2V6YB

Structure of the mit domain from a s. solfataricus vps4-like atpase
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
74
structure length
72
Chain Sequence
SAQVMLEDMARKYAILAVKADKEGDDAITYYKKAIEVLSQIIVLYPESVARTAYEQMINEYKKRISYLEKVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords AAA FAMILY ATPASE, P60 KATANIN
publication title Structural Basis for Selective Recognition of Escrt-III by the Aaa ATPase Vps4
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 31
structure length 72
sequence length 74
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2007-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2v6yB00
1YXRA 4U2YA 3ZSSA 2K3WA 2CRBA 3K1SA 5FVKA 4ZEYA 2W2UA 4CN1A 5CJ5A 4U7IA 3ZT7A 2LRKA 2JQ9A 3ZT5A 2JQKA 5CGMA 4CN6A 4U2ZA 2MPKA 2JQHA 2WY2A 4U3CA 2WWVA 2RPAA 2V6YB 4P1NA 2V6YA 4U31A 5FVLA 2XZEA 5LB7B 2A9UA 4CN4A 2DL1A 4NIQA 4A5XA 1WCRA 2CPTA 3ZT6A 1WR0A 2LRLA 2V6XA 3EABA 4IT4A 4U33A 4U7YA 1WFDA 3ZSTA 4WZXA
chains in the Genus database with same CATH superfamily
1MMDA 2HPLA 3UQ4A 4OFZA 2E9XB 4KBMB 4ERRA 2C5KT 2RP4A 3ZT5A 2BVMA 5J0ZA 3U3IA 5CGMA 3N2OA 3RC8A 5LHHB 2WMNA 4DV1T 3P4QA 4F8HA 1Y01A 4I55E 4EIWA 1YW0A 3ZYMA 2WQYA 2ES0A 2W00A 4HTEA 3H3AA 4U2ZA 3CQCB 4E7SA 2NOXA 3VR8A 3J9X1 2WU2A 2JRKA 2Z6EA 2N9DA 1LVFA 4I4TE 2ODUA 5AQSB 2LT3A 2KMFA 2DHRA 3AE2A 4HWHA 4N78D 4JI3T 4XZCA 5L3BB 4IHJE 5BMVE 3AE9A 2JQ9A 4JYAT 3HA4A 2B76A 4LF8T 1AJ3A 2LEHA 5HEUA 3RX6A 2E8IA 2IMLA 2QA7A 5HEJA 3UFGA 5TAOA 1WLXA 4U72A 4JEUB 5FYMA 1BR4A 3JC6D 3FZKB 4C91A 2LM2A 4AQFC 4YTPA 1NAFA 4L0RA 4ZI3D 5LGUB 3CX7B 1MMNA 2UXCT 3UUBA 2EHOA 4MHCA 3ZSTA 2BS2A 3N5LA 4ILBA 4YY3T 1V9DA 3JAEA 3LK2B 4JUYA 3EAMA 5AQLB 5C2TA 3NWIA 2BG9B 2H88A 5HEHA 4EYYR 4BA9A 5AQHB 4DV3T 3ETVA 4CZZB 3SS1A 3P8CD 2Y48B 3V5SA 2LM9A 3RC3A 1T98A 1CUNA 2D2SA 4HE8A 2CMRA 2CLYB 2C5JA 2I6HA 2MBGA 3SFDA 4CQIA 2UXBT 3JADA 1HG2A 2PBIA 3ZN1B 5AQUB 3RIFA 1G8XA 2X0YA 4LF7T 4FJOA 2VQET 3UU6A 4OX9T 5JDMA 4EOZB 2MTQA 3K1SA 3M65A 5LOVE 3CQGB 1HX1B 3N9NA 5DABA 5LG4A 4K0KT 2VVSA 3VKHA 4O2AE 3LSVA 3HKDE 2XQ3A 1L0VA 2XAQB 2V7IA 1HNXT 4ZHQE 2ZM6T 2IAKA 2I0MA 2Q9QA 5FKYA 4Z90A 3EUHA 2W0GA 2K9AA 3LK3B 5FL0A 2NWBA 1WYCA 4O4IE 2VB6A 2WM9A 2WY2A 2RPAA 4DNDA 3C51A 2H7VC 3M3ZB 2V8SV 4UVCB 2CWYA 4ADZA 1N32T 4IDZA 3B13A 2BKOA 4KMCA 5JR9C 4DUYT 5AQKB 5FP3A 4AQGA 4XAXB 3L8RA 3AEAA 2YDQA 1OEDC 4ISTA 3HKCE 5AQOB 3TLWA 3VKGA 2I59A 3KV4A 4BAYB 4PJJA 5HEGA 2W63A 3LJCA 4TWFA 1MIWA 5HXSA 2AE9A 3MJXA 1XNRT 4AI6A 3ZEFB 3H37A 2UUBT 2A3DA 2NW8A 3KV5A 5C8YE 2F4VT 3JAFA 2B1EA 1VCSA 1ZV4X 3KDSE 1MNEA 4OYKA 2WB5A 5L2LA 1YD8G 3W15B 2KWHA 4EEBA 2YOEA 3RQUA 2KLQA 3E0ZA 3Q5WA 2NTXA 2XM2A 2W2UA 2LSGA 1KF6A 3CWZB 5LB7B 4X66T 4DR6T 1MMGA 1SE7A 5LP6E 3L09A 5ETWA 4HWDA 4NUUA 2PTFA 2VKOA 3LK42 2VL0A 3JC6C 4DR2T 1DU2A 1D0XA 2XPKA 1HS7A 3ETUA 2JMKA 2A9UA 2DL1A 5AQMB 4EV6A 2X67A 3QB5K 3E22E 4DV5T 3LBXB 3FZHB 3N9QA 3U78A 2VL8A 2XY8B 5LGTB 3HL6A 4GK0E 5CJ5A 2X0HA 5A1LA 5LGNB 3EVYA 3JCFA 2V7MA 1IBMT 4O4LE 4JEHB 3I0QA 5FY1A 4YSZA 1T7SA 4JLEA 2ACZA 1XMOT 5AQRB 2CXFA 4K0UA 4TZ4C 5LA6E 1E2AA 4P1NA 2IC6A 2NP9A 4GYSA 3I9WA 4UV8B 4H63H 1W0AA 4QH1A 2PJQA 3PU8A 3MXZA 4TNVA 2HN2A 3ZN0B 5H6RB 2EHOC 3O4XE 4CI2B 5FNVE 4DUZT 1YQ4A 2CWOA 5ABGA 2BS4A 3MACA 4HWFA 3RIUA 1SA0E 4NUVA 3NRXA 4H9RC 2X9HA 3GN5A 4IGUA 2PFVA 3S4UA 1UX5A 3AA6B 4Z91A 3AE1A 2H89A 2LHNA 4V1Av 3KBTA 2XUEA 2A72A 3AECA 2LKHA 2CM0A 4PAGA 3BQKA 4HWIB 4PFOA 3AXJA 2KWIB 4DBQA 5JDHA 1Y64B 4QWNB 4IE7A 4X5TA 5LHIB 2NW9A 1LVKA 5AQIB 1BR0A 1XDOA 4UR9A 1HR0T 3D0TA 3KBUA 1X79A 2CCQA 4HFIA 1E1HB 2Q9QC 3L3PA 2QVAA 5FMNA 3C50A 2R6GF 4QXHB 2CEAA 4ZS3A 1YQ3A 5HXEA 5L4EA 5KX5E 1HTJF 4ZZCA 1D1AA 3ZCJA 2X66A 2CRBA 2KZ7B 3KVAA 3FXDB 4U7IA 4ZI2D 5AQGB 2ZLYA 5LYJE 4DV4T 3N2GE 1J1JA 5CA0E 4LFBT 5L3DB 2WWUA 3TLTA 3ANWB 1HCIA 4TWHA 2XQ6A 4A5XA 4PJNA 4ILAA 1SUMB 3OJAA 3RGLA 4HFHA 4A98A 4LF6T 3CKDA 2J4GA 1W9RA 2JQQA 1OEDB 4B6XA 4X62T 4PFPA 5L47A 2XM1A 2LE8A 3VRBA 2K48A 2GK9A 2E9XD 3IBPA 5DQWA 3NRYA 1ZHCA 4DV6T 2DCFA 4ZI7E 4YXDA 2LJLA 1D1BA 2WP9A 2XQ4A 4EYUA 1R8IA 2BS3A 2VKHA 3N9MA 3AE5A 2VKDA 3KV9A 2H7OA 2K24A 4TV8E 3AAEB 3ZYLA 3EI0A 2PG8A 1M62A 3G06A 3EHZA 3Q5EA 3OYZA 3CVRA 4JI0T 2CPTA 2D9DA 3IEEA 1WFDA 3RYFE 3ZT7A 2BG9E 2N1GA 3OBVE 3RYIE 5FVLA 4H63V 1JNZA 5FY7A 5IWAT 2ODVA 3AE4A 2WDRA 4KUMB 3AA1B 4PNIA 3PUQA 2DLRA 4ILCA 3RKOA 3PJAJ 2JQKA 3N9LA 4WNKA 4QX8B 4GIWA 4U31A 5F5WA 2MOZA 1OXZA 3OTOT 3ONLC 3NKZA 3NVOA 3PTRB 3R6NA 4PK6A 4CN6A 4YSXA 3HR0A 3AA0B 5AQNB 3CK6A 3FXEB 2X51A 3UU8A 4XBFB 1WR0A 4LFAT 1Z8UA 3Q2MA 4Q25A 4B3MT 4LF4T 2UXNB 3O1IA 3AE3A 2XQ9A 2XSAA 1NEKA 3PUGA 1M7KA 3KVBA 5CB4E 4DMWA 2KT9A 3MZKB 2W4XA 2A2FX 5JDNA 3IHRA 5FXVA 4CXXA 3ZKRA 3RIUC 4DR1T 3ONXA 4TN7B 4OK0A 1KEYA 1UURA 3ESLA 4H9QC 2H3RA 2EHOB 4PJMA 1N36T 2CXLA 4O4HE 3CPZA 1HX8A 1HG5A 2J47A 2JQHA 3PJAA 4QH4A 2X68A 4YLHA 4F6RC 4IE6A 4WW0A 4TNWA 3SFEA 3ZYKA 4EGWA 2AXDS 2V7JA 3UT5E 1U5PA 1W09A 1MNDA 5HEOA 5FXXA 4PJLA 5EK4A 3OVUA 1HF8A 4PW8A 2WMOA 3K3OA 5ADXL 3AA7B 2IW5B 4GKJT 4EZHA 3QUJA 5LMUT 4IDNA 5ABEA 3TKLB 1XNQT 4L9IA 5ABFA 2L3LA 4JI1T 2FBWA 2D0TA 3F2EA 3ONJA 1QSDA 2UU9T 3PE0A 3RQWA 1ZP0A 4YT0A 3CIRA 4HKAA 2V5DA 1QLBA 5F8PA 4MBQA 4EEDA 3VR9A 2DI4A 3PUXF 4UXNB 3K3NA 4NXNT 4LFCT 2XJ7A 5LBQB 1WCRA 4ZOLE 5EK3A 4UF0A 1MIVA 2BKPA 3PUSA 5KMGP 4QHOA 3N2KE 3C98B 3IF8B 4CN1A 2MYSA 1JNRA 2IDOB 4U74A 4H9NC 2J1DG 2FJDA 4C90A 2CHOA 4BJNA 4ZI3C 1B7TA 5JH7E 3K8PC 1Z0PA 5L3CB 4AISA 3VRAA 3T1HT 1LKXA 2G0UA 2YDRA 3C4WA 3UU3A 2VASA 1T72A 5LG3A 3NZQA 2XAJB 5HXRA 3ZPOA 1W0BA 3RH3A 4ISSA 4QXBB 3ZT6A 3C64A 2ZM0A 3LG7A 5FY0A 2YN6A 4WZXA 3LDQB 3UU5A 3ZJ1A 1XWMA 1WRDA 3DP7A 2ACXA 3AEEA 3A5XA 1VRBA 2CLYC 1NENA 4IDQA 3X1DA 3TLSA 2LOSA 3UU4A 3ZMSB 4BJMA 4CI1B 2BBJA 2XSBA 3VU7H 5JDLA 4HN9A 2WZHA 5L3FB 3BQIA 3MK7C 4FI5A 2BDEA 4KP3C 4QH5A 4DO0A 4B3TT 2C0SA 1O3XA 1J5WA 4O4JE 4Z8XA 4M1PA 4JBWF 4LMKA 2YU1A 5LNKA 2WDVA 2X0LB 5JQGE 3AE8A 2LSYA 5HYAA 1XMQT 2HH7A 2OA5A 2IC9A 4WBOA 4MLKA 3HKBE 5JDGA 1IBLT 3WI3A 3ZMZB 3O9XA 4EXTA 4H9PC 4UVAB 1U4QA 4IE5A 4NXMT 3R84B 5JRCA 3J7Yq 3AVSA 3NZPA 5C3JA 2WCAA 5J2UE 5KDMC 4AKLA 4UV9B 2X9WA 4U33A 2IHR1 5FXWA 2QYWA 3GMIA 3N9OA 4G63A 1D0ZA 2JIWA 4YTNA 3ZMVB 3ANWA 4ILUA 3EDUA 2MPKA 4I43B 3NBXX 1IJ5A 4I50E 3IA3A 1N33T 1LRZA 1ZKEA 4EZ4A 4GKKT 3PUWF 2DNXA 5LCYA 1OEDE 4OHFA 2YEVC 2KXPB 3FBZA 2Y8DA 2FJAA 2E9XA 2VVNA 3RRCA 4TV9E 5FL1A 4JI8T 4CXWA 4JI4T 4DVDA 1HNWT 2WWVA 4G2AA 3OPCA 5H6QB 4GYRA 5DQVA 4ZXLA 4AQYT 2VURA 3N9PA 3FB2A 3AXJB 3CMLA 3UULA 5GONE 5FVKA 4LMJA 2HHHT 3AE6A 2JPFA 2WZIA 5J1GA 4LMLA 5JR9B 4QX7B 4IIJE 2LRLA 3PUAA 3P4WA 1MIYA 3SRZA 4X20E 2YINA 2WAUA 3RIAA 3T8OA 3GA8A 2UUCT 2ZM8A 1S94A 4IDPA 4DV0T 5LHGB 5LJNA 2V7KA 2V6YB 2XZEA 1FJGT 4B3RT 1FEWA 2XQAA 2XAFB 1J5ET 4U7YA 4JI6T 2FJEA 3T1YT 1IJ6A 2LLYA 2KSRA 3RHWA 4YSYA 4EAHA 4ZZBA 4LF5T 4QKNA 4E7ZA 4X65T 1EZ3A 3RI5A 3VHLA 3AE7A 1UK5A 4X1YE 2K5BB 2OLTA 2L9QA 3UFEA 4IREA 4IE0A 2XQYA 1YKEB 3HKEE 5EK2A 2BG9A 3WAJA 2NR4A 1BR2A 2JJ9A 4IT4A 1KNRA 4IE4A 4COFA 2NTYA 2C5IT 4PK5A 3PV0F 5AQTB 4UEMA 3BK9A 3O1JA 4HFEA 1MMAA 1KNPA 4J2CA 2SPCA 1ZOYA 3RLFF 5HXHA 1D1CA 2CBIA 2Y6XA 1UX4A 2X9XA 1G73A 1YKHB 1FMWA 2YK0A 5EZYE 2WS3A 2P9BA 4YHJA 5HWYA 2XHEB 2V26A 2W62A 3OYXA 1VOMA 1XDPA 3RPUA 2CHNA 2XAHB 1X9BA 2UUAT 2QRXA 3Q5DA 1UCUA 3V5UA 1HFAA 1US7B 5LBMA 3MKDA 3ZCIA 3AEFA 3AEDA 3KFWX 3SWHA 2M67A 4UVBB 4MALA 5AQJB 4YFSA 1FIOA 4HFDA 4QXCB 3I0OA 3BQLA 1I6ZA 3PDYA 3CQXC 4U3CA 4AIUA 4AXPA 1OWAA 3F57A 3A8YC 3FZFB 1CHUA 4P0AA 1KNZA 4KHZF 2E2AA 4IL9A 2EHOD 3Q9DA 3QOFA 2UXXB 3AB3B 1FMVA 1KK7A 4ZI2C 2XQ7A 4H9OC 4NIQA 4IDOA 4AKRB 4HWCA 2XQ5A 4JV5T 5FXZA 5L3EB 5L3GB 5ABHA 1E7PA 2LKGA 2XAGB 1WR6A 3DJBA 1BR1A 2YDSA 3B5MA 2KINB 2D5UA 2WDQA 2OV9A 2QGSA 2V6XA 4JI2T 3AVRA 3CX8B 4HFCA 3FHNA 3PUZF 5E0OA 1H7CA 3TLUA 3ABVA 2LSKA 3K3QC 2E9XC 1ZEEA 3QNUA 3CX6B 4H9SE 3RF1A 2W66A 2Q9QB 4AKGA 4DMVA 2Q9QD 3GWHA 4DV2T 4GK5E 4ASKA 2BKNA 4JI5T 5CA1E 4JI7T 3OKQA 5IYZE 2LSJA 4KHPT 2LHRA 4CN4A 5HXCA 3LBXA 2VQFT 3ZC0A 4LF9T 3UQ7A 2KNDA 2CBJA 1UUSA 3AAIA 3UTKA 3HI2A 4AKIA 4GOUA 3H3MA 3UUXB 4TX5A 3P7IA 5IUXA 5AQVB 5HCJA 5HWXA 2DWKA 2MAWA 3F31A 3AAAB 4CXYA 4PK4A 3C4XA 2FJBA 2YU2A 1GQEA 5JVDE 1XZYA 3QK6A 5ABFB 4X64T 3MA9A 2FUPA 5M4YA 3P4PA 3A7MA 4YJ3E 2VK9A 3KV6A 5AQQB 2LRKA 3PURA 2L8KA 3QC9A 3UUMA 5JDQA 4UELA 4P0BA 3Q5XA 4YHHT 3FZLB 3RYHE 4DR4T 4TUYE 2LOPA 5KXJA 3RKGA 2BG9C 1IBKT 5JDFA 4AQFA 3PUYF 2K3WA 5HAXA 2V7LA 5LXTE 3KINB 4DR3T 2J62A 4DR7T 5AQFB 4KX6A 1UGOA 3ZLIA 4UF0B 2BBHA 2UXDT 3B57A 3I9YA 2ZM2A 3DTOA 4WBNE 4DIDB 3AEBA 3UUNA 5JTGA 4OYJA 2E5VA 2D0UA 4DR5T 2VKJA 3P4RA 2W61A 2WBLA 4O2BE 3C4ZA 4I0UA 2M6BA 3EDVA 2IUBA 2BVLA 2RA1A 4MFRA 3ZC1A 5J2TE 3FZMB 1IZNB 2W67A 2HN1A 2X9YA 2XQ8A 3O1HA 2NW7A 2CXDA 2M6IA 3QB5A 2YKSA 3AEGA 3ZJ2A 1D0YA 1N34T 1SHZC 1YXRA 3TLVA 4P09A 3ZMTB 4L5GA 4UIGA 2XASB 4HGAA 4HFBA 2CA5A 4A56A 2V5CA 5L4HA 1KFYA 4HEAA 2HPJA 4KI0F 3PUVF 2JMHA 5LMNT 1IAPA 4X1KE 3LFMA 4TWDA 5IHYA 1HNZT 4B3ST 2E5LT 5JR9A 4IL4A 5AQPB 3PU3A 4AKHA 4NPPA 1OEDA 3SOLA 4YTMA 2BZBA 3GN5B 4EB6E 1WYBA 2LSIA 1T8BA 2V6YA 2WU5A 2ZMAA 5JREA 2DWGA 4X1IE 2XTLA 5JRCB 2N2NA 4A97A 4U2YA 3RYCE 3I1AA 3L39A 4HFVA 2CE7A 2IIUA 2V1DB 5HCMA 4DBRA 4DV7T 1VCTA 3E08A 3P50A 3ZMUB 5AFUL 3EABA 2VWAA 3WAKA 1QUUA 5LJMA 3RRWA 4ZS2A 3ZSSA 1NWMX 3FBLA 4ZEYA 4O8SA 1S35A 5F3JA 4YJ2E 1I94T 4WYVA 4ANJA 5CFBA 3P4SA 5DJQC 4CI3B 5BR8T 2WSSV
chains in the Genus database with same CATH topology
1YXRA 4U2YA 3ZSSA 2K3WA 2CRBA 3K1SA 5FVKA 4ZEYA 2W2UA 4CN1A 5CJ5A 4U7IA 3ZT7A 2LRKA 2JQ9A 3ZT5A 2JQKA 5CGMA 4CN6A 4U2ZA 2MPKA 2JQHA 2WY2A 4U3CA 2WWVA 2RPAA 2V6YB 4P1NA 2V6YA 4U31A 5FVLA 2XZEA 5LB7B 2A9UA 4CN4A 2DL1A 4NIQA 4A5XA 1WCRA 2CPTA 3ZT6A 1WR0A 2LRLA 2V6XA 3EABA 4IT4A 4U33A 4U7YA 1WFDA 3ZSTA 4WZXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YXR A;  4U2Y A;  3ZSS A;  2K3W A;  2CRB A;  3K1S A;  5FVK A;  4ZEY A;  2W2U A;  4CN1 A;  5CJ5 A;  4U7I A;  3ZT7 A;  2LRK A;  2JQ9 A;  3ZT5 A;  2JQK A;  5CGM A;  4CN6 A;  4U2Z A;  2MPK A;  2JQH A;  2WY2 A;  4U3C A;  2WWV A;  2RPA A;  2V6Y B;  4P1N A;  2V6Y A;  4U31 A;  5FVL A;  2XZE A;  5LB7 B;  2A9U A;  4CN4 A;  2DL1 A;  4NIQ A;  4A5X A;  1WCR A;  2CPT A;  3ZT6 A;  1WR0 A;  2LRL A;  2V6X A;  3EAB A;  4IT4 A;  4U33 A;  4U7Y A;  1WFD A;  3ZST A;  4WZX A; 
#chains in the Genus database with same CATH topology
 1MMD A;  2HPL A;  3UQ4 A;  4OFZ A;  2E9X B;  4KBM B;  4ERR A;  2C5K T;  2RP4 A;  3ZT5 A;  2BVM A;  5J0Z A;  3U3I A;  5CGM A;  3N2O A;  3RC8 A;  5LHH B;  2WMN A;  4DV1 T;  3P4Q A;  4F8H A;  1Y01 A;  4I55 E;  4EIW A;  1YW0 A;  3ZYM A;  2WQY A;  2ES0 A;  2W00 A;  4HTE A;  3H3A A;  4U2Z A;  3CQC B;  4E7S A;  2NOX A;  3VR8 A;  3J9X 1;  2WU2 A;  2JRK A;  2Z6E A;  2N9D A;  1LVF A;  4I4T E;  2ODU A;  5AQS B;  2LT3 A;  2KMF A;  2DHR A;  3AE2 A;  4HWH A;  4N78 D;  4JI3 T;  4XZC A;  5L3B B;  4IHJ E;  5BMV E;  3AE9 A;  2JQ9 A;  4JYA T;  3HA4 A;  2B76 A;  4LF8 T;  1AJ3 A;  2LEH A;  5HEU A;  3RX6 A;  2E8I A;  2IML A;  2QA7 A;  5HEJ A;  3UFG A;  5TAO A;  1WLX A;  4U72 A;  4JEU B;  5FYM A;  1BR4 A;  3JC6 D;  3FZK B;  4C91 A;  2LM2 A;  4AQF C;  4YTP A;  1NAF A;  4L0R A;  4ZI3 D;  5LGU B;  3CX7 B;  1MMN A;  2UXC T;  3UUB A;  2EHO A;  4MHC A;  3ZST A;  2BS2 A;  3N5L A;  4ILB A;  4YY3 T;  1V9D A;  3JAE A;  3LK2 B;  4JUY A;  3EAM A;  5AQL B;  5C2T A;  3NWI A;  2BG9 B;  2H88 A;  5HEH A;  4EYY R;  4BA9 A;  5AQH B;  4DV3 T;  3ETV A;  4CZZ B;  3SS1 A;  3P8C D;  2Y48 B;  3V5S A;  2LM9 A;  3RC3 A;  1T98 A;  1CUN A;  2D2S A;  4HE8 A;  2CMR A;  2CLY B;  2C5J A;  2I6H A;  2MBG A;  3SFD A;  4CQI A;  2UXB T;  3JAD A;  1HG2 A;  2PBI A;  3ZN1 B;  5AQU B;  3RIF A;  1G8X A;  2X0Y A;  4LF7 T;  4FJO A;  2VQE T;  3UU6 A;  4OX9 T;  5JDM A;  4EOZ B;  2MTQ A;  3K1S A;  3M65 A;  5LOV E;  3CQG B;  1HX1 B;  3N9N A;  5DAB A;  5LG4 A;  4K0K T;  2VVS A;  3VKH A;  4O2A E;  3LSV A;  3HKD E;  2XQ3 A;  1L0V A;  2XAQ B;  2V7I A;  1HNX T;  4ZHQ E;  2ZM6 T;  2IAK A;  2I0M A;  2Q9Q A;  5FKY A;  4Z90 A;  3EUH A;  2W0G A;  2K9A A;  3LK3 B;  5FL0 A;  2NWB A;  1WYC A;  4O4I E;  2VB6 A;  2WM9 A;  2WY2 A;  2RPA A;  4DND A;  3C51 A;  2H7V C;  3M3Z B;  2V8S V;  4UVC B;  2CWY A;  4ADZ A;  1N32 T;  4IDZ A;  3B13 A;  2BKO A;  4KMC A;  5JR9 C;  4DUY T;  5AQK B;  5FP3 A;  4AQG A;  4XAX B;  3L8R A;  3AEA A;  2YDQ A;  1OED C;  4IST A;  3HKC E;  5AQO B;  3TLW A;  3VKG A;  2I59 A;  3KV4 A;  4BAY B;  4PJJ A;  5HEG A;  2W63 A;  3LJC A;  4TWF A;  1MIW A;  5HXS A;  2AE9 A;  3MJX A;  1XNR T;  4AI6 A;  3ZEF B;  3H37 A;  2UUB T;  2A3D A;  2NW8 A;  3KV5 A;  5C8Y E;  2F4V T;  3JAF A;  2B1E A;  1VCS A;  1ZV4 X;  3KDS E;  1MNE A;  4OYK A;  2WB5 A;  5L2L A;  1YD8 G;  3W15 B;  2KWH A;  4EEB A;  2YOE A;  3RQU A;  2KLQ A;  3E0Z A;  3Q5W A;  2NTX A;  2XM2 A;  2W2U A;  2LSG A;  1KF6 A;  3CWZ B;  5LB7 B;  4X66 T;  4DR6 T;  1MMG A;  1SE7 A;  5LP6 E;  3L09 A;  5ETW A;  4HWD A;  4NUU A;  2PTF A;  2VKO A;  3LK4 2;  2VL0 A;  3JC6 C;  4DR2 T;  1DU2 A;  1D0X A;  2XPK A;  1HS7 A;  3ETU A;  2JMK A;  2A9U A;  2DL1 A;  5AQM B;  4EV6 A;  2X67 A;  3QB5 K;  3E22 E;  4DV5 T;  3LBX B;  3FZH B;  3N9Q A;  3U78 A;  2VL8 A;  2XY8 B;  5LGT B;  3HL6 A;  4GK0 E;  5CJ5 A;  2X0H A;  5A1L A;  5LGN B;  3EVY A;  3JCF A;  2V7M A;  1IBM T;  4O4L E;  4JEH B;  3I0Q A;  5FY1 A;  4YSZ A;  1T7S A;  4JLE A;  2ACZ A;  1XMO T;  5AQR B;  2CXF A;  4K0U A;  4TZ4 C;  5LA6 E;  1E2A A;  4P1N A;  2IC6 A;  2NP9 A;  4GYS A;  3I9W A;  4UV8 B;  4H63 H;  1W0A A;  4QH1 A;  2PJQ A;  3PU8 A;  3MXZ A;  4TNV A;  2HN2 A;  3ZN0 B;  5H6R B;  2EHO C;  3O4X E;  4CI2 B;  5FNV E;  4DUZ T;  1YQ4 A;  2CWO A;  5ABG A;  2BS4 A;  3MAC A;  4HWF A;  3RIU A;  1SA0 E;  4NUV A;  3NRX A;  4H9R C;  2X9H A;  3GN5 A;  4IGU A;  2PFV A;  3S4U A;  1UX5 A;  3AA6 B;  4Z91 A;  3AE1 A;  2H89 A;  2LHN A;  4V1A v;  3KBT A;  2XUE A;  2A72 A;  3AEC A;  2LKH A;  2CM0 A;  4PAG A;  3BQK A;  4HWI B;  4PFO A;  3AXJ A;  2KWI B;  4DBQ A;  5JDH A;  1Y64 B;  4QWN B;  4IE7 A;  4X5T A;  5LHI B;  2NW9 A;  1LVK A;  5AQI B;  1BR0 A;  1XDO A;  4UR9 A;  1HR0 T;  3D0T A;  3KBU A;  1X79 A;  2CCQ A;  4HFI A;  1E1H B;  2Q9Q C;  3L3P A;  2QVA A;  5FMN A;  3C50 A;  2R6G F;  4QXH B;  2CEA A;  4ZS3 A;  1YQ3 A;  5HXE A;  5L4E A;  5KX5 E;  1HTJ F;  4ZZC A;  1D1A A;  3ZCJ A;  2X66 A;  2CRB A;  2KZ7 B;  3KVA A;  3FXD B;  4U7I A;  4ZI2 D;  5AQG B;  2ZLY A;  5LYJ E;  4DV4 T;  3N2G E;  1J1J A;  5CA0 E;  4LFB T;  5L3D B;  2WWU A;  3TLT A;  3ANW B;  1HCI A;  4TWH A;  2XQ6 A;  4A5X A;  4PJN A;  4ILA A;  1SUM B;  3OJA A;  3RGL A;  4HFH A;  4A98 A;  4LF6 T;  3CKD A;  2J4G A;  1W9R A;  2JQQ A;  1OED B;  4B6X A;  4X62 T;  4PFP A;  5L47 A;  2XM1 A;  2LE8 A;  3VRB A;  2K48 A;  2GK9 A;  2E9X D;  3IBP A;  5DQW A;  3NRY A;  1ZHC A;  4DV6 T;  2DCF A;  4ZI7 E;  4YXD A;  2LJL A;  1D1B A;  2WP9 A;  2XQ4 A;  4EYU A;  1R8I A;  2BS3 A;  2VKH A;  3N9M A;  3AE5 A;  2VKD A;  3KV9 A;  2H7O A;  2K24 A;  4TV8 E;  3AAE B;  3ZYL A;  3EI0 A;  2PG8 A;  1M62 A;  3G06 A;  3EHZ A;  3Q5E A;  3OYZ A;  3CVR A;  4JI0 T;  2CPT A;  2D9D A;  3IEE A;  1WFD A;  3RYF E;  3ZT7 A;  2BG9 E;  2N1G A;  3OBV E;  3RYI E;  5FVL A;  4H63 V;  1JNZ A;  5FY7 A;  5IWA T;  2ODV A;  3AE4 A;  2WDR A;  4KUM B;  3AA1 B;  4PNI A;  3PUQ A;  2DLR A;  4ILC A;  3RKO A;  3PJA J;  2JQK A;  3N9L A;  4WNK A;  4QX8 B;  4GIW A;  4U31 A;  5F5W A;  2MOZ A;  1OXZ A;  3OTO T;  3ONL C;  3NKZ A;  3NVO A;  3PTR B;  3R6N A;  4PK6 A;  4CN6 A;  4YSX A;  3HR0 A;  3AA0 B;  5AQN B;  3CK6 A;  3FXE B;  2X51 A;  3UU8 A;  4XBF B;  1WR0 A;  4LFA T;  1Z8U A;  3Q2M A;  4Q25 A;  4B3M T;  4LF4 T;  2UXN B;  3O1I A;  3AE3 A;  2XQ9 A;  2XSA A;  1NEK A;  3PUG A;  1M7K A;  3KVB A;  5CB4 E;  4DMW A;  2KT9 A;  3MZK B;  2W4X A;  2A2F X;  5JDN A;  3IHR A;  5FXV A;  4CXX A;  3ZKR A;  3RIU C;  4DR1 T;  3ONX A;  4TN7 B;  4OK0 A;  1KEY A;  1UUR A;  3ESL A;  4H9Q C;  2H3R A;  2EHO B;  4PJM A;  1N36 T;  2CXL A;  4O4H E;  3CPZ A;  1HX8 A;  1HG5 A;  2J47 A;  2JQH A;  3PJA A;  4QH4 A;  2X68 A;  4YLH A;  4F6R C;  4IE6 A;  4WW0 A;  4TNW A;  3SFE A;  3ZYK A;  4EGW A;  2AXD S;  2V7J A;  3UT5 E;  1U5P A;  1W09 A;  1MND A;  5HEO A;  5FXX A;  4PJL A;  5EK4 A;  3OVU A;  1HF8 A;  4PW8 A;  2WMO A;  3K3O A;  5ADX L;  3AA7 B;  2IW5 B;  4GKJ T;  4EZH A;  3QUJ A;  5LMU T;  4IDN A;  5ABE A;  3TKL B;  1XNQ T;  4L9I A;  5ABF A;  2L3L A;  4JI1 T;  2FBW A;  2D0T A;  3F2E A;  3ONJ A;  1QSD A;  2UU9 T;  3PE0 A;  3RQW A;  1ZP0 A;  4YT0 A;  3CIR A;  4HKA A;  2V5D A;  1QLB A;  5F8P A;  4MBQ A;  4EED A;  3VR9 A;  2DI4 A;  3PUX F;  4UXN B;  3K3N A;  4NXN T;  4LFC T;  2XJ7 A;  5LBQ B;  1WCR A;  4ZOL E;  5EK3 A;  4UF0 A;  1MIV A;  2BKP A;  3PUS A;  5KMG P;  4QHO A;  3N2K E;  3C98 B;  3IF8 B;  4CN1 A;  2MYS A;  1JNR A;  2IDO B;  4U74 A;  4H9N C;  2J1D G;  2FJD A;  4C90 A;  2CHO A;  4BJN A;  4ZI3 C;  1B7T A;  5JH7 E;  3K8P C;  1Z0P A;  5L3C B;  4AIS A;  3VRA A;  3T1H T;  1LKX A;  2G0U A;  2YDR A;  3C4W A;  3UU3 A;  2VAS A;  1T72 A;  5LG3 A;  3NZQ A;  2XAJ B;  5HXR A;  3ZPO A;  1W0B A;  3RH3 A;  4ISS A;  4QXB B;  3ZT6 A;  3C64 A;  2ZM0 A;  3LG7 A;  5FY0 A;  2YN6 A;  4WZX A;  3LDQ B;  3UU5 A;  3ZJ1 A;  1XWM A;  1WRD A;  3DP7 A;  2ACX A;  3AEE A;  3A5X A;  1VRB A;  2CLY C;  1NEN A;  4IDQ A;  3X1D A;  3TLS A;  2LOS A;  3UU4 A;  3ZMS B;  4BJM A;  4CI1 B;  2BBJ A;  2XSB A;  3VU7 H;  5JDL A;  4HN9 A;  2WZH A;  5L3F B;  3BQI A;  3MK7 C;  4FI5 A;  2BDE A;  4KP3 C;  4QH5 A;  4DO0 A;  4B3T T;  2C0S A;  1O3X A;  1J5W A;  4O4J E;  4Z8X A;  4M1P A;  4JBW F;  4LMK A;  2YU1 A;  5LNK A;  2WDV A;  2X0L B;  5JQG E;  3AE8 A;  2LSY A;  5HYA A;  1XMQ T;  2HH7 A;  2OA5 A;  2IC9 A;  4WBO A;  4MLK A;  3HKB E;  5JDG A;  1IBL T;  3WI3 A;  3ZMZ B;  3O9X A;  4EXT A;  4H9P C;  4UVA B;  1U4Q A;  4IE5 A;  4NXM T;  3R84 B;  5JRC A;  3J7Y q;  3AVS A;  3NZP A;  5C3J A;  2WCA A;  5J2U E;  5KDM C;  4AKL A;  4UV9 B;  2X9W A;  4U33 A;  2IHR 1;  5FXW A;  2QYW A;  3GMI A;  3N9O A;  4G63 A;  1D0Z A;  2JIW A;  4YTN A;  3ZMV B;  3ANW A;  4ILU A;  3EDU A;  2MPK A;  4I43 B;  3NBX X;  1IJ5 A;  4I50 E;  3IA3 A;  1N33 T;  1LRZ A;  1ZKE A;  4EZ4 A;  4GKK T;  3PUW F;  2DNX A;  5LCY A;  1OED E;  4OHF A;  2YEV C;  2KXP B;  3FBZ A;  2Y8D A;  2FJA A;  2E9X A;  2VVN A;  3RRC A;  4TV9 E;  5FL1 A;  4JI8 T;  4CXW A;  4JI4 T;  4DVD A;  1HNW T;  2WWV A;  4G2A A;  3OPC A;  5H6Q B;  4GYR A;  5DQV A;  4ZXL A;  4AQY T;  2VUR A;  3N9P A;  3FB2 A;  3AXJ B;  3CML A;  3UUL A;  5GON E;  5FVK A;  4LMJ A;  2HHH T;  3AE6 A;  2JPF A;  2WZI A;  5J1G A;  4LML A;  5JR9 B;  4QX7 B;  4IIJ E;  2LRL A;  3PUA A;  3P4W A;  1MIY A;  3SRZ A;  4X20 E;  2YIN A;  2WAU A;  3RIA A;  3T8O A;  3GA8 A;  2UUC T;  2ZM8 A;  1S94 A;  4IDP A;  4DV0 T;  5LHG B;  5LJN A;  2V7K A;  2V6Y B;  2XZE A;  1FJG T;  4B3R T;  1FEW A;  2XQA A;  2XAF B;  1J5E T;  4U7Y A;  4JI6 T;  2FJE A;  3T1Y T;  1IJ6 A;  2LLY A;  2KSR A;  3RHW A;  4YSY A;  4EAH A;  4ZZB A;  4LF5 T;  4QKN A;  4E7Z A;  4X65 T;  1EZ3 A;  3RI5 A;  3VHL A;  3AE7 A;  1UK5 A;  4X1Y E;  2K5B B;  2OLT A;  2L9Q A;  3UFE A;  4IRE A;  4IE0 A;  2XQY A;  1YKE B;  3HKE E;  5EK2 A;  2BG9 A;  3WAJ A;  2NR4 A;  1BR2 A;  2JJ9 A;  4IT4 A;  1KNR A;  4IE4 A;  4COF A;  2NTY A;  2C5I T;  4PK5 A;  3PV0 F;  5AQT B;  4UEM A;  3BK9 A;  3O1J A;  4HFE A;  1MMA A;  1KNP A;  4J2C A;  2SPC A;  1ZOY A;  3RLF F;  5HXH A;  1D1C A;  2CBI A;  2Y6X A;  1UX4 A;  2X9X A;  1G73 A;  1YKH B;  1FMW A;  2YK0 A;  5EZY E;  2WS3 A;  2P9B A;  4YHJ A;  5HWY A;  2XHE B;  2V26 A;  2W62 A;  3OYX A;  1VOM A;  1XDP A;  3RPU A;  2CHN A;  2XAH B;  1X9B A;  2UUA T;  2QRX A;  3Q5D A;  1UCU A;  3V5U A;  1HFA A;  1US7 B;  5LBM A;  3MKD A;  3ZCI A;  3AEF A;  3AED A;  3KFW X;  3SWH A;  2M67 A;  4UVB B;  4MAL A;  5AQJ B;  4YFS A;  1FIO A;  4HFD A;  4QXC B;  3I0O A;  3BQL A;  1I6Z A;  3PDY A;  3CQX C;  4U3C A;  4AIU A;  4AXP A;  1OWA A;  3F57 A;  3A8Y C;  3FZF B;  1CHU A;  4P0A A;  1KNZ A;  4KHZ F;  2E2A A;  4IL9 A;  2EHO D;  3Q9D A;  3QOF A;  2UXX B;  3AB3 B;  1FMV A;  1KK7 A;  4ZI2 C;  2XQ7 A;  4H9O C;  4NIQ A;  4IDO A;  4AKR B;  4HWC A;  2XQ5 A;  4JV5 T;  5FXZ A;  5L3E B;  5L3G B;  5ABH A;  1E7P A;  2LKG A;  2XAG B;  1WR6 A;  3DJB A;  1BR1 A;  2YDS A;  3B5M A;  2KIN B;  2D5U A;  2WDQ A;  2OV9 A;  2QGS A;  2V6X A;  4JI2 T;  3AVR A;  3CX8 B;  4HFC A;  3FHN A;  3PUZ F;  5E0O A;  1H7C A;  3TLU A;  3ABV A;  2LSK A;  3K3Q C;  2E9X C;  1ZEE A;  3QNU A;  3CX6 B;  4H9S E;  3RF1 A;  2W66 A;  2Q9Q B;  4AKG A;  4DMV A;  2Q9Q D;  3GWH A;  4DV2 T;  4GK5 E;  4ASK A;  2BKN A;  4JI5 T;  5CA1 E;  4JI7 T;  3OKQ A;  5IYZ E;  2LSJ A;  4KHP T;  2LHR A;  4CN4 A;  5HXC A;  3LBX A;  2VQF T;  3ZC0 A;  4LF9 T;  3UQ7 A;  2KND A;  2CBJ A;  1UUS A;  3AAI A;  3UTK A;  3HI2 A;  4AKI A;  4GOU A;  3H3M A;  3UUX B;  4TX5 A;  3P7I A;  5IUX A;  5AQV B;  5HCJ A;  5HWX A;  2DWK A;  2MAW A;  3F31 A;  3AAA B;  4CXY A;  4PK4 A;  3C4X A;  2FJB A;  2YU2 A;  1GQE A;  5JVD E;  1XZY A;  3QK6 A;  5ABF B;  4X64 T;  3MA9 A;  2FUP A;  5M4Y A;  3P4P A;  3A7M A;  4YJ3 E;  2VK9 A;  3KV6 A;  5AQQ B;  2LRK A;  3PUR A;  2L8K A;  3QC9 A;  3UUM A;  5JDQ A;  4UEL A;  4P0B A;  3Q5X A;  4YHH T;  3FZL B;  3RYH E;  4DR4 T;  4TUY E;  2LOP A;  5KXJ A;  3RKG A;  2BG9 C;  1IBK T;  5JDF A;  4AQF A;  3PUY F;  2K3W A;  5HAX A;  2V7L A;  5LXT E;  3KIN B;  4DR3 T;  2J62 A;  4DR7 T;  5AQF B;  4KX6 A;  1UGO A;  3ZLI A;  4UF0 B;  2BBH A;  2UXD T;  3B57 A;  3I9Y A;  2ZM2 A;  3DTO A;  4WBN E;  4DID B;  3AEB A;  3UUN A;  5JTG A;  4OYJ A;  2E5V A;  2D0U A;  4DR5 T;  2VKJ A;  3P4R A;  2W61 A;  2WBL A;  4O2B E;  3C4Z A;  4I0U A;  2M6B A;  3EDV A;  2IUB A;  2BVL A;  2RA1 A;  4MFR A;  3ZC1 A;  5J2T E;  3FZM B;  1IZN B;  2W67 A;  2HN1 A;  2X9Y A;  2XQ8 A;  3O1H A;  2NW7 A;  2CXD A;  2M6I A;  3QB5 A;  2YKS A;  3AEG A;  3ZJ2 A;  1D0Y A;  1N34 T;  1SHZ C;  1YXR A;  3TLV A;  4P09 A;  3ZMT B;  4L5G A;  4UIG A;  2XAS B;  4HGA A;  4HFB A;  2CA5 A;  4A56 A;  2V5C A;  5L4H A;  1KFY A;  4HEA A;  2HPJ A;  4KI0 F;  3PUV F;  2JMH A;  5LMN T;  1IAP A;  4X1K E;  3LFM A;  4TWD A;  5IHY A;  1HNZ T;  4B3S T;  2E5L T;  5JR9 A;  4IL4 A;  5AQP B;  3PU3 A;  4AKH A;  4NPP A;  1OED A;  3SOL A;  4YTM A;  2BZB A;  3GN5 B;  4EB6 E;  1WYB A;  2LSI A;  1T8B A;  2V6Y A;  2WU5 A;  2ZMA A;  5JRE A;  2DWG A;  4X1I E;  2XTL A;  5JRC B;  2N2N A;  4A97 A;  4U2Y A;  3RYC E;  3I1A A;  3L39 A;  4HFV A;  2CE7 A;  2IIU A;  2V1D B;  5HCM A;  4DBR A;  4DV7 T;  1VCT A;  3E08 A;  3P50 A;  3ZMU B;  5AFU L;  3EAB A;  2VWA A;  3WAK A;  1QUU A;  5LJM A;  3RRW A;  4ZS2 A;  3ZSS A;  1NWM X;  3FBL A;  4ZEY A;  4O8S A;  1S35 A;  5F3J A;  4YJ2 E;  1I94 T;  4WYV A;  4ANJ A;  5CFB A;  3P4S A;  5DJQ C;  4CI3 B;  5BR8 T;  2WSS V; 
#chains in the Genus database with same CATH homology
 1YXR A;  4U2Y A;  3ZSS A;  2K3W A;  2CRB A;  3K1S A;  5FVK A;  4ZEY A;  2W2U A;  4CN1 A;  5CJ5 A;  4U7I A;  3ZT7 A;  2LRK A;  2JQ9 A;  3ZT5 A;  2JQK A;  5CGM A;  4CN6 A;  4U2Z A;  2MPK A;  2JQH A;  2WY2 A;  4U3C A;  2WWV A;  2RPA A;  2V6Y B;  4P1N A;  2V6Y A;  4U31 A;  5FVL A;  2XZE A;  5LB7 B;  2A9U A;  4CN4 A;  2DL1 A;  4NIQ A;  4A5X A;  1WCR A;  2CPT A;  3ZT6 A;  1WR0 A;  2LRL A;  2V6X A;  3EAB A;  4IT4 A;  4U33 A;  4U7Y A;  1WFD A;  3ZST A;  4WZX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...