2V6YB

Structure of the mit domain from a s. solfataricus vps4-like atpase
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
74
structure length
72
Chain Sequence
SAQVMLEDMARKYAILAVKADKEGDDAITYYKKAIEVLSQIIVLYPESVARTAYEQMINEYKKRISYLEKVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Selective Recognition of Escrt-III by the Aaa ATPase Vps4
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
molecule keywords AAA FAMILY ATPASE, P60 KATANIN
total genus 31
structure length 72
sequence length 74
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2007-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2v6yB00
2XZEA 5LB7B 2V6YA 4U33A 2CRBA 2W2UA 5CJ5A 4U7IA 2A9UA 4U2YA 2RPAA 3ZT5A 4IT4A 2K3WA 2WY2A 4U31A 3ZSSA 4WZXA 2JQKA 4P1NA 5FVKA 2LRLA 4U3CA 4CN6A 2DL1A 4NIQA 2JQ9A 3ZT6A 4U7YA 4ZEYA 4U2ZA 4A5XA 4CN1A 2WWVA 1WCRA 3ZSTA 2MPKA 4CN4A 2LRKA 1YXRA 2CPTA 5CGMA 2V6XA 3K1SA 3EABA 2JQHA 1WR0A 5FVLA 3ZT7A 2V6YB 1WFDA
chains in the Genus database with same CATH superfamily
2WBLA 2V6YA 4DR2T 3SS1A 3EDVA 2W2UA 4QWNB 1NWMX 3ZMZB 5LOVE 4DR6T 4HKAA 1UGOA 4I43B 3C4XA 4ISSA 3NRYA 4B6XA 2WY2A 4X1IE 4HFVA 1HF8A 3UULA 4DUZT 1NEKA 3C4ZA 2ZM0A 3FZHB 4ILCA 2Y6XA 4FJOA 4ILUA 1OEDB 4ZEYA 3UFGA 4A5XA 2IIUA 2E5VA 3T1HT 4LFBT 3I9YA 3KDSE 2Q9QD 2WMOA 3AA0B 3AXJB 3KVAA 4UV9B 2EHOA 3RIAA 4LMJA 3RHWA 4BJNA 2GK9A 5JDLA 2X0HA 5KMGP 4XBFB 3Q2MA 2A3DA 5AQVB 4AIUA 2FJAA 3KVBA 4QH5A 4EV6A 4YJ2E 2VK9A 4XZCA 2HN1A 3LK2B 1UCUA 3ETUA 3P50A 3RYHE 4A97A 1ZKEA 5DJQC 4JUYA 2XM2A 3KBTA 3LSVA 4PK4A 1N34T 4ZI3C 1LVKA 2UXNB 2ZM8A 3KV9A 2CM0A 3CX8B 2CXDA 2W4XA 3UU6A 2VKJA 2K3WA 3ZN0B 4F6RC 1KFYA 2CE7A 4IE4A 1SHZC 2HPLA 5FY7A 3PUWF 4DO0A 3NKZA 5JR9B 2BS3A 2MOZA 1N33T 5AQPB 2K48A 4IE7A 5HXRA 4DR7T 2KINB 3N9MA 4AQFA 2ZMAA 2MBGA 2F4VT 2X0YA 4QH1A 4UIGA 3EUHA 3OPCA 3Q5DA 4YSZA 4EZHA 5J0ZA 1HFAA 5M4YA 1J5WA 3AE3A 4HWCA 3ZN1B 3RYCE 4DVDA 5EK2A 3EI0A 4DV7T 4DBRA 2WWUA 2N9DA 3PJAA 5AQQB 3N2OA 3C64A 2IHR1 5HCJA 5LBQB 3Q5XA 3AE5A 3N9OA 3PV0F 3JADA 4JI3T 2JQHA 3UU8A 3CMLA 4NPPA 2NWBA 2X51A 2XM1A 4X66T 4YY3T 4IDPA 2LSYA 3V5SA 3GWHA 4WBOA 5HEGA 3N9PA 3ZKRA 4HFDA 4ZI2C 4EGWA 4JLEA 2IC9A 3CPZA 3OKQA 3N9NA 3OJAA 1IBKT 4ADZA 2X9WA 3FXDB 4O4LE 5HEUA 3ZC0A 2ACZA 4IL4A 2VKHA 5LMUT 1UK5A 2WP9A 1X9BA 4YLHA 2G0UA 4DV4T 2WU2A 4NIQA 4LF9T 3LK3B 5JR9A 2UXDT 4EIWA 2IUBA 3GMIA 4GYRA 4LF6T 3I9WA 4MFRA 2AXDS 2ODVA 2DNXA 3GN5A 3AEAA 2XAHB 5BR8T 4HFIA 3G06A 3UQ7A 3KINB 3PUSA 3EABA 5DABA 3U3IA 1S35A 2UUCT 4A98A 2A2FX 2VVNA 2MAWA 4GK0E 1JNZA 1NAFA 4IDZA 5JQGE 1KNZA 4U72A 2QVAA 5C3JA 1XNQT 5LNKA 3FBZA 5AQLB 2NTXA 3T1YT 4X1YE 4B3TT 1YQ4A 2H3RA 2WDVA 3AAEB 3ZJ2A 3PUZF 3KFWX 4E7ZA 2A9UA 4WNKA 2RP4A 4ZI2D 2BKOA 3RYFE 4DNDA 1HCIA 4UXNB 1GQEA 3IF8B 3RF1A 3ZCJA 3NRXA 2ZM2A 1BR0A 2W00A 5LBMA 1Y01A 3TLSA 1VCTA 3SFEA 3V5UA 2MTQA 5L3EB 3H3MA 3QK6A 2E5LT 3PU8A 4UR9A 2XUEA 1MIWA 4H63H 4U2ZA 4CN1A 4LF8T 4U74A 3RLFF 4H9SE 3VHLA 4AKIA 1M7KA 3RRCA 2EHOD 3FZKB 3CX7B 4O8SA 4OYJA 3LG7A 3CQXC 4Z90A 2VASA 5KDMC 5AQOB 3RKOA 3GN5B 4CI2B 1HTJF 2V7KA 5E0OA 1KK7A 2YU2A 5L3GB 1HNXT 2X68A 3L3PA 4H9QC 3VRBA 3O9XA 3OVUA 5J2TE 3CQGB 1HR0T 3CKDA 3FB2A 2QRXA 2RA1A 3C51A 3O1HA 3PURA 2LOSA 5LHGB 2CLYB 5A1LA 5KXJA 3VKHA 2YDRA 5AQMB 5FY0A 2YKSA 4CXWA 4J2CA 3O1JA 4B3ST 3CX6B 1BR2A 2C5IT 1KF6A 2XASB 2OA5A 4PAGA 4WZXA 4X20E 4CI3B 3KV5A 4MLKA 2CXLA 2LSJA 3HA4A 5JDQA 4LF7T 4U3CA 2NR4A 3N2GE 4UF0A 3PUYF 3RX6A 3UFEA 4IDQA 3AVSA 4X65T 3ZMUB 1HX8A 3HKEE 3LDQB 1G8XA 4HE8A 5IUXA 5LCYA 4JI5T 2VKDA 4ZZBA 3I0OA 4GK5E 2HHHT 2BBJA 5FMNA 4AQFC 3OYZA 4AKRB 2QGSA 2R6GF 5J2UE 2CEAA 2JQQA 3AEFA 3PUVF 3S4UA 5ABHA 5LXTE 1W09A 2CCQA 2KXPB 3AE7A 3ONJA 4X5TA 1IJ5A 4X1KE 3UU5A 4EEDA 2N2NA 3RQWA 1FEWA 5JDMA 1M62A 4U7IA 4JEHB 2BS4A 3P4PA 4EOZB 2V7IA 3AVRA 3BQIA 2FUPA 2VWAA 2BZBA 3PUXF 3PUQA 4PNIA 2N1GA 3E22E 4H9NC 3HKDE 3P4WA 3UT5E 3PTRB 2WU5A 3AA7B 4OK0A 4ZHQE 1UX4A 5LG4A 5F8PA 2CBJA 1ZEEA 2IMLA 2D5UA 2YDQA 2XAGB 2E9XB 4G63A 2BS2A 4HFBA 4ILAA 4JI6T 2BVLA 1YKHB 3AEGA 4IE6A 4B3MT 1IAPA 1O3XA 2ACXA 2VQFT 2D0UA 1I94T 4ZXLA 5AQTB 3K3NA 2WSSV 4TX5A 3ZYMA 3RIUC 3FBLA 3P7IA 3UQ4A 1HG5A 3ZCIA 2YU1A 4TV8E 4IE0A 3ONXA 5JDGA 3N9QA 3M65A 5CJ5A 4O2BE 3I0QA 2V7LA 3K8PC 4IL9A 5HXCA 2BDEA 2VVSA 2XAQB 3ABVA 3F57A 3P4SA 4BAYB 4U2YA 2RPAA 4EZ4A 5FNVE 2K5BB 2H89A 2D2SA 3QNUA 2E9XC 4HWIB 2EHOC 3L39A 4IIJE 5FYMA 5FVKA 3ZSSA 5IWAT 1XWMA 2KWIB 4QXBB 4C91A 4EYYR 1OEDC 5LMNT 2WB5A 3TLUA 4DR5T 3M3ZB 5ABGA 2CWOA 1T7SA 1YD8G 4WBNE 5L47A 3WAJA 5H6QB 4ZI7E 4EAHA 2KLQA 3AE8A 2CPTA 1US7B 1D1BA 5FL0A 4CI1B 4PJJA 1UUSA 2V6XA 2V7MA 4OYKA 2NW9A 4DMWA 2XQ4A 1D0YA 3AE9A 2JRKA 3C98B 3N5LA 1WR0A 4K0KT 3L8RA 3QOFA 4UVAB 4P09A 4NXMT 3F2EA 3IBPA 5CB4E 2ZM6T 3UUBA 2W63A 3E0ZA 1E2AA 2JIWA 2LSGA 1UURA 4ISTA 4K0UA 5ABFB 2VKOA 2CBIA 1WR6A 3TLVA 4TWFA 2YEVC 2X9HA 2E2AA 3LJCA 2PBIA 4IT4A 2XQ7A 2YOEA 2P9BA 2LHNA 2X9XA 3AEEA 3VR8A 4P1NA 5EZYE 2FJBA 4LMLA 2JPFA 3SOLA 4EXTA 2J4GA 1D1AA 2LRLA 3E08A 4PFPA 1WYCA 3A7MA 2DI4A 3RYIE 3FZMB 5LGTB 3MACA 2DL1A 2E9XD 2BG9C 3UU4A 1WYBA 3UUNA 5AQJB 4NUVA 5JVDE 4YSYA 3NBXX 1ZHCA 1IBMT 3ZSTA 1EZ3A 1B7TA 2I6HA 2KMFA 4AI6A 3VKGA 4CQIA 3NWIA 2JMHA 2X67A 5LA6E 5LJNA 3FZLB 2LSKA 3AE2A 3DTOA 1NENA 2WZHA 4MBQA 2IW5B 3ZT7A 3PJAJ 2KNDA 1UX5A 1WLXA 3B57A 2XZEA 4JI8T 1D1CA 2CXFA 2X9YA 3HL6A 3R6NA 4AKLA 5HXEA 4DUYT 4LFCT 3D0TA 4UVCB 4PW8A 2DWKA 1XDOA 1KEYA 1HX1B 1SE7A 2DCFA 2LJLA 5LHIB 4DR4T 3DP7A 5AQSB 2WMNA 2WM9A 3NVOA 5ABFA 1HS7A 1V9DA 5EK3A 2IDOB 3K3QC 4HFEA 4I50E 3HR0A 5FL1A 4L9IA 4OX9T 4AKGA 4GKKT 3P4QA 3JC6C 2JQ9A 2C5JA 1VRBA 2LKGA 3B5MA 2J62A 3GA8A 1QUUA 3H3AA 1SA0E 2I0MA 4HEAA 4ZS3A 5JREA 2WWVA 4ANJA 1Y64B 3B13A 4KMCA 2BKNA 4PJLA 2XTLA 2HH7A 3ZMVB 5F3JA 5L4HA 1W0AA 2XSAA 3CK6A 5HWYA 3CIRA 5CA1E 4P0BA 5HWXA 4ZS2A 3VU7H 1XZYA 3CWZB 4C90A 2NOXA 2LSIA 2D9DA 3DJBA 5CA0E 3AEDA 1XMQT 4PK6A 5AQRB 4O4JE 2ZLYA 3SWHA 3MKDA 3RI5A 1OXZA 5JTGA 2W62A 2WDQA 4Z8XA 4IDNA 5ETWA 2JMKA 4AQGA 2VL8A 2NP9A 5C2TA 4MHCA 4DV2T 1OEDE 5HXSA 1ZOYA 2Z6EA 2V5CA 3WAKA 2BKPA 2IC6A 1KNPA 4NUUA 2XQ5A 3A5XA 1LVFA 1ZP0A 4IGUA 2KT9A 2Y48B 2LM2A 4YT0A 3RQUA 4TNWA 2XSBA 2W66A 4M1PA 2PFVA 1U4QA 3AA1B 2CLYC 4A56A 3TLWA 2WCAA 4CN4A 4DBQA 4ZOLE 5KX5E 4I4TE 4OFZA 3BQKA 2AE9A 2XAFB 3C4WA 3K1SA 4H9OC 2L9QA 3QB5A 2V6YB 1ZV4X 5FP3A 4GKJT 2VURA 1VOMA 2M6BA 1MNDA 2KSRA 3JAFA 3QC9A 3A8YC 3MZKB 4EYUA 3JCFA 5BMVE 1E7PA 4DV0T 1BR1A 2CHOA 4OHFA 2X66A 5JDNA 4KUMB 4YXDA 4B3RT 2W0GA 4AQYT 3NZPA 3X1DA 1H7CA 4XAXB 2ODUA 2V26A 3PDYA 2WS3A 5FY1A 5LGNB 3LFMA 1KNRA 4Z91A 3ZJ1A 3AAIA 5JR9C 3AE6A 4QX7B 3AECA 1IBLT 3VRAA 4DR3T 5HEHA 4PFOA 4WW0A 3AXJA 3NZQA 5F5WA 5FXWA 3J9X1 2EHOB 4HWDA 3OTOT 2K24A 3ESLA 2UUAT 4V1Av 4JI4T 2FJDA 4X64T 1I6ZA 4IDOA 2PJQA 4Q25A 2XQ6A 4UEMA 2M6IA 2W67A 3UU3A 1YQ3A 2MYSA 5HAXA 4JYAT 5HYAA 2PG8A 4I0UA 3F31A 4KP3C 3T8OA 1HG2A 3VR9A 5IHYA 3L09A 2C0SA 1T98A 1FJGT 4AKHA 5HCMA 3PUAA 4JI7T 5LJMA 1DU2A 4DR1T 2IAKA 1S94A 2B76A 1R8IA 4QHOA 2V1DB 4UELA 2L3LA 1VCSA 2H88A 2VL0A 2YINA 2QA7A 3CQCB 5L2LA 3ZPOA 2J47A 4QKNA 1T72A 2LLYA 2XAJB 5IYZE 5HXHA 5ADXL 2J1DG 5DQWA 2Q9QB 2W61A 3OBVE 4QXHB 3RPUA 3QB5K 1MMAA 4UVBB 5L3CB 2UUBT 1YKEB 5FXXA 4GYSA 3CVRA 2LE8A 4HFHA 4YTNA 2NW7A 2M67A 2HPJA 2CA5A 4UV8B 3SRZA 3RC3A 4CXXA 2H7OA 2BG9B 2XQYA 2PTFA 3SFDA 3UUMA 2V5DA 3ETVA 4JI2T 4N78D 1YW0A 1HNWT 5LB7B 3TLTA 2D0TA 5AQFB 4LF4T 4JV5T 3ZMTB 2LKHA 2LOPA 1E1HB 1MIYA 2DLRA 2WZIA 2DHRA 2SPCA 5AQGB 3R84B 4F8HA 2A72A 4FI5A 1BR4A 3RIFA 5L3BB 3RKGA 2KWHA 1W9RA 3Q9DA 3ZLIA 5J1GA 5AFUL 2WQYA 3EAMA 4TWHA 3KV4A 4KHZF 3Q5WA 4DV5T 2LT3A 3RGLA 4DMVA 4IE5A 2XQAA 4CN6A 1Z0PA 1JNRA 4WYVA 3P4RA 2XHEB 4X62T 5JDHA 1L0VA 5L4EA 2HN2A 5AQIB 4P0AA 4KBMB 5ABEA 3C50A 2Q9QA 4LMKA 4ASKA 1U5PA 5LG3A 3ZYLA 4TNVA 2UXXB 3AE4A 2I59A 2VB6A 4TV9E 3RIUA 3AEBA 4EB6E 3ZEFB 3KBUA 4ERRA 3UUXB 1WFDA 1MIVA 3K3OA 4KHPT 2CRBA 1MMGA 2BG9A 4L0RA 4O4IE 2QYWA 3U78A 4YHJA 2XQ9A 3N2KE 4YTMA 4JI1T 4DIDB 1OWAA 5FKYA 2BVMA 4I55E 2LHRA 3ZT5A 2H7VC 5HEOA 4COFA 3H37A 5JRCA 4GIWA 3AA6B 3AB3B 2Q9QC 4L5GA 4O2AE 4U31A 5LP6E 2ES0A 4HWHA 3LBXB 3IEEA 2VQET 4ZZCA 4CZZB 2WAUA 3ZMSB 5LGUB 4JEUB 3ZYKA 3ZT6A 3W15B 4YTPA 4DV1T 3HKCE 2LM9A 3PUGA 1J5ET 2CWYA 2UU9T 2UXBT 1WCRA 4PJMA 2L8KA 5L3FB 1XDPA 3IA3A 1MMNA 1LRZA 1T8BA 3FZFB 1CHUA 2CMRA 3EDUA 3Q5EA 1QLBA 3I1AA 4HN9A 4TWDA 4AXPA 3O4XE 5CFBA 3ANWA 4QX8B 2B1EA 3P8CD 4GOUA 2DWGA 4PK5A 2E8IA 2BBHA 3ZC1A 4YHHT 1G73A 5FXZA 2OV9A 5LYJE 5AQKB 4JBWF 1SUMB 4LF5T 2XQ8A 3OYXA 1XNRT 5LHHB 2C5KT 3EVYA 3FHNA 4DV6T 2YDSA 1FMWA 4YJ3E 2JQKA 4IREA 5EK4A 4G2AA 1QSDA 5JRCB 4IHJE 4ILBA 3AAAB 1W0BA 2V7JA 1MMDA 4O4HE 2NW8A 4UF0B 1D0ZA 5GONE 3BK9A 2K9AA 4TN7B 4HGAA 1MNEA 3MJXA 3LBXA 3WI3A 4U7YA 5HEJA 2Y8DA 1FIOA 3HKBE 5TAOA 1X79A 3TKLB 2FBWA 4PJNA 4QH4A 2JJ9A 3MK7C 4TZ4C 4YSXA 1N36T 4KX6A 2XJ7A 1D0XA 4ZI3D 1Z8UA 3O1IA 4HTEA 3JAEA 3RRWA 4H9RC 5H6RB 5FVLA 2YK0A 4HWFA 5AQHB 3RH3A 2XY8B 3J7Yq 4QXCB 4U33A 3ANWB 4H63V 1N32T 1IJ6A 3AE1A 1WRDA 4TUYE 5JDFA 4EEBA 4E7SA 4NXNT 1AJ3A 2NTYA 1HNZT 3PU3A 5AQUB 1FMVA 3ONLC 3JC6D 3RC8A 2CHNA 4HFCA 4JI0T 1OEDA 1J1JA 3LK42 2V8SV 3IHRA 4CXYA 4DV3T 2OLTA 5AQNB 2E9XA 5DQVA 1IZNB 2WDRA 2YN6A 4H9PC 4KI0F 4BJMA 2XQ3A 2XPKA 5C8YE 2BG9E 4YFSA 4BA9A 5JH7E 5FXVA 2MPKA 4AISA 2LRKA 5L3DB 1YXRA 3MA9A 3FXEB 4MALA 3UTKA 3PE0A 2UXCT 2X0LB 5CGMA 2LEHA 3BQLA 3EHZA 4LFAT 2KZ7B 1XMOT 2FJEA 3N9LA 3KV6A 1LKXA 3MXZA 3HI2A 3QUJA 1CUNA
chains in the Genus database with same CATH topology
2XZEA 5LB7B 2V6YA 4U33A 2CRBA 2W2UA 5CJ5A 4U7IA 2A9UA 4U2YA 2RPAA 3ZT5A 4IT4A 2K3WA 2WY2A 4U31A 3ZSSA 4WZXA 2JQKA 4P1NA 5FVKA 2LRLA 4U3CA 4CN6A 2DL1A 4NIQA 2JQ9A 3ZT6A 4U7YA 4ZEYA 4U2ZA 4A5XA 4CN1A 2WWVA 1WCRA 3ZSTA 2MPKA 4CN4A 2LRKA 1YXRA 2CPTA 5CGMA 2V6XA 3K1SA 3EABA 2JQHA 1WR0A 5FVLA 3ZT7A 2V6YB 1WFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XZE A;  5LB7 B;  2V6Y A;  4U33 A;  2CRB A;  2W2U A;  5CJ5 A;  4U7I A;  2A9U A;  4U2Y A;  2RPA A;  3ZT5 A;  4IT4 A;  2K3W A;  2WY2 A;  4U31 A;  3ZSS A;  4WZX A;  2JQK A;  4P1N A;  5FVK A;  2LRL A;  4U3C A;  4CN6 A;  2DL1 A;  4NIQ A;  2JQ9 A;  3ZT6 A;  4U7Y A;  4ZEY A;  4U2Z A;  4A5X A;  4CN1 A;  2WWV A;  1WCR A;  3ZST A;  2MPK A;  4CN4 A;  2LRK A;  1YXR A;  2CPT A;  5CGM A;  2V6X A;  3K1S A;  3EAB A;  2JQH A;  1WR0 A;  5FVL A;  3ZT7 A;  2V6Y B;  1WFD A; 
#chains in the Genus database with same CATH topology
 2WBL A;  2V6Y A;  4DR2 T;  3SS1 A;  3EDV A;  2W2U A;  4QWN B;  1NWM X;  3ZMZ B;  5LOV E;  4DR6 T;  4HKA A;  1UGO A;  4I43 B;  3C4X A;  4ISS A;  3NRY A;  4B6X A;  2WY2 A;  4X1I E;  4HFV A;  1HF8 A;  3UUL A;  4DUZ T;  1NEK A;  3C4Z A;  2ZM0 A;  3FZH B;  4ILC A;  2Y6X A;  4FJO A;  4ILU A;  1OED B;  4ZEY A;  3UFG A;  4A5X A;  2IIU A;  2E5V A;  3T1H T;  4LFB T;  3I9Y A;  3KDS E;  2Q9Q D;  2WMO A;  3AA0 B;  3AXJ B;  3KVA A;  4UV9 B;  2EHO A;  3RIA A;  4LMJ A;  3RHW A;  4BJN A;  2GK9 A;  5JDL A;  2X0H A;  5KMG P;  4XBF B;  3Q2M A;  2A3D A;  5AQV B;  4AIU A;  2FJA A;  3KVB A;  4QH5 A;  4EV6 A;  4YJ2 E;  2VK9 A;  4XZC A;  2HN1 A;  3LK2 B;  1UCU A;  3ETU A;  3P50 A;  3RYH E;  4A97 A;  1ZKE A;  5DJQ C;  4JUY A;  2XM2 A;  3KBT A;  3LSV A;  4PK4 A;  1N34 T;  4ZI3 C;  1LVK A;  2UXN B;  2ZM8 A;  3KV9 A;  2CM0 A;  3CX8 B;  2CXD A;  2W4X A;  3UU6 A;  2VKJ A;  2K3W A;  3ZN0 B;  4F6R C;  1KFY A;  2CE7 A;  4IE4 A;  1SHZ C;  2HPL A;  5FY7 A;  3PUW F;  4DO0 A;  3NKZ A;  5JR9 B;  2BS3 A;  2MOZ A;  1N33 T;  5AQP B;  2K48 A;  4IE7 A;  5HXR A;  4DR7 T;  2KIN B;  3N9M A;  4AQF A;  2ZMA A;  2MBG A;  2F4V T;  2X0Y A;  4QH1 A;  4UIG A;  3EUH A;  3OPC A;  3Q5D A;  4YSZ A;  4EZH A;  5J0Z A;  1HFA A;  5M4Y A;  1J5W A;  3AE3 A;  4HWC A;  3ZN1 B;  3RYC E;  4DVD A;  5EK2 A;  3EI0 A;  4DV7 T;  4DBR A;  2WWU A;  2N9D A;  3PJA A;  5AQQ B;  3N2O A;  3C64 A;  2IHR 1;  5HCJ A;  5LBQ B;  3Q5X A;  3AE5 A;  3N9O A;  3PV0 F;  3JAD A;  4JI3 T;  2JQH A;  3UU8 A;  3CML A;  4NPP A;  2NWB A;  2X51 A;  2XM1 A;  4X66 T;  4YY3 T;  4IDP A;  2LSY A;  3V5S A;  3GWH A;  4WBO A;  5HEG A;  3N9P A;  3ZKR A;  4HFD A;  4ZI2 C;  4EGW A;  4JLE A;  2IC9 A;  3CPZ A;  3OKQ A;  3N9N A;  3OJA A;  1IBK T;  4ADZ A;  2X9W A;  3FXD B;  4O4L E;  5HEU A;  3ZC0 A;  2ACZ A;  4IL4 A;  2VKH A;  5LMU T;  1UK5 A;  2WP9 A;  1X9B A;  4YLH A;  2G0U A;  4DV4 T;  2WU2 A;  4NIQ A;  4LF9 T;  3LK3 B;  5JR9 A;  2UXD T;  4EIW A;  2IUB A;  3GMI A;  4GYR A;  4LF6 T;  3I9W A;  4MFR A;  2AXD S;  2ODV A;  2DNX A;  3GN5 A;  3AEA A;  2XAH B;  5BR8 T;  4HFI A;  3G06 A;  3UQ7 A;  3KIN B;  3PUS A;  3EAB A;  5DAB A;  3U3I A;  1S35 A;  2UUC T;  4A98 A;  2A2F X;  2VVN A;  2MAW A;  4GK0 E;  1JNZ A;  1NAF A;  4IDZ A;  5JQG E;  1KNZ A;  4U72 A;  2QVA A;  5C3J A;  1XNQ T;  5LNK A;  3FBZ A;  5AQL B;  2NTX A;  3T1Y T;  4X1Y E;  4B3T T;  1YQ4 A;  2H3R A;  2WDV A;  3AAE B;  3ZJ2 A;  3PUZ F;  3KFW X;  4E7Z A;  2A9U A;  4WNK A;  2RP4 A;  4ZI2 D;  2BKO A;  3RYF E;  4DND A;  1HCI A;  4UXN B;  1GQE A;  3IF8 B;  3RF1 A;  3ZCJ A;  3NRX A;  2ZM2 A;  1BR0 A;  2W00 A;  5LBM A;  1Y01 A;  3TLS A;  1VCT A;  3SFE A;  3V5U A;  2MTQ A;  5L3E B;  3H3M A;  3QK6 A;  2E5L T;  3PU8 A;  4UR9 A;  2XUE A;  1MIW A;  4H63 H;  4U2Z A;  4CN1 A;  4LF8 T;  4U74 A;  3RLF F;  4H9S E;  3VHL A;  4AKI A;  1M7K A;  3RRC A;  2EHO D;  3FZK B;  3CX7 B;  4O8S A;  4OYJ A;  3LG7 A;  3CQX C;  4Z90 A;  2VAS A;  5KDM C;  5AQO B;  3RKO A;  3GN5 B;  4CI2 B;  1HTJ F;  2V7K A;  5E0O A;  1KK7 A;  2YU2 A;  5L3G B;  1HNX T;  2X68 A;  3L3P A;  4H9Q C;  3VRB A;  3O9X A;  3OVU A;  5J2T E;  3CQG B;  1HR0 T;  3CKD A;  3FB2 A;  2QRX A;  2RA1 A;  3C51 A;  3O1H A;  3PUR A;  2LOS A;  5LHG B;  2CLY B;  5A1L A;  5KXJ A;  3VKH A;  2YDR A;  5AQM B;  5FY0 A;  2YKS A;  4CXW A;  4J2C A;  3O1J A;  4B3S T;  3CX6 B;  1BR2 A;  2C5I T;  1KF6 A;  2XAS B;  2OA5 A;  4PAG A;  4WZX A;  4X20 E;  4CI3 B;  3KV5 A;  4MLK A;  2CXL A;  2LSJ A;  3HA4 A;  5JDQ A;  4LF7 T;  4U3C A;  2NR4 A;  3N2G E;  4UF0 A;  3PUY F;  3RX6 A;  3UFE A;  4IDQ A;  3AVS A;  4X65 T;  3ZMU B;  1HX8 A;  3HKE E;  3LDQ B;  1G8X A;  4HE8 A;  5IUX A;  5LCY A;  4JI5 T;  2VKD A;  4ZZB A;  3I0O A;  4GK5 E;  2HHH T;  2BBJ A;  5FMN A;  4AQF C;  3OYZ A;  4AKR B;  2QGS A;  2R6G F;  5J2U E;  2CEA A;  2JQQ A;  3AEF A;  3PUV F;  3S4U A;  5ABH A;  5LXT E;  1W09 A;  2CCQ A;  2KXP B;  3AE7 A;  3ONJ A;  4X5T A;  1IJ5 A;  4X1K E;  3UU5 A;  4EED A;  2N2N A;  3RQW A;  1FEW A;  5JDM A;  1M62 A;  4U7I A;  4JEH B;  2BS4 A;  3P4P A;  4EOZ B;  2V7I A;  3AVR A;  3BQI A;  2FUP A;  2VWA A;  2BZB A;  3PUX F;  3PUQ A;  4PNI A;  2N1G A;  3E22 E;  4H9N C;  3HKD E;  3P4W A;  3UT5 E;  3PTR B;  2WU5 A;  3AA7 B;  4OK0 A;  4ZHQ E;  1UX4 A;  5LG4 A;  5F8P A;  2CBJ A;  1ZEE A;  2IML A;  2D5U A;  2YDQ A;  2XAG B;  2E9X B;  4G63 A;  2BS2 A;  4HFB A;  4ILA A;  4JI6 T;  2BVL A;  1YKH B;  3AEG A;  4IE6 A;  4B3M T;  1IAP A;  1O3X A;  2ACX A;  2VQF T;  2D0U A;  1I94 T;  4ZXL A;  5AQT B;  3K3N A;  2WSS V;  4TX5 A;  3ZYM A;  3RIU C;  3FBL A;  3P7I A;  3UQ4 A;  1HG5 A;  3ZCI A;  2YU1 A;  4TV8 E;  4IE0 A;  3ONX A;  5JDG A;  3N9Q A;  3M65 A;  5CJ5 A;  4O2B E;  3I0Q A;  2V7L A;  3K8P C;  4IL9 A;  5HXC A;  2BDE A;  2VVS A;  2XAQ B;  3ABV A;  3F57 A;  3P4S A;  4BAY B;  4U2Y A;  2RPA A;  4EZ4 A;  5FNV E;  2K5B B;  2H89 A;  2D2S A;  3QNU A;  2E9X C;  4HWI B;  2EHO C;  3L39 A;  4IIJ E;  5FYM A;  5FVK A;  3ZSS A;  5IWA T;  1XWM A;  2KWI B;  4QXB B;  4C91 A;  4EYY R;  1OED C;  5LMN T;  2WB5 A;  3TLU A;  4DR5 T;  3M3Z B;  5ABG A;  2CWO A;  1T7S A;  1YD8 G;  4WBN E;  5L47 A;  3WAJ A;  5H6Q B;  4ZI7 E;  4EAH A;  2KLQ A;  3AE8 A;  2CPT A;  1US7 B;  1D1B A;  5FL0 A;  4CI1 B;  4PJJ A;  1UUS A;  2V6X A;  2V7M A;  4OYK A;  2NW9 A;  4DMW A;  2XQ4 A;  1D0Y A;  3AE9 A;  2JRK A;  3C98 B;  3N5L A;  1WR0 A;  4K0K T;  3L8R A;  3QOF A;  4UVA B;  4P09 A;  4NXM T;  3F2E A;  3IBP A;  5CB4 E;  2ZM6 T;  3UUB A;  2W63 A;  3E0Z A;  1E2A A;  2JIW A;  2LSG A;  1UUR A;  4IST A;  4K0U A;  5ABF B;  2VKO A;  2CBI A;  1WR6 A;  3TLV A;  4TWF A;  2YEV C;  2X9H A;  2E2A A;  3LJC A;  2PBI A;  4IT4 A;  2XQ7 A;  2YOE A;  2P9B A;  2LHN A;  2X9X A;  3AEE A;  3VR8 A;  4P1N A;  5EZY E;  2FJB A;  4LML A;  2JPF A;  3SOL A;  4EXT A;  2J4G A;  1D1A A;  2LRL A;  3E08 A;  4PFP A;  1WYC A;  3A7M A;  2DI4 A;  3RYI E;  3FZM B;  5LGT B;  3MAC A;  2DL1 A;  2E9X D;  2BG9 C;  3UU4 A;  1WYB A;  3UUN A;  5AQJ B;  4NUV A;  5JVD E;  4YSY A;  3NBX X;  1ZHC A;  1IBM T;  3ZST A;  1EZ3 A;  1B7T A;  2I6H A;  2KMF A;  4AI6 A;  3VKG A;  4CQI A;  3NWI A;  2JMH A;  2X67 A;  5LA6 E;  5LJN A;  3FZL B;  2LSK A;  3AE2 A;  3DTO A;  1NEN A;  2WZH A;  4MBQ A;  2IW5 B;  3ZT7 A;  3PJA J;  2KND A;  1UX5 A;  1WLX A;  3B57 A;  2XZE A;  4JI8 T;  1D1C A;  2CXF A;  2X9Y A;  3HL6 A;  3R6N A;  4AKL A;  5HXE A;  4DUY T;  4LFC T;  3D0T A;  4UVC B;  4PW8 A;  2DWK A;  1XDO A;  1KEY A;  1HX1 B;  1SE7 A;  2DCF A;  2LJL A;  5LHI B;  4DR4 T;  3DP7 A;  5AQS B;  2WMN A;  2WM9 A;  3NVO A;  5ABF A;  1HS7 A;  1V9D A;  5EK3 A;  2IDO B;  3K3Q C;  4HFE A;  4I50 E;  3HR0 A;  5FL1 A;  4L9I A;  4OX9 T;  4AKG A;  4GKK T;  3P4Q A;  3JC6 C;  2JQ9 A;  2C5J A;  1VRB A;  2LKG A;  3B5M A;  2J62 A;  3GA8 A;  1QUU A;  3H3A A;  1SA0 E;  2I0M A;  4HEA A;  4ZS3 A;  5JRE A;  2WWV A;  4ANJ A;  1Y64 B;  3B13 A;  4KMC A;  2BKN A;  4PJL A;  2XTL A;  2HH7 A;  3ZMV B;  5F3J A;  5L4H A;  1W0A A;  2XSA A;  3CK6 A;  5HWY A;  3CIR A;  5CA1 E;  4P0B A;  5HWX A;  4ZS2 A;  3VU7 H;  1XZY A;  3CWZ B;  4C90 A;  2NOX A;  2LSI A;  2D9D A;  3DJB A;  5CA0 E;  3AED A;  1XMQ T;  4PK6 A;  5AQR B;  4O4J E;  2ZLY A;  3SWH A;  3MKD A;  3RI5 A;  1OXZ A;  5JTG A;  2W62 A;  2WDQ A;  4Z8X A;  4IDN A;  5ETW A;  2JMK A;  4AQG A;  2VL8 A;  2NP9 A;  5C2T A;  4MHC A;  4DV2 T;  1OED E;  5HXS A;  1ZOY A;  2Z6E A;  2V5C A;  3WAK A;  2BKP A;  2IC6 A;  1KNP A;  4NUU A;  2XQ5 A;  3A5X A;  1LVF A;  1ZP0 A;  4IGU A;  2KT9 A;  2Y48 B;  2LM2 A;  4YT0 A;  3RQU A;  4TNW A;  2XSB A;  2W66 A;  4M1P A;  2PFV A;  1U4Q A;  3AA1 B;  2CLY C;  4A56 A;  3TLW A;  2WCA A;  4CN4 A;  4DBQ A;  4ZOL E;  5KX5 E;  4I4T E;  4OFZ A;  3BQK A;  2AE9 A;  2XAF B;  3C4W A;  3K1S A;  4H9O C;  2L9Q A;  3QB5 A;  2V6Y B;  1ZV4 X;  5FP3 A;  4GKJ T;  2VUR A;  1VOM A;  2M6B A;  1MND A;  2KSR A;  3JAF A;  3QC9 A;  3A8Y C;  3MZK B;  4EYU A;  3JCF A;  5BMV E;  1E7P A;  4DV0 T;  1BR1 A;  2CHO A;  4OHF A;  2X66 A;  5JDN A;  4KUM B;  4YXD A;  4B3R T;  2W0G A;  4AQY T;  3NZP A;  3X1D A;  1H7C A;  4XAX B;  2ODU A;  2V26 A;  3PDY A;  2WS3 A;  5FY1 A;  5LGN B;  3LFM A;  1KNR A;  4Z91 A;  3ZJ1 A;  3AAI A;  5JR9 C;  3AE6 A;  4QX7 B;  3AEC A;  1IBL T;  3VRA A;  4DR3 T;  5HEH A;  4PFO A;  4WW0 A;  3AXJ A;  3NZQ A;  5F5W A;  5FXW A;  3J9X 1;  2EHO B;  4HWD A;  3OTO T;  2K24 A;  3ESL A;  2UUA T;  4V1A v;  4JI4 T;  2FJD A;  4X64 T;  1I6Z A;  4IDO A;  2PJQ A;  4Q25 A;  2XQ6 A;  4UEM A;  2M6I A;  2W67 A;  3UU3 A;  1YQ3 A;  2MYS A;  5HAX A;  4JYA T;  5HYA A;  2PG8 A;  4I0U A;  3F31 A;  4KP3 C;  3T8O A;  1HG2 A;  3VR9 A;  5IHY A;  3L09 A;  2C0S A;  1T98 A;  1FJG T;  4AKH A;  5HCM A;  3PUA A;  4JI7 T;  5LJM A;  1DU2 A;  4DR1 T;  2IAK A;  1S94 A;  2B76 A;  1R8I A;  4QHO A;  2V1D B;  4UEL A;  2L3L A;  1VCS A;  2H88 A;  2VL0 A;  2YIN A;  2QA7 A;  3CQC B;  5L2L A;  3ZPO A;  2J47 A;  4QKN A;  1T72 A;  2LLY A;  2XAJ B;  5IYZ E;  5HXH A;  5ADX L;  2J1D G;  5DQW A;  2Q9Q B;  2W61 A;  3OBV E;  4QXH B;  3RPU A;  3QB5 K;  1MMA A;  4UVB B;  5L3C B;  2UUB T;  1YKE B;  5FXX A;  4GYS A;  3CVR A;  2LE8 A;  4HFH A;  4YTN A;  2NW7 A;  2M67 A;  2HPJ A;  2CA5 A;  4UV8 B;  3SRZ A;  3RC3 A;  4CXX A;  2H7O A;  2BG9 B;  2XQY A;  2PTF A;  3SFD A;  3UUM A;  2V5D A;  3ETV A;  4JI2 T;  4N78 D;  1YW0 A;  1HNW T;  5LB7 B;  3TLT A;  2D0T A;  5AQF B;  4LF4 T;  4JV5 T;  3ZMT B;  2LKH A;  2LOP A;  1E1H B;  1MIY A;  2DLR A;  2WZI A;  2DHR A;  2SPC A;  5AQG B;  3R84 B;  4F8H A;  2A72 A;  4FI5 A;  1BR4 A;  3RIF A;  5L3B B;  3RKG A;  2KWH A;  1W9R A;  3Q9D A;  3ZLI A;  5J1G A;  5AFU L;  2WQY A;  3EAM A;  4TWH A;  3KV4 A;  4KHZ F;  3Q5W A;  4DV5 T;  2LT3 A;  3RGL A;  4DMV A;  4IE5 A;  2XQA A;  4CN6 A;  1Z0P A;  1JNR A;  4WYV A;  3P4R A;  2XHE B;  4X62 T;  5JDH A;  1L0V A;  5L4E A;  2HN2 A;  5AQI B;  4P0A A;  4KBM B;  5ABE A;  3C50 A;  2Q9Q A;  4LMK A;  4ASK A;  1U5P A;  5LG3 A;  3ZYL A;  4TNV A;  2UXX B;  3AE4 A;  2I59 A;  2VB6 A;  4TV9 E;  3RIU A;  3AEB A;  4EB6 E;  3ZEF B;  3KBU A;  4ERR A;  3UUX B;  1WFD A;  1MIV A;  3K3O A;  4KHP T;  2CRB A;  1MMG A;  2BG9 A;  4L0R A;  4O4I E;  2QYW A;  3U78 A;  4YHJ A;  2XQ9 A;  3N2K E;  4YTM A;  4JI1 T;  4DID B;  1OWA A;  5FKY A;  2BVM A;  4I55 E;  2LHR A;  3ZT5 A;  2H7V C;  5HEO A;  4COF A;  3H37 A;  5JRC A;  4GIW A;  3AA6 B;  3AB3 B;  2Q9Q C;  4L5G A;  4O2A E;  4U31 A;  5LP6 E;  2ES0 A;  4HWH A;  3LBX B;  3IEE A;  2VQE T;  4ZZC A;  4CZZ B;  2WAU A;  3ZMS B;  5LGU B;  4JEU B;  3ZYK A;  3ZT6 A;  3W15 B;  4YTP A;  4DV1 T;  3HKC E;  2LM9 A;  3PUG A;  1J5E T;  2CWY A;  2UU9 T;  2UXB T;  1WCR A;  4PJM A;  2L8K A;  5L3F B;  1XDP A;  3IA3 A;  1MMN A;  1LRZ A;  1T8B A;  3FZF B;  1CHU A;  2CMR A;  3EDU A;  3Q5E A;  1QLB A;  3I1A A;  4HN9 A;  4TWD A;  4AXP A;  3O4X E;  5CFB A;  3ANW A;  4QX8 B;  2B1E A;  3P8C D;  4GOU A;  2DWG A;  4PK5 A;  2E8I A;  2BBH A;  3ZC1 A;  4YHH T;  1G73 A;  5FXZ A;  2OV9 A;  5LYJ E;  5AQK B;  4JBW F;  1SUM B;  4LF5 T;  2XQ8 A;  3OYX A;  1XNR T;  5LHH B;  2C5K T;  3EVY A;  3FHN A;  4DV6 T;  2YDS A;  1FMW A;  4YJ3 E;  2JQK A;  4IRE A;  5EK4 A;  4G2A A;  1QSD A;  5JRC B;  4IHJ E;  4ILB A;  3AAA B;  1W0B A;  2V7J A;  1MMD A;  4O4H E;  2NW8 A;  4UF0 B;  1D0Z A;  5GON E;  3BK9 A;  2K9A A;  4TN7 B;  4HGA A;  1MNE A;  3MJX A;  3LBX A;  3WI3 A;  4U7Y A;  5HEJ A;  2Y8D A;  1FIO A;  3HKB E;  5TAO A;  1X79 A;  3TKL B;  2FBW A;  4PJN A;  4QH4 A;  2JJ9 A;  3MK7 C;  4TZ4 C;  4YSX A;  1N36 T;  4KX6 A;  2XJ7 A;  1D0X A;  4ZI3 D;  1Z8U A;  3O1I A;  4HTE A;  3JAE A;  3RRW A;  4H9R C;  5H6R B;  5FVL A;  2YK0 A;  4HWF A;  5AQH B;  3RH3 A;  2XY8 B;  3J7Y q;  4QXC B;  4U33 A;  3ANW B;  4H63 V;  1N32 T;  1IJ6 A;  3AE1 A;  1WRD A;  4TUY E;  5JDF A;  4EEB A;  4E7S A;  4NXN T;  1AJ3 A;  2NTY A;  1HNZ T;  3PU3 A;  5AQU B;  1FMV A;  3ONL C;  3JC6 D;  3RC8 A;  2CHN A;  4HFC A;  4JI0 T;  1OED A;  1J1J A;  3LK4 2;  2V8S V;  3IHR A;  4CXY A;  4DV3 T;  2OLT A;  5AQN B;  2E9X A;  5DQV A;  1IZN B;  2WDR A;  2YN6 A;  4H9P C;  4KI0 F;  4BJM A;  2XQ3 A;  2XPK A;  5C8Y E;  2BG9 E;  4YFS A;  4BA9 A;  5JH7 E;  5FXV A;  2MPK A;  4AIS A;  2LRK A;  5L3D B;  1YXR A;  3MA9 A;  3FXE B;  4MAL A;  3UTK A;  3PE0 A;  2UXC T;  2X0L B;  5CGM A;  2LEH A;  3BQL A;  3EHZ A;  4LFA T;  2KZ7 B;  1XMO T;  2FJE A;  3N9L A;  3KV6 A;  1LKX A;  3MXZ A;  3HI2 A;  3QUJ A;  1CUN A; 
#chains in the Genus database with same CATH homology
 2XZE A;  5LB7 B;  2V6Y A;  4U33 A;  2CRB A;  2W2U A;  5CJ5 A;  4U7I A;  2A9U A;  4U2Y A;  2RPA A;  3ZT5 A;  4IT4 A;  2K3W A;  2WY2 A;  4U31 A;  3ZSS A;  4WZX A;  2JQK A;  4P1N A;  5FVK A;  2LRL A;  4U3C A;  4CN6 A;  2DL1 A;  4NIQ A;  2JQ9 A;  3ZT6 A;  4U7Y A;  4ZEY A;  4U2Z A;  4A5X A;  4CN1 A;  2WWV A;  1WCR A;  3ZST A;  2MPK A;  4CN4 A;  2LRK A;  1YXR A;  2CPT A;  5CGM A;  2V6X A;  3K1S A;  3EAB A;  2JQH A;  1WR0 A;  5FVL A;  3ZT7 A;  2V6Y B;  1WFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...