3LG7A

Crystal structure of hiv epitope-scaffold 4e10_s0_1ez3a_002_c
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
126
structure length
123
Chain Sequence
RDKFMDEFFKQVEEIRQYIDRIAENVEEVARQHQAILASPNPNWFDISQLLWLMADIKETANEVRKKLKEIEQSIEQEEKSSADLKIRKRQHEELERKFREVMKEYNATQQDYRKRARKRNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 4E10_S0_1EZ3A_002_C (T246)
publication title Computational Design of Epitope-Scaffolds Allows Induction of Antibodies Specific for a Poorly Immunogenic HIV Vaccine Epitope.
pubmed doi rcsb
source organism Artificial gene
total genus 56
structure length 123
sequence length 126
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-01-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3lg7A00
1FEWA 1BR0A 1G73A 2DNXA 2XHEB 4JEUB 5LG4A 3C98B 5M4YA 1HS7A 3LG7A 4TX5A 1S94A 1EZ3A 4JEHB 1FIOA
chains in the Genus database with same CATH superfamily
3ZEFB 4HFCA 1LRZA 2ACXA 4X1KE 3RHWA 4KP3C 4DO0A 4HFBA 4H63V 5JQGE 3BQIA 3K3NA 2M67A 2WAUA 2VWAA 3IEEA 3P4SA 4DR4T 5J2UE 3Q5DA 3PUXF 4AKRB 2H7OA 4AKGA 4EEBA 4YY3T 2WQYA 1FJGT 3LBXB 5L4HA 2D0TA 3K1SA 4I0UA 2E5LT 4EZ4A 5HEJA 2K9AA 3ZCIA 3HL6A 5ABEA 4UEMA 3ZJ2A 1W0BA 2WZIA 1ZV4X 4WW0A 2YK0A 3AAAB 3LK2B 4ERRA 4IDPA 1BR4A 3KV6A 2LJLA 3DJBA 5CGMA 2CMRA 2LSYA 3RYHE 1I94T 2FJAA 3VR9A 4JI6T 4NXNT 2UU9T 2NOXA 4QX7B 5HWXA 5ETWA 4LF7T 4EIWA 4UF0B 3M65A 3R6NA 1WLXA 5FY0A 1WYBA 3CQXC 4ZS3A 4IDNA 3FZMB 2IC9A 4GKJT 1X9BA 2Q9QB 5FXVA 5H6RB 1WYCA 3AECA 2Z6EA 4IDQA 1HS7A 4DBQA 1XMQT 4X66T 4TZ4C 2LOPA 4ANJA 2VB6A 4GK0E 2WM9A 1HNZT 4TWDA 4YT0A 1SHZC 1SE7A 3P50A 2XSBA 3B57A 3DTOA 2LM9A 2XQAA 2CM0A 4X1IE 4PW8A 5GONE 4PK5A 3WI3A 4OX9T 4EOZB 4I55E 2LLYA 3EDVA 1HNWT 4YTNA 4YFSA 2ZM8A 2BG9C 2QA7A 2NTYA 1LVKA 4IGUA 2OA5A 2Y6XA 5FVLA 2BKNA 4DIDB 3C4WA 1O3XA 3K3OA 1LKXA 2Y8DA 3RI5A 3QB5K 3PDYA 4B3ST 2QYWA 1Y01A 4KBMB 2K3WA 3RPUA 2NTXA 3JC6D 3N9MA 3CIRA 3T8OA 1WR6A 4X1YE 2VL0A 4Z91A 4DV5T 2WU5A 3JAEA 4UV9B 2WMOA 3C64A 1B7TA 2Q9QA 2ZMAA 4GOUA 2BG9B 3UFEA 4LFCT 3AAIA 3AEGA 3CQGB 3KBUA 3LDQB 3P4RA 4AIUA 3AXJA 4ILBA 2XQ8A 1E2AA 1LVFA 2YEVC 2N9DA 4IDOA 2W63A 3AE2A 2A3DA 2V6XA 3U78A 4YLHA 2FJBA 2N1GA 3I0OA 5HAXA 4OHFA 5FL1A 5AQTB 2C5KT 4ZI3C 2CLYC 3M3ZB 4AQFC 1UX5A 3GMIA 3HKCE 2NP9A 5LGNB 3IA3A 5FP3A 4ZZCA 3JC6C 2R6GF 5DABA 5L2LA 4IREA 4QH1A 4BAYB 4GKKT 2BBHA 5JDQA 2ACZA 2FJDA 2FJEA 5L3BB 2UXXB 3ABVA 4LF6T 5EK3A 4AISA 4BJNA 3QC9A 2X67A 4I50E 2IMLA 2NR4A 2KXPB 4F8HA 5KMGP 1IBMT 2VVNA 4UVBB 3MA9A 3Q5EA 1ZEEA 5AFUL 4DV4T 4B3RT 2X9WA 3BQLA 2XTLA 1KNRA 2V7IA 2W0GA 5FMNA 4KI0F 3L8RA 3AA7B 4HWIB 4PJNA 4EAHA 2CWOA 2HPLA 3AA6B 2LHRA 5LMUT 2A9UA 5L4EA 4GK5E 4HFHA 2BVLA 1SUMB 3H3AA 2H88A 4NUUA 3AE6A 4JV5T 2LE8A 4ZHQE 3UQ7A 3PE0A 3GN5B 3LK42 4CN6A 1Z8UA 4EEDA 1WCRA 1WRDA 4OFZA 2J47A 3AE9A 2XZEA 3NKZA 4Q25A 3SS1A 3OJAA 4ISTA 2CWYA 4U33A 2ZLYA 2YN6A 3N9OA 1J5ET 4Z8XA 1EZ3A 3PUGA 5HXRA 2JQ9A 3NZQA 1KNPA 3RQWA 2H89A 1NENA 5LXTE 5EK4A 3C50A 4EGWA 3TLWA 3AEFA 4PFPA 5AQMB 3CMLA 5FVKA 4AQYT 3KFWX 2XQ6A 4JI3T 4U7YA 1YQ3A 3KV9A 3TLUA 4O2AE 4ZXLA 3EAMA 4JBWF 3UFGA 4L9IA 3ZKRA 3ANWB 2V26A 5LBMA 4LF4T 2W67A 5L3CB 5HXCA 4QXCB 3UUNA 3SFDA 4TUYE 4CZZB 5ABFA 4HKAA 2KWIB 5BR8T 4ZEYA 4DR6T 4BJMA 1YQ4A 2H7VC 5IWAT 4JLEA 3GN5A 3LFMA 2WDQA 2YDQA 2DHRA 4DR7T 2KINB 1HF8A 1YKHB 3N2GE 4G63A 4NUVA 4H9NC 3FXDB 2K5BB 1W09A 2RP4A 1Y64B 1MMNA 4JI8T 5F3JA 2RPAA 2HN1A 2EHOD 2CHNA 3ZMSB 5C8YE 4EZHA 3MJXA 2F4VT 4ZI2C 2D9DA 3ONLC 3PU3A 2XQ3A 4I43B 5KXJA 4O2BE 4B3TT 4KHPT 4HWHA 3FBZA 4PJLA 5AQPB 1L0VA 1KK7A 2LM2A 3E22E 4FI5A 2VKHA 5IHYA 2XM2A 2OV9A 4F6RC 3RH3A 3VU7H 3ZT6A 2CPTA 3ANWA 3EABA 2X68A 2BS4A 4HFVA 3VR8A 1IZNB 4DUZT 3RRWA 3AA1B 2X0HA 4JEUB 2WMNA 2LOSA 2XHEB 2FBWA 4JI1T 4TNWA 2ZM6T 3IF8B 3SWHA 5AQGB 1J5WA 3UQ4A 4JYAT 5EK2A 2UXNB 2LKGA 3O1IA 4GYRA 4UVAB 3ETUA 3PJAJ 3KBTA 5AQSB 2ODVA 5DQWA 4QH4A 4PAGA 1M62A 4DMVA 2Q9QC 3PU8A 4UR9A 1XDPA 2BKOA 2I59A 2V7MA 4UIGA 2MYSA 1T8BA 2EHOB 4KX6A 5LJMA 3ZSTA 4N78D 4YJ3E 1VRBA 2LSJA 2V7KA 3X1DA 4LF9T 5JDNA 3PURA 3CQCB 2WDRA 3A7MA 4AKHA 3NRYA 4HE8A 3EUHA 1DU2A 2HHHT 3CX8B 4LMJA 1I6ZA 3LJCA 3F31A 2WB5A 2CE7A 2YDSA 5HYAA 4A98A 2DWGA 4ZI7E 1MIYA 2BS2A 3RQUA 1MNDA 2W66A 3OBVE 3VHLA 5HCJA 5AQVB 3NRXA 3AXJB 1HG2A 4YHJA 4QX8B 2J62A 2XAHB 3O4XE 5CA1E 3N9PA 4MBQA 3HA4A 3HI2A 1UK5A 3UULA 2ZM2A 2W2UA 4YSYA 5FY1A 3JCFA 5LP6E 3P4WA 1H7CA 5LB7B 2IHR1 3T1YT 3KVAA 3PUZF 3I9YA 2PG8A 2E9XA 2JRKA 1IJ6A 4KHZF 3S4UA 3ESLA 2WP9A 2CCQA 5JR9A 3NBXX 5L47A 3V5SA 2WWUA 3OPCA 4DR2T 1D1AA 4TV8E 5LCYA 2MTQA 2KZ7B 5HXEA 2EHOA 1JNRA 4PJMA 1JNZA 4QXBB 4P1NA 2KSRA 4DBRA 3ZYLA 5FL0A 5FKYA 5EZYE 4V1Av 4IIJE 2Y48B 4CXYA 5FYMA 3RGLA 3E08A 2CHOA 5DJQC 4WZXA 2KWHA 4CXXA 2KMFA 3PUAA 5IUXA 3AEBA 3ETVA 5LG4A 3PV0F 5JREA 2I0MA 3KV5A 2N2NA 2OLTA 2GK9A 2JMHA 3D0TA 4Z90A 1XZYA 3IBPA 3N9NA 3G06A 4AQGA 3C51A 4MFRA 4L5GA 3UT5E 2BBJA 3UUBA 2X0LB 5ABHA 4PK4A 5HCMA 1D0YA 3ZCJA 2C0SA 4DR3T 3PUWF 4EV6A 1KNZA 2K48A 5AQNB 1YXRA 2SPCA 4O4LE 3GA8A 4H9SE 2BVMA 4IDZA 4QWNB 5HEUA 3ONJA 3RYCE 1W0AA 3CPZA 2W00A 5HWYA 3AE3A 3HKBE 3CWZB 5C3JA 1ZKEA 3OKQA 4YTPA 2W62A 3L09A 3ZT7A 3RLFF 5LBQB 2A72A 1HTJF 4E7ZA 4XAXB 2XQYA 4IE7A 4U72A 3KDSE 1OXZA 1OWAA 2L3LA 5LYJE 3E0ZA 3OYXA 2DWKA 4O4IE 5J1GA 5KX5E 3EVYA 3Q5XA 3ZYKA 2XUEA 2XAQB 4E7SA 2FUPA 2UUBT 4TWFA 5LNKA 4DR1T 2QGSA 4PJJA 1FMVA 4L0RA 3F57A 5AQLB 3EDUA 2KT9A 2V5CA 1MIWA 2LT3A 4KMCA 5ABFB 4DV2T 5LA6E 4UELA 2LEHA 3RIAA 3OVUA 1ZHCA 3QK6A 5LGTB 2E2AA 4U2YA 1US7B 4X62T 1KF6A 5AQFB 3PUVF 5L3EB 4A97A 3MK7C 3ZSSA 2ODUA 3RYIE 4BA9A 2B1EA 4CI2B 4FJOA 3NZPA 2CRBA 2QVAA 3EHZA 2AXDS 4HFDA 5A1LA 2NWBA 4YJ2E 3F2EA 3QNUA 1GQEA 1NWMX 2B76A 5JRCA 3RYFE 1OEDE 5AQJB 3NWIA 2XSAA 1WFDA 1XWMA 2AE9A 2NW7A 3RX6A 2JIWA 3ZYMA 3FZHB 2JQQA 2CBJA 3JAFA 4X20E 2E5VA 3K8PC 4DR5T 5LHHB 2IUBA 2BS3A 3FZKB 1UURA 1FMWA 1IBKT 4EYYR 3I1AA 1OEDA 3AEAA 4MLKA 2ZM0A 4CN1A 2HN2A 2W4XA 2LSGA 1QSDA 4UXNB 2BDEA 5AQKB 4AQFA 3RIUA 1XMOT 3B13A 2DL1A 2XAFB 2XPKA 3VRAA 4PFOA 4IE5A 3I0QA 4CI3B 1IAPA 2PFVA 4P09A 2WDVA 4AKIA 2I6HA 1U5PA 4A56A 1MMDA 3AVRA 1NAFA 3C4XA 4ZZBA 2E9XD 4PNIA 4XBFB 5ABGA 3FXEB 5LHIB 2D5UA 1X79A 5HXSA 2X0YA 4X64T 2XM1A 5DQVA 4QH5A 4U3CA 1T98A 2CXFA 2JPFA 5LJNA 2CBIA 3ZN1B 2J1DG 3FZLB 2JJ9A 4LFBT 3WAJA 2V6YB 3VKHA 4X65T 4YSXA 2UXCT 3HKEE 3L39A 3VRBA 2MOZA 4O4HE 4ZOLE 2VL8A 2XJ7A 5L3GB 1D1CA 4YSZA 4J2CA 1UGOA 3L3PA 1IBLT 1G8XA 5ADXL 5FXXA 3BK9A 2E9XC 1N32T 3SFEA 2D2SA 3W15B 3HKDE 2WU2A 5AQIB 3ZLIA 2WS3A 5TAOA 3KVBA 4UVCB 3N9QA 2EHOC 3TLSA 1N36T 2DNXA 3Q9DA 1XNRT 1QLBA 1VCTA 3QOFA 1D0XA 4U31A 2A2FX 4DVDA 3LK3B 4O4JE 5AQUB 2XQ9A 3LG7A 3DP7A 5FY7A 4LFAT 1N33T 4ISSA 4HTEA 2VQET 3OTOT 2V5DA 2MBGA 4A5XA 2KNDA 2WSSV 2WZHA 2QRXA 3RF1A 3KINB 3UUXB 2E9XB 3Q2MA 4LF5T 5L3DB 4P0AA 2D0UA 2WBLA 5IYZE 4TNVA 5JR9B 2CXLA 3AEDA 5LMNT 3UU5A 3N2KE 2V6YA 2XY8B 2P9BA 2HH7A 2JMKA 3B5MA 2CEAA 2X9YA 4NIQA 4K0KT 3AE7A 2LRLA 3C4ZA 2V1DB 4UV8B 5FXWA 2PBIA 1HFAA 3AEEA 3A8YC 4DV7T 2DI4A 5JVDE 5F8PA 3HR0A 2JQKA 3TLVA 4JEHB 2M6BA 3CKDA 3AE5A 3UU8A 4I4TE 3CX6B 4IT4A 1AJ3A 4C91A 3QUJA 5JDFA 2PJQA 1HNXT 4CQIA 4EYUA 4OYKA 4HFEA 3RKOA 4GIWA 4B3MT 2W61A 4DV3T 5HXHA 1W9RA 3JADA 1HCIA 2K24A 3ZC1A 3LBXA 2C5IT 3Q5WA 4CN4A 3AE8A 1HX1B 4JI7T 4IE6A 2LRKA 1T72A 3P4PA 4OYJA 3PUSA 2LHNA 5F5WA 4IL4A 1M7KA 2YOEA 3QB5A 1D1BA 4HFIA 5L3FB 4WBOA 3C98B 1MMGA 2H3RA 4QHOA 4JI0T 3ZMZB 2JQHA 3AVSA 4AI6A 2VKOA 1WR0A 3VKGA 3ZMUB 3H3MA 4ZI3D 5JDGA 3N5LA 4ILAA 4UF0A 5LG3A 2UUAT 2XQ4A 4IE0A 1R8IA 1KFYA 4AKLA 3CX7B 1J1JA 1E7PA 3ZC0A 4MALA 2VQFT 5J2TE 5BMVE 4LMKA 1MMAA 2UXDT 1XDOA 2UXBT 1D0ZA 4AXPA 3P8CD 4HWDA 4EXTA 4JUYA 4CI1B 1U4QA 4U7IA 3T1HT 5JDHA 5M4YA 5LGUB 5AQHB 2YU2A 2CXDA 2MAWA 1OEDC 3CK6A 3TLTA 3RRCA 4NXMT 4DNDA 2BKPA 2X66A 4YHHT 5H6QB 2E8IA 3RIFA 3RIUC 3PTRB 1T7SA 3UTKA 2VURA 3OYZA 3H37A 5JRCB 2BZBA 4GYSA 1YKEB 4HEAA 4P0BA 4IL9A 2X51A 4YTMA 1IJ5A 1YW0A 4XZCA 2IAKA 4U74A 2BG9E 4QXHB 2V7JA 3R84B 1VCSA 4COFA 4HN9A 3AA0B 1KEYA 2CA5A 1YD8G 2PTFA 1OEDB 4WNKA 4H9RC 2YKSA 3LSVA 4X5TA 4QKNA 2CLYB 1G73A 2DLRA 5JH7E 4HWCA 1UX4A 2J4GA 1UCUA 4WYVA 2BG9A 3MXZA 3KV4A 1BR0A 4O8SA 1UUSA 3P7IA 3J9X1 4LF8T 4JI4T 3WAKA 3RC8A 1V9DA 3FBLA 4H9OC 4IE4A 5FNVE 3ZMTB 5LOVE 3P4QA 2VVSA 3RC3A 3IHRA 3NVOA 2VK9A 4C90A 5HEHA 3K3QC 4DV1T 4ZS2A 2XASB 4WBNE 2X9XA 3AE4A 3O1JA 2V7LA 1BR2A 2WCAA 1XNQT 3O9XA 1ZP0A 4PK6A 4K0UA 4YXDA 5LHGB 3FZFB 5HEGA 2YINA 4MHCA 1FIOA 2VKDA 3SRZA 4TWHA 4DMWA 5AQRB 4DUYT 3MZKB 4ADZA 2RA1A 4U2ZA 4HGAA 5E0OA 3U3IA 2IC6A 3FB2A 2C5JA 5CFBA 4CXWA 2XAGB 2IIUA 2L9QA 3ZPOA 3PUQA 1QUUA 2IDOB 1BR1A 4ILCA 1S94A 2ES0A 3ZJ1A 2XQ5A 1SA0E 5JTGA 1CHUA 4TV9E 5CA0E 5JDMA 3BQKA 4ZI2D 1MNEA 2LSKA 2NW9A 4NPPA 2WWVA 1S35A 2DCFA 3N2OA 4H9PC 4DV0T 4JI2T 1HX8A 3MACA 3RKGA 2LKHA 3MKDA 3AAEB 5AQOB 3O1HA 2X9HA 2M6IA 4KUMB 2YU1A 2VKJA 5J0ZA 1FEWA 3TKLB 2XAJB 3ONXA 5AQQB 3UUMA 2G0UA 3I9WA 4ASKA 3A5XA 4OK0A 2HPJA 3PJAA 4G2AA 5CB4E 3FHNA 4HWFA 3PUYF 4TX5A 3ZT5A 1ZOYA 2XQ7A 4DV6T 1CUNA 3J7Yq 3ZMVB 4IHJE 4TN7B 5HEOA 3SOLA 4ILUA 3CVRA 3AE1A 1N34T 2NW8A 1Z0PA 1MIVA 2WY2A 5KDMC 2YDRA 3ZN0B 3V5UA 1VOMA 3EI0A 1HR0T 2MPKA 5CJ5A 3UU3A 2UUCT 1NEKA 4H9QC 5FXZA 4EB6E 3GWHA 3AB3B 3N9LA 2VASA 4H63H 5JR9C 2KLQA 1E1HB 4LMLA 2Q9QD 4B6XA 4M1PA 2LSIA 3UU4A 2L8KA 5C2TA 4JI5T 5JDLA 2IW5B 2V8SV 1HG5A 3UU6A
chains in the Genus database with same CATH topology
3ZEFB 3CMLA 5LBQB 2A72A 3KFWX 1LRZA 1HCIA 2ACXA 4X1KE 2K24A 4KP3C 3ZC1A 4DO0A 3LBXA 2C5IT 1HTJF 4H63V 3Q5WA 5JQGE 3KV9A 4E7ZA 4O2AE 4XAXB 2XQYA 3BQIA 4IE7A 4U72A 3KDSE 1OXZA 3K3NA 1OWAA 2M67A 4IE6A 4L9IA 3ANWB 2WAUA 3L09A 2L3LA 4OYJA 3E0ZA 3PUSA 2V26A 3OYXA 5LYJE 5LBMA 2DWKA 2VWAA 3IEEA 5J2UE 4O4IE 5J1GA 5KX5E 5L3CB 3EVYA 4AKRB 5HXCA 2H7OA 3Q5XA 4QXCB 2XUEA 2XAQB 3UUNA 3ZYKA 4AKGA 2LHNA 4TUYE 4CZZB 4E7SA 5HXHA 3LBXB 2D0TA 1D1BA 4HKAA 4EZ4A 5L3FB 4WBOA 2KWIB 3C98B 5LNKA 1MMGA 2K9AA 3ZCIA 4BJMA 2H3RA 2H7VC 3HL6A 2QGSA 4PJJA 4JLEA 4QHOA 3GN5A 3LFMA 3ZMZB 1FMVA 4L0RA 4UEMA 2DHRA 3F57A 3ZJ2A 3AVSA 3EDUA 4AI6A 1HF8A 2KINB 2KT9A 2VKOA 3VKGA 1YKHB 3ZMUB 1MIWA 1ZV4X 3N2GE 4G63A 2YK0A 4WW0A 3AAAB 2LT3A 4NUVA 4ZI3D 4H9NC 3FXDB 4KMCA 5JDGA 3LK2B 4ERRA 3N5LA 5LA6E 1BR4A 2K5BB 4UELA 3KV6A 2LEHA 2LJLA 1ZHCA 3QK6A 4UF0A 3DJBA 2RP4A 5LGTB 2CMRA 1Y64B 1MMNA 2LSYA 4IE0A 1US7B 3RYHE 5F3JA 4AKLA 3CX7B 2EHOD 3ZC0A 4MALA 5L3EB 5J2TE 3MK7C 2ODUA 3RYIE 5BMVE 3ZMSB 4BA9A 5C8YE 4EZHA 2B1EA 4CI2B 1MMAA 3MJXA 2NOXA 4FJOA 3NZPA 4QX7B 5HWXA 4ZI2C 3PU3A 5ETWA 4I43B 4EIWA 4UF0B 4O2BE 1D0ZA 5A1LA 2NWBA 3M65A 4AXPA 3P8CD 3R6NA 1WLXA 4YJ2E 3F2EA 4EXTA 5FY0A 3FBZA 4JUYA 1WYBA 3CQXC 4CI1B 1NWMX 4ZS3A 4PJLA 1U4QA 5JDHA 1KK7A 5JRCA 3RYFE 2IC9A 3E22E 5FXVA 2Q9QB 5H6RB 4FI5A 1WYCA 2VKHA 5IHYA 5M4YA 2Z6EA 5LGUB 2NW7A 2YU2A 2CXDA 3RX6A 4DBQA 1HS7A 3RRCA 3ZYMA 3RH3A 4F6RC 3VU7H 2JQQA 4DNDA 4TZ4C 2LOPA 2X66A 4ANJA 4X20E 3ANWA 5H6QB 2VB6A 2E8IA 4GK0E 2WM9A 2X68A 3K8PC 3PTRB 1SHZC 1IZNB 4HFVA 3UTKA 3OYZA 3H37A 5LHHB 5JRCB 2BZBA 3RRWA 3AA1B 3B57A 3DTOA 4JEUB 2WMNA 1YKEB 4GYSA 2LM9A 1FMWA 4HEAA 2LOSA 4P0BA 2CM0A 4X1IE 2X51A 4PW8A 5GONE 4EYYR 2XHEB 3I1AA 1IJ5A 1YW0A 4XZCA 4MLKA 2ZM0A 2IAKA 4PK5A 3WI3A 4EOZB 4I55E 3IF8B 3EDVA 2LSGA 3SWHA 1QSDA 4U74A 2BDEA 4UXNB 4AQFA 4QXHB 2V7JA 3B13A 2XAFB 4YFSA 3R84B 4PFOA 2ZM8A 5EK2A 4HN9A 2UXNB 2QA7A 3AA0B 4IE5A 2NTYA 1LVKA 3O1IA 4IGUA 2CA5A 3I0QA 4GYRA 4UVAB 1YD8G 4CI3B 3ETUA 2OA5A 2Y6XA 1IAPA 4WNKA 2PFVA 4P09A 3KBTA 4H9RC 4AKIA 2ODVA 3C4WA 5DQWA 4QKNA 2CLYB 1O3XA 1U5PA 3K3OA 4A56A 1G73A 1LKXA 2Y8DA 4PAGA 1MMDA 2DLRA 4DMVA 3PDYA 5JH7E 3AVRA 2Q9QC 3PU8A 1UX4A 1NAFA 3C4XA 2I59A 1UCUA 2E9XD 4PNIA 3MXZA 2V7MA 4XBFB 4UIGA 4KBMB 2MYSA 3FXEB 5LHIB 3KV4A 1BR0A 3RPUA 2NTXA 4O8SA 3P7IA 2EHOB 3JC6D 3N9MA 3T8OA 2D5UA 1WR6A 5LJMA 3J9X1 4N78D 1X79A 4X1YE 4YJ3E 5HXSA 1VRBA 2LSJA 2V7KA 5DQVA 3WAKA 3RC8A 1T98A 2CXFA 5JDNA 2JPFA 1V9DA 3FBLA 3PURA 4H9OC 4UV9B 5LJNA 2WMOA 3CQCB 3C64A 4IE4A 1B7TA 2Q9QA 2ZMAA 5FNVE 3ZMTB 5LOVE 2J1DG 3ZN1B 4GOUA 3RC3A 3IHRA 4AKHA 3UFEA 2JJ9A 2VK9A 4C90A 3NRYA 3AAIA 3CQGB 3WAJA 3KBUA 3VKHA 4HE8A 3K3QC 3EUHA 3CX8B 4ZS2A 3HKEE 2XASB 1LVFA 3LJCA 2YEVC 4WBNE 2X9XA 2N9DA 2MOZA 3F31A 4O4HE 4ZOLE 2CE7A 2W63A 5HYAA 2DWGA 4ZI7E 2VL8A 3O1JA 1MIYA 5L3GB 1D1CA 2A3DA 2V7LA 1BR2A 3U78A 4YLHA 4J2CA 3O9XA 2N1GA 3I0OA 3L3PA 4PK6A 4K0UA 5LHGB 1G8XA 1MNDA 2YINA 4MHCA 3OBVE 5HAXA 5ADXL 1FIOA 3VHLA 4OHFA 2VKDA 3NRXA 3SRZA 1HG2A 5FXXA 2C5KT 4YHJA 4QX8B 4DMWA 2XAHB 3BK9A 4ZI3C 3O4XE 5CA1E 2CLYC 2E9XC 3N9PA 4AQFC 4MBQA 3MZKB 3HA4A 3HI2A 4ADZA 1UX5A 2RA1A 2D2SA 3GMIA 3W15B 3HKCE 2ZM2A 3UULA 2NP9A 5LGNB 5FP3A 3HKDE 4HGAA 5E0OA 3U3IA 3JC6C 2IC6A 5FY1A 3ZLIA 5TAOA 5DABA 3KVBA 3FB2A 4UVCB 2C5JA 3N9QA 5LP6E 4CXWA 1H7CA 2XAGB 5L2LA 2EHOC 3KVAA 2DNXA 3Q9DA 2L9QA 3I9YA 3ZPOA 2PG8A 3PUQA 1D0XA 4DVDA 2A2FX 2E9XA 2JRKA 3LK3B 4O4JE 1QUUA 1IJ6A 3LG7A 1BR1A 3S4UA 3ESLA 1S94A 4BAYB 5JDQA 3DP7A 5FY7A 2ES0A 2CCQA 5JR9A 4ISSA 3NBXX 3ZJ1A 5L3BB 1SA0E 2UXXB 3V5SA 2WWUA 4HTEA 5EK3A 4TV9E 4BJNA 1D1AA 3QC9A 4TV8E 5LCYA 2X67A 2MBGA 2KNDA 2MTQA 2WSSV 4I50E 5CA0E 2KZ7B 3BQKA 5JDMA 5HXEA 2EHOA 4PJMA 4ZI2D 4QXBB 1MNEA 2KXPB 2LSKA 3KINB 2NW9A 3UUXB 5KMGP 4DBRA 1S35A 2DCFA 2E9XB 3MA9A 4UVBB 3ZYLA 5EZYE 3N2OA 3Q2MA 4H9PC 4V1Av 4IIJE 5L3DB 1ZEEA 5AFUL 1HX8A 2Y48B 3MACA 4P0AA 4CXYA 2D0UA 2WBLA 2X9WA 5FYMA 5IYZE 3BQLA 2CXLA 5JR9B 3MKDA 3AAEB 3E08A 3O1HA 2X9HA 5DJQC 2XTLA 4KUMB 2V7IA 2W0GA 2KWHA 5FMNA 4CXXA 3N2KE 2YU1A 2VKJA 4PJNA 3AA7B 2KMFA 3PUAA 4EAHA 2P9BA 1FEWA 3TKLB 2CWOA 2XAJB 3ONXA 2HH7A 2JMKA 2HPLA 2CEAA 3AA6B 2LHRA 3ETVA 5LG4A 2X9YA 3UUMA 2G0UA 3I9WA 4ASKA 3A5XA 4OK0A 5JREA 2HPJA 3KV5A 4GK5E 4G2AA 2BVLA 2N2NA 5CB4E 2GK9A 3C4ZA 3FHNA 3H3AA 2V1DB 2JMHA 3D0TA 3IBPA 3N9NA 4UV8B 4AQGA 3C51A 4NUUA 5FXWA 2PBIA 4MFRA 4TX5A 4L5GA 3UT5E 2LE8A 4ZHQE 1HFAA 1CUNA 2X0LB 3PE0A 3J7Yq 3GN5B 3LK42 3ZMVB 4IHJE 4TN7B 4PK4A 2DI4A 5JVDE 1D0YA 3ZCJA 1WRDA 3SOLA 4OFZA 5F8PA 4ILUA 2C0SA 3CVRA 3HR0A 1KNZA 1Z0PA 2NW8A 1MIVA 2K48A 4JEHB 5KDMC 2SPCA 4O4LE 3GA8A 3CKDA 3ZN0B 4I4TE 3CX6B 3V5UA 1VOMA 4H9SE 3SS1A 3OJAA 1AJ3A 4C91A 4ISTA 2CWYA 2ZLYA 3N9OA 2BVMA 3QUJA 4IDZA 4QWNB 5JDFA 2PJQA 4H9QC 4CQIA 5FXZA 4EB6E 3GWHA 4Z8XA 3RYCE 3CPZA 1EZ3A 3AB3B 3N9LA 2W00A 4EYUA 3PUGA 2VASA 5HXRA 5HWYA 4H63H 3NZQA 5JR9C 4OYKA 2KLQA 1E1HB 2Q9QD 3HKBE 3CWZB 1ZKEA 4B6XA 4M1PA 2LSIA 5LXTE 5EK4A 3RKOA 3OKQA 4GIWA 3C50A 2L8KA 5JDLA 2W61A 2W62A 2IW5B 4PFPA 1HG5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FEW A;  1BR0 A;  1G73 A;  2DNX A;  2XHE B;  4JEU B;  5LG4 A;  3C98 B;  5M4Y A;  1HS7 A;  3LG7 A;  4TX5 A;  1S94 A;  1EZ3 A;  4JEH B;  1FIO A; 
#chains in the Genus database with same CATH topology
 3ZEF B;  4HFC A;  1LRZ A;  2ACX A;  4X1K E;  3RHW A;  4KP3 C;  4DO0 A;  4HFB A;  4H63 V;  5JQG E;  3BQI A;  3K3N A;  2M67 A;  2WAU A;  2VWA A;  3IEE A;  3P4S A;  4DR4 T;  5J2U E;  3Q5D A;  3PUX F;  4AKR B;  2H7O A;  4AKG A;  4EEB A;  4YY3 T;  2WQY A;  1FJG T;  3LBX B;  5L4H A;  2D0T A;  3K1S A;  4I0U A;  2E5L T;  4EZ4 A;  5HEJ A;  2K9A A;  3ZCI A;  3HL6 A;  5ABE A;  4UEM A;  3ZJ2 A;  1W0B A;  2WZI A;  1ZV4 X;  4WW0 A;  2YK0 A;  3AAA B;  3LK2 B;  4ERR A;  4IDP A;  1BR4 A;  3KV6 A;  2LJL A;  3DJB A;  5CGM A;  2CMR A;  2LSY A;  3RYH E;  1I94 T;  2FJA A;  3VR9 A;  4JI6 T;  4NXN T;  2UU9 T;  2NOX A;  4QX7 B;  5HWX A;  5ETW A;  4LF7 T;  4EIW A;  4UF0 B;  3M65 A;  3R6N A;  1WLX A;  5FY0 A;  1WYB A;  3CQX C;  4ZS3 A;  4IDN A;  3FZM B;  2IC9 A;  4GKJ T;  1X9B A;  2Q9Q B;  5FXV A;  5H6R B;  1WYC A;  3AEC A;  2Z6E A;  4IDQ A;  1HS7 A;  4DBQ A;  1XMQ T;  4X66 T;  4TZ4 C;  2LOP A;  4ANJ A;  2VB6 A;  4GK0 E;  2WM9 A;  1HNZ T;  4TWD A;  4YT0 A;  1SHZ C;  1SE7 A;  3P50 A;  2XSB A;  3B57 A;  3DTO A;  2LM9 A;  2XQA A;  2CM0 A;  4X1I E;  4PW8 A;  5GON E;  4PK5 A;  3WI3 A;  4OX9 T;  4EOZ B;  4I55 E;  2LLY A;  3EDV A;  1HNW T;  4YTN A;  4YFS A;  2ZM8 A;  2BG9 C;  2QA7 A;  2NTY A;  1LVK A;  4IGU A;  2OA5 A;  2Y6X A;  5FVL A;  2BKN A;  4DID B;  3C4W A;  1O3X A;  3K3O A;  1LKX A;  2Y8D A;  3RI5 A;  3QB5 K;  3PDY A;  4B3S T;  2QYW A;  1Y01 A;  4KBM B;  2K3W A;  3RPU A;  2NTX A;  3JC6 D;  3N9M A;  3CIR A;  3T8O A;  1WR6 A;  4X1Y E;  2VL0 A;  4Z91 A;  4DV5 T;  2WU5 A;  3JAE A;  4UV9 B;  2WMO A;  3C64 A;  1B7T A;  2Q9Q A;  2ZMA A;  4GOU A;  2BG9 B;  3UFE A;  4LFC T;  3AAI A;  3AEG A;  3CQG B;  3KBU A;  3LDQ B;  3P4R A;  4AIU A;  3AXJ A;  4ILB A;  2XQ8 A;  1E2A A;  1LVF A;  2YEV C;  2N9D A;  4IDO A;  2W63 A;  3AE2 A;  2A3D A;  2V6X A;  3U78 A;  4YLH A;  2FJB A;  2N1G A;  3I0O A;  5HAX A;  4OHF A;  5FL1 A;  5AQT B;  2C5K T;  4ZI3 C;  2CLY C;  3M3Z B;  4AQF C;  1UX5 A;  3GMI A;  3HKC E;  2NP9 A;  5LGN B;  3IA3 A;  5FP3 A;  4ZZC A;  3JC6 C;  2R6G F;  5DAB A;  5L2L A;  4IRE A;  4QH1 A;  4BAY B;  4GKK T;  2BBH A;  5JDQ A;  2ACZ A;  2FJD A;  2FJE A;  5L3B B;  2UXX B;  3ABV A;  4LF6 T;  5EK3 A;  4AIS A;  4BJN A;  3QC9 A;  2X67 A;  4I50 E;  2IML A;  2NR4 A;  2KXP B;  4F8H A;  5KMG P;  1IBM T;  2VVN A;  4UVB B;  3MA9 A;  3Q5E A;  1ZEE A;  5AFU L;  4DV4 T;  4B3R T;  2X9W A;  3BQL A;  2XTL A;  1KNR A;  2V7I A;  2W0G A;  5FMN A;  4KI0 F;  3L8R A;  3AA7 B;  4HWI B;  4PJN A;  4EAH A;  2CWO A;  2HPL A;  3AA6 B;  2LHR A;  5LMU T;  2A9U A;  5L4E A;  4GK5 E;  4HFH A;  2BVL A;  1SUM B;  3H3A A;  2H88 A;  4NUU A;  3AE6 A;  4JV5 T;  2LE8 A;  4ZHQ E;  3UQ7 A;  3PE0 A;  3GN5 B;  3LK4 2;  4CN6 A;  1Z8U A;  4EED A;  1WCR A;  1WRD A;  4OFZ A;  2J47 A;  3AE9 A;  2XZE A;  3NKZ A;  4Q25 A;  3SS1 A;  3OJA A;  4IST A;  2CWY A;  4U33 A;  2ZLY A;  2YN6 A;  3N9O A;  1J5E T;  4Z8X A;  1EZ3 A;  3PUG A;  5HXR A;  2JQ9 A;  3NZQ A;  1KNP A;  3RQW A;  2H89 A;  1NEN A;  5LXT E;  5EK4 A;  3C50 A;  4EGW A;  3TLW A;  3AEF A;  4PFP A;  5AQM B;  3CML A;  5FVK A;  4AQY T;  3KFW X;  2XQ6 A;  4JI3 T;  4U7Y A;  1YQ3 A;  3KV9 A;  3TLU A;  4O2A E;  4ZXL A;  3EAM A;  4JBW F;  3UFG A;  4L9I A;  3ZKR A;  3ANW B;  2V26 A;  5LBM A;  4LF4 T;  2W67 A;  5L3C B;  5HXC A;  4QXC B;  3UUN A;  3SFD A;  4TUY E;  4CZZ B;  5ABF A;  4HKA A;  2KWI B;  5BR8 T;  4ZEY A;  4DR6 T;  4BJM A;  1YQ4 A;  2H7V C;  5IWA T;  4JLE A;  3GN5 A;  3LFM A;  2WDQ A;  2YDQ A;  2DHR A;  4DR7 T;  2KIN B;  1HF8 A;  1YKH B;  3N2G E;  4G63 A;  4NUV A;  4H9N C;  3FXD B;  2K5B B;  1W09 A;  2RP4 A;  1Y64 B;  1MMN A;  4JI8 T;  5F3J A;  2RPA A;  2HN1 A;  2EHO D;  2CHN A;  3ZMS B;  5C8Y E;  4EZH A;  3MJX A;  2F4V T;  4ZI2 C;  2D9D A;  3ONL C;  3PU3 A;  2XQ3 A;  4I43 B;  5KXJ A;  4O2B E;  4B3T T;  4KHP T;  4HWH A;  3FBZ A;  4PJL A;  5AQP B;  1L0V A;  1KK7 A;  2LM2 A;  3E22 E;  4FI5 A;  2VKH A;  5IHY A;  2XM2 A;  2OV9 A;  4F6R C;  3RH3 A;  3VU7 H;  3ZT6 A;  2CPT A;  3ANW A;  3EAB A;  2X68 A;  2BS4 A;  4HFV A;  3VR8 A;  1IZN B;  4DUZ T;  3RRW A;  3AA1 B;  2X0H A;  4JEU B;  2WMN A;  2LOS A;  2XHE B;  2FBW A;  4JI1 T;  4TNW A;  2ZM6 T;  3IF8 B;  3SWH A;  5AQG B;  1J5W A;  3UQ4 A;  4JYA T;  5EK2 A;  2UXN B;  2LKG A;  3O1I A;  4GYR A;  4UVA B;  3ETU A;  3PJA J;  3KBT A;  5AQS B;  2ODV A;  5DQW A;  4QH4 A;  4PAG A;  1M62 A;  4DMV A;  2Q9Q C;  3PU8 A;  4UR9 A;  1XDP A;  2BKO A;  2I59 A;  2V7M A;  4UIG A;  2MYS A;  1T8B A;  2EHO B;  4KX6 A;  5LJM A;  3ZST A;  4N78 D;  4YJ3 E;  1VRB A;  2LSJ A;  2V7K A;  3X1D A;  4LF9 T;  5JDN A;  3PUR A;  3CQC B;  2WDR A;  3A7M A;  4AKH A;  3NRY A;  4HE8 A;  3EUH A;  1DU2 A;  2HHH T;  3CX8 B;  4LMJ A;  1I6Z A;  3LJC A;  3F31 A;  2WB5 A;  2CE7 A;  2YDS A;  5HYA A;  4A98 A;  2DWG A;  4ZI7 E;  1MIY A;  2BS2 A;  3RQU A;  1MND A;  2W66 A;  3OBV E;  3VHL A;  5HCJ A;  5AQV B;  3NRX A;  3AXJ B;  1HG2 A;  4YHJ A;  4QX8 B;  2J62 A;  2XAH B;  3O4X E;  5CA1 E;  3N9P A;  4MBQ A;  3HA4 A;  3HI2 A;  1UK5 A;  3UUL A;  2ZM2 A;  2W2U A;  4YSY A;  5FY1 A;  3JCF A;  5LP6 E;  3P4W A;  1H7C A;  5LB7 B;  2IHR 1;  3T1Y T;  3KVA A;  3PUZ F;  3I9Y A;  2PG8 A;  2E9X A;  2JRK A;  1IJ6 A;  4KHZ F;  3S4U A;  3ESL A;  2WP9 A;  2CCQ A;  5JR9 A;  3NBX X;  5L47 A;  3V5S A;  2WWU A;  3OPC A;  4DR2 T;  1D1A A;  4TV8 E;  5LCY A;  2MTQ A;  2KZ7 B;  5HXE A;  2EHO A;  1JNR A;  4PJM A;  1JNZ A;  4QXB B;  4P1N A;  2KSR A;  4DBR A;  3ZYL A;  5FL0 A;  5FKY A;  5EZY E;  4V1A v;  4IIJ E;  2Y48 B;  4CXY A;  5FYM A;  3RGL A;  3E08 A;  2CHO A;  5DJQ C;  4WZX A;  2KWH A;  4CXX A;  2KMF A;  3PUA A;  5IUX A;  3AEB A;  3ETV A;  5LG4 A;  3PV0 F;  5JRE A;  2I0M A;  3KV5 A;  2N2N A;  2OLT A;  2GK9 A;  2JMH A;  3D0T A;  4Z90 A;  1XZY A;  3IBP A;  3N9N A;  3G06 A;  4AQG A;  3C51 A;  4MFR A;  4L5G A;  3UT5 E;  2BBJ A;  3UUB A;  2X0L B;  5ABH A;  4PK4 A;  5HCM A;  1D0Y A;  3ZCJ A;  2C0S A;  4DR3 T;  3PUW F;  4EV6 A;  1KNZ A;  2K48 A;  5AQN B;  1YXR A;  2SPC A;  4O4L E;  3GA8 A;  4H9S E;  2BVM A;  4IDZ A;  4QWN B;  5HEU A;  3ONJ A;  3RYC E;  1W0A A;  3CPZ A;  2W00 A;  5HWY A;  3AE3 A;  3HKB E;  3CWZ B;  5C3J A;  1ZKE A;  3OKQ A;  4YTP A;  2W62 A;  3L09 A;  3ZT7 A;  3RLF F;  5LBQ B;  2A72 A;  1HTJ F;  4E7Z A;  4XAX B;  2XQY A;  4IE7 A;  4U72 A;  3KDS E;  1OXZ A;  1OWA A;  2L3L A;  5LYJ E;  3E0Z A;  3OYX A;  2DWK A;  4O4I E;  5J1G A;  5KX5 E;  3EVY A;  3Q5X A;  3ZYK A;  2XUE A;  2XAQ B;  4E7S A;  2FUP A;  2UUB T;  4TWF A;  5LNK A;  4DR1 T;  2QGS A;  4PJJ A;  1FMV A;  4L0R A;  3F57 A;  5AQL B;  3EDU A;  2KT9 A;  2V5C A;  1MIW A;  2LT3 A;  4KMC A;  5ABF B;  4DV2 T;  5LA6 E;  4UEL A;  2LEH A;  3RIA A;  3OVU A;  1ZHC A;  3QK6 A;  5LGT B;  2E2A A;  4U2Y A;  1US7 B;  4X62 T;  1KF6 A;  5AQF B;  3PUV F;  5L3E B;  4A97 A;  3MK7 C;  3ZSS A;  2ODU A;  3RYI E;  4BA9 A;  2B1E A;  4CI2 B;  4FJO A;  3NZP A;  2CRB A;  2QVA A;  3EHZ A;  2AXD S;  4HFD A;  5A1L A;  2NWB A;  4YJ2 E;  3F2E A;  3QNU A;  1GQE A;  1NWM X;  2B76 A;  5JRC A;  3RYF E;  1OED E;  5AQJ B;  3NWI A;  2XSA A;  1WFD A;  1XWM A;  2AE9 A;  2NW7 A;  3RX6 A;  2JIW A;  3ZYM A;  3FZH B;  2JQQ A;  2CBJ A;  3JAF A;  4X20 E;  2E5V A;  3K8P C;  4DR5 T;  5LHH B;  2IUB A;  2BS3 A;  3FZK B;  1UUR A;  1FMW A;  1IBK T;  4EYY R;  3I1A A;  1OED A;  3AEA A;  4MLK A;  2ZM0 A;  4CN1 A;  2HN2 A;  2W4X A;  2LSG A;  1QSD A;  4UXN B;  2BDE A;  5AQK B;  4AQF A;  3RIU A;  1XMO T;  3B13 A;  2DL1 A;  2XAF B;  2XPK A;  3VRA A;  4PFO A;  4IE5 A;  3I0Q A;  4CI3 B;  1IAP A;  2PFV A;  4P09 A;  2WDV A;  4AKI A;  2I6H A;  1U5P A;  4A56 A;  1MMD A;  3AVR A;  1NAF A;  3C4X A;  4ZZB A;  2E9X D;  4PNI A;  4XBF B;  5ABG A;  3FXE B;  5LHI B;  2D5U A;  1X79 A;  5HXS A;  2X0Y A;  4X64 T;  2XM1 A;  5DQV A;  4QH5 A;  4U3C A;  1T98 A;  2CXF A;  2JPF A;  5LJN A;  2CBI A;  3ZN1 B;  2J1D G;  3FZL B;  2JJ9 A;  4LFB T;  3WAJ A;  2V6Y B;  3VKH A;  4X65 T;  4YSX A;  2UXC T;  3HKE E;  3L39 A;  3VRB A;  2MOZ A;  4O4H E;  4ZOL E;  2VL8 A;  2XJ7 A;  5L3G B;  1D1C A;  4YSZ A;  4J2C A;  1UGO A;  3L3P A;  1IBL T;  1G8X A;  5ADX L;  5FXX A;  3BK9 A;  2E9X C;  1N32 T;  3SFE A;  2D2S A;  3W15 B;  3HKD E;  2WU2 A;  5AQI B;  3ZLI A;  2WS3 A;  5TAO A;  3KVB A;  4UVC B;  3N9Q A;  2EHO C;  3TLS A;  1N36 T;  2DNX A;  3Q9D A;  1XNR T;  1QLB A;  1VCT A;  3QOF A;  1D0X A;  4U31 A;  2A2F X;  4DVD A;  3LK3 B;  4O4J E;  5AQU B;  2XQ9 A;  3LG7 A;  3DP7 A;  5FY7 A;  4LFA T;  1N33 T;  4ISS A;  4HTE A;  2VQE T;  3OTO T;  2V5D A;  2MBG A;  4A5X A;  2KND A;  2WSS V;  2WZH A;  2QRX A;  3RF1 A;  3KIN B;  3UUX B;  2E9X B;  3Q2M A;  4LF5 T;  5L3D B;  4P0A A;  2D0U A;  2WBL A;  5IYZ E;  4TNV A;  5JR9 B;  2CXL A;  3AED A;  5LMN T;  3UU5 A;  3N2K E;  2V6Y A;  2XY8 B;  2P9B A;  2HH7 A;  2JMK A;  3B5M A;  2CEA A;  2X9Y A;  4NIQ A;  4K0K T;  3AE7 A;  2LRL A;  3C4Z A;  2V1D B;  4UV8 B;  5FXW A;  2PBI A;  1HFA A;  3AEE A;  3A8Y C;  4DV7 T;  2DI4 A;  5JVD E;  5F8P A;  3HR0 A;  2JQK A;  3TLV A;  4JEH B;  2M6B A;  3CKD A;  3AE5 A;  3UU8 A;  4I4T E;  3CX6 B;  4IT4 A;  1AJ3 A;  4C91 A;  3QUJ A;  5JDF A;  2PJQ A;  1HNX T;  4CQI A;  4EYU A;  4OYK A;  4HFE A;  3RKO A;  4GIW A;  4B3M T;  2W61 A;  4DV3 T;  5HXH A;  1W9R A;  3JAD A;  1HCI A;  2K24 A;  3ZC1 A;  3LBX A;  2C5I T;  3Q5W A;  4CN4 A;  3AE8 A;  1HX1 B;  4JI7 T;  4IE6 A;  2LRK A;  1T72 A;  3P4P A;  4OYJ A;  3PUS A;  2LHN A;  5F5W A;  4IL4 A;  1M7K A;  2YOE A;  3QB5 A;  1D1B A;  4HFI A;  5L3F B;  4WBO A;  3C98 B;  1MMG A;  2H3R A;  4QHO A;  4JI0 T;  3ZMZ B;  2JQH A;  3AVS A;  4AI6 A;  2VKO A;  1WR0 A;  3VKG A;  3ZMU B;  3H3M A;  4ZI3 D;  5JDG A;  3N5L A;  4ILA A;  4UF0 A;  5LG3 A;  2UUA T;  2XQ4 A;  4IE0 A;  1R8I A;  1KFY A;  4AKL A;  3CX7 B;  1J1J A;  1E7P A;  3ZC0 A;  4MAL A;  2VQF T;  5J2T E;  5BMV E;  4LMK A;  1MMA A;  2UXD T;  1XDO A;  2UXB T;  1D0Z A;  4AXP A;  3P8C D;  4HWD A;  4EXT A;  4JUY A;  4CI1 B;  1U4Q A;  4U7I A;  3T1H T;  5JDH A;  5M4Y A;  5LGU B;  5AQH B;  2YU2 A;  2CXD A;  2MAW A;  1OED C;  3CK6 A;  3TLT A;  3RRC A;  4NXM T;  4DND A;  2BKP A;  2X66 A;  4YHH T;  5H6Q B;  2E8I A;  3RIF A;  3RIU C;  3PTR B;  1T7S A;  3UTK A;  2VUR A;  3OYZ A;  3H37 A;  5JRC B;  2BZB A;  4GYS A;  1YKE B;  4HEA A;  4P0B A;  4IL9 A;  2X51 A;  4YTM A;  1IJ5 A;  1YW0 A;  4XZC A;  2IAK A;  4U74 A;  2BG9 E;  4QXH B;  2V7J A;  3R84 B;  1VCS A;  4COF A;  4HN9 A;  3AA0 B;  1KEY A;  2CA5 A;  1YD8 G;  2PTF A;  1OED B;  4WNK A;  4H9R C;  2YKS A;  3LSV A;  4X5T A;  4QKN A;  2CLY B;  1G73 A;  2DLR A;  5JH7 E;  4HWC A;  1UX4 A;  2J4G A;  1UCU A;  4WYV A;  2BG9 A;  3MXZ A;  3KV4 A;  1BR0 A;  4O8S A;  1UUS A;  3P7I A;  3J9X 1;  4LF8 T;  4JI4 T;  3WAK A;  3RC8 A;  1V9D A;  3FBL A;  4H9O C;  4IE4 A;  5FNV E;  3ZMT B;  5LOV E;  3P4Q A;  2VVS A;  3RC3 A;  3IHR A;  3NVO A;  2VK9 A;  4C90 A;  5HEH A;  3K3Q C;  4DV1 T;  4ZS2 A;  2XAS B;  4WBN E;  2X9X A;  3AE4 A;  3O1J A;  2V7L A;  1BR2 A;  2WCA A;  1XNQ T;  3O9X A;  1ZP0 A;  4PK6 A;  4K0U A;  4YXD A;  5LHG B;  3FZF B;  5HEG A;  2YIN A;  4MHC A;  1FIO A;  2VKD A;  3SRZ A;  4TWH A;  4DMW A;  5AQR B;  4DUY T;  3MZK B;  4ADZ A;  2RA1 A;  4U2Z A;  4HGA A;  5E0O A;  3U3I A;  2IC6 A;  3FB2 A;  2C5J A;  5CFB A;  4CXW A;  2XAG B;  2IIU A;  2L9Q A;  3ZPO A;  3PUQ A;  1QUU A;  2IDO B;  1BR1 A;  4ILC A;  1S94 A;  2ES0 A;  3ZJ1 A;  2XQ5 A;  1SA0 E;  5JTG A;  1CHU A;  4TV9 E;  5CA0 E;  5JDM A;  3BQK A;  4ZI2 D;  1MNE A;  2LSK A;  2NW9 A;  4NPP A;  2WWV A;  1S35 A;  2DCF A;  3N2O A;  4H9P C;  4DV0 T;  4JI2 T;  1HX8 A;  3MAC A;  3RKG A;  2LKH A;  3MKD A;  3AAE B;  5AQO B;  3O1H A;  2X9H A;  2M6I A;  4KUM B;  2YU1 A;  2VKJ A;  5J0Z A;  1FEW A;  3TKL B;  2XAJ B;  3ONX A;  5AQQ B;  3UUM A;  2G0U A;  3I9W A;  4ASK A;  3A5X A;  4OK0 A;  2HPJ A;  3PJA A;  4G2A A;  5CB4 E;  3FHN A;  4HWF A;  3PUY F;  4TX5 A;  3ZT5 A;  1ZOY A;  2XQ7 A;  4DV6 T;  1CUN A;  3J7Y q;  3ZMV B;  4IHJ E;  4TN7 B;  5HEO A;  3SOL A;  4ILU A;  3CVR A;  3AE1 A;  1N34 T;  2NW8 A;  1Z0P A;  1MIV A;  2WY2 A;  5KDM C;  2YDR A;  3ZN0 B;  3V5U A;  1VOM A;  3EI0 A;  1HR0 T;  2MPK A;  5CJ5 A;  3UU3 A;  2UUC T;  1NEK A;  4H9Q C;  5FXZ A;  4EB6 E;  3GWH A;  3AB3 B;  3N9L A;  2VAS A;  4H63 H;  5JR9 C;  2KLQ A;  1E1H B;  4LML A;  2Q9Q D;  4B6X A;  4M1P A;  2LSI A;  3UU4 A;  2L8K A;  5C2T A;  4JI5 T;  5JDL A;  2IW5 B;  2V8S V;  1HG5 A;  3UU6 A; 
#chains in the Genus database with same CATH homology
 3ZEF B;  3CML A;  5LBQ B;  2A72 A;  3KFW X;  1LRZ A;  1HCI A;  2ACX A;  4X1K E;  2K24 A;  4KP3 C;  3ZC1 A;  4DO0 A;  3LBX A;  2C5I T;  1HTJ F;  4H63 V;  3Q5W A;  5JQG E;  3KV9 A;  4E7Z A;  4O2A E;  4XAX B;  2XQY A;  3BQI A;  4IE7 A;  4U72 A;  3KDS E;  1OXZ A;  3K3N A;  1OWA A;  2M67 A;  4IE6 A;  4L9I A;  3ANW B;  2WAU A;  3L09 A;  2L3L A;  4OYJ A;  3E0Z A;  3PUS A;  2V26 A;  3OYX A;  5LYJ E;  5LBM A;  2DWK A;  2VWA A;  3IEE A;  5J2U E;  4O4I E;  5J1G A;  5KX5 E;  5L3C B;  3EVY A;  4AKR B;  5HXC A;  2H7O A;  3Q5X A;  4QXC B;  2XUE A;  2XAQ B;  3UUN A;  3ZYK A;  4AKG A;  2LHN A;  4TUY E;  4CZZ B;  4E7S A;  5HXH A;  3LBX B;  2D0T A;  1D1B A;  4HKA A;  4EZ4 A;  5L3F B;  4WBO A;  2KWI B;  3C98 B;  5LNK A;  1MMG A;  2K9A A;  3ZCI A;  4BJM A;  2H3R A;  2H7V C;  3HL6 A;  2QGS A;  4PJJ A;  4JLE A;  4QHO A;  3GN5 A;  3LFM A;  3ZMZ B;  1FMV A;  4L0R A;  4UEM A;  2DHR A;  3F57 A;  3ZJ2 A;  3AVS A;  3EDU A;  4AI6 A;  1HF8 A;  2KIN B;  2KT9 A;  2VKO A;  3VKG A;  1YKH B;  3ZMU B;  1MIW A;  1ZV4 X;  3N2G E;  4G63 A;  2YK0 A;  4WW0 A;  3AAA B;  2LT3 A;  4NUV A;  4ZI3 D;  4H9N C;  3FXD B;  4KMC A;  5JDG A;  3LK2 B;  4ERR A;  3N5L A;  5LA6 E;  1BR4 A;  2K5B B;  4UEL A;  3KV6 A;  2LEH A;  2LJL A;  1ZHC A;  3QK6 A;  4UF0 A;  3DJB A;  2RP4 A;  5LGT B;  2CMR A;  1Y64 B;  1MMN A;  2LSY A;  4IE0 A;  1US7 B;  3RYH E;  5F3J A;  4AKL A;  3CX7 B;  2EHO D;  3ZC0 A;  4MAL A;  5L3E B;  5J2T E;  3MK7 C;  2ODU A;  3RYI E;  5BMV E;  3ZMS B;  4BA9 A;  5C8Y E;  4EZH A;  2B1E A;  4CI2 B;  1MMA A;  3MJX A;  2NOX A;  4FJO A;  3NZP A;  4QX7 B;  5HWX A;  4ZI2 C;  3PU3 A;  5ETW A;  4I43 B;  4EIW A;  4UF0 B;  4O2B E;  1D0Z A;  5A1L A;  2NWB A;  3M65 A;  4AXP A;  3P8C D;  3R6N A;  1WLX A;  4YJ2 E;  3F2E A;  4EXT A;  5FY0 A;  3FBZ A;  4JUY A;  1WYB A;  3CQX C;  4CI1 B;  1NWM X;  4ZS3 A;  4PJL A;  1U4Q A;  5JDH A;  1KK7 A;  5JRC A;  3RYF E;  2IC9 A;  3E22 E;  5FXV A;  2Q9Q B;  5H6R B;  4FI5 A;  1WYC A;  2VKH A;  5IHY A;  5M4Y A;  2Z6E A;  5LGU B;  2NW7 A;  2YU2 A;  2CXD A;  3RX6 A;  4DBQ A;  1HS7 A;  3RRC A;  3ZYM A;  3RH3 A;  4F6R C;  3VU7 H;  2JQQ A;  4DND A;  4TZ4 C;  2LOP A;  2X66 A;  4ANJ A;  4X20 E;  3ANW A;  5H6Q B;  2VB6 A;  2E8I A;  4GK0 E;  2WM9 A;  2X68 A;  3K8P C;  3PTR B;  1SHZ C;  1IZN B;  4HFV A;  3UTK A;  3OYZ A;  3H37 A;  5LHH B;  5JRC B;  2BZB A;  3RRW A;  3AA1 B;  3B57 A;  3DTO A;  4JEU B;  2WMN A;  1YKE B;  4GYS A;  2LM9 A;  1FMW A;  4HEA A;  2LOS A;  4P0B A;  2CM0 A;  4X1I E;  2X51 A;  4PW8 A;  5GON E;  4EYY R;  2XHE B;  3I1A A;  1IJ5 A;  1YW0 A;  4XZC A;  4MLK A;  2ZM0 A;  2IAK A;  4PK5 A;  3WI3 A;  4EOZ B;  4I55 E;  3IF8 B;  3EDV A;  2LSG A;  3SWH A;  1QSD A;  4U74 A;  2BDE A;  4UXN B;  4AQF A;  4QXH B;  2V7J A;  3B13 A;  2XAF B;  4YFS A;  3R84 B;  4PFO A;  2ZM8 A;  5EK2 A;  4HN9 A;  2UXN B;  2QA7 A;  3AA0 B;  4IE5 A;  2NTY A;  1LVK A;  3O1I A;  4IGU A;  2CA5 A;  3I0Q A;  4GYR A;  4UVA B;  1YD8 G;  4CI3 B;  3ETU A;  2OA5 A;  2Y6X A;  1IAP A;  4WNK A;  2PFV A;  4P09 A;  3KBT A;  4H9R C;  4AKI A;  2ODV A;  3C4W A;  5DQW A;  4QKN A;  2CLY B;  1O3X A;  1U5P A;  3K3O A;  4A56 A;  1G73 A;  1LKX A;  2Y8D A;  4PAG A;  1MMD A;  2DLR A;  4DMV A;  3PDY A;  5JH7 E;  3AVR A;  2Q9Q C;  3PU8 A;  1UX4 A;  1NAF A;  3C4X A;  2I59 A;  1UCU A;  2E9X D;  4PNI A;  3MXZ A;  2V7M A;  4XBF B;  4UIG A;  4KBM B;  2MYS A;  3FXE B;  5LHI B;  3KV4 A;  1BR0 A;  3RPU A;  2NTX A;  4O8S A;  3P7I A;  2EHO B;  3JC6 D;  3N9M A;  3T8O A;  2D5U A;  1WR6 A;  5LJM A;  3J9X 1;  4N78 D;  1X79 A;  4X1Y E;  4YJ3 E;  5HXS A;  1VRB A;  2LSJ A;  2V7K A;  5DQV A;  3WAK A;  3RC8 A;  1T98 A;  2CXF A;  5JDN A;  2JPF A;  1V9D A;  3FBL A;  3PUR A;  4H9O C;  4UV9 B;  5LJN A;  2WMO A;  3CQC B;  3C64 A;  4IE4 A;  1B7T A;  2Q9Q A;  2ZMA A;  5FNV E;  3ZMT B;  5LOV E;  2J1D G;  3ZN1 B;  4GOU A;  3RC3 A;  3IHR A;  4AKH A;  3UFE A;  2JJ9 A;  2VK9 A;  4C90 A;  3NRY A;  3AAI A;  3CQG B;  3WAJ A;  3KBU A;  3VKH A;  4HE8 A;  3K3Q C;  3EUH A;  3CX8 B;  4ZS2 A;  3HKE E;  2XAS B;  1LVF A;  3LJC A;  2YEV C;  4WBN E;  2X9X A;  2N9D A;  2MOZ A;  3F31 A;  4O4H E;  4ZOL E;  2CE7 A;  2W63 A;  5HYA A;  2DWG A;  4ZI7 E;  2VL8 A;  3O1J A;  1MIY A;  5L3G B;  1D1C A;  2A3D A;  2V7L A;  1BR2 A;  3U78 A;  4YLH A;  4J2C A;  3O9X A;  2N1G A;  3I0O A;  3L3P A;  4PK6 A;  4K0U A;  5LHG B;  1G8X A;  1MND A;  2YIN A;  4MHC A;  3OBV E;  5HAX A;  5ADX L;  1FIO A;  3VHL A;  4OHF A;  2VKD A;  3NRX A;  3SRZ A;  1HG2 A;  5FXX A;  2C5K T;  4YHJ A;  4QX8 B;  4DMW A;  2XAH B;  3BK9 A;  4ZI3 C;  3O4X E;  5CA1 E;  2CLY C;  2E9X C;  3N9P A;  4AQF C;  4MBQ A;  3MZK B;  3HA4 A;  3HI2 A;  4ADZ A;  1UX5 A;  2RA1 A;  2D2S A;  3GMI A;  3W15 B;  3HKC E;  2ZM2 A;  3UUL A;  2NP9 A;  5LGN B;  5FP3 A;  3HKD E;  4HGA A;  5E0O A;  3U3I A;  3JC6 C;  2IC6 A;  5FY1 A;  3ZLI A;  5TAO A;  5DAB A;  3KVB A;  3FB2 A;  4UVC B;  2C5J A;  3N9Q A;  5LP6 E;  4CXW A;  1H7C A;  2XAG B;  5L2L A;  2EHO C;  3KVA A;  2DNX A;  3Q9D A;  2L9Q A;  3I9Y A;  3ZPO A;  2PG8 A;  3PUQ A;  1D0X A;  4DVD A;  2A2F X;  2E9X A;  2JRK A;  3LK3 B;  4O4J E;  1QUU A;  1IJ6 A;  3LG7 A;  1BR1 A;  3S4U A;  3ESL A;  1S94 A;  4BAY B;  5JDQ A;  3DP7 A;  5FY7 A;  2ES0 A;  2CCQ A;  5JR9 A;  4ISS A;  3NBX X;  3ZJ1 A;  5L3B B;  1SA0 E;  2UXX B;  3V5S A;  2WWU A;  4HTE A;  5EK3 A;  4TV9 E;  4BJN A;  1D1A A;  3QC9 A;  4TV8 E;  5LCY A;  2X67 A;  2MBG A;  2KND A;  2MTQ A;  2WSS V;  4I50 E;  5CA0 E;  2KZ7 B;  3BQK A;  5JDM A;  5HXE A;  2EHO A;  4PJM A;  4ZI2 D;  4QXB B;  1MNE A;  2KXP B;  2LSK A;  3KIN B;  2NW9 A;  3UUX B;  5KMG P;  4DBR A;  1S35 A;  2DCF A;  2E9X B;  3MA9 A;  4UVB B;  3ZYL A;  5EZY E;  3N2O A;  3Q2M A;  4H9P C;  4V1A v;  4IIJ E;  5L3D B;  1ZEE A;  5AFU L;  1HX8 A;  2Y48 B;  3MAC A;  4P0A A;  4CXY A;  2D0U A;  2WBL A;  2X9W A;  5FYM A;  5IYZ E;  3BQL A;  2CXL A;  5JR9 B;  3MKD A;  3AAE B;  3E08 A;  3O1H A;  2X9H A;  5DJQ C;  2XTL A;  4KUM B;  2V7I A;  2W0G A;  2KWH A;  5FMN A;  4CXX A;  3N2K E;  2YU1 A;  2VKJ A;  4PJN A;  3AA7 B;  2KMF A;  3PUA A;  4EAH A;  2P9B A;  1FEW A;  3TKL B;  2CWO A;  2XAJ B;  3ONX A;  2HH7 A;  2JMK A;  2HPL A;  2CEA A;  3AA6 B;  2LHR A;  3ETV A;  5LG4 A;  2X9Y A;  3UUM A;  2G0U A;  3I9W A;  4ASK A;  3A5X A;  4OK0 A;  5JRE A;  2HPJ A;  3KV5 A;  4GK5 E;  4G2A A;  2BVL A;  2N2N A;  5CB4 E;  2GK9 A;  3C4Z A;  3FHN A;  3H3A A;  2V1D B;  2JMH A;  3D0T A;  3IBP A;  3N9N A;  4UV8 B;  4AQG A;  3C51 A;  4NUU A;  5FXW A;  2PBI A;  4MFR A;  4TX5 A;  4L5G A;  3UT5 E;  2LE8 A;  4ZHQ E;  1HFA A;  1CUN A;  2X0L B;  3PE0 A;  3J7Y q;  3GN5 B;  3LK4 2;  3ZMV B;  4IHJ E;  4TN7 B;  4PK4 A;  2DI4 A;  5JVD E;  1D0Y A;  3ZCJ A;  1WRD A;  3SOL A;  4OFZ A;  5F8P A;  4ILU A;  2C0S A;  3CVR A;  3HR0 A;  1KNZ A;  1Z0P A;  2NW8 A;  1MIV A;  2K48 A;  4JEH B;  5KDM C;  2SPC A;  4O4L E;  3GA8 A;  3CKD A;  3ZN0 B;  4I4T E;  3CX6 B;  3V5U A;  1VOM A;  4H9S E;  3SS1 A;  3OJA A;  1AJ3 A;  4C91 A;  4IST A;  2CWY A;  2ZLY A;  3N9O A;  2BVM A;  3QUJ A;  4IDZ A;  4QWN B;  5JDF A;  2PJQ A;  4H9Q C;  4CQI A;  5FXZ A;  4EB6 E;  3GWH A;  4Z8X A;  3RYC E;  3CPZ A;  1EZ3 A;  3AB3 B;  3N9L A;  2W00 A;  4EYU A;  3PUG A;  2VAS A;  5HXR A;  5HWY A;  4H63 H;  3NZQ A;  5JR9 C;  4OYK A;  2KLQ A;  1E1H B;  2Q9Q D;  3HKB E;  3CWZ B;  1ZKE A;  4B6X A;  4M1P A;  2LSI A;  5LXT E;  5EK4 A;  3RKO A;  3OKQ A;  4GIW A;  3C50 A;  2L8K A;  5JDL A;  2W61 A;  2W62 A;  2IW5 B;  4PFP A;  1HG5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...