3P8CD

Structure and control of the actin regulatory wave complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
244
structure length
204
Chain Sequence
GIKNELECVTNISLANIIRQLSSLSKYAEDIFGELFNEAHSFSFRVNSLQERVDRLSVSVTQLDPKEEELSLQDITMRKAFRSSTIQDQQLFDRKTLPIPLQETYDVCEQPPPLNILTPYRDDGKEGLKFYTNPSYFFDLWKEKMLQDTEDKRKEKRKQKQKNLDARSVLLEAIRKGIQLRKVEEQRENDVATILSRRIAVEYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytoplasmic FMR1-interacting protein 1
publication title Structure and control of the actin regulatory WAVE complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 57
structure length 204
sequence length 244
ec nomenclature
pdb deposition date 2010-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02205 WH2 WH2 motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3p8cD01
1.20.58.1570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3p8cD02
3U1CA 4I1LA 2FXMA 5KTBA 3C9IA 2JEEA 4O9BA 1WT6A 5BU8B 1NKNA 1X79B 3N7NA 5BU5A 4ZKPA 4N3YB 4GIFA 3OJAB 3VP8A 4ZKUA 2POHA 4N78D 3P8CD 3U59A 5BVZA 3BASA 3VP9A 3BATA 1IC2A 3U1AA 3N4XA 3HRNA
chains in the Genus database with same CATH superfamily
1SQBJ 1Y8AA 4KHPT 5APVA 3B5NC 1GU5A 4ZZCA 1EDIA 2DLRA 3AE4A 1GK6A 2QJPC 2A06G 2P10A 4DV7T 1KQLA 3ZSSA 3LFMA 2O01N 3LK42 3HTKA 1PGJA 4BJMA 3N2GE 2Y0CA 3JCUE 4LF4T 1KN7A 4NUUA 4UVBB 4CXYA 5L3CB 3SFEC 4EGWA 4ILBA 3A0BH 3L74G 3L75G 1D0ZA 2IFNA 5CCGA 3O1IA 2LE8A 3AEAC 2YOEA 3M9BA 3AVSA 5LB7B 2LHNA 1IK7A 3SSUA 3AEBC 1KV4A 2MKVA 2DW3A 1OEDB 1PL5A 1KB9E 3FBLA 4TNWA 3LK2B 1MKMA 2KSJA 2H3RA 3H37A 4ANJA 3AE1A 3RF1A 4KX6A 1SQPE 3AE5A 4ZXLA 1S4XA 2B87A 1GW4A 1LGHB 2K9JB 3P8CE 1XNRT 3O4XE 1NO4A 3HRNA 1D7MA 1YQ4A 2XKMA 3RYHE 2XM1A 1MIWA 1KMIZ 4DMVA 3VKHA 3C9IA 2M5AB 5L3DB 1HR0T 3V4WA 1M7LA 1HGZA 2Z6EA 3JCFA 4QXHB 2FBWA 1LT9C 2L5GB 3LJCA 1QSDA 2AE9A 2JQHA 3AA1B 1GDTA 3UU8A 2E75D 3K3QC 2E8IA 4F6RC 1EZ3A 1NKZB 4YFSA 3T8OA 1G8XA 1YTZT 2Y9YA 4IE0A 5JRCB 1DEBA 1MUUA 2R3SA 3L71J 1L0LG 2X0YA 2CBJA 3B71A 4HKZH 1NU1K 1OVVA 2LSKA 5AQVB 2V1DB 1GZLA 4JLEA 5KLVD 1NTZJ 2X68A 3J9X1 2ZFCA 1L0NJ 3TYYA 2LKHA 2E2AA 3FB2A 4BRYA 1P84I 4JYCA 3PJSK 3ZT6A 3AAEB 4JUYA 4DBQA 2XQ9A 3P7KA 3VYIA 2BBJA 3ZC1A 1BE3G 1QEXA 2C0WA 2QYWA 3II6A 4ZS3A 4JQ0D 2FUPA 2FYUG 1KYOE 3N9OA 2BS4A 1HTLC 4OK0A 3JADA 3WU2E 1ZV8A 1X79A 4IL4A 4XBFB 3L75D 4LFCT 1H0TB 5CJ0A 1EC5A 4MHCA 2FYUK 4X65T 1SQVD 3PUSA 2H89C 1JM0A 3MHVA 3C4ZA 3PP5A 2VVSA 2XHEB 1WT6A 3NZQA 2MTQA 2PRRA 2FFDB 2YN6A 5L3EB 1GD2E 2E74B 5JR9B 4DBRA 2KB7P 3IN6A 2E74C 3KHUA 4YXWH 3MP7B 3CC2P 4B6XA 3KINB 1ZXGA 1T3JA 1HVVA 1EQ7A 2O01J 4KP3C 1W2BO 3KXDA 4LMLA 4CXXA 1QVGO 1WLXA 4YTNA 4ZEYA 2KT9A 2XAHB 2XSBA 1PGPA 2B89A 2XAGB 5B66H 1AV1A 4KHZF 3GWHA 3ONLC 3CCQP 3S4RA 3WAJA 2BS3A 3ZC0A 3H1JJ 3GMIA 3HL6A 2O01H 1GL2C 3T97B 3IHRA 3OYXA 4PAGA 5FKYA 2XU6A 4WB4A 1PP9E 1OZHA 5LBQB 3K3OA 4PD4H 1AQ5A 1N7SA 1L0LD 1NHLA 1QL2A 1DIPA 2Y9ZA 3VN0A 2W66A 1HJ0A 4CZZB 4UV9B 1LTAC 2H7VC 3KDSE 3OA7A 2QSIA 5AQJB 4COFA 1BE3D 4A5XA 3TNUA 5AVUB 2LLYA 2W2UA 2I1KA 3RL0B 3RIUC 3NFQA 4P1NA 4YJ2E 4I0UA 3UU6A 3F5HA 5L3BB 2KK7A 2XZRA 2LSGA 3ZT7A 4JPZB 3FXEA 4HWDA 2NPSD 2XSAA 3VHLA 2LOPA 4IREA 2EHOD 3SFDA 4AKGA 1IFNA 2KI7B 2KWIB 4A97A 1NTMD 1JTHB 3TLVA 5J2UE 1G1JA 2QJYB 2CHNA 2UU9T 4A7PA 3L73J 3ZJ1A 3OVUA 1YKHB 5AFUL 1R5SA 2YO2A 2CPBA 4N6JA 5K5GB 2WDVA 5FVKA 2X9XA 1CUNA 2QA7A 1W9RA 3GA8A 5IUXA 4JI6T 1D1CA 3ANWB 1XTGB 4ZMDA 2Q7CA 3K8PC 3MACA 3UUNA 3L70G 1RF0C 2LOSA 4LMKA 1OMIA 2R5DA 5AQFB 2BVLA 2DCFA 4WBOA 2HLOA 1Q82Q 3GLMA 3SFEA 1BGYG 1N8RQ 4RKUJ 2JMKA 2JR8A 1BSHA 2K1AA 3AEAA 2BCCJ 3AEBA 2FJDA 2X51A 1EXJA 5L3FB 2PAJA 2X9HA 3DTOA 3RYCE 4JI4T 2LR2A 5GONE 4C46A 5HEGA 4H44B 4ZZBA 2QEXP 1SQQG 1IFIA 4Z8XA 4GIFA 1BDDA 1PPJG 3CXHH 4XFJA 2ZT9D 1FZEA 3M91A 2VK9A 2YMKA 2YO3A 1SQXG 1VQKP 4JI1T 1KILD 3OW2O 4N78E 4DR7T 3RBXA 1WYCA 3PUWF 2D9DA 2R6GF 2Q9QC 3QC9A 3CCLP 5CFBA 5JRCA 3M3ZB 5HEJA 4DR1T 5TJHA 3WUUA 5LG4A 1SVFA 2POHA 2G8YA 1T8BA 4Y99B 4PJ0E 3F31A 2FYNB 4ASKA 2D0UA 1P84E 3F57A 2FJAA 1IK9A 2C9LY 1KZUB 1FE6A 2C5IT 1SQBG 3A3YB 1KC8Q 2NTXA 1KQSO 1HJBA 3L72G 2XZEA 2WZ7A 1ZHCA 1FAVA 3EWKA 4RESB 4WYVA 2DL1A 3J7Yq 3H1LG 3PU8A 3L74J 4HFHA 3OBVE 3B5MA 2L9QA 3AAIA 1H0TA 5TISE 2H89A 1MMGA 1N7LA 4TX5A 5AVRB 2WITA 4TZ4C 4CXWA 5CA0E 1VQ9P 4WBNE 4YY3T 1FJKA 2K9YA 4I2LC 2B1EA 4XAXB 5DQVA 4MALA 1SLQA 5KXJA 2UXXB 1SQQD 2WMMA 4D6TD 1RHZB 5LMNT 1YITP 3RK3D 4TWDA 5HWYA 3FZMB 4LF6T 1FMWA 2WSFH 2WQYC 5L8RJ 4EIWA 1MZ9A 2PP6A 2D2CD 2H43A 2IW5B 3BRVB 4U3CA 5A1LA 4U7YA 1HH0A 3HD7D 2E75C 3V5UA 2WU5A 4YSYA 2ZYAA 1GL2A 3RQWA 3T97A 4DV2T 1GW3A 1NU1J 2OTKE 1PGQA 4UEMA 1USEA 3CMEP 4UVAB 4U74A 4DOJA 1UUSA 2B76A 2IYOA 1WRGA 2YDQA 4YSXA 4XA4A 1JY2O 1H89A 2WPRA 3TGUD 2ZVNB 4HWFA 2O1KA 3K3NA 2E5YA 3D6ZA 4AI6A 5KLVE 2YMYA 4YHJA 1EZVG 1JY3P 2VKOA 3FZFB 4IE7A 1JY2P 4DV5T 1S2EA 3L71G 4PFPA 3OTOT 3RIUA 3PH0A 2FYUJ 4E7SA 2HN1A 4UB6E 3B57A 4PJJA 3IR9A 2KSRA 2WS3A 3O6QB 1NTZG 3LK3B 1L0NG 3CCMP 4OX9T 3Q2MA 3L75E 2WSSV 3TLTA 1J1JA 1SQVE 4DUZT 1JY2N 2OTJP 3M9QA 3ZMVB 5AW9B 2A45H 1FU1A 1T8ZA 1FC2C 2Y8DA 5APTA 5KAFH 4JI2T 1JTHA 2WSCJ 3SRZA 1M8OB 5BR8T 1W5CE 1MIVA 2UXNB 1VDFA 3N9LA 2AXCA 1GU4A 4JI5T 3H1KD 3PURA 5JTGA 4DMWA 1X9VA 2E5LT 1V9DA 3RIFA 1N32T 4H0LD 3L35A 2WSSH 3ANWA 1RF0A 4KMCA 3N9QA 4IL6H 4LFAT 4ILUA 5KX5E 5AQKB 3PRJA 2X0HA 3C4WA 4IDNA 4LFBT 4L74A 2DWKA 4U3FG 1D0YA 3M9HA 2WZHA 1UX4A 3E1IA 4Z90A 3VKGA 1L0LE 3H1JG 2JQKA 1HUCA 2KP8A 2PTFA 5BU8B 5BMVE 3H1HD 3CX5D 2XV5A 4QXCB 4OVNF 3M0DC 1MV8A 4TV9E 1BE3E 4KJMA 2LSYA 3DP7A 4P09A 5LHIB 1WR0A 1IJ6A 3FZKB 1YQ3C 5AVSB 1OVUA 4JBZA 5AVWB 4H9SE 2NPSB 3BK9A 2NPSC 1QL1A 3PTRB 3BQIA 3ABVC 2EHOC 3P50A 5F3JA 3AXJB 2BS2A 1GK4A 4IDQA 2JP3A 2Q9QA 2W8ZA 1HNZT 3C1LA 4ZOLE 1N33T 1NTME 3W15B 3MD0A 2HFED 4O4LE 1US7B 2UXDT 1J1DC 3TF5A 1WFDA 3ZN1B 3EVYA 4U2YA 3RL0g 3DJBA 5ETWA 4GIWA 2A2FX 1VQ5P 3TSIA 3FZLB 3NXSA 2V8SV 3PUZF 2WWVA 1VQMP 2ZM6T 2J59M 4QX7B 1KFMA 1PFIA 3EFFK 1T2KD 4PJNA 1D1AA 2VQET 1KORA 3BRTB 4JV5T 3SWFA 4PD4D 1BGYJ 5CB4E 5AW5B 2ZM0A 1YIJP 1WRDA 3H1JD 3U1AA 1M90Q 1T7SA 4B3ST 2J1DG 2V7QJ 1AA0A 2E76D 5CJ5A 1HF8A 1W2EA 2VQFT 3RH3A 3RGLA 1N7SB 4UVCB 4ERRA 2AXTE 3FXDA 1HFAA 3CQGB 4DV0T 1IJDB 1QVFO 5J2TE 4EYYQ 4B86A 5APXA 1NTKD 4CN4A 2BCCG 4NPDA 5M1BA 3RYIE 2WQYA 2ZT9C 3Q1MA 3D0TA 2WM9A 2IDBA 4CN6A 4TWFA 2WWWA 2A72A 1SA0E 4X1YE 2LRLA 1KILC 2ZLYA 4DV3T 4ZS2A 4TNVA 2HYNA 2E5VA 1KILE 3EABA 1URQD 3JCUH 3K5BA 3BCCG 1YW0A 2IBZD 3PUXF 3B8EB 3FXEB 3V2NA 2LRKA 5AQHB 1VQPP 4GDOA 3WI3A 2ACXA 5LJMA 3ZMTB 2BVMA 1JO5A 4YXDC 5AQNB 2UWJE 1ZW0A 2JIWA 3PTZA 5LGUB 2W00A 3M06A 2IFMA 2KS1A 4GOFA 3B5NB 2SPZA 3L73D 1KB9H 1LWUC 1AVOA 2YDSA 4R4LA 3L72J 1VQNP 3B13A 3UUXB 1CI6B 2QJPB 3F89A 1P84D 2V6XA 1YJNP 3H1LJ 1NGMB 3CWBG 3NBXX 5HEUA 4DNDA 3O6QA 4ZKUA 3V5BA 3NVOA 5AVYB 4J2CA 5BVZA 4KI0F 4IT4A 2OYHB 3MA9A 5FYMA 4PD4I 2OYHC 2KZ7B 4QMAA 5HXCA 3T1YT 2ODUA 4BJNA 4RJTA 1XZYA 3LIDA 3Q5XA 5LG3A 2Z4EA 2KWHA 3JAFA 1Y01A 3F2EA 4MFRA 2WBLA 3Q3DA 2V7JA 5CCHD 1S9KD 2VVNA 1E1HB 4EXTA 4X20E 4DR3T 4ZHQE 1ZOYC 1SQQE 3RK3C 4D6TE 5FXVA 1L4AD 2BBHA 4L9IA 2ZYGA 3RK3E 2IMLA 4TLFA 2D2CC 3CCUP 1BR1A 3HD7B 1HX8A 3P4RA 1QX8A 3HD7C 4OYKA 3C8VA 2NTYA 5C2TA 1KYOH 2W67A 3AEDC 3RLFF 3UQ4A 2MBGA 1LT9B 3WU2H 4EOTA 5IYZE 5E79H 2VKHA 3HKBE 1N86A 2IBZI 2CLYB 2CLYC 4UR9A 5FL1A 3CQXC 4AQRD 3FWNA 3ZLIA 3TGUE 3P8MC 2UUCT 1NWQA 2P9BA 2GUVA 1NU1G 3KYQA 3E1RA 2V7KA 3M0DA 2WAUA 5L3GB 1BCCJ 4EEDA 1SQBE 2IC6A 3O1JA 1YQ3A 1RQUA 1MFZA 2A06D 2I8DA 4QWNB 1JUNA 4I7ZC 3W67A 1XNQT 1PGOA 2NPSA 2FJBA 3ABVA 2EHOA 1NENA 1K05A 5GTIE 4EV6A 2W0GA 2A45G 3AXJA 4C7NA 1X8YA 3L74D 5AW0B 5EK3A 3RRCA 2HH7A 4CN1A 3N5LA 2ITAA 2M67A 1K04A 1YTZI 3PUGA 2OTLP 4HJGH 5APWA 1X22A 1FZBA 1RQVA 5CBNA 2LM9A 4AQYT 3G71P 2N1TD 2QM7A 4E7ZA 3H1KE 5JDFA 1JOCA 3RI5A 2MPKA 4H0LC 2Z5HA 2MYSA 1FJGT 2YNYA 5L2LA 3AEGC 1XDPA 2JKVA 5GTHE 3KDPB 2HN2A 3A0HH 2CK3H 3EDUA 3ZMZB 1Q7YQ 4UB8E 4WW0A 4C91A 4U3FJ 4PK5A 3H1IG 1S72P 3MK7C 4U72A 1OW8A 5HXRA 3MZWB 1UIXA 4UXNB 3Q5PA 1GL2B 3B4SA 3VU7H 2NRGA 1M57D 3V6IA 4TWHA 4QH5A 2XY8B 3ZYMA 2NP9A 4IE4A 2C5KT 1FMVA 3MZKB 2J5UA 3H1HE 1RH5B 3I55P 2W83C 4HEAA 3CX5E 3OJAA 5APQA 4ZI7E 4OWFA 1JCCA 5LCYA 5FY7A 2KLVA 3PHLA 3RYFE 3GHGB 1MMAA 2JDIH 4UF0A 1OFCX 3GHGC 4AYCA 3PLNA 2A9UA 1FOSF 1NAFA 4H9PC 1Z8UA 2FYUD 3RC8A 3PUVF 2UXBT 2VL8A 2HR3A 4DVDA 3FHNA 4EOZB 5AW7B 2VWAA 4L5GA 1R8IA 2D0TA 2Q3EA 4EZHA 2W63A 5ADXL 4YXDA 1LTSC 4HKAA 3S1KA 3KBUA 2O3JA 2ZM8A 5FXWA 4LMJA 2KYVA 2QVAA 1LWUA 3B5NA 3C64A 4TV8E 3UUMA 2CXFA 2W90A 2I0MA 1JMBA 1G1IA 4YT0A 1T2KC 3CCSP 4YTMA 2XM2A 3I1AA 4H13D 1CI6A 1A02J 1JEKA 5AVXB 3LSVA 1U7MA 3SWYA 3X1DA 2RN0A 3KVAA 4YHHT 4PD4E 2OYHA 4WY4D 1W0AA 2RA1A 1XTCC 1XWMA 1UGOA 3H1JE 1MNDA 2NW8A 2E76C 3R2PA 1FDOA 1LNQA 3IBPA 1FJPA 5JVDE 3AA0B 1MIYA 5JDLA 5AW2B 1NH4A 3CVRA 1N36T 4HYTB 3FZHB 2P58A 4HFIA 3L8RA 1ZOYA 4KBMB 4ZI2D 2K5BB 3A2AA 3GMAA 1G73A 2IC9A 4IE6A 2YU1A 1NTKE 1FZCC 2FXPA 2WPVB 2E9XD 3I0OA 2QM8A 2V4HA 4GOEA 2ZJSE 2CXLA 3HD7A 4JF7A 4WVZA 3OAKA 1JMMA 3WUVA 1URQB 3VP8A 4L0RA 4YLHA 2BZBA 2A45I 1URQC 3BCCJ 2BG9C 4ILAA 2ZXEB 4H9OC 3AEDA 2BG9E 4PJLA 4UELA 2OYIB 1LT9A 2IBZE 3CD6P 1M1KQ 3I9YA 5CBOA 2OYIC 4PV1D 2QE7H 2VKJA 4LF5T 5KJ7D 2KINB 2XPKA 3RIAA 3BVHA 2Q9QB 1PIXA 3O1HA 3HE4B 2Q1KA 4GK0E 3V2PA 1AJYA 2IHR1 1YJWP 4O9BA 2WU2A 4GODA 4DR6T 1W09A 4PW8A 1IAPA 4N3YB 5FY0A 1KF6A 1Y64B 3L73E 5H6QB 2Y48B 5DABA 1DD4A 1OW7A 3OKQA 4HH2A 3CWBJ 3QB5A 2CHOA 4O4HE 1NJIQ 3D70A 1D0XA 2C0XA 4I55E 5C3JA 2YXRB 3AE7C 5FXZA 1JCDA 1ZP0C 1SQPK 2IX7C 3L70D 1IFMA 2ZXXA 1SFCD 1IFPA 3ZYKA 2JQQA 4QX8B 2VASA 1LTTC 3Q5SA 3EI0A 1XMOT 4ADZA 1BGYD 2P7JA 1FEWA 1YKEB 3AA7B 4HWCA 2M0BA 4XZCA 3U78A 5IWAT 1S9KE 1KTMA 2DI4A 4ISTA 4ASWA 1YHQP 3EHZA 3TKLB 2KIKA 4M3LA 4IFMA 2ZYDA 1DD3A 2VRSA 1H8AA 4GOUA 2WSFJ 1L4AC 4C7RA 2NOXA 3FXDB 1QLBA 2WT7B 2CE7A 2A3DA 1GTWA 2OV9A 3GF7A 1VQ4P 3AEGA 2HPJA 3RC3A 3UQ7A 4LC1A 1PPJD 1VQ6P 3LDQB 3QB5K 5AW6B 3P4SA 2UUAT 3C98B 3G4SP 5L4HA 3VTPC 3KV4A 2XAFB 1SQXD 3E22E 2E75B 3CCVP 2IYPA 1S5LX 2BDEA 3UU3A 2I1JA 1LVKA 5J0ZA 1Y9BA 2YKSA 1JY3O 4AQFC 5APSA 4JYAT 4JI7T 2WCAA 3PJAA 1R8EA 1FDMA 5C8YE 3HKDE 3G9RA 1HBWA 3KZIE 2M6BA 2K48A 4NXMT 2NW7A 2KS1B 3AE6C 2A06E 3HA4A 4U7JA 1QUUA 1L0VA 4Z1MH 4X66T 3GHGA 1SQBD 2R32A 5FMNA 2BKPA 1BCCG 3H6PA 3L72D 2BEZF 4EDFA 3HR0A 2F4VT 1IBLT 2W27A 3H1LD 3MKDA 4WZXA 5LA6E 5H2FH 3A8YC 1NVOA 2KUBA 2JRKA 2N9DA 3L74E 4GT1A 3TDKA 1PP9G 4IDZA 1OVRA 3MIWA 1JY3N 2BKOA 1JB0J 4QXBB 2R3CA 5DQWA 2Y0EA 3RGUA 4DCKA 1M62A 1SS1A 2VL0A 3NRXA 2PG8A 3NMDA 2N1TC 4TUYE 2Q9IA 2WMNA 2YU2A 2QJKC 3C4XA 3Q9DA 2XQ4A 3FX0A 2L91A 1U57A 2H7OA 1N2DC 3P4WA 4UIGA 1EXIA 2IZ1A 1RE3C 3HKCE 2W62A 5CGMA 1S5LE 2HG5D 4XE5B 3A5TA 3H1IJ 3NWIA 5AQIB 4Y28J 5AVZB 4U31A 3E7KA 2XQAA 5L47A 3BASA 5KKZC 2FY8A 2K3RA 2KLQA 5JDHA 2N2NA 1VCSA 3R84B 3QH9A 1H88A 2KZJA 5ABGA 1CW5A 2KOGA 2OGUA 2QIWA 5AW4B 4OHFA 4HWHA 3U1CA 5CHXA 1KB9I 2KXPB 5LGTB 3CKDA 3GN5A 1ZV4X 1RE4C 4C90A 1EZVD 1FDIA 2ZAEB 3CMLA 1FZCA 2XNXA 2KZIA 4YTPC 4BAYB 4NPFX 3L71D 3E08A 1BCCD 3RK2D 4JI3T 4WWIA 4MLKA 4WBAA 1WCRA 4WNKA 1NTZD 3AVRA 5AW8B 2FYUE 2LJLA 4IDOA 1L0ND 2Q6QA 1URQA 1FZFA 2BG9A 1LTGC 4IIJE 2CM0A 3RKOA 1WR6A 3KBTA 3ZJ2A 2EHOB 2OYIA 2IPPA 5AQQB 1VOMA 5JDMA 1LKXA 3N2KE 4JEHB 4B3MT 3VMAA 1PZQA 4C7NB 5AQTB 5AQSB 3HE4A 5HWXA 2ZMAA 4HFDA 2YDRA 1HTJF 1QGKB 3R4YA 3Q5RA 1J1DB 3CCEP 2AXTH 4NPEA 2W4XA 1FS0E 2CPSA 2W6BA 4H13C 3P4PA 3TLWA 2CA5A 1NTKK 2XQ7A 3QK6A 4X5TA 3AE7A 3RL0D 3RBZA 1VRBA 2YEVC 4WY4B 1ZP0A 2ES0A 3L09A 4DT0A 4WY4C 4X62T 1IFJA 3JC22 1VPCA 4OYJA 3A7OA 4ILCA 1TU3F 2H7HA 3NKZA 1ZEEA 4V1Av 2C0SA 5KMGP 2OARA 1L2PA 4U3FD 1DEEG 4DR4T 2WPQA 1JNRA 4YJ3E 4CI3B 1MMNA 4KHXA 4I1LA 1S1CX 5KAIE 2XASB 4ZI2C 5ABHA 4FI5A 2VKDA 1L4AA 5HXHA 2E9XC 1EZVI 2WT7A 4EAHA 3OJAB 4CI2B 4EYUA 5LGNB 2LSIA 1GMJA 3UU5A 2V6YA 2AXDS 1ZLLA 3ZCJA 3ZEFB 4UF0B 2ZT9B 3Q2YA 2CEAA 2UUBT 2CBIA 3M0AA 1KK7A 3AE2C 3N2OA 3MGNA 1AVYA 4TN7B 1KILB 4PV1C 4IFDK 5KJ7C 2YK0A 1KNZA 3GW6A 2CCQA 5AQOB 1ZR4A 4D6TJ 1LTJC 4O4JE 3CLQA 2YINA 2DWGA 1T72A 2KSEA 4O2BE 5HXEA 4AQFA 2UXCT 3VMYA 1SQPJ 3Q5DA 1N73B 2P2UA 2LKGA 3I5CA 1N73C 1WMKA 1KNRA 1IFDA 1S94A 2M3EA 3AE6A 4AKHA 1UCUA 4H44D 1LWUB 1E79H 3PE0A 1LVFA 2R44A 1VCTA 1EDLA 5AQUB 3L70E 1JNZA 1SFCC 5B5EE 2D5UA 4IE5A 2NWBA 3TGUJ 3SFDC 1BR4A 4ISSA 2JWAA 1SUMB 1BGYE 2H88C 4ASVA 1Q90D 3JC6D 2P1JA 3AECC 1K8AQ 3RQUA 3ONXA 5LJNA 1U4QA 3CK6A 2JPFA 3H32A 2BKNA 3AE3C 4IFFA 4YSZA 2N1TA 3WMM0 4MN4C 4NXNT 1M56D 4OH8B 5KLVG 4QH1A 3I0QA 4AIUA 2D2SA 3NZPA 2E42A 2H8PD 3UIAA 3RK3B 3D71A 1FOSE 1RE3A 3CXHD 2BCCD 5KLVK 2XQ8A 4GYSA 4DUYT 2DNXA 5EK4A 1FZAA 1PPJE 2D2CB 4DJGA 1VF5D 1FBMA 3L4FA 4BWNA 3CWZB 3WAKA 2GM4A 5KDMC 4CI1B 4GKKT 1SQXE 1HNWT 1T98A 5CA1E 1SQVG 3BCCD 2YXQB 2XAJB 5GTIH 2RMZA 2ZM2A 5ABEA 3H1KJ 3BQLA 3EAMA 1SQVK 4X1KE 1Y47A 1OEDC 5LXTE 3C51A 4DZOA 1RE4A 1OEDE 4H9RC 1UIIA 4IGUA 2XQ3A 1E7PA 2I59A 4I4TE 4YTPA 1U7JA 3L36A 4LGDE 3LBXA 1T6AA 4OGQD 2PGDA 2Y0DA 3CWBD 3L72E 1IO4A 2C9NY 3HE5B 4I7ZB 4IOIH 3I9WA 5GTHH 2V26A 2OQQA 4DV4T 5LYJE 1OXZA 3H1LE 2QA4P 2IUBA 2LT3A 2OYOA 4AKRB 3A0BE 1PP9J 2KNCA 3V2RA 5JH7E 3H1HJ 4UB8H 5APYA 2X0LB 1MFTA 3MTUE 4QKNA 4P0BA 1HS7A 3D6YA 4H9NC 1AQTA 2XQ6A 1AFOA 1J2JB 2MJZA 3OYZA 3PJAJ 3RX6A 4RO0A 3UTKA 2NW9A 3FWLA 3MUDC 1L0LK 4I50E 4LF7T 5EFWB 5FVLA 3CX5H 3Q5EA 1M1JB 2J58A 2CWOA 5HXSA 1Q86Q 3ESLA 1M1JC 3IAOA 3KFWX 1IJ5A 3CXHI 4K35A 4H0LB 1S35A 3MXZA 3CPWO 2X66A 3L37A 5E79E 2G0UA 4WY4A 5KLIB 5APUA 3SWKA 3EQ2A 1G2CB 1LP1B 5KLIC 4O2AE 3IFMA 2OA5A 2PFXA 3CC7P 2K24A 2LHRA 2JEEA 2ZVOB 1HG2A 1NKNA 2FFDC 2JJ9A 3P32A 5CJ4A 1HF9A 1NTMG 3USSA 1YD8G 4KUMB 5JR9C 4AISA 5CCGD 2V7LA 4EB6E 2K88A 3VP9A 1NU1D 3ZYLA 1NTMK 4YPCA 2LSJA 1IZNB 2DHRA 2E9XA 1EZVE 3RK2B 3NTNA 4Z91A 2N1GA 3RK2C 5LOVE 3VR9A 4PNIA 3L71E 3LW5J 4I43B 1BCCE 2J47A 1BR2A 3O9XA 1NTZE 2ODVA 3TLSA 1L0NE 1KFNA 3AE2A 2QRXA 2IZ0A 2XJ7A 3CQCB 2L8KA 3LG7A 4HFVA 3RHWA 3JAEA 1KILA 2I6HA 5KJ7A 5ABFB 1W0BA 3LW5H 3GG2A 2E5TA 4P0AA 2WTYA 3N9PA 2PFVA 4OFZA 5F5WA 3AE8C 1B7TA 1BDCA 4HTEA 3UFGA 1LTJA 3ETUA 1NTKJ 2FKWB 5DJTB 5FL0A 3KV5A 1E2AA 4IL9A 3ITKA 2W6AA 3G3ZA 2HPCB 1N73A 3N7NA 4LLHA 4W80A 5FY1A 3LIEA 3A0HE 5H6RB 3V2QA 4MBQA 3RL0C 3IF4A 1HNXT 4L76A 5B66E 3AAAB 4EYYR 3KVBA 2IAKA 1K73Q 1RF1B 1RF1C 4K0KT 1SFCA 5JREA 4W7YA 3H1ID 2JWDA 1VQLP 5HCJA 3M65A 3MJXA 4U7IA 2H88A 4U3FE 3AECA 2GK9A 1JNMA 1X0TA 1NAYA 4ZI3D 2E76B 2QJYC 4R4MA 2WP9A 3ETVA 2O1JA 3AE3A 4EZ4A 3ONJA 1Q81Q 2LEHA 4CPGA 1OIPA 2E43A 1KFYA 3GF3A 3CX6B 3GN5B 5HYAA 3SS1A 1X9BA 3U59A 1LT1A 2YKQA 3G6EP 4PK6A 1FZCB 2V5CA 4L73A 3ZPOA 4PJ0H 3C50A 1ZRTD 2B9BA 1EDKA 4X64T 2BEQD 1P84H 3CX8B 3ZN0B 4JEUB 3TLUA 1OX3A 2V7MA 3ZKRA 2BG9B 2V5DA 1D1BA 5HAXA 3S9OA 1IC2A 3O8ZA 3UUBA 4AKIA 1RY3A 1UK5A 3PUYF 3RKGA 5TISH 1OEDA 2G3AA 1N7SD 1XDOA 4GYRA 1BSNA 4DR5T 2K37A 2SPCA 4LF9T 4GK5E 4H44C 2K9JA 4D6TG 2HPLA 4QHOA 3ZMSB 4JBWF 1Z56A 2HODB 5LBMA 1Q2NA 2RP4A 3FBZA 5F8PA 3PUAA 2M5AA 1SQQK 3VMXA 5M4YA 1SQPG 3HE5A 4A56A 4QH4A 3L3PA 4DR2T 3JSVC 3JC6C 2AEMA 1SQXK 5AQGB 4DV6T 3TK1A 3A5XA 3N9MA 1ZMEC 3QNUA 1OW6A 3CCJP 3IEEA 2JO1A 3KPEA 5JDGA 5IHYA 2XQ5A 1KNPA 3TGUG 3QWOC 2WPSA 5KLVJ 5CCHC 1DU2A 3V4QA 3MUDA 3R6NA 4Y99C 2FYNC 2LXBA 5AQRB 1E5WA 2QG4A 2CWYA 2CPTA 1M1JA 1L4AB 3B5ND 1EDJA 4H63V 1VF5B 3CXHE 3KZIH 2BCCE 1Z0PA 1VF5C 2LXCB 1S3JA 1SQBK 5KTBA 3L75J 3AEEC 3ZDMA 1J5WA 1ZN5A 2V6YB 2NZ2A 4BA9A 4G63A 1G2CA 1LP1A 3KQGA 1SQVJ 1BR0A 4HWIB 4UB6H 3I56P 1WYBA 1XMQT 2JJLA 3BCCE 2WB5A 2FFDA 1T3UA 2MAWA 3W68A 1I94T 1CZQA 1R5LA 3UFEA 2RPAA 2Q5UA 3AEFC 3CPZA 4O8SA 5JR9A 3G06A 1J5ET 3N4XA 3P7IA 2X9YA 4NUVA 3RPUA 4H63H 3VMZA 1H7CA 1KB9D 3PDYA 3HUSB 4BXLA 1O3XA 3H1KG 3HUSC 3SOLA 4DO0A 2FXOA 4OGQB 3AE9C 5JQGE 1IBKT 2AEFA 1SQPD 4OGQC 2K3WA 3QUJA 3P8CD 1USDA 4HE8A 2P67A 2N9YB 3CWBE 1YYCA 4K3AA 3EDVA 2WWUA 3L39A 1S5LH 2LKMA 4PK4A 4AUWA 1L0LJ 2N9BA 1PV3A 5ABFA 1NWMX 1LJ2A 4HFCA 3AE8A 3UULA 2KNDA 5JDQA 5E0OA 4HN9A 2IDOB 1KQFB 2B88A 3H1HG 2GUSA 1YI2P 4IHJE 3CMAP 3H32B 2WDRA 4I6MC 3PU3A 3VRBA 1BE3J 2YKPA 2N1TB 4W7ZA 2MOZA 2HPCA 5DJUB 2QJKB 3AE4C 4L75A 3RRWA 3ZCIA 5HEHA 1M7KA 2WZIA 2YIUB 1J1EB 1NOHA 4K0UA 5AQMB 3VRAA 3ZSTA 2YIUC 1J1EC 1KQGB 1RF1A 3HTKB 5FP3A 4DIDB 2ACZA 1NTZK 1KYOD 2PBIA 2JQ9A 1L0NK 1LTBC 5L4EA 5KKZB 1NTMJ 1CSBA 4IL6X 1NEKA 3EFGA 5CCGC 2Y6XA 2YKOA 1A02F 3KV9A 3FGAD 2RKLA 2FYZA 1SP4A 2GA1A 2Z5IA 1HX1B 2XUEA 4CQIA 3NRYA 1NU1E 1GQEA 2VURA 1KEYA 3IA3A 4H9QC 3CC4P 1KD1Q 2E74D 1YJ9P 3S4UA 3E0ZA 4AQGA 4EI2A 2WSCH 3AE1C 5EK2A 2M8RA 2B87B 3AE5C 1MNEA 2CMRA 3HKEE 1UX5A 2J4GA 3A7MA 4F8HA 3CI9A 5H2FE 3BQKA 1YQ4C 3LBXB 2KLUA 4A98A 2J62A 2M3BA 3KV6A 4KT0J 4HFBA 2FBWC 2FJEA 3QOFA 1DX7A 3HI2A 4HB1A 1VL2A 1YBKA 2KNCB 1GL2D 5C39A 5KAFE 1PP9D 3UU4A 3SWHA 2CRBA 1U5PA 5AQPB 3CIRA 5AVTB 4IDPA 1AJ3A 3CCRP 2WSEJ 1SHZC 1FIOA 2RH0A 2LM2A 3U3IA 4DV1T 5KAIH 3IF8B 2HHHT 4BRYB 4JI0T 1K9MQ 2NR4A 1NTKG 2JMHA 4PFOA 2HODA 4TT3H 1YXRA 4H13B 3ZT5A 4U33A 4IL6E 1DH3A 4UV8B 1HG5A 2X9WA 5HCMA 3H25A 2WSEH 5AW3B 5HEOA 3OPCA 1HGVA 1VQ7P 1KYOI 5FXXA 1NYHA 1X79B 5J1GA 5BU5A 2M6IA 3H1IE 3H3MA 2XDJA 1VQOP 2AEJA 2IBZG 3WUTA 4ZI3C 4ZNCA 2XTLA 2QGSA 2C5JA 5AVVB 2IIUA 2XNDH 5CCHA 2Q3IA 5LHGB 4AXPA 1VQ8P 2XAQB 3EUHA 4M1PA 2OLTA 4JI8T 2XQYA 3L73G 4U2ZA 3L70J 4JYBA 2E9XB 1HCIA 3H3AA 4B3RT 2W6JH 1IBMT 1CHUA 2V7IA 4O4IE 4B3TT 3AEEA 2WY2A 1ZRTE 1MMDA 4EIJA 4GKGA 5LP6E 2L3LA 2BASA 4LF8T 5AW1B 5B5EH 1LRZA 4PJMA 4Q25A 1UURA 2PJQA 4NIQA 1ZKEA 4NPPA 1FZGA 2FXMA 4PV1B 2X67A 2WVRA 3AEFA 1N7SC 3CX5I 4ZKPA 3P4QA 1LTJB 3CL3D 1SQQJ 3V5SA 5FNVE 3T1HT 3AA6B 2WDQA 2V7QH 3HUSA 2WMOA 3CX7B 3AE9A 1I6ZA 3AB3B 2K9AA 3TNUB 5TAOA 2R5BA 4G2AA 1SQXJ 3VOPA 5JDNA 5AVQB 3PUQA 5EZYE 3UT5E 1LTIC 3VR8A 2W61A 3PV0F 4FJOA 5CMZA 4X1IE 2VB6A 3ZMUB 3K1SA 1OWAA 1SFCB 5LMUT 1ZR2A 4HFEA 2CXDA 5AQLB 4N78D 3Q5WA 3BATA 2KMFA 5LNKA 5DJQC 1HWTC 1SE7A 1QLED 4AKLA 4GKJT 2Q9QD 4HGAA 1N34T 3N9NA 4EEBA 5LHHB
chains in the Genus database with same CATH topology
5APVA 3B5NC 1GU5A 2DLRA 1GK6A 1KQLA 3LFMA 3LK42 3HTKA 4BJMA 3N2GE 4NUUA 4UVBB 4CXYA 5L3CB 1D0ZA 2IFNA 5CCGA 3O1IA 2LE8A 3M9BA 3AVSA 2LHNA 3FBLA 3LK2B 2KSJA 2H3RA 3H37A 4ANJA 1GW4A 1LGHB 3P8CE 3O4XE 1NO4A 3HRNA 2XKMA 3RYHE 1MIWA 4DMVA 3VKHA 3C9IA 5L3DB 3V4WA 1M7LA 1HGZA 2Z6EA 4QXHB 1LT9C 2L5GB 3LJCA 1QSDA 3AA1B 1GDTA 3K3QC 2E8IA 1EZ3A 1NKZB 4YFSA 3T8OA 1G8XA 1YTZT 4IE0A 5JRCB 1DEBA 1MUUA 1NU1K 2LSKA 2V1DB 1GZLA 4JLEA 3J9X1 2X68A 2ZFCA 3TYYA 3FB2A 4JYCA 3AAEB 4JUYA 4DBQA 3ZC1A 3P7KA 3VYIA 2C0WA 3II6A 4ZS3A 3N9OA 4OK0A 1HTLC 1ZV8A 1X79A 4XBFB 5CJ0A 4MHCA 2FYUK 3PUSA 3C4ZA 3PP5A 2XHEB 1WT6A 3NZQA 2MTQA 2FFDB 5L3EB 1GD2E 5JR9B 4DBRA 2KB7P 4B6XA 3KINB 1T3JA 1HVVA 1EQ7A 4KP3C 4CXXA 1WLXA 2KT9A 2XAHB 2XAGB 3GWHA 3ZC0A 3WAJA 3GMIA 3HL6A 2O01H 1GL2C 3IHRA 3OYXA 4PAGA 2XU6A 4WB4A 5LBQB 3K3OA 1AQ5A 1N7SA 1NHLA 1QL2A 3VN0A 4CZZB 4UV9B 1LTAC 2H7VC 3KDSE 3OA7A 3TNUA 5AVUB 2I1KA 3RL0B 3NFQA 4YJ2E 5L3BB 2XZRA 2LSGA 2NPSD 3VHLA 2LOPA 2EHOD 4AKGA 1IFNA 2KWIB 1JTHB 5J2UE 1G1JA 3ZJ1A 1YKHB 5AFUL 2YO2A 2CPBA 4N6JA 2X9XA 1CUNA 2QA7A 3GA8A 1D1CA 3ANWB 1XTGB 2Q7CA 3K8PC 3MACA 3UUNA 1RF0C 2LOSA 2R5DA 2BVLA 2DCFA 4WBOA 2HLOA 2JMKA 2X51A 5L3FB 2PAJA 2X9HA 3DTOA 3RYCE 5GONE 4C46A 1IFIA 4Z8XA 4GIFA 3M91A 1FZEA 2VK9A 2YO3A 1KILD 4N78E 1WYCA 2Q9QC 3QC9A 5JRCA 5LG4A 1SVFA 2POHA 4Y99B 3F31A 4ASKA 2D0UA 3F57A 1IK9A 2C9LY 1KZUB 2C5IT 3A3YB 2NTXA 1HJBA 2WZ7A 1ZHCA 1FAVA 4RESB 3J7Yq 3PU8A 3OBVE 2L9QA 3AAIA 1MMGA 1N7LA 4TX5A 5AVRB 2WITA 4TZ4C 4CXWA 5CA0E 4WBNE 1FJKA 4I2LC 2B1EA 4XAXB 5DQVA 4MALA 1SLQA 2UXXB 3RK3D 5HWYA 1FMWA 2WSFH 4EIWA 1MZ9A 2PP6A 2H43A 2IW5B 3BRVB 5A1LA 1HH0A 3HD7D 3V5UA 1GL2A 3T97A 1GW3A 4UEMA 4UVAB 4U74A 4DOJA 1WRGA 4XA4A 1JY2O 1H89A 2WPRA 2O1KA 3K3NA 4AI6A 2YMYA 4YHJA 1JY3P 2VKOA 4IE7A 1JY2P 4PFPA 4E7SA 3B57A 4PJJA 3IR9A 3LK3B 3Q2MA 2WSSV 1JY2N 3M9QA 3ZMVB 5AW9B 2A45H 1FU1A 1T8ZA 2Y8DA 5APTA 3SRZA 1JTHA 1MIVA 2UXNB 1VDFA 3N9LA 1GU4A 3PURA 4DMWA 1X9VA 1V9DA 3L35A 3ANWA 1RF0A 4KMCA 3N9QA 4ILUA 5KX5E 3C4WA 2DWKA 1D0YA 3M9HA 1UX4A 3E1IA 3VKGA 1HUCA 2KP8A 5BU8B 5BMVE 2XV5A 4QXCB 3M0DC 1MV8A 4TV9E 3DP7A 2LSYA 4P09A 5LHIB 1IJ6A 5AVSB 5AVWB 4H9SE 2NPSB 3BK9A 2NPSC 1QL1A 3PTRB 3BQIA 2EHOC 5F3JA 1GK4A 2Q9QA 4ZOLE 3W15B 3MD0A 2HFED 4O4LE 1US7B 1J1DC 3ZN1B 3EVYA 3DJBA 5ETWA 4GIWA 2A2FX 3TSIA 3NXSA 2J59M 4QX7B 1KFMA 1PFIA 1T2KD 4PJNA 1D1AA 3BRTB 3SWFA 5CB4E 5AW5B 2ZM0A 1WRDA 3U1AA 2J1DG 1HF8A 1W2EA 3RH3A 1N7SB 4UVCB 4ERRA 1HFAA 3CQGB 1IJDB 5J2TE 4B86A 5APXA 3RYIE 3D0TA 2WM9A 2WWWA 2A72A 1SA0E 4X1YE 1KILC 2ZLYA 4ZS2A 2HYNA 1URQD 1YW0A 3B8EB 3FXEB 3V2NA 3WI3A 2ACXA 5LJMA 3ZMTB 2BVMA 1JO5A 5LGUB 2W00A 3M06A 2IFMA 3B5NB 1LWUC 3B13A 3UUXB 1CI6B 3NBXX 4DNDA 4ZKUA 3V5BA 5AVYB 4J2CA 5BVZA 2OYHB 3MA9A 5FYMA 2OYHC 2KZ7B 5HXCA 2ODUA 4BJNA 3LIDA 3Q5XA 2Z4EA 2KWHA 3F2EA 4MFRA 2WBLA 2V7JA 5CCHD 1S9KD 1E1HB 4EXTA 4X20E 4ZHQE 3RK3C 5FXVA 1L4AD 4L9IA 1BR1A 3HD7B 1HX8A 4OYKA 3HD7C 2NTYA 2MBGA 1LT9B 4EOTA 5IYZE 2VKHA 3HKBE 1N86A 2CLYB 2CLYC 3CQXC 4AQRD 3ZLIA 3P8MC 1NWQA 2P9BA 2GUVA 3KYQA 2V7KA 3M0DA 2WAUA 5L3GB 2IC6A 3O1JA 1MFZA 4QWNB 1JUNA 2NPSA 2EHOA 2W0GA 2A45G 4C7NA 1X8YA 5AW0B 5EK3A 3RRCA 2HH7A 3N5LA 2M67A 1YTZI 3PUGA 5APWA 1FZBA 2LM9A 2N1TD 2QM7A 4E7ZA 5JDFA 1JOCA 2Z5HA 2MYSA 2YNYA 5L2LA 3KDPB 3EDUA 3ZMZB 4WW0A 4C91A 4PK5A 3MK7C 4U72A 5HXRA 4UXNB 1GL2B 3VU7H 3ZYMA 2NP9A 4IE4A 2C5KT 1FMVA 3MZKB 4HEAA 3OJAA 5APQA 4ZI7E 1JCCA 5LCYA 5FY7A 2KLVA 3RYFE 3GHGB 1MMAA 4UF0A 3GHGC 4AYCA 1FOSF 1NAFA 4H9PC 3RC8A 2VL8A 4DVDA 3FHNA 4EOZB 5AW7B 2VWAA 4L5GA 2D0TA 4EZHA 2W63A 5ADXL 1LTSC 4HKAA 3KBUA 2ZM8A 5FXWA 2KYVA 1LWUA 3B5NA 3C64A 4TV8E 3UUMA 2CXFA 1G1IA 1T2KC 3I1AA 1CI6A 1A02J 5AVXB 3SWYA 3KVAA 2OYHA 4WY4D 2RA1A 1XTCC 1MNDA 2NW8A 3R2PA 3IBPA 1FJPA 5JVDE 3AA0B 1MIYA 5JDLA 5AW2B 1NH4A 3CVRA 4HYTB 4KBMB 4ZI2D 2K5BB 3A2AA 2IC9A 1G73A 4IE6A 2YU1A 1FZCC 2E9XD 3I0OA 2QM8A 2CXLA 3HD7A 4JF7A 3OAKA 1JMMA 1URQB 3VP8A 4L0RA 4YLHA 2BZBA 2A45I 1URQC 2ZXEB 4H9OC 4PJLA 4UELA 2OYIB 1LT9A 3I9YA 2OYIC 2VKJA 5KJ7D 2KINB 3BVHA 2Q9QB 3O1HA 3HE4B 4GK0E 3V2PA 4O9BA 4PW8A 1IAPA 4N3YB 5FY0A 1Y64B 5H6QB 2Y48B 5DABA 3OKQA 4HH2A 4O4HE 1D0XA 2C0XA 4I55E 5FXZA 1JCDA 1SQPK 2IX7C 1IFMA 1SFCD 3ZYKA 2JQQA 4QX8B 2VASA 1LTTC 4ADZA 2P7JA 1FEWA 1YKEB 3AA7B 4XZCA 3U78A 1S9KE 2DI4A 4ISTA 3TKLB 4M3LA 4IFMA 4GOUA 2VRSA 1H8AA 1L4AC 4C7RA 2NOXA 3FXDB 2WT7B 2CE7A 2A3DA 1GTWA 2HPJA 3RC3A 4LC1A 5AW6B 3C98B 3VTPC 3KV4A 2XAFB 3E22E 2BDEA 2I1JA 1LVKA 1JY3O 4AQFC 5APSA 1FDMA 5C8YE 3HKDE 1HBWA 2K48A 2NW7A 3HA4A 1QUUA 3GHGA 2R32A 5FMNA 3H6PA 3HR0A 2W27A 3MKDA 5LA6E 2JRKA 2N9DA 4GT1A 4IDZA 3MIWA 1JY3N 4QXBB 2R3CA 5DQWA 3NRXA 2PG8A 3NMDA 2N1TC 4TUYE 2Q9IA 2WMNA 2YU2A 3C4XA 3Q9DA 2H7OA 1N2DC 4UIGA 1RE3C 3HKCE 2W62A 2HG5D 4XE5B 3A5TA 5AVZB 3BASA 2KLQA 5JDHA 2N2NA 3R84B 1H88A 1CW5A 2KOGA 5AW4B 4OHFA 3U1CA 5CHXA 2KXPB 5LGTB 3CKDA 3GN5A 1ZV4X 1RE4C 4C90A 3CMLA 1FZCA 2XNXA 4BAYB 3E08A 3RK2D 4MLKA 4WBAA 4WNKA 3AVRA 5AW8B 2LJLA 1URQA 1FZFA 1LTGC 4IIJE 2CM0A 3RKOA 1WR6A 3KBTA 3ZJ2A 2EHOB 2OYIA 2IPPA 1VOMA 5JDMA 1LKXA 3N2KE 4JEHB 4C7NB 3HE4A 5HWXA 2ZMAA 1HTJF 1J1DB 2CPSA 2W6BA 2CA5A 1NTKK 3QK6A 3RL0D 1VRBA 2YEVC 4WY4B 2ES0A 3L09A 4WY4C 1IFJA 4OYJA 1VPCA 3A7OA 2H7HA 1ZEEA 4V1Av 2C0SA 5KMGP 2OARA 2WPQA 4YJ3E 4CI3B 1MMNA 4KHXA 4I1LA 2XASB 4ZI2C 4FI5A 2VKDA 1L4AA 5HXHA 2E9XC 2WT7A 4EAHA 3OJAB 4CI2B 4EYUA 5LGNB 2LSIA 1ZLLA 3ZCJA 3ZEFB 4UF0B 2CEAA 3M0AA 1KK7A 3N2OA 3MGNA 4TN7B 1KILB 4IFDK 5KJ7C 2YK0A 1KNZA 2CCQA 1ZR4A 1LTJC 4O4JE 3CLQA 2YINA 2DWGA 4O2BE 5HXEA 4AQFA 3VMYA 1N73B 2P2UA 3I5CA 1N73C 1S94A 1IFDA 4AKHA 1UCUA 1LWUB 3PE0A 1LVFA 1SFCC 2D5UA 4IE5A 2NWBA 1BR4A 4ISSA 3JC6D 2P1JA 3ONXA 5LJNA 1U4QA 2JPFA 3H32A 4IFFA 2N1TA 3WMM0 4OH8B 3I0QA 2D2SA 3NZPA 2E42A 2H8PD 3UIAA 3RK3B 1FOSE 1RE3A 5KLVK 4GYSA 2DNXA 5EK4A 1FZAA 1FBMA 3L4FA 3CWZB 3WAKA 2GM4A 5KDMC 4CI1B 1T98A 5CA1E 2XAJB 2ZM2A 3BQLA 1SQVK 4X1KE 5LXTE 3C51A 4DZOA 1RE4A 4H9RC 4IGUA 2I59A 4I4TE 3L36A 4LGDE 3LBXA 1IO4A 2C9NY 3HE5B 3I9WA 2V26A 5LYJE 1OXZA 4AKRB 2LT3A 3V2RA 5JH7E 5APYA 2X0LB 3MTUE 4QKNA 4P0BA 1HS7A 4H9NC 1AFOA 1J2JB 2MJZA 3OYZA 3RX6A 3UTKA 2NW9A 1L0LK 4I50E 1M1JB 2J58A 2CWOA 5HXSA 3ESLA 1M1JC 3KFWX 1IJ5A 1S35A 3MXZA 2X66A 3L37A 2G0UA 4WY4A 5APUA 3EQ2A 1G2CB 4O2AE 3IFMA 2OA5A 2K24A 2LHRA 2JEEA 1HG2A 1NKNA 2FFDC 2JJ9A 3P32A 5CJ4A 1YD8G 4KUMB 5JR9C 5CCGD 2V7LA 4EB6E 3ZYLA 3VP9A 1NTMK 2LSJA 1IZNB 2DHRA 2E9XA 3RK2B 3NTNA 2N1GA 3RK2C 5LOVE 4PNIA 4I43B 1BR2A 3O9XA 2ODVA 1KFNA 3CQCB 2L8KA 3LG7A 4HFVA 1KILA 5KJ7A 3LW5H 4P0AA 2WTYA 3N9PA 2PFVA 4OFZA 1B7TA 4HTEA 1LTJA 3ETUA 2FKWB 3KV5A 2W6AA 3G3ZA 2HPCB 1N73A 3N7NA 4LLHA 4W80A 5FY1A 3LIEA 5H6RB 3V2QA 4MBQA 3RL0C 3AAAB 4EYYR 3KVBA 2IAKA 1RF1B 1RF1C 1SFCA 5JREA 4W7YA 3M65A 3MJXA 2GK9A 1JNMA 4ZI3D 3ETVA 2O1JA 4EZ4A 2LEHA 2E43A 3CX6B 3GN5B 5HYAA 3SS1A 3U59A 2YKQA 4PK6A 1FZCB 3ZPOA 3C50A 3CX8B 3ZN0B 4JEUB 2V7MA 5HAXA 1D1BA 1IC2A 3O8ZA 4AKIA 1RY3A 1N7SD 4GYRA 2SPCA 4GK5E 2HPLA 4QHOA 3ZMSB 1Z56A 2HODB 5LBMA 2RP4A 3FBZA 5F8PA 3PUAA 3VMXA 1SQQK 5M4YA 3HE5A 4A56A 3L3PA 3JC6C 1SQXK 3TK1A 3A5XA 3N9MA 3IEEA 3KPEA 5JDGA 5IHYA 5CCHC 2WPSA 3V4QA 3MUDA 3R6NA 4Y99C 1E5WA 2CWYA 1M1JA 1L4AB 3B5ND 4H63V 1Z0PA 1SQBK 5KTBA 1ZN5A 4BA9A 4G63A 1G2CA 3KQGA 1BR0A 1WYBA 2JJLA 2FFDA 1T3UA 1CZQA 3UFEA 2Q5UA 3CPZA 4O8SA 5JR9A 3N4XA 3P7IA 2X9YA 4NUVA 3RPUA 4H63H 3VMZA 1H7CA 3PDYA 3HUSB 1O3XA 3HUSC 3SOLA 4DO0A 5JQGE 3QUJA 3P8CD 4HE8A 2P67A 1YYCA 3EDVA 2WWUA 2LKMA 4PK4A 4AUWA 2N9BA 1NWMX 3UULA 2KNDA 5JDQA 5E0OA 4HN9A 2GUSA 4IHJE 3H32B 4I6MC 3PU3A 2YKPA 2N1TB 4W7ZA 2MOZA 2HPCA 3RRWA 3ZCIA 1J1EB 1NOHA 4K0UA 1J1EC 1RF1A 3HTKB 5FP3A 1NTZK 2PBIA 1L0NK 1LTBC 1CSBA 3EFGA 5CCGC 2Y6XA 2YKOA 1A02F 3KV9A 2FYZA 1SP4A 2Z5IA 2XUEA 4CQIA 3NRYA 4H9QC 3S4UA 3E0ZA 4AQGA 2WSCH 5EK2A 2M8RA 1MNEA 2CMRA 3HKEE 1UX5A 3CI9A 3BQKA 3LBXB 2M3BA 3KV6A 1DX7A 3HI2A 1GL2D 3SWHA 1U5PA 5AVTB 1AJ3A 1SHZC 1FIOA 3U3IA 3IF8B 2JMHA 4PFOA 2HODA 1DH3A 4UV8B 1HG5A 2X9WA 4F6RC 2WSEH 5AW3B 1HGVA 5FXXA 1X79B 5J1GA 5BU5A 2XDJA 4ZI3C 2XTLA 2QGSA 2C5JA 5AVVB 5CCHA 2Q3IA 5LHGB 4AXPA 2XAQB 3EUHA 4M1PA 2XQYA 4JYBA 2E9XB 1HCIA 3H3AA 2V7IA 4O4IE 1MMDA 4EIJA 4GKGA 5LP6E 2L3LA 2BASA 5AW1B 1LRZA 4PJMA 2PJQA 1ZKEA 1FZGA 2FXMA 2X67A 1N7SC 4ZKPA 1LTJB 3CL3D 3V5SA 5FNVE 3AA6B 3HUSA 2WMOA 3CX7B 3AB3B 2K9AA 3TNUB 5TAOA 2R5BA 4G2AA 3VOPA 5JDNA 5AVQB 3UT5E 5EZYE 3PUQA 1LTIC 2W61A 4FJOA 5CMZA 4X1IE 2VB6A 3ZMUB 1OWAA 1SFCB 1ZR2A 2CXDA 4N78D 3Q5WA 3BATA 2KMFA 5LNKA 5DJQC 1HWTC 4AKLA 2Q9QD 4HGAA 3N9NA 5LHHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U1C A;  4I1L A;  2FXM A;  5KTB A;  3C9I A;  2JEE A;  4O9B A;  1WT6 A;  5BU8 B;  1NKN A;  1X79 B;  3N7N A;  5BU5 A;  4ZKP A;  4N3Y B;  4GIF A;  3OJA B;  3VP8 A;  4ZKU A;  2POH A;  4N78 D;  3P8C D;  3U59 A;  5BVZ A;  3BAS A;  3VP9 A;  3BAT A;  1IC2 A;  3U1A A;  3N4X A;  3HRN A; 
#chains in the Genus database with same CATH topology
 1SQB J;  1Y8A A;  4KHP T;  5APV A;  3B5N C;  1GU5 A;  4ZZC A;  1EDI A;  2DLR A;  3AE4 A;  1GK6 A;  2QJP C;  2A06 G;  2P10 A;  4DV7 T;  1KQL A;  3ZSS A;  3LFM A;  2O01 N;  3LK4 2;  3HTK A;  1PGJ A;  4BJM A;  3N2G E;  2Y0C A;  3JCU E;  4LF4 T;  1KN7 A;  4NUU A;  4UVB B;  4CXY A;  5L3C B;  3SFE C;  4EGW A;  4ILB A;  3A0B H;  3L74 G;  3L75 G;  1D0Z A;  2IFN A;  5CCG A;  3O1I A;  2LE8 A;  3AEA C;  2YOE A;  3M9B A;  3AVS A;  5LB7 B;  2LHN A;  1IK7 A;  3SSU A;  3AEB C;  1KV4 A;  2MKV A;  2DW3 A;  1OED B;  1PL5 A;  1KB9 E;  3FBL A;  4TNW A;  3LK2 B;  1MKM A;  2KSJ A;  2H3R A;  3H37 A;  4ANJ A;  3AE1 A;  3RF1 A;  4KX6 A;  1SQP E;  3AE5 A;  4ZXL A;  1S4X A;  2B87 A;  1GW4 A;  1LGH B;  2K9J B;  3P8C E;  1XNR T;  3O4X E;  1NO4 A;  3HRN A;  1D7M A;  1YQ4 A;  2XKM A;  3RYH E;  2XM1 A;  1MIW A;  1KMI Z;  4DMV A;  3VKH A;  3C9I A;  2M5A B;  5L3D B;  1HR0 T;  3V4W A;  1M7L A;  1HGZ A;  2Z6E A;  3JCF A;  4QXH B;  2FBW A;  1LT9 C;  2L5G B;  3LJC A;  1QSD A;  2AE9 A;  2JQH A;  3AA1 B;  1GDT A;  3UU8 A;  2E75 D;  3K3Q C;  2E8I A;  4F6R C;  1EZ3 A;  1NKZ B;  4YFS A;  3T8O A;  1G8X A;  1YTZ T;  2Y9Y A;  4IE0 A;  5JRC B;  1DEB A;  1MUU A;  2R3S A;  3L71 J;  1L0L G;  2X0Y A;  2CBJ A;  3B71 A;  4HKZ H;  1NU1 K;  1OVV A;  2LSK A;  5AQV B;  2V1D B;  1GZL A;  4JLE A;  5KLV D;  1NTZ J;  2X68 A;  3J9X 1;  2ZFC A;  1L0N J;  3TYY A;  2LKH A;  2E2A A;  3FB2 A;  4BRY A;  1P84 I;  4JYC A;  3PJS K;  3ZT6 A;  3AAE B;  4JUY A;  4DBQ A;  2XQ9 A;  3P7K A;  3VYI A;  2BBJ A;  3ZC1 A;  1BE3 G;  1QEX A;  2C0W A;  2QYW A;  3II6 A;  4ZS3 A;  4JQ0 D;  2FUP A;  2FYU G;  1KYO E;  3N9O A;  2BS4 A;  1HTL C;  4OK0 A;  3JAD A;  3WU2 E;  1ZV8 A;  1X79 A;  4IL4 A;  4XBF B;  3L75 D;  4LFC T;  1H0T B;  5CJ0 A;  1EC5 A;  4MHC A;  2FYU K;  4X65 T;  1SQV D;  3PUS A;  2H89 C;  1JM0 A;  3MHV A;  3C4Z A;  3PP5 A;  2VVS A;  2XHE B;  1WT6 A;  3NZQ A;  2MTQ A;  2PRR A;  2FFD B;  2YN6 A;  5L3E B;  1GD2 E;  2E74 B;  5JR9 B;  4DBR A;  2KB7 P;  3IN6 A;  2E74 C;  3KHU A;  4YXW H;  3MP7 B;  3CC2 P;  4B6X A;  3KIN B;  1ZXG A;  1T3J A;  1HVV A;  1EQ7 A;  2O01 J;  4KP3 C;  1W2B O;  3KXD A;  4LML A;  4CXX A;  1QVG O;  1WLX A;  4YTN A;  4ZEY A;  2KT9 A;  2XAH B;  2XSB A;  1PGP A;  2B89 A;  2XAG B;  5B66 H;  1AV1 A;  4KHZ F;  3GWH A;  3ONL C;  3CCQ P;  3S4R A;  3WAJ A;  2BS3 A;  3ZC0 A;  3H1J J;  3GMI A;  3HL6 A;  2O01 H;  1GL2 C;  3T97 B;  3IHR A;  3OYX A;  4PAG A;  5FKY A;  2XU6 A;  4WB4 A;  1PP9 E;  1OZH A;  5LBQ B;  3K3O A;  4PD4 H;  1AQ5 A;  1N7S A;  1L0L D;  1NHL A;  1QL2 A;  1DIP A;  2Y9Z A;  3VN0 A;  2W66 A;  1HJ0 A;  4CZZ B;  4UV9 B;  1LTA C;  2H7V C;  3KDS E;  3OA7 A;  2QSI A;  5AQJ B;  4COF A;  1BE3 D;  4A5X A;  3TNU A;  5AVU B;  2LLY A;  2W2U A;  2I1K A;  3RL0 B;  3RIU C;  3NFQ A;  4P1N A;  4YJ2 E;  4I0U A;  3UU6 A;  3F5H A;  5L3B B;  2KK7 A;  2XZR A;  2LSG A;  3ZT7 A;  4JPZ B;  3FXE A;  4HWD A;  2NPS D;  2XSA A;  3VHL A;  2LOP A;  4IRE A;  2EHO D;  3SFD A;  4AKG A;  1IFN A;  2KI7 B;  2KWI B;  4A97 A;  1NTM D;  1JTH B;  3TLV A;  5J2U E;  1G1J A;  2QJY B;  2CHN A;  2UU9 T;  4A7P A;  3L73 J;  3ZJ1 A;  3OVU A;  1YKH B;  5AFU L;  1R5S A;  2YO2 A;  2CPB A;  4N6J A;  5K5G B;  2WDV A;  5FVK A;  2X9X A;  1CUN A;  2QA7 A;  1W9R A;  3GA8 A;  5IUX A;  4JI6 T;  1D1C A;  3ANW B;  1XTG B;  4ZMD A;  2Q7C A;  3K8P C;  3MAC A;  3UUN A;  3L70 G;  1RF0 C;  2LOS A;  4LMK A;  1OMI A;  2R5D A;  5AQF B;  2BVL A;  2DCF A;  4WBO A;  2HLO A;  1Q82 Q;  3GLM A;  3SFE A;  1BGY G;  1N8R Q;  4RKU J;  2JMK A;  2JR8 A;  1BSH A;  2K1A A;  3AEA A;  2BCC J;  3AEB A;  2FJD A;  2X51 A;  1EXJ A;  5L3F B;  2PAJ A;  2X9H A;  3DTO A;  3RYC E;  4JI4 T;  2LR2 A;  5GON E;  4C46 A;  5HEG A;  4H44 B;  4ZZB A;  2QEX P;  1SQQ G;  1IFI A;  4Z8X A;  4GIF A;  1BDD A;  1PPJ G;  3CXH H;  4XFJ A;  2ZT9 D;  1FZE A;  3M91 A;  2VK9 A;  2YMK A;  2YO3 A;  1SQX G;  1VQK P;  4JI1 T;  1KIL D;  3OW2 O;  4N78 E;  4DR7 T;  3RBX A;  1WYC A;  3PUW F;  2D9D A;  2R6G F;  2Q9Q C;  3QC9 A;  3CCL P;  5CFB A;  5JRC A;  3M3Z B;  5HEJ A;  4DR1 T;  5TJH A;  3WUU A;  5LG4 A;  1SVF A;  2POH A;  2G8Y A;  1T8B A;  4Y99 B;  4PJ0 E;  3F31 A;  2FYN B;  4ASK A;  2D0U A;  1P84 E;  3F57 A;  2FJA A;  1IK9 A;  2C9L Y;  1KZU B;  1FE6 A;  2C5I T;  1SQB G;  3A3Y B;  1KC8 Q;  2NTX A;  1KQS O;  1HJB A;  3L72 G;  2XZE A;  2WZ7 A;  1ZHC A;  1FAV A;  3EWK A;  4RES B;  4WYV A;  2DL1 A;  3J7Y q;  3H1L G;  3PU8 A;  3L74 J;  4HFH A;  3OBV E;  3B5M A;  2L9Q A;  3AAI A;  1H0T A;  5TIS E;  2H89 A;  1MMG A;  1N7L A;  4TX5 A;  5AVR B;  2WIT A;  4TZ4 C;  4CXW A;  5CA0 E;  1VQ9 P;  4WBN E;  4YY3 T;  1FJK A;  2K9Y A;  4I2L C;  2B1E A;  4XAX B;  5DQV A;  4MAL A;  1SLQ A;  5KXJ A;  2UXX B;  1SQQ D;  2WMM A;  4D6T D;  1RHZ B;  5LMN T;  1YIT P;  3RK3 D;  4TWD A;  5HWY A;  3FZM B;  4LF6 T;  1FMW A;  2WSF H;  2WQY C;  5L8R J;  4EIW A;  1MZ9 A;  2PP6 A;  2D2C D;  2H43 A;  2IW5 B;  3BRV B;  4U3C A;  5A1L A;  4U7Y A;  1HH0 A;  3HD7 D;  2E75 C;  3V5U A;  2WU5 A;  4YSY A;  2ZYA A;  1GL2 A;  3RQW A;  3T97 A;  4DV2 T;  1GW3 A;  1NU1 J;  2OTK E;  1PGQ A;  4UEM A;  1USE A;  3CME P;  4UVA B;  4U74 A;  4DOJ A;  1UUS A;  2B76 A;  2IYO A;  1WRG A;  2YDQ A;  4YSX A;  4XA4 A;  1JY2 O;  1H89 A;  2WPR A;  3TGU D;  2ZVN B;  4HWF A;  2O1K A;  3K3N A;  2E5Y A;  3D6Z A;  4AI6 A;  5KLV E;  2YMY A;  4YHJ A;  1EZV G;  1JY3 P;  2VKO A;  3FZF B;  4IE7 A;  1JY2 P;  4DV5 T;  1S2E A;  3L71 G;  4PFP A;  3OTO T;  3RIU A;  3PH0 A;  2FYU J;  4E7S A;  2HN1 A;  4UB6 E;  3B57 A;  4PJJ A;  3IR9 A;  2KSR A;  2WS3 A;  3O6Q B;  1NTZ G;  3LK3 B;  1L0N G;  3CCM P;  4OX9 T;  3Q2M A;  3L75 E;  2WSS V;  3TLT A;  1J1J A;  1SQV E;  4DUZ T;  1JY2 N;  2OTJ P;  3M9Q A;  3ZMV B;  5AW9 B;  2A45 H;  1FU1 A;  1T8Z A;  1FC2 C;  2Y8D A;  5APT A;  5KAF H;  4JI2 T;  1JTH A;  2WSC J;  3SRZ A;  1M8O B;  5BR8 T;  1W5C E;  1MIV A;  2UXN B;  1VDF A;  3N9L A;  2AXC A;  1GU4 A;  4JI5 T;  3H1K D;  3PUR A;  5JTG A;  4DMW A;  1X9V A;  2E5L T;  1V9D A;  3RIF A;  1N32 T;  4H0L D;  3L35 A;  2WSS H;  3ANW A;  1RF0 A;  4KMC A;  3N9Q A;  4IL6 H;  4LFA T;  4ILU A;  5KX5 E;  5AQK B;  3PRJ A;  2X0H A;  3C4W A;  4IDN A;  4LFB T;  4L74 A;  2DWK A;  4U3F G;  1D0Y A;  3M9H A;  2WZH A;  1UX4 A;  3E1I A;  4Z90 A;  3VKG A;  1L0L E;  3H1J G;  2JQK A;  1HUC A;  2KP8 A;  2PTF A;  5BU8 B;  5BMV E;  3H1H D;  3CX5 D;  2XV5 A;  4QXC B;  4OVN F;  3M0D C;  1MV8 A;  4TV9 E;  1BE3 E;  4KJM A;  2LSY A;  3DP7 A;  4P09 A;  5LHI B;  1WR0 A;  1IJ6 A;  3FZK B;  1YQ3 C;  5AVS B;  1OVU A;  4JBZ A;  5AVW B;  4H9S E;  2NPS B;  3BK9 A;  2NPS C;  1QL1 A;  3PTR B;  3BQI A;  3ABV C;  2EHO C;  3P50 A;  5F3J A;  3AXJ B;  2BS2 A;  1GK4 A;  4IDQ A;  2JP3 A;  2Q9Q A;  2W8Z A;  1HNZ T;  3C1L A;  4ZOL E;  1N33 T;  1NTM E;  3W15 B;  3MD0 A;  2HFE D;  4O4L E;  1US7 B;  2UXD T;  1J1D C;  3TF5 A;  1WFD A;  3ZN1 B;  3EVY A;  4U2Y A;  3RL0 g;  3DJB A;  5ETW A;  4GIW A;  2A2F X;  1VQ5 P;  3TSI A;  3FZL B;  3NXS A;  2V8S V;  3PUZ F;  2WWV A;  1VQM P;  2ZM6 T;  2J59 M;  4QX7 B;  1KFM A;  1PFI A;  3EFF K;  1T2K D;  4PJN A;  1D1A A;  2VQE T;  1KOR A;  3BRT B;  4JV5 T;  3SWF A;  4PD4 D;  1BGY J;  5CB4 E;  5AW5 B;  2ZM0 A;  1YIJ P;  1WRD A;  3H1J D;  3U1A A;  1M90 Q;  1T7S A;  4B3S T;  2J1D G;  2V7Q J;  1AA0 A;  2E76 D;  5CJ5 A;  1HF8 A;  1W2E A;  2VQF T;  3RH3 A;  3RGL A;  1N7S B;  4UVC B;  4ERR A;  2AXT E;  3FXD A;  1HFA A;  3CQG B;  4DV0 T;  1IJD B;  1QVF O;  5J2T E;  4EYY Q;  4B86 A;  5APX A;  1NTK D;  4CN4 A;  2BCC G;  4NPD A;  5M1B A;  3RYI E;  2WQY A;  2ZT9 C;  3Q1M A;  3D0T A;  2WM9 A;  2IDB A;  4CN6 A;  4TWF A;  2WWW A;  2A72 A;  1SA0 E;  4X1Y E;  2LRL A;  1KIL C;  2ZLY A;  4DV3 T;  4ZS2 A;  4TNV A;  2HYN A;  2E5V A;  1KIL E;  3EAB A;  1URQ D;  3JCU H;  3K5B A;  3BCC G;  1YW0 A;  2IBZ D;  3PUX F;  3B8E B;  3FXE B;  3V2N A;  2LRK A;  5AQH B;  1VQP P;  4GDO A;  3WI3 A;  2ACX A;  5LJM A;  3ZMT B;  2BVM A;  1JO5 A;  4YXD C;  5AQN B;  2UWJ E;  1ZW0 A;  2JIW A;  3PTZ A;  5LGU B;  2W00 A;  3M06 A;  2IFM A;  2KS1 A;  4GOF A;  3B5N B;  2SPZ A;  3L73 D;  1KB9 H;  1LWU C;  1AVO A;  2YDS A;  4R4L A;  3L72 J;  1VQN P;  3B13 A;  3UUX B;  1CI6 B;  2QJP B;  3F89 A;  1P84 D;  2V6X A;  1YJN P;  3H1L J;  1NGM B;  3CWB G;  3NBX X;  5HEU A;  4DND A;  3O6Q A;  4ZKU A;  3V5B A;  3NVO A;  5AVY B;  4J2C A;  5BVZ A;  4KI0 F;  4IT4 A;  2OYH B;  3MA9 A;  5FYM A;  4PD4 I;  2OYH C;  2KZ7 B;  4QMA A;  5HXC A;  3T1Y T;  2ODU A;  4BJN A;  4RJT A;  1XZY A;  3LID A;  3Q5X A;  5LG3 A;  2Z4E A;  2KWH A;  3JAF A;  1Y01 A;  3F2E A;  4MFR A;  2WBL A;  3Q3D A;  2V7J A;  5CCH D;  1S9K D;  2VVN A;  1E1H B;  4EXT A;  4X20 E;  4DR3 T;  4ZHQ E;  1ZOY C;  1SQQ E;  3RK3 C;  4D6T E;  5FXV A;  1L4A D;  2BBH A;  4L9I A;  2ZYG A;  3RK3 E;  2IML A;  4TLF A;  2D2C C;  3CCU P;  1BR1 A;  3HD7 B;  1HX8 A;  3P4R A;  1QX8 A;  3HD7 C;  4OYK A;  3C8V A;  2NTY A;  5C2T A;  1KYO H;  2W67 A;  3AED C;  3RLF F;  3UQ4 A;  2MBG A;  1LT9 B;  3WU2 H;  4EOT A;  5IYZ E;  5E79 H;  2VKH A;  3HKB E;  1N86 A;  2IBZ I;  2CLY B;  2CLY C;  4UR9 A;  5FL1 A;  3CQX C;  4AQR D;  3FWN A;  3ZLI A;  3TGU E;  3P8M C;  2UUC T;  1NWQ A;  2P9B A;  2GUV A;  1NU1 G;  3KYQ A;  3E1R A;  2V7K A;  3M0D A;  2WAU A;  5L3G B;  1BCC J;  4EED A;  1SQB E;  2IC6 A;  3O1J A;  1YQ3 A;  1RQU A;  1MFZ A;  2A06 D;  2I8D A;  4QWN B;  1JUN A;  4I7Z C;  3W67 A;  1XNQ T;  1PGO A;  2NPS A;  2FJB A;  3ABV A;  2EHO A;  1NEN A;  1K05 A;  5GTI E;  4EV6 A;  2W0G A;  2A45 G;  3AXJ A;  4C7N A;  1X8Y A;  3L74 D;  5AW0 B;  5EK3 A;  3RRC A;  2HH7 A;  4CN1 A;  3N5L A;  2ITA A;  2M67 A;  1K04 A;  1YTZ I;  3PUG A;  2OTL P;  4HJG H;  5APW A;  1X22 A;  1FZB A;  1RQV A;  5CBN A;  2LM9 A;  4AQY T;  3G71 P;  2N1T D;  2QM7 A;  4E7Z A;  3H1K E;  5JDF A;  1JOC A;  3RI5 A;  2MPK A;  4H0L C;  2Z5H A;  2MYS A;  1FJG T;  2YNY A;  5L2L A;  3AEG C;  1XDP A;  2JKV A;  5GTH E;  3KDP B;  2HN2 A;  3A0H H;  2CK3 H;  3EDU A;  3ZMZ B;  1Q7Y Q;  4UB8 E;  4WW0 A;  4C91 A;  4U3F J;  4PK5 A;  3H1I G;  1S72 P;  3MK7 C;  4U72 A;  1OW8 A;  5HXR A;  3MZW B;  1UIX A;  4UXN B;  3Q5P A;  1GL2 B;  3B4S A;  3VU7 H;  2NRG A;  1M57 D;  3V6I A;  4TWH A;  4QH5 A;  2XY8 B;  3ZYM A;  2NP9 A;  4IE4 A;  2C5K T;  1FMV A;  3MZK B;  2J5U A;  3H1H E;  1RH5 B;  3I55 P;  2W83 C;  4HEA A;  3CX5 E;  3OJA A;  5APQ A;  4ZI7 E;  4OWF A;  1JCC A;  5LCY A;  5FY7 A;  2KLV A;  3PHL A;  3RYF E;  3GHG B;  1MMA A;  2JDI H;  4UF0 A;  1OFC X;  3GHG C;  4AYC A;  3PLN A;  2A9U A;  1FOS F;  1NAF A;  4H9P C;  1Z8U A;  2FYU D;  3RC8 A;  3PUV F;  2UXB T;  2VL8 A;  2HR3 A;  4DVD A;  3FHN A;  4EOZ B;  5AW7 B;  2VWA A;  4L5G A;  1R8I A;  2D0T A;  2Q3E A;  4EZH A;  2W63 A;  5ADX L;  4YXD A;  1LTS C;  4HKA A;  3S1K A;  3KBU A;  2O3J A;  2ZM8 A;  5FXW A;  4LMJ A;  2KYV A;  2QVA A;  1LWU A;  3B5N A;  3C64 A;  4TV8 E;  3UUM A;  2CXF A;  2W90 A;  2I0M A;  1JMB A;  1G1I A;  4YT0 A;  1T2K C;  3CCS P;  4YTM A;  2XM2 A;  3I1A A;  4H13 D;  1CI6 A;  1A02 J;  1JEK A;  5AVX B;  3LSV A;  1U7M A;  3SWY A;  3X1D A;  2RN0 A;  3KVA A;  4YHH T;  4PD4 E;  2OYH A;  4WY4 D;  1W0A A;  2RA1 A;  1XTC C;  1XWM A;  1UGO A;  3H1J E;  1MND A;  2NW8 A;  2E76 C;  3R2P A;  1FDO A;  1LNQ A;  3IBP A;  1FJP A;  5JVD E;  3AA0 B;  1MIY A;  5JDL A;  5AW2 B;  1NH4 A;  3CVR A;  1N36 T;  4HYT B;  3FZH B;  2P58 A;  4HFI A;  3L8R A;  1ZOY A;  4KBM B;  4ZI2 D;  2K5B B;  3A2A A;  3GMA A;  1G73 A;  2IC9 A;  4IE6 A;  2YU1 A;  1NTK E;  1FZC C;  2FXP A;  2WPV B;  2E9X D;  3I0O A;  2QM8 A;  2V4H A;  4GOE A;  2ZJS E;  2CXL A;  3HD7 A;  4JF7 A;  4WVZ A;  3OAK A;  1JMM A;  3WUV A;  1URQ B;  3VP8 A;  4L0R A;  4YLH A;  2BZB A;  2A45 I;  1URQ C;  3BCC J;  2BG9 C;  4ILA A;  2ZXE B;  4H9O C;  3AED A;  2BG9 E;  4PJL A;  4UEL A;  2OYI B;  1LT9 A;  2IBZ E;  3CD6 P;  1M1K Q;  3I9Y A;  5CBO A;  2OYI C;  4PV1 D;  2QE7 H;  2VKJ A;  4LF5 T;  5KJ7 D;  2KIN B;  2XPK A;  3RIA A;  3BVH A;  2Q9Q B;  1PIX A;  3O1H A;  3HE4 B;  2Q1K A;  4GK0 E;  3V2P A;  1AJY A;  2IHR 1;  1YJW P;  4O9B A;  2WU2 A;  4GOD A;  4DR6 T;  1W09 A;  4PW8 A;  1IAP A;  4N3Y B;  5FY0 A;  1KF6 A;  1Y64 B;  3L73 E;  5H6Q B;  2Y48 B;  5DAB A;  1DD4 A;  1OW7 A;  3OKQ A;  4HH2 A;  3CWB J;  3QB5 A;  2CHO A;  4O4H E;  1NJI Q;  3D70 A;  1D0X A;  2C0X A;  4I55 E;  5C3J A;  2YXR B;  3AE7 C;  5FXZ A;  1JCD A;  1ZP0 C;  1SQP K;  2IX7 C;  3L70 D;  1IFM A;  2ZXX A;  1SFC D;  1IFP A;  3ZYK A;  2JQQ A;  4QX8 B;  2VAS A;  1LTT C;  3Q5S A;  3EI0 A;  1XMO T;  4ADZ A;  1BGY D;  2P7J A;  1FEW A;  1YKE B;  3AA7 B;  4HWC A;  2M0B A;  4XZC A;  3U78 A;  5IWA T;  1S9K E;  1KTM A;  2DI4 A;  4IST A;  4ASW A;  1YHQ P;  3EHZ A;  3TKL B;  2KIK A;  4M3L A;  4IFM A;  2ZYD A;  1DD3 A;  2VRS A;  1H8A A;  4GOU A;  2WSF J;  1L4A C;  4C7R A;  2NOX A;  3FXD B;  1QLB A;  2WT7 B;  2CE7 A;  2A3D A;  1GTW A;  2OV9 A;  3GF7 A;  1VQ4 P;  3AEG A;  2HPJ A;  3RC3 A;  3UQ7 A;  4LC1 A;  1PPJ D;  1VQ6 P;  3LDQ B;  3QB5 K;  5AW6 B;  3P4S A;  2UUA T;  3C98 B;  3G4S P;  5L4H A;  3VTP C;  3KV4 A;  2XAF B;  1SQX D;  3E22 E;  2E75 B;  3CCV P;  2IYP A;  1S5L X;  2BDE A;  3UU3 A;  2I1J A;  1LVK A;  5J0Z A;  1Y9B A;  2YKS A;  1JY3 O;  4AQF C;  5APS A;  4JYA T;  4JI7 T;  2WCA A;  3PJA A;  1R8E A;  1FDM A;  5C8Y E;  3HKD E;  3G9R A;  1HBW A;  3KZI E;  2M6B A;  2K48 A;  4NXM T;  2NW7 A;  2KS1 B;  3AE6 C;  2A06 E;  3HA4 A;  4U7J A;  1QUU A;  1L0V A;  4Z1M H;  4X66 T;  3GHG A;  1SQB D;  2R32 A;  5FMN A;  2BKP A;  1BCC G;  3H6P A;  3L72 D;  2BEZ F;  4EDF A;  3HR0 A;  2F4V T;  1IBL T;  2W27 A;  3H1L D;  3MKD A;  4WZX A;  5LA6 E;  5H2F H;  3A8Y C;  1NVO A;  2KUB A;  2JRK A;  2N9D A;  3L74 E;  4GT1 A;  3TDK A;  1PP9 G;  4IDZ A;  1OVR A;  3MIW A;  1JY3 N;  2BKO A;  1JB0 J;  4QXB B;  2R3C A;  5DQW A;  2Y0E A;  3RGU A;  4DCK A;  1M62 A;  1SS1 A;  2VL0 A;  3NRX A;  2PG8 A;  3NMD A;  2N1T C;  4TUY E;  2Q9I A;  2WMN A;  2YU2 A;  2QJK C;  3C4X A;  3Q9D A;  2XQ4 A;  3FX0 A;  2L91 A;  1U57 A;  2H7O A;  1N2D C;  3P4W A;  4UIG A;  1EXI A;  2IZ1 A;  1RE3 C;  3HKC E;  2W62 A;  5CGM A;  1S5L E;  2HG5 D;  4XE5 B;  3A5T A;  3H1I J;  3NWI A;  5AQI B;  4Y28 J;  5AVZ B;  4U31 A;  3E7K A;  2XQA A;  5L47 A;  3BAS A;  5KKZ C;  2FY8 A;  2K3R A;  2KLQ A;  5JDH A;  2N2N A;  1VCS A;  3R84 B;  3QH9 A;  1H88 A;  2KZJ A;  5ABG A;  1CW5 A;  2KOG A;  2OGU A;  2QIW A;  5AW4 B;  4OHF A;  4HWH A;  3U1C A;  5CHX A;  1KB9 I;  2KXP B;  5LGT B;  3CKD A;  3GN5 A;  1ZV4 X;  1RE4 C;  4C90 A;  1EZV D;  1FDI A;  2ZAE B;  3CML A;  1FZC A;  2XNX A;  2KZI A;  4YTP C;  4BAY B;  4NPF X;  3L71 D;  3E08 A;  1BCC D;  3RK2 D;  4JI3 T;  4WWI A;  4MLK A;  4WBA A;  1WCR A;  4WNK A;  1NTZ D;  3AVR A;  5AW8 B;  2FYU E;  2LJL A;  4IDO A;  1L0N D;  2Q6Q A;  1URQ A;  1FZF A;  2BG9 A;  1LTG C;  4IIJ E;  2CM0 A;  3RKO A;  1WR6 A;  3KBT A;  3ZJ2 A;  2EHO B;  2OYI A;  2IPP A;  5AQQ B;  1VOM A;  5JDM A;  1LKX A;  3N2K E;  4JEH B;  4B3M T;  3VMA A;  1PZQ A;  4C7N B;  5AQT B;  5AQS B;  3HE4 A;  5HWX A;  2ZMA A;  4HFD A;  2YDR A;  1HTJ F;  1QGK B;  3R4Y A;  3Q5R A;  1J1D B;  3CCE P;  2AXT H;  4NPE A;  2W4X A;  1FS0 E;  2CPS A;  2W6B A;  4H13 C;  3P4P A;  3TLW A;  2CA5 A;  1NTK K;  2XQ7 A;  3QK6 A;  4X5T A;  3AE7 A;  3RL0 D;  3RBZ A;  1VRB A;  2YEV C;  4WY4 B;  1ZP0 A;  2ES0 A;  3L09 A;  4DT0 A;  4WY4 C;  4X62 T;  1IFJ A;  3JC2 2;  1VPC A;  4OYJ A;  3A7O A;  4ILC A;  1TU3 F;  2H7H A;  3NKZ A;  1ZEE A;  4V1A v;  2C0S A;  5KMG P;  2OAR A;  1L2P A;  4U3F D;  1DEE G;  4DR4 T;  2WPQ A;  1JNR A;  4YJ3 E;  4CI3 B;  1MMN A;  4KHX A;  4I1L A;  1S1C X;  5KAI E;  2XAS B;  4ZI2 C;  5ABH A;  4FI5 A;  2VKD A;  1L4A A;  5HXH A;  2E9X C;  1EZV I;  2WT7 A;  4EAH A;  3OJA B;  4CI2 B;  4EYU A;  5LGN B;  2LSI A;  1GMJ A;  3UU5 A;  2V6Y A;  2AXD S;  1ZLL A;  3ZCJ A;  3ZEF B;  4UF0 B;  2ZT9 B;  3Q2Y A;  2CEA A;  2UUB T;  2CBI A;  3M0A A;  1KK7 A;  3AE2 C;  3N2O A;  3MGN A;  1AVY A;  4TN7 B;  1KIL B;  4PV1 C;  4IFD K;  5KJ7 C;  2YK0 A;  1KNZ A;  3GW6 A;  2CCQ A;  5AQO B;  1ZR4 A;  4D6T J;  1LTJ C;  4O4J E;  3CLQ A;  2YIN A;  2DWG A;  1T72 A;  2KSE A;  4O2B E;  5HXE A;  4AQF A;  2UXC T;  3VMY A;  1SQP J;  3Q5D A;  1N73 B;  2P2U A;  2LKG A;  3I5C A;  1N73 C;  1WMK A;  1KNR A;  1IFD A;  1S94 A;  2M3E A;  3AE6 A;  4AKH A;  1UCU A;  4H44 D;  1LWU B;  1E79 H;  3PE0 A;  1LVF A;  2R44 A;  1VCT A;  1EDL A;  5AQU B;  3L70 E;  1JNZ A;  1SFC C;  5B5E E;  2D5U A;  4IE5 A;  2NWB A;  3TGU J;  3SFD C;  1BR4 A;  4ISS A;  2JWA A;  1SUM B;  1BGY E;  2H88 C;  4ASV A;  1Q90 D;  3JC6 D;  2P1J A;  3AEC C;  1K8A Q;  3RQU A;  3ONX A;  5LJN A;  1U4Q A;  3CK6 A;  2JPF A;  3H32 A;  2BKN A;  3AE3 C;  4IFF A;  4YSZ A;  2N1T A;  3WMM 0;  4MN4 C;  4NXN T;  1M56 D;  4OH8 B;  5KLV G;  4QH1 A;  3I0Q A;  4AIU A;  2D2S A;  3NZP A;  2E42 A;  2H8P D;  3UIA A;  3RK3 B;  3D71 A;  1FOS E;  1RE3 A;  3CXH D;  2BCC D;  5KLV K;  2XQ8 A;  4GYS A;  4DUY T;  2DNX A;  5EK4 A;  1FZA A;  1PPJ E;  2D2C B;  4DJG A;  1VF5 D;  1FBM A;  3L4F A;  4BWN A;  3CWZ B;  3WAK A;  2GM4 A;  5KDM C;  4CI1 B;  4GKK T;  1SQX E;  1HNW T;  1T98 A;  5CA1 E;  1SQV G;  3BCC D;  2YXQ B;  2XAJ B;  5GTI H;  2RMZ A;  2ZM2 A;  5ABE A;  3H1K J;  3BQL A;  3EAM A;  1SQV K;  4X1K E;  1Y47 A;  1OED C;  5LXT E;  3C51 A;  4DZO A;  1RE4 A;  1OED E;  4H9R C;  1UII A;  4IGU A;  2XQ3 A;  1E7P A;  2I59 A;  4I4T E;  4YTP A;  1U7J A;  3L36 A;  4LGD E;  3LBX A;  1T6A A;  4OGQ D;  2PGD A;  2Y0D A;  3CWB D;  3L72 E;  1IO4 A;  2C9N Y;  3HE5 B;  4I7Z B;  4IOI H;  3I9W A;  5GTH H;  2V26 A;  2OQQ A;  4DV4 T;  5LYJ E;  1OXZ A;  3H1L E;  2QA4 P;  2IUB A;  2LT3 A;  2OYO A;  4AKR B;  3A0B E;  1PP9 J;  2KNC A;  3V2R A;  5JH7 E;  3H1H J;  4UB8 H;  5APY A;  2X0L B;  1MFT A;  3MTU E;  4QKN A;  4P0B A;  1HS7 A;  3D6Y A;  4H9N C;  1AQT A;  2XQ6 A;  1AFO A;  1J2J B;  2MJZ A;  3OYZ A;  3PJA J;  3RX6 A;  4RO0 A;  3UTK A;  2NW9 A;  3FWL A;  3MUD C;  1L0L K;  4I50 E;  4LF7 T;  5EFW B;  5FVL A;  3CX5 H;  3Q5E A;  1M1J B;  2J58 A;  2CWO A;  5HXS A;  1Q86 Q;  3ESL A;  1M1J C;  3IAO A;  3KFW X;  1IJ5 A;  3CXH I;  4K35 A;  4H0L B;  1S35 A;  3MXZ A;  3CPW O;  2X66 A;  3L37 A;  5E79 E;  2G0U A;  4WY4 A;  5KLI B;  5APU A;  3SWK A;  3EQ2 A;  1G2C B;  1LP1 B;  5KLI C;  4O2A E;  3IFM A;  2OA5 A;  2PFX A;  3CC7 P;  2K24 A;  2LHR A;  2JEE A;  2ZVO B;  1HG2 A;  1NKN A;  2FFD C;  2JJ9 A;  3P32 A;  5CJ4 A;  1HF9 A;  1NTM G;  3USS A;  1YD8 G;  4KUM B;  5JR9 C;  4AIS A;  5CCG D;  2V7L A;  4EB6 E;  2K88 A;  3VP9 A;  1NU1 D;  3ZYL A;  1NTM K;  4YPC A;  2LSJ A;  1IZN B;  2DHR A;  2E9X A;  1EZV E;  3RK2 B;  3NTN A;  4Z91 A;  2N1G A;  3RK2 C;  5LOV E;  3VR9 A;  4PNI A;  3L71 E;  3LW5 J;  4I43 B;  1BCC E;  2J47 A;  1BR2 A;  3O9X A;  1NTZ E;  2ODV A;  3TLS A;  1L0N E;  1KFN A;  3AE2 A;  2QRX A;  2IZ0 A;  2XJ7 A;  3CQC B;  2L8K A;  3LG7 A;  4HFV A;  3RHW A;  3JAE A;  1KIL A;  2I6H A;  5KJ7 A;  5ABF B;  1W0B A;  3LW5 H;  3GG2 A;  2E5T A;  4P0A A;  2WTY A;  3N9P A;  2PFV A;  4OFZ A;  5F5W A;  3AE8 C;  1B7T A;  1BDC A;  4HTE A;  3UFG A;  1LTJ A;  3ETU A;  1NTK J;  2FKW B;  5DJT B;  5FL0 A;  3KV5 A;  1E2A A;  4IL9 A;  3ITK A;  2W6A A;  3G3Z A;  2HPC B;  1N73 A;  3N7N A;  4LLH A;  4W80 A;  5FY1 A;  3LIE A;  3A0H E;  5H6R B;  3V2Q A;  4MBQ A;  3RL0 C;  3IF4 A;  1HNX T;  4L76 A;  5B66 E;  3AAA B;  4EYY R;  3KVB A;  2IAK A;  1K73 Q;  1RF1 B;  1RF1 C;  4K0K T;  1SFC A;  5JRE A;  4W7Y A;  3H1I D;  2JWD A;  1VQL P;  5HCJ A;  3M65 A;  3MJX A;  4U7I A;  2H88 A;  4U3F E;  3AEC A;  2GK9 A;  1JNM A;  1X0T A;  1NAY A;  4ZI3 D;  2E76 B;  2QJY C;  4R4M A;  2WP9 A;  3ETV A;  2O1J A;  3AE3 A;  4EZ4 A;  3ONJ A;  1Q81 Q;  2LEH A;  4CPG A;  1OIP A;  2E43 A;  1KFY A;  3GF3 A;  3CX6 B;  3GN5 B;  5HYA A;  3SS1 A;  1X9B A;  3U59 A;  1LT1 A;  2YKQ A;  3G6E P;  4PK6 A;  1FZC B;  2V5C A;  4L73 A;  3ZPO A;  4PJ0 H;  3C50 A;  1ZRT D;  2B9B A;  1EDK A;  4X64 T;  2BEQ D;  1P84 H;  3CX8 B;  3ZN0 B;  4JEU B;  3TLU A;  1OX3 A;  2V7M A;  3ZKR A;  2BG9 B;  2V5D A;  1D1B A;  5HAX A;  3S9O A;  1IC2 A;  3O8Z A;  3UUB A;  4AKI A;  1RY3 A;  1UK5 A;  3PUY F;  3RKG A;  5TIS H;  1OED A;  2G3A A;  1N7S D;  1XDO A;  4GYR A;  1BSN A;  4DR5 T;  2K37 A;  2SPC A;  4LF9 T;  4GK5 E;  4H44 C;  2K9J A;  4D6T G;  2HPL A;  4QHO A;  3ZMS B;  4JBW F;  1Z56 A;  2HOD B;  5LBM A;  1Q2N A;  2RP4 A;  3FBZ A;  5F8P A;  3PUA A;  2M5A A;  1SQQ K;  3VMX A;  5M4Y A;  1SQP G;  3HE5 A;  4A56 A;  4QH4 A;  3L3P A;  4DR2 T;  3JSV C;  3JC6 C;  2AEM A;  1SQX K;  5AQG B;  4DV6 T;  3TK1 A;  3A5X A;  3N9M A;  1ZME C;  3QNU A;  1OW6 A;  3CCJ P;  3IEE A;  2JO1 A;  3KPE A;  5JDG A;  5IHY A;  2XQ5 A;  1KNP A;  3TGU G;  3QWO C;  2WPS A;  5KLV J;  5CCH C;  1DU2 A;  3V4Q A;  3MUD A;  3R6N A;  4Y99 C;  2FYN C;  2LXB A;  5AQR B;  1E5W A;  2QG4 A;  2CWY A;  2CPT A;  1M1J A;  1L4A B;  3B5N D;  1EDJ A;  4H63 V;  1VF5 B;  3CXH E;  3KZI H;  2BCC E;  1Z0P A;  1VF5 C;  2LXC B;  1S3J A;  1SQB K;  5KTB A;  3L75 J;  3AEE C;  3ZDM A;  1J5W A;  1ZN5 A;  2V6Y B;  2NZ2 A;  4BA9 A;  4G63 A;  1G2C A;  1LP1 A;  3KQG A;  1SQV J;  1BR0 A;  4HWI B;  4UB6 H;  3I56 P;  1WYB A;  1XMQ T;  2JJL A;  3BCC E;  2WB5 A;  2FFD A;  1T3U A;  2MAW A;  3W68 A;  1I94 T;  1CZQ A;  1R5L A;  3UFE A;  2RPA A;  2Q5U A;  3AEF C;  3CPZ A;  4O8S A;  5JR9 A;  3G06 A;  1J5E T;  3N4X A;  3P7I A;  2X9Y A;  4NUV A;  3RPU A;  4H63 H;  3VMZ A;  1H7C A;  1KB9 D;  3PDY A;  3HUS B;  4BXL A;  1O3X A;  3H1K G;  3HUS C;  3SOL A;  4DO0 A;  2FXO A;  4OGQ B;  3AE9 C;  5JQG E;  1IBK T;  2AEF A;  1SQP D;  4OGQ C;  2K3W A;  3QUJ A;  3P8C D;  1USD A;  4HE8 A;  2P67 A;  2N9Y B;  3CWB E;  1YYC A;  4K3A A;  3EDV A;  2WWU A;  3L39 A;  1S5L H;  2LKM A;  4PK4 A;  4AUW A;  1L0L J;  2N9B A;  1PV3 A;  5ABF A;  1NWM X;  1LJ2 A;  4HFC A;  3AE8 A;  3UUL A;  2KND A;  5JDQ A;  5E0O A;  4HN9 A;  2IDO B;  1KQF B;  2B88 A;  3H1H G;  2GUS A;  1YI2 P;  4IHJ E;  3CMA P;  3H32 B;  2WDR A;  4I6M C;  3PU3 A;  3VRB A;  1BE3 J;  2YKP A;  2N1T B;  4W7Z A;  2MOZ A;  2HPC A;  5DJU B;  2QJK B;  3AE4 C;  4L75 A;  3RRW A;  3ZCI A;  5HEH A;  1M7K A;  2WZI A;  2YIU B;  1J1E B;  1NOH A;  4K0U A;  5AQM B;  3VRA A;  3ZST A;  2YIU C;  1J1E C;  1KQG B;  1RF1 A;  3HTK B;  5FP3 A;  4DID B;  2ACZ A;  1NTZ K;  1KYO D;  2PBI A;  2JQ9 A;  1L0N K;  1LTB C;  5L4E A;  5KKZ B;  1NTM J;  1CSB A;  4IL6 X;  1NEK A;  3EFG A;  5CCG C;  2Y6X A;  2YKO A;  1A02 F;  3KV9 A;  3FGA D;  2RKL A;  2FYZ A;  1SP4 A;  2GA1 A;  2Z5I A;  1HX1 B;  2XUE A;  4CQI A;  3NRY A;  1NU1 E;  1GQE A;  2VUR A;  1KEY A;  3IA3 A;  4H9Q C;  3CC4 P;  1KD1 Q;  2E74 D;  1YJ9 P;  3S4U A;  3E0Z A;  4AQG A;  4EI2 A;  2WSC H;  3AE1 C;  5EK2 A;  2M8R A;  2B87 B;  3AE5 C;  1MNE A;  2CMR A;  3HKE E;  1UX5 A;  2J4G A;  3A7M A;  4F8H A;  3CI9 A;  5H2F E;  3BQK A;  1YQ4 C;  3LBX B;  2KLU A;  4A98 A;  2J62 A;  2M3B A;  3KV6 A;  4KT0 J;  4HFB A;  2FBW C;  2FJE A;  3QOF A;  1DX7 A;  3HI2 A;  4HB1 A;  1VL2 A;  1YBK A;  2KNC B;  1GL2 D;  5C39 A;  5KAF E;  1PP9 D;  3UU4 A;  3SWH A;  2CRB A;  1U5P A;  5AQP B;  3CIR A;  5AVT B;  4IDP A;  1AJ3 A;  3CCR P;  2WSE J;  1SHZ C;  1FIO A;  2RH0 A;  2LM2 A;  3U3I A;  4DV1 T;  5KAI H;  3IF8 B;  2HHH T;  4BRY B;  4JI0 T;  1K9M Q;  2NR4 A;  1NTK G;  2JMH A;  4PFO A;  2HOD A;  4TT3 H;  1YXR A;  4H13 B;  3ZT5 A;  4U33 A;  4IL6 E;  1DH3 A;  4UV8 B;  1HG5 A;  2X9W A;  5HCM A;  3H25 A;  2WSE H;  5AW3 B;  5HEO A;  3OPC A;  1HGV A;  1VQ7 P;  1KYO I;  5FXX A;  1NYH A;  1X79 B;  5J1G A;  5BU5 A;  2M6I A;  3H1I E;  3H3M A;  2XDJ A;  1VQO P;  2AEJ A;  2IBZ G;  3WUT A;  4ZI3 C;  4ZNC A;  2XTL A;  2QGS A;  2C5J A;  5AVV B;  2IIU A;  2XND H;  5CCH A;  2Q3I A;  5LHG B;  4AXP A;  1VQ8 P;  2XAQ B;  3EUH A;  4M1P A;  2OLT A;  4JI8 T;  2XQY A;  3L73 G;  4U2Z A;  3L70 J;  4JYB A;  2E9X B;  1HCI A;  3H3A A;  4B3R T;  2W6J H;  1IBM T;  1CHU A;  2V7I A;  4O4I E;  4B3T T;  3AEE A;  2WY2 A;  1ZRT E;  1MMD A;  4EIJ A;  4GKG A;  5LP6 E;  2L3L A;  2BAS A;  4LF8 T;  5AW1 B;  5B5E H;  1LRZ A;  4PJM A;  4Q25 A;  1UUR A;  2PJQ A;  4NIQ A;  1ZKE A;  4NPP A;  1FZG A;  2FXM A;  4PV1 B;  2X67 A;  2WVR A;  3AEF A;  1N7S C;  3CX5 I;  4ZKP A;  3P4Q A;  1LTJ B;  3CL3 D;  1SQQ J;  3V5S A;  5FNV E;  3T1H T;  3AA6 B;  2WDQ A;  2V7Q H;  3HUS A;  2WMO A;  3CX7 B;  3AE9 A;  1I6Z A;  3AB3 B;  2K9A A;  3TNU B;  5TAO A;  2R5B A;  4G2A A;  1SQX J;  3VOP A;  5JDN A;  5AVQ B;  3PUQ A;  5EZY E;  3UT5 E;  1LTI C;  3VR8 A;  2W61 A;  3PV0 F;  4FJO A;  5CMZ A;  4X1I E;  2VB6 A;  3ZMU B;  3K1S A;  1OWA A;  1SFC B;  5LMU T;  1ZR2 A;  4HFE A;  2CXD A;  5AQL B;  4N78 D;  3Q5W A;  3BAT A;  2KMF A;  5LNK A;  5DJQ C;  1HWT C;  1SE7 A;  1QLE D;  4AKL A;  4GKJ T;  2Q9Q D;  4HGA A;  1N34 T;  3N9N A;  4EEB A;  5LHH B; 
#chains in the Genus database with same CATH homology
 5APV A;  3B5N C;  1GU5 A;  2DLR A;  1GK6 A;  1KQL A;  3LFM A;  3LK4 2;  3HTK A;  4BJM A;  3N2G E;  4NUU A;  4UVB B;  4CXY A;  5L3C B;  1D0Z A;  2IFN A;  5CCG A;  3O1I A;  2LE8 A;  3M9B A;  3AVS A;  2LHN A;  3FBL A;  3LK2 B;  2KSJ A;  2H3R A;  3H37 A;  4ANJ A;  1GW4 A;  1LGH B;  3P8C E;  3O4X E;  1NO4 A;  3HRN A;  2XKM A;  3RYH E;  1MIW A;  4DMV A;  3VKH A;  3C9I A;  5L3D B;  3V4W A;  1M7L A;  1HGZ A;  2Z6E A;  4QXH B;  1LT9 C;  2L5G B;  3LJC A;  1QSD A;  3AA1 B;  1GDT A;  3K3Q C;  2E8I A;  1EZ3 A;  1NKZ B;  4YFS A;  3T8O A;  1G8X A;  1YTZ T;  4IE0 A;  5JRC B;  1DEB A;  1MUU A;  1NU1 K;  2LSK A;  2V1D B;  1GZL A;  4JLE A;  3J9X 1;  2X68 A;  2ZFC A;  3TYY A;  3FB2 A;  4JYC A;  3AAE B;  4JUY A;  4DBQ A;  3ZC1 A;  3P7K A;  3VYI A;  2C0W A;  3II6 A;  4ZS3 A;  3N9O A;  4OK0 A;  1HTL C;  1ZV8 A;  1X79 A;  4XBF B;  5CJ0 A;  4MHC A;  2FYU K;  3PUS A;  3C4Z A;  3PP5 A;  2XHE B;  1WT6 A;  3NZQ A;  2MTQ A;  2FFD B;  5L3E B;  1GD2 E;  5JR9 B;  4DBR A;  2KB7 P;  4B6X A;  3KIN B;  1T3J A;  1HVV A;  1EQ7 A;  4KP3 C;  4CXX A;  1WLX A;  2KT9 A;  2XAH B;  2XAG B;  3GWH A;  3ZC0 A;  3WAJ A;  3GMI A;  3HL6 A;  2O01 H;  1GL2 C;  3IHR A;  3OYX A;  4PAG A;  2XU6 A;  4WB4 A;  5LBQ B;  3K3O A;  1AQ5 A;  1N7S A;  1NHL A;  1QL2 A;  3VN0 A;  4CZZ B;  4UV9 B;  1LTA C;  2H7V C;  3KDS E;  3OA7 A;  3TNU A;  5AVU B;  2I1K A;  3RL0 B;  3NFQ A;  4YJ2 E;  5L3B B;  2XZR A;  2LSG A;  2NPS D;  3VHL A;  2LOP A;  2EHO D;  4AKG A;  1IFN A;  2KWI B;  1JTH B;  5J2U E;  1G1J A;  3ZJ1 A;  1YKH B;  5AFU L;  2YO2 A;  2CPB A;  4N6J A;  2X9X A;  1CUN A;  2QA7 A;  3GA8 A;  1D1C A;  3ANW B;  1XTG B;  2Q7C A;  3K8P C;  3MAC A;  3UUN A;  1RF0 C;  2LOS A;  2R5D A;  2BVL A;  2DCF A;  4WBO A;  2HLO A;  2JMK A;  2X51 A;  5L3F B;  2PAJ A;  2X9H A;  3DTO A;  3RYC E;  5GON E;  4C46 A;  1IFI A;  4Z8X A;  4GIF A;  3M91 A;  1FZE A;  2VK9 A;  2YO3 A;  1KIL D;  4N78 E;  1WYC A;  2Q9Q C;  3QC9 A;  5JRC A;  5LG4 A;  1SVF A;  2POH A;  4Y99 B;  3F31 A;  4ASK A;  2D0U A;  3F57 A;  1IK9 A;  2C9L Y;  1KZU B;  2C5I T;  3A3Y B;  2NTX A;  1HJB A;  2WZ7 A;  1ZHC A;  1FAV A;  4RES B;  3J7Y q;  3PU8 A;  3OBV E;  2L9Q A;  3AAI A;  1MMG A;  1N7L A;  4TX5 A;  5AVR B;  2WIT A;  4TZ4 C;  4CXW A;  5CA0 E;  4WBN E;  1FJK A;  4I2L C;  2B1E A;  4XAX B;  5DQV A;  4MAL A;  1SLQ A;  2UXX B;  3RK3 D;  5HWY A;  1FMW A;  2WSF H;  4EIW A;  1MZ9 A;  2PP6 A;  2H43 A;  2IW5 B;  3BRV B;  5A1L A;  1HH0 A;  3HD7 D;  3V5U A;  1GL2 A;  3T97 A;  1GW3 A;  4UEM A;  4UVA B;  4U74 A;  4DOJ A;  1WRG A;  4XA4 A;  1JY2 O;  1H89 A;  2WPR A;  2O1K A;  3K3N A;  4AI6 A;  2YMY A;  4YHJ A;  1JY3 P;  2VKO A;  4IE7 A;  1JY2 P;  4PFP A;  4E7S A;  3B57 A;  4PJJ A;  3IR9 A;  3LK3 B;  3Q2M A;  2WSS V;  1JY2 N;  3M9Q A;  3ZMV B;  5AW9 B;  2A45 H;  1FU1 A;  1T8Z A;  2Y8D A;  5APT A;  3SRZ A;  1JTH A;  1MIV A;  2UXN B;  1VDF A;  3N9L A;  1GU4 A;  3PUR A;  4DMW A;  1X9V A;  1V9D A;  3L35 A;  3ANW A;  1RF0 A;  4KMC A;  3N9Q A;  4ILU A;  5KX5 E;  3C4W A;  2DWK A;  1D0Y A;  3M9H A;  1UX4 A;  3E1I A;  3VKG A;  1HUC A;  2KP8 A;  5BU8 B;  5BMV E;  2XV5 A;  4QXC B;  3M0D C;  1MV8 A;  4TV9 E;  3DP7 A;  2LSY A;  4P09 A;  5LHI B;  1IJ6 A;  5AVS B;  5AVW B;  4H9S E;  2NPS B;  3BK9 A;  2NPS C;  1QL1 A;  3PTR B;  3BQI A;  2EHO C;  5F3J A;  1GK4 A;  2Q9Q A;  4ZOL E;  3W15 B;  3MD0 A;  2HFE D;  4O4L E;  1US7 B;  1J1D C;  3ZN1 B;  3EVY A;  3DJB A;  5ETW A;  4GIW A;  2A2F X;  3TSI A;  3NXS A;  2J59 M;  4QX7 B;  1KFM A;  1PFI A;  1T2K D;  4PJN A;  1D1A A;  3BRT B;  3SWF A;  5CB4 E;  5AW5 B;  2ZM0 A;  1WRD A;  3U1A A;  2J1D G;  1HF8 A;  1W2E A;  3RH3 A;  1N7S B;  4UVC B;  4ERR A;  1HFA A;  3CQG B;  1IJD B;  5J2T E;  4B86 A;  5APX A;  3RYI E;  3D0T A;  2WM9 A;  2WWW A;  2A72 A;  1SA0 E;  4X1Y E;  1KIL C;  2ZLY A;  4ZS2 A;  2HYN A;  1URQ D;  1YW0 A;  3B8E B;  3FXE B;  3V2N A;  3WI3 A;  2ACX A;  5LJM A;  3ZMT B;  2BVM A;  1JO5 A;  5LGU B;  2W00 A;  3M06 A;  2IFM A;  3B5N B;  1LWU C;  3B13 A;  3UUX B;  1CI6 B;  3NBX X;  4DND A;  4ZKU A;  3V5B A;  5AVY B;  4J2C A;  5BVZ A;  2OYH B;  3MA9 A;  5FYM A;  2OYH C;  2KZ7 B;  5HXC A;  2ODU A;  4BJN A;  3LID A;  3Q5X A;  2Z4E A;  2KWH A;  3F2E A;  4MFR A;  2WBL A;  2V7J A;  5CCH D;  1S9K D;  1E1H B;  4EXT A;  4X20 E;  4ZHQ E;  3RK3 C;  5FXV A;  1L4A D;  4L9I A;  1BR1 A;  3HD7 B;  1HX8 A;  4OYK A;  3HD7 C;  2NTY A;  2MBG A;  1LT9 B;  4EOT A;  5IYZ E;  2VKH A;  3HKB E;  1N86 A;  2CLY B;  2CLY C;  3CQX C;  4AQR D;  3ZLI A;  3P8M C;  1NWQ A;  2P9B A;  2GUV A;  3KYQ A;  2V7K A;  3M0D A;  2WAU A;  5L3G B;  2IC6 A;  3O1J A;  1MFZ A;  4QWN B;  1JUN A;  2NPS A;  2EHO A;  2W0G A;  2A45 G;  4C7N A;  1X8Y A;  5AW0 B;  5EK3 A;  3RRC A;  2HH7 A;  3N5L A;  2M67 A;  1YTZ I;  3PUG A;  5APW A;  1FZB A;  2LM9 A;  2N1T D;  2QM7 A;  4E7Z A;  5JDF A;  1JOC A;  2Z5H A;  2MYS A;  2YNY A;  5L2L A;  3KDP B;  3EDU A;  3ZMZ B;  4WW0 A;  4C91 A;  4PK5 A;  3MK7 C;  4U72 A;  5HXR A;  4UXN B;  1GL2 B;  3VU7 H;  3ZYM A;  2NP9 A;  4IE4 A;  2C5K T;  1FMV A;  3MZK B;  4HEA A;  3OJA A;  5APQ A;  4ZI7 E;  1JCC A;  5LCY A;  5FY7 A;  2KLV A;  3RYF E;  3GHG B;  1MMA A;  4UF0 A;  3GHG C;  4AYC A;  1FOS F;  1NAF A;  4H9P C;  3RC8 A;  2VL8 A;  4DVD A;  3FHN A;  4EOZ B;  5AW7 B;  2VWA A;  4L5G A;  2D0T A;  4EZH A;  2W63 A;  5ADX L;  1LTS C;  4HKA A;  3KBU A;  2ZM8 A;  5FXW A;  2KYV A;  1LWU A;  3B5N A;  3C64 A;  4TV8 E;  3UUM A;  2CXF A;  1G1I A;  1T2K C;  3I1A A;  1CI6 A;  1A02 J;  5AVX B;  3SWY A;  3KVA A;  2OYH A;  4WY4 D;  2RA1 A;  1XTC C;  1MND A;  2NW8 A;  3R2P A;  3IBP A;  1FJP A;  5JVD E;  3AA0 B;  1MIY A;  5JDL A;  5AW2 B;  1NH4 A;  3CVR A;  4HYT B;  4KBM B;  4ZI2 D;  2K5B B;  3A2A A;  2IC9 A;  1G73 A;  4IE6 A;  2YU1 A;  1FZC C;  2E9X D;  3I0O A;  2QM8 A;  2CXL A;  3HD7 A;  4JF7 A;  3OAK A;  1JMM A;  1URQ B;  3VP8 A;  4L0R A;  4YLH A;  2BZB A;  2A45 I;  1URQ C;  2ZXE B;  4H9O C;  4PJL A;  4UEL A;  2OYI B;  1LT9 A;  3I9Y A;  2OYI C;  2VKJ A;  5KJ7 D;  2KIN B;  3BVH A;  2Q9Q B;  3O1H A;  3HE4 B;  4GK0 E;  3V2P A;  4O9B A;  4PW8 A;  1IAP A;  4N3Y B;  5FY0 A;  1Y64 B;  5H6Q B;  2Y48 B;  5DAB A;  3OKQ A;  4HH2 A;  4O4H E;  1D0X A;  2C0X A;  4I55 E;  5FXZ A;  1JCD A;  1SQP K;  2IX7 C;  1IFM A;  1SFC D;  3ZYK A;  2JQQ A;  4QX8 B;  2VAS A;  1LTT C;  4ADZ A;  2P7J A;  1FEW A;  1YKE B;  3AA7 B;  4XZC A;  3U78 A;  1S9K E;  2DI4 A;  4IST A;  3TKL B;  4M3L A;  4IFM A;  4GOU A;  2VRS A;  1H8A A;  1L4A C;  4C7R A;  2NOX A;  3FXD B;  2WT7 B;  2CE7 A;  2A3D A;  1GTW A;  2HPJ A;  3RC3 A;  4LC1 A;  5AW6 B;  3C98 B;  3VTP C;  3KV4 A;  2XAF B;  3E22 E;  2BDE A;  2I1J A;  1LVK A;  1JY3 O;  4AQF C;  5APS A;  1FDM A;  5C8Y E;  3HKD E;  1HBW A;  2K48 A;  2NW7 A;  3HA4 A;  1QUU A;  3GHG A;  2R32 A;  5FMN A;  3H6P A;  3HR0 A;  2W27 A;  3MKD A;  5LA6 E;  2JRK A;  2N9D A;  4GT1 A;  4IDZ A;  3MIW A;  1JY3 N;  4QXB B;  2R3C A;  5DQW A;  3NRX A;  2PG8 A;  3NMD A;  2N1T C;  4TUY E;  2Q9I A;  2WMN A;  2YU2 A;  3C4X A;  3Q9D A;  2H7O A;  1N2D C;  4UIG A;  1RE3 C;  3HKC E;  2W62 A;  2HG5 D;  4XE5 B;  3A5T A;  5AVZ B;  3BAS A;  2KLQ A;  5JDH A;  2N2N A;  3R84 B;  1H88 A;  1CW5 A;  2KOG A;  5AW4 B;  4OHF A;  3U1C A;  5CHX A;  2KXP B;  5LGT B;  3CKD A;  3GN5 A;  1ZV4 X;  1RE4 C;  4C90 A;  3CML A;  1FZC A;  2XNX A;  4BAY B;  3E08 A;  3RK2 D;  4MLK A;  4WBA A;  4WNK A;  3AVR A;  5AW8 B;  2LJL A;  1URQ A;  1FZF A;  1LTG C;  4IIJ E;  2CM0 A;  3RKO A;  1WR6 A;  3KBT A;  3ZJ2 A;  2EHO B;  2OYI A;  2IPP A;  1VOM A;  5JDM A;  1LKX A;  3N2K E;  4JEH B;  4C7N B;  3HE4 A;  5HWX A;  2ZMA A;  1HTJ F;  1J1D B;  2CPS A;  2W6B A;  2CA5 A;  1NTK K;  3QK6 A;  3RL0 D;  1VRB A;  2YEV C;  4WY4 B;  2ES0 A;  3L09 A;  4WY4 C;  1IFJ A;  4OYJ A;  1VPC A;  3A7O A;  2H7H A;  1ZEE A;  4V1A v;  2C0S A;  5KMG P;  2OAR A;  2WPQ A;  4YJ3 E;  4CI3 B;  1MMN A;  4KHX A;  4I1L A;  2XAS B;  4ZI2 C;  4FI5 A;  2VKD A;  1L4A A;  5HXH A;  2E9X C;  2WT7 A;  4EAH A;  3OJA B;  4CI2 B;  4EYU A;  5LGN B;  2LSI A;  1ZLL A;  3ZCJ A;  3ZEF B;  4UF0 B;  2CEA A;  3M0A A;  1KK7 A;  3N2O A;  3MGN A;  4TN7 B;  1KIL B;  4IFD K;  5KJ7 C;  2YK0 A;  1KNZ A;  2CCQ A;  1ZR4 A;  1LTJ C;  4O4J E;  3CLQ A;  2YIN A;  2DWG A;  4O2B E;  5HXE A;  4AQF A;  3VMY A;  1N73 B;  2P2U A;  3I5C A;  1N73 C;  1S94 A;  1IFD A;  4AKH A;  1UCU A;  1LWU B;  3PE0 A;  1LVF A;  1SFC C;  2D5U A;  4IE5 A;  2NWB A;  1BR4 A;  4ISS A;  3JC6 D;  2P1J A;  3ONX A;  5LJN A;  1U4Q A;  2JPF A;  3H32 A;  4IFF A;  2N1T A;  3WMM 0;  4OH8 B;  3I0Q A;  2D2S A;  3NZP A;  2E42 A;  2H8P D;  3UIA A;  3RK3 B;  1FOS E;  1RE3 A;  5KLV K;  4GYS A;  2DNX A;  5EK4 A;  1FZA A;  1FBM A;  3L4F A;  3CWZ B;  3WAK A;  2GM4 A;  5KDM C;  4CI1 B;  1T98 A;  5CA1 E;  2XAJ B;  2ZM2 A;  3BQL A;  1SQV K;  4X1K E;  5LXT E;  3C51 A;  4DZO A;  1RE4 A;  4H9R C;  4IGU A;  2I59 A;  4I4T E;  3L36 A;  4LGD E;  3LBX A;  1IO4 A;  2C9N Y;  3HE5 B;  3I9W A;  2V26 A;  5LYJ E;  1OXZ A;  4AKR B;  2LT3 A;  3V2R A;  5JH7 E;  5APY A;  2X0L B;  3MTU E;  4QKN A;  4P0B A;  1HS7 A;  4H9N C;  1AFO A;  1J2J B;  2MJZ A;  3OYZ A;  3RX6 A;  3UTK A;  2NW9 A;  1L0L K;  4I50 E;  1M1J B;  2J58 A;  2CWO A;  5HXS A;  3ESL A;  1M1J C;  3KFW X;  1IJ5 A;  1S35 A;  3MXZ A;  2X66 A;  3L37 A;  2G0U A;  4WY4 A;  5APU A;  3EQ2 A;  1G2C B;  4O2A E;  3IFM A;  2OA5 A;  2K24 A;  2LHR A;  2JEE A;  1HG2 A;  1NKN A;  2FFD C;  2JJ9 A;  3P32 A;  5CJ4 A;  1YD8 G;  4KUM B;  5JR9 C;  5CCG D;  2V7L A;  4EB6 E;  3ZYL A;  3VP9 A;  1NTM K;  2LSJ A;  1IZN B;  2DHR A;  2E9X A;  3RK2 B;  3NTN A;  2N1G A;  3RK2 C;  5LOV E;  4PNI A;  4I43 B;  1BR2 A;  3O9X A;  2ODV A;  1KFN A;  3CQC B;  2L8K A;  3LG7 A;  4HFV A;  1KIL A;  5KJ7 A;  3LW5 H;  4P0A A;  2WTY A;  3N9P A;  2PFV A;  4OFZ A;  1B7T A;  4HTE A;  1LTJ A;  3ETU A;  2FKW B;  3KV5 A;  2W6A A;  3G3Z A;  2HPC B;  1N73 A;  3N7N A;  4LLH A;  4W80 A;  5FY1 A;  3LIE A;  5H6R B;  3V2Q A;  4MBQ A;  3RL0 C;  3AAA B;  4EYY R;  3KVB A;  2IAK A;  1RF1 B;  1RF1 C;  1SFC A;  5JRE A;  4W7Y A;  3M65 A;  3MJX A;  2GK9 A;  1JNM A;  4ZI3 D;  3ETV A;  2O1J A;  4EZ4 A;  2LEH A;  2E43 A;  3CX6 B;  3GN5 B;  5HYA A;  3SS1 A;  3U59 A;  2YKQ A;  4PK6 A;  1FZC B;  3ZPO A;  3C50 A;  3CX8 B;  3ZN0 B;  4JEU B;  2V7M A;  5HAX A;  1D1B A;  1IC2 A;  3O8Z A;  4AKI A;  1RY3 A;  1N7S D;  4GYR A;  2SPC A;  4GK5 E;  2HPL A;  4QHO A;  3ZMS B;  1Z56 A;  2HOD B;  5LBM A;  2RP4 A;  3FBZ A;  5F8P A;  3PUA A;  3VMX A;  1SQQ K;  5M4Y A;  3HE5 A;  4A56 A;  3L3P A;  3JC6 C;  1SQX K;  3TK1 A;  3A5X A;  3N9M A;  3IEE A;  3KPE A;  5JDG A;  5IHY A;  5CCH C;  2WPS A;  3V4Q A;  3MUD A;  3R6N A;  4Y99 C;  1E5W A;  2CWY A;  1M1J A;  1L4A B;  3B5N D;  4H63 V;  1Z0P A;  1SQB K;  5KTB A;  1ZN5 A;  4BA9 A;  4G63 A;  1G2C A;  3KQG A;  1BR0 A;  1WYB A;  2JJL A;  2FFD A;  1T3U A;  1CZQ A;  3UFE A;  2Q5U A;  3CPZ A;  4O8S A;  5JR9 A;  3N4X A;  3P7I A;  2X9Y A;  4NUV A;  3RPU A;  4H63 H;  3VMZ A;  1H7C A;  3PDY A;  3HUS B;  1O3X A;  3HUS C;  3SOL A;  4DO0 A;  5JQG E;  3QUJ A;  3P8C D;  4HE8 A;  2P67 A;  1YYC A;  3EDV A;  2WWU A;  2LKM A;  4PK4 A;  4AUW A;  2N9B A;  1NWM X;  3UUL A;  2KND A;  5JDQ A;  5E0O A;  4HN9 A;  2GUS A;  4IHJ E;  3H32 B;  4I6M C;  3PU3 A;  2YKP A;  2N1T B;  4W7Z A;  2MOZ A;  2HPC A;  3RRW A;  3ZCI A;  1J1E B;  1NOH A;  4K0U A;  1J1E C;  1RF1 A;  3HTK B;  5FP3 A;  1NTZ K;  2PBI A;  1L0N K;  1LTB C;  1CSB A;  3EFG A;  5CCG C;  2Y6X A;  2YKO A;  1A02 F;  3KV9 A;  2FYZ A;  1SP4 A;  2Z5I A;  2XUE A;  4CQI A;  3NRY A;  4H9Q C;  3S4U A;  3E0Z A;  4AQG A;  2WSC H;  5EK2 A;  2M8R A;  1MNE A;  2CMR A;  3HKE E;  1UX5 A;  3CI9 A;  3BQK A;  3LBX B;  2M3B A;  3KV6 A;  1DX7 A;  3HI2 A;  1GL2 D;  3SWH A;  1U5P A;  5AVT B;  1AJ3 A;  1SHZ C;  1FIO A;  3U3I A;  3IF8 B;  2JMH A;  4PFO A;  2HOD A;  1DH3 A;  4UV8 B;  1HG5 A;  2X9W A;  4F6R C;  2WSE H;  5AW3 B;  1HGV A;  5FXX A;  1X79 B;  5J1G A;  5BU5 A;  2XDJ A;  4ZI3 C;  2XTL A;  2QGS A;  2C5J A;  5AVV B;  5CCH A;  2Q3I A;  5LHG B;  4AXP A;  2XAQ B;  3EUH A;  4M1P A;  2XQY A;  4JYB A;  2E9X B;  1HCI A;  3H3A A;  2V7I A;  4O4I E;  1MMD A;  4EIJ A;  4GKG A;  5LP6 E;  2L3L A;  2BAS A;  5AW1 B;  1LRZ A;  4PJM A;  2PJQ A;  1ZKE A;  1FZG A;  2FXM A;  2X67 A;  1N7S C;  4ZKP A;  1LTJ B;  3CL3 D;  3V5S A;  5FNV E;  3AA6 B;  3HUS A;  2WMO A;  3CX7 B;  3AB3 B;  2K9A A;  3TNU B;  5TAO A;  2R5B A;  4G2A A;  3VOP A;  5JDN A;  5AVQ B;  3UT5 E;  5EZY E;  3PUQ A;  1LTI C;  2W61 A;  4FJO A;  5CMZ A;  4X1I E;  2VB6 A;  3ZMU B;  1OWA A;  1SFC B;  1ZR2 A;  2CXD A;  4N78 D;  3Q5W A;  3BAT A;  2KMF A;  5LNK A;  5DJQ C;  1HWT C;  4AKL A;  2Q9Q D;  4HGA A;  3N9N A;  5LHH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...