3LG7A

Crystal structure of hiv epitope-scaffold 4e10_s0_1ez3a_002_c
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
126
structure length
123
Chain Sequence
b'RDKFMDEFFKQVEEIRQYIDRIAENVEEVARQHQAILASPNPNWFDISQLLWLMADIKETANEVRKKLKEIEQSIEQEEKSSADLKIRKRQHEELERKFREVMKEYNATQQDYRKRARKRNLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4E10_S0_1EZ3A_002_C (T246)
molecule tags Immune system
source organism Artificial gene
publication title Computational Design of Epitope-Scaffolds Allows Induction of Antibodies Specific for a Poorly Immunogenic HIV Vaccine Epitope.
pubmed doi rcsb
total genus 56
structure length 123
sequence length 126
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-01-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3lg7A00
2DNXA 1EZ3A 2XHEB 3C98B 4TX5A 1HS7A 5M4YA 1BR0A 1FIOA 4JEHB 1FEWA 3LG7A 1S94A 5LG4A 1G73A 4JEUB
chains in the Genus database with same CATH superfamily
2V8SV 4Z8XA 5JDQA 4KP3C 3RLFF 3TLSA 4C91A 4IHJE 4JI2T 4ANJA 4IE4A 5C2TA 4MHCA 4IREA 2HN2A 2BS3A 2X0YA 2G0UA 3H3AA 4TNWA 3RQWA 3A8YC 2WBLA 4ZI2D 4IGUA 1MIYA 5FVLA 3KFWX 2IUBA 4PW8A 5LCYA 4FI5A 2M6IA 2YDSA 5LGTB 3FZMB 4UELA 2LSJA 3CK6A 3UUBA 4BJNA 4TX5A 4CQIA 5LMNT 3ZMSB 3NBXX 3O1HA 4H9NC 5LG3A 3UQ7A 2PTFA 2WP9A 5CGMA 2JMKA 3ESLA 1FJGT 2LKGA 2LLYA 4NPPA 2NTYA 2NWBA 2W00A 2VKOA 5LBMA 3AEDA 3WAJA 2IAKA 5ABEA 4GKKT 4DV6T 3N2GE 3NVOA 4CZZB 3OJAA 4B6XA 5HWYA 3GA8A 3UULA 4UF0B 2V7JA 3Q5EA 1LKXA 3N9LA 4H9OC 1SE7A 2DNXA 4HGAA 5TAOA 4CI3B 4ZI3D 5EZYE 4DR5T 2UUBT 2V6YA 3CPZA 3HR0A 1YD8G 2RA1A 1FEWA 1E7PA 1UX5A 4QH1A 5F8PA 3ZYMA 5LMUT 3CX6B 5HXEA 4NXNT 4UXNB 4YY3T 4Z90A 3ZN1B 4B3MT 4HFCA 4U74A 5HEUA 2ODUA 3CX8B 4K0KT 3EDVA 4P0AA 4PNIA 5M4YA 4YT0A 2KLQA 5DQWA 4GYRA 3UTKA 2Q9QB 5KXJA 3C4XA 4GK5E 4ILUA 4X1YE 5LJNA 4ASKA 4OYKA 1WYCA 3NRYA 4A97A 4G2AA 5AQIB 3RIUC 2LKHA 5FYMA 1KF6A 2W61A 2Y8DA 3UU4A 2FUPA 2LSYA 2K9AA 1Z0PA 2WB5A 5LGNB 2JQKA 1D0XA 2A2FX 2DHRA 5H6QB 5JREA 4AQYT 2LSKA 5JDMA 4AKIA 2A72A 2VB6A 4GK0E 4LFCT 4KBMB 2YOEA 2V6YB 3PUXF 3RRCA 4PJJA 4EV6A 5F3JA 4OHFA 3VR9A 4O4JE 3O1JA 3HKEE 3Q9DA 1OEDC 3A7MA 5IHYA 4IE6A 2Q9QA 3EVYA 2OLTA 3CKDA 3OPCA 2DI4A 3AE5A 4IE5A 4IE0A 1G8XA 2WDVA 4O4LE 2XQ9A 1T7SA 1D1AA 1ZV4X 4QH4A 4PFOA 4QWNB 1YKHB 4WNKA 3U3IA 4H9PC 2WSSV 2UXXB 5HEHA 2X67A 4A5XA 5FKYA 5FXWA 3UUMA 3AA7B 3RYIE 5LNKA 5CJ5A 4PK5A 1IJ6A 4JI8T 1KNPA 2EHOD 1W0AA 2XAQB 4K0UA 3TLVA 3T1YT 1I94T 3ZC1A 2IC6A 4JBWF 5LJMA 2V5DA 2W2UA 2BG9B 2X9WA 4FJOA 4AISA 3PU8A 2NW9A 4CXXA 2OA5A 3MKDA 4PJNA 4U7YA 1L0VA 2ODVA 3RIUA 3UUNA 3ZYKA 5LGUB 5L47A 3ZMZB 2E2AA 2D0UA 3UQ4A 2HPLA 4HFDA 5L3DB 2J1DG 4I0UA 2M67A 2MTQA 5AQHB 2X0HA 4HEAA 2E5VA 5ABGA 3Q5XA 3SS1A 5J2UE 3ONXA 2X68A 5C3JA 5JDLA 4BA9A 2YU1A 3P4WA 5L3CB 3VU7H 3UU8A 4UV8B 3AECA 2WY2A 1UURA 2KXPB 3LBXB 3NZPA 1HCIA 3VR8A 3ZSTA 1UK5A 1T72A 3ZCIA 1S94A 1MMDA 3BQIA 3N9NA 3UUXB 4ADZA 1WCRA 4QXHB 2VKDA 1BR4A 2QYWA 5J2TE 1UCUA 2I0MA 4CXYA 3AE4A 3QB5A 4HFEA 3FZHB 2XAJB 3SFDA 3QC9A 4ZI3C 2V7LA 4DUZT 4L0RA 2BZBA 3ZT7A 3RPUA 4OFZA 2YK0A 4JEUB 4HE8A 3AEAA 4E7SA 1JNZA 4NIQA 3UU6A 2XQ3A 5CA0E 3MA9A 4DV0T 1BR0A 2LM2A 3CIRA 4PJLA 4IL9A 2WWVA 5L3GB 2L8KA 3KBTA 3AAAB 1Y64B 4QXCB 5AFUL 3KDSE 3VKGA 2XM2A 2W63A 4TNVA 3VRAA 2QVAA 4L9IA 3I9WA 3S4UA 4ZXLA 2D2SA 4IT4A 3OBVE 3PE0A 2BKOA 1HF8A 4YXDA 4X64T 2WMNA 2WMOA 2CPTA 1KNRA 2CXDA 4OX9T 1OWAA 2IDOB 5AQTB 1KFYA 3AA1B 4DR6T 1CHUA 4LF5T 1LRZA 2M6BA 2CXFA 2JQHA 2MAWA 3CQGB 2EHOB 4AQGA 4LF6T 1ZOYA 4LF8T 4ZS2A 3OKQA 4YTMA 4ILAA 4B3RT 4XAXB 3BK9A 3VHLA 4N78D 3RHWA 1I6ZA 4YSXA 5GONE 2WDQA 3MXZA 4UIGA 5AQLB 1XZYA 2VQFT 3KBUA 1IBLT 3AE8A 1OEDA 1X79A 4H9SE 4JI6T 4H9QC 4EZHA 3RKOA 2XZEA 1D0ZA 3K1SA 3SRZA 1D1BA 1M7KA 4HWCA 2IW5B 5JDGA 4OK0A 4EB6E 5L3BB 2RP4A 4LMLA 3UU5A 3ETUA 5FL1A 4O4IE 3HKBE 1IBMT 2X51A 3ONJA 2PFVA 4LF7T 1HX8A 3PV0F 4HFHA 3ZMVB 3R84B 4ZOLE 3NRXA 2W62A 4PK6A 4EZ4A 3N9QA 5J0ZA 4GOUA 4HFBA 3T1HT 2J47A 3AEGA 3IHRA 4HWIB 3OTOT 2Q9QC 2LE8A 2PBIA 3LDQB 3N9PA 5IWAT 3SWHA 3P4SA 2K24A 2ZLYA 4ISSA 4ISTA 2UXNB 1IZNB 2X9XA 5ETWA 4JV5T 2K5BB 4ILBA 3AE6A 3HKCE 4GIWA 4LF4T 2YINA 3HI2A 2F4VT 2MOZA 1N36T 5J1GA 3AA0B 1OEDB 1VRBA 2UUCT 2OV9A 4P0BA 4DR4T 2JQ9A 4JLEA 5EK3A 4LF9T 3VKHA 1FMVA 2YU2A 2JQQA 2YDRA 2VL8A 4LMKA 4UR9A 2KWHA 5IYZE 5CB4E 2KNDA 2VWAA 2DWGA 4PK4A 5AQGB 4NXMT 4AKHA 3RQUA 2LRLA 1WR0A 2Z6EA 4H63V 4OYJA 4QX8B 5AQUB 3RF1A 4BAYB 4JI3T 1WRDA 3KVAA 2H7VC 2W66A 3K3NA 3KINB 4EYUA 1YXRA 3EABA 5AQJB 2XQ8A 4I43B 5HEJA 4JI4T 4YJ2E 1J5ET 5JQGE 2CM0A 2ZM0A 5JDNA 2A9UA 2HHHT 3PUYF 1IAPA 3QOFA 4GKJT 5LOVE 5LYJE 2LHRA 3KV6A 2GK9A 1ZP0A 2XQ5A 4B3TT 3AE2A 5FVKA 2FJAA 1FIOA 2V7KA 2WAUA 2W67A 2YKSA 4MLKA 3T8OA 3AVRA 2CCQA 4HWFA 2VQET 1N32T 3AA6B 4QX7B 3P8CD 4UVBB 1MNDA 5L4HA 4YTNA 3E0ZA 5FNVE 3ZCJA 1V9DA 1KK7A 2CLYC 2X9HA 5HWXA 3DTOA 1CUNA 3MZKB 4DNDA 2XAHB 5HXHA 1HNXT 3H3MA 2KWIB 1W0BA 4WW0A 4X1IE 3UU3A 3AB3B 1AJ3A 4A56A 1QSDA 3RH3A 2E9XC 2WU5A 3P4QA 4U3CA 3GWHA 1S35A 4LMJA 2XPKA 4DUYT 2UXCT 2WDRA 2H7OA 2J62A 2HN1A 1MIWA 4EOZB 5HCJA 4QKNA 2H89A 3JC6C 1YQ4A 4AKLA 2QRXA 5LHHB 1H7CA 2NW7A 3C50A 1MIVA 1KNZA 5AQOB 4YHHT 2LOSA 2MYSA 2IIUA 2XQAA 2XY8B 3CQXC 3PUWF 2YEVC 1MMNA 3L39A 3UFEA 3ZT6A 2SPCA 4U33A 3AEFA 3AEBA 1VCTA 1Y01A 2JIWA 3FBZA 3SFEA 4TWDA 1W9RA 2NTXA 2NOXA 2VVSA 5E0OA 5LHGB 1XWMA 4DV3T 1XDOA 2C5JA 2W0GA 2N1GA 5FMNA 2IMLA 3PUZF 5HEGA 1XMQT 3B5MA 5H6RB 2K3WA 1E1HB 3FZKB 3LK42 4ERRA 2CRBA 2WCAA 2X66A 4MFRA 3N5LA 5IUXA 4AKRB 4DV2T 3P50A 2C0SA 4TWFA 2D9DA 1EZ3A 3GMIA 2LSGA 4X1KE 2XUEA 2WZHA 2ES0A 5AQMB 5EK4A 3O4XE 1D0YA 1QUUA 3C64A 3ZYLA 4EYYR 3L3PA 2AE9A 2UU9T 2UXBT 1MMAA 2VASA 5JRCB 3LK3B 3KV9A 2BS2A 2JRKA 2ACXA 3EUHA 3UFGA 4KHZF 3C4WA 1M62A 2E8IA 1GQEA 2XQYA 1NENA 3MK7C 4TWHA 2XJ7A 3ONLC 1HTJF 4ZHQE 2N9DA 3OYZA 1FMWA 1B7TA 5LG4A 3ZSSA 2BG9C 4KHPT 4X20E 3KVBA 1JNRA 5FXXA 5JR9C 4XBFB 2YN6A 4F6RC 2JMHA 2BVLA 4X66T 4TV8E 5ABFB 4DIDB 3CMLA 1LVFA 3IBPA 2ACZA 2BKNA 3FHNA 4EXTA 2W4XA 3AE3A 2IHR1 4JI0T 3WAKA 5AQNB 2ZM2A 3I0OA 4Z91A 3ZPOA 2VURA 4UF0A 5A1LA 3GN5A 2BG9A 2JJ9A 2ZMAA 5C8YE 1ZEEA 5JRCA 3LSVA 4NUVA 3D0TA 1ZHCA 4ZI2C 2JPFA 3ANWB 5HYAA 3AXJB 2VL0A 3OVUA 3X1DA 1N34T 4TN7B 3LJCA 2LM9A 1W09A 2P9BA 5AQVB 3ZT5A 3QUJA 3RC3A 4IDNA 2BKPA 4YJ3E 3PUGA 1YQ3A 2BDEA 5LXTE 4CN4A 1UGOA 3I0QA 3LBXA 2PG8A 4KX6A 4EEDA 3PJAA 2KSRA 3AVSA 3ZN0B 2VK9A 1UUSA 1HS7A 1XDPA 5ABFA 2E9XA 4AKGA 4AI6A 5FY7A 4COFA 4TV9E 5BMVE 1VOMA 3O1IA 3L09A 2EHOC 2J4GA 4X65T 3MJXA 5L2LA 3GN5B 4A98A 1UX4A 2CBIA 4JI7T 2HPJA 1YKEB 3G06A 4J2CA 4KUMB 3PURA 2B1EA 2B76A 1SUMB 2CE7A 4IDZA 4ZS3A 4YSZA 4YLHA 4U7IA 2XQ4A 3ANWA 4AIUA 4U31A 3AXJA 4EEBA 2BBHA 2KZ7B 4HFIA 5CFBA 5LBQB 3JADA 3TLWA 4XZCA 4MBQA 3N9MA 4DV5T 2WS3A 2MPKA 1O3XA 4DO0A 1J1JA 2MBGA 4YSYA 1XMOT 2E5LT 4M1PA 4CI1B 1HG5A 4TUYE 5DQVA 3U78A 1HR0T 1Z8UA 5AQRB 2E9XB 3RIFA 5KDMC 2WQYA 1J5WA 2VVNA 1R8IA 1YW0A 2C5IT 3E08A 1VCSA 2H3RA 3TLUA 3ZMTB 5AQFB 5EK2A 1MNEA 4O8SA 2XM1A 3F57A 4DV7T 4HWHA 2A3DA 4IDPA 5BR8T 4DR3T 3C98B 3JC6D 3RC8A 3AE1A 3EDUA 3FXDB 3VRBA 4BJMA 4CI2B 5JH7E 4LFAT 2FJBA 3SOLA 3KV5A 4HN9A 2E9XD 3EAMA 1WLXA 3P4RA 1HG2A 3Q5DA 4TZ4C 4Q25A 3ZLIA 4ZZBA 5JR9B 3AE7A 2C5KT 2RPAA 1BR2A 2WU2A 3FB2A 3K3QC 3N2OA 4MALA 4UVCB 2XSBA 3AAIA 4WYVA 5AQQB 4E7ZA 2V5CA 1KEYA 2LHNA 2Y48B 3AEEA 5KMGP 4U2ZA 3N2KE 2L9QA 1WYBA 1HNZT 4NUUA 5L4EA 1US7B 1BR1A 3ETVA 4G63A 3CVRA 2Y6XA 2LEHA 3P7IA 4I55E 4UV9B 3EHZA 5DJQC 2X9YA 2KT9A 5KX5E 2AXDS 2X0LB 3WI3A 5HXSA 3I9YA 3NWIA 2UUAT 2L3LA 5LA6E 4JYAT 2V7IA 5DABA 2Q9QD 2WM9A 3M65A 4YFSA 5FXVA 2R6GF 2DCFA 3F2EA 3LG7A 3FXEB 3JAFA 4O2BE 2CHNA 3PTRB 5CA1E 3CX7B 1E2AA 4EAHA 2I6HA 3O9XA 4DV4T 3ZKRA 5JTGA 1U5PA 2CBJA 4H63H 4X5TA 1LVKA 3NZQA 2CEAA 1X9BA 2CWOA 3F31A 1G73A 3RGLA 5JR9A 4CXWA 4DBQA 1WFDA 3H37A 4X62T 1T98A 2D5UA 2XAFB 2QGSA 2KMFA 2VKJA 3B57A 3BQKA 3FBLA 3PUQA 3RRWA 2LSIA 3TKLB 2CA5A 4P1NA 3RI5A 2LOPA 1IJ5A 3IF8B 4HFVA 2CMRA 3P4PA 5AQKB 2K48A 5FL0A 5HEOA 4IIJE 2XSAA 4YTPA 2NR4A 3LFMA 4WBOA 4KI0F 3PJAJ 2DLRA 3FZLB 5FP3A 2XQ6A 4ILCA 5LB7B 4CN1A 1MMGA 2YDQA 4JUYA 2I59A 3OYXA 2BS4A 4HTEA 3ZJ1A 4DR7T 3J9X1 4WZXA 4UEMA 4I4TE 4JI5T 1WR6A 2EHOA 2V6XA 1ZKEA 3B13A 3E22E 5FY0A 4GYSA 4P09A 2WWUA 3DJBA 3RYHE 1T8BA 4ZZCA 5LP6E 3MACA 4DBRA 4JEHB 2CXLA 2HH7A 2LJLA 3EI0A 1HFAA 3JCFA 4IDOA 5FY1A 5FXZA 2ZM6T 1XNQT 3HKDE 2BG9E 3RX6A 2BVMA 1NEKA 2FBWA 4ZEYA 2IC9A 3FZFB 4O4HE 5JDFA 5ADXL 1N33T 3AAEB 3CQCB 5L3FB 5LHIB 2XASB 2XAGB 4O2AE 2CLYB 5AQPB 3C51A 2NP9A 5L3EB 4WBNE 4B3ST 2QA7A 3J7Yq 4C90A 4PJMA 4U72A 5JDHA 3QB5K 4QXBB 3RYFE 4JI1T 1XNRT 1OXZA 2LRKA 3RIAA 2DWKA 4ZI7E 4U2YA 4DV1T 2V26A 2D0TA 2XQ7A 2XTLA 3V5UA 3PUAA 1DU2A 3PDYA 5HXRA 4CN6A 3ZEFB 3RKGA 3IA3A 1IBKT 1OEDE 2BBJA 3CWZB 4DVDA 3LK2B 3HL6A 4UVAB 2PJQA 4QHOA 4PAGA 4F8HA 4DR1T 3ZMUB 4DR2T 4AXPA 2DL1A 4PFPA 4AQFC 3C4ZA 1NAFA 4DMVA 3K3OA 2UXDT 4LFBT 2LT3A 3NKZA 2ZM8A 3Q2MA 3TLTA 5HAXA 2CWYA 3L8RA 3DP7A 5JVDE 2H88A 3PUSA 3A5XA 3PUVF 4IDQA 3KV4A 1U4QA 1HNWT 4AQFA 3Q5WA 5F5WA 5ABHA 3PU3A 2FJDA 4IL4A 3R6NA 3IEEA 1HX1B 3QNUA 1SA0E 1QLBA 3N9OA 4HWDA 5AQSB 4EGWA 4L5GA 1NWMX 4YHJA 3ABVA 4IE7A 4H9RC 4I50E 4DMWA 2V7MA 2WZIA 2NW8A 3M3ZB 3W15B 2N2NA 2VKHA 2FJEA 1D1CA 2CHOA 2KINB 3AE9A 1SHZC 4V1Av 3K8PC 4KMCA 4EIWA 2V1DB 3HA4A 4QH5A 3I1AA 3UT5E 3ZC0A 2XHEB 3BQLA 3ZJ2A 5HCMA 3QK6A 4HKAA 5HXCA 3V5SA 3RYCE 3JAEA
chains in the Genus database with same CATH topology
4Z8XA 5JDQA 4KP3C 4C91A 4IHJE 4ANJA 4IE4A 4MHCA 3H3AA 2G0UA 2WBLA 4ZI2D 4IGUA 1MIYA 5LCYA 3KFWX 4PW8A 5LGTB 4FI5A 4UELA 2LSJA 4BJNA 4TX5A 4CQIA 3ZMSB 3NBXX 3O1HA 4H9NC 2JMKA 3ESLA 2NTYA 2NWBA 2W00A 2VKOA 5LBMA 3WAJA 2IAKA 3N2GE 4CZZB 3OJAA 4B6XA 5HWYA 3GA8A 3UULA 4UF0B 2V7JA 5JDHA 1LKXA 3N9LA 4H9OC 4ZI3D 2DNXA 4HGAA 5TAOA 5EZYE 3CPZA 3HR0A 1YD8G 2RA1A 1FEWA 1UX5A 3ZYMA 5F8PA 3CX6B 5HXEA 4UXNB 3ZN1B 4U74A 2ODUA 3CX8B 3EDVA 4PNIA 5M4YA 2KLQA 5DQWA 4GYRA 3UTKA 2Q9QB 3C4XA 4GK5E 4ILUA 4X1YE 5LJNA 4ASKA 4OYKA 1WYCA 3NRYA 4G2AA 5FYMA 2W61A 2Y8DA 2LSYA 2K9AA 1Z0PA 5LGNB 2DHRA 1D0XA 2A2FX 5H6QB 5JREA 2LSKA 5JDMA 4AKIA 2A72A 2VB6A 4GK0E 4KBMB 3RRCA 4PJJA 5F3JA 4OHFA 4O4JE 3O1JA 3HKEE 3Q9DA 5IHYA 4IE6A 2Q9QA 3EVYA 4IE5A 3CKDA 4IE0A 2DI4A 4O4LE 5C8YE 1G8XA 3R6NA 4PFOA 3RPUA 1D1AA 1ZV4X 4WNKA 4QWNB 3U3IA 1YKHB 4ERRA 4H9PC 2WSSV 2UXXB 2X67A 5FXWA 3UUMA 3AA7B 3RYIE 5LNKA 4PK5A 1IJ6A 2EHOD 4K0UA 2XAQB 3ZC1A 2IC6A 2X9WA 4FJOA 4CXXA 3PU8A 2NW9A 2OA5A 3MKDA 4PJNA 2ODVA 3UUNA 3ZYKA 5LGUB 3ZMZB 2D0UA 5L3DB 2HPLA 2J1DG 2M67A 2MTQA 4HEAA 5J2UE 3Q5XA 3ONXA 2X68A 5JDLA 4BA9A 2YU1A 5L3CB 3VU7H 4CI3B 4UV8B 3LBXB 3NZPA 2KXPB 1HCIA 3ZCIA 1S94A 1MMDA 3BQIA 3N9NA 3UUXB 4ADZA 4QXHB 2VKDA 1BR4A 5J2TE 1UCUA 4CXYA 2XAJB 3QC9A 4ZI3C 2V7LA 4L0RA 2BZBA 4OFZA 2YK0A 4JEUB 4HE8A 4E7SA 5CA0E 3MA9A 1BR0A 4PJLA 5L3GB 2L8KA 3KBTA 3AAAB 1Y64B 4QXCB 5AFUL 3KDSE 3VKGA 2W63A 4L9IA 3I9WA 3S4UA 2D2SA 3OBVE 3PE0A 1HF8A 2WMNA 2WMOA 2CXDA 1OWAA 3AA1B 1LRZA 2CXFA 3CQGB 2EHOB 4AQGA 4ZS2A 3OKQA 4XAXB 3BK9A 3VHLA 4N78D 5GONE 3MXZA 4UIGA 3KBUA 1X79A 4H9SE 4H9QC 4EZHA 3RKOA 1D0ZA 3SRZA 1D1BA 5JDGA 2IW5B 4OK0A 4EB6E 5L3BB 2RP4A 3ETUA 4O4IE 3HKBE 2X51A 2PFVA 1HX8A 3ZMVB 3R84B 4ZOLE 3NRXA 2W62A 4PK6A 4EZ4A 3N9QA 4GOUA 3IHRA 4P0AA 2Q9QC 2LE8A 2PBIA 3N9PA 3SWHA 2K24A 2ZLYA 4ISSA 4ISTA 2UXNB 1IZNB 2X9XA 5ETWA 2K5BB 3HKCE 4GIWA 2YINA 3HI2A 2MOZA 5J1GA 3AA0B 1VRBA 4P0BA 4JLEA 5EK3A 3VKHA 1FMVA 2YU2A 2JQQA 2VL8A 2KWHA 5IYZE 5CB4E 2KNDA 2VWAA 2DWGA 4PK4A 4AKHA 2Z6EA 4H63V 4OYJA 4QX8B 4BAYB 1WRDA 3KVAA 2H7VC 3K3NA 3KINB 4EYUA 4I43B 4YJ2E 5JQGE 2CM0A 2ZM0A 5JDNA 1IAPA 5LOVE 5LYJE 2LHRA 3KV6A 2GK9A 2V7KA 1FIOA 2WAUA 4MLKA 3T8OA 3AVRA 2CCQA 3AA6B 4QX7B 3P8CD 4UVBB 1MNDA 3E0ZA 5FNVE 3ZCJA 1V9DA 1KK7A 2CLYC 2X9HA 5HWXA 3DTOA 1CUNA 3MZKB 4DNDA 2XAHB 5HXHA 2KWIB 4WW0A 4X1IE 3AB3B 1AJ3A 4A56A 1QSDA 3RH3A 2E9XC 3GWHA 1S35A 2H7OA 1MIWA 4EOZB 4QKNA 3JC6C 4AKLA 5LHHB 1H7CA 2NW7A 3C50A 1MIVA 1KNZA 2LOSA 2MYSA 3CQXC 2YEVC 1MMNA 3UFEA 2SPCA 3FBZA 2NTXA 2NOXA 5E0OA 5LHGB 2C5JA 2W0GA 2N1GA 5FMNA 5H6RB 1E1HB 3LK42 2X66A 4MFRA 3N5LA 4AKRB 2C0SA 3GMIA 1EZ3A 2LSGA 4X1KE 2XUEA 2ES0A 5EK4A 3O4XE 1D0YA 1QUUA 3C64A 3ZYLA 4EYYR 3L3PA 1MMAA 2VASA 5JRCB 3LK3B 3KV9A 2JRKA 2ACXA 3EUHA 3C4WA 2E8IA 2XQYA 3MK7C 4ZHQE 1HTJF 2N9DA 3OYZA 1FMWA 1B7TA 5LG4A 4X20E 3KVBA 5JR9C 5FXXA 4XBFB 4F6RC 2JMHA 2BVLA 4TV8E 3CMLA 1LVFA 3IBPA 3FHNA 4EXTA 3WAKA 2ZM2A 3I0OA 3ZPOA 5A1LA 4UF0A 3GN5A 2JJ9A 2ZMAA 1ZEEA 5JRCA 4NUVA 3D0TA 1ZHCA 4ZI2C 2JPFA 3ANWB 5HYAA 4TN7B 3LJCA 2LM9A 2P9BA 3QUJA 3RC3A 4YJ3E 3PUGA 5LXTE 2BDEA 3I0QA 3LBXA 2PG8A 3AVSA 3ZN0B 2VK9A 1HS7A 2E9XA 4AKGA 4AI6A 5FY7A 5BMVE 4TV9E 1VOMA 3O1IA 3L09A 2EHOC 3MJXA 5L2LA 3GN5B 1UX4A 2HPJA 1YKEB 4J2CA 4KUMB 3PURA 2B1EA 4IDZA 2CE7A 4ZS3A 4YLHA 3ANWA 2KZ7B 5LBQB 4XZCA 4MBQA 3N9MA 1O3XA 4DO0A 2MBGA 4M1PA 4CI1B 1HG5A 4TUYE 5DQVA 3U78A 2E9XB 5KDMC 3ZMTB 1YW0A 2C5IT 3E08A 2H3RA 5EK2A 1MNEA 4O8SA 3F57A 2A3DA 3C98B 3JC6D 3RC8A 3FXDB 3EDUA 4CI2B 5JH7E 4BJMA 3SOLA 3KV5A 4HN9A 2E9XD 1WLXA 4TZ4C 1HG2A 3ZLIA 5JR9B 2C5KT 4UVCB 1BR2A 3FB2A 3K3QC 3N2OA 5FXZA 4MALA 3AAIA 4E7ZA 5LJMA 2LHNA 2Y48B 5KMGP 3N2KE 2L9QA 1WYBA 4NUUA 1US7B 1BR1A 3ETVA 4G63A 3CVRA 2Y6XA 2LEHA 3P7IA 4I55E 4UV9B 5DJQC 5KX5E 2X9YA 2KT9A 2X0LB 3WI3A 5HXSA 3I9YA 2L3LA 5LA6E 2V7IA 5DABA 2Q9QD 2WM9A 3M65A 4YFSA 5FXVA 2DCFA 3F2EA 3LG7A 3FXEB 4O2BE 3PTRB 5CA1E 3CX7B 4EAHA 3O9XA 1U5PA 4H63H 1LVKA 3NZQA 2CEAA 2CWOA 3F31A 4CXWA 1G73A 4DBQA 5JR9A 3H37A 1T98A 2D5UA 2XAFB 2QGSA 2KMFA 2VKJA 3B57A 3BQKA 3FBLA 3PUQA 3RRWA 2LSIA 2CA5A 2LOPA 1IJ5A 3IF8B 4HFVA 2CMRA 2K48A 4IIJE 4WBOA 3LFMA 5FP3A 3TKLB 2DLRA 1MMGA 4JUYA 2I59A 3OYXA 4HTEA 3ZJ1A 3J9X1 4UEMA 4I4TE 1WR6A 2EHOA 3B13A 1ZKEA 3E22E 5FY0A 4GYSA 4P09A 2WWUA 3DJBA 3RYHE 5LP6E 3MACA 4DBRA 4JEHB 2CXLA 2HH7A 2LJLA 5FY1A 1HFAA 3HKDE 3RX6A 2BVMA 2IC9A 4O4HE 5JDFA 5ADXL 3AAEB 3CQCB 5L3FB 5LHIB 2XASB 2XAGB 4O2AE 2CLYB 3C51A 2NP9A 5L3EB 4WBNE 2QA7A 3J7Yq 4C90A 4PJMA 4U72A 4QXBB 3RYFE 1OXZA 2DWKA 4ZI7E 2V26A 2D0TA 2XTLA 3V5UA 3PUAA 3PDYA 5HXRA 3ZEFB 3CWZB 4DVDA 3LK2B 3HL6A 4UVAB 2PJQA 4QHOA 4PAGA 3ZMUB 4AXPA 4PFPA 4AQFC 3C4ZA 1NAFA 4DMVA 3K3OA 2LT3A 3Q2MA 2ZM8A 5HAXA 2CWYA 3DP7A 5JVDE 3PUSA 3A5XA 3KV4A 1U4QA 4AQFA 3Q5WA 3PU3A 3SS1A 3IEEA 1SA0E 3N9OA 4L5GA 1NWMX 4YHJA 4IE7A 4DMWA 4H9RC 4I50E 2V7MA 2NW8A 3W15B 2N2NA 2VKHA 2KINB 1D1CA 4V1Av 4EIWA 1SHZC 3K8PC 4KMCA 2V1DB 3HA4A 3I1AA 3UT5E 3ZC0A 2XHEB 3BQLA 3ZJ2A 3QK6A 4HKAA 5HXCA 3V5SA 3RYCE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DNX A;  1EZ3 A;  2XHE B;  3C98 B;  4TX5 A;  1HS7 A;  5M4Y A;  1BR0 A;  1FIO A;  4JEH B;  1FEW A;  3LG7 A;  1S94 A;  5LG4 A;  1G73 A;  4JEU B; 
#chains in the Genus database with same CATH topology
 2V8S V;  4Z8X A;  5JDQ A;  4KP3 C;  3RLF F;  3TLS A;  4C91 A;  4IHJ E;  4JI2 T;  4ANJ A;  4IE4 A;  5C2T A;  4MHC A;  4IRE A;  2HN2 A;  2BS3 A;  2X0Y A;  2G0U A;  3H3A A;  4TNW A;  3RQW A;  3A8Y C;  2WBL A;  4ZI2 D;  4IGU A;  1MIY A;  5FVL A;  3KFW X;  2IUB A;  4PW8 A;  5LCY A;  4FI5 A;  2M6I A;  2YDS A;  5LGT B;  3FZM B;  4UEL A;  2LSJ A;  3CK6 A;  3UUB A;  4BJN A;  4TX5 A;  4CQI A;  5LMN T;  3ZMS B;  3NBX X;  3O1H A;  4H9N C;  5LG3 A;  3UQ7 A;  2PTF A;  2WP9 A;  5CGM A;  2JMK A;  3ESL A;  1FJG T;  2LKG A;  2LLY A;  4NPP A;  2NTY A;  2NWB A;  2W00 A;  2VKO A;  5LBM A;  3AED A;  3WAJ A;  2IAK A;  5ABE A;  4GKK T;  4DV6 T;  3N2G E;  3NVO A;  4CZZ B;  3OJA A;  4B6X A;  5HWY A;  3GA8 A;  3UUL A;  4UF0 B;  2V7J A;  3Q5E A;  1LKX A;  3N9L A;  4H9O C;  1SE7 A;  2DNX A;  4HGA A;  5TAO A;  4CI3 B;  4ZI3 D;  5EZY E;  4DR5 T;  2UUB T;  2V6Y A;  3CPZ A;  3HR0 A;  1YD8 G;  2RA1 A;  1FEW A;  1E7P A;  1UX5 A;  4QH1 A;  5F8P A;  3ZYM A;  5LMU T;  3CX6 B;  5HXE A;  4NXN T;  4UXN B;  4YY3 T;  4Z90 A;  3ZN1 B;  4B3M T;  4HFC A;  4U74 A;  5HEU A;  2ODU A;  3CX8 B;  4K0K T;  3EDV A;  4P0A A;  4PNI A;  5M4Y A;  4YT0 A;  2KLQ A;  5DQW A;  4GYR A;  3UTK A;  2Q9Q B;  5KXJ A;  3C4X A;  4GK5 E;  4ILU A;  4X1Y E;  5LJN A;  4ASK A;  4OYK A;  1WYC A;  3NRY A;  4A97 A;  4G2A A;  5AQI B;  3RIU C;  2LKH A;  5FYM A;  1KF6 A;  2W61 A;  2Y8D A;  3UU4 A;  2FUP A;  2LSY A;  2K9A A;  1Z0P A;  2WB5 A;  5LGN B;  2JQK A;  1D0X A;  2A2F X;  2DHR A;  5H6Q B;  5JRE A;  4AQY T;  2LSK A;  5JDM A;  4AKI A;  2A72 A;  2VB6 A;  4GK0 E;  4LFC T;  4KBM B;  2YOE A;  2V6Y B;  3PUX F;  3RRC A;  4PJJ A;  4EV6 A;  5F3J A;  4OHF A;  3VR9 A;  4O4J E;  3O1J A;  3HKE E;  3Q9D A;  1OED C;  3A7M A;  5IHY A;  4IE6 A;  2Q9Q A;  3EVY A;  2OLT A;  3CKD A;  3OPC A;  2DI4 A;  3AE5 A;  4IE5 A;  4IE0 A;  1G8X A;  2WDV A;  4O4L E;  2XQ9 A;  1T7S A;  1D1A A;  1ZV4 X;  4QH4 A;  4PFO A;  4QWN B;  1YKH B;  4WNK A;  3U3I A;  4H9P C;  2WSS V;  2UXX B;  5HEH A;  2X67 A;  4A5X A;  5FKY A;  5FXW A;  3UUM A;  3AA7 B;  3RYI E;  5LNK A;  5CJ5 A;  4PK5 A;  1IJ6 A;  4JI8 T;  1KNP A;  2EHO D;  1W0A A;  2XAQ B;  4K0U A;  3TLV A;  3T1Y T;  1I94 T;  3ZC1 A;  2IC6 A;  4JBW F;  5LJM A;  2V5D A;  2W2U A;  2BG9 B;  2X9W A;  4FJO A;  4AIS A;  3PU8 A;  2NW9 A;  4CXX A;  2OA5 A;  3MKD A;  4PJN A;  4U7Y A;  1L0V A;  2ODV A;  3RIU A;  3UUN A;  3ZYK A;  5LGU B;  5L47 A;  3ZMZ B;  2E2A A;  2D0U A;  3UQ4 A;  2HPL A;  4HFD A;  5L3D B;  2J1D G;  4I0U A;  2M67 A;  2MTQ A;  5AQH B;  2X0H A;  4HEA A;  2E5V A;  5ABG A;  3Q5X A;  3SS1 A;  5J2U E;  3ONX A;  2X68 A;  5C3J A;  5JDL A;  4BA9 A;  2YU1 A;  3P4W A;  5L3C B;  3VU7 H;  3UU8 A;  4UV8 B;  3AEC A;  2WY2 A;  1UUR A;  2KXP B;  3LBX B;  3NZP A;  1HCI A;  3VR8 A;  3ZST A;  1UK5 A;  1T72 A;  3ZCI A;  1S94 A;  1MMD A;  3BQI A;  3N9N A;  3UUX B;  4ADZ A;  1WCR A;  4QXH B;  2VKD A;  1BR4 A;  2QYW A;  5J2T E;  1UCU A;  2I0M A;  4CXY A;  3AE4 A;  3QB5 A;  4HFE A;  3FZH B;  2XAJ B;  3SFD A;  3QC9 A;  4ZI3 C;  2V7L A;  4DUZ T;  4L0R A;  2BZB A;  3ZT7 A;  3RPU A;  4OFZ A;  2YK0 A;  4JEU B;  4HE8 A;  3AEA A;  4E7S A;  1JNZ A;  4NIQ A;  3UU6 A;  2XQ3 A;  5CA0 E;  3MA9 A;  4DV0 T;  1BR0 A;  2LM2 A;  3CIR A;  4PJL A;  4IL9 A;  2WWV A;  5L3G B;  2L8K A;  3KBT A;  3AAA B;  1Y64 B;  4QXC B;  5AFU L;  3KDS E;  3VKG A;  2XM2 A;  2W63 A;  4TNV A;  3VRA A;  2QVA A;  4L9I A;  3I9W A;  3S4U A;  4ZXL A;  2D2S A;  4IT4 A;  3OBV E;  3PE0 A;  2BKO A;  1HF8 A;  4YXD A;  4X64 T;  2WMN A;  2WMO A;  2CPT A;  1KNR A;  2CXD A;  4OX9 T;  1OWA A;  2IDO B;  5AQT B;  1KFY A;  3AA1 B;  4DR6 T;  1CHU A;  4LF5 T;  1LRZ A;  2M6B A;  2CXF A;  2JQH A;  2MAW A;  3CQG B;  2EHO B;  4AQG A;  4LF6 T;  1ZOY A;  4LF8 T;  4ZS2 A;  3OKQ A;  4YTM A;  4ILA A;  4B3R T;  4XAX B;  3BK9 A;  3VHL A;  4N78 D;  3RHW A;  1I6Z A;  4YSX A;  5GON E;  2WDQ A;  3MXZ A;  4UIG A;  5AQL B;  1XZY A;  2VQF T;  3KBU A;  1IBL T;  3AE8 A;  1OED A;  1X79 A;  4H9S E;  4JI6 T;  4H9Q C;  4EZH A;  3RKO A;  2XZE A;  1D0Z A;  3K1S A;  3SRZ A;  1D1B A;  1M7K A;  4HWC A;  2IW5 B;  5JDG A;  4OK0 A;  4EB6 E;  5L3B B;  2RP4 A;  4LML A;  3UU5 A;  3ETU A;  5FL1 A;  4O4I E;  3HKB E;  1IBM T;  2X51 A;  3ONJ A;  2PFV A;  4LF7 T;  1HX8 A;  3PV0 F;  4HFH A;  3ZMV B;  3R84 B;  4ZOL E;  3NRX A;  2W62 A;  4PK6 A;  4EZ4 A;  3N9Q A;  5J0Z A;  4GOU A;  4HFB A;  3T1H T;  2J47 A;  3AEG A;  3IHR A;  4HWI B;  3OTO T;  2Q9Q C;  2LE8 A;  2PBI A;  3LDQ B;  3N9P A;  5IWA T;  3SWH A;  3P4S A;  2K24 A;  2ZLY A;  4ISS A;  4IST A;  2UXN B;  1IZN B;  2X9X A;  5ETW A;  4JV5 T;  2K5B B;  4ILB A;  3AE6 A;  3HKC E;  4GIW A;  4LF4 T;  2YIN A;  3HI2 A;  2F4V T;  2MOZ A;  1N36 T;  5J1G A;  3AA0 B;  1OED B;  1VRB A;  2UUC T;  2OV9 A;  4P0B A;  4DR4 T;  2JQ9 A;  4JLE A;  5EK3 A;  4LF9 T;  3VKH A;  1FMV A;  2YU2 A;  2JQQ A;  2YDR A;  2VL8 A;  4LMK A;  4UR9 A;  2KWH A;  5IYZ E;  5CB4 E;  2KND A;  2VWA A;  2DWG A;  4PK4 A;  5AQG B;  4NXM T;  4AKH A;  3RQU A;  2LRL A;  1WR0 A;  2Z6E A;  4H63 V;  4OYJ A;  4QX8 B;  5AQU B;  3RF1 A;  4BAY B;  4JI3 T;  1WRD A;  3KVA A;  2H7V C;  2W66 A;  3K3N A;  3KIN B;  4EYU A;  1YXR A;  3EAB A;  5AQJ B;  2XQ8 A;  4I43 B;  5HEJ A;  4JI4 T;  4YJ2 E;  1J5E T;  5JQG E;  2CM0 A;  2ZM0 A;  5JDN A;  2A9U A;  2HHH T;  3PUY F;  1IAP A;  3QOF A;  4GKJ T;  5LOV E;  5LYJ E;  2LHR A;  3KV6 A;  2GK9 A;  1ZP0 A;  2XQ5 A;  4B3T T;  3AE2 A;  5FVK A;  2FJA A;  1FIO A;  2V7K A;  2WAU A;  2W67 A;  2YKS A;  4MLK A;  3T8O A;  3AVR A;  2CCQ A;  4HWF A;  2VQE T;  1N32 T;  3AA6 B;  4QX7 B;  3P8C D;  4UVB B;  1MND A;  5L4H A;  4YTN A;  3E0Z A;  5FNV E;  3ZCJ A;  1V9D A;  1KK7 A;  2CLY C;  2X9H A;  5HWX A;  3DTO A;  1CUN A;  3MZK B;  4DND A;  2XAH B;  5HXH A;  1HNX T;  3H3M A;  2KWI B;  1W0B A;  4WW0 A;  4X1I E;  3UU3 A;  3AB3 B;  1AJ3 A;  4A56 A;  1QSD A;  3RH3 A;  2E9X C;  2WU5 A;  3P4Q A;  4U3C A;  3GWH A;  1S35 A;  4LMJ A;  2XPK A;  4DUY T;  2UXC T;  2WDR A;  2H7O A;  2J62 A;  2HN1 A;  1MIW A;  4EOZ B;  5HCJ A;  4QKN A;  2H89 A;  3JC6 C;  1YQ4 A;  4AKL A;  2QRX A;  5LHH B;  1H7C A;  2NW7 A;  3C50 A;  1MIV A;  1KNZ A;  5AQO B;  4YHH T;  2LOS A;  2MYS A;  2IIU A;  2XQA A;  2XY8 B;  3CQX C;  3PUW F;  2YEV C;  1MMN A;  3L39 A;  3UFE A;  3ZT6 A;  2SPC A;  4U33 A;  3AEF A;  3AEB A;  1VCT A;  1Y01 A;  2JIW A;  3FBZ A;  3SFE A;  4TWD A;  1W9R A;  2NTX A;  2NOX A;  2VVS A;  5E0O A;  5LHG B;  1XWM A;  4DV3 T;  1XDO A;  2C5J A;  2W0G A;  2N1G A;  5FMN A;  2IML A;  3PUZ F;  5HEG A;  1XMQ T;  3B5M A;  5H6R B;  2K3W A;  1E1H B;  3FZK B;  3LK4 2;  4ERR A;  2CRB A;  2WCA A;  2X66 A;  4MFR A;  3N5L A;  5IUX A;  4AKR B;  4DV2 T;  3P50 A;  2C0S A;  4TWF A;  2D9D A;  1EZ3 A;  3GMI A;  2LSG A;  4X1K E;  2XUE A;  2WZH A;  2ES0 A;  5AQM B;  5EK4 A;  3O4X E;  1D0Y A;  1QUU A;  3C64 A;  3ZYL A;  4EYY R;  3L3P A;  2AE9 A;  2UU9 T;  2UXB T;  1MMA A;  2VAS A;  5JRC B;  3LK3 B;  3KV9 A;  2BS2 A;  2JRK A;  2ACX A;  3EUH A;  3UFG A;  4KHZ F;  3C4W A;  1M62 A;  2E8I A;  1GQE A;  2XQY A;  1NEN A;  3MK7 C;  4TWH A;  2XJ7 A;  3ONL C;  1HTJ F;  4ZHQ E;  2N9D A;  3OYZ A;  1FMW A;  1B7T A;  5LG4 A;  3ZSS A;  2BG9 C;  4KHP T;  4X20 E;  3KVB A;  1JNR A;  5FXX A;  5JR9 C;  4XBF B;  2YN6 A;  4F6R C;  2JMH A;  2BVL A;  4X66 T;  4TV8 E;  5ABF B;  4DID B;  3CML A;  1LVF A;  3IBP A;  2ACZ A;  2BKN A;  3FHN A;  4EXT A;  2W4X A;  3AE3 A;  2IHR 1;  4JI0 T;  3WAK A;  5AQN B;  2ZM2 A;  3I0O A;  4Z91 A;  3ZPO A;  2VUR A;  4UF0 A;  5A1L A;  3GN5 A;  2BG9 A;  2JJ9 A;  2ZMA A;  5C8Y E;  1ZEE A;  5JRC A;  3LSV A;  4NUV A;  3D0T A;  1ZHC A;  4ZI2 C;  2JPF A;  3ANW B;  5HYA A;  3AXJ B;  2VL0 A;  3OVU A;  3X1D A;  1N34 T;  4TN7 B;  3LJC A;  2LM9 A;  1W09 A;  2P9B A;  5AQV B;  3ZT5 A;  3QUJ A;  3RC3 A;  4IDN A;  2BKP A;  4YJ3 E;  3PUG A;  1YQ3 A;  2BDE A;  5LXT E;  4CN4 A;  1UGO A;  3I0Q A;  3LBX A;  2PG8 A;  4KX6 A;  4EED A;  3PJA A;  2KSR A;  3AVS A;  3ZN0 B;  2VK9 A;  1UUS A;  1HS7 A;  1XDP A;  5ABF A;  2E9X A;  4AKG A;  4AI6 A;  5FY7 A;  4COF A;  4TV9 E;  5BMV E;  1VOM A;  3O1I A;  3L09 A;  2EHO C;  2J4G A;  4X65 T;  3MJX A;  5L2L A;  3GN5 B;  4A98 A;  1UX4 A;  2CBI A;  4JI7 T;  2HPJ A;  1YKE B;  3G06 A;  4J2C A;  4KUM B;  3PUR A;  2B1E A;  2B76 A;  1SUM B;  2CE7 A;  4IDZ A;  4ZS3 A;  4YSZ A;  4YLH A;  4U7I A;  2XQ4 A;  3ANW A;  4AIU A;  4U31 A;  3AXJ A;  4EEB A;  2BBH A;  2KZ7 B;  4HFI A;  5CFB A;  5LBQ B;  3JAD A;  3TLW A;  4XZC A;  4MBQ A;  3N9M A;  4DV5 T;  2WS3 A;  2MPK A;  1O3X A;  4DO0 A;  1J1J A;  2MBG A;  4YSY A;  1XMO T;  2E5L T;  4M1P A;  4CI1 B;  1HG5 A;  4TUY E;  5DQV A;  3U78 A;  1HR0 T;  1Z8U A;  5AQR B;  2E9X B;  3RIF A;  5KDM C;  2WQY A;  1J5W A;  2VVN A;  1R8I A;  1YW0 A;  2C5I T;  3E08 A;  1VCS A;  2H3R A;  3TLU A;  3ZMT B;  5AQF B;  5EK2 A;  1MNE A;  4O8S A;  2XM1 A;  3F57 A;  4DV7 T;  4HWH A;  2A3D A;  4IDP A;  5BR8 T;  4DR3 T;  3C98 B;  3JC6 D;  3RC8 A;  3AE1 A;  3EDU A;  3FXD B;  3VRB A;  4BJM A;  4CI2 B;  5JH7 E;  4LFA T;  2FJB A;  3SOL A;  3KV5 A;  4HN9 A;  2E9X D;  3EAM A;  1WLX A;  3P4R A;  1HG2 A;  3Q5D A;  4TZ4 C;  4Q25 A;  3ZLI A;  4ZZB A;  5JR9 B;  3AE7 A;  2C5K T;  2RPA A;  1BR2 A;  2WU2 A;  3FB2 A;  3K3Q C;  3N2O A;  4MAL A;  4UVC B;  2XSB A;  3AAI A;  4WYV A;  5AQQ B;  4E7Z A;  2V5C A;  1KEY A;  2LHN A;  2Y48 B;  3AEE A;  5KMG P;  4U2Z A;  3N2K E;  2L9Q A;  1WYB A;  1HNZ T;  4NUU A;  5L4E A;  1US7 B;  1BR1 A;  3ETV A;  4G63 A;  3CVR A;  2Y6X A;  2LEH A;  3P7I A;  4I55 E;  4UV9 B;  3EHZ A;  5DJQ C;  2X9Y A;  2KT9 A;  5KX5 E;  2AXD S;  2X0L B;  3WI3 A;  5HXS A;  3I9Y A;  3NWI A;  2UUA T;  2L3L A;  5LA6 E;  4JYA T;  2V7I A;  5DAB A;  2Q9Q D;  2WM9 A;  3M65 A;  4YFS A;  5FXV A;  2R6G F;  2DCF A;  3F2E A;  3LG7 A;  3FXE B;  3JAF A;  4O2B E;  2CHN A;  3PTR B;  5CA1 E;  3CX7 B;  1E2A A;  4EAH A;  2I6H A;  3O9X A;  4DV4 T;  3ZKR A;  5JTG A;  1U5P A;  2CBJ A;  4H63 H;  4X5T A;  1LVK A;  3NZQ A;  2CEA A;  1X9B A;  2CWO A;  3F31 A;  1G73 A;  3RGL A;  5JR9 A;  4CXW A;  4DBQ A;  1WFD A;  3H37 A;  4X62 T;  1T98 A;  2D5U A;  2XAF B;  2QGS A;  2KMF A;  2VKJ A;  3B57 A;  3BQK A;  3FBL A;  3PUQ A;  3RRW A;  2LSI A;  3TKL B;  2CA5 A;  4P1N A;  3RI5 A;  2LOP A;  1IJ5 A;  3IF8 B;  4HFV A;  2CMR A;  3P4P A;  5AQK B;  2K48 A;  5FL0 A;  5HEO A;  4IIJ E;  2XSA A;  4YTP A;  2NR4 A;  3LFM A;  4WBO A;  4KI0 F;  3PJA J;  2DLR A;  3FZL B;  5FP3 A;  2XQ6 A;  4ILC A;  5LB7 B;  4CN1 A;  1MMG A;  2YDQ A;  4JUY A;  2I59 A;  3OYX A;  2BS4 A;  4HTE A;  3ZJ1 A;  4DR7 T;  3J9X 1;  4WZX A;  4UEM A;  4I4T E;  4JI5 T;  1WR6 A;  2EHO A;  2V6X A;  1ZKE A;  3B13 A;  3E22 E;  5FY0 A;  4GYS A;  4P09 A;  2WWU A;  3DJB A;  3RYH E;  1T8B A;  4ZZC A;  5LP6 E;  3MAC A;  4DBR A;  4JEH B;  2CXL A;  2HH7 A;  2LJL A;  3EI0 A;  1HFA A;  3JCF A;  4IDO A;  5FY1 A;  5FXZ A;  2ZM6 T;  1XNQ T;  3HKD E;  2BG9 E;  3RX6 A;  2BVM A;  1NEK A;  2FBW A;  4ZEY A;  2IC9 A;  3FZF B;  4O4H E;  5JDF A;  5ADX L;  1N33 T;  3AAE B;  3CQC B;  5L3F B;  5LHI B;  2XAS B;  2XAG B;  4O2A E;  2CLY B;  5AQP B;  3C51 A;  2NP9 A;  5L3E B;  4WBN E;  4B3S T;  2QA7 A;  3J7Y q;  4C90 A;  4PJM A;  4U72 A;  5JDH A;  3QB5 K;  4QXB B;  3RYF E;  4JI1 T;  1XNR T;  1OXZ A;  2LRK A;  3RIA A;  2DWK A;  4ZI7 E;  4U2Y A;  4DV1 T;  2V26 A;  2D0T A;  2XQ7 A;  2XTL A;  3V5U A;  3PUA A;  1DU2 A;  3PDY A;  5HXR A;  4CN6 A;  3ZEF B;  3RKG A;  3IA3 A;  1IBK T;  1OED E;  2BBJ A;  3CWZ B;  4DVD A;  3LK2 B;  3HL6 A;  4UVA B;  2PJQ A;  4QHO A;  4PAG A;  4F8H A;  4DR1 T;  3ZMU B;  4DR2 T;  4AXP A;  2DL1 A;  4PFP A;  4AQF C;  3C4Z A;  1NAF A;  4DMV A;  3K3O A;  2UXD T;  4LFB T;  2LT3 A;  3NKZ A;  2ZM8 A;  3Q2M A;  3TLT A;  5HAX A;  2CWY A;  3L8R A;  3DP7 A;  5JVD E;  2H88 A;  3PUS A;  3A5X A;  3PUV F;  4IDQ A;  3KV4 A;  1U4Q A;  1HNW T;  4AQF A;  3Q5W A;  5F5W A;  5ABH A;  3PU3 A;  2FJD A;  4IL4 A;  3R6N A;  3IEE A;  1HX1 B;  3QNU A;  1SA0 E;  1QLB A;  3N9O A;  4HWD A;  5AQS B;  4EGW A;  4L5G A;  1NWM X;  4YHJ A;  3ABV A;  4IE7 A;  4H9R C;  4I50 E;  4DMW A;  2V7M A;  2WZI A;  2NW8 A;  3M3Z B;  3W15 B;  2N2N A;  2VKH A;  2FJE A;  1D1C A;  2CHO A;  2KIN B;  3AE9 A;  1SHZ C;  4V1A v;  3K8P C;  4KMC A;  4EIW A;  2V1D B;  3HA4 A;  4QH5 A;  3I1A A;  3UT5 E;  3ZC0 A;  2XHE B;  3BQL A;  3ZJ2 A;  5HCM A;  3QK6 A;  4HKA A;  5HXC A;  3V5S A;  3RYC E;  3JAE A; 
#chains in the Genus database with same CATH homology
 4Z8X A;  5JDQ A;  4KP3 C;  4C91 A;  4IHJ E;  4ANJ A;  4IE4 A;  4MHC A;  3H3A A;  2G0U A;  2WBL A;  4ZI2 D;  4IGU A;  1MIY A;  5LCY A;  3KFW X;  4PW8 A;  5LGT B;  4FI5 A;  4UEL A;  2LSJ A;  4BJN A;  4TX5 A;  4CQI A;  3ZMS B;  3NBX X;  3O1H A;  4H9N C;  2JMK A;  3ESL A;  2NTY A;  2NWB A;  2W00 A;  2VKO A;  5LBM A;  3WAJ A;  2IAK A;  3N2G E;  4CZZ B;  3OJA A;  4B6X A;  5HWY A;  3GA8 A;  3UUL A;  4UF0 B;  2V7J A;  5JDH A;  1LKX A;  3N9L A;  4H9O C;  4ZI3 D;  2DNX A;  4HGA A;  5TAO A;  5EZY E;  3CPZ A;  3HR0 A;  1YD8 G;  2RA1 A;  1FEW A;  1UX5 A;  3ZYM A;  5F8P A;  3CX6 B;  5HXE A;  4UXN B;  3ZN1 B;  4U74 A;  2ODU A;  3CX8 B;  3EDV A;  4PNI A;  5M4Y A;  2KLQ A;  5DQW A;  4GYR A;  3UTK A;  2Q9Q B;  3C4X A;  4GK5 E;  4ILU A;  4X1Y E;  5LJN A;  4ASK A;  4OYK A;  1WYC A;  3NRY A;  4G2A A;  5FYM A;  2W61 A;  2Y8D A;  2LSY A;  2K9A A;  1Z0P A;  5LGN B;  2DHR A;  1D0X A;  2A2F X;  5H6Q B;  5JRE A;  2LSK A;  5JDM A;  4AKI A;  2A72 A;  2VB6 A;  4GK0 E;  4KBM B;  3RRC A;  4PJJ A;  5F3J A;  4OHF A;  4O4J E;  3O1J A;  3HKE E;  3Q9D A;  5IHY A;  4IE6 A;  2Q9Q A;  3EVY A;  4IE5 A;  3CKD A;  4IE0 A;  2DI4 A;  4O4L E;  5C8Y E;  1G8X A;  3R6N A;  4PFO A;  3RPU A;  1D1A A;  1ZV4 X;  4WNK A;  4QWN B;  3U3I A;  1YKH B;  4ERR A;  4H9P C;  2WSS V;  2UXX B;  2X67 A;  5FXW A;  3UUM A;  3AA7 B;  3RYI E;  5LNK A;  4PK5 A;  1IJ6 A;  2EHO D;  4K0U A;  2XAQ B;  3ZC1 A;  2IC6 A;  2X9W A;  4FJO A;  4CXX A;  3PU8 A;  2NW9 A;  2OA5 A;  3MKD A;  4PJN A;  2ODV A;  3UUN A;  3ZYK A;  5LGU B;  3ZMZ B;  2D0U A;  5L3D B;  2HPL A;  2J1D G;  2M67 A;  2MTQ A;  4HEA A;  5J2U E;  3Q5X A;  3ONX A;  2X68 A;  5JDL A;  4BA9 A;  2YU1 A;  5L3C B;  3VU7 H;  4CI3 B;  4UV8 B;  3LBX B;  3NZP A;  2KXP B;  1HCI A;  3ZCI A;  1S94 A;  1MMD A;  3BQI A;  3N9N A;  3UUX B;  4ADZ A;  4QXH B;  2VKD A;  1BR4 A;  5J2T E;  1UCU A;  4CXY A;  2XAJ B;  3QC9 A;  4ZI3 C;  2V7L A;  4L0R A;  2BZB A;  4OFZ A;  2YK0 A;  4JEU B;  4HE8 A;  4E7S A;  5CA0 E;  3MA9 A;  1BR0 A;  4PJL A;  5L3G B;  2L8K A;  3KBT A;  3AAA B;  1Y64 B;  4QXC B;  5AFU L;  3KDS E;  3VKG A;  2W63 A;  4L9I A;  3I9W A;  3S4U A;  2D2S A;  3OBV E;  3PE0 A;  1HF8 A;  2WMN A;  2WMO A;  2CXD A;  1OWA A;  3AA1 B;  1LRZ A;  2CXF A;  3CQG B;  2EHO B;  4AQG A;  4ZS2 A;  3OKQ A;  4XAX B;  3BK9 A;  3VHL A;  4N78 D;  5GON E;  3MXZ A;  4UIG A;  3KBU A;  1X79 A;  4H9S E;  4H9Q C;  4EZH A;  3RKO A;  1D0Z A;  3SRZ A;  1D1B A;  5JDG A;  2IW5 B;  4OK0 A;  4EB6 E;  5L3B B;  2RP4 A;  3ETU A;  4O4I E;  3HKB E;  2X51 A;  2PFV A;  1HX8 A;  3ZMV B;  3R84 B;  4ZOL E;  3NRX A;  2W62 A;  4PK6 A;  4EZ4 A;  3N9Q A;  4GOU A;  3IHR A;  4P0A A;  2Q9Q C;  2LE8 A;  2PBI A;  3N9P A;  3SWH A;  2K24 A;  2ZLY A;  4ISS A;  4IST A;  2UXN B;  1IZN B;  2X9X A;  5ETW A;  2K5B B;  3HKC E;  4GIW A;  2YIN A;  3HI2 A;  2MOZ A;  5J1G A;  3AA0 B;  1VRB A;  4P0B A;  4JLE A;  5EK3 A;  3VKH A;  1FMV A;  2YU2 A;  2JQQ A;  2VL8 A;  2KWH A;  5IYZ E;  5CB4 E;  2KND A;  2VWA A;  2DWG A;  4PK4 A;  4AKH A;  2Z6E A;  4H63 V;  4OYJ A;  4QX8 B;  4BAY B;  1WRD A;  3KVA A;  2H7V C;  3K3N A;  3KIN B;  4EYU A;  4I43 B;  4YJ2 E;  5JQG E;  2CM0 A;  2ZM0 A;  5JDN A;  1IAP A;  5LOV E;  5LYJ E;  2LHR A;  3KV6 A;  2GK9 A;  2V7K A;  1FIO A;  2WAU A;  4MLK A;  3T8O A;  3AVR A;  2CCQ A;  3AA6 B;  4QX7 B;  3P8C D;  4UVB B;  1MND A;  3E0Z A;  5FNV E;  3ZCJ A;  1V9D A;  1KK7 A;  2CLY C;  2X9H A;  5HWX A;  3DTO A;  1CUN A;  3MZK B;  4DND A;  2XAH B;  5HXH A;  2KWI B;  4WW0 A;  4X1I E;  3AB3 B;  1AJ3 A;  4A56 A;  1QSD A;  3RH3 A;  2E9X C;  3GWH A;  1S35 A;  2H7O A;  1MIW A;  4EOZ B;  4QKN A;  3JC6 C;  4AKL A;  5LHH B;  1H7C A;  2NW7 A;  3C50 A;  1MIV A;  1KNZ A;  2LOS A;  2MYS A;  3CQX C;  2YEV C;  1MMN A;  3UFE A;  2SPC A;  3FBZ A;  2NTX A;  2NOX A;  5E0O A;  5LHG B;  2C5J A;  2W0G A;  2N1G A;  5FMN A;  5H6R B;  1E1H B;  3LK4 2;  2X66 A;  4MFR A;  3N5L A;  4AKR B;  2C0S A;  3GMI A;  1EZ3 A;  2LSG A;  4X1K E;  2XUE A;  2ES0 A;  5EK4 A;  3O4X E;  1D0Y A;  1QUU A;  3C64 A;  3ZYL A;  4EYY R;  3L3P A;  1MMA A;  2VAS A;  5JRC B;  3LK3 B;  3KV9 A;  2JRK A;  2ACX A;  3EUH A;  3C4W A;  2E8I A;  2XQY A;  3MK7 C;  4ZHQ E;  1HTJ F;  2N9D A;  3OYZ A;  1FMW A;  1B7T A;  5LG4 A;  4X20 E;  3KVB A;  5JR9 C;  5FXX A;  4XBF B;  4F6R C;  2JMH A;  2BVL A;  4TV8 E;  3CML A;  1LVF A;  3IBP A;  3FHN A;  4EXT A;  3WAK A;  2ZM2 A;  3I0O A;  3ZPO A;  5A1L A;  4UF0 A;  3GN5 A;  2JJ9 A;  2ZMA A;  1ZEE A;  5JRC A;  4NUV A;  3D0T A;  1ZHC A;  4ZI2 C;  2JPF A;  3ANW B;  5HYA A;  4TN7 B;  3LJC A;  2LM9 A;  2P9B A;  3QUJ A;  3RC3 A;  4YJ3 E;  3PUG A;  5LXT E;  2BDE A;  3I0Q A;  3LBX A;  2PG8 A;  3AVS A;  3ZN0 B;  2VK9 A;  1HS7 A;  2E9X A;  4AKG A;  4AI6 A;  5FY7 A;  5BMV E;  4TV9 E;  1VOM A;  3O1I A;  3L09 A;  2EHO C;  3MJX A;  5L2L A;  3GN5 B;  1UX4 A;  2HPJ A;  1YKE B;  4J2C A;  4KUM B;  3PUR A;  2B1E A;  4IDZ A;  2CE7 A;  4ZS3 A;  4YLH A;  3ANW A;  2KZ7 B;  5LBQ B;  4XZC A;  4MBQ A;  3N9M A;  1O3X A;  4DO0 A;  2MBG A;  4M1P A;  4CI1 B;  1HG5 A;  4TUY E;  5DQV A;  3U78 A;  2E9X B;  5KDM C;  3ZMT B;  1YW0 A;  2C5I T;  3E08 A;  2H3R A;  5EK2 A;  1MNE A;  4O8S A;  3F57 A;  2A3D A;  3C98 B;  3JC6 D;  3RC8 A;  3FXD B;  3EDU A;  4CI2 B;  5JH7 E;  4BJM A;  3SOL A;  3KV5 A;  4HN9 A;  2E9X D;  1WLX A;  4TZ4 C;  1HG2 A;  3ZLI A;  5JR9 B;  2C5K T;  4UVC B;  1BR2 A;  3FB2 A;  3K3Q C;  3N2O A;  5FXZ A;  4MAL A;  3AAI A;  4E7Z A;  5LJM A;  2LHN A;  2Y48 B;  5KMG P;  3N2K E;  2L9Q A;  1WYB A;  4NUU A;  1US7 B;  1BR1 A;  3ETV A;  4G63 A;  3CVR A;  2Y6X A;  2LEH A;  3P7I A;  4I55 E;  4UV9 B;  5DJQ C;  5KX5 E;  2X9Y A;  2KT9 A;  2X0L B;  3WI3 A;  5HXS A;  3I9Y A;  2L3L A;  5LA6 E;  2V7I A;  5DAB A;  2Q9Q D;  2WM9 A;  3M65 A;  4YFS A;  5FXV A;  2DCF A;  3F2E A;  3LG7 A;  3FXE B;  4O2B E;  3PTR B;  5CA1 E;  3CX7 B;  4EAH A;  3O9X A;  1U5P A;  4H63 H;  1LVK A;  3NZQ A;  2CEA A;  2CWO A;  3F31 A;  4CXW A;  1G73 A;  4DBQ A;  5JR9 A;  3H37 A;  1T98 A;  2D5U A;  2XAF B;  2QGS A;  2KMF A;  2VKJ A;  3B57 A;  3BQK A;  3FBL A;  3PUQ A;  3RRW A;  2LSI A;  2CA5 A;  2LOP A;  1IJ5 A;  3IF8 B;  4HFV A;  2CMR A;  2K48 A;  4IIJ E;  4WBO A;  3LFM A;  5FP3 A;  3TKL B;  2DLR A;  1MMG A;  4JUY A;  2I59 A;  3OYX A;  4HTE A;  3ZJ1 A;  3J9X 1;  4UEM A;  4I4T E;  1WR6 A;  2EHO A;  3B13 A;  1ZKE A;  3E22 E;  5FY0 A;  4GYS A;  4P09 A;  2WWU A;  3DJB A;  3RYH E;  5LP6 E;  3MAC A;  4DBR A;  4JEH B;  2CXL A;  2HH7 A;  2LJL A;  5FY1 A;  1HFA A;  3HKD E;  3RX6 A;  2BVM A;  2IC9 A;  4O4H E;  5JDF A;  5ADX L;  3AAE B;  3CQC B;  5L3F B;  5LHI B;  2XAS B;  2XAG B;  4O2A E;  2CLY B;  3C51 A;  2NP9 A;  5L3E B;  4WBN E;  2QA7 A;  3J7Y q;  4C90 A;  4PJM A;  4U72 A;  4QXB B;  3RYF E;  1OXZ A;  2DWK A;  4ZI7 E;  2V26 A;  2D0T A;  2XTL A;  3V5U A;  3PUA A;  3PDY A;  5HXR A;  3ZEF B;  3CWZ B;  4DVD A;  3LK2 B;  3HL6 A;  4UVA B;  2PJQ A;  4QHO A;  4PAG A;  3ZMU B;  4AXP A;  4PFP A;  4AQF C;  3C4Z A;  1NAF A;  4DMV A;  3K3O A;  2LT3 A;  3Q2M A;  2ZM8 A;  5HAX A;  2CWY A;  3DP7 A;  5JVD E;  3PUS A;  3A5X A;  3KV4 A;  1U4Q A;  4AQF A;  3Q5W A;  3PU3 A;  3SS1 A;  3IEE A;  1SA0 E;  3N9O A;  4L5G A;  1NWM X;  4YHJ A;  4IE7 A;  4DMW A;  4H9R C;  4I50 E;  2V7M A;  2NW8 A;  3W15 B;  2N2N A;  2VKH A;  2KIN B;  1D1C A;  4V1A v;  4EIW A;  1SHZ C;  3K8P C;  4KMC A;  2V1D B;  3HA4 A;  3I1A A;  3UT5 E;  3ZC0 A;  2XHE B;  3BQL A;  3ZJ2 A;  3QK6 A;  4HKA A;  5HXC A;  3V5S A;  3RYC E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...