3J7Yq

Structure of the large ribosomal subunit from human mitochondria
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
128
structure length
128
Chain Sequence
b'YRARPPPRRRPGPRWPDPEDLLTPRWQLGPRYAAKQFARYGAASGVVPGSLWPSPEQLRELEAEEREWYPSLATMQESLRVKQLAEEQKRREREQHIAECMAKMPQMIVNWQQQQRENWEKAQADKER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
publication title Structure of the large ribosomal subunit from human mitochondria.
pubmed doi rcsb
total genus 35
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
q PF10147 CR6_interact Growth arrest and DNA-damage-inducible proteins-interacting protein 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1430 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3j7yq00
3J7Yq 4V1Av
chains in the Genus database with same CATH superfamily
1HG2A 1KNRA 3TLSA 4X66T 2MYSA 3N9QA 3O1IA 1HNXT 4MALA 5HXEA 1J5WA 1S35A 1R8IA 5LA6E 4ZZBA 3CX8B 2JQQA 5F3JA 4X1KE 1OEDB 3IHRA 5LXTE 4AIUA 2Z6EA 5AQNB 4B3MT 1NENA 2YDSA 1MMAA 1BR0A 5AQQB 3AE9A 5EK3A 3UFEA 1HG5A 2MBGA 3I0OA 1XZYA 1HX1B 1I6ZA 4Z90A 2WY2A 2H88A 2FUPA 5FP3A 3LBXB 3O9XA 4YJ3E 1U4QA 2Q9QC 1OWAA 3V5SA 3ZT7A 4DIDB 5ETWA 4ERRA 5L3FB 2XQAA 5CFBA 2DWKA 1VCTA 2LSKA 1US7B 2W66A 1Y64B 3HI2A 4PK6A 4PJLA 1NAFA 4ZS2A 5F5WA 5FL0A 4ZZCA 1XMQT 2BZBA 3FBZA 2X9WA 2WU2A 3CQXC 2N1GA 3CMLA 4WW0A 4EB6E 3AA6B 1M7KA 4XBFB 4I43B 4A5XA 4U2YA 3I9YA 4IREA 1IBMT 5JRCA 3DTOA 5FXXA 1H7CA 3P8CD 4DV2T 2XUEA 3UU6A 3GN5B 4UR9A 5DJQC 1OEDA 3KVAA 3RH3A 2ZM8A 4ZHQE 5BR8T 4H9QC 2A2FX 1SUMB 3JAEA 1KEYA 5JR9B 5KDMC 4UELA 2NW7A 1WFDA 4HE8A 3E22E 2IC6A 3F31A 5H6QB 3RIUA 2ZLYA 3NRYA 4EAHA 2J4GA 3HA4A 3FBLA 3P4RA 3ZPOA 2D5UA 3N9PA 4EZHA 1WRDA 3RGLA 1MIYA 2CCQA 4H9NC 5AQJB 1QSDA 4A98A 4ZI7E 1ZEEA 2L8KA 3C4XA 2UXXB 4X20E 3AE7A 4ILBA 4IDOA 3NBXX 2H89A 2NTXA 2IMLA 3AEAA 4JEUB 4UV9B 2LRKA 2UXNB 1HFAA 3QC9A 4HEAA 2PBIA 2V6XA 5JR9C 4A97A 3Q5XA 2VQET 3PTRB 3C64A 3SRZA 3ZSTA 3VR8A 4TV9E 2PJQA 2NTYA 5BMVE 5EZYE 3L3PA 1LVKA 5L3BB 3N2GE 4YTMA 2KZ7B 2BBJA 2JMHA 4AKIA 4PK4A 3N5LA 4B3ST 1BR2A 2XQ3A 5EK4A 5CB4E 5CA0E 5L3DB 1J5ET 3ZC0A 5HCJA 3VKHA 3AE1A 1UX5A 2BS2A 3FZFB 2X51A 5FVKA 2A9UA 3RYCE 2LT3A 5L3GB 5AQUB 2HHHT 1FJGT 4AKGA 5DABA 2MAWA 1XDPA 2WP9A 2M6IA 1XMOT 2UXBT 3PURA 2ZM0A 4H9PC 4PFOA 4KMCA 3PJAA 4YHHT 2CWYA 2ES0A 4LMKA 2KINB 3ANWB 3AEGA 3ETUA 4L0RA 3N9MA 3FB2A 2XQ4A 3L09A 4LF5T 2XSAA 3UU4A 2W0GA 3AAAB 3TLUA 4WYVA 2LSIA 4JI0T 4BA9A 5ABHA 2CBJA 3AE5A 4LMJA 4TWHA 1ZV4X 5TAOA 3QB5K 3EUHA 5AFUL 2CHNA 4IL9A 3C50A 3AA1B 1UX4A 2VKHA 3N9NA 4QX8B 4KBMB 3DP7A 3ZT5A 5LMNT 1N34T 2XAQB 5IYZE 4LF6T 3VRAA 2JQKA 3ONLC 3PUGA 5C3JA 5CA1E 5J2UE 4IT4A 2XZEA 1X79A 5AQPB 3KVBA 1D1CA 3WAKA 3ZMVB 1NWMX 2W67A 3CVRA 2FJBA 4QXCB 5ABEA 3H3MA 4ILCA 3UTKA 3X1DA 3JCFA 3HL6A 4QHOA 4L5GA 5LOVE 3VRBA 3SOLA 3OYZA 2M6BA 1T72A 1ZOYA 4WBOA 1W0AA 2X68A 3T8OA 3HKEE 2LRLA 5J1GA 5JH7E 5LB7B 3T1YT 2JPFA 4HFCA 2ZM6T 3ONXA 2UXDT 4O4HE 4AKLA 5DQVA 3MA9A 4CN4A 2IDOB 2NP9A 2XQ8A 3IF8B 2VURA 4HFEA 1ZP0A 4IHJE 4LF9T 1D1AA 3PUAA 5LP6E 2BG9E 4TX5A 4E7ZA 4DV0T 2D0TA 2WDVA 4O4LE 1MIWA 4KUMB 2JRKA 2M67A 4J2CA 5LBQB 4TWFA 4QH1A 4COFA 4LFBT 1D1BA 4KX6A 4GK5E 2CEAA 3P4SA 4K0KT 4G2AA 3B57A 4O8SA 1HNWT 4UF0B 4IDNA 3GMIA 3Q5EA 2X67A 4GIWA 4OFZA 1S94A 4LF7T 4GKJT 2IIUA 3RYHE 5LJNA 4IE7A 4IE6A 5LNKA 3N2OA 4IDPA 4YSYA 2LM2A 1VCSA 4WZXA 4ZS3A 4P0AA 3AE4A 3Q2MA 1XNQT 1YD8G 3QK6A 1AJ3A 3V5UA 2OA5A 5JDLA 1M62A 2XY8B 1MNEA 1KNZA 4HFBA 3CQGB 3I9WA 2NOXA 1U5PA 3IA3A 2W63A 1I94T 4QWNB 4U7IA 2K5BB 4DV1T 3BQIA 3AECA 4XAXB 4JI7T 5HWYA 2J62A 4MLKA 2CE7A 4I0UA 2BVMA 2EHOA 4I4TE 4AQFC 1LVFA 2CXDA 5AQSB 3ZSSA 5KMGP 5IHYA 3K8PC 3UUNA 5JDFA 4DV3T 2LSJA 3ESLA 4EIWA 3SFDA 3AXJA 4IGUA 5AQVB 1T98A 3VHLA 2ODVA 2I6HA 1IAPA 3M65A 4JLEA 4UF0A 2D0UA 2WWUA 2ZMAA 2BS3A 2IW5B 2XQ9A 2R6GF 4TV8E 3UU3A 2IC9A 2UU9T 4JV5T 3NKZA 1NEKA 5FXZA 4BAYB 4UEMA 3LBXA 2X0LB 1VRBA 4UVAB 3ZCJA 4U2ZA 4E7SA 4DV6T 5HEOA 3ONJA 4HKAA 4AKHA 1HS7A 4F8HA 5L2LA 2V6YB 5L4EA 2XQ5A 3IEEA 3UUXB 5FL1A 3AE3A 3SFEA 2KMFA 5J0ZA 5KXJA 1FIOA 3EDUA 2FJEA 3ZLIA 3ZYMA 2LHRA 4U7YA 4KP3C 3OJAA 3UUBA 3ZYLA 5AQMB 2I59A 3P4WA 3RIUC 2PTFA 3AB3B 1MNDA 2NW8A 4JI2T 3TKLB 2DHRA 2CRBA 3Q5WA 4AQFA 5CGMA 4DR5T 1W9RA 2WZIA 3A7MA 4KHZF 4TZ4C 3ZN0B 2VKOA 2P9BA 3PUSA 4ZEYA 5L47A 2UXCT 2WZHA 4H9RC 3KV5A 1B7TA 4PFPA 4A56A 1LKXA 3RLFF 4AI6A 3D0TA 1N33T 2N9DA 2RP4A 3QNUA 4PAGA 2EHOD 3HKDE 2V5DA 4X5TA 5M4YA 2CM0A 3HKBE 3AA0B 3AVSA 4CXWA 1Z0PA 2C5IT 5L3EB 2XAJB 1MMDA 5FKYA 5LHHB 3PUVF 3RHWA 3OTOT 3NRXA 4ISTA 2WMNA 3EVYA 3MACA 4MFRA 1CHUA 5LBMA 1OXZA 5FY1A 1UUSA 1N36T 2LSYA 2PG8A 4HFHA 4IE4A 2WB5A 3CQCB 5HEGA 4QX7B 3C98B 3GWHA 4B6XA 1WCRA 3UUMA 4ASKA 2HN2A 1EZ3A 4IDZA 2E8IA 2D2SA 3LSVA 4K0UA 3ZCIA 4HWIB 4JI3T 5HXRA 3Q5DA 3SWHA 2KSRA 2VKDA 4DV7T 5HEJA 2YU1A 4DUZT 4I50E 4Z91A 4NXMT 1YQ3A 3UU5A 4HWDA 2C0SA 2HN1A 3PUYF 3JC6D 4HWHA 1D0YA 3AE8A 3MKDA 2CBIA 3NWIA 5ABFA 3K3QC 3K3OA 3PV0F 1IJ5A 2V7MA 2PFVA 2SPCA 2GK9A 3AEDA 3LK3B 3AVRA 1HF8A 3K3NA 3FZKB 5ABGA 4TNWA 2XQYA 4DVDA 2XAFB 1Y01A 4H63H 4P1NA 4CI2B 2RPAA 1IJ6A 4U3CA 1OEDE 3RRCA 4AKRB 4LFAT 4UV8B 4PJMA 1IZNB 2W4XA 5HEUA 3UQ7A 3U3IA 3RC3A 2BKOA 4JI8T 1ZHCA 2JMKA 3E0ZA 4PW8A 4CQIA 1BR1A 1YXRA 4HFIA 5AQRB 3ZT6A 1IBLT 2LLYA 3C51A 4CI3B 2X9YA 3MZKB 2VVSA 3PUZF 2AXDS 1VOMA 1W0BA 4QKNA 2WCAA 4U31A 5JREA 3RYIE 2H3RA 2H7OA 3AA7B 4ISSA 5FYMA 1DU2A 5JR9A 2XAHB 2L3LA 4QH4A 5FMNA 2V1DB 5ADXL 3NZPA 2WWVA 1WYCA 3RRWA 1UK5A 1V9DA 3B13A 1OEDC 2K3WA 3KINB 4EEDA 5JDNA 3EHZA 4X62T 3TLTA 2WDQA 4PK5A 2V26A 4OX9T 3B5MA 2ODUA 4O4JE 4DUYT 4GKKT 5AQFB 2BS4A 1J1JA 2LOPA 3JADA 3ZKRA 1HX8A 2RA1A 2BBHA 4JYAT 3Q9DA 2DI4A 4H9OC 5AQKB 5JVDE 1E1HB 1YKEB 2XM1A 3S4UA 4YSXA 3H3AA 2X66A 1N32T 1IBKT 3RC8A 2QVAA 3F57A 3OBVE 2CXFA 5LJMA 4DO0A 3I0QA 2FBWA 3T1HT 4UIGA 5JDQA 4X1YE 4TNVA 5HAXA 3RKOA 5L3CB 4DV5T 2OV9A 2W2UA 4HWCA 1FEWA 4O2AE 5ABFB 1HTJF 2CWOA 4I55E 2DNXA 3PDYA 4EGWA 5HXSA 3LK2B 3KV4A 5JTGA 3LG7A 2AE9A 4ZXLA 4DR2T 1X9BA 1HR0T 4UVCB 2CA5A 4AQYT 3ANWA 3R6NA 4DR1T 3WI3A 2BVLA 2YDQA 4YHJA 5F8PA 3AAEB 4ZI3D 2NR4A 4CXXA 2DWGA 3PUWF 4LF8T 2VASA 2N2NA 5JDHA 1D0XA 5JRCB 4JI1T 3QOFA 5IUXA 5LGTB 5JDMA 3P4PA 4B3TT 3A5XA 4ILAA 4YTPA 4DMVA 4DR7T 5J2TE 2WU5A 2XTLA 5HYAA 3UQ4A 1YQ4A 2IAKA 2W00A 1KK7A 2K9AA 4M1PA 4EEBA 3ZJ1A 2WM9A 3U78A 3ZC1A 3CIRA 5FXWA 1GQEA 2VL8A 2V7LA 2A3DA 2VWAA 4JI5T 4ADZA 2DLRA 5LGNB 4DR4T 3KV6A 3RI5A 2X9HA 2Y48B 2LSGA 4L9IA 3AEBA 4EYYR 1XDOA 3CX7B 3L39A 4DMWA 2XASB 3ZN1B 4H63V 1MIVA 1WR0A 2Y6XA 2FJDA 2YU2A 3H37A 1MMGA 4GOUA 3A8YC 4OYKA 5AQHB 5L4HA 3TLWA 2C5KT 4EV6A 3KDSE 2E5LT 4KHPT 3FXEB 2EHOB 4TUYE 5HXCA 3VKGA 5FY7A 1FMVA 2YKSA 1CUNA 3RQUA 2J47A 2CLYC 2JIWA 3QB5A 4X1IE 3VU7H 4EYUA 2W62A 5LGUB 5IWAT 4WNKA 3PE0A 3RF1A 4OK0A 4P0BA 3UU8A 4NUVA 4CI1B 2HPLA 3ABVA 3OKQA 4PJNA 3EAMA 5HWXA 2XJ7A 4HTEA 2W61A 4CXYA 1KNPA 3RIAA 3WAJA 4EOZB 4F6RC 4CN6A 2KLQA 2E9XD 3FZLB 5AQLB 2KT9A 2YDRA 3CK6A 4GYSA 3PUXF 5LHIB 4ZI2D 4YY3T 2X0YA 4U72A 1Z8UA 2DL1A 4Z8XA 4BJNA 2XPKA 1WYBA 3G06A 4H9SE 4HWFA 3I1AA 2BG9B 2CMRA 4YFSA 5E0OA 2D9DA 5LCYA 3P7IA 2V7JA 4U74A 3AAIA 3E08A 2YOEA 3FXDB 1WLXA 3R84B 3RX6A 2ZM2A 4YLHA 5FNVE 3AEEA 4GYRA 4AISA 3VR9A 2CHOA 4C91A 5JQGE 4TWDA 4O2BE 3GN5A 3MJXA 4UVBB 4UXNB 3N9OA 4IE0A 5A1LA 1YW0A 1LRZA 1XWMA 2XQ6A 3HKCE 4G63A 3JC6C 4HN9A 1E7PA 4DNDA 3PJAJ 4LFCT 1D0ZA 3SS1A 4TN7B 2VK9A 3UULA 2G0UA 2H7VC 3CKDA 2WBLA 4DR3T 2ACZA 1JNZA 4FJOA 4U33A 2LM9A 4YJ2E 2DCFA 2KXPB 2HH7A 4P09A 3NVOA 4XZCA 3RIFA 5LG3A 3CPZA 4ILUA 4WBNE 4OHFA 2JJ9A 2KWHA 3KBTA 5GONE 3KFWX 5DQWA 3K1SA 4ZI3C 2I0MA 3O1HA 3OVUA 5FXVA 3EABA 4AQGA 5HXHA 4QXHB 4OYJA 2YN6A 4YT0A 4C90A 2BKPA 1MMNA 2IUBA 2MTQA 2E9XA 4NXNT 3W15B 2FJAA 3L8RA 1UGOA 2LKHA 4X64T 4Q25A 2J1DG 2V5CA 3AXJB 1SHZC 3LK42 3J9X1 2BG9C 2NWBA 2X9XA 5AQGB 4ZI2C 5EK2A 4JI4T 2QGSA 2WSSV 1HCIA 2VQFT 4EXTA 4AXPA 3FZHB 2ACXA 3FZMB 3AE6A 4IIJE 3RYFE 2Y8DA 3EDVA 4JI6T 2KNDA 3ZMSB 2OLTA 3OPCA 4ZOLE 2V8SV 2L9QA 2EHOC 2JQ9A 3CWZB 5CJ5A 2YEVC 3P4QA 1KFYA 3C4WA 2V7KA 3OYXA 2V6YA 2YK0A 4JUYA 2X0HA 3PU8A 5AQIB 3TLVA 3ZEFB 3UFGA 2BKNA 2F4VT 1UCUA 4BJMA 1O3XA 1G8XA 2XSBA 3KBUA 2BG9A 4KI0F 2YINA 3MXZA 3NZQA 4LF4T 4YSZA 2XAGB 2C5JA 5AQTB 2E5VA 2E9XC 3PU3A 1WR6A 1JNRA 1T7SA 3GA8A 1G73A 3DJBA 4NIQA 2HPJA 4GK0E 5FY0A 5HEHA 3RKGA 3KV9A 2Q9QA 3LFMA 2KWIB 2VL0A 2WS3A 3FHNA 2LJLA 1W09A 3AEFA 4NUUA 4NPPA 4QXBB 2NW9A 3ZMUB 1L0VA 3EI0A 3ZJ2A 3ZYKA 4DBRA 3RPUA 2XM2A 1SE7A 2K24A 4IL4A 4X65T 5H6RB 3UT5E 2LOSA 2BDEA 4DR6T 3JAFA 3ZMZB 4PNIA 1ZKEA 3BQLA 2VKJA 3RQWA 3LJCA 5AQOB 2CLYB 3ETVA 3J7Yq 4HGAA 5HCMA 2A72A 4EZ4A 4B3RT 2XHEB 1YKHB 3N2KE 2WQYA 2V7IA 2QA7A 1UURA 4DV4T 5C8YE 3ZMTB 2UUBT 2QYWA 4O4IE 4MBQA 4CN1A 3LDQB 1T8BA 4JEHB 1KF6A 3BK9A 3N9LA 4IE5A 2MOZA 2E9XB 4LMLA 2WDRA 4MHCA 4HFDA 5FVLA 5LG4A 5LHGB 2LEHA 2WMOA 3CX6B 2Q9QB 3MK7C 3QUJA 4FI5A 4JBWF 1QUUA 2CPTA 2QRXA 2LKGA 2VB6A 3F2EA 3HR0A 2JQHA 3M3ZB 2WAUA 5LYJE 2UUCT 1FMWA 2LE8A 5C2TA 4YTNA 1XNRT 3PUQA 2B76A 2XQ7A 4ANJA 2B1EA 3BQKA 3AE2A 4N78D 4HFVA 2UUAT 2IHR1 4V1Av 3O1JA 1QLBA 2LHNA 4QH5A 1E2AA 5KX5E 4CZZB 2Q9QD 5LMUT 3P50A 1SA0E 4IDQA 4DBQA 2K48A 4YXDA 3IBPA 3C4ZA 5JDGA 1HNZT 1BR4A 2CXLA 4PJJA 3O4XE 2MPKA 2E2AA 2VVNA
chains in the Genus database with same CATH topology
1HG2A 2MYSA 3N9QA 3O1IA 4MALA 5HXEA 1S35A 5LA6E 3CX8B 2JQQA 5F3JA 4X1KE 3IHRA 5LXTE 2Z6EA 1MMAA 1BR0A 5EK3A 3UFEA 1HG5A 2MBGA 3I0OA 5FP3A 3O9XA 3LBXB 4YJ3E 1U4QA 2Q9QC 1OWAA 3V5SA 4ERRA 5L3FB 5ETWA 2DWKA 2LSKA 4PJLA 1US7B 1Y64B 3HI2A 4PK6A 4ZS2A 1NAFA 2BZBA 3FBZA 2X9WA 3CQXC 4WW0A 2N1GA 3CMLA 4EB6E 3AA6B 4XBFB 4I43B 3I9YA 5JRCA 3DTOA 5FXXA 1H7CA 3P8CD 2XUEA 3GN5B 5DJQC 3KVAA 3RH3A 2ZM8A 4ZHQE 4H9QC 2A2FX 5JR9B 5KDMC 4UELA 2NW7A 4HE8A 3E22E 2IC6A 3F31A 5H6QB 2ZLYA 3NRYA 4EAHA 3ZPOA 3HA4A 3FBLA 4EZHA 4ZI3D 2D5UA 3N9PA 5JR9C 1WRDA 1MIYA 2CCQA 4H9NC 4ZI7E 1QSDA 1ZEEA 2L8KA 3C4XA 2UXXB 4X20E 3NBXX 2NTXA 4UV9B 4JEUB 2UXNB 1HFAA 3QC9A 4HEAA 2PBIA 3Q5XA 3PTRB 3C64A 3SRZA 4TV9E 2PJQA 2NTYA 5BMVE 5EZYE 3L3PA 1LVKA 5L3BB 3N2GE 2KZ7B 4AKIA 2JMHA 4PK4A 3N5LA 1BR2A 5EK4A 5CB4E 5CA0E 5L3DB 3ZC0A 3VKHA 1UX5A 3RYCE 2X51A 2LT3A 5L3GB 4AKGA 5DABA 3PURA 2ZM0A 4H9PC 4PFOA 4KMCA 2CWYA 2ES0A 2KINB 3ANWB 3ETUA 4L0RA 3N9MA 3FB2A 3L09A 2W0GA 3AAAB 2LSIA 4BA9A 5AFUL 1ZV4X 5TAOA 3EUHA 3C50A 3AA1B 1UX4A 2VKHA 3N9NA 4QX8B 4KBMB 3DP7A 2XAQB 5IYZE 3PUGA 5CA1E 5J2UE 1X79A 3WAKA 3KVBA 1D1CA 1NWMX 3CVRA 4QXCB 3UTKA 4QHOA 3HL6A 5LOVE 4L5GA 3SOLA 3OYZA 4WBOA 2X68A 3T8OA 3HKEE 5J1GA 5JH7E 2JPFA 3ONXA 4O4HE 4AKLA 5DQVA 3MA9A 2NP9A 3IF8B 4IHJE 1D1AA 3PUAA 5LP6E 4TX5A 4E7ZA 2D0TA 4O4LE 1MIWA 4KUMB 2JRKA 2M67A 4J2CA 5LBQB 1D1BA 4GK5E 2CEAA 4G2AA 3B57A 4O8SA 4UF0B 3GMIA 4GIWA 2X67A 4OFZA 1S94A 3RYHE 5LJNA 4IE7A 4IE6A 5LNKA 3N2OA 4P0AA 4ZS3A 1AJ3A 3Q2MA 1YD8G 3QK6A 3V5UA 2OA5A 5JDLA 1KNZA 1MNEA 3CQGB 3I9WA 2NOXA 1U5PA 2W63A 4QWNB 2K5BB 3BQIA 4XAXB 5HWYA 4MLKA 2CE7A 2BVMA 2EHOA 4I4TE 4AQFC 1LVFA 2CXDA 5KMGP 5IHYA 3K8PC 3UUNA 5JDFA 2LSJA 3ESLA 4EIWA 4IGUA 1T98A 3VHLA 2ODVA 3M65A 1IAPA 4UF0A 4JLEA 2D0UA 2WWUA 2ZMAA 4CXWA 2IW5B 4TV8E 2IC9A 5FXZA 4BAYB 4UEMA 3LBXA 2X0LB 1VRBA 4UVAB 3ZCJA 4E7SA 4HKAA 4AKHA 1HS7A 5L2LA 3IEEA 3UUXB 2KMFA 1FIOA 3EDUA 3ZYMA 3ZLIA 2LHRA 4EYUA 4KP3C 3OJAA 3ZYLA 3TKLB 2I59A 3AB3B 1MNDA 2NW8A 4AQFA 2DHRA 3Q5WA 4TZ4C 3ZN0B 2VKOA 2P9BA 3PUSA 4H9RC 3KV5A 1B7TA 4PFPA 4A56A 1LKXA 4AI6A 3D0TA 2N9DA 2RP4A 4PAGA 2EHOD 3HKDE 5M4YA 2CM0A 3HKBE 3AA0B 3AVSA 1Z0PA 2C5IT 5L3EB 2XAJB 1MMDA 5LHHB 3NRXA 4ISTA 2WMNA 3EVYA 3MACA 4MFRA 5LBMA 1OXZA 5FY1A 2LSYA 2PG8A 4IE4A 3CQCB 4QX7B 3C98B 3GWHA 4B6XA 3UUMA 4ASKA 1EZ3A 4IDZA 2E8IA 2D2SA 4K0UA 3ZCIA 5HXRA 3SWHA 2VKDA 2YU1A 4I50E 2C0SA 3JC6D 1D0YA 3MKDA 3K3QC 3K3OA 1IJ5A 2V7MA 2PFVA 2SPCA 2GK9A 3LK3B 3AVRA 1HF8A 3K3NA 2XQYA 4DVDA 2XAFB 4H63H 4CI2B 1IJ6A 4AKRB 3RRCA 4UV8B 4PJMA 1IZNB 3U3IA 3RC3A 1ZHCA 2JMKA 3E0ZA 4PW8A 4CQIA 1BR1A 3C51A 4CI3B 2X9YA 3MZKB 1VOMA 4QKNA 5JREA 2H3RA 2H7OA 3AA7B 4ISSA 5FYMA 5JR9A 2XAHB 2L3LA 5FMNA 2V1DB 5ADXL 3NZPA 1WYCA 3RRWA 1V9DA 3B13A 5JDNA 3KINB 4PK5A 2V26A 4O4JE 2ODUA 2LOPA 1HX8A 2RA1A 3Q9DA 2DI4A 4H9OC 5JVDE 1E1HB 1YKEB 3S4UA 3H3AA 2X66A 3RC8A 3F57A 3OBVE 2CXFA 5LJMA 4DO0A 3I0QA 4UIGA 5JDQA 4X1YE 5HAXA 3RKOA 5L3CB 1FEWA 4O2AE 1HTJF 2CWOA 4I55E 2DNXA 3PDYA 5HXSA 3LK2B 3KV4A 3LG7A 4UVCB 2CA5A 3ANWA 3R6NA 3WI3A 2BVLA 5F8PA 4YHJA 3AAEB 4CXXA 2DWGA 2VASA 2N2NA 5JDHA 1D0XA 5JRCB 5LGTB 5JDMA 3A5XA 4DMVA 5J2TE 2XTLA 5HYAA 2IAKA 2W00A 1KK7A 2K9AA 4M1PA 3ZJ1A 2WM9A 3U78A 3ZC1A 5FXWA 2VL8A 2V7LA 2A3DA 2VWAA 4ADZA 5LGNB 2DLRA 3KV6A 2X9HA 2Y48B 2LSGA 4L9IA 4EYYR 3CX7B 4DMWA 2XASB 3ZN1B 4H63V 1MIVA 3H37A 2Y6XA 2YU2A 4OYKA 1MMGA 4GOUA 2C5KT 3KDSE 3VKGA 3FXEB 2EHOB 4TUYE 5HXCA 5FY7A 1FMVA 1CUNA 5LGUB 3VU7H 2CLYC 4X1IE 2W62A 4WNKA 3PE0A 4OK0A 4P0BA 4NUVA 4CI1B 2HPLA 3OKQA 4PJNA 5HWXA 4HTEA 2W61A 4CXYA 3WAJA 4EOZB 4F6RC 2KLQA 2E9XD 2KT9A 4GYSA 5LHIB 4ZI2D 4U72A 4Z8XA 4BJNA 1WYBA 4H9SE 3I1AA 2CMRA 5E0OA 5LCYA 3P7IA 2V7JA 4U74A 3AAIA 3E08A 3R84B 3FXDB 1WLXA 3RX6A 2ZM2A 4YLHA 5FNVE 4GYRA 4C91A 5JQGE 4O2BE 3GN5A 3MJXA 4UVBB 4UXNB 3N9OA 4IE0A 5A1LA 1YW0A 1LRZA 3HKCE 4G63A 3JC6C 4HN9A 4DNDA 1D0ZA 3SS1A 4TN7B 2VK9A 3UULA 2G0UA 2H7VC 3CKDA 2WBLA 4FJOA 2LM9A 4YJ2E 2DCFA 2KXPB 2HH7A 4P09A 4XZCA 3CPZA 4ILUA 4WBNE 4OHFA 2JJ9A 2KWHA 3KBTA 5GONE 3KFWX 5DQWA 4ZI3C 3O1HA 5FXVA 4AQGA 5HXHA 4QXHB 4OYJA 4C90A 1MMNA 2MTQA 2E9XA 3W15B 2J1DG 3LK42 3J9X1 1SHZC 2NWBA 2X9XA 4ZI2C 5EK2A 2QGSA 2WSSV 1HCIA 4EXTA 4AXPA 2ACXA 4IIJE 2Y8DA 3EDVA 2KNDA 3ZMSB 4ZOLE 2L9QA 2EHOC 3CWZB 2YEVC 3C4WA 2V7KA 3OYXA 4JUYA 2YK0A 3ZEFB 3PU8A 1UCUA 4BJMA 1O3XA 1G8XA 3KBUA 2YINA 3MXZA 3NZQA 2XAGB 2C5JA 2E9XC 3PU3A 1WR6A 3GA8A 1G73A 3DJBA 2HPJA 4GK0E 5FY0A 3KV9A 2Q9QA 3LFMA 2KWIB 3FHNA 2LJLA 4NUUA 4QXBB 2NW9A 3ZMUB 3ZYKA 4DBRA 3ZJ2A 3RPUA 2K24A 5H6RB 3UT5E 2LOSA 2BDEA 3ZMZB 4PNIA 1ZKEA 3BQLA 2VKJA 3LJCA 2CLYB 3ETVA 3J7Yq 4HGAA 2A72A 4EZ4A 2XHEB 1YKHB 3N2KE 2V7IA 2QA7A 5C8YE 3ZMTB 4O4IE 4MBQA 4JEHB 3RYIE 3ZMVB 3N9LA 3BK9A 3RYFE 4IE5A 2MOZA 2E9XB 4MHCA 5LG4A 5LHGB 2LEHA 2WMOA 3CX6B 2Q9QB 3MK7C 3QUJA 4FI5A 1QUUA 4YFSA 2VB6A 3F2EA 5LYJE 3HR0A 2WAUA 1FMWA 2LE8A 3PUQA 4ANJA 2B1EA 3BQKA 4N78D 4HFVA 4V1Av 3O1JA 2LHNA 5KX5E 4CZZB 2Q9QD 1SA0E 4DBQA 2K48A 3IBPA 3C4ZA 5JDGA 1BR4A 2CXLA 4PJJA 3O4XE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7Y q;  4V1A v; 
#chains in the Genus database with same CATH topology
 1HG2 A;  1KNR A;  3TLS A;  4X66 T;  2MYS A;  3N9Q A;  3O1I A;  1HNX T;  4MAL A;  5HXE A;  1J5W A;  1S35 A;  1R8I A;  5LA6 E;  4ZZB A;  3CX8 B;  2JQQ A;  5F3J A;  4X1K E;  1OED B;  3IHR A;  5LXT E;  4AIU A;  2Z6E A;  5AQN B;  4B3M T;  1NEN A;  2YDS A;  1MMA A;  1BR0 A;  5AQQ B;  3AE9 A;  5EK3 A;  3UFE A;  1HG5 A;  2MBG A;  3I0O A;  1XZY A;  1HX1 B;  1I6Z A;  4Z90 A;  2WY2 A;  2H88 A;  2FUP A;  5FP3 A;  3LBX B;  3O9X A;  4YJ3 E;  1U4Q A;  2Q9Q C;  1OWA A;  3V5S A;  3ZT7 A;  4DID B;  5ETW A;  4ERR A;  5L3F B;  2XQA A;  5CFB A;  2DWK A;  1VCT A;  2LSK A;  1US7 B;  2W66 A;  1Y64 B;  3HI2 A;  4PK6 A;  4PJL A;  1NAF A;  4ZS2 A;  5F5W A;  5FL0 A;  4ZZC A;  1XMQ T;  2BZB A;  3FBZ A;  2X9W A;  2WU2 A;  3CQX C;  2N1G A;  3CML A;  4WW0 A;  4EB6 E;  3AA6 B;  1M7K A;  4XBF B;  4I43 B;  4A5X A;  4U2Y A;  3I9Y A;  4IRE A;  1IBM T;  5JRC A;  3DTO A;  5FXX A;  1H7C A;  3P8C D;  4DV2 T;  2XUE A;  3UU6 A;  3GN5 B;  4UR9 A;  5DJQ C;  1OED A;  3KVA A;  3RH3 A;  2ZM8 A;  4ZHQ E;  5BR8 T;  4H9Q C;  2A2F X;  1SUM B;  3JAE A;  1KEY A;  5JR9 B;  5KDM C;  4UEL A;  2NW7 A;  1WFD A;  4HE8 A;  3E22 E;  2IC6 A;  3F31 A;  5H6Q B;  3RIU A;  2ZLY A;  3NRY A;  4EAH A;  2J4G A;  3HA4 A;  3FBL A;  3P4R A;  3ZPO A;  2D5U A;  3N9P A;  4EZH A;  1WRD A;  3RGL A;  1MIY A;  2CCQ A;  4H9N C;  5AQJ B;  1QSD A;  4A98 A;  4ZI7 E;  1ZEE A;  2L8K A;  3C4X A;  2UXX B;  4X20 E;  3AE7 A;  4ILB A;  4IDO A;  3NBX X;  2H89 A;  2NTX A;  2IML A;  3AEA A;  4JEU B;  4UV9 B;  2LRK A;  2UXN B;  1HFA A;  3QC9 A;  4HEA A;  2PBI A;  2V6X A;  5JR9 C;  4A97 A;  3Q5X A;  2VQE T;  3PTR B;  3C64 A;  3SRZ A;  3ZST A;  3VR8 A;  4TV9 E;  2PJQ A;  2NTY A;  5BMV E;  5EZY E;  3L3P A;  1LVK A;  5L3B B;  3N2G E;  4YTM A;  2KZ7 B;  2BBJ A;  2JMH A;  4AKI A;  4PK4 A;  3N5L A;  4B3S T;  1BR2 A;  2XQ3 A;  5EK4 A;  5CB4 E;  5CA0 E;  5L3D B;  1J5E T;  3ZC0 A;  5HCJ A;  3VKH A;  3AE1 A;  1UX5 A;  2BS2 A;  3FZF B;  2X51 A;  5FVK A;  2A9U A;  3RYC E;  2LT3 A;  5L3G B;  5AQU B;  2HHH T;  1FJG T;  4AKG A;  5DAB A;  2MAW A;  1XDP A;  2WP9 A;  2M6I A;  1XMO T;  2UXB T;  3PUR A;  2ZM0 A;  4H9P C;  4PFO A;  4KMC A;  3PJA A;  4YHH T;  2CWY A;  2ES0 A;  4LMK A;  2KIN B;  3ANW B;  3AEG A;  3ETU A;  4L0R A;  3N9M A;  3FB2 A;  2XQ4 A;  3L09 A;  4LF5 T;  2XSA A;  3UU4 A;  2W0G A;  3AAA B;  3TLU A;  4WYV A;  2LSI A;  4JI0 T;  4BA9 A;  5ABH A;  2CBJ A;  3AE5 A;  4LMJ A;  4TWH A;  1ZV4 X;  5TAO A;  3QB5 K;  3EUH A;  5AFU L;  2CHN A;  4IL9 A;  3C50 A;  3AA1 B;  1UX4 A;  2VKH A;  3N9N A;  4QX8 B;  4KBM B;  3DP7 A;  3ZT5 A;  5LMN T;  1N34 T;  2XAQ B;  5IYZ E;  4LF6 T;  3VRA A;  2JQK A;  3ONL C;  3PUG A;  5C3J A;  5CA1 E;  5J2U E;  4IT4 A;  2XZE A;  1X79 A;  5AQP B;  3KVB A;  1D1C A;  3WAK A;  3ZMV B;  1NWM X;  2W67 A;  3CVR A;  2FJB A;  4QXC B;  5ABE A;  3H3M A;  4ILC A;  3UTK A;  3X1D A;  3JCF A;  3HL6 A;  4QHO A;  4L5G A;  5LOV E;  3VRB A;  3SOL A;  3OYZ A;  2M6B A;  1T72 A;  1ZOY A;  4WBO A;  1W0A A;  2X68 A;  3T8O A;  3HKE E;  2LRL A;  5J1G A;  5JH7 E;  5LB7 B;  3T1Y T;  2JPF A;  4HFC A;  2ZM6 T;  3ONX A;  2UXD T;  4O4H E;  4AKL A;  5DQV A;  3MA9 A;  4CN4 A;  2IDO B;  2NP9 A;  2XQ8 A;  3IF8 B;  2VUR A;  4HFE A;  1ZP0 A;  4IHJ E;  4LF9 T;  1D1A A;  3PUA A;  5LP6 E;  2BG9 E;  4TX5 A;  4E7Z A;  4DV0 T;  2D0T A;  2WDV A;  4O4L E;  1MIW A;  4KUM B;  2JRK A;  2M67 A;  4J2C A;  5LBQ B;  4TWF A;  4QH1 A;  4COF A;  4LFB T;  1D1B A;  4KX6 A;  4GK5 E;  2CEA A;  3P4S A;  4K0K T;  4G2A A;  3B57 A;  4O8S A;  1HNW T;  4UF0 B;  4IDN A;  3GMI A;  3Q5E A;  2X67 A;  4GIW A;  4OFZ A;  1S94 A;  4LF7 T;  4GKJ T;  2IIU A;  3RYH E;  5LJN A;  4IE7 A;  4IE6 A;  5LNK A;  3N2O A;  4IDP A;  4YSY A;  2LM2 A;  1VCS A;  4WZX A;  4ZS3 A;  4P0A A;  3AE4 A;  3Q2M A;  1XNQ T;  1YD8 G;  3QK6 A;  1AJ3 A;  3V5U A;  2OA5 A;  5JDL A;  1M62 A;  2XY8 B;  1MNE A;  1KNZ A;  4HFB A;  3CQG B;  3I9W A;  2NOX A;  1U5P A;  3IA3 A;  2W63 A;  1I94 T;  4QWN B;  4U7I A;  2K5B B;  4DV1 T;  3BQI A;  3AEC A;  4XAX B;  4JI7 T;  5HWY A;  2J62 A;  4MLK A;  2CE7 A;  4I0U A;  2BVM A;  2EHO A;  4I4T E;  4AQF C;  1LVF A;  2CXD A;  5AQS B;  3ZSS A;  5KMG P;  5IHY A;  3K8P C;  3UUN A;  5JDF A;  4DV3 T;  2LSJ A;  3ESL A;  4EIW A;  3SFD A;  3AXJ A;  4IGU A;  5AQV B;  1T98 A;  3VHL A;  2ODV A;  2I6H A;  1IAP A;  3M65 A;  4JLE A;  4UF0 A;  2D0U A;  2WWU A;  2ZMA A;  2BS3 A;  2IW5 B;  2XQ9 A;  2R6G F;  4TV8 E;  3UU3 A;  2IC9 A;  2UU9 T;  4JV5 T;  3NKZ A;  1NEK A;  5FXZ A;  4BAY B;  4UEM A;  3LBX A;  2X0L B;  1VRB A;  4UVA B;  3ZCJ A;  4U2Z A;  4E7S A;  4DV6 T;  5HEO A;  3ONJ A;  4HKA A;  4AKH A;  1HS7 A;  4F8H A;  5L2L A;  2V6Y B;  5L4E A;  2XQ5 A;  3IEE A;  3UUX B;  5FL1 A;  3AE3 A;  3SFE A;  2KMF A;  5J0Z A;  5KXJ A;  1FIO A;  3EDU A;  2FJE A;  3ZLI A;  3ZYM A;  2LHR A;  4U7Y A;  4KP3 C;  3OJA A;  3UUB A;  3ZYL A;  5AQM B;  2I59 A;  3P4W A;  3RIU C;  2PTF A;  3AB3 B;  1MND A;  2NW8 A;  4JI2 T;  3TKL B;  2DHR A;  2CRB A;  3Q5W A;  4AQF A;  5CGM A;  4DR5 T;  1W9R A;  2WZI A;  3A7M A;  4KHZ F;  4TZ4 C;  3ZN0 B;  2VKO A;  2P9B A;  3PUS A;  4ZEY A;  5L47 A;  2UXC T;  2WZH A;  4H9R C;  3KV5 A;  1B7T A;  4PFP A;  4A56 A;  1LKX A;  3RLF F;  4AI6 A;  3D0T A;  1N33 T;  2N9D A;  2RP4 A;  3QNU A;  4PAG A;  2EHO D;  3HKD E;  2V5D A;  4X5T A;  5M4Y A;  2CM0 A;  3HKB E;  3AA0 B;  3AVS A;  4CXW A;  1Z0P A;  2C5I T;  5L3E B;  2XAJ B;  1MMD A;  5FKY A;  5LHH B;  3PUV F;  3RHW A;  3OTO T;  3NRX A;  4IST A;  2WMN A;  3EVY A;  3MAC A;  4MFR A;  1CHU A;  5LBM A;  1OXZ A;  5FY1 A;  1UUS A;  1N36 T;  2LSY A;  2PG8 A;  4HFH A;  4IE4 A;  2WB5 A;  3CQC B;  5HEG A;  4QX7 B;  3C98 B;  3GWH A;  4B6X A;  1WCR A;  3UUM A;  4ASK A;  2HN2 A;  1EZ3 A;  4IDZ A;  2E8I A;  2D2S A;  3LSV A;  4K0U A;  3ZCI A;  4HWI B;  4JI3 T;  5HXR A;  3Q5D A;  3SWH A;  2KSR A;  2VKD A;  4DV7 T;  5HEJ A;  2YU1 A;  4DUZ T;  4I50 E;  4Z91 A;  4NXM T;  1YQ3 A;  3UU5 A;  4HWD A;  2C0S A;  2HN1 A;  3PUY F;  3JC6 D;  4HWH A;  1D0Y A;  3AE8 A;  3MKD A;  2CBI A;  3NWI A;  5ABF A;  3K3Q C;  3K3O A;  3PV0 F;  1IJ5 A;  2V7M A;  2PFV A;  2SPC A;  2GK9 A;  3AED A;  3LK3 B;  3AVR A;  1HF8 A;  3K3N A;  3FZK B;  5ABG A;  4TNW A;  2XQY A;  4DVD A;  2XAF B;  1Y01 A;  4H63 H;  4P1N A;  4CI2 B;  2RPA A;  1IJ6 A;  4U3C A;  1OED E;  3RRC A;  4AKR B;  4LFA T;  4UV8 B;  4PJM A;  1IZN B;  2W4X A;  5HEU A;  3UQ7 A;  3U3I A;  3RC3 A;  2BKO A;  4JI8 T;  1ZHC A;  2JMK A;  3E0Z A;  4PW8 A;  4CQI A;  1BR1 A;  1YXR A;  4HFI A;  5AQR B;  3ZT6 A;  1IBL T;  2LLY A;  3C51 A;  4CI3 B;  2X9Y A;  3MZK B;  2VVS A;  3PUZ F;  2AXD S;  1VOM A;  1W0B A;  4QKN A;  2WCA A;  4U31 A;  5JRE A;  3RYI E;  2H3R A;  2H7O A;  3AA7 B;  4ISS A;  5FYM A;  1DU2 A;  5JR9 A;  2XAH B;  2L3L A;  4QH4 A;  5FMN A;  2V1D B;  5ADX L;  3NZP A;  2WWV A;  1WYC A;  3RRW A;  1UK5 A;  1V9D A;  3B13 A;  1OED C;  2K3W A;  3KIN B;  4EED A;  5JDN A;  3EHZ A;  4X62 T;  3TLT A;  2WDQ A;  4PK5 A;  2V26 A;  4OX9 T;  3B5M A;  2ODU A;  4O4J E;  4DUY T;  4GKK T;  5AQF B;  2BS4 A;  1J1J A;  2LOP A;  3JAD A;  3ZKR A;  1HX8 A;  2RA1 A;  2BBH A;  4JYA T;  3Q9D A;  2DI4 A;  4H9O C;  5AQK B;  5JVD E;  1E1H B;  1YKE B;  2XM1 A;  3S4U A;  4YSX A;  3H3A A;  2X66 A;  1N32 T;  1IBK T;  3RC8 A;  2QVA A;  3F57 A;  3OBV E;  2CXF A;  5LJM A;  4DO0 A;  3I0Q A;  2FBW A;  3T1H T;  4UIG A;  5JDQ A;  4X1Y E;  4TNV A;  5HAX A;  3RKO A;  5L3C B;  4DV5 T;  2OV9 A;  2W2U A;  4HWC A;  1FEW A;  4O2A E;  5ABF B;  1HTJ F;  2CWO A;  4I55 E;  2DNX A;  3PDY A;  4EGW A;  5HXS A;  3LK2 B;  3KV4 A;  5JTG A;  3LG7 A;  2AE9 A;  4ZXL A;  4DR2 T;  1X9B A;  1HR0 T;  4UVC B;  2CA5 A;  4AQY T;  3ANW A;  3R6N A;  4DR1 T;  3WI3 A;  2BVL A;  2YDQ A;  4YHJ A;  5F8P A;  3AAE B;  4ZI3 D;  2NR4 A;  4CXX A;  2DWG A;  3PUW F;  4LF8 T;  2VAS A;  2N2N A;  5JDH A;  1D0X A;  5JRC B;  4JI1 T;  3QOF A;  5IUX A;  5LGT B;  5JDM A;  3P4P A;  4B3T T;  3A5X A;  4ILA A;  4YTP A;  4DMV A;  4DR7 T;  5J2T E;  2WU5 A;  2XTL A;  5HYA A;  3UQ4 A;  1YQ4 A;  2IAK A;  2W00 A;  1KK7 A;  2K9A A;  4M1P A;  4EEB A;  3ZJ1 A;  2WM9 A;  3U78 A;  3ZC1 A;  3CIR A;  5FXW A;  1GQE A;  2VL8 A;  2V7L A;  2A3D A;  2VWA A;  4JI5 T;  4ADZ A;  2DLR A;  5LGN B;  4DR4 T;  3KV6 A;  3RI5 A;  2X9H A;  2Y48 B;  2LSG A;  4L9I A;  3AEB A;  4EYY R;  1XDO A;  3CX7 B;  3L39 A;  4DMW A;  2XAS B;  3ZN1 B;  4H63 V;  1MIV A;  1WR0 A;  2Y6X A;  2FJD A;  2YU2 A;  3H37 A;  1MMG A;  4GOU A;  3A8Y C;  4OYK A;  5AQH B;  5L4H A;  3TLW A;  2C5K T;  4EV6 A;  3KDS E;  2E5L T;  4KHP T;  3FXE B;  2EHO B;  4TUY E;  5HXC A;  3VKG A;  5FY7 A;  1FMV A;  2YKS A;  1CUN A;  3RQU A;  2J47 A;  2CLY C;  2JIW A;  3QB5 A;  4X1I E;  3VU7 H;  4EYU A;  2W62 A;  5LGU B;  5IWA T;  4WNK A;  3PE0 A;  3RF1 A;  4OK0 A;  4P0B A;  3UU8 A;  4NUV A;  4CI1 B;  2HPL A;  3ABV A;  3OKQ A;  4PJN A;  3EAM A;  5HWX A;  2XJ7 A;  4HTE A;  2W61 A;  4CXY A;  1KNP A;  3RIA A;  3WAJ A;  4EOZ B;  4F6R C;  4CN6 A;  2KLQ A;  2E9X D;  3FZL B;  5AQL B;  2KT9 A;  2YDR A;  3CK6 A;  4GYS A;  3PUX F;  5LHI B;  4ZI2 D;  4YY3 T;  2X0Y A;  4U72 A;  1Z8U A;  2DL1 A;  4Z8X A;  4BJN A;  2XPK A;  1WYB A;  3G06 A;  4H9S E;  4HWF A;  3I1A A;  2BG9 B;  2CMR A;  4YFS A;  5E0O A;  2D9D A;  5LCY A;  3P7I A;  2V7J A;  4U74 A;  3AAI A;  3E08 A;  2YOE A;  3FXD B;  1WLX A;  3R84 B;  3RX6 A;  2ZM2 A;  4YLH A;  5FNV E;  3AEE A;  4GYR A;  4AIS A;  3VR9 A;  2CHO A;  4C91 A;  5JQG E;  4TWD A;  4O2B E;  3GN5 A;  3MJX A;  4UVB B;  4UXN B;  3N9O A;  4IE0 A;  5A1L A;  1YW0 A;  1LRZ A;  1XWM A;  2XQ6 A;  3HKC E;  4G63 A;  3JC6 C;  4HN9 A;  1E7P A;  4DND A;  3PJA J;  4LFC T;  1D0Z A;  3SS1 A;  4TN7 B;  2VK9 A;  3UUL A;  2G0U A;  2H7V C;  3CKD A;  2WBL A;  4DR3 T;  2ACZ A;  1JNZ A;  4FJO A;  4U33 A;  2LM9 A;  4YJ2 E;  2DCF A;  2KXP B;  2HH7 A;  4P09 A;  3NVO A;  4XZC A;  3RIF A;  5LG3 A;  3CPZ A;  4ILU A;  4WBN E;  4OHF A;  2JJ9 A;  2KWH A;  3KBT A;  5GON E;  3KFW X;  5DQW A;  3K1S A;  4ZI3 C;  2I0M A;  3O1H A;  3OVU A;  5FXV A;  3EAB A;  4AQG A;  5HXH A;  4QXH B;  4OYJ A;  2YN6 A;  4YT0 A;  4C90 A;  2BKP A;  1MMN A;  2IUB A;  2MTQ A;  2E9X A;  4NXN T;  3W15 B;  2FJA A;  3L8R A;  1UGO A;  2LKH A;  4X64 T;  4Q25 A;  2J1D G;  2V5C A;  3AXJ B;  1SHZ C;  3LK4 2;  3J9X 1;  2BG9 C;  2NWB A;  2X9X A;  5AQG B;  4ZI2 C;  5EK2 A;  4JI4 T;  2QGS A;  2WSS V;  1HCI A;  2VQF T;  4EXT A;  4AXP A;  3FZH B;  2ACX A;  3FZM B;  3AE6 A;  4IIJ E;  3RYF E;  2Y8D A;  3EDV A;  4JI6 T;  2KND A;  3ZMS B;  2OLT A;  3OPC A;  4ZOL E;  2V8S V;  2L9Q A;  2EHO C;  2JQ9 A;  3CWZ B;  5CJ5 A;  2YEV C;  3P4Q A;  1KFY A;  3C4W A;  2V7K A;  3OYX A;  2V6Y A;  2YK0 A;  4JUY A;  2X0H A;  3PU8 A;  5AQI B;  3TLV A;  3ZEF B;  3UFG A;  2BKN A;  2F4V T;  1UCU A;  4BJM A;  1O3X A;  1G8X A;  2XSB A;  3KBU A;  2BG9 A;  4KI0 F;  2YIN A;  3MXZ A;  3NZQ A;  4LF4 T;  4YSZ A;  2XAG B;  2C5J A;  5AQT B;  2E5V A;  2E9X C;  3PU3 A;  1WR6 A;  1JNR A;  1T7S A;  3GA8 A;  1G73 A;  3DJB A;  4NIQ A;  2HPJ A;  4GK0 E;  5FY0 A;  5HEH A;  3RKG A;  3KV9 A;  2Q9Q A;  3LFM A;  2KWI B;  2VL0 A;  2WS3 A;  3FHN A;  2LJL A;  1W09 A;  3AEF A;  4NUU A;  4NPP A;  4QXB B;  2NW9 A;  3ZMU B;  1L0V A;  3EI0 A;  3ZJ2 A;  3ZYK A;  4DBR A;  3RPU A;  2XM2 A;  1SE7 A;  2K24 A;  4IL4 A;  4X65 T;  5H6R B;  3UT5 E;  2LOS A;  2BDE A;  4DR6 T;  3JAF A;  3ZMZ B;  4PNI A;  1ZKE A;  3BQL A;  2VKJ A;  3RQW A;  3LJC A;  5AQO B;  2CLY B;  3ETV A;  3J7Y q;  4HGA A;  5HCM A;  2A72 A;  4EZ4 A;  4B3R T;  2XHE B;  1YKH B;  3N2K E;  2WQY A;  2V7I A;  2QA7 A;  1UUR A;  4DV4 T;  5C8Y E;  3ZMT B;  2UUB T;  2QYW A;  4O4I E;  4MBQ A;  4CN1 A;  3LDQ B;  1T8B A;  4JEH B;  1KF6 A;  3BK9 A;  3N9L A;  4IE5 A;  2MOZ A;  2E9X B;  4LML A;  2WDR A;  4MHC A;  4HFD A;  5FVL A;  5LG4 A;  5LHG B;  2LEH A;  2WMO A;  3CX6 B;  2Q9Q B;  3MK7 C;  3QUJ A;  4FI5 A;  4JBW F;  1QUU A;  2CPT A;  2QRX A;  2LKG A;  2VB6 A;  3F2E A;  3HR0 A;  2JQH A;  3M3Z B;  2WAU A;  5LYJ E;  2UUC T;  1FMW A;  2LE8 A;  5C2T A;  4YTN A;  1XNR T;  3PUQ A;  2B76 A;  2XQ7 A;  4ANJ A;  2B1E A;  3BQK A;  3AE2 A;  4N78 D;  4HFV A;  2UUA T;  2IHR 1;  4V1A v;  3O1J A;  1QLB A;  2LHN A;  4QH5 A;  1E2A A;  5KX5 E;  4CZZ B;  2Q9Q D;  5LMU T;  3P50 A;  1SA0 E;  4IDQ A;  4DBQ A;  2K48 A;  4YXD A;  3IBP A;  3C4Z A;  5JDG A;  1HNZ T;  1BR4 A;  2CXL A;  4PJJ A;  3O4X E;  2MPK A;  2E2A A;  2VVN A; 
#chains in the Genus database with same CATH homology
 1HG2 A;  2MYS A;  3N9Q A;  3O1I A;  4MAL A;  5HXE A;  1S35 A;  5LA6 E;  3CX8 B;  2JQQ A;  5F3J A;  4X1K E;  3IHR A;  5LXT E;  2Z6E A;  1MMA A;  1BR0 A;  5EK3 A;  3UFE A;  1HG5 A;  2MBG A;  3I0O A;  5FP3 A;  3O9X A;  3LBX B;  4YJ3 E;  1U4Q A;  2Q9Q C;  1OWA A;  3V5S A;  4ERR A;  5L3F B;  5ETW A;  2DWK A;  2LSK A;  4PJL A;  1US7 B;  1Y64 B;  3HI2 A;  4PK6 A;  4ZS2 A;  1NAF A;  2BZB A;  3FBZ A;  2X9W A;  3CQX C;  4WW0 A;  2N1G A;  3CML A;  4EB6 E;  3AA6 B;  4XBF B;  4I43 B;  3I9Y A;  5JRC A;  3DTO A;  5FXX A;  1H7C A;  3P8C D;  2XUE A;  3GN5 B;  5DJQ C;  3KVA A;  3RH3 A;  2ZM8 A;  4ZHQ E;  4H9Q C;  2A2F X;  5JR9 B;  5KDM C;  4UEL A;  2NW7 A;  4HE8 A;  3E22 E;  2IC6 A;  3F31 A;  5H6Q B;  2ZLY A;  3NRY A;  4EAH A;  3ZPO A;  3HA4 A;  3FBL A;  4EZH A;  4ZI3 D;  2D5U A;  3N9P A;  5JR9 C;  1WRD A;  1MIY A;  2CCQ A;  4H9N C;  4ZI7 E;  1QSD A;  1ZEE A;  2L8K A;  3C4X A;  2UXX B;  4X20 E;  3NBX X;  2NTX A;  4UV9 B;  4JEU B;  2UXN B;  1HFA A;  3QC9 A;  4HEA A;  2PBI A;  3Q5X A;  3PTR B;  3C64 A;  3SRZ A;  4TV9 E;  2PJQ A;  2NTY A;  5BMV E;  5EZY E;  3L3P A;  1LVK A;  5L3B B;  3N2G E;  2KZ7 B;  4AKI A;  2JMH A;  4PK4 A;  3N5L A;  1BR2 A;  5EK4 A;  5CB4 E;  5CA0 E;  5L3D B;  3ZC0 A;  3VKH A;  1UX5 A;  3RYC E;  2X51 A;  2LT3 A;  5L3G B;  4AKG A;  5DAB A;  3PUR A;  2ZM0 A;  4H9P C;  4PFO A;  4KMC A;  2CWY A;  2ES0 A;  2KIN B;  3ANW B;  3ETU A;  4L0R A;  3N9M A;  3FB2 A;  3L09 A;  2W0G A;  3AAA B;  2LSI A;  4BA9 A;  5AFU L;  1ZV4 X;  5TAO A;  3EUH A;  3C50 A;  3AA1 B;  1UX4 A;  2VKH A;  3N9N A;  4QX8 B;  4KBM B;  3DP7 A;  2XAQ B;  5IYZ E;  3PUG A;  5CA1 E;  5J2U E;  1X79 A;  3WAK A;  3KVB A;  1D1C A;  1NWM X;  3CVR A;  4QXC B;  3UTK A;  4QHO A;  3HL6 A;  5LOV E;  4L5G A;  3SOL A;  3OYZ A;  4WBO A;  2X68 A;  3T8O A;  3HKE E;  5J1G A;  5JH7 E;  2JPF A;  3ONX A;  4O4H E;  4AKL A;  5DQV A;  3MA9 A;  2NP9 A;  3IF8 B;  4IHJ E;  1D1A A;  3PUA A;  5LP6 E;  4TX5 A;  4E7Z A;  2D0T A;  4O4L E;  1MIW A;  4KUM B;  2JRK A;  2M67 A;  4J2C A;  5LBQ B;  1D1B A;  4GK5 E;  2CEA A;  4G2A A;  3B57 A;  4O8S A;  4UF0 B;  3GMI A;  4GIW A;  2X67 A;  4OFZ A;  1S94 A;  3RYH E;  5LJN A;  4IE7 A;  4IE6 A;  5LNK A;  3N2O A;  4P0A A;  4ZS3 A;  1AJ3 A;  3Q2M A;  1YD8 G;  3QK6 A;  3V5U A;  2OA5 A;  5JDL A;  1KNZ A;  1MNE A;  3CQG B;  3I9W A;  2NOX A;  1U5P A;  2W63 A;  4QWN B;  2K5B B;  3BQI A;  4XAX B;  5HWY A;  4MLK A;  2CE7 A;  2BVM A;  2EHO A;  4I4T E;  4AQF C;  1LVF A;  2CXD A;  5KMG P;  5IHY A;  3K8P C;  3UUN A;  5JDF A;  2LSJ A;  3ESL A;  4EIW A;  4IGU A;  1T98 A;  3VHL A;  2ODV A;  3M65 A;  1IAP A;  4UF0 A;  4JLE A;  2D0U A;  2WWU A;  2ZMA A;  4CXW A;  2IW5 B;  4TV8 E;  2IC9 A;  5FXZ A;  4BAY B;  4UEM A;  3LBX A;  2X0L B;  1VRB A;  4UVA B;  3ZCJ A;  4E7S A;  4HKA A;  4AKH A;  1HS7 A;  5L2L A;  3IEE A;  3UUX B;  2KMF A;  1FIO A;  3EDU A;  3ZYM A;  3ZLI A;  2LHR A;  4EYU A;  4KP3 C;  3OJA A;  3ZYL A;  3TKL B;  2I59 A;  3AB3 B;  1MND A;  2NW8 A;  4AQF A;  2DHR A;  3Q5W A;  4TZ4 C;  3ZN0 B;  2VKO A;  2P9B A;  3PUS A;  4H9R C;  3KV5 A;  1B7T A;  4PFP A;  4A56 A;  1LKX A;  4AI6 A;  3D0T A;  2N9D A;  2RP4 A;  4PAG A;  2EHO D;  3HKD E;  5M4Y A;  2CM0 A;  3HKB E;  3AA0 B;  3AVS A;  1Z0P A;  2C5I T;  5L3E B;  2XAJ B;  1MMD A;  5LHH B;  3NRX A;  4IST A;  2WMN A;  3EVY A;  3MAC A;  4MFR A;  5LBM A;  1OXZ A;  5FY1 A;  2LSY A;  2PG8 A;  4IE4 A;  3CQC B;  4QX7 B;  3C98 B;  3GWH A;  4B6X A;  3UUM A;  4ASK A;  1EZ3 A;  4IDZ A;  2E8I A;  2D2S A;  4K0U A;  3ZCI A;  5HXR A;  3SWH A;  2VKD A;  2YU1 A;  4I50 E;  2C0S A;  3JC6 D;  1D0Y A;  3MKD A;  3K3Q C;  3K3O A;  1IJ5 A;  2V7M A;  2PFV A;  2SPC A;  2GK9 A;  3LK3 B;  3AVR A;  1HF8 A;  3K3N A;  2XQY A;  4DVD A;  2XAF B;  4H63 H;  4CI2 B;  1IJ6 A;  4AKR B;  3RRC A;  4UV8 B;  4PJM A;  1IZN B;  3U3I A;  3RC3 A;  1ZHC A;  2JMK A;  3E0Z A;  4PW8 A;  4CQI A;  1BR1 A;  3C51 A;  4CI3 B;  2X9Y A;  3MZK B;  1VOM A;  4QKN A;  5JRE A;  2H3R A;  2H7O A;  3AA7 B;  4ISS A;  5FYM A;  5JR9 A;  2XAH B;  2L3L A;  5FMN A;  2V1D B;  5ADX L;  3NZP A;  1WYC A;  3RRW A;  1V9D A;  3B13 A;  5JDN A;  3KIN B;  4PK5 A;  2V26 A;  4O4J E;  2ODU A;  2LOP A;  1HX8 A;  2RA1 A;  3Q9D A;  2DI4 A;  4H9O C;  5JVD E;  1E1H B;  1YKE B;  3S4U A;  3H3A A;  2X66 A;  3RC8 A;  3F57 A;  3OBV E;  2CXF A;  5LJM A;  4DO0 A;  3I0Q A;  4UIG A;  5JDQ A;  4X1Y E;  5HAX A;  3RKO A;  5L3C B;  1FEW A;  4O2A E;  1HTJ F;  2CWO A;  4I55 E;  2DNX A;  3PDY A;  5HXS A;  3LK2 B;  3KV4 A;  3LG7 A;  4UVC B;  2CA5 A;  3ANW A;  3R6N A;  3WI3 A;  2BVL A;  5F8P A;  4YHJ A;  3AAE B;  4CXX A;  2DWG A;  2VAS A;  2N2N A;  5JDH A;  1D0X A;  5JRC B;  5LGT B;  5JDM A;  3A5X A;  4DMV A;  5J2T E;  2XTL A;  5HYA A;  2IAK A;  2W00 A;  1KK7 A;  2K9A A;  4M1P A;  3ZJ1 A;  2WM9 A;  3U78 A;  3ZC1 A;  5FXW A;  2VL8 A;  2V7L A;  2A3D A;  2VWA A;  4ADZ A;  5LGN B;  2DLR A;  3KV6 A;  2X9H A;  2Y48 B;  2LSG A;  4L9I A;  4EYY R;  3CX7 B;  4DMW A;  2XAS B;  3ZN1 B;  4H63 V;  1MIV A;  3H37 A;  2Y6X A;  2YU2 A;  4OYK A;  1MMG A;  4GOU A;  2C5K T;  3KDS E;  3VKG A;  3FXE B;  2EHO B;  4TUY E;  5HXC A;  5FY7 A;  1FMV A;  1CUN A;  5LGU B;  3VU7 H;  2CLY C;  4X1I E;  2W62 A;  4WNK A;  3PE0 A;  4OK0 A;  4P0B A;  4NUV A;  4CI1 B;  2HPL A;  3OKQ A;  4PJN A;  5HWX A;  4HTE A;  2W61 A;  4CXY A;  3WAJ A;  4EOZ B;  4F6R C;  2KLQ A;  2E9X D;  2KT9 A;  4GYS A;  5LHI B;  4ZI2 D;  4U72 A;  4Z8X A;  4BJN A;  1WYB A;  4H9S E;  3I1A A;  2CMR A;  5E0O A;  5LCY A;  3P7I A;  2V7J A;  4U74 A;  3AAI A;  3E08 A;  3R84 B;  3FXD B;  1WLX A;  3RX6 A;  2ZM2 A;  4YLH A;  5FNV E;  4GYR A;  4C91 A;  5JQG E;  4O2B E;  3GN5 A;  3MJX A;  4UVB B;  4UXN B;  3N9O A;  4IE0 A;  5A1L A;  1YW0 A;  1LRZ A;  3HKC E;  4G63 A;  3JC6 C;  4HN9 A;  4DND A;  1D0Z A;  3SS1 A;  4TN7 B;  2VK9 A;  3UUL A;  2G0U A;  2H7V C;  3CKD A;  2WBL A;  4FJO A;  2LM9 A;  4YJ2 E;  2DCF A;  2KXP B;  2HH7 A;  4P09 A;  4XZC A;  3CPZ A;  4ILU A;  4WBN E;  4OHF A;  2JJ9 A;  2KWH A;  3KBT A;  5GON E;  3KFW X;  5DQW A;  4ZI3 C;  3O1H A;  5FXV A;  4AQG A;  5HXH A;  4QXH B;  4OYJ A;  4C90 A;  1MMN A;  2MTQ A;  2E9X A;  3W15 B;  2J1D G;  3LK4 2;  3J9X 1;  1SHZ C;  2NWB A;  2X9X A;  4ZI2 C;  5EK2 A;  2QGS A;  2WSS V;  1HCI A;  4EXT A;  4AXP A;  2ACX A;  4IIJ E;  2Y8D A;  3EDV A;  2KND A;  3ZMS B;  4ZOL E;  2L9Q A;  2EHO C;  3CWZ B;  2YEV C;  3C4W A;  2V7K A;  3OYX A;  4JUY A;  2YK0 A;  3ZEF B;  3PU8 A;  1UCU A;  4BJM A;  1O3X A;  1G8X A;  3KBU A;  2YIN A;  3MXZ A;  3NZQ A;  2XAG B;  2C5J A;  2E9X C;  3PU3 A;  1WR6 A;  3GA8 A;  1G73 A;  3DJB A;  2HPJ A;  4GK0 E;  5FY0 A;  3KV9 A;  2Q9Q A;  3LFM A;  2KWI B;  3FHN A;  2LJL A;  4NUU A;  4QXB B;  2NW9 A;  3ZMU B;  3ZYK A;  4DBR A;  3ZJ2 A;  3RPU A;  2K24 A;  5H6R B;  3UT5 E;  2LOS A;  2BDE A;  3ZMZ B;  4PNI A;  1ZKE A;  3BQL A;  2VKJ A;  3LJC A;  2CLY B;  3ETV A;  3J7Y q;  4HGA A;  2A72 A;  4EZ4 A;  2XHE B;  1YKH B;  3N2K E;  2V7I A;  2QA7 A;  5C8Y E;  3ZMT B;  4O4I E;  4MBQ A;  4JEH B;  3RYI E;  3ZMV B;  3N9L A;  3BK9 A;  3RYF E;  4IE5 A;  2MOZ A;  2E9X B;  4MHC A;  5LG4 A;  5LHG B;  2LEH A;  2WMO A;  3CX6 B;  2Q9Q B;  3MK7 C;  3QUJ A;  4FI5 A;  1QUU A;  4YFS A;  2VB6 A;  3F2E A;  5LYJ E;  3HR0 A;  2WAU A;  1FMW A;  2LE8 A;  3PUQ A;  4ANJ A;  2B1E A;  3BQK A;  4N78 D;  4HFV A;  4V1A v;  3O1J A;  2LHN A;  5KX5 E;  4CZZ B;  2Q9Q D;  1SA0 E;  4DBQ A;  2K48 A;  3IBP A;  3C4Z A;  5JDG A;  1BR4 A;  2CXL A;  4PJJ A;  3O4X E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...