3J7Yq

Structure of the large ribosomal subunit from human mitochondria
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
128
structure length
128
Chain Sequence
YRARPPPRRRPGPRWPDPEDLLTPRWQLGPRYAAKQFARYGAASGVVPGSLWPSPEQLRELEAEEREWYPSLATMQESLRVKQLAEEQKRREREQHIAECMAKMPQMIVNWQQQQRENWEKAQADKER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Structure of the large ribosomal subunit from human mitochondria.
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
q PF10147 CR6_interact Growth arrest and DNA-damage-inducible proteins-interacting protein 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1430 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3j7yq00
3J7Yq 4V1Av
chains in the Genus database with same CATH superfamily
3PU3A 2WZIA 1MMGA 1WFDA 1D0YA 4AQGA 2YDRA 4QX7B 1BR0A 1WR0A 2XQ3A 3RX6A 2CWYA 2Q9QB 2Y8DA 2VB6A 5LHGB 4AKHA 5TAOA 3BQLA 4JI5T 2LSYA 5CJ5A 4COFA 2D0UA 1N34T 4NIQA 3SWHA 5LYJE 1XDOA 1BR2A 2M6BA 2BG9B 3AAEB 5C2TA 5FXWA 1OWAA 2JMKA 5EK2A 4V1Av 2BS4A 3U3IA 5AQHB 3PJAA 4EZ4A 3UFGA 3PUAA 4HFBA 5CA1E 5HXHA 4JI4T 5LGTB 1UGOA 3P7IA 2XSBA 3LK42 3QB5K 5FKYA 2VKHA 3LK3B 4A5XA 2VL8A 2KMFA 5AQFB 2BKPA 1KFYA 5HXEA 4LFAT 3PDYA 5FVLA 4YLHA 5GONE 5FXVA 1UX4A 1L0VA 3L09A 3ZEFB 2A3DA 2UXDT 2ZM6T 4CXYA 2EHOA 4HFEA 3C64A 3EUHA 4IDZA 4CN4A 5JVDE 1XZYA 2X9XA 5HEUA 1YKEB 3AAAB 4L5GA 4IDPA 2WP9A 3FHNA 4DR7T 2E2AA 4P0AA 3PUGA 1ZP0A 4TX5A 3KBUA 5JQGE 3I0OA 4X1KE 4YJ2E 3TLWA 3U78A 2ODUA 4A97A 2LKGA 3KV9A 5FMNA 2WAUA 2Z6EA 1OEDC 3FZMB 5DQVA 5LGNB 4JI8T 3AE2A 3AEEA 4E7SA 2FBWA 5FNVE 4GKJT 4PK6A 5J2UE 5HCMA 2ODVA 2XPKA 2YOEA 3UT5E 2XQ6A 4XAXB 3ONLC 3WAJA 3I9YA 4G2AA 2CLYC 4U7YA 2LRKA 2V1DB 4C90A 1U5PA 3M3ZB 4X66T 3UU4A 1S94A 4ISSA 5LCYA 3JAFA 2W2UA 4UIGA 3G06A 5ETWA 4TN7B 2YDSA 3EAMA 1AJ3A 2IDOB 3UQ4A 2LLYA 2WU2A 1U4QA 4JYAT 2XM2A 4JBWF 3RYIE 2KLQA 3ONXA 3ANWA 5LJNA 4CXXA 3ZMVB 2BKNA 3M65A 3OJAA 1BR1A 2BBJA 1QLBA 3ZCIA 4ANJA 4ZI2D 4DR6T 2BS3A 3Q5DA 3K3QC 4WBOA 3BQKA 5JRCA 4ZI3D 2PBIA 3N2OA 3ZKRA 4YTNA 4O2AE 2DNXA 1Y64B 4CZZB 4AXPA 5FVKA 3AE3A 2YU1A 1J5ET 5ADXL 5JR9A 3AE1A 2ZM8A 4B6XA 2UXCT 2J4GA 5HCJA 3PJAJ 3JADA 4P0BA 3ZN1B 4QXHB 2ZLYA 2D9DA 2IW5B 2BZBA 4IE6A 3N9NA 2Y48B 5DQWA 3HI2A 2LSIA 1D1AA 3F31A 4YSYA 2ACZA 3ZPOA 2WU5A 3L8RA 1T8BA 2EHOD 3AVSA 3N9PA 5AQPB 3LBXA 3ZYMA 2MAWA 4Z90A 2J62A 3AEGA 4AQFC 4GYSA 4EXTA 3P4RA 3SS1A 4O4HE 3UTKA 2CPTA 2LM2A 1OEDB 2XY8B 3EDUA 4I55E 3CQCB 1VRBA 2WWVA 3PU8A 3IBPA 2C5JA 1FIOA 4TWDA 5HEHA 3RH3A 2CLYB 3A7MA 4IDQA 5LJMA 2JMHA 4MFRA 3OPCA 1SUMB 3H3AA 3AXJA 3A5XA 4U33A 3PUWF 5EK4A 3ETVA 2XQ4A 4JV5T 3DTOA 2E5LT 2UXXB 1E7PA 4OFZA 2BVLA 1KEYA 2FJAA 4CI1B 3H37A 5E0OA 2UUAT 1R8IA 3F57A 3GN5A 3HL6A 4A56A 2QYWA 2KWIB 2YK0A 4UXNB 5AQLB 3ZN0B 5L3DB 1MNDA 2W66A 1T7SA 4ILCA 3T1YT 1LKXA 4KUMB 3S4UA 4OHFA 5BMVE 4OK0A 1N33T 2M6IA 2XQYA 2E5VA 2DI4A 2L9QA 3OYZA 2RP4A 1H7CA 3PUSA 3TLVA 3PURA 3CIRA 4YTMA 4X64T 2X0LB 5HEGA 4XZCA 4DVDA 4DMVA 4ZI7E 2ZM0A 1GQEA 2D2SA 4EAHA 2VL0A 2XHEB 4DMWA 3LDQB 4ZS3A 1VOMA 3RIFA 3LG7A 5KDMC 5AFUL 3I1AA 5HWYA 4L0RA 3RLFF 3ZJ1A 3EI0A 2YU2A 5LP6E 4KI0F 4KMCA 3P4QA 5A1LA 2Q9QD 3KV6A 3RPUA 4K0UA 4DNDA 2XTLA 3N9LA 1UK5A 4GK0E 2DHRA 3O1JA 3I0QA 5L3EB 5CB4E 4HWIB 2R6GF 2A2FX 4CI2B 2BS2A 4I4TE 4H9SE 2C0SA 4JI3T 4NXNT 2E9XC 1M7KA 3Q5WA 2K24A 2I59A 4JEHB 2CRBA 2XAFB 1CHUA 2XAGB 3PUXF 1BR4A 4HFVA 4DV7T 4EOZB 3TKLB 2KNDA 2D0TA 3PUYF 2WDQA 3QK6A 2LOPA 3RKGA 2CXLA 1KK7A 4PJLA 2C5KT 2V6YA 3SFDA 4EIWA 2K5BB 2W67A 2H7VC 3Q5EA 4CN1A 1XMOT 2JQQA 2UXNB 4IDOA 1E2AA 5LBQB 2L3LA 4IE4A 4CI3B 4CQIA 3EHZA 2CE7A 2XQ9A 4U7IA 3CMLA 1SE7A 4HN9A 5C8YE 4LF7T 1HNZT 2NTXA 4UF0A 4YFSA 5LHHB 4MLKA 3HKEE 2I0MA 1XMQT 2RPAA 3CPZA 3ABVA 5AQRB 1FMVA 4PK4A 4MBQA 2WCAA 1KNZA 3MJXA 2DLRA 3RYHE 3CKDA 3UU5A 4TNWA 3PUQA 4ZHQE 2CHNA 2WWUA 5ABFA 3MKDA 4H9NC 1KNPA 4TV9E 2VQET 5L4EA 4TNVA 2A9UA 2JPFA 2UU9T 4AKIA 4U31A 3FZHB 3A8YC 4KHPT 2WS3A 2FJDA 5FL0A 1IJ5A 3AA1B 2E8IA 2WDRA 2H3RA 5AQMB 2KWHA 2J1DG 1CUNA 3RKOA 1US7B 2NP9A 3K8PC 2B76A 4F6RC 5IYZE 2PFVA 2WZHA 5CA0E 2X67A 4CXWA 1DU2A 3JC6C 3P50A 3ZMSB 5LGUB 3C51A 5JDMA 2QVAA 4EYUA 2E9XB 4PAGA 4LF5T 2XASB 1NAFA 2WSSV 4YHJA 3FBZA 2X51A 2JJ9A 2CMRA 3N9MA 4DR4T 2ACXA 4H9PC 2Y6XA 2V7LA 5AQVB 4DV1T 4ZS2A 1O3XA 3J9X1 2XZEA 4HFIA 3NVOA 1MIVA 2X0HA 2L8KA 2QA7A 3VR8A 4ISTA 2OLTA 1WRDA 3RF1A 1MMNA 5BR8T 5HAXA 5JH7E 2HPJA 2HH7A 4H9OC 4ZI2C 5FY0A 1QSDA 3B5MA 3O1IA 4IREA 4P09A 3C98B 4IL4A 2N2NA 2V5DA 4ZI3C 4YTPA 5L2LA 4B3RT 4QX8B 4EEBA 4Z91A 4EEDA 4U2ZA 3RYCE 2W00A 2NW8A 3NZPA 1IJ6A 1I94T 4QXCB 4MALA 3FXEB 3CQXC 2KINB 2V7JA 1WR6A 1HX1B 3UU6A 4QXBB 3NWIA 4BAYB 3FBLA 2QGSA 4H9RC 4L9IA 1IBMT 5KXJA 2VURA 4U72A 2LSKA 2JIWA 5H6RB 3ZC0A 3GWHA 3Q5XA 3T1HT 5AQGB 2AXDS 1W0BA 4AIUA 3ZMTB 3P8CD 2EHOC 3OKQA 4M1PA 4IIJE 2LHNA 3UUXB 2X9YA 2J47A 3QOFA 3O9XA 3RIUA 2CM0A 2Q9QA 4AQYT 3FZFB 5AQQB 3TLSA 4DV3T 2RA1A 3CQGB 3GMIA 1ZHCA 5C3JA 3ZC1A 2SPCA 1SA0E 2BG9E 4B3MT 4QKNA 4EGWA 1HTJF 5AQSB 4DR3T 1SHZC 5FP3A 4DBRA 2BG9A 4DV4T 3L3PA 3AEFA 1IZNB 5LG4A 3VKHA 4G63A 3JAEA 2IMLA 4IT4A 4U2YA 3R6NA 3ZYKA 3NKZA 2W4XA 3CX8B 3HKDE 4JI0T 3CWZB 3B13A 2NW9A 5F5WA 3CX6B 3ZT5A 2LHRA 3I9WA 2FJEA 5HXSA 2JQ9A 3PTRB 4LMKA 3RIAA 5DABA 4I50E 3N9QA 4UV8B 1Z8UA 2CA5A 1HX8A 2WBLA 4AKGA 2KSRA 4ZZBA 3MXZA 4EZHA 2FJBA 5KMGP 5JDFA 4YHHT 4YXDA 2IIUA 4DR1T 3CX7B 3KV4A 5F8PA 3C4WA 3P4WA 4JEUB 3C4ZA 4NUVA 3PV0F 1NENA 1G73A 4O4IE 3K3OA 5HXRA 3UUNA 1NEKA 3AE4A 5EK3A 3IF8B 4EV6A 3AEDA 4LMJA 3UUMA 4HE8A 2X66A 2N1GA 2V7IA 4Q25A 1IAPA 3DJBA 4BA9A 2WQYA 4TZ4C 2X9HA 3EABA 3KVAA 4HGAA 5HXCA 5JR9C 1MIYA 2V6XA 4EB6E 2CHOA 2VWAA 5JDGA 1MMAA 2EHOB 2BVMA 4JI7T 4KHZF 3AEAA 5EZYE 1D1BA 3AE9A 1W9RA 1QUUA 4B3TT 4PK5A 4YSZA 4FI5A 1UURA 3D0TA 3T8OA 4DR2T 5ABEA 2X0YA 3E22E 4IGUA 3VRAA 5LMUT 3BQIA 3MK7C 5LA6E 5JDHA 4EYYR 4DV6T 4WYVA 2H88A 1WCRA 3BK9A 2WM9A 4O8SA 2LRLA 5LB7B 2XM1A 4IE5A 4P1NA 2WMOA 1Z0PA 2DWGA 3MACA 5JREA 5AQTB 5ABGA 5JTGA 3UU8A 3UULA 3KVBA 3WI3A 3VR9A 4UVAB 1LVKA 4BJNA 1YD8G 2MYSA 2UUCT 2V26A 5HYAA 3WAKA 2VQFT 3PUVF 1Y01A 3DP7A 3W15B 4DV5T 1I6ZA 5IWAT 4E7ZA 4O4LE 4JI2T 3CVRA 3AE5A 2NWBA 3Q9DA 4UV9B 3ZSTA 4WNKA 3V5UA 4YT0A 3RHWA 3ESLA 1T72A 2XAJB 3ANWB 3ETUA 3MZKB 2V7KA 2XQ5A 2XAHB 4DO0A 1YW0A 3ZLIA 4DBQA 4X62T 1MIWA 1YKHB 1FEWA 2H7OA 2PG8A 2XQAA 4GIWA 4PFPA 3TLTA 3UQ7A 1W0AA 2XQ7A 2LEHA 5AQNB 5J0ZA 1OEDE 3C4XA 5JRCB 3RC8A 3RI5A 4WZXA 1T98A 1OEDA 1OXZA 1HCIA 5AQOB 5JR9B 3AEBA 2E9XD 3IEEA 1HG5A 2X68A 4NXMT 2CXDA 5DJQC 2PTFA 2UUBT 4Z8XA 3LJCA 1KNRA 1VCSA 5CFBA 5LBMA 3UFEA 2BDEA 1UX5A 4MHCA 5L3CB 1X9BA 4FJOA 3IHRA 2BKOA 2GK9A 5M4YA 1YQ4A 5HEJA 5LOVE 4ADZA 1IBLT 2A72A 4K0KT 3HKCE 4AI6A 1JNZA 2P9BA 2YN6A 3NZQA 3LBXB 2OV9A 1YXRA 3SRZA 4DUZT 4NUUA 1ZEEA 4LF6T 5FXZA 4O4JE 2JQHA 3EDVA 1XNRT 5AQJB 2CBJA 4ILAA 4X65T 4ILBA 3ZMZB 4U74A 2VVSA 3ZYLA 3LSVA 5LNKA 4GYRA 3ZMUB 4ILUA 4AKRB 2V5CA 5ABHA 4DUYT 1D0ZA 2VKDA 2DCFA 4QH4A 4DV0T 3O1HA 2VKJA 4LFBT 2YEVC 3JCFA 3AXJB 2IUBA 1N36T 4JUYA 1W09A 3P4PA 3OBVE 4GOUA 3GN5B 4YJ3E 2BBHA 2LJLA 5FY1A 1S35A 3AE6A 4KP3C 3N9OA 5JDQA 1UUSA 1J5WA 2HN2A 4PFOA 4QHOA 3QC9A 1UCUA 3AA6B 2LE8A 4HEAA 2LKHA 2NW7A 4IE7A 1IBKT 4ZZCA 3L39A 3K3NA 4LF4T 3OVUA 3GA8A 3N5LA 4KX6A 3QNUA 3O4XE 5FY7A 4AQFA 2XUEA 4X5TA 3VRBA 2XQ8A 2K48A 3QB5A 4AKLA 3RC3A 3FZLB 4LFCT 2MOZA 3JC6D 2YINA 1MMDA 1G8XA 4H63V 3FXDB 4PJMA 2XJ7A 4HWDA 2LT3A 4H63H 1J1JA 1ZV4X 2ES0A 5IUXA 3EVYA 3NRYA 3NRXA 1X79A 4ASKA 2DWKA 3RGLA 1LRZA 2JRKA 2W61A 3KDSE 3HA4A 2WY2A 3ZT6A 4KBMB 4HWHA 4CN6A 3SFEA 4JI1T 5L3FB 3RYFE 4PW8A 1WYBA 2HHHT 1HR0T 2WMNA 4HTEA 4QH5A 3VU7H 2ZMAA 4HFDA 1XDPA 3AE7A 4OX9T 4BJMA 2W63A 3UU3A 3CK6A 3B57A 4QH1A 2DL1A 3KINB 2CXFA 5HEOA 5F3JA 3VHLA 3ZSSA 2YDQA 3Q2MA 4GK5E 4ZOLE 3KV5A 4J2CA 2D5UA 4IHJE 3FZKB 2JQKA 4UVBB 4WBNE 1HNWT 3N2GE 2IC6A 3HKBE 2K3WA 3NBXX 2M67A 3UUBA 4DV2T 4X1YE 4N78D 2V6YB 4IE0A 2W62A 1YQ3A 2NTYA 2CCQA 2CBIA 3E08A 3ONJA 4PNIA 3VKGA 1HNXT 3ZT7A 4HKAA 5AQIB 5L3BB 4OYKA 3RRWA 1XNQT 1XWMA 2H89A 1HFAA 1VCTA 3E0ZA 5L47A 4LF8T 1EZ3A 4UF0B 2YKSA 4X20E 4LMLA 1JNRA 4YY3T 1WYCA 2LM9A 2C5IT 2NR4A 3SOLA 5CGMA 4C91A 2K9AA 5LG3A 3AVRA 1D1CA 1ZKEA 2V8SV 2W0GA 5KX5E 4ZEYA 3RQWA 2MTQA 2E9XA 2WB5A 3K1SA 2VASA 3LFMA 4B3ST 3OYXA 5ABFB 4XBFB 5JDLA 2I6HA 4I43B 4IL9A 2VK9A 2G0UA 2CWOA 3KBTA 3KFWX 3AAIA 4WW0A 4UR9A 3RIUC 3R84B 2KXPB 4PJNA 5FYMA 5LMNT 2Q9QC 2KZ7B 4JI6T 5LHIB 4AISA 4UEMA 2LSGA 2V7MA 2X9WA 4A98A 3AE8A 4O2BE 1D0XA 2UXBT 1M62A 4OYJA 3LK2B 2BG9C 3H3MA 4H9QC 4UVCB 2NOXA 2XSAA 3IA3A 5J2TE 4HWFA 5AQKB 1B7TA 1NWMX 5L4HA 4ERRA 3PE0A 1HF8A 3HR0A 5FXXA 4HFHA 3TLUA 1FJGT 4HFCA 4GKKT 4HWCA 1HG2A 3X1DA 2IHR1 2HPLA 2MPKA 2PJQA 3AECA 3RRCA 5AQUB 3PUZF 5L3GB 3ZCJA 4TWFA 2F4VT 4QWNB 1ZOYA 2ZM2A 1FMWA 4I0UA 4IDNA 2HN1A 2LOSA 3OTOT 4LF9T 3QUJA 5J1GA 2B1EA 4TV8E 1KF6A 2LSJA 3AA7B 4ZXLA 2IC9A 4YSXA 3AA0B 5LXTE 2XAQB 3P4SA 4U3CA 5IHYA 1WLXA 2QRXA 4TWHA 2VVNA 2FUPA 4UELA 2KT9A 3N2KE 3MA9A 4X1IE 3J7Yq 1MNEA 5H6QB 4NPPA 4TUYE 2N9DA 2CEAA 4DR5T 3F2EA 2VKOA 3C50A 2IAKA 5HWXA 5FL1A 3V5SA 4DIDB 1V9DA 1N32T 1E1HB 2WDVA 4F8HA 1LVFA 3FB2A 5JDNA 4JLEA 2MBGA 3ZJ2A 1HS7A 3AB3B 2AE9A 2OA5A 4PJJA 3RQUA
chains in the Genus database with same CATH topology
3PU3A 3OBVE 4QKNA 1HTJF 2XQYA 4GOUA 3GN5B 4YJ3E 2LJLA 2DI4A 2L9QA 1MMGA 1D0YA 1SHZC 3OYZA 5FP3A 4AQGA 5FY1A 4DBRA 3L3PA 1S35A 2RP4A 1H7CA 3PUSA 4KP3C 4QX7B 3PURA 1BR0A 3N9OA 3RX6A 2CWYA 5JDQA 1IZNB 5LG4A 4PFOA 4QHOA 2Q9QB 3QC9A 1UCUA 2X0LB 2Y8DA 3AA6B 2VB6A 2LE8A 5LHGB 3VKHA 4G63A 4XZCA 4DVDA 4DMVA 4HEAA 4AKHA 5TAOA 3R6NA 3BQLA 4ZI7E 3ZYKA 2NW7A 2LSYA 2ZM0A 4IE7A 2D0UA 3CX8B 2D2SA 3HKDE 4EAHA 3CWZB 2XHEB 3B13A 3K3NA 4DMWA 3SWHA 4ZS3A 1VOMA 2NW9A 1BR2A 5LYJE 3LG7A 5KDMC 3CX6B 5AFUL 3I1AA 3GA8A 2LHRA 3I9WA 3N5LA 5HWYA 3AAEB 5FXWA 4L0RA 3O4XE 5FY7A 4AQFA 3ZJ1A 1OWAA 2JMKA 2XUEA 5HXSA 5EK2A 4V1Av 2YU2A 5LP6E 3PTRB 4KMCA 5DABA 5A1LA 2K48A 4I50E 2Q9QD 3N9QA 4AKLA 3U3IA 4UV8B 3RC3A 2CA5A 2MOZA 4EZ4A 3PUAA 3KV6A 3JC6D 5CA1E 2YINA 5HXHA 1HX8A 1G8XA 1MMDA 2WBLA 4H63V 4K0UA 3RPUA 3FXDB 4AKGA 1SA0E 3P7IA 5LGTB 3LK42 4PJMA 4DNDA 2VKHA 2LT3A 3LK3B 2XTLA 4H63H 1ZV4X 2ES0A 2VL8A 3EVYA 3MXZA 3NRYA 4EZHA 5KMGP 2KMFA 3N9LA 3NRXA 1X79A 5JDFA 4ASKA 4GK0E 5HXEA 2DWKA 2DHRA 3O1JA 3PDYA 3I0QA 1LRZA 4YLHA 5L3EB 2JRKA 3CX7B 3KV4A 5F8PA 2W61A 5CB4E 3KDSE 5GONE 3C4WA 1UX4A 5FXVA 3HA4A 2A2FX 4KBMB 4JEUB 4CI2B 3L09A 4I4TE 3C4ZA 4NUVA 3ZEFB 4H9SE 2C0SA 1G73A 2A3DA 2E9XC 3K3OA 3Q5WA 4O4IE 5HXRA 5L3FB 2K24A 3RYFE 3UUNA 5EK3A 2I59A 3IF8B 4PW8A 1WYBA 4JEHB 4OK0A 2WMNA 2XAFB 3UUMA 2EHOA 2XAGB 2X66A 4HE8A 4CXYA 4HTEA 2N1GA 2V7IA 1BR4A 3VU7H 1IAPA 2ZMAA 4HFVA 3DJBA 4BA9A 3C64A 4EOZB 3TKLB 2KNDA 2D0TA 3EUHA 4IDZA 3QK6A 4TZ4C 5JVDE 4BJMA 2W63A 2X9HA 2X9XA 1YKEB 3AAAB 3KVAA 4L5GA 4HGAA 2LOPA 5HXCA 2CXLA 5JR9C 3B57A 1KK7A 1MIYA 4PJLA 2C5KT 3KINB 4EIWA 2CXFA 3FHNA 2K5BB 4P0AA 4EB6E 3PUGA 4TX5A 5F3JA 3VHLA 2VWAA 1MMAA 2H7VC 2EHOB 5JDGA 3Q2MA 4GK5E 3KBUA 2BVMA 2JQQA 4ZOLE 2UXNB 5JQGE 5EZYE 3I0OA 4X1KE 5LBQB 4YJ2E 3KV5A 1D1BA 2L3LA 4J2CA 4IE4A 4CI3B 2D5UA 4CQIA 3U78A 2CE7A 4IHJE 2ODUA 3KV9A 5FMNA 1QUUA 4UVBB 4WBNE 2WAUA 4PK5A 2Z6EA 4FI5A 3CMLA 3D0TA 3N2GE 3T8OA 2IC6A 5DQVA 5LGNB 3HKBE 4HN9A 3E22E 5C8YE 3NBXX 4IGUA 2M67A 4E7SA 4X1YE 4N78D 2NTXA 3BQIA 3MK7C 4UF0A 4IE0A 4YFSA 5FNVE 5LA6E 4PK6A 5JDHA 5LHHB 4MLKA 5J2UE 2W62A 4EYYR 2NTYA 3HKEE 2ODVA 2CCQA 3E08A 4PNIA 3UT5E 3VKGA 4XAXB 3CPZA 3WAJA 3I9YA 4G2AA 4HKAA 2CLYC 3BK9A 1FMVA 5L3BB 2V1DB 4OYKA 4PK4A 3RRWA 4C90A 1U5PA 4MBQA 2WM9A 1HFAA 4O8SA 1KNZA 3MJXA 3E0ZA 2DLRA 1S94A 3RYHE 4ISSA 3CKDA 5LCYA 4IE5A 1EZ3A 3PUQA 4ZHQE 4UIGA 4UF0B 2WWUA 2WMOA 5ETWA 4X20E 1Z0PA 4TN7B 2DWGA 3MKDA 1AJ3A 4H9NC 3MACA 5JREA 4TV9E 3UULA 3KVBA 3WI3A 1WYCA 2LM9A 4UVAB 1LVKA 2C5IT 3SOLA 1U4QA 4BJNA 4C91A 1YD8G 2MYSA 2K9AA 3RYIE 2V26A 2JPFA 2KLQA 3ONXA 5HYAA 3WAKA 4AKIA 3ANWA 3AVRA 5LJNA 1D1CA 1ZKEA 3DP7A 4CXXA 3W15B 2W0GA 3ZMVB 5KX5E 3M65A 3OJAA 2MTQA 2E9XA 1BR1A 2VASA 3LFMA 1IJ5A 3AA1B 3OYXA 2E8IA 4O4LE 4E7ZA 3CVRA 3ZCIA 4ANJA 4XBFB 4ZI2D 2H3RA 2NWBA 2KWHA 4I43B 5JDLA 2J1DG 2VK9A 3Q9DA 4UV9B 2G0UA 1CUNA 3K3QC 3RKOA 2CWOA 3KBTA 1US7B 4WBOA 4WNKA 3KFWX 3BQKA 3AAIA 2NP9A 5JRCA 3K8PC 4ZI3D 2PBIA 3V5UA 4WW0A 3N2OA 4F6RC 5IYZE 3R84B 2KXPB 2PFVA 3ESLA 4O2AE 4PJNA 2Q9QC 5FYMA 2DNXA 2XAJB 5CA0E 1Y64B 2KZ7B 3ANWB 3ETUA 4CZZB 3MZKB 2V7KA 5LHIB 4AXPA 2X67A 4CXWA 2XAHB 2YU1A 4DO0A 4UEMA 2LSGA 3JC6C 5ADXL 1YW0A 5JR9A 3ZLIA 3ZMSB 4DBQA 5LGUB 2V7MA 3C51A 2ZM8A 4EYUA 1MIWA 2E9XB 4PAGA 5JDMA 1YKHB 2X9WA 2XASB 1FEWA 1NAFA 4O2BE 2WSSV 2H7OA 4YHJA 4B6XA 3FBZA 2PG8A 1D0XA 2X51A 2JJ9A 4GIWA 2CMRA 3N9MA 4PFPA 2ACXA 4OYJA 4P0BA 3LK2B 3ZN1B 4H9PC 2ZLYA 2LEHA 4QXHB 2Y6XA 2V7LA 4H9QC 4UVCB 2NOXA 3C4XA 5J2TE 5JRCB 3RC8A 2IW5B 2BZBA 4IE6A 4ZS2A 3N9NA 1O3XA 3J9X1 1B7TA 1NWMX 1T98A 4ERRA 2Y48B 5DQWA 3HI2A 2LSIA 3PE0A 1D1AA 1MIVA 3F31A 1OXZA 1HF8A 2L8KA 1HCIA 3HR0A 2QA7A 5JR9B 4ISTA 2E9XD 3IEEA 5FXXA 1WRDA 3ZPOA 2EHOD 1MMNA 1HG5A 2X68A 5HAXA 3AVSA 2HPJA 5JH7E 1HG2A 2CXDA 3N9PA 2HH7A 5DJQC 4H9OC 4ZI2C 5FY0A 1QSDA 3LBXA 3ZYMA 3O1IA 2HPLA 4P09A 4Z8XA 4AQFC 3LJCA 3C98B 4GYSA 2PJQA 3RRCA 4EXTA 3SS1A 2N2NA 4ZI3C 4O4HE 3UTKA 5L3GB 5L2LA 5LBMA 3ZCJA 4QX8B 3UFEA 2BDEA 4QWNB 1UX5A 4MHCA 5L3CB 4FJOA 2ZM2A 1FMWA 3RYCE 3EDUA 3IHRA 2W00A 2NW8A 3NZPA 2GK9A 5M4YA 1IJ6A 5LOVE 4QXCB 4ADZA 2LOSA 2A72A 3QUJA 4I55E 4MALA 5J1GA 3CQCB 3HKCE 3FXEB 2B1EA 1VRBA 3CQXC 4AI6A 2P9BA 3PU8A 2KINB 3IBPA 4TV8E 3NZQA 3LBXB 2C5JA 2V7JA 1WR6A 1FIOA 2LSJA 4QXBB 3AA7B 3SRZA 4BAYB 2IC9A 3AA0B 4NUUA 3RH3A 1ZEEA 2CLYB 5LJMA 5LXTE 3FBLA 2XAQB 5FXZA 5IHYA 2JMHA 4MFRA 4O4JE 1WLXA 2QGSA 4H9RC 4L9IA 3H3AA 3EDVA 3A5XA 4U72A 2LSKA 4UELA 5H6RB 5EK4A 3ZMZB 3ZC0A 3ETVA 4U74A 2KT9A 3GWHA 3N2KE 3DTOA 3Q5XA 2UXXB 3MA9A 4X1IE 3J7Yq 4OFZA 1MNEA 5H6QB 2BVLA 3ZYLA 5LNKA 3ZMTB 4GYRA 3H37A 2N9DA 4TUYE 4ILUA 5E0OA 3ZMUB 2CEAA 4CI1B 3F57A 4AKRB 3GN5A 3P8CD 2EHOC 3OKQA 4M1PA 4IIJE 3F2EA 1D0ZA 3HL6A 4A56A 2LHNA 2VKDA 2VKOA 3C50A 3UUXB 2X9YA 2KWIB 2YK0A 3O9XA 4UXNB 2IAKA 2DCFA 5HWXA 3ZN0B 3V5SA 2CM0A 2Q9QA 5L3DB 3O1HA 2VKJA 1MNDA 1V9DA 2YEVC 1E1HB 1LVFA 3FB2A 2RA1A 5JDNA 4JLEA 2MBGA 1LKXA 3CQGB 3GMIA 1ZHCA 3ZJ2A 3ZC1A 1HS7A 3AB3B 4JUYA 4KUMB 3S4UA 4OHFA 2SPCA 5BMVE 2OA5A 4PJJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7Y q;  4V1A v; 
#chains in the Genus database with same CATH topology
 3PU3 A;  2WZI A;  1MMG A;  1WFD A;  1D0Y A;  4AQG A;  2YDR A;  4QX7 B;  1BR0 A;  1WR0 A;  2XQ3 A;  3RX6 A;  2CWY A;  2Q9Q B;  2Y8D A;  2VB6 A;  5LHG B;  4AKH A;  5TAO A;  3BQL A;  4JI5 T;  2LSY A;  5CJ5 A;  4COF A;  2D0U A;  1N34 T;  4NIQ A;  3SWH A;  5LYJ E;  1XDO A;  1BR2 A;  2M6B A;  2BG9 B;  3AAE B;  5C2T A;  5FXW A;  1OWA A;  2JMK A;  5EK2 A;  4V1A v;  2BS4 A;  3U3I A;  5AQH B;  3PJA A;  4EZ4 A;  3UFG A;  3PUA A;  4HFB A;  5CA1 E;  5HXH A;  4JI4 T;  5LGT B;  1UGO A;  3P7I A;  2XSB A;  3LK4 2;  3QB5 K;  5FKY A;  2VKH A;  3LK3 B;  4A5X A;  2VL8 A;  2KMF A;  5AQF B;  2BKP A;  1KFY A;  5HXE A;  4LFA T;  3PDY A;  5FVL A;  4YLH A;  5GON E;  5FXV A;  1UX4 A;  1L0V A;  3L09 A;  3ZEF B;  2A3D A;  2UXD T;  2ZM6 T;  4CXY A;  2EHO A;  4HFE A;  3C64 A;  3EUH A;  4IDZ A;  4CN4 A;  5JVD E;  1XZY A;  2X9X A;  5HEU A;  1YKE B;  3AAA B;  4L5G A;  4IDP A;  2WP9 A;  3FHN A;  4DR7 T;  2E2A A;  4P0A A;  3PUG A;  1ZP0 A;  4TX5 A;  3KBU A;  5JQG E;  3I0O A;  4X1K E;  4YJ2 E;  3TLW A;  3U78 A;  2ODU A;  4A97 A;  2LKG A;  3KV9 A;  5FMN A;  2WAU A;  2Z6E A;  1OED C;  3FZM B;  5DQV A;  5LGN B;  4JI8 T;  3AE2 A;  3AEE A;  4E7S A;  2FBW A;  5FNV E;  4GKJ T;  4PK6 A;  5J2U E;  5HCM A;  2ODV A;  2XPK A;  2YOE A;  3UT5 E;  2XQ6 A;  4XAX B;  3ONL C;  3WAJ A;  3I9Y A;  4G2A A;  2CLY C;  4U7Y A;  2LRK A;  2V1D B;  4C90 A;  1U5P A;  3M3Z B;  4X66 T;  3UU4 A;  1S94 A;  4ISS A;  5LCY A;  3JAF A;  2W2U A;  4UIG A;  3G06 A;  5ETW A;  4TN7 B;  2YDS A;  3EAM A;  1AJ3 A;  2IDO B;  3UQ4 A;  2LLY A;  2WU2 A;  1U4Q A;  4JYA T;  2XM2 A;  4JBW F;  3RYI E;  2KLQ A;  3ONX A;  3ANW A;  5LJN A;  4CXX A;  3ZMV B;  2BKN A;  3M65 A;  3OJA A;  1BR1 A;  2BBJ A;  1QLB A;  3ZCI A;  4ANJ A;  4ZI2 D;  4DR6 T;  2BS3 A;  3Q5D A;  3K3Q C;  4WBO A;  3BQK A;  5JRC A;  4ZI3 D;  2PBI A;  3N2O A;  3ZKR A;  4YTN A;  4O2A E;  2DNX A;  1Y64 B;  4CZZ B;  4AXP A;  5FVK A;  3AE3 A;  2YU1 A;  1J5E T;  5ADX L;  5JR9 A;  3AE1 A;  2ZM8 A;  4B6X A;  2UXC T;  2J4G A;  5HCJ A;  3PJA J;  3JAD A;  4P0B A;  3ZN1 B;  4QXH B;  2ZLY A;  2D9D A;  2IW5 B;  2BZB A;  4IE6 A;  3N9N A;  2Y48 B;  5DQW A;  3HI2 A;  2LSI A;  1D1A A;  3F31 A;  4YSY A;  2ACZ A;  3ZPO A;  2WU5 A;  3L8R A;  1T8B A;  2EHO D;  3AVS A;  3N9P A;  5AQP B;  3LBX A;  3ZYM A;  2MAW A;  4Z90 A;  2J62 A;  3AEG A;  4AQF C;  4GYS A;  4EXT A;  3P4R A;  3SS1 A;  4O4H E;  3UTK A;  2CPT A;  2LM2 A;  1OED B;  2XY8 B;  3EDU A;  4I55 E;  3CQC B;  1VRB A;  2WWV A;  3PU8 A;  3IBP A;  2C5J A;  1FIO A;  4TWD A;  5HEH A;  3RH3 A;  2CLY B;  3A7M A;  4IDQ A;  5LJM A;  2JMH A;  4MFR A;  3OPC A;  1SUM B;  3H3A A;  3AXJ A;  3A5X A;  4U33 A;  3PUW F;  5EK4 A;  3ETV A;  2XQ4 A;  4JV5 T;  3DTO A;  2E5L T;  2UXX B;  1E7P A;  4OFZ A;  2BVL A;  1KEY A;  2FJA A;  4CI1 B;  3H37 A;  5E0O A;  2UUA T;  1R8I A;  3F57 A;  3GN5 A;  3HL6 A;  4A56 A;  2QYW A;  2KWI B;  2YK0 A;  4UXN B;  5AQL B;  3ZN0 B;  5L3D B;  1MND A;  2W66 A;  1T7S A;  4ILC A;  3T1Y T;  1LKX A;  4KUM B;  3S4U A;  4OHF A;  5BMV E;  4OK0 A;  1N33 T;  2M6I A;  2XQY A;  2E5V A;  2DI4 A;  2L9Q A;  3OYZ A;  2RP4 A;  1H7C A;  3PUS A;  3TLV A;  3PUR A;  3CIR A;  4YTM A;  4X64 T;  2X0L B;  5HEG A;  4XZC A;  4DVD A;  4DMV A;  4ZI7 E;  2ZM0 A;  1GQE A;  2D2S A;  4EAH A;  2VL0 A;  2XHE B;  4DMW A;  3LDQ B;  4ZS3 A;  1VOM A;  3RIF A;  3LG7 A;  5KDM C;  5AFU L;  3I1A A;  5HWY A;  4L0R A;  3RLF F;  3ZJ1 A;  3EI0 A;  2YU2 A;  5LP6 E;  4KI0 F;  4KMC A;  3P4Q A;  5A1L A;  2Q9Q D;  3KV6 A;  3RPU A;  4K0U A;  4DND A;  2XTL A;  3N9L A;  1UK5 A;  4GK0 E;  2DHR A;  3O1J A;  3I0Q A;  5L3E B;  5CB4 E;  4HWI B;  2R6G F;  2A2F X;  4CI2 B;  2BS2 A;  4I4T E;  4H9S E;  2C0S A;  4JI3 T;  4NXN T;  2E9X C;  1M7K A;  3Q5W A;  2K24 A;  2I59 A;  4JEH B;  2CRB A;  2XAF B;  1CHU A;  2XAG B;  3PUX F;  1BR4 A;  4HFV A;  4DV7 T;  4EOZ B;  3TKL B;  2KND A;  2D0T A;  3PUY F;  2WDQ A;  3QK6 A;  2LOP A;  3RKG A;  2CXL A;  1KK7 A;  4PJL A;  2C5K T;  2V6Y A;  3SFD A;  4EIW A;  2K5B B;  2W67 A;  2H7V C;  3Q5E A;  4CN1 A;  1XMO T;  2JQQ A;  2UXN B;  4IDO A;  1E2A A;  5LBQ B;  2L3L A;  4IE4 A;  4CI3 B;  4CQI A;  3EHZ A;  2CE7 A;  2XQ9 A;  4U7I A;  3CML A;  1SE7 A;  4HN9 A;  5C8Y E;  4LF7 T;  1HNZ T;  2NTX A;  4UF0 A;  4YFS A;  5LHH B;  4MLK A;  3HKE E;  2I0M A;  1XMQ T;  2RPA A;  3CPZ A;  3ABV A;  5AQR B;  1FMV A;  4PK4 A;  4MBQ A;  2WCA A;  1KNZ A;  3MJX A;  2DLR A;  3RYH E;  3CKD A;  3UU5 A;  4TNW A;  3PUQ A;  4ZHQ E;  2CHN A;  2WWU A;  5ABF A;  3MKD A;  4H9N C;  1KNP A;  4TV9 E;  2VQE T;  5L4E A;  4TNV A;  2A9U A;  2JPF A;  2UU9 T;  4AKI A;  4U31 A;  3FZH B;  3A8Y C;  4KHP T;  2WS3 A;  2FJD A;  5FL0 A;  1IJ5 A;  3AA1 B;  2E8I A;  2WDR A;  2H3R A;  5AQM B;  2KWH A;  2J1D G;  1CUN A;  3RKO A;  1US7 B;  2NP9 A;  3K8P C;  2B76 A;  4F6R C;  5IYZ E;  2PFV A;  2WZH A;  5CA0 E;  2X67 A;  4CXW A;  1DU2 A;  3JC6 C;  3P50 A;  3ZMS B;  5LGU B;  3C51 A;  5JDM A;  2QVA A;  4EYU A;  2E9X B;  4PAG A;  4LF5 T;  2XAS B;  1NAF A;  2WSS V;  4YHJ A;  3FBZ A;  2X51 A;  2JJ9 A;  2CMR A;  3N9M A;  4DR4 T;  2ACX A;  4H9P C;  2Y6X A;  2V7L A;  5AQV B;  4DV1 T;  4ZS2 A;  1O3X A;  3J9X 1;  2XZE A;  4HFI A;  3NVO A;  1MIV A;  2X0H A;  2L8K A;  2QA7 A;  3VR8 A;  4IST A;  2OLT A;  1WRD A;  3RF1 A;  1MMN A;  5BR8 T;  5HAX A;  5JH7 E;  2HPJ A;  2HH7 A;  4H9O C;  4ZI2 C;  5FY0 A;  1QSD A;  3B5M A;  3O1I A;  4IRE A;  4P09 A;  3C98 B;  4IL4 A;  2N2N A;  2V5D A;  4ZI3 C;  4YTP A;  5L2L A;  4B3R T;  4QX8 B;  4EEB A;  4Z91 A;  4EED A;  4U2Z A;  3RYC E;  2W00 A;  2NW8 A;  3NZP A;  1IJ6 A;  1I94 T;  4QXC B;  4MAL A;  3FXE B;  3CQX C;  2KIN B;  2V7J A;  1WR6 A;  1HX1 B;  3UU6 A;  4QXB B;  3NWI A;  4BAY B;  3FBL A;  2QGS A;  4H9R C;  4L9I A;  1IBM T;  5KXJ A;  2VUR A;  4U72 A;  2LSK A;  2JIW A;  5H6R B;  3ZC0 A;  3GWH A;  3Q5X A;  3T1H T;  5AQG B;  2AXD S;  1W0B A;  4AIU A;  3ZMT B;  3P8C D;  2EHO C;  3OKQ A;  4M1P A;  4IIJ E;  2LHN A;  3UUX B;  2X9Y A;  2J47 A;  3QOF A;  3O9X A;  3RIU A;  2CM0 A;  2Q9Q A;  4AQY T;  3FZF B;  5AQQ B;  3TLS A;  4DV3 T;  2RA1 A;  3CQG B;  3GMI A;  1ZHC A;  5C3J A;  3ZC1 A;  2SPC A;  1SA0 E;  2BG9 E;  4B3M T;  4QKN A;  4EGW A;  1HTJ F;  5AQS B;  4DR3 T;  1SHZ C;  5FP3 A;  4DBR A;  2BG9 A;  4DV4 T;  3L3P A;  3AEF A;  1IZN B;  5LG4 A;  3VKH A;  4G63 A;  3JAE A;  2IML A;  4IT4 A;  4U2Y A;  3R6N A;  3ZYK A;  3NKZ A;  2W4X A;  3CX8 B;  3HKD E;  4JI0 T;  3CWZ B;  3B13 A;  2NW9 A;  5F5W A;  3CX6 B;  3ZT5 A;  2LHR A;  3I9W A;  2FJE A;  5HXS A;  2JQ9 A;  3PTR B;  4LMK A;  3RIA A;  5DAB A;  4I50 E;  3N9Q A;  4UV8 B;  1Z8U A;  2CA5 A;  1HX8 A;  2WBL A;  4AKG A;  2KSR A;  4ZZB A;  3MXZ A;  4EZH A;  2FJB A;  5KMG P;  5JDF A;  4YHH T;  4YXD A;  2IIU A;  4DR1 T;  3CX7 B;  3KV4 A;  5F8P A;  3C4W A;  3P4W A;  4JEU B;  3C4Z A;  4NUV A;  3PV0 F;  1NEN A;  1G73 A;  4O4I E;  3K3O A;  5HXR A;  3UUN A;  1NEK A;  3AE4 A;  5EK3 A;  3IF8 B;  4EV6 A;  3AED A;  4LMJ A;  3UUM A;  4HE8 A;  2X66 A;  2N1G A;  2V7I A;  4Q25 A;  1IAP A;  3DJB A;  4BA9 A;  2WQY A;  4TZ4 C;  2X9H A;  3EAB A;  3KVA A;  4HGA A;  5HXC A;  5JR9 C;  1MIY A;  2V6X A;  4EB6 E;  2CHO A;  2VWA A;  5JDG A;  1MMA A;  2EHO B;  2BVM A;  4JI7 T;  4KHZ F;  3AEA A;  5EZY E;  1D1B A;  3AE9 A;  1W9R A;  1QUU A;  4B3T T;  4PK5 A;  4YSZ A;  4FI5 A;  1UUR A;  3D0T A;  3T8O A;  4DR2 T;  5ABE A;  2X0Y A;  3E22 E;  4IGU A;  3VRA A;  5LMU T;  3BQI A;  3MK7 C;  5LA6 E;  5JDH A;  4EYY R;  4DV6 T;  4WYV A;  2H88 A;  1WCR A;  3BK9 A;  2WM9 A;  4O8S A;  2LRL A;  5LB7 B;  2XM1 A;  4IE5 A;  4P1N A;  2WMO A;  1Z0P A;  2DWG A;  3MAC A;  5JRE A;  5AQT B;  5ABG A;  5JTG A;  3UU8 A;  3UUL A;  3KVB A;  3WI3 A;  3VR9 A;  4UVA B;  1LVK A;  4BJN A;  1YD8 G;  2MYS A;  2UUC T;  2V26 A;  5HYA A;  3WAK A;  2VQF T;  3PUV F;  1Y01 A;  3DP7 A;  3W15 B;  4DV5 T;  1I6Z A;  5IWA T;  4E7Z A;  4O4L E;  4JI2 T;  3CVR A;  3AE5 A;  2NWB A;  3Q9D A;  4UV9 B;  3ZST A;  4WNK A;  3V5U A;  4YT0 A;  3RHW A;  3ESL A;  1T72 A;  2XAJ B;  3ANW B;  3ETU A;  3MZK B;  2V7K A;  2XQ5 A;  2XAH B;  4DO0 A;  1YW0 A;  3ZLI A;  4DBQ A;  4X62 T;  1MIW A;  1YKH B;  1FEW A;  2H7O A;  2PG8 A;  2XQA A;  4GIW A;  4PFP A;  3TLT A;  3UQ7 A;  1W0A A;  2XQ7 A;  2LEH A;  5AQN B;  5J0Z A;  1OED E;  3C4X A;  5JRC B;  3RC8 A;  3RI5 A;  4WZX A;  1T98 A;  1OED A;  1OXZ A;  1HCI A;  5AQO B;  5JR9 B;  3AEB A;  2E9X D;  3IEE A;  1HG5 A;  2X68 A;  4NXM T;  2CXD A;  5DJQ C;  2PTF A;  2UUB T;  4Z8X A;  3LJC A;  1KNR A;  1VCS A;  5CFB A;  5LBM A;  3UFE A;  2BDE A;  1UX5 A;  4MHC A;  5L3C B;  1X9B A;  4FJO A;  3IHR A;  2BKO A;  2GK9 A;  5M4Y A;  1YQ4 A;  5HEJ A;  5LOV E;  4ADZ A;  1IBL T;  2A72 A;  4K0K T;  3HKC E;  4AI6 A;  1JNZ A;  2P9B A;  2YN6 A;  3NZQ A;  3LBX B;  2OV9 A;  1YXR A;  3SRZ A;  4DUZ T;  4NUU A;  1ZEE A;  4LF6 T;  5FXZ A;  4O4J E;  2JQH A;  3EDV A;  1XNR T;  5AQJ B;  2CBJ A;  4ILA A;  4X65 T;  4ILB A;  3ZMZ B;  4U74 A;  2VVS A;  3ZYL A;  3LSV A;  5LNK A;  4GYR A;  3ZMU B;  4ILU A;  4AKR B;  2V5C A;  5ABH A;  4DUY T;  1D0Z A;  2VKD A;  2DCF A;  4QH4 A;  4DV0 T;  3O1H A;  2VKJ A;  4LFB T;  2YEV C;  3JCF A;  3AXJ B;  2IUB A;  1N36 T;  4JUY A;  1W09 A;  3P4P A;  3OBV E;  4GOU A;  3GN5 B;  4YJ3 E;  2BBH A;  2LJL A;  5FY1 A;  1S35 A;  3AE6 A;  4KP3 C;  3N9O A;  5JDQ A;  1UUS A;  1J5W A;  2HN2 A;  4PFO A;  4QHO A;  3QC9 A;  1UCU A;  3AA6 B;  2LE8 A;  4HEA A;  2LKH A;  2NW7 A;  4IE7 A;  1IBK T;  4ZZC A;  3L39 A;  3K3N A;  4LF4 T;  3OVU A;  3GA8 A;  3N5L A;  4KX6 A;  3QNU A;  3O4X E;  5FY7 A;  4AQF A;  2XUE A;  4X5T A;  3VRB A;  2XQ8 A;  2K48 A;  3QB5 A;  4AKL A;  3RC3 A;  3FZL B;  4LFC T;  2MOZ A;  3JC6 D;  2YIN A;  1MMD A;  1G8X A;  4H63 V;  3FXD B;  4PJM A;  2XJ7 A;  4HWD A;  2LT3 A;  4H63 H;  1J1J A;  1ZV4 X;  2ES0 A;  5IUX A;  3EVY A;  3NRY A;  3NRX A;  1X79 A;  4ASK A;  2DWK A;  3RGL A;  1LRZ A;  2JRK A;  2W61 A;  3KDS E;  3HA4 A;  2WY2 A;  3ZT6 A;  4KBM B;  4HWH A;  4CN6 A;  3SFE A;  4JI1 T;  5L3F B;  3RYF E;  4PW8 A;  1WYB A;  2HHH T;  1HR0 T;  2WMN A;  4HTE A;  4QH5 A;  3VU7 H;  2ZMA A;  4HFD A;  1XDP A;  3AE7 A;  4OX9 T;  4BJM A;  2W63 A;  3UU3 A;  3CK6 A;  3B57 A;  4QH1 A;  2DL1 A;  3KIN B;  2CXF A;  5HEO A;  5F3J A;  3VHL A;  3ZSS A;  2YDQ A;  3Q2M A;  4GK5 E;  4ZOL E;  3KV5 A;  4J2C A;  2D5U A;  4IHJ E;  3FZK B;  2JQK A;  4UVB B;  4WBN E;  1HNW T;  3N2G E;  2IC6 A;  3HKB E;  2K3W A;  3NBX X;  2M67 A;  3UUB A;  4DV2 T;  4X1Y E;  4N78 D;  2V6Y B;  4IE0 A;  2W62 A;  1YQ3 A;  2NTY A;  2CCQ A;  2CBI A;  3E08 A;  3ONJ A;  4PNI A;  3VKG A;  1HNX T;  3ZT7 A;  4HKA A;  5AQI B;  5L3B B;  4OYK A;  3RRW A;  1XNQ T;  1XWM A;  2H89 A;  1HFA A;  1VCT A;  3E0Z A;  5L47 A;  4LF8 T;  1EZ3 A;  4UF0 B;  2YKS A;  4X20 E;  4LML A;  1JNR A;  4YY3 T;  1WYC A;  2LM9 A;  2C5I T;  2NR4 A;  3SOL A;  5CGM A;  4C91 A;  2K9A A;  5LG3 A;  3AVR A;  1D1C A;  1ZKE A;  2V8S V;  2W0G A;  5KX5 E;  4ZEY A;  3RQW A;  2MTQ A;  2E9X A;  2WB5 A;  3K1S A;  2VAS A;  3LFM A;  4B3S T;  3OYX A;  5ABF B;  4XBF B;  5JDL A;  2I6H A;  4I43 B;  4IL9 A;  2VK9 A;  2G0U A;  2CWO A;  3KBT A;  3KFW X;  3AAI A;  4WW0 A;  4UR9 A;  3RIU C;  3R84 B;  2KXP B;  4PJN A;  5FYM A;  5LMN T;  2Q9Q C;  2KZ7 B;  4JI6 T;  5LHI B;  4AIS A;  4UEM A;  2LSG A;  2V7M A;  2X9W A;  4A98 A;  3AE8 A;  4O2B E;  1D0X A;  2UXB T;  1M62 A;  4OYJ A;  3LK2 B;  2BG9 C;  3H3M A;  4H9Q C;  4UVC B;  2NOX A;  2XSA A;  3IA3 A;  5J2T E;  4HWF A;  5AQK B;  1B7T A;  1NWM X;  5L4H A;  4ERR A;  3PE0 A;  1HF8 A;  3HR0 A;  5FXX A;  4HFH A;  3TLU A;  1FJG T;  4HFC A;  4GKK T;  4HWC A;  1HG2 A;  3X1D A;  2IHR 1;  2HPL A;  2MPK A;  2PJQ A;  3AEC A;  3RRC A;  5AQU B;  3PUZ F;  5L3G B;  3ZCJ A;  4TWF A;  2F4V T;  4QWN B;  1ZOY A;  2ZM2 A;  1FMW A;  4I0U A;  4IDN A;  2HN1 A;  2LOS A;  3OTO T;  4LF9 T;  3QUJ A;  5J1G A;  2B1E A;  4TV8 E;  1KF6 A;  2LSJ A;  3AA7 B;  4ZXL A;  2IC9 A;  4YSX A;  3AA0 B;  5LXT E;  2XAQ B;  3P4S A;  4U3C A;  5IHY A;  1WLX A;  2QRX A;  4TWH A;  2VVN A;  2FUP A;  4UEL A;  2KT9 A;  3N2K E;  3MA9 A;  4X1I E;  3J7Y q;  1MNE A;  5H6Q B;  4NPP A;  4TUY E;  2N9D A;  2CEA A;  4DR5 T;  3F2E A;  2VKO A;  3C50 A;  2IAK A;  5HWX A;  5FL1 A;  3V5S A;  4DID B;  1V9D A;  1N32 T;  1E1H B;  2WDV A;  4F8H A;  1LVF A;  3FB2 A;  5JDN A;  4JLE A;  2MBG A;  3ZJ2 A;  1HS7 A;  3AB3 B;  2AE9 A;  2OA5 A;  4PJJ A;  3RQU A; 
#chains in the Genus database with same CATH homology
 3PU3 A;  3OBV E;  4QKN A;  1HTJ F;  2XQY A;  4GOU A;  3GN5 B;  4YJ3 E;  2LJL A;  2DI4 A;  2L9Q A;  1MMG A;  1D0Y A;  1SHZ C;  3OYZ A;  5FP3 A;  4AQG A;  5FY1 A;  4DBR A;  3L3P A;  1S35 A;  2RP4 A;  1H7C A;  3PUS A;  4KP3 C;  4QX7 B;  3PUR A;  1BR0 A;  3N9O A;  3RX6 A;  2CWY A;  5JDQ A;  1IZN B;  5LG4 A;  4PFO A;  4QHO A;  2Q9Q B;  3QC9 A;  1UCU A;  2X0L B;  2Y8D A;  3AA6 B;  2VB6 A;  2LE8 A;  5LHG B;  3VKH A;  4G63 A;  4XZC A;  4DVD A;  4DMV A;  4HEA A;  4AKH A;  5TAO A;  3R6N A;  3BQL A;  4ZI7 E;  3ZYK A;  2NW7 A;  2LSY A;  2ZM0 A;  4IE7 A;  2D0U A;  3CX8 B;  2D2S A;  3HKD E;  4EAH A;  3CWZ B;  2XHE B;  3B13 A;  3K3N A;  4DMW A;  3SWH A;  4ZS3 A;  1VOM A;  2NW9 A;  1BR2 A;  5LYJ E;  3LG7 A;  5KDM C;  3CX6 B;  5AFU L;  3I1A A;  3GA8 A;  2LHR A;  3I9W A;  3N5L A;  5HWY A;  3AAE B;  5FXW A;  4L0R A;  3O4X E;  5FY7 A;  4AQF A;  3ZJ1 A;  1OWA A;  2JMK A;  2XUE A;  5HXS A;  5EK2 A;  4V1A v;  2YU2 A;  5LP6 E;  3PTR B;  4KMC A;  5DAB A;  5A1L A;  2K48 A;  4I50 E;  2Q9Q D;  3N9Q A;  4AKL A;  3U3I A;  4UV8 B;  3RC3 A;  2CA5 A;  2MOZ A;  4EZ4 A;  3PUA A;  3KV6 A;  3JC6 D;  5CA1 E;  2YIN A;  5HXH A;  1HX8 A;  1G8X A;  1MMD A;  2WBL A;  4H63 V;  4K0U A;  3RPU A;  3FXD B;  4AKG A;  1SA0 E;  3P7I A;  5LGT B;  3LK4 2;  4PJM A;  4DND A;  2VKH A;  2LT3 A;  3LK3 B;  2XTL A;  4H63 H;  1ZV4 X;  2ES0 A;  2VL8 A;  3EVY A;  3MXZ A;  3NRY A;  4EZH A;  5KMG P;  2KMF A;  3N9L A;  3NRX A;  1X79 A;  5JDF A;  4ASK A;  4GK0 E;  5HXE A;  2DWK A;  2DHR A;  3O1J A;  3PDY A;  3I0Q A;  1LRZ A;  4YLH A;  5L3E B;  2JRK A;  3CX7 B;  3KV4 A;  5F8P A;  2W61 A;  5CB4 E;  3KDS E;  5GON E;  3C4W A;  1UX4 A;  5FXV A;  3HA4 A;  2A2F X;  4KBM B;  4JEU B;  4CI2 B;  3L09 A;  4I4T E;  3C4Z A;  4NUV A;  3ZEF B;  4H9S E;  2C0S A;  1G73 A;  2A3D A;  2E9X C;  3K3O A;  3Q5W A;  4O4I E;  5HXR A;  5L3F B;  2K24 A;  3RYF E;  3UUN A;  5EK3 A;  2I59 A;  3IF8 B;  4PW8 A;  1WYB A;  4JEH B;  4OK0 A;  2WMN A;  2XAF B;  3UUM A;  2EHO A;  2XAG B;  2X66 A;  4HE8 A;  4CXY A;  4HTE A;  2N1G A;  2V7I A;  1BR4 A;  3VU7 H;  1IAP A;  2ZMA A;  4HFV A;  3DJB A;  4BA9 A;  3C64 A;  4EOZ B;  3TKL B;  2KND A;  2D0T A;  3EUH A;  4IDZ A;  3QK6 A;  4TZ4 C;  5JVD E;  4BJM A;  2W63 A;  2X9H A;  2X9X A;  1YKE B;  3AAA B;  3KVA A;  4L5G A;  4HGA A;  2LOP A;  5HXC A;  2CXL A;  5JR9 C;  3B57 A;  1KK7 A;  1MIY A;  4PJL A;  2C5K T;  3KIN B;  4EIW A;  2CXF A;  3FHN A;  2K5B B;  4P0A A;  4EB6 E;  3PUG A;  4TX5 A;  5F3J A;  3VHL A;  2VWA A;  1MMA A;  2H7V C;  2EHO B;  5JDG A;  3Q2M A;  4GK5 E;  3KBU A;  2BVM A;  2JQQ A;  4ZOL E;  2UXN B;  5JQG E;  5EZY E;  3I0O A;  4X1K E;  5LBQ B;  4YJ2 E;  3KV5 A;  1D1B A;  2L3L A;  4J2C A;  4IE4 A;  4CI3 B;  2D5U A;  4CQI A;  3U78 A;  2CE7 A;  4IHJ E;  2ODU A;  3KV9 A;  5FMN A;  1QUU A;  4UVB B;  4WBN E;  2WAU A;  4PK5 A;  2Z6E A;  4FI5 A;  3CML A;  3D0T A;  3N2G E;  3T8O A;  2IC6 A;  5DQV A;  5LGN B;  3HKB E;  4HN9 A;  3E22 E;  5C8Y E;  3NBX X;  4IGU A;  2M67 A;  4E7S A;  4X1Y E;  4N78 D;  2NTX A;  3BQI A;  3MK7 C;  4UF0 A;  4IE0 A;  4YFS A;  5FNV E;  5LA6 E;  4PK6 A;  5JDH A;  5LHH B;  4MLK A;  5J2U E;  2W62 A;  4EYY R;  2NTY A;  3HKE E;  2ODV A;  2CCQ A;  3E08 A;  4PNI A;  3UT5 E;  3VKG A;  4XAX B;  3CPZ A;  3WAJ A;  3I9Y A;  4G2A A;  4HKA A;  2CLY C;  3BK9 A;  1FMV A;  5L3B B;  2V1D B;  4OYK A;  4PK4 A;  3RRW A;  4C90 A;  1U5P A;  4MBQ A;  2WM9 A;  1HFA A;  4O8S A;  1KNZ A;  3MJX A;  3E0Z A;  2DLR A;  1S94 A;  3RYH E;  4ISS A;  3CKD A;  5LCY A;  4IE5 A;  1EZ3 A;  3PUQ A;  4ZHQ E;  4UIG A;  4UF0 B;  2WWU A;  2WMO A;  5ETW A;  4X20 E;  1Z0P A;  4TN7 B;  2DWG A;  3MKD A;  1AJ3 A;  4H9N C;  3MAC A;  5JRE A;  4TV9 E;  3UUL A;  3KVB A;  3WI3 A;  1WYC A;  2LM9 A;  4UVA B;  1LVK A;  2C5I T;  3SOL A;  1U4Q A;  4BJN A;  4C91 A;  1YD8 G;  2MYS A;  2K9A A;  3RYI E;  2V26 A;  2JPF A;  2KLQ A;  3ONX A;  5HYA A;  3WAK A;  4AKI A;  3ANW A;  3AVR A;  5LJN A;  1D1C A;  1ZKE A;  3DP7 A;  4CXX A;  3W15 B;  2W0G A;  3ZMV B;  5KX5 E;  3M65 A;  3OJA A;  2MTQ A;  2E9X A;  1BR1 A;  2VAS A;  3LFM A;  1IJ5 A;  3AA1 B;  3OYX A;  2E8I A;  4O4L E;  4E7Z A;  3CVR A;  3ZCI A;  4ANJ A;  4XBF B;  4ZI2 D;  2H3R A;  2NWB A;  2KWH A;  4I43 B;  5JDL A;  2J1D G;  2VK9 A;  3Q9D A;  4UV9 B;  2G0U A;  1CUN A;  3K3Q C;  3RKO A;  2CWO A;  3KBT A;  1US7 B;  4WBO A;  4WNK A;  3KFW X;  3BQK A;  3AAI A;  2NP9 A;  5JRC A;  3K8P C;  4ZI3 D;  2PBI A;  3V5U A;  4WW0 A;  3N2O A;  4F6R C;  5IYZ E;  3R84 B;  2KXP B;  2PFV A;  3ESL A;  4O2A E;  4PJN A;  2Q9Q C;  5FYM A;  2DNX A;  2XAJ B;  5CA0 E;  1Y64 B;  2KZ7 B;  3ANW B;  3ETU A;  4CZZ B;  3MZK B;  2V7K A;  5LHI B;  4AXP A;  2X67 A;  4CXW A;  2XAH B;  2YU1 A;  4DO0 A;  4UEM A;  2LSG A;  3JC6 C;  5ADX L;  1YW0 A;  5JR9 A;  3ZLI A;  3ZMS B;  4DBQ A;  5LGU B;  2V7M A;  3C51 A;  2ZM8 A;  4EYU A;  1MIW A;  2E9X B;  4PAG A;  5JDM A;  1YKH B;  2X9W A;  2XAS B;  1FEW A;  1NAF A;  4O2B E;  2WSS V;  2H7O A;  4YHJ A;  4B6X A;  3FBZ A;  2PG8 A;  1D0X A;  2X51 A;  2JJ9 A;  4GIW A;  2CMR A;  3N9M A;  4PFP A;  2ACX A;  4OYJ A;  4P0B A;  3LK2 B;  3ZN1 B;  4H9P C;  2ZLY A;  2LEH A;  4QXH B;  2Y6X A;  2V7L A;  4H9Q C;  4UVC B;  2NOX A;  3C4X A;  5J2T E;  5JRC B;  3RC8 A;  2IW5 B;  2BZB A;  4IE6 A;  4ZS2 A;  3N9N A;  1O3X A;  3J9X 1;  1B7T A;  1NWM X;  1T98 A;  4ERR A;  2Y48 B;  5DQW A;  3HI2 A;  2LSI A;  3PE0 A;  1D1A A;  1MIV A;  3F31 A;  1OXZ A;  1HF8 A;  2L8K A;  1HCI A;  3HR0 A;  2QA7 A;  5JR9 B;  4IST A;  2E9X D;  3IEE A;  5FXX A;  1WRD A;  3ZPO A;  2EHO D;  1MMN A;  1HG5 A;  2X68 A;  5HAX A;  3AVS A;  2HPJ A;  5JH7 E;  1HG2 A;  2CXD A;  3N9P A;  2HH7 A;  5DJQ C;  4H9O C;  4ZI2 C;  5FY0 A;  1QSD A;  3LBX A;  3ZYM A;  3O1I A;  2HPL A;  4P09 A;  4Z8X A;  4AQF C;  3LJC A;  3C98 B;  4GYS A;  2PJQ A;  3RRC A;  4EXT A;  3SS1 A;  2N2N A;  4ZI3 C;  4O4H E;  3UTK A;  5L3G B;  5L2L A;  5LBM A;  3ZCJ A;  4QX8 B;  3UFE A;  2BDE A;  4QWN B;  1UX5 A;  4MHC A;  5L3C B;  4FJO A;  2ZM2 A;  1FMW A;  3RYC E;  3EDU A;  3IHR A;  2W00 A;  2NW8 A;  3NZP A;  2GK9 A;  5M4Y A;  1IJ6 A;  5LOV E;  4QXC B;  4ADZ A;  2LOS A;  2A72 A;  3QUJ A;  4I55 E;  4MAL A;  5J1G A;  3CQC B;  3HKC E;  3FXE B;  2B1E A;  1VRB A;  3CQX C;  4AI6 A;  2P9B A;  3PU8 A;  2KIN B;  3IBP A;  4TV8 E;  3NZQ A;  3LBX B;  2C5J A;  2V7J A;  1WR6 A;  1FIO A;  2LSJ A;  4QXB B;  3AA7 B;  3SRZ A;  4BAY B;  2IC9 A;  3AA0 B;  4NUU A;  3RH3 A;  1ZEE A;  2CLY B;  5LJM A;  5LXT E;  3FBL A;  2XAQ B;  5FXZ A;  5IHY A;  2JMH A;  4MFR A;  4O4J E;  1WLX A;  2QGS A;  4H9R C;  4L9I A;  3H3A A;  3EDV A;  3A5X A;  4U72 A;  2LSK A;  4UEL A;  5H6R B;  5EK4 A;  3ZMZ B;  3ZC0 A;  3ETV A;  4U74 A;  2KT9 A;  3GWH A;  3N2K E;  3DTO A;  3Q5X A;  2UXX B;  3MA9 A;  4X1I E;  3J7Y q;  4OFZ A;  1MNE A;  5H6Q B;  2BVL A;  3ZYL A;  5LNK A;  3ZMT B;  4GYR A;  3H37 A;  2N9D A;  4TUY E;  4ILU A;  5E0O A;  3ZMU B;  2CEA A;  4CI1 B;  3F57 A;  4AKR B;  3GN5 A;  3P8C D;  2EHO C;  3OKQ A;  4M1P A;  4IIJ E;  3F2E A;  1D0Z A;  3HL6 A;  4A56 A;  2LHN A;  2VKD A;  2VKO A;  3C50 A;  3UUX B;  2X9Y A;  2KWI B;  2YK0 A;  3O9X A;  4UXN B;  2IAK A;  2DCF A;  5HWX A;  3ZN0 B;  3V5S A;  2CM0 A;  2Q9Q A;  5L3D B;  3O1H A;  2VKJ A;  1MND A;  1V9D A;  2YEV C;  1E1H B;  1LVF A;  3FB2 A;  2RA1 A;  5JDN A;  4JLE A;  2MBG A;  1LKX A;  3CQG B;  3GMI A;  1ZHC A;  3ZJ2 A;  3ZC1 A;  1HS7 A;  3AB3 B;  4JUY A;  4KUM B;  3S4U A;  4OHF A;  2SPC A;  5BMV E;  2OA5 A;  4PJJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...