA 3AEFA 4LF4T 4HFCA 3ZYKA 2WP9A 4KBMB 3I9YA 4L0RA 1N34T 4LF7T 1WFDA 2SPCA 1HS7A 3ZT6A 3LG7A 1XZYA 4I55E 4Z8XA 5FYMA 2PBIA 2C5IT 3ZN0B 2UU9T 3H3AA 2V6XA 4JV5T 1IZNB 2L8KA 5FVKA 4IE0A 3LBXA 4IHJE 4GK0E 4UV9B 1YXRA 2VQFT 4PJJA 2CBIA 3CVRA 4O4IE 5HXSA 2Y8DA 4EZ4A 2VURA 3NRXA 2KNDA 2ZM0A 2CLYB 4KUMB 5FXVA 4KI0F 3F31A 5ADXL 4DUZT 3B5MA 2J4GA 5FMNA 2E9XB 5L4HA 4X62T 1HNXT 2MAWA 4JLEA 4IGUA 1IJ6A 2KMFA 2UUBT 3ZMTB 1OEDB 2F4VT 5JRCB 3T1YT 5AQSB 3ZPOA 3FZHB 1HNZT 5HXEA 2L9QA 5FP3A 4OFZA 2ES0A 4P1NA 3TLVA 1OWAA 3MXZA 2CLYC 1VRBA 3RH3A 2V7IA 1CHUA 3RPUA 4YHJA 3W15B 5JDGA 2JIWA 3OJAA 2E9XC 3C51A 3UU4A 2VWAA 1KFYA 2H3RA 3ONXA 3MKDA 3OYXA 4QH1A 3N9QA 3S4UA 3QOFA 1OEDC 3KFWX 5L3BB 1NWMX 3ZCJA 4AQFA 2ZM8A 4QXCB 2WMNA 3CX7B 3WAKA 4OX9T 4BAYB 1MMNA 2BKOA 4PJLA 2X9YA 3EVYA 3PUYF 3RKOA 2WDRA 3Q5EA 4K0UA 2BG9B 3JAEA 1NAFA 3AB3B 3PUGA 2V6YA 2XTLA 3MA9A 1HTJF 3UUMA 5EK4A 3UU8A 3L3PA 2Q9QC 3FB2A 5LB7B 1IAPA 3RX6A 4FJOA 2LM2A 5AQIB 1HCIA 3DP7A 4EEDA 1KNZA 3HKBE 2KINB 3NKZA 4DR3T 2VVNA 4COFA 5H6RB 2LOPA 2BG9C 5BMVE 3C4WA 2WWUA 1WYCA 1N33T 4YJ2E 2VASA 2P9BA 2WB5A 2IHR1 2IMLA 4ZI2D 5L3DB 4ZS3A 3LK42 4X1IE 2UXCT 2MOZA 5LA6E 1WCRA 4JI7T 3EDVA 3SFEA 2J62A 4KP3C 2XSBA 4H9QC 3HL6A 2JJ9A 1YKHB 3CQXC 2W2UA 4A97A 1D1AA 4CN4A 1FJGT 4DBRA 3RC8A 3GWHA 4B3RT 3UT5E 2I0MA 2X9HA 2D0UA 4O2AE 2BS3A 5LGNB 5AQNB 5HCMA 3ZSTA 2ACZA 3UULA 5JVDE 2WZHA 3C64A 3ETVA 5JDMA 5EK2A 3OBVE 2ZM2A 2YN6A 5L47A 3F2EA 4O4JE 3UQ4A 2J1DG 2K24A 3KV6A 4XAXB 5LP6E 2CXFA 3T1HT 4DV7T 2IW5B 4YSZA 3R6NA 2ODUA 4LMKA 4G63A 5LHHB 1JNZA 4IDZA 4AI6A 3EDUA 1UCUA 2FJAA 2XQAA 3P7IA 2YOEA 3K3NA 2Z6EA 3ZMUB 2PTFA 2CWOA 5J0ZA 2XQ7A 2BBHA 4XZCA 5JTGA 4ADZA 2YINA 1E7PA 2WM9A 3AA1B 3H3MA 2EHOB 1V9DA 2LHRA 3FZFB 2E2AA 3RYIE 5L3EB 4LMJA 5A1LA 5LHGB 2XQ9A 4NUUA 4I50E 2CRBA 1YD8G 3SWHA 2CHOA 4F6RC 4DUYT 3AAIA 5AQRB 4ASKA 2XQ8A 2VKDA 1KEYA 1W0BA 2QRXA 1O3XA 1FMVA 2HH7A 4LFBT 4PFOA 1S35A 3Q5XA 2WMOA 2A9UA 2D5UA 4KMCA 3PV0F 3OYZA 2CHNA 4NIQA 2MTQA 4E7SA 2K48A 3TLSA 2BZBA 2NTXA 4HFDA 4AISA 3UU5A 4IDNA 2AE9A 1D0ZA 2CPTA 5HXRA 4H9NC 4HKAA 3KV5A 2YU1A 2FUPA 4EV6A 4JI8T 3AEEA 3ZC0A 3LDQB 3VU7H 4TWFA 5FKYA 4HWCA 3MK7C 1MNEA 5FY1A 3MACA 2KT9A 1UGOA 2WQYA 3RIUC 2BBJA 4HFBA 4TZ4C 5HEOA 3ZSSA 2AXDS 3RYCE 4A5XA 4DIDB 2E9XA 5LGTB 1HG5A 4DR6T 2UXDT 3SOLA 4QXHB 3K3OA 2D2SA 5FVLA 3RQWA 5HEHA 2CXDA 1B7TA 1OEDA 4QX8B 4AKLA 2NWBA 4ZZCA 5JRCA 2XZEA 4C91A 2X0HA 4B3ST 3R84B 2A72A 3QNUA 1I6ZA 3QB5K 5LCYA 3ZKRA 3JAFA 5EK3A 4AQGA 5CA1E 4ISSA 4UVCB 5H6QB 3JADA 3RYFE 3D0TA 3LK2B 5LGUB 5HEUA 3O1IA 3ZCIA 2HPLA 5HWYA 4DV2T 1N32T 3CKDA 4JEHB 1I94T 3ZLIA 4TNVA 2EHOD 2XQ5A 1FIOA 1YW0A 1YKEB 4GYRA 5EZYE 1W9RA 2WU2A 4HFIA 1XWMA 3FXDB 2WWVA 4ISTA 3EI0A 5ETWA 1VCSA 2MYSA 4H9SE 4PK6A 1M7KA 2XQYA 3AE1A 2VQET 4HN9A 3K8PC 3I0QA 1HG2A 5CA0E 2BG9A 3RC3A 2VKJA 5JDQA 3IBPA 4HFEA 4DR4T 4H63H 2V7MA 2XSAA 2CE7A 3QUJA 4U7YA 2NW8A 4NPPA 1UURA 2ODVA 3JC6D 2W67A 3ZN1B 3K3QC 3CQCB 3CIRA 3RHWA 2M67A 4EB6E 4BJNA 3AAEB 4MBQA 5HXCA 1WR6A 3LK3B 4YTPA 2J47A 2LKHA 3AXJB 5BR8T 2JQKA 5GONE 2H88A 5LYJE 3EUHA 4ZS2A 3KV9A 1SUMB 4NXNT 4Z91A 2XJ7A 1HX1B 2DWKA 3RRCA 3LFMA 1HR0T 4EOZB 3ONJA 3PUVF 2WAUA 4U7IA 1IBMT 3E08A 5CB4E 1SE7A 4ZI2C 4UF0A 5LBQB 3AA6B 1JNRA 5LBMA 3ZJ1A 2E5VA 4ERRA 2X0YA 4KHZF 2WDVA 2LT3A 3KBUA 4CXXA 3P4WA 3FXEB 4KHPT 4PK5A 4LF9T 1BR2A 4QX7B 2X68A 4YT0A 3O1JA 5JDFA 4IT4A 2W62A 3ZEFB 4LFAT 2X0LB 4A98A 5LHIB 3KINB 4ZEYA 5C3JA 4YTMA 4DR2T 2V7JA 5FL1A 1X79A 5ABGA 4CZZB 3NVOA 5ABEA 4EEBA 1IBKT 3I9WA 2CWYA 2N1GA 2X66A 4J2CA 2L3LA 3H37A 4O4LE 1XMQT 3E22E 4IDQA 1HNWT 5L3CB 3ETUA 5IWAT 4EYYR 4DBQA 3WAJA 4CQIA 3AE5A 4AKIA 2H89A 2RPAA 5L4EA 5AQKB 2XY8B 3RYHE 2NW7A 2LJLA 1LVKA 5FY7A 4DV0T 2NP9A 2FJDA 4DR7T 4WNKA 5AQGB 1NEKA 2XAHB 4UVAB 3NZPA 2B1EA 4YLHA 2JMKA 4DV5T 3KDSE 2DNXA 2XM1A 1XMOT 3LSVA 1MMDA 2PG8A 2X9WA 2C0SA 4YFSA 3ZJ2A 3U3IA 4O2BE 4TV8E 4X1YE 2XASB 3O1HA 4I43B 3PUZF 1FMWA 2UUAT 4X20E 2H7VC 2FBWA 3IF8B 5AQOB 2YEVC 3VKHA 4IREA 2K9AA 4WZXA 2ZMAA 3MJXA 1KNPA 2G0UA 3RQUA 2WSSV 3AE9A 4HFVA 1UUSA 4CN1A 1M62A 4EIWA 4U3CA 5HYAA 5HXHA 3RRWA 4DMVA 4ILBA 3UFGA 1XNRT 4I4TE 1MMGA 4PJMA 4UR9A 1KNRA 4OYJA 5LJMA 4QXBB 3ZT7A 3ZMSB 4DO0A 3ZC1A 3CMLA 5JDNA 1CUNA 3EAMA 3N9PA 3P50A 2CEAA 2D9DA 2RA1A 4IDOA 1YQ4A 2DCFA 4HWDA 3QC9A 4WW0A 4U74A 3RIFA 4U72A 5AFUL 2IAKA 4IL4A 4UV8B 4IE4A 4GYSA 5KX5E 3VR9A 1E1HB 3RIUA 4AKGA 2ZM6T 3AA7B 3VRAA 3P4QA 2K3WA 5C2TA 2I59A 3C4XA 4ZI3D 5LXTE 3O4XE 4CI2B 5JR9B 2VB6A 3C4ZA 3V5UA 3FZKB 4L5GA 5FL0A 2V1DB 4TX5A 4ILAA 2X9XA 3U78A 1SHZC 4CXYA 4HFHA 3ZT5A 3N2GE 1ZKEA 2LSGA 2QA7A 3PURA 5LMUT 3B13A 4U33A 1D1BA 2CBJA 2CCQA 4O8SA 5HEJA 2YKSA 4BA9A 4I0UA 3FZLB 4Q25A 1W0AA 3UUBA 3AEDA 3ZMZB 4LFCT 2NW9A 1IJ5A 3CK6A 3K1SA 3P4PA 5JR9C 4ILUA 2WBLA 3CPZA 2IIUA 3AE3A 1D1CA 1D0YA 2DI4A 3BQIA 1L0VA 1Y64B 4MALA 3PUXF 2IUBA 1T7SA 3PUWF 2E8IA 2NOXA 1FEWA 3AE6A 4TWDA 1KF6A 2XPKA 2NR4A 3PUQA 2BKNA 3NBXX 3KVAA 4HWFA 4FI5A 2RP4A 2V5CA 5CJ5A 4DVDA 2QGSA 5JH7E 5HAXA 3VRBA 4HGAA 2EHOC 4JI4T 5ABFB 4JYAT 1XNQT 1ZP0A 2WU5A 2CA5A 4P09A 3QK6A 5LG4A 4P0BA 2V7KA 4B6XA 4UVBB 3AE2A 3F57A 4ZI7E 4IL9A 1HX8A 2A2FX 2VVSA 4H9PC 5TAOA 4YTNA 3AEBA 3PDYA 1HF8A 3CWZB 3PUSA 4MHCA 3JC6C 4H9RC
chains in the Genus database with same CATH topology
2JPFA 3AAEB 2K5BB 4MBQA 5HXCA 1WR6A 3FB2A 1H7CA 3LK3B 1QUUA 1IAPA 3RX6A 4WBNE 2NTYA 3N2OA 2JMHA 4FJOA 4PK4A 4AQFC 2Y48B 2W0GA 2Y6XA 1HCIA 3DP7A 3O9XA 1KK7A 1KNZA 2JRKA 3HKBE 2KINB 4JEUB 5GONE 3HR0A 3M65A 5LYJE 4N78D 3NZQA 2XAFB 3EUHA 3GMIA 4ZS2A 5H6RB 3HKDE 3KV9A 2LOPA 3KBTA 1WRDA 4JUYA 4E7ZA 4ZHQE 4IIJE 2ACXA 4PJNA 5BMVE 3C4WA 2WWUA 4ANJA 2GK9A 5JDLA 5JQGE 1T98A 4HE8A 3N5LA 2DWKA 4TUYE 1WYCA 3RRCA 4GOUA 4YJ2E 3CQGB 2VASA 3LFMA 4ZOLE 4EOZB 2IC6A 5IYZE 2P9BA 2JQQA 3SRZA 2WAUA 1ZHCA 4ZI2D 3UTKA 2W00A 5L3DB 4ZS3A 3E08A 5CB4E 3LK42 5L2LA 4UEMA 4ZI2C 4X1IE 2MOZA 4UF0A 5LA6E 5LBQB 3AA6B 3EDVA 5LBMA 4UIGA 3ZJ1A 3N9OA 4KP3C 4ERRA 3PU8A 2YK0A 2OA5A 4H9QC 1HFAA 3HL6A 2LT3A 3C50A 5KMGP 3KBUA 4CXXA 1MMAA 5DABA 2LE8A 3FXEB 4QHOA 2JJ9A 1YKHB 1Z0PA 3CQXC 3N9MA 4PK5A 4IE7A 1D1AA 3ZYLA 1BR2A 4DBRA 2XUEA 3RC8A 4QX7B 3GWHA 3B57A 3FBZA 2X68A 4TV9E 3O1JA 5JDFA 3UT5E 3E0ZA 5L3GB 2W62A 2V26A 4GK5E 3ESLA 3ZEFB 5FNVE 2X9HA 2X0LB 2D0UA 5LHIB 1BR0A 4PFPA 3KINB 3N9NA 4O2AE 5LGNB 2UXNB 5J2TE 2V7JA 4L9IA 1X79A 3MZKB 5FXZA 5E0OA 5JVDE 3UULA 2PFVA 2BVMA 2W63A 4CZZB 2XHEB 3C64A 3ETVA 3KVBA 4PW8A 3T8OA 5JDMA 5LJNA 4C90A 2XAQB 4CI1B 3BK9A 5EK2A 3I9WA 2CWYA 2N1GA 1U4QA 5J1GA 2X66A 4J2CA 2L3LA 3H37A 4O4LE 4AXPA 4H63V 4V1Av 3BQLA 3E22E 3NRYA 2ZM2A 3OBVE 2DLRA 3ZYMA 5L3CB 1SA0E 3ETUA 5JREA 3F2EA 4O4JE 2J1DG 2K24A 4EYYR 4EZHA 4QWNB 2CM0A 4DBQA 3WAJA 3PE0A 4CQIA 4AKIA 3KV6A 3UFEA 4XAXB 5LOVE 2X67A 5LP6E 2CXFA 4G2AA 3RYHE 2NW7A 2LJLA 1ZV4X 1D0XA 1LVKA 2N2NA 1WYBA 5FY7A 1EZ3A 2NP9A 2LM9A 3I0OA 3J9X1 1OXZA 4WNKA 2IW5B 3ZMVB 2BVLA 2XAHB 4UVAB 4QKNA 3R6NA 2ODUA 2B1EA 3NZPA 3UUXB 4YLHA 2JMKA 4UELA 3TKLB 3KDSE 2DNXA 4G63A 5LHHB 4IDZA 2LEHA 4AI6A 3EDUA 5F3JA 2C5JA 1MMDA 1UCUA 2PG8A 2X9WA 2W61A 2C0SA 4YFSA 3ZJ2A 3U3IA 2C5KT 3LJCA 1QSDA 3V5SA 3ANWA 4O2BE 5KDMC 2KZ7B 3PU3A 3P7IA 4GIWA 4TV8E 4X1YE 4DMWA 2XASB 3O1HA 4I43B 3WI3A 5L3FB 3ANWB 3GN5A 3K3NA 2MBGA 4P0AA 1FMWA 3HKCE 4HTEA 2Z6EA 4WBOA 1US7B 3ZMUB 4X20E 2CWOA 5M4YA 3GN5B 2H7VC 3Q2MA 3Q9DA 3IF8B 2YEVC 1MIWA 3VKHA 2K9AA 4XZCA 4A56A 4ADZA 2CMRA 2ZMAA 4UXNB 2YINA 3MJXA 5F8PA 2G0UA 2A3DA 2WSSV 4IE5A 2WM9A 4HFVA 4TN7B 3AA1B 1ZEEA 4EIWA 2EHOB 1V9DA 5HYAA 5HXHA 2LSKA 2PJQA 3AVRA 2VKOA 2LHRA 1S94A 3RRWA 2VKHA 4DMVA 3RYIE 5L3EB 5A1LA 5LHGB 4HEAA 4I4TE 1MMGA 4NUUA 4PJMA 4I50E 1WLXA 5DQWA 4OYJA 1LVFA 5FXWA 5LJMA 3DTOA 4QXBB 5IHYA 3ZMSB 1YD8G 3SWHA 2XAJB 4MFRA 4DO0A 2DWGA 2H7OA 3ZC1A 2LSYA 4F6RC 3CMLA 3AAIA 5FXXA 4EAHA 5C8YE 3OKQA 4NUVA 5JDNA 1CUNA 4ASKA 2VKDA 4PAGA 3KV4A 3N9PA 3I1AA 4PNIA 2CEAA 3CX8B 3P8CD 1UX4A 2RA1A 2LOSA 4BJMA 1G8XA 2ZLYA 1BR4A 2DCFA 3PUAA 4IE6A 1O3XA 2YU2A 5LNKA 1FMVA 3QC9A 2HH7A 3FBLA 3AVSA 4WW0A 5DQVA 4PFOA 2Q9QA 3AA0B 1S35A 4U74A 3Q5XA 2WMOA 2D5UA 3C98B 4U72A 2IAKA 3FHNA 5AFUL 1U5PA 2Q9QB 4KMCA 4UV8B 4AKRB 4IE4A 4GYSA 3OYZA 3ZYKA 2X51A 3PTRB 4YJ3E 5KX5E 1E1HB 2MTQA 3L09A 4AKGA 4KBMB 3I9YA 2K48A 4L0RA 4E7SA 3AA7B 1AJ3A 3HI2A 2CXLA 2SPCA 1HS7A 4AKHA 3LG7A 2BZBA 2NTXA 4I55E 4Z8XA 5FYMA 2I59A 3C4XA 2PBIA 4OYKA 2C5IT 5JR9A 4ZI3D 5LXTE 3O4XE 4OK0A 4CI2B 4O4HE 3ZN0B 1D0ZA 5HXRA 4H9NC 5JR9B 3A5XA 3H3AA 4ZI3C 1IZNB 2VB6A 2L8KA 3GA8A 3C4ZA 4HKAA 3KV5A 3V5UA 2KWHA 4L5GA 2YU1A 4IE0A 2KWIB 3AAAB 3LBXA 1BR1A 2V1DB 4TX5A 4IHJE 3U78A 2X9XA 1SHZC 3LBXB 4GK0E 4UV9B 4CXYA 3CX6B 3N9LA 4DNDA 4PJJA 3ZC0A 3CVRA 1ZKEA 2LSGA 2QA7A 3N2GE 3PURA 3VU7H 4O4IE 5HXSA 3B13A 3MK7C 4X1KE 1MNEA 5FY1A 1D1BA 4XBFB 2Y8DA 4EZ4A 2CCQA 4EYUA 3MACA 2UXXB 4EXTA 1LKXA 2KT9A 3NRXA 2KNDA 4O8SA 2ZM0A 4BA9A 4TZ4C 2CLYB 4KUMB 5FXVA 3F31A 3RYCE 5ADXL 3ZMZB 2E9XA 2NW9A 4MLKA 1IJ5A 5FMNA 5J2UE 5LGTB 1HG5A 1UX5A 2E9XB 1LRZA 3SOLA 4QXHB 5JR9C 3K3OA 4ILUA 4OHFA 2WBLA 2D2SA 4JLEA 3VKGA 3CPZA 4M1PA 2EHOA 2N9DA 1IJ6A 1VOMA 1B7TA 2CXDA 2KMFA 4IGUA 4CI3B 2IC9A 3UUNA 1D1CA 1D0YA 4QX8B 4AKLA 2NWBA 2DI4A 3BQIA 1Y64B 5JRCA 3ZMTB 4MALA 4C91A 2E8IA 2NOXA 3R84B 5JRCB 1FEWA 3ZPOA 2D0TA 2A72A 3SS1A 2LSJA 5HXEA 2L9QA 5FP3A 3BQKA 4OFZA 2ES0A 5LCYA 1MNDA 1OWAA 5EK3A 3MXZA 2CLYC 4AQGA 5CA1E 4ISSA 1VRBA 3PUQA 3N2KE 2E9XD 4UF0B 2V7IA 4UVCB 5H6QB 3RH3A 3RYFE 3D0TA 3LK2B 3RPUA 5LGUB 4YHJA 2HPJA 3W15B 3O1IA 4H9OC 3ZCIA 3NBXX 5JDGA 2HPLA 5HWYA 2LSIA 3OJAA 3KVAA 2KLQA 2E9XC 3CKDA 3C51A 4JEHB 3VHLA 4FI5A 2RP4A 3ZLIA 2VWAA 2EHOD 2H3RA 2QGSA 4DVDA 5JH7E 1MIYA 5HAXA 3ONXA 4HGAA 1FIOA 3MKDA 1YW0A 2EHOC 5HWXA 1YKEB 3OYXA 4GYRA 5EZYE 3N9QA 2KXPB 3FXDB 3S4UA 4ISTA 3HKEE 3KFWX 5L3BB 1NWMX 5ETWA 2LHNA 2CA5A 3ZCJA 2VL8A 2MYSA 4AQFA 3DJBA 2ZM8A 4H9SE 3Q5WA 4PK6A 4QXCB 2BDEA 2WMNA 3CX7B 3WAKA 2XQYA 4P09A 5JDHA 4HN9A 5DJQC 3K8PC 4BAYB 1MMNA 3QK6A 3IEEA 5LG4A 4PJLA 2X9YA 4CXWA 4P0BA 2V7KA 4B6XA 3EVYA 4UVBB 3RKOA 3I0QA 1HG2A 5CA0E 3IHRA 1G73A 3RC3A 2VKJA 5JDQA 3F57A 4ZI7E 2XAGB 2V7LA 3IBPA 1HX8A 4K0UA 2A2FX 3J7Yq 1NAFA 2VK9A 4BJNA 1MIVA 2DHRA 3AB3B 3PUGA 4H63H 5FY0A 2V7MA 2XTLA 2CE7A 3MA9A 3QUJA 4H9PC 1HTJF 2NW8A 2Q9QD 5TAOA 3UUMA 2ODVA 3JC6D 3PDYA 3ZN1B 1HF8A 5EK4A 3K3QC 3CWZB 3PUSA 3JC6C 3L3PA 2Q9QC 3CQCB 4MHCA 3HA4A 2M67A 4EB6E 4H9RC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7Y q;  4V1A v; 
#chains in the Genus database with same CATH topology
 2JPF A;  2K5B B;  1H7C A;  1QUU A;  4WBN E;  2NTY A;  3AXJ A;  2W0G A;  2Y6X A;  3O9X A;  4JI1 T;  2FJE A;  3RGL A;  4JEU B;  4X66 T;  4HWH A;  3HR0 A;  4N78 D;  3NZQ A;  3GMI A;  3HKD E;  4E7Z A;  4ZHQ E;  4ZZB A;  4PJN A;  4ANJ A;  1T98 A;  3RI5 A;  4TUY E;  3CQG B;  1XDO A;  2BS4 A;  2IC6 A;  5IYZ E;  2JQQ A;  3EAB A;  1ZHC A;  4IDP A;  2B76 A;  5L2L A;  4LF8 T;  2FJB A;  1E2A A;  3N9O A;  3TLT A;  2YK0 A;  1HFA A;  4YHH T;  1OED E;  5KMG P;  1MMA A;  5DAB A;  2LE8 A;  4YSX A;  1Z0P A;  3N9M A;  4IE7 A;  2XUE A;  3FBZ A;  4TV9 E;  2BS2 A;  4U2Y A;  2LLY A;  2V26 A;  4GK5 E;  3ESL A;  5AQH B;  5FNV E;  5J2T E;  4TWH A;  3AE7 A;  2PFV A;  4JI3 T;  2W63 A;  3L8R A;  3KVB A;  4PW8 A;  3T8O A;  5LJN A;  5ABH A;  2XAQ B;  3AE8 A;  5J1G A;  1U4Q A;  4GKK T;  5CGM A;  4H63 V;  4V1A v;  3BQL A;  3JCF A;  2DLR A;  3ZYM A;  2IDO B;  3M3Z B;  4EZH A;  4U2Z A;  4QWN B;  3PE0 A;  3UFE A;  2X67 A;  5F5W A;  2M6I A;  1XDP A;  1ZV4 X;  1D0X A;  2N2N A;  1WYB A;  1EZ3 A;  3J9X 1;  2BG9 E;  3IA3 A;  4Z90 A;  3UUX B;  3TKL B;  2JQ9 A;  5F3J A;  1UK5 A;  2W4X A;  1Z8U A;  4B3T T;  5AQU B;  3V5S A;  5KDM C;  2KZ7 B;  3PU3 A;  4GIW A;  4DMW A;  5AQF B;  3ANW B;  4P0A A;  3HKC E;  4HTE A;  1J1J A;  1US7 B;  2UUC T;  3GN5 B;  3Q9D A;  4AIU A;  4DR5 T;  3G06 A;  4YSY A;  4UXN B;  5F8P A;  4IE5 A;  2LKG A;  4TN7 B;  1ZEE A;  3X1D A;  2LSK A;  1N36 T;  1T72 A;  2QYW A;  2VKO A;  1S94 A;  3Q5D A;  3OPC A;  4HEA A;  1WLX A;  2MPK A;  1LVF A;  5FXW A;  3OTO T;  3DTO A;  4GKJ T;  2XAJ B;  2DWG A;  2H7O A;  4LF5 T;  2LSY A;  4EAH A;  4PAG A;  1W09 A;  4ILC A;  3I1A A;  4QH4 A;  4PNI A;  3P8C D;  3TLW A;  2WY2 A;  3UU6 A;  1BR4 A;  3RF1 A;  4IE6 A;  5LNK A;  4JI5 T;  4DV6 T;  3AA0 B;  1U5P A;  2Q9Q B;  2QVA A;  4AKR B;  1X9B A;  2X51 A;  1GQE A;  3PTR B;  4YJ3 E;  5CFB A;  3PJA J;  3L09 A;  2HN1 A;  1AJ3 A;  3HI2 A;  2CXL A;  4AKH A;  4OYK A;  5JR9 A;  4OK0 A;  4O4H E;  2VL0 A;  4AQY T;  2YDQ A;  3A5X A;  4ZI3 C;  2LRL A;  3GA8 A;  3AEC A;  3UU3 A;  2KWH A;  2XQ3 A;  2KWI B;  3AAA B;  1BR1 A;  4X65 T;  3LBX B;  3CX6 B;  3N9L A;  4DND A;  3A8Y C;  4X1K E;  2BKP A;  4XBF B;  4DV1 T;  4EYU A;  2UXX B;  4EXT A;  1LKX A;  4JBW F;  3EHZ A;  4YXD A;  4MLK A;  5J2U E;  1UX5 A;  1LRZ A;  4NXM T;  4OHF A;  3VKG A;  4M1P A;  2W66 A;  2EHO A;  2N9D A;  4CI3 B;  1VOM A;  2V8S V;  2IC9 A;  3UUN A;  5LG3 A;  5AQT B;  4LF6 T;  1IBL T;  2D0T A;  3SS1 A;  5AQP B;  2LSJ A;  3OVU A;  3BQK A;  1MND A;  3N2K E;  2E9X D;  4UF0 B;  2HPJ A;  4H9O C;  2LSI A;  4JI0 T;  2KLQ A;  3VHL A;  3RLF F;  2XQ4 A;  5ABF A;  1MIY A;  5IUX A;  5HWX A;  2XQ6 A;  2KXP B;  3HKE E;  5LMN T;  3RKG A;  2LHN A;  2V5D A;  2VL8 A;  4F8H A;  3DJB A;  3Q5W A;  2JQH A;  2BDE A;  5AQL B;  5JDH A;  5DJQ C;  4U31 A;  3A7M A;  4JI6 T;  3IEE A;  4CXW A;  4YY3 T;  3IHR A;  1G73 A;  2XAG B;  2V7L A;  3P4S A;  3J7Y q;  2VK9 A;  1MIV A;  2DHR A;  5FY0 A;  4X5T A;  3P4R A;  2Q9Q D;  2V6Y B;  2YDS A;  3AE4 A;  3HA4 A;  4B3M T;  3AEG A;  4ZXL A;  3N2O A;  2JMH A;  5HCJ A;  4PK4 A;  4AQF C;  2Y48 B;  5AQV B;  1KK7 A;  3VR8 A;  1J5W A;  2JRK A;  2E5L T;  3M65 A;  3NWI A;  2XAF B;  4JUY A;  3KBT A;  1WRD A;  4IIJ E;  2ACX A;  5AQQ B;  2OV9 A;  2WS3 A;  5JQG E;  2GK9 A;  5JDL A;  4HE8 A;  3N5L A;  4GOU A;  4ZOL E;  3SRZ A;  3UTK A;  2W00 A;  1VCT A;  5AQJ B;  4LML A;  4UEM A;  3ONL C;  3SFD A;  4UIG A;  1R8I A;  3PU8 A;  2UXB T;  2OA5 A;  2R6G F;  2WCA A;  3C50 A;  4EGW A;  4QHO A;  3ZYL A;  3AEA A;  3B57 A;  3E0Z A;  5L3G B;  3QB5 A;  5KXJ A;  1BR0 A;  4PFP A;  3N9N A;  1NEN A;  2YDR A;  2UXN B;  4L9I A;  2KSR A;  3MZK B;  5E0O A;  5FXZ A;  2BVM A;  1Y01 A;  2XHE B;  2WDQ A;  4C90 A;  4CI1 B;  2XM2 A;  3BK9 A;  4AXP A;  3NRY A;  1SA0 E;  5JRE A;  2CM0 A;  2OLT A;  3FZM B;  5LOV E;  4TNW A;  4G2A A;  1QLB A;  2LM9 A;  2HN2 A;  3I0O A;  1OXZ A;  3ZMV B;  2BVL A;  5AQM B;  4QKN A;  2WZI A;  4UEL A;  2LEH A;  2C5J A;  2W61 A;  2C5K T;  3LJC A;  1QSD A;  3ANW A;  3L39 A;  2HHH T;  3WI3 A;  4CN6 A;  5L3F B;  3GN5 A;  2MBG A;  4WYV A;  4WBO A;  1YQ3 A;  1DU2 A;  5M4Y A;  3Q2M A;  4DV4 T;  4JI2 T;  4DV3 T;  1MIW A;  1WR0 A;  4A56 A;  4KX6 A;  3RIA A;  1ZOY A;  2CMR A;  4HWI B;  2A3D A;  2I6H A;  2PJQ A;  3AVR A;  4X64 T;  2VKH A;  4K0K T;  2LRK A;  5DQW A;  5IHY A;  4MFR A;  5FXX A;  5C8Y E;  3OKQ A;  4NUV A;  3KV4 A;  3CX8 B;  1UX4 A;  4QH5 A;  2LOS A;  4BJM A;  1G8X A;  2ZLY A;  3PUA A;  2DL1 A;  2M6B A;  5HEG A;  1J5E T;  2YU2 A;  3ABV A;  3UQ7 A;  4DR1 T;  3FBL A;  3AVS A;  5DQV A;  3TLU A;  2Q9Q A;  1T8B A;  3PJA A;  3C98 B;  3FHN A;  3AEF A;  4LF4 T;  4HFC A;  3ZYK A;  2WP9 A;  4KBM B;  3I9Y A;  4L0R A;  1N34 T;  4LF7 T;  1WFD A;  2SPC A;  1HS7 A;  3ZT6 A;  3LG7 A;  1XZY A;  4I55 E;  4Z8X A;  5FYM A;  2PBI A;  2C5I T;  3ZN0 B;  2UU9 T;  3H3A A;  2V6X A;  4JV5 T;  1IZN B;  2L8K A;  5FVK A;  4IE0 A;  3LBX A;  4IHJ E;  4GK0 E;  4UV9 B;  1YXR A;  2VQF T;  4PJJ A;  2CBI A;  3CVR A;  4O4I E;  5HXS A;  2Y8D A;  4EZ4 A;  2VUR A;  3NRX A;  2KND A;  2ZM0 A;  2CLY B;  4KUM B;  5FXV A;  4KI0 F;  3F31 A;  5ADX L;  4DUZ T;  3B5M A;  2J4G A;  5FMN A;  2E9X B;  5L4H A;  4X62 T;  1HNX T;  2MAW A;  4JLE A;  4IGU A;  1IJ6 A;  2KMF A;  2UUB T;  3ZMT B;  1OED B;  2F4V T;  5JRC B;  3T1Y T;  5AQS B;  3ZPO A;  3FZH B;  1HNZ T;  5HXE A;  2L9Q A;  5FP3 A;  4OFZ A;  2ES0 A;  4P1N A;  3TLV A;  1OWA A;  3MXZ A;  2CLY C;  1VRB A;  3RH3 A;  2V7I A;  1CHU A;  3RPU A;  4YHJ A;  3W15 B;  5JDG A;  2JIW A;  3OJA A;  2E9X C;  3C51 A;  3UU4 A;  2VWA A;  1KFY A;  2H3R A;  3ONX A;  3MKD A;  3OYX A;  4QH1 A;  3N9Q A;  3S4U A;  3QOF A;  1OED C;  3KFW X;  5L3B B;  1NWM X;  3ZCJ A;  4AQF A;  2ZM8 A;  4QXC B;  2WMN A;  3CX7 B;  3WAK A;  4OX9 T;  4BAY B;  1MMN A;  2BKO A;  4PJL A;  2X9Y A;  3EVY A;  3PUY F;  3RKO A;  2WDR A;  3Q5E A;  4K0U A;  2BG9 B;  3JAE A;  1NAF A;  3AB3 B;  3PUG A;  2V6Y A;  2XTL A;  3MA9 A;  1HTJ F;  3UUM A;  5EK4 A;  3UU8 A;  3L3P A;  2Q9Q C;  3FB2 A;  5LB7 B;  1IAP A;  3RX6 A;  4FJO A;  2LM2 A;  5AQI B;  1HCI A;  3DP7 A;  4EED A;  1KNZ A;  3HKB E;  2KIN B;  3NKZ A;  4DR3 T;  2VVN A;  4COF A;  5H6R B;  2LOP A;  2BG9 C;  5BMV E;  3C4W A;  2WWU A;  1WYC A;  1N33 T;  4YJ2 E;  2VAS A;  2P9B A;  2WB5 A;  2IHR 1;  2IML A;  4ZI2 D;  5L3D B;  4ZS3 A;  3LK4 2;  4X1I E;  2UXC T;  2MOZ A;  5LA6 E;  1WCR A;  4JI7 T;  3EDV A;  3SFE A;  2J62 A;  4KP3 C;  2XSB A;  4H9Q C;  3HL6 A;  2JJ9 A;  1YKH B;  3CQX C;  2W2U A;  4A97 A;  1D1A A;  4CN4 A;  1FJG T;  4DBR A;  3RC8 A;  3GWH A;  4B3R T;  3UT5 E;  2I0M A;  2X9H A;  2D0U A;  4O2A E;  2BS3 A;  5LGN B;  5AQN B;  5HCM A;  3ZST A;  2ACZ A;  3UUL A;  5JVD E;  2WZH A;  3C64 A;  3ETV A;  5JDM A;  5EK2 A;  3OBV E;  2ZM2 A;  2YN6 A;  5L47 A;  3F2E A;  4O4J E;  3UQ4 A;  2J1D G;  2K24 A;  3KV6 A;  4XAX B;  5LP6 E;  2CXF A;  3T1H T;  4DV7 T;  2IW5 B;  4YSZ A;  3R6N A;  2ODU A;  4LMK A;  4G63 A;  5LHH B;  1JNZ A;  4IDZ A;  4AI6 A;  3EDU A;  1UCU A;  2FJA A;  2XQA A;  3P7I A;  2YOE A;  3K3N A;  2Z6E A;  3ZMU B;  2PTF A;  2CWO A;  5J0Z A;  2XQ7 A;  2BBH A;  4XZC A;  5JTG A;  4ADZ A;  2YIN A;  1E7P A;  2WM9 A;  3AA1 B;  3H3M A;  2EHO B;  1V9D A;  2LHR A;  3FZF B;  2E2A A;  3RYI E;  5L3E B;  4LMJ A;  5A1L A;  5LHG B;  2XQ9 A;  4NUU A;  4I50 E;  2CRB A;  1YD8 G;  3SWH A;  2CHO A;  4F6R C;  4DUY T;  3AAI A;  5AQR B;  4ASK A;  2XQ8 A;  2VKD A;  1KEY A;  1W0B A;  2QRX A;  1O3X A;  1FMV A;  2HH7 A;  4LFB T;  4PFO A;  1S35 A;  3Q5X A;  2WMO A;  2A9U A;  2D5U A;  4KMC A;  3PV0 F;  3OYZ A;  2CHN A;  4NIQ A;  2MTQ A;  4E7S A;  2K48 A;  3TLS A;  2BZB A;  2NTX A;  4HFD A;  4AIS A;  3UU5 A;  4IDN A;  2AE9 A;  1D0Z A;  2CPT A;  5HXR A;  4H9N C;  4HKA A;  3KV5 A;  2YU1 A;  2FUP A;  4EV6 A;  4JI8 T;  3AEE A;  3ZC0 A;  3LDQ B;  3VU7 H;  4TWF A;  5FKY A;  4HWC A;  3MK7 C;  1MNE A;  5FY1 A;  3MAC A;  2KT9 A;  1UGO A;  2WQY A;  3RIU C;  2BBJ A;  4HFB A;  4TZ4 C;  5HEO A;  3ZSS A;  2AXD S;  3RYC E;  4A5X A;  4DID B;  2E9X A;  5LGT B;  1HG5 A;  4DR6 T;  2UXD T;  3SOL A;  4QXH B;  3K3O A;  2D2S A;  5FVL A;  3RQW A;  5HEH A;  2CXD A;  1B7T A;  1OED A;  4QX8 B;  4AKL A;  2NWB A;  4ZZC A;  5JRC A;  2XZE A;  4C91 A;  2X0H A;  4B3S T;  3R84 B;  2A72 A;  3QNU A;  1I6Z A;  3QB5 K;  5LCY A;  3ZKR A;  3JAF A;  5EK3 A;  4AQG A;  5CA1 E;  4ISS A;  4UVC B;  5H6Q B;  3JAD A;  3RYF E;  3D0T A;  3LK2 B;  5LGU B;  5HEU A;  3O1I A;  3ZCI A;  2HPL A;  5HWY A;  4DV2 T;  1N32 T;  3CKD A;  4JEH B;  1I94 T;  3ZLI A;  4TNV A;  2EHO D;  2XQ5 A;  1FIO A;  1YW0 A;  1YKE B;  4GYR A;  5EZY E;  1W9R A;  2WU2 A;  4HFI A;  1XWM A;  3FXD B;  2WWV A;  4IST A;  3EI0 A;  5ETW A;  1VCS A;  2MYS A;  4H9S E;  4PK6 A;  1M7K A;  2XQY A;  3AE1 A;  2VQE T;  4HN9 A;  3K8P C;  3I0Q A;  1HG2 A;  5CA0 E;  2BG9 A;  3RC3 A;  2VKJ A;  5JDQ A;  3IBP A;  4HFE A;  4DR4 T;  4H63 H;  2V7M A;  2XSA A;  2CE7 A;  3QUJ A;  4U7Y A;  2NW8 A;  4NPP A;  1UUR A;  2ODV A;  3JC6 D;  2W67 A;  3ZN1 B;  3K3Q C;  3CQC B;  3CIR A;  3RHW A;  2M67 A;  4EB6 E;  4BJN A;  3AAE B;  4MBQ A;  5HXC A;  1WR6 A;  3LK3 B;  4YTP A;  2J47 A;  2LKH A;  3AXJ B;  5BR8 T;  2JQK A;  5GON E;  2H88 A;  5LYJ E;  3EUH A;  4ZS2 A;  3KV9 A;  1SUM B;  4NXN T;  4Z91 A;  2XJ7 A;  1HX1 B;  2DWK A;  3RRC A;  3LFM A;  1HR0 T;  4EOZ B;  3ONJ A;  3PUV F;  2WAU A;  4U7I A;  1IBM T;  3E08 A;  5CB4 E;  1SE7 A;  4ZI2 C;  4UF0 A;  5LBQ B;  3AA6 B;  1JNR A;  5LBM A;  3ZJ1 A;  2E5V A;  4ERR A;  2X0Y A;  4KHZ F;  2WDV A;  2LT3 A;  3KBU A;  4CXX A;  3P4W A;  3FXE B;  4KHP T;  4PK5 A;  4LF9 T;  1BR2 A;  4QX7 B;  2X68 A;  4YT0 A;  3O1J A;  5JDF A;  4IT4 A;  2W62 A;  3ZEF B;  4LFA T;  2X0L B;  4A98 A;  5LHI B;  3KIN B;  4ZEY A;  5C3J A;  4YTM A;  4DR2 T;  2V7J A;  5FL1 A;  1X79 A;  5ABG A;  4CZZ B;  3NVO A;  5ABE A;  4EEB A;  1IBK T;  3I9W A;  2CWY A;  2N1G A;  2X66 A;  4J2C A;  2L3L A;  3H37 A;  4O4L E;  1XMQ T;  3E22 E;  4IDQ A;  1HNW T;  5L3C B;  3ETU A;  5IWA T;  4EYY R;  4DBQ A;  3WAJ A;  4CQI A;  3AE5 A;  4AKI A;  2H89 A;  2RPA A;  5L4E A;  5AQK B;  2XY8 B;  3RYH E;  2NW7 A;  2LJL A;  1LVK A;  5FY7 A;  4DV0 T;  2NP9 A;  2FJD A;  4DR7 T;  4WNK A;  5AQG B;  1NEK A;  2XAH B;  4UVA B;  3NZP A;  2B1E A;  4YLH A;  2JMK A;  4DV5 T;  3KDS E;  2DNX A;  2XM1 A;  1XMO T;  3LSV A;  1MMD A;  2PG8 A;  2X9W A;  2C0S A;  4YFS A;  3ZJ2 A;  3U3I A;  4O2B E;  4TV8 E;  4X1Y E;  2XAS B;  3O1H A;  4I43 B;  3PUZ F;  1FMW A;  2UUA T;  4X20 E;  2H7V C;  2FBW A;  3IF8 B;  5AQO B;  2YEV C;  3VKH A;  4IRE A;  2K9A A;  4WZX A;  2ZMA A;  3MJX A;  1KNP A;  2G0U A;  3RQU A;  2WSS V;  3AE9 A;  4HFV A;  1UUS A;  4CN1 A;  1M62 A;  4EIW A;  4U3C A;  5HYA A;  5HXH A;  3RRW A;  4DMV A;  4ILB A;  3UFG A;  1XNR T;  4I4T E;  1MMG A;  4PJM A;  4UR9 A;  1KNR A;  4OYJ A;  5LJM A;  4QXB B;  3ZT7 A;  3ZMS B;  4DO0 A;  3ZC1 A;  3CML A;  5JDN A;  1CUN A;  3EAM A;  3N9P A;  3P50 A;  2CEA A;  2D9D A;  2RA1 A;  4IDO A;  1YQ4 A;  2DCF A;  4HWD A;  3QC9 A;  4WW0 A;  4U74 A;  3RIF A;  4U72 A;  5AFU L;  2IAK A;  4IL4 A;  4UV8 B;  4IE4 A;  4GYS A;  5KX5 E;  3VR9 A;  1E1H B;  3RIU A;  4AKG A;  2ZM6 T;  3AA7 B;  3VRA A;  3P4Q A;  2K3W A;  5C2T A;  2I59 A;  3C4X A;  4ZI3 D;  5LXT E;  3O4X E;  4CI2 B;  5JR9 B;  2VB6 A;  3C4Z A;  3V5U A;  3FZK B;  4L5G A;  5FL0 A;  2V1D B;  4TX5 A;  4ILA A;  2X9X A;  3U78 A;  1SHZ C;  4CXY A;  4HFH A;  3ZT5 A;  3N2G E;  1ZKE A;  2LSG A;  2QA7 A;  3PUR A;  5LMU T;  3B13 A;  4U33 A;  1D1B A;  2CBJ A;  2CCQ A;  4O8S A;  5HEJ A;  2YKS A;  4BA9 A;  4I0U A;  3FZL B;  4Q25 A;  1W0A A;  3UUB A;  3AED A;  3ZMZ B;  4LFC T;  2NW9 A;  1IJ5 A;  3CK6 A;  3K1S A;  3P4P A;  5JR9 C;  4ILU A;  2WBL A;  3CPZ A;  2IIU A;  3AE3 A;  1D1C A;  1D0Y A;  2DI4 A;  3BQI A;  1L0V A;  1Y64 B;  4MAL A;  3PUX F;  2IUB A;  1T7S A;  3PUW F;  2E8I A;  2NOX A;  1FEW A;  3AE6 A;  4TWD A;  1KF6 A;  2XPK A;  2NR4 A;  3PUQ A;  2BKN A;  3NBX X;  3KVA A;  4HWF A;  4FI5 A;  2RP4 A;  2V5C A;  5CJ5 A;  4DVD A;  2QGS A;  5JH7 E;  5HAX A;  3VRB A;  4HGA A;  2EHO C;  4JI4 T;  5ABF B;  4JYA T;  1XNQ T;  1ZP0 A;  2WU5 A;  2CA5 A;  4P09 A;  3QK6 A;  5LG4 A;  4P0B A;  2V7K A;  4B6X A;  4UVB B;  3AE2 A;  3F57 A;  4ZI7 E;  4IL9 A;  1HX8 A;  2A2F X;  2VVS A;  4H9P C;  5TAO A;  4YTN A;  3AEB A;  3PDY A;  1HF8 A;  3CWZ B;  3PUS A;  4MHC A;  3JC6 C;  4H9R C; 
#chains in the Genus database with same CATH homology
 2JPF A;  3AAE B;  2K5B B;  4MBQ A;  5HXC A;  1WR6 A;  3FB2 A;  1H7C A;  3LK3 B;  1QUU A;  1IAP A;  3RX6 A;  4WBN E;  2NTY A;  3N2O A;  2JMH A;  4FJO A;  4PK4 A;  4AQF C;  2Y48 B;  2W0G A;  2Y6X A;  1HCI A;  3DP7 A;  3O9X A;  1KK7 A;  1KNZ A;  2JRK A;  3HKB E;  2KIN B;  4JEU B;  5GON E;  3HR0 A;  3M65 A;  5LYJ E;  4N78 D;  3NZQ A;  2XAF B;  3EUH A;  3GMI A;  4ZS2 A;  5H6R B;  3HKD E;  3KV9 A;  2LOP A;  3KBT A;  1WRD A;  4JUY A;  4E7Z A;  4ZHQ E;  4IIJ E;  2ACX A;  4PJN A;  5BMV E;  3C4W A;  2WWU A;  4ANJ A;  2GK9 A;  5JDL A;  5JQG E;  1T98 A;  4HE8 A;  3N5L A;  2DWK A;  4TUY E;  1WYC A;  3RRC A;  4GOU A;  4YJ2 E;  3CQG B;  2VAS A;  3LFM A;  4ZOL E;  4EOZ B;  2IC6 A;  5IYZ E;  2P9B A;  2JQQ A;  3SRZ A;  2WAU A;  1ZHC A;  4ZI2 D;  3UTK A;  2W00 A;  5L3D B;  4ZS3 A;  3E08 A;  5CB4 E;  3LK4 2;  5L2L A;  4UEM A;  4ZI2 C;  4X1I E;  2MOZ A;  4UF0 A;  5LA6 E;  5LBQ B;  3AA6 B;  3EDV A;  5LBM A;  4UIG A;  3ZJ1 A;  3N9O A;  4KP3 C;  4ERR A;  3PU8 A;  2YK0 A;  2OA5 A;  4H9Q C;  1HFA A;  3HL6 A;  2LT3 A;  3C50 A;  5KMG P;  3KBU A;  4CXX A;  1MMA A;  5DAB A;  2LE8 A;  3FXE B;  4QHO A;  2JJ9 A;  1YKH B;  1Z0P A;  3CQX C;  3N9M A;  4PK5 A;  4IE7 A;  1D1A A;  3ZYL A;  1BR2 A;  4DBR A;  2XUE A;  3RC8 A;  4QX7 B;  3GWH A;  3B57 A;  3FBZ A;  2X68 A;  4TV9 E;  3O1J A;  5JDF A;  3UT5 E;  3E0Z A;  5L3G B;  2W62 A;  2V26 A;  4GK5 E;  3ESL A;  3ZEF B;  5FNV E;  2X9H A;  2X0L B;  2D0U A;  5LHI B;  1BR0 A;  4PFP A;  3KIN B;  3N9N A;  4O2A E;  5LGN B;  2UXN B;  5J2T E;  2V7J A;  4L9I A;  1X79 A;  3MZK B;  5FXZ A;  5E0O A;  5JVD E;  3UUL A;  2PFV A;  2BVM A;  2W63 A;  4CZZ B;  2XHE B;  3C64 A;  3ETV A;  3KVB A;  4PW8 A;  3T8O A;  5JDM A;  5LJN A;  4C90 A;  2XAQ B;  4CI1 B;  3BK9 A;  5EK2 A;  3I9W A;  2CWY A;  2N1G A;  1U4Q A;  5J1G A;  2X66 A;  4J2C A;  2L3L A;  3H37 A;  4O4L E;  4AXP A;  4H63 V;  4V1A v;  3BQL A;  3E22 E;  3NRY A;  2ZM2 A;  3OBV E;  2DLR A;  3ZYM A;  5L3C B;  1SA0 E;  3ETU A;  5JRE A;  3F2E A;  4O4J E;  2J1D G;  2K24 A;  4EYY R;  4EZH A;  4QWN B;  2CM0 A;  4DBQ A;  3WAJ A;  3PE0 A;  4CQI A;  4AKI A;  3KV6 A;  3UFE A;  4XAX B;  5LOV E;  2X67 A;  5LP6 E;  2CXF A;  4G2A A;  3RYH E;  2NW7 A;  2LJL A;  1ZV4 X;  1D0X A;  1LVK A;  2N2N A;  1WYB A;  5FY7 A;  1EZ3 A;  2NP9 A;  2LM9 A;  3I0O A;  3J9X 1;  1OXZ A;  4WNK A;  2IW5 B;  3ZMV B;  2BVL A;  2XAH B;  4UVA B;  4QKN A;  3R6N A;  2ODU A;  2B1E A;  3NZP A;  3UUX B;  4YLH A;  2JMK A;  4UEL A;  3TKL B;  3KDS E;  2DNX A;  4G63 A;  5LHH B;  4IDZ A;  2LEH A;  4AI6 A;  3EDU A;  5F3J A;  2C5J A;  1MMD A;  1UCU A;  2PG8 A;  2X9W A;  2W61 A;  2C0S A;  4YFS A;  3ZJ2 A;  3U3I A;  2C5K T;  3LJC A;  1QSD A;  3V5S A;  3ANW A;  4O2B E;  5KDM C;  2KZ7 B;  3PU3 A;  3P7I A;  4GIW A;  4TV8 E;  4X1Y E;  4DMW A;  2XAS B;  3O1H A;  4I43 B;  3WI3 A;  5L3F B;  3ANW B;  3GN5 A;  3K3N A;  2MBG A;  4P0A A;  1FMW A;  3HKC E;  4HTE A;  2Z6E A;  4WBO A;  1US7 B;  3ZMU B;  4X20 E;  2CWO A;  5M4Y A;  3GN5 B;  2H7V C;  3Q2M A;  3Q9D A;  3IF8 B;  2YEV C;  1MIW A;  3VKH A;  2K9A A;  4XZC A;  4A56 A;  4ADZ A;  2CMR A;  2ZMA A;  4UXN B;  2YIN A;  3MJX A;  5F8P A;  2G0U A;  2A3D A;  2WSS V;  4IE5 A;  2WM9 A;  4HFV A;  4TN7 B;  3AA1 B;  1ZEE A;  4EIW A;  2EHO B;  1V9D A;  5HYA A;  5HXH A;  2LSK A;  2PJQ A;  3AVR A;  2VKO A;  2LHR A;  1S94 A;  3RRW A;  2VKH A;  4DMV A;  3RYI E;  5L3E B;  5A1L A;  5LHG B;  4HEA A;  4I4T E;  1MMG A;  4NUU A;  4PJM A;  4I50 E;  1WLX A;  5DQW A;  4OYJ A;  1LVF A;  5FXW A;  5LJM A;  3DTO A;  4QXB B;  5IHY A;  3ZMS B;  1YD8 G;  3SWH A;  2XAJ B;  4MFR A;  4DO0 A;  2DWG A;  2H7O A;  3ZC1 A;  2LSY A;  4F6R C;  3CML A;  3AAI A;  5FXX A;  4EAH A;  5C8Y E;  3OKQ A;  4NUV A;  5JDN A;  1CUN A;  4ASK A;  2VKD A;  4PAG A;  3KV4 A;  3N9P A;  3I1A A;  4PNI A;  2CEA A;  3CX8 B;  3P8C D;  1UX4 A;  2RA1 A;  2LOS A;  4BJM A;  1G8X A;  2ZLY A;  1BR4 A;  2DCF A;  3PUA A;  4IE6 A;  1O3X A;  2YU2 A;  5LNK A;  1FMV A;  3QC9 A;  2HH7 A;  3FBL A;  3AVS A;  4WW0 A;  5DQV A;  4PFO A;  2Q9Q A;  3AA0 B;  1S35 A;  4U74 A;  3Q5X A;  2WMO A;  2D5U A;  3C98 B;  4U72 A;  2IAK A;  3FHN A;  5AFU L;  1U5P A;  2Q9Q B;  4KMC A;  4UV8 B;  4AKR B;  4IE4 A;  4GYS A;  3OYZ A;  3ZYK A;  2X51 A;  3PTR B;  4YJ3 E;  5KX5 E;  1E1H B;  2MTQ A;  3L09 A;  4AKG A;  4KBM B;  3I9Y A;  2K48 A;  4L0R A;  4E7S A;  3AA7 B;  1AJ3 A;  3HI2 A;  2CXL A;  2SPC A;  1HS7 A;  4AKH A;  3LG7 A;  2BZB A;  2NTX A;  4I55 E;  4Z8X A;  5FYM A;  2I59 A;  3C4X A;  2PBI A;  4OYK A;  2C5I T;  5JR9 A;  4ZI3 D;  5LXT E;  3O4X E;  4OK0 A;  4CI2 B;  4O4H E;  3ZN0 B;  1D0Z A;  5HXR A;  4H9N C;  5JR9 B;  3A5X A;  3H3A A;  4ZI3 C;  1IZN B;  2VB6 A;  2L8K A;  3GA8 A;  3C4Z A;  4HKA A;  3KV5 A;  3V5U A;  2KWH A;  4L5G A;  2YU1 A;  4IE0 A;  2KWI B;  3AAA B;  3LBX A;  1BR1 A;  2V1D B;  4TX5 A;  4IHJ E;  3U78 A;  2X9X A;  1SHZ C;  3LBX B;  4GK0 E;  4UV9 B;  4CXY A;  3CX6 B;  3N9L A;  4DND A;  4PJJ A;  3ZC0 A;  3CVR A;  1ZKE A;  2LSG A;  2QA7 A;  3N2G E;  3PUR A;  3VU7 H;  4O4I E;  5HXS A;  3B13 A;  3MK7 C;  4X1K E;  1MNE A;  5FY1 A;  1D1B A;  4XBF B;  2Y8D A;  4EZ4 A;  2CCQ A;  4EYU A;  3MAC A;  2UXX B;  4EXT A;  1LKX A;  2KT9 A;  3NRX A;  2KND A;  4O8S A;  2ZM0 A;  4BA9 A;  4TZ4 C;  2CLY B;  4KUM B;  5FXV A;  3F31 A;  3RYC E;  5ADX L;  3ZMZ B;  2E9X A;  2NW9 A;  4MLK A;  1IJ5 A;  5FMN A;  5J2U E;  5LGT B;  1HG5 A;  1UX5 A;  2E9X B;  1LRZ A;  3SOL A;  4QXH B;  5JR9 C;  3K3O A;  4ILU A;  4OHF A;  2WBL A;  2D2S A;  4JLE A;  3VKG A;  3CPZ A;  4M1P A;  2EHO A;  2N9D A;  1IJ6 A;  1VOM A;  1B7T A;  2CXD A;  2KMF A;  4IGU A;  4CI3 B;  2IC9 A;  3UUN A;  1D1C A;  1D0Y A;  4QX8 B;  4AKL A;  2NWB A;  2DI4 A;  3BQI A;  1Y64 B;  5JRC A;  3ZMT B;  4MAL A;  4C91 A;  2E8I A;  2NOX A;  3R84 B;  5JRC B;  1FEW A;  3ZPO A;  2D0T A;  2A72 A;  3SS1 A;  2LSJ A;  5HXE A;  2L9Q A;  5FP3 A;  3BQK A;  4OFZ A;  2ES0 A;  5LCY A;  1MND A;  1OWA A;  5EK3 A;  3MXZ A;  2CLY C;  4AQG A;  5CA1 E;  4ISS A;  1VRB A;  3PUQ A;  3N2K E;  2E9X D;  4UF0 B;  2V7I A;  4UVC B;  5H6Q B;  3RH3 A;  3RYF E;  3D0T A;  3LK2 B;  3RPU A;  5LGU B;  4YHJ A;  2HPJ A;  3W15 B;  3O1I A;  4H9O C;  3ZCI A;  3NBX X;  5JDG A;  2HPL A;  5HWY A;  2LSI A;  3OJA A;  3KVA A;  2KLQ A;  2E9X C;  3CKD A;  3C51 A;  4JEH B;  3VHL A;  4FI5 A;  2RP4 A;  3ZLI A;  2VWA A;  2EHO D;  2H3R A;  2QGS A;  4DVD A;  5JH7 E;  1MIY A;  5HAX A;  3ONX A;  4HGA A;  1FIO A;  3MKD A;  1YW0 A;  2EHO C;  5HWX A;  1YKE B;  3OYX A;  4GYR A;  5EZY E;  3N9Q A;  2KXP B;  3FXD B;  3S4U A;  4IST A;  3HKE E;  3KFW X;  5L3B B;  1NWM X;  5ETW A;  2LHN A;  2CA5 A;  3ZCJ A;  2VL8 A;  2MYS A;  4AQF A;  3DJB A;  2ZM8 A;  4H9S E;  3Q5W A;  4PK6 A;  4QXC B;  2BDE A;  2WMN A;  3CX7 B;  3WAK A;  2XQY A;  4P09 A;  5JDH A;  4HN9 A;  5DJQ C;  3K8P C;  4BAY B;  1MMN A;  3QK6 A;  3IEE A;  5LG4 A;  4PJL A;  2X9Y A;  4CXW A;  4P0B A;  2V7K A;  4B6X A;  3EVY A;  4UVB B;  3RKO A;  3I0Q A;  1HG2 A;  5CA0 E;  3IHR A;  1G73 A;  3RC3 A;  2VKJ A;  5JDQ A;  3F57 A;  4ZI7 E;  2XAG B;  2V7L A;  3IBP A;  1HX8 A;  4K0U A;  2A2F X;  3J7Y q;  1NAF A;  2VK9 A;  4BJN A;  1MIV A;  2DHR A;  3AB3 B;  3PUG A;  4H63 H;  5FY0 A;  2V7M A;  2XTL A;  2CE7 A;  3MA9 A;  3QUJ A;  4H9P C;  1HTJ F;  2NW8 A;  2Q9Q D;  5TAO A;  3UUM A;  2ODV A;  3JC6 D;  3PDY A;  3ZN1 B;  1HF8 A;  5EK4 A;  3K3Q C;  3CWZ B;  3PUS A;  3JC6 C;  3L3P A;  2Q9Q C;  3CQC B;  4MHC A;  3HA4 A;  2M67 A;  4EB6 E;  4H9R C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...