3P8CD

Structure and control of the actin regulatory wave complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
244
structure length
204
Chain Sequence
b'GIKNELECVTNISLANIIRQLSSLSKYAEDIFGELFNEAHSFSFRVNSLQERVDRLSVSVTQLDPKEEELSLQDITMRKAFRSSTIQDQQLFDRKTLPIPLQETYDVCEQPPPLNILTPYRDDGKEGLKFYTNPSYFFDLWKEKMLQDTEDKRKEKRKQKQKNLDARSVLLEAIRKGIQLRKVEEQRENDVATILSRRIAVEYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytoplasmic FMR1-interacting protein 1
publication title Structure and control of the actin regulatory WAVE complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 57
structure length 204
sequence length 244
ec nomenclature
pdb deposition date 2010-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02205 WH2 WH2 motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3p8cD01
1.20.58.1570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3p8cD02
3VP8A 4N3YB 3P8CD 1IC2A 3C9IA 3U59A 3BASA 3BATA 1NKNA 1WT6A 3N7NA 3OJAB 4GIFA 5BVZA 5KTBA 2FXMA 1X79B 4O9BA 2JEEA 3HRNA 4I1LA 3U1AA 5BU5A 5BU8B 4ZKPA 2POHA 4N78D 3N4XA 3U1CA 3VP9A 4ZKUA
chains in the Genus database with same CATH superfamily
1PP9D 3P8MC 3HD7B 2CA5A 2I0MA 2WSFH 4NPEA 4PJMA 3GHGC 1U7JA 1S9KD 1W0AA 4JI0T 1YQ4A 1NTMD 3CMAP 2MYSA 1LNQA 3PUQA 3OW2O 4KHZF 4QH4A 1DH3A 2GM4A 5ABGA 3RRCA 1WLXA 4HFDA 2XKMA 1XMQT 3CQGB 3L75E 4PJ0H 1VOMA 5LHGB 2OLTA 5IHYA 1FMVA 5AVRB 4C90A 2PFXA 4UF0B 1XTGB 1JY2P 2FBWC 4WVZA 1EZVE 1X8YA 2FYUE 1X9BA 4HWDA 3DP7A 1A02F 4TWFA 5B66E 2CHNA 4I55E 5DQVA 3NTNA 2L91A 2H43A 5CBOA 3AEBA 2JQQA 1MMAA 4DV6T 2DHRA 3AA6B 4W7YA 5EZYE 5AFUL 5JRCB 4JPZB 5AVUB 4H44C 2ZXEB 3V2RA 1GL2B 2BCCE 1RF1B 5C2TA 5L2LA 2VKHA 1T2KD 2LJLA 2OTLP 3L70D 2G3AA 5J1GA 4XAXB 1KNPA 4DO0A 3KZIE 5CJ5A 2B76A 2LT3A 4OYJA 2YOEA 4EIJA 3CX7B 1MFZA 3OYXA 3V5UA 4IE5A 1AVOA 2QYWA 3PUVF 5APSA 1LTSC 4PD4D 1JUNA 1OEDC 3AVRA 1NENA 1M1JC 4U74A 2X9HA 3O9XA 3T97A 3Q2YA 2K9YA 2W62A 3AE5A 2KIKA 4IREA 3H1KD 3D6YA 5JDLA 3H25A 4HKZH 4X62T 2ACZA 1PP9G 3HKCE 5FP3A 5HEOA 1PGOA 2NP9A 1LT9B 2KUBA 2FXPA 4CZZB 1NTMG 2VVSA 4K3AA 5LYJE 1X22A 5AQMB 2A45I 4LFAT 1KILD 5JR9C 5JDGA 2CBJA 4BJMA 2YNYA 4GKKT 1KFNA 5CFBA 4Z1MH 2XSAA 4JI2T 4YJ2E 3AE8C 2XV5A 2RPAA 1E2AA 3U1AA 3TK1A 1KTMA 3VN0A 2KLVA 3NBXX 4DR1T 1LP1B 2GUVA 4N78D 1URQA 2UXDT 1UIIA 4ZKUA 3CPWO 4KMCA 4IGUA 1N34T 5BR8T 5CCGC 3J9X1 4KUMB 4PJLA 4UV8B 3M0AA 2V6XA 5KLIB 4TX5A 5LMUT 1YTZI 3A0HE 5AQVB 4G2AA 4IDZA 2HN2A 1FC2C 2WMNA 2FYUK 1T8BA 5GTHE 2EHOB 1KB9D 2FKWB 3H1HJ 3L70G 2CHOA 1GK6A 5EK2A 2XY8B 1PP9E 1T8ZA 4JI5T 2WM9A 4C46A 3G4SP 2XNDH 2N1TC 5KJ7C 1S9KE 1GTWA 1SVFA 5M4YA 1NTME 1X79A 2XAHB 4K0UA 3NRXA 1L0ND 1WR6A 4JEHB 3PTZA 4GDOA 1IK7A 1G2CA 2FY8A 2XZRA 1XMOT 2PAJA 1NU1D 1S5LE 1JNRA 5ETWA 4KP3C 4QHOA 4TWHA 1KYOH 3H1KG 2P2UA 1QVFO 3B57A 4DV0T 2ZVOB 3RKGA 1IFMA 1LWUB 3ITKA 2E43A 2ZYGA 3L75J 3WMM0 2FJDA 4PK6A 5LGUB 1SQBJ 1HVVA 4U7JA 2IC9A 4IE4A 3CCSP 1XZYA 1JTHA 1XDOA 4LF6T 3N5LA 1W0BA 4U72A 3P4SA 2Y8DA 3PUSA 5ABFB 2FYUJ 3N9OA 2Q3EA 4OGQC 4CQIA 4RJTA 3RL0D 4ZI2C 4H13D 4Z91A 5JDNA 1YQ3A 3HD7A 4LMLA 2Z4EA 3ZLIA 3L72D 3L70E 1SHZC 3GG2A 3MTUE 3RRWA 1S35A 2BCCJ 4LC1A 3L09A 2ACXA 3TLVA 1NWQA 3FZFB 3CK6A 2KYVA 5FXWA 4K0KT 4LF5T 1FS0E 5HAXA 3O6QB 3Q5EA 1LTGC 4H9PC 4PD4E 2E75B 4WB4A 3H32B 1N7SB 2QJKB 1KV4A 4I4TE 1YW0A 4UB6E 5B5EH 4DOJA 3KHUA 3WU2H 1WYBA 3JSVC 5AVZB 3H1KE 5HYAA 1L4AA 2DCFA 2UUCT 3FGAD 1K8AQ 3G06A 1WFDA 4WNKA 3I9WA 3KV4A 4AISA 3VMZA 1VCTA 3EFFK 3SFEC 3ZMVB 3T8OA 1L0NG 1KILE 1VQLP 2LKHA 2RN0A 1NU1G 2Q6QA 3M3ZB 1ZW0A 2OQQA 3P4WA 2W6BA 3HUSB 2XASB 4HJGH 2AXDS 2H89C 2IFMA 1IZNB 4YPCA 1Q7YQ 2PTFA 1M7KA 3CX6B 4N78E 1MIWA 5A1LA 3MKDA 4L73A 3N9NA 1G1IA 2KWIB 2WZIA 2OYIB 2Q3IA 3QH9A 2L9QA 2LHRA 4JYAT 2WSEJ 1D0YA 1PGQA 2J5UA 1VQNP 3SWKA 1D1AA 1D0ZA 1Z8UA 3MUDC 3GMAA 3ZT5A 4B3TT 2JKVA 3L72G 1KB9E 3C64A 3P4QA 3PTRB 1ZRTD 3N7NA 1FZCB 3CMLA 4QX7B 3HE5A 3AEGA 3UQ7A 3V6IA 3CCLP 4AIUA 4H63V 1PP9J 3KPEA 1BE3G 1L0NE 1KQGB 4Q25A 4CI2B 3AE1C 5LCYA 4AI6A 1P84H 5HWYA 2LE8A 1NU1E 1SQQG 4X20E 3L3PA 1NTMJ 3KVBA 2E75C 2BEQD 1GW3A 2IBZD 1MNEA 1SQXD 2YKOA 1M56D 4UVCB 5IWAT 1FOSF 1ZN5A 3Q5PA 1QVGO 4NPDA 5E79H 3RK2B 1QLBA 4LFCT 5FMNA 3CLQA 1UURA 1IFPA 2OTKE 4EV6A 2XSBA 1QUUA 4JBWF 1E79H 3GWHA 4QXHB 2EHOA 2ZVNB 3ZMSB 1MMDA 3IF8B 4WBNE 4Y99C 4DR2T 1W2BO 2C5JA 3AE9A 4L76A 1VQ6P 4MLKA 3U59A 5IYZE 3L72E 4WY4B 3H1JG 2LRLA 2L8KA 3AAEB 1NAYA 5AW6B 3ZN0B 2NRGA 1XDPA 1K05A 2YK0A 3MA9A 3TLWA 2WSCH 3AEDA 2KSEA 3LW5H 3L70J 1IFNA 1VL2A 2K37A 4NPPA 3KYQA 4ASVA 5BU8B 2YDRA 2QIWA 5GTIH 3ZCJA 2V7QJ 2JO1A 3OAKA 5HXEA 5JH7E 2HG5D 1LWUA 3KV5A 1SQQE 5LP6E 1JMMA 1Q90D 1HF8A 1HTJF 1ZEEA 5M1BA 3SRZA 2WWUA 3ZC0A 3LBXB 3HD7D 2GK9A 2BS4A 2DI4A 1FZEA 3H1KJ 1T72A 2UXBT 1NKZB 3PUXF 4IFDK 2JEEA 4YFSA 4KX6A 3ABVA 2KZIA 2YKPA 2JJ9A 3LG7A 2YINA 2I6HA 4AXPA 3ONJA 2VL8A 2B89A 2IBZG 1SQXG 1FJPA 2NPSA 4AYCA 3H1JE 4MFRA 5CCGD 3CIRA 5L3GB 2XZEA 2LKMA 2OYOA 1EXIA 4GK5E 1L0NK 4WZXA 4CN6A 2Z5IA 3OJAB 2LXBA 2KSRA 3CKDA 1NU1K 3LJCA 5LB7B 2WU5A 4KHXA 3AE4A 4ZKPA 4LMKA 5KLVK 2LM2A 2HHHT 1GL2D 4YTPC 4EXTA 4WYVA 3UUMA 3ZEFB 3TSIA 2A3DA 2E2AA 4IE0A 3PU8A 4XZCA 5L3CB 3A8YC 4UV9B 3L71D 1AFOA 4DR5T 1DIPA 1KNZA 3ZT7A 4EZ4A 2RA1A 3CI9A 2KK7A 3HUSA 3RX6A 1KMIZ 2WPQA 5LGNB 2IBZE 1SQXE 2OYIA 3GLMA 2IDOB 3RIUC 2O1KA 4HN9A 3PUWF 3BATA 5AVVB 4DIDB 3PV0F 2XM2A 1S5LX 3ANWB 1N32T 1G8XA 2BG9B 2FJAA 2QA7A 1SQQK 1FDOA 4ZI2D 2E76B 4TLFA 4W80A 5TISH 1L0LJ 3QNUA 4C7RA 2KLQA 2N2NA 2OV9A 5KKZC 1FZCA 2QJPB 2W8ZA 3N2KE 5LG4A 2K88A 3KQGA 2J62A 3K3OA 1LTJC 1CUNA 1JY3N 2WCAA 4GOEA 2JQ9A 1VF5B 4EGWA 4JYBA 2UXCT 1XNRT 2A9UA 1AJYA 1LTIC 2CXLA 4HE8A 3U3IA 2YKSA 2X68A 5J0ZA 5B66H 3TLSA 4UEMA 1SQBD 4G63A 5AQKB 2EHOD 3F57A 3C98B 3H1ID 4YJ3E 3B5NC 1JEKA 3BASA 2KZ7B 2YIUB 1H8AA 4EB6E 4ASWA 3L71G 4YXDA 4KHPT 2R6GF 2ZM0A 2E74C 3L74J 1HNZT 5F3JA 2B1EA 1VRBA 2BKNA 3LK3B 1P84I 3KZIH 3EI0A 1HNWT 1JY2O 2VVNA 1IK9A 3BQLA 5EFWB 1DD4A 2WY2A 5FYMA 2OYHB 2FYZA 2WU2A 5KAIE 2E9XC 1MIVA 2LEHA 1SFCC 5LGTB 1BDCA 4QXCB 1IFIA 3RQWA 3BRTB 3RC3A 3GHGB 1HF9A 1VDFA 5AVSB 1GU4A 1KILA 1TU3F 4D6TJ 3PUGA 5DQWA 2QE7H 5L3BB 1ZOYA 2IX7C 1SQXK 2ZAEB 5APQA 1KC8Q 1GDTA 2NW8A 1HS7A 1FJGT 3AE3C 5AW8B 4AQGA 3V4QA 5AW4B 3AXJA 1YQ4C 2MBGA 4NUVA 5JDMA 3LBXA 3CWBD 3OVUA 1DU2A 1NTKD 1T6AA 1J1EC 2BVMA 4QWNB 4OH8B 1K04A 5AQSB 3L71E 2WT7A 4H44B 2W4XA 3O1JA 3X1DA 1S1CX 3FXDB 4CI1B 2E75D 2HODA 2P1JA 1N7SD 1SQBG 4JI3T 3A3YB 3SSUA 4TUYE 1HX8A 3H1IG 3VP8A 1CI6B 3Q5XA 2NW7A 2ZMAA 1IBLT 1HH0A 3G9RA 3G3ZA 5GTHH 1SQXJ 2AXTE 1OEDB 1BSHA 3I9YA 1M1JB 3SOLA 3W15B 2X0HA 2VK9A 1GW4A 1JNZA 2ES0A 4EEDA 2P7JA 1Z0PA 2W63A 4HWFA 1J5ET 4HFIA 1EDKA 4IFFA 4ILCA 3U1CA 1RE4C 2BBJA 4DR6T 4QX8B 2ODUA 3RK3C 4PV1C 3NRYA 2WWWA 3FZKB 2WDRA 2K9AA 5JR9B 4AKIA 3AE5C 3WAKA 3R84B 3Q1MA 3GF3A 3AVSA 4IL9A 2IFNA 5AQJB 1NKNA 1PZQA 3PURA 2O1JA 3AEEA 4DVDA 2QSIA 2Y0CA 4XE5B 5HEGA 1SQBE 2WMOA 2BEZF 5AW3B 4O8SA 3CX5E 2X67A 5AQUB 1NTZD 3RGLA 1SS1A 2V26A 5FXVA 3H1IE 3CQCB 2Q7CA 5FY7A 1JCDA 4B86A 2KI7B 3IAOA 1YITP 3HR0A 2QJYC 5FVLA 5AQHB 4JF7A 5LMNT 2NOXA 5J2UE 3V2PA 3RYHE 1BGYJ 3MGNA 4IDNA 1CZQA 5BMVE 3FZHB 5TAOA 3HE4A 2AEMA 1URQC 4W7ZA 2J1DG 1VQ8P 2MOZA 2WPSA 4TN7B 4ILUA 4DV1T 2XHEB 3AE2A 4C91A 2B9BA 3CCEP 4CI3B 2N1TB 2XQYA 2O01J 2QG4A 4JLEA 5L3FB 1XTCC 3QOFA 2AXCA 3M9BA 5H6RB 4AQFC 4LMJA 3O1HA 3RK2D 3UULA 1OWAA 3PUAA 4LF9T 2M5AB 2W90A 2L5GB 4ZZCA 2QGSA 2YO3A 4X1IE 3Q5WA 2D0TA 2FXMA 3R4YA 1VQ7P 1FDIA 4WWIA 2JMKA 4GOUA 1L2PA 2W00A 1OZHA 3CWBE 4WY4D 3RPUA 1PIXA 2B87B 1KEYA 2ZM8A 1OFCX 2OARA 3TNUA 2PRRA 3V5BA 4N3YB 2WPVB 4U7YA 2BKPA 3NZPA 2LR2A 4TNVA 4OGQB 3KV6A 3FXEB 4YHJA 3L4FA 2VRSA 2Y6XA 3G6EP 1IO4A 4IL4A 1R5SA 1RF0C 3M9HA 2CEAA 4UB8H 3L71J 4HH2A 3D71A 2Y0DA 3AECC 1NTZG 3E1IA 4YTMA 1GD2E 3TYYA 4P1NA 1I6ZA 3P8CE 3ZMUB 4IIJE 4OHFA 3P50A 5AQIB 4IDPA 4B3RT 3UUNA 2NWBA 1YQ3C 2E5LT 4HWCA 3JCUE 2OTJP 1J2JB 2OGUA 1H7CA 4DNDA 2LSGA 2Q1KA 1SQBK 4R4MA 1KF6A 1UX4A 3FZMB 2YKQA 1Y64B 5JTGA 5HXCA 4DV5T 4EZHA 1JM0A 1H0TB 3CCUP 3G71P 2UU9T 1S3JA 4IL6E 2P58A 2H7HA 2VQET 2JRKA 1UX5A 1KNRA 4MALA 2XAGB 1L4AC 2NTXA 3JC6C 2IUBA 4C7NA 4BAYB 1VQMP 5H2FH 3IEEA 2IMLA 2Q9QC 5C39A 3UIAA 1PL5A 4GOFA 4KBMB 3AEFA 1NTZE 1HNXT 5ADXL 3VR9A 1UCUA 4B3MT 1OVVA 3EAMA 1Y9BA 3JAFA 2E74D 1KQFB 1FMWA 2P9BA 3MHVA 4DJGA 3V2NA 3ZKRA 3H1IJ 3GN5B 1L0LD 3RGUA 1US7B 5HXHA 2NTYA 2X9YA 2HR3A 4H9OC 1HTLC 2G8YA 3MD0A 1AJ3A 1ZHCA 2QM8A 4AQYT 3FHNA 2VQFT 4DR3T 3N9LA 1YIJP 1OXZA 1N73C 4L5GA 4PK4A 3RLFF 3L37A 1JY3P 4BRYB 4PJNA 3RC8A 1FEWA 4H9RC 2BS3A 2ZT9C 5CCHD 3AE8A 3CCMP 3DJBA 1RE3A 5FY0A 3E22E 4XFJA 2E76D 1WR0A 1M57D 2WWVA 2LLYA 2F4VT 3C4ZA 2C0XA 4UF0A 3AEGC 1OIPA 4I7ZC 5CCGA 2W66A 3P4RA 4X65T 2V6YB 1UK5A 4PNIA 1E1HB 3VKHA 3L74D 3UUBA 1JMBA 3B13A 5AW0B 2B88A 3K1SA 1VF5D 2V4HA 5JRCA 1T3UA 4WBOA 3CWBJ 4HFCA 1GL2A 2AEJA 4Y99B 1NTKJ 4YXWH 1RF1A 4FI5A 2K5BB 3RHWA 2XQ6A 2KB7P 2V8SV 2BBHA 2E5TA 2IC6A 3SWYA 2I1KA 1QL2A 3H3AA 3S4UA 1HX1B 1SUMB 4EOTA 2GUSA 1ZXGA 3M0DC 1EDLA 3WUUA 5LXTE 4D6TD 1NTMK 2KXPB 2M5AA 5JDFA 3AE9C 1ZR2A 1L0LG 2HPCB 1HUCA 3C8VA 4AQRD 1BSNA 3A2AA 2SPCA 1NTZK 3WUTA 4WBAA 4ANJA 4HKAA 2C9NY 1W09A 5LA6E 2B87A 3AEDC 4XA4A 3CXHH 3KBTA 3L73D 3S9OA 2CPSA 3MIWA 1DX7A 1LT9A 3EQ2A 3C51A 3AEAA 4HWIB 3F5HA 3GW6A 5HCJA 3T1YT 4GODA 2IYOA 2DWGA 1LVFA 2MJZA 3I55P 1YHQP 4TT3H 2WDQA 3ZC1A 3Q5RA 1AVYA 3M91A 2DLRA 2MTQA 3KXDA 2JIWA 4MN4C 5KX5E 3H37A 1LP1A 2CPBA 3ABVC 3L74G 4EIWA 2XAJB 2FYNC 5CHXA 3WAJA 1CSBA 3QWOC 3E08A 2CM0A 3C50A 1NTZJ 3MK7C 1L0LE 4H44D 3CMEP 4I0UA 2BZBA 2NPSC 2KNCB 1H0TA 3ETVA 4YSYA 3U78A 2XQ3A 4QH1A 3AE6C 4EOZB 3IHRA 4GT1A 3PE0A 2KMFA 1HBWA 1SA0E 2JMHA 1VQ5P 2H3RA 4D6TG 1JY2N 1EDIA 1KD1Q 4H9SE 1P84D 2WSFJ 4A7PA 1VQ9P 5CA1E 3ETUA 4IHJE 1SQVD 4UXNB 4JI4T 4JI6T 2V7MA 2BG9E 3OTOT 4X1KE 3VU7H 2WQYC 1FAVA 3FWNA 4CXYA 3HKBE 1HJBA 3PDYA 4Y28J 4ADZA 1T3JA 5KAFH 3CCRP 2RKLA 1W2EA 2HPJA 3L73G 5L8RJ 1FZFA 4DUYT 5AQLB 1BGYD 3L74E 2FFDC 3L8RA 2WDVA 2N9DA 3DTOA 4ZXLA 3V2QA 5KDMC 5ABFA 3MUDA 5KAIH 1B7TA 2I59A 2L3LA 2JP3A 2K3RA 4BA9A 4I1LA 4PW8A 3CD6P 3IA3A 3S1KA 5KKZB 2XM1A 4EYYQ 1KYOI 4HFVA 5AQTB 2W6AA 1XNQT 2HFED 1LTJB 5AW9B 4MBQA 2NR4A 3LDQB 4R4LA 3CQXC 5FKYA 1N2DC 4D6TE 2KSJA 3O6QA 2AEFA 5B5EE 1ZMEC 1AQ5A 1MV8A 3H32A 3EUHA 1N7SA 1M7LA 3GA8A 3VMAA 3CCJP 1BR2A 2V6YA 3H1LD 3VP9A 4JBZA 3T1HT 3AA1B 1M8OB 1G1JA 5L4HA 3R2PA 3L73E 3B5NB 5JDQA 3Q9DA 3VMXA 2IHR1 2CBIA 5DJQC 2ZM6T 1T2KC 2A2FX 4HYTB 4COFA 2LKGA 2N1TD 1ZRTE 1ZV8A 5KJ7D 2E74B 1L0LK 3F31A 1GMJA 5C3JA 5HEHA 5LHIB 1D1CA 2C5IT 5FXXA 1WMKA 3RYIE 2QM7A 3B5MA 1ZLLA 2WB5A 3UU8A 4GKJT 5FL1A 4IL6X 1UUSA 2E9XB 3W68A 1V9DA 5JQGE 1SFCB 1QEXA 4YXDC 2KOGA 3K5BA 2PP6A 2HH7A 4U31A 1BGYG 1RHZB 4ZI3C 1AV1A 1HFAA 3CPZA 4A97A 4JV5T 2MKVA 5AQNB 4ZEYA 3MXZA 2ZXXA 1O3XA 3A0BH 2YU2A 5AVWB 2ZLYA 4J2CA 4OGQD 3F2EA 3LSVA 4O4HE 4UVAB 5AW5B 2PBIA 2M8RA 1KILC 1PFIA 4KJMA 2LXCB 2J4GA 4X66T 1J1EB 4BWNA 4TV9E 2ZT9D 1ZR4A 3BQIA 1ZP0C 1ZOYC 3JC22 1P84E 3C1LA 3NVOA 1H89A 4O4IE 1HCIA 5LJNA 3CX5H 1MKMA 2XQ5A 3L39A 1OEDE 1IAPA 1RQUA 3PUZF 4OK0A 2YDSA 1NVOA 1XWMA 4O2BE 3H1LG 3CC2P 4ZMDA 5FVKA 3CXHI 3VMYA 3UFEA 5E79E 1RH5B 2Z5HA 5CB4E 4DV7T 2BVLA 1FDMA 1R8IA 2UUAT 1BGYE 1ZV4X 2XAQB 3QC9A 1YJWP 1U7MA 3K3QC 1BCCD 3P32A 3VTPC 3LK42 4HEAA 1QGKB 3CX8B 4H0LC 1DEBA 2PGDA 2XUEA 5LBQB 3AA0B 2R3CA 2JPFA 3ZSTA 4WY4A 1SLQA 3B4SA 1N8RQ 3RK3B 3QB5K 4PV1B 2D2CC 5CJ0A 5TJHA 1KN7A 5LJMA 4MHCA 2KS1B 5GTIE 1NH4A 2P67A 3AE7A 1T7SA 4U3FJ 3KDPB 4A56A 2M0BA 3L36A 1JCCA 3IR9A 4HGAA 3KINB 1FZAA 2J47A 1SQPJ 3D0TA 3AAIA 3H1LE 2V7KA 5BU5A 3PJSK 2POHA 1LJ2A 4QKNA 3TLTA 3RL0C 4H13C 1HWTC 2QJYB 4IE6A 3AEEC 1J1DC 2O01N 3L73J 3E1RA 3CC4P 4ASKA 2X51A 3RH3A 4DR7T 1URQB 1N33T 2VWAA 1LTJA 4L74A 2FJEA 4DV3T 3RQUA 1NWMX 3FBZA 3JCUH 1A02J 2G0UA 2QVAA 3AEBC 1J5WA 4U33A 3EDVA 5CBNA 5AVQB 3FBLA 3RYCE 5CGMA 3OJAA 5APVA 2C5KT 2GA1A 1EDJA 3A0HH 2I8DA 1YI2P 3ZN1B 3CVRA 1U57A 5HXSA 5APYA 4ZI7E 1BCCG 3SFDA 2PFVA 2BDEA 3EDUA 3BVHA 4IL6H 4U3CA 4L75A 3JADA 1GZLA 3S4RA 3AE2C 4ILAA 1BR1A 2XPKA 3IBPA 3C4WA 2CRBA 1X79B 3Q5SA 4NIQA 5L4EA 1MMNA 3C4XA 5L3DB 4H9QC 1G2CB 3RIFA 3M65A 2SPZA 2Y9YA 3PHLA 2A45G 1S5LH 2H7OA 3FZLB 3N2GE 1EQ7A 1HG2A 4JEUB 1NEKA 3VOPA 1MNDA 2CE7A 5HWXA 2Z6EA 4YY3T 3A7OA 4TV8E 2VKDA 2DL1A 1JTHB 2E8IA 3MZKB 1SQVJ 1KZUB 1VQKP 3MJXA 1IJDB 2UWJE 1U4QA 1MMGA 3HTKB 3WUVA 1J1JA 3AB3B 3USSA 1NAFA 5JDHA 5CCHA 3PU3A 3ANWA 5JVDE 3CWBG 2BG9A 5APWA 1NTKG 2K9JB 2IW5B 3H6PA 4FJOA 4K35A 2CXDA 3AE3A 2JQHA 1KQSO 3MP7B 1EC5A 5TISE 4L0RA 4E7ZA 2IPPA 1BCCE 5APUA 1JB0J 2WBLA 4B3ST 3RI5A 3MACA 2W67A 2V7QH 5AQGB 1K73Q 1IJ5A 1D0XA 2WSSH 1WRDA 3NMDA 4DR4T 1Q82Q 2W61A 4GIWA 1USEA 1ZKEA 1NO4A 4PD4H 3ESLA 1HJ0A 5C8YE 3ZCIA 3W67A 4B6XA 4UB6H 5FNVE 2ZFCA 1L4AB 2WSCJ 3LW5J 2H88A 4O4JE 2X0LB 1PV3A 2Q9QB 2V5DA 1R5LA 1JY3O 1VQOP 4DV2T 3Q3DA 1YJ9P 2A72A 1R8EA 3O4XE 4O2AE 2P10A 4JYCA 3HL6A 2LOPA 2ITAA 1OW7A 2HN1A 2N1GA 4HTEA 1S72P 1OW6A 3H1LJ 2ODVA 3BCCD 2IZ1A 3EHZA 1FIOA 3RBZA 4DBQA 1NTKE 1X9VA 3CX5I 4HWHA 5F5WA 1GU5A 1OX3A 3TKLB 3CCVP 5FY1A 2ZM2A 3AEFC 4UR9A 2CLYC 2HYNA 2OA5A 5HCMA 3I0OA 5AVTB 2OYHA 1EZVI 1RE4A 1FOSE 1RY3A 3ZYLA 4GKGA 1N73B 2KINB 1USDA 2KS1A 4ZI3D 5AQRB 3GHGA 3OYZA 3QB5A 3HRNA 1YJNP 2ZT9B 3RL0g 3I1AA 4DT0A 3NWIA 3LFMA 5EK4A 2WAUA 1HR0T 2K3WA 4X64T 3KVAA 2X66A 1KB9H 2DNXA 2A06D 2YMKA 3PLNA 4RO0A 3HD7C 3P4PA 4IDQA 1MZ9A 5AVYB 3HE5B 3TLUA 2X0YA 1SP4A 4I7ZB 2FBWA 5HEUA 2M6BA 2WPRA 3GMIA 3L35A 2M6IA 2R44A 1RE3C 2KT9A 4O9BA 3FB2A 2ZJSE 4F6RC 2FJBA 4OYKA 3A5XA 2I1JA 1RQVA 3FXDA 3UU3A 4I6MC 4ZS2A 5ABHA 4Z90A 3EFGA 1FU1A 4ILBA 4AKRB 4DMVA 4U2YA 2JQKA 2WZHA 4AKHA 4OX9T 2LHNA 4AQFA 1CI6A 2NW9A 3I56P 3VR8A 4GIFA 1QLED 5BVZA 2HLOA 3B5ND 1GL2C 3UU5A 1RF1C 3BCCG 2WZ7A 1OEDA 3BK9A 1M1JA 3I0QA 2R5BA 3UU6A 4EEBA 2RMZA 4ZZBA 4H0LD 2QEXP 1HG5A 4DCKA 2XQAA 4YHHT 1IC2A 5FL0A 3II6A 2FXOA 4ZNCA 4DUZT 1SE7A 1W5CE 2E9XD 2D2CD 4IDOA 2FUPA 1N7LA 1SFCD 3TGUD 1LTTC 1BCCJ 1LTAC 4PFPA 3ZT6A 4YLHA 1NTKK 5KLVD 4DBRA 4YTNA 4PAGA 2CPTA 4PK5A 1S2EA 5JR9A 3ZPOA 1RF0A 1AQTA 4RKUJ 5CA0E 1IFJA 3AECA 4ZS3A 2A06G 4PJ0E 4ZHQE 1KYOD 1LT9C 1E5WA 1DD3A 3HTKA 1L0VA 3AEAC 4A5XA 3HI2A 2FYNB 2K9JA 2JR8A 2E5VA 1D7MA 4JUYA 4F8HA 4YSZA 1K9MQ 5KTBA 4TNWA 1KFYA 2D5UA 3BCCE 2M67A 3ZMTB 1FE6A 3RYFE 1QX8A 5GONE 1KQLA 3VRBA 2DWKA 2NPSB 3LIEA 4M1PA 1AA0A 1M62A 2CXFA 5APTA 4HFEA 1BE3D 1CHUA 4GK0E 4JQ0D 3C9IA 1YXRA 3HA4A 4HB1A 1SQQD 2W6JH 5L47A 4LLHA 1W9RA 2N1TA 5KLIC 5KJ7A 3MZWB 4U3FD 3N9PA 3ZDMA 3UFGA 1KFMA 4EYUA 1Y47A 3OKQA 4P0AA 4OWFA 3ZMZB 1SQPD 2Q9QA 2EHOC 4NPFX 1GK4A 4N6JA 4CPGA 4L9IA 3GF7A 1WCRA 1BR0A 4GYRA 5AW2B 1VQ4P 2A06E 4LFBT 2JDIH 3K8PC 3CL3D 2D2SA 3NXSA 3TGUG 3VKGA 4QMAA 5KLVG 2FFDB 4CXXA 4PD4I 2Q5UA 3PRJA 5H6QB 3RK3D 3RF1A 3RKOA 4PV1D 3LIDA 3H1JD 2W0GA 2BS2A 2R3SA 1YKEB 2IYPA 3FXEA 4IE7A 4YT0A 4TZ4C 1QSDA 4UB8E 1LWUC 4M3LA 3E0ZA 1N73A 2UUBT 4IT4A 3CWZB 4V1Av 4QH5A 5AQFB 1MIYA 3JCFA 2XU6A 3PH0A 3CC7P 4IFMA 3RIAA 1X0TA 4OFZA 2WVRA 5AW7B 2LSIA 3QK6A 1MUUA 1QL1A 4NUUA 4KT0J 2VL0A 3CXHD 5APXA 1Y01A 2N9YB 1NGMB 1URQD 4KI0F 5ABEA 2AE9A 3HKDE 3D6ZA 1S4XA 2LSJA 4PJJA 4CN4A 3A7MA 4UIGA 3TGUE 5CMZA 4GYSA 4U3FG 1N7SC 2QJKC 5KLVE 3SFEA 2D0UA 2VKOA 1LKXA 3O1IA 1SQPG 3AE4C 4RESB 1LVKA 3B71A 1YBKA 5H2FE 5J2TE 1HGZA 2H8PD 4JI1T 1KB9I 5LOVE 2YEVC 4BXLA 1G73A 2JWAA 3M0DA 3Q2MA 1KYOE 4TWDA 4HFHA 4XBFB 3IF4A 2H89A 1Q2NA 3BRVB 2CMRA 2XQ7A 2XTLA 2PG8A 1JO5A 4O4LE 2QRXA 3ONXA 2WTYA 1VCSA 1WT6A 3HUSC 3GN5A 4HFBA 5AQPB 3HKEE 2O01H 1D1BA 3J7Yq 2X9XA 1GQEA 3BCCJ 1DEEG 3F89A 1KILB 2C9LY 2BASA 2Y9ZA 2OYIC 1BE3E 1Q81Q 4LF8T 3PUYF 1FJKA 2X9WA 5AQQB 1LGHB 3OA7A 4EI2A 3V4WA 2LOSA 4CN1A 1NHLA 4BRYA 3EWKA 2C0WA 4U3FE 3WI3A 3K3NA 2JJLA 2IZ0A 1JOCA 3KFWX 1S94A 1SQPE 3AXJB 3AE1A 4H9NC 3VHLA 2YU1A 3VYIA 2UXXB 1BR4A 2E5YA 4ERRA 3WU2E 1FZCC 4IOIH 3N9QA 4LGDE 1PGPA 3UTKA 4PFOA 2JWDA 2WT7B 5LNKA 2K1AA 3KBUA 2YN6A 1PPJD 2CWOA 4NXMT 2WP9A 2HODB 4E7SA 2W2UA 3RK3E 3SWHA 2ZYAA 2HPLA 3AE6A 2YO2A 1SQVG 1L4AD 4H0LB 3LK2B 3N2OA 2XJ7A 3JC6D 4UVBB 1YD8G 5EK3A 3BQKA 2Q9QD 2VKJA 1T98A 2QA4P 2ZYDA 3RK2C 2PJQA 3NKZA 1FBMA 4AKGA 2KP8A 2D2CB 1LRZA 2DW3A 2AXTH 3JAEA 3P7IA 5E0OA 2WQYA 1FZBA 3TDKA 2K48A 3ONLC 2IAKA 1YTZT 2HPCA 2D9DA 3SS1A 4WY4C 2KNDA 1N86A 1YYCA 1IJ6A 2XAFB 5HXRA 3R6NA 1OVUA 3PJAJ 1I94T 1KK7A 3CXHE 1FZGA 3RBXA 3KDSE 2BKOA 3UUXB 2FFDA 4U2ZA 1VPCA 1IBMT 1Q86Q 2MPKA 3AE7C 2YXQB 3RL0B 4H13B 4LF7T 2H7VC 5DJTB 1L0NJ 2CCQA 3N9MA 2R5DA 3AAAB 1J1DB 4EDFA 2WSSV 2XQ9A 5AQOB 1NU1J 2LM9A 3TGUJ 5LBMA 4EAHA 4I43B 5KLVJ 3B8EB 5CJ4A 2WMMA 1SQVE 3KV9A 1NYHA 5DABA 5LHHB 3ZYKA 3P7KA 4ZOLE 2Y48B 1M1KQ 5LG3A 4JI8T 3H1HD 5L3EB 1PPJG 3EABA 1NOHA 1SQPK 2KWHA 2XQ8A 4X1YE 3HE4B 2C0SA 2Y0EA 2J58A 3OBVE 3O8ZA 2CK3H 2W83C 3OPCA 2V7LA 2KLUA 2IBZI 2KZJA 4H63H 1OVRA 4ISTA 3L72J 2KNCA 4YTPA 3V5SA 1MFTA 5DJUB 2WS3A 3ZJ2A 1E7PA 2A45H 3FX0A 1LT1A 4P09A 5F8PA 3M06A 2XDJA 2XNXA 3L75D 5KXJA 2MAWA 4AKLA 3CX5D 3SFDC 2XQ4A 1BE3J 4P0BA 3T97B 2V1DB 5KMGP 1N36T 3PP5A 1EZVD 2FYUD 1SQQJ 5AW1B 3AA7B 3NZQA 1UIXA 3ZYMA 2IIUA 5KAFE 3CCQP 1KORA 3TNUB 4X5TA 2YMYA 2WITA 2LRKA 3RIUA 2V7JA 4DV4T 5JREA 2LSKA 4EYYR 2CWYA 3IN6A 2N9BA 2M3BA 3ZJ1A 1EZ3A 1CW5A 2BCCD 2E42A 1IBKT 1PPJE 1PGJA 4Z8XA 2R32A 1IFDA 4CXWA 4ISSA 1BDDA 2UXNB 2RH0A 3IFMA 2O3JA 4DZOA 1JNMA 3D70A 1WRGA 4JI7T 3QUJA 5FXZA 5CCHC 3H1JJ 2VURA 3H1HG 2W27A 2BG9C 2M3EA 1ZP0A 4DMWA 4OVNF 2K24A 2WSEH 4A98A 2E76C 2VB6A 3Q5DA 3FWLA 2V7IA 2YXRB 3M9QA 1UGOA 4YSXA 1SQVK 3SWFA 1H88A 2QJPC 2YDQA 3UQ4A 2NZ2A 3H3MA 4NXNT 1NJIQ 3E7KA 4UELA 2NPSD 1U5PA 1VF5C 2LSYA 1OMIA 2Q9IA 4AUWA 4QXBB 2J59M 1WYCA 3B5NA 2RP4A 2VASA 3PJAA 3L75G 3UT5E 2H88C 3UU4A 1YKHB 3ZSSA 4C7NB 3TF5A 5K5GB 3I5CA 3N4XA 4I2LC 1EZVG 2FYUG 2IDBA 3P8CD 5IUXA 4WW0A 1EXJA 4BJNA 2CLYB 1OW8A 4LF4T 4U7IA 1HGVA 2E9XA 1LTBC 2YIUC 3A5TA 1SFCA 1VQPP 3H1HE 2BCCG 3EVYA 4I50E 5HEJA 2V5CA 3VRAA 1Y8AA 3A0BE 3NFQA 5AVXB 2OYHC 1M90Q 1Z56A
chains in the Genus database with same CATH topology
3P8MC 3HD7B 2CA5A 2WSFH 4PJMA 3GHGC 1S9KD 2MYSA 3PUQA 1DH3A 2GM4A 3RRCA 1WLXA 2XKMA 3CQGB 1VOMA 5LHGB 5IHYA 1FMVA 5AVRB 4C90A 4UF0B 1XTGB 1JY2P 1X8YA 3DP7A 1A02F 4I55E 5DQVA 3NTNA 2H43A 2JQQA 1MMAA 2DHRA 3AA6B 4W7YA 5EZYE 5AFUL 5JRCB 5AVUB 2ZXEB 3V2RA 1GL2B 1RF1B 5L2LA 2VKHA 1T2KD 2LJLA 5J1GA 4XAXB 4DO0A 2LT3A 4OYJA 4EIJA 3CX7B 1MFZA 3OYXA 3V5UA 4IE5A 5APSA 1LTSC 1JUNA 3AVRA 1M1JC 4U74A 2X9HA 3O9XA 3T97A 2W62A 5JDLA 5FP3A 3HKCE 2NP9A 1LT9B 4CZZB 5LYJE 2A45I 1KILD 5JR9C 5JDGA 4BJMA 2YNYA 1KFNA 4YJ2E 2XV5A 3U1AA 3TK1A 3VN0A 2KLVA 3NBXX 2GUVA 4N78D 1URQA 4ZKUA 4KMCA 4IGUA 5CCGC 3J9X1 4KUMB 4PJLA 4UV8B 3M0AA 4TX5A 1YTZI 4G2AA 4IDZA 2WMNA 2FYUK 2EHOB 5EK2A 2FKWB 1GK6A 1T8ZA 2WM9A 4C46A 2N1TC 5KJ7C 1S9KE 1GTWA 1SVFA 5M4YA 1X79A 2XAHB 4K0UA 3NRXA 1WR6A 4JEHB 1G2CA 2XZRA 2PAJA 5ETWA 4KP3C 4QHOA 2P2UA 3B57A 1IFMA 1LWUB 2E43A 3WMM0 4PK6A 5LGUB 1HVVA 2IC9A 4IE4A 1JTHA 3N5LA 4U72A 2Y8DA 3PUSA 3N9OA 4CQIA 3RL0D 4ZI2C 5JDNA 3HD7A 3ZLIA 2Z4EA 1SHZC 3MTUE 3RRWA 1S35A 4LC1A 3L09A 2ACXA 1NWQA 5FXWA 2KYVA 5HAXA 1LTGC 4H9PC 4WB4A 3H32B 1N7SB 4I4TE 1YW0A 4DOJA 1WYBA 5AVZB 5HYAA 1L4AA 2DCFA 4WNKA 3I9WA 3KV4A 3VMZA 3ZMVB 3T8OA 2W6BA 3HUSB 2XASB 2IFMA 1IZNB 3CX6B 4N78E 1MIWA 5A1LA 3MKDA 3N9NA 1G1IA 2KWIB 2OYIB 2Q3IA 2L9QA 2LHRA 1D0YA 1D1AA 1D0ZA 3C64A 3PTRB 3N7NA 1FZCB 3CMLA 4QX7B 3HE5A 4H63V 3KPEA 4CI2B 5LCYA 4AI6A 5HWYA 2LE8A 4X20E 3L3PA 3KVBA 1GW3A 1MNEA 2YKOA 4UVCB 1FOSF 1ZN5A 3RK2B 5FMNA 3CLQA 1QUUA 3GWHA 4QXHB 2EHOA 3ZMSB 1MMDA 3IF8B 4WBNE 4Y99C 2C5JA 4MLKA 3U59A 5IYZE 4WY4B 3AAEB 2L8KA 5AW6B 3ZN0B 3MA9A 2YK0A 2WSCH 3LW5H 1IFNA 3KYQA 5BU8B 3ZCJA 3OAKA 5HXEA 5JH7E 2HG5D 1LWUA 3KV5A 5LP6E 1JMMA 1HF8A 1HTJF 1ZEEA 3SRZA 2WWUA 3ZC0A 3LBXB 3HD7D 2GK9A 2DI4A 1FZEA 1NKZB 4IFDK 2JEEA 4YFSA 2YKPA 2JJ9A 3LG7A 2YINA 4AXPA 2VL8A 1FJPA 2NPSA 4AYCA 4MFRA 5CCGD 5L3GB 2LKMA 4GK5E 1L0NK 2Z5IA 3OJAB 3CKDA 1NU1K 3LJCA 4KHXA 4ZKPA 5KLVK 1GL2D 4EXTA 3UUMA 3ZEFB 3TSIA 2A3DA 4IE0A 3PU8A 4XZCA 5L3CB 4UV9B 1AFOA 1KNZA 4EZ4A 2RA1A 3CI9A 3HUSA 3RX6A 2WPQA 5LGNB 2OYIA 2O1KA 4HN9A 3BATA 5AVVB 3ANWB 1G8XA 2QA7A 1SQQK 4ZI2D 4W80A 2KLQA 4C7RA 2N2NA 1FZCA 3N2KE 5LG4A 3KQGA 3K3OA 1LTJC 1CUNA 1JY3N 4JYBA 1LTIC 2CXLA 4HE8A 3U3IA 2X68A 4UEMA 4G63A 2EHOD 3F57A 3C98B 4YJ3E 3B5NC 3BASA 2KZ7B 1H8AA 4EB6E 2ZM0A 5F3JA 2B1EA 1VRBA 3LK3B 1JY2O 3BQLA 1IK9A 5FYMA 2OYHB 2FYZA 2E9XC 1MIVA 2LEHA 1SFCC 5LGTB 4QXCB 1IFIA 3BRTB 3RC3A 3GHGB 1VDFA 5AVSB 1GU4A 1KILA 3PUGA 5DQWA 5L3BB 2IX7C 1SQXK 5APQA 1GDTA 2NW8A 1HS7A 5AW8B 4AQGA 3V4QA 5AW4B 2MBGA 4NUVA 5JDMA 3LBXA 1J1EC 2BVMA 4QWNB 4OH8B 2WT7A 3O1JA 3FXDB 4CI1B 2HODA 2P1JA 1N7SD 3A3YB 4TUYE 1HX8A 3VP8A 1CI6B 3Q5XA 2NW7A 2ZMAA 1HH0A 3G3ZA 3I9YA 1M1JB 3SOLA 3W15B 2VK9A 1GW4A 2ES0A 2P7JA 1Z0PA 2W63A 4IFFA 3U1CA 1RE4C 4QX8B 2ODUA 3RK3C 3NRYA 2WWWA 2K9AA 5JR9B 4AKIA 3WAKA 3R84B 3AVSA 2IFNA 1NKNA 3PURA 2O1JA 4DVDA 4XE5B 2WMOA 5AW3B 4O8SA 2X67A 5FXVA 2V26A 3CQCB 5FY7A 2Q7CA 1JCDA 4B86A 3HR0A 4JF7A 2NOXA 5J2UE 3V2PA 3RYHE 3MGNA 1CZQA 5BMVE 5TAOA 3HE4A 1URQC 4W7ZA 2J1DG 2MOZA 2WPSA 4TN7B 4ILUA 2XHEB 4C91A 4CI3B 2N1TB 2XQYA 4JLEA 5L3FB 1XTCC 3M9BA 5H6RB 4AQFC 3O1HA 3RK2D 3UULA 1OWAA 3PUAA 2L5GB 2QGSA 2YO3A 4X1IE 3Q5WA 2D0TA 2FXMA 2JMKA 4GOUA 2W00A 4WY4D 3RPUA 2ZM8A 2OARA 3TNUA 3V5BA 4N3YB 3NZPA 3KV6A 3FXEB 4YHJA 3L4FA 2VRSA 2Y6XA 1IO4A 1RF0C 3M9HA 2CEAA 4HH2A 3E1IA 1GD2E 3TYYA 3P8CE 3ZMUB 4IIJE 4OHFA 3UUNA 2NWBA 1J2JB 4DNDA 1H7CA 2LSGA 1SQBK 1UX4A 2YKQA 1Y64B 5HXCA 4EZHA 2H7HA 2JRKA 1UX5A 4MALA 2XAGB 1L4AC 2NTXA 3JC6C 4C7NA 4BAYB 3IEEA 2Q9QC 3UIAA 4KBMB 5ADXL 1UCUA 1FMWA 2P9BA 3V2NA 3GN5B 5HXHA 1US7B 2NTYA 2X9YA 4H9OC 1AJ3A 1HTLC 3MD0A 1ZHCA 2QM8A 3FHNA 3N9LA 1OXZA 1N73C 4L5GA 4PK4A 3L37A 1JY3P 4PJNA 3RC8A 1FEWA 4H9RC 5CCHD 3DJBA 1RE3A 5FY0A 3E22E 3C4ZA 2C0XA 4UF0A 5CCGA 4PNIA 1E1HB 3VKHA 3B13A 5AW0B 5JRCA 1T3UA 4WBOA 1GL2A 4Y99B 1RF1A 4FI5A 2K5BB 2KB7P 2IC6A 3SWYA 2I1KA 1QL2A 3H3AA 3S4UA 4EOTA 2GUSA 3M0DC 5LXTE 1NTMK 2KXPB 5JDFA 1ZR2A 2HPCB 1HUCA 4AQRD 3A2AA 2SPCA 1NTZK 4WBAA 4ANJA 4HKAA 2C9NY 5LA6E 4XA4A 3KBTA 2CPSA 3MIWA 1DX7A 1LT9A 3EQ2A 3C51A 2DWGA 1LVFA 2MJZA 3ZC1A 3M91A 2DLRA 2MTQA 5KX5E 3H37A 2CPBA 4EIWA 2XAJB 5CHXA 3WAJA 1CSBA 3E08A 2CM0A 3C50A 3MK7C 1Z56A 2BZBA 3ETVA 2NPSC 3U78A 4EOZB 3IHRA 4GT1A 3PE0A 2KMFA 1HBWA 1SA0E 2JMHA 2H3RA 1JY2N 4H9SE 5CA1E 3ETUA 4IHJE 4UXNB 2V7MA 4X1KE 3VU7H 1FAVA 4CXYA 3HKBE 1HJBA 3PDYA 4ADZA 1T3JA 1W2EA 2HPJA 1FZFA 2FFDC 2N9DA 3DTOA 3V2QA 5KDMC 3MUDA 1B7TA 2I59A 2L3LA 4BA9A 4I1LA 4PW8A 4HFVA 2W6AA 2HFED 1LTJB 5AW9B 4MBQA 3CQXC 1N2DC 2KSJA 1AQ5A 1MV8A 3H32A 3EUHA 1N7SA 1M7LA 3GA8A 1BR2A 3VP9A 3AA1B 1G1JA 3R2PA 3B5NB 5JDQA 3Q9DA 3VMXA 5DJQC 1T2KC 2A2FX 4HYTB 2N1TD 5KJ7D 1ZV8A 1L0LK 3F31A 5LHIB 1D1CA 2C5IT 5FXXA 3RYIE 2QM7A 1ZLLA 2E9XB 1V9DA 5JQGE 1SFCB 2KOGA 2PP6A 2HH7A 4ZI3C 1HFAA 3CPZA 3MXZA 1O3XA 2YU2A 5AVWB 2ZLYA 4J2CA 3F2EA 4O4HE 4UVAB 5AW5B 2PBIA 2M8RA 1KILC 1PFIA 1J1EB 4TV9E 1ZR4A 3BQIA 1H89A 4O4IE 1HCIA 5LJNA 1IAPA 4OK0A 4O2BE 3VMYA 3UFEA 2Z5HA 5CB4E 2BVLA 1FDMA 1ZV4X 2XAQB 3QC9A 3K3QC 3P32A 3VTPC 3LK42 4HEAA 3CX8B 1DEBA 2XUEA 5LBQB 3AA0B 2R3CA 2JPFA 4WY4A 1SLQA 3RK3B 5CJ0A 5LJMA 4MHCA 1NH4A 2P67A 3KDPB 4A56A 3L36A 1JCCA 3IR9A 4HGAA 3KINB 1FZAA 3D0TA 3AAIA 2V7KA 5BU5A 2POHA 4QKNA 3RL0C 1HWTC 4IE6A 1J1DC 4ASKA 2X51A 3RH3A 1URQB 2VWAA 1LTJA 1NWMX 3FBZA 1A02J 2G0UA 3EDVA 5AVQB 3FBLA 3RYCE 3OJAA 5APVA 2C5KT 3ZN1B 3CVRA 5HXSA 5APYA 4ZI7E 2PFVA 2BDEA 3EDUA 3BVHA 1GZLA 1BR1A 3IBPA 3C4WA 1X79B 1MMNA 3C4XA 5L3DB 4H9QC 1G2CB 3M65A 2A45G 2H7OA 3N2GE 1EQ7A 1HG2A 4JEUB 3VOPA 1MNDA 2CE7A 5HWXA 2Z6EA 3A7OA 4TV8E 2VKDA 1JTHB 2E8IA 3MZKB 1KZUB 3MJXA 1IJDB 1U4QA 1MMGA 3HTKB 3AB3B 1NAFA 5JDHA 5CCHA 3PU3A 3ANWA 5JVDE 5APWA 2IW5B 3H6PA 4FJOA 2CXDA 4L0RA 4E7ZA 2IPPA 5APUA 2WBLA 3MACA 1IJ5A 1D0XA 1WRDA 3NMDA 4GIWA 2W61A 1ZKEA 1NO4A 3ESLA 5C8YE 3ZCIA 4B6XA 5FNVE 2ZFCA 1L4AB 4O4JE 2X0LB 2Q9QB 1JY3O 2A72A 3O4XE 4O2AE 4JYCA 3HL6A 2LOPA 4HTEA 2N1GA 2ODVA 1FIOA 4DBQA 1X9VA 1GU5A 3TKLB 5FY1A 2ZM2A 2CLYC 2HYNA 2OA5A 3I0OA 5AVTB 2OYHA 1RE4A 1FOSE 1RY3A 3ZYLA 4GKGA 1N73B 2KINB 4ZI3D 3GHGA 3OYZA 3HRNA 3I1AA 5EK4A 3LFMA 2WAUA 3KVAA 2X66A 2DNXA 3HD7C 1MZ9A 5AVYB 3HE5B 1SP4A 2WPRA 3GMIA 3L35A 1RE3C 2KT9A 4O9BA 3FB2A 4F6RC 4OYKA 3A5XA 2I1JA 4I6MC 4ZS2A 3EFGA 1FU1A 4AKRB 4DMVA 4AKHA 2LHNA 4AQFA 1CI6A 2NW9A 4GIFA 5BVZA 3B5ND 2HLOA 1GL2C 1RF1C 2WZ7A 3BK9A 1M1JA 3I0QA 2R5BA 1HG5A 1IC2A 3II6A 2E9XD 4PFPA 1N7LA 1SFCD 1LTTC 1LTAC 4YLHA 1NTKK 4DBRA 4PAGA 4PK5A 5JR9A 3ZPOA 1RF0A 5CA0E 1IFJA 4ZS3A 4ZHQE 1LT9C 1E5WA 3HTKA 3HI2A 4JUYA 5KTBA 2D5UA 2M67A 3ZMTB 3RYFE 5GONE 1KQLA 2DWKA 2NPSB 3LIEA 4M1PA 2CXFA 5APTA 4GK0E 3C9IA 3HA4A 4LLHA 2N1TA 5KJ7A 3N9PA 1KFMA 4EYUA 3OKQA 4P0AA 3ZMZB 2Q9QA 2EHOC 1GK4A 4N6JA 4L9IA 1BR0A 4GYRA 5AW2B 3K8PC 3CL3D 2D2SA 3NXSA 3VKGA 2FFDB 4CXXA 2Q5UA 5H6QB 3RK3D 3RKOA 3LIDA 2W0GA 1YKEB 4IE7A 4TZ4C 1QSDA 1LWUC 4M3LA 3E0ZA 1N73A 3CWZB 4V1Av 1MIYA 2XU6A 4IFMA 4OFZA 5AW7B 2LSIA 3QK6A 1MUUA 1QL1A 4NUUA 5APXA 1URQD 3HKDE 2LSJA 4PJJA 4UIGA 5CMZA 4GYSA 1N7SC 2D0UA 2VKOA 1LKXA 3O1IA 4RESB 1LVKA 5J2TE 1HGZA 2H8PD 5LOVE 2YEVC 1G73A 3Q2MA 3M0DA 4XBFB 3BRVB 2CMRA 2XTLA 2PG8A 1JO5A 4O4LE 3ONXA 2WTYA 1WT6A 3HUSC 3GN5A 3HKEE 2O01H 1D1BA 3J7Yq 2X9XA 2C9LY 1KILB 2BASA 2OYIC 1FJKA 2X9WA 1LGHB 3OA7A 3V4WA 2LOSA 1NHLA 2C0WA 3WI3A 3K3NA 2JJLA 1JOCA 3KFWX 1S94A 4H9NC 3VHLA 2YU1A 3VYIA 2UXXB 1BR4A 4ERRA 1FZCC 3N9QA 4LGDE 4PFOA 2WT7B 5LNKA 3KBUA 2CWOA 2HODB 4E7SA 3SWHA 2HPLA 2YO2A 1L4AD 3LK2B 3N2OA 3JC6D 4UVBB 1YD8G 5EK3A 3BQKA 2Q9QD 2VKJA 1T98A 3RK2C 2PJQA 1FBMA 4AKGA 2KP8A 1LRZA 3P7IA 5E0OA 1FZBA 2K48A 2IAKA 1YTZT 2HPCA 3SS1A 4WY4C 2KNDA 5HXRA 3R6NA 1N86A 1YYCA 1IJ6A 2XAFB 1KK7A 1FZGA 3KDSE 3UUXB 2FFDA 1VPCA 3RL0B 2H7VC 2CCQA 3N9MA 2R5DA 3AAAB 1J1DB 2WSSV 2LM9A 5LBMA 4EAHA 4I43B 3B8EB 5CJ4A 3KV9A 5DABA 5LHHB 3ZYKA 3P7KA 4ZOLE 2Y48B 5L3EB 1NOHA 1SQPK 2KWHA 4X1YE 3HE4B 2C0SA 2J58A 3OBVE 3O8ZA 2V7LA 4H63H 4ISTA 3V5SA 3ZJ2A 2A45H 4P09A 5F8PA 3M06A 2XDJA 2XNXA 4AKLA 4P0BA 2V1DB 5KMGP 3PP5A 3AA7B 5AW1B 3NZQA 3ZYMA 3TNUB 2YMYA 2WITA 2V7JA 5JREA 2LSKA 4EYYR 2CWYA 2N9BA 2M3BA 3ZJ1A 1EZ3A 1CW5A 2E42A 4Z8XA 2R32A 1IFDA 4CXWA 4ISSA 2UXNB 3IFMA 4DZOA 1JNMA 1WRGA 3QUJA 5FXZA 5CCHC 2W27A 4DMWA 2K24A 2WSEH 2VB6A 2V7IA 3M9QA 1SQVK 3SWFA 1H88A 4UELA 2NPSD 1U5PA 2LSYA 2Q9IA 4AUWA 4QXBB 2J59M 1WYCA 3B5NA 2RP4A 2VASA 3UT5E 1YKHB 4C7NB 3I5CA 3N4XA 4I2LC 3P8CD 4WW0A 4BJNA 2CLYB 1HGVA 2E9XA 1LTBC 3A5TA 1SFCA 3EVYA 4I50E 3NFQA 5AVXB 2OYHC 3UTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VP8 A;  4N3Y B;  3P8C D;  1IC2 A;  3C9I A;  3U59 A;  3BAS A;  3BAT A;  1NKN A;  1WT6 A;  3N7N A;  3OJA B;  4GIF A;  5BVZ A;  5KTB A;  2FXM A;  1X79 B;  4O9B A;  2JEE A;  3HRN A;  4I1L A;  3U1A A;  5BU5 A;  5BU8 B;  4ZKP A;  2POH A;  4N78 D;  3N4X A;  3U1C A;  3VP9 A;  4ZKU A; 
#chains in the Genus database with same CATH topology
 1PP9 D;  3P8M C;  3HD7 B;  2CA5 A;  2I0M A;  2WSF H;  4NPE A;  4PJM A;  3GHG C;  1U7J A;  1S9K D;  1W0A A;  4JI0 T;  1YQ4 A;  1NTM D;  3CMA P;  2MYS A;  1LNQ A;  3PUQ A;  3OW2 O;  4KHZ F;  4QH4 A;  1DH3 A;  2GM4 A;  5ABG A;  3RRC A;  1WLX A;  4HFD A;  2XKM A;  1XMQ T;  3CQG B;  3L75 E;  4PJ0 H;  1VOM A;  5LHG B;  2OLT A;  5IHY A;  1FMV A;  5AVR B;  4C90 A;  2PFX A;  4UF0 B;  1XTG B;  1JY2 P;  2FBW C;  4WVZ A;  1EZV E;  1X8Y A;  2FYU E;  1X9B A;  4HWD A;  3DP7 A;  1A02 F;  4TWF A;  5B66 E;  2CHN A;  4I55 E;  5DQV A;  3NTN A;  2L91 A;  2H43 A;  5CBO A;  3AEB A;  2JQQ A;  1MMA A;  4DV6 T;  2DHR A;  3AA6 B;  4W7Y A;  5EZY E;  5AFU L;  5JRC B;  4JPZ B;  5AVU B;  4H44 C;  2ZXE B;  3V2R A;  1GL2 B;  2BCC E;  1RF1 B;  5C2T A;  5L2L A;  2VKH A;  1T2K D;  2LJL A;  2OTL P;  3L70 D;  2G3A A;  5J1G A;  4XAX B;  1KNP A;  4DO0 A;  3KZI E;  5CJ5 A;  2B76 A;  2LT3 A;  4OYJ A;  2YOE A;  4EIJ A;  3CX7 B;  1MFZ A;  3OYX A;  3V5U A;  4IE5 A;  1AVO A;  2QYW A;  3PUV F;  5APS A;  1LTS C;  4PD4 D;  1JUN A;  1OED C;  3AVR A;  1NEN A;  1M1J C;  4U74 A;  2X9H A;  3O9X A;  3T97 A;  3Q2Y A;  2K9Y A;  2W62 A;  3AE5 A;  2KIK A;  4IRE A;  3H1K D;  3D6Y A;  5JDL A;  3H25 A;  4HKZ H;  4X62 T;  2ACZ A;  1PP9 G;  3HKC E;  5FP3 A;  5HEO A;  1PGO A;  2NP9 A;  1LT9 B;  2KUB A;  2FXP A;  4CZZ B;  1NTM G;  2VVS A;  4K3A A;  5LYJ E;  1X22 A;  5AQM B;  2A45 I;  4LFA T;  1KIL D;  5JR9 C;  5JDG A;  2CBJ A;  4BJM A;  2YNY A;  4GKK T;  1KFN A;  5CFB A;  4Z1M H;  2XSA A;  4JI2 T;  4YJ2 E;  3AE8 C;  2XV5 A;  2RPA A;  1E2A A;  3U1A A;  3TK1 A;  1KTM A;  3VN0 A;  2KLV A;  3NBX X;  4DR1 T;  1LP1 B;  2GUV A;  4N78 D;  1URQ A;  2UXD T;  1UII A;  4ZKU A;  3CPW O;  4KMC A;  4IGU A;  1N34 T;  5BR8 T;  5CCG C;  3J9X 1;  4KUM B;  4PJL A;  4UV8 B;  3M0A A;  2V6X A;  5KLI B;  4TX5 A;  5LMU T;  1YTZ I;  3A0H E;  5AQV B;  4G2A A;  4IDZ A;  2HN2 A;  1FC2 C;  2WMN A;  2FYU K;  1T8B A;  5GTH E;  2EHO B;  1KB9 D;  2FKW B;  3H1H J;  3L70 G;  2CHO A;  1GK6 A;  5EK2 A;  2XY8 B;  1PP9 E;  1T8Z A;  4JI5 T;  2WM9 A;  4C46 A;  3G4S P;  2XND H;  2N1T C;  5KJ7 C;  1S9K E;  1GTW A;  1SVF A;  5M4Y A;  1NTM E;  1X79 A;  2XAH B;  4K0U A;  3NRX A;  1L0N D;  1WR6 A;  4JEH B;  3PTZ A;  4GDO A;  1IK7 A;  1G2C A;  2FY8 A;  2XZR A;  1XMO T;  2PAJ A;  1NU1 D;  1S5L E;  1JNR A;  5ETW A;  4KP3 C;  4QHO A;  4TWH A;  1KYO H;  3H1K G;  2P2U A;  1QVF O;  3B57 A;  4DV0 T;  2ZVO B;  3RKG A;  1IFM A;  1LWU B;  3ITK A;  2E43 A;  2ZYG A;  3L75 J;  3WMM 0;  2FJD A;  4PK6 A;  5LGU B;  1SQB J;  1HVV A;  4U7J A;  2IC9 A;  4IE4 A;  3CCS P;  1XZY A;  1JTH A;  1XDO A;  4LF6 T;  3N5L A;  1W0B A;  4U72 A;  3P4S A;  2Y8D A;  3PUS A;  5ABF B;  2FYU J;  3N9O A;  2Q3E A;  4OGQ C;  4CQI A;  4RJT A;  3RL0 D;  4ZI2 C;  4H13 D;  4Z91 A;  5JDN A;  1YQ3 A;  3HD7 A;  4LML A;  2Z4E A;  3ZLI A;  3L72 D;  3L70 E;  1SHZ C;  3GG2 A;  3MTU E;  3RRW A;  1S35 A;  2BCC J;  4LC1 A;  3L09 A;  2ACX A;  3TLV A;  1NWQ A;  3FZF B;  3CK6 A;  2KYV A;  5FXW A;  4K0K T;  4LF5 T;  1FS0 E;  5HAX A;  3O6Q B;  3Q5E A;  1LTG C;  4H9P C;  4PD4 E;  2E75 B;  4WB4 A;  3H32 B;  1N7S B;  2QJK B;  1KV4 A;  4I4T E;  1YW0 A;  4UB6 E;  5B5E H;  4DOJ A;  3KHU A;  3WU2 H;  1WYB A;  3JSV C;  5AVZ B;  3H1K E;  5HYA A;  1L4A A;  2DCF A;  2UUC T;  3FGA D;  1K8A Q;  3G06 A;  1WFD A;  4WNK A;  3I9W A;  3KV4 A;  4AIS A;  3VMZ A;  1VCT A;  3EFF K;  3SFE C;  3ZMV B;  3T8O A;  1L0N G;  1KIL E;  1VQL P;  2LKH A;  2RN0 A;  1NU1 G;  2Q6Q A;  3M3Z B;  1ZW0 A;  2OQQ A;  3P4W A;  2W6B A;  3HUS B;  2XAS B;  4HJG H;  2AXD S;  2H89 C;  2IFM A;  1IZN B;  4YPC A;  1Q7Y Q;  2PTF A;  1M7K A;  3CX6 B;  4N78 E;  1MIW A;  5A1L A;  3MKD A;  4L73 A;  3N9N A;  1G1I A;  2KWI B;  2WZI A;  2OYI B;  2Q3I A;  3QH9 A;  2L9Q A;  2LHR A;  4JYA T;  2WSE J;  1D0Y A;  1PGQ A;  2J5U A;  1VQN P;  3SWK A;  1D1A A;  1D0Z A;  1Z8U A;  3MUD C;  3GMA A;  3ZT5 A;  4B3T T;  2JKV A;  3L72 G;  1KB9 E;  3C64 A;  3P4Q A;  3PTR B;  1ZRT D;  3N7N A;  1FZC B;  3CML A;  4QX7 B;  3HE5 A;  3AEG A;  3UQ7 A;  3V6I A;  3CCL P;  4AIU A;  4H63 V;  1PP9 J;  3KPE A;  1BE3 G;  1L0N E;  1KQG B;  4Q25 A;  4CI2 B;  3AE1 C;  5LCY A;  4AI6 A;  1P84 H;  5HWY A;  2LE8 A;  1NU1 E;  1SQQ G;  4X20 E;  3L3P A;  1NTM J;  3KVB A;  2E75 C;  2BEQ D;  1GW3 A;  2IBZ D;  1MNE A;  1SQX D;  2YKO A;  1M56 D;  4UVC B;  5IWA T;  1FOS F;  1ZN5 A;  3Q5P A;  1QVG O;  4NPD A;  5E79 H;  3RK2 B;  1QLB A;  4LFC T;  5FMN A;  3CLQ A;  1UUR A;  1IFP A;  2OTK E;  4EV6 A;  2XSB A;  1QUU A;  4JBW F;  1E79 H;  3GWH A;  4QXH B;  2EHO A;  2ZVN B;  3ZMS B;  1MMD A;  3IF8 B;  4WBN E;  4Y99 C;  4DR2 T;  1W2B O;  2C5J A;  3AE9 A;  4L76 A;  1VQ6 P;  4MLK A;  3U59 A;  5IYZ E;  3L72 E;  4WY4 B;  3H1J G;  2LRL A;  2L8K A;  3AAE B;  1NAY A;  5AW6 B;  3ZN0 B;  2NRG A;  1XDP A;  1K05 A;  2YK0 A;  3MA9 A;  3TLW A;  2WSC H;  3AED A;  2KSE A;  3LW5 H;  3L70 J;  1IFN A;  1VL2 A;  2K37 A;  4NPP A;  3KYQ A;  4ASV A;  5BU8 B;  2YDR A;  2QIW A;  5GTI H;  3ZCJ A;  2V7Q J;  2JO1 A;  3OAK A;  5HXE A;  5JH7 E;  2HG5 D;  1LWU A;  3KV5 A;  1SQQ E;  5LP6 E;  1JMM A;  1Q90 D;  1HF8 A;  1HTJ F;  1ZEE A;  5M1B A;  3SRZ A;  2WWU A;  3ZC0 A;  3LBX B;  3HD7 D;  2GK9 A;  2BS4 A;  2DI4 A;  1FZE A;  3H1K J;  1T72 A;  2UXB T;  1NKZ B;  3PUX F;  4IFD K;  2JEE A;  4YFS A;  4KX6 A;  3ABV A;  2KZI A;  2YKP A;  2JJ9 A;  3LG7 A;  2YIN A;  2I6H A;  4AXP A;  3ONJ A;  2VL8 A;  2B89 A;  2IBZ G;  1SQX G;  1FJP A;  2NPS A;  4AYC A;  3H1J E;  4MFR A;  5CCG D;  3CIR A;  5L3G B;  2XZE A;  2LKM A;  2OYO A;  1EXI A;  4GK5 E;  1L0N K;  4WZX A;  4CN6 A;  2Z5I A;  3OJA B;  2LXB A;  2KSR A;  3CKD A;  1NU1 K;  3LJC A;  5LB7 B;  2WU5 A;  4KHX A;  3AE4 A;  4ZKP A;  4LMK A;  5KLV K;  2LM2 A;  2HHH T;  1GL2 D;  4YTP C;  4EXT A;  4WYV A;  3UUM A;  3ZEF B;  3TSI A;  2A3D A;  2E2A A;  4IE0 A;  3PU8 A;  4XZC A;  5L3C B;  3A8Y C;  4UV9 B;  3L71 D;  1AFO A;  4DR5 T;  1DIP A;  1KNZ A;  3ZT7 A;  4EZ4 A;  2RA1 A;  3CI9 A;  2KK7 A;  3HUS A;  3RX6 A;  1KMI Z;  2WPQ A;  5LGN B;  2IBZ E;  1SQX E;  2OYI A;  3GLM A;  2IDO B;  3RIU C;  2O1K A;  4HN9 A;  3PUW F;  3BAT A;  5AVV B;  4DID B;  3PV0 F;  2XM2 A;  1S5L X;  3ANW B;  1N32 T;  1G8X A;  2BG9 B;  2FJA A;  2QA7 A;  1SQQ K;  1FDO A;  4ZI2 D;  2E76 B;  4TLF A;  4W80 A;  5TIS H;  1L0L J;  3QNU A;  4C7R A;  2KLQ A;  2N2N A;  2OV9 A;  5KKZ C;  1FZC A;  2QJP B;  2W8Z A;  3N2K E;  5LG4 A;  2K88 A;  3KQG A;  2J62 A;  3K3O A;  1LTJ C;  1CUN A;  1JY3 N;  2WCA A;  4GOE A;  2JQ9 A;  1VF5 B;  4EGW A;  4JYB A;  2UXC T;  1XNR T;  2A9U A;  1AJY A;  1LTI C;  2CXL A;  4HE8 A;  3U3I A;  2YKS A;  2X68 A;  5J0Z A;  5B66 H;  3TLS A;  4UEM A;  1SQB D;  4G63 A;  5AQK B;  2EHO D;  3F57 A;  3C98 B;  3H1I D;  4YJ3 E;  3B5N C;  1JEK A;  3BAS A;  2KZ7 B;  2YIU B;  1H8A A;  4EB6 E;  4ASW A;  3L71 G;  4YXD A;  4KHP T;  2R6G F;  2ZM0 A;  2E74 C;  3L74 J;  1HNZ T;  5F3J A;  2B1E A;  1VRB A;  2BKN A;  3LK3 B;  1P84 I;  3KZI H;  3EI0 A;  1HNW T;  1JY2 O;  2VVN A;  1IK9 A;  3BQL A;  5EFW B;  1DD4 A;  2WY2 A;  5FYM A;  2OYH B;  2FYZ A;  2WU2 A;  5KAI E;  2E9X C;  1MIV A;  2LEH A;  1SFC C;  5LGT B;  1BDC A;  4QXC B;  1IFI A;  3RQW A;  3BRT B;  3RC3 A;  3GHG B;  1HF9 A;  1VDF A;  5AVS B;  1GU4 A;  1KIL A;  1TU3 F;  4D6T J;  3PUG A;  5DQW A;  2QE7 H;  5L3B B;  1ZOY A;  2IX7 C;  1SQX K;  2ZAE B;  5APQ A;  1KC8 Q;  1GDT A;  2NW8 A;  1HS7 A;  1FJG T;  3AE3 C;  5AW8 B;  4AQG A;  3V4Q A;  5AW4 B;  3AXJ A;  1YQ4 C;  2MBG A;  4NUV A;  5JDM A;  3LBX A;  3CWB D;  3OVU A;  1DU2 A;  1NTK D;  1T6A A;  1J1E C;  2BVM A;  4QWN B;  4OH8 B;  1K04 A;  5AQS B;  3L71 E;  2WT7 A;  4H44 B;  2W4X A;  3O1J A;  3X1D A;  1S1C X;  3FXD B;  4CI1 B;  2E75 D;  2HOD A;  2P1J A;  1N7S D;  1SQB G;  4JI3 T;  3A3Y B;  3SSU A;  4TUY E;  1HX8 A;  3H1I G;  3VP8 A;  1CI6 B;  3Q5X A;  2NW7 A;  2ZMA A;  1IBL T;  1HH0 A;  3G9R A;  3G3Z A;  5GTH H;  1SQX J;  2AXT E;  1OED B;  1BSH A;  3I9Y A;  1M1J B;  3SOL A;  3W15 B;  2X0H A;  2VK9 A;  1GW4 A;  1JNZ A;  2ES0 A;  4EED A;  2P7J A;  1Z0P A;  2W63 A;  4HWF A;  1J5E T;  4HFI A;  1EDK A;  4IFF A;  4ILC A;  3U1C A;  1RE4 C;  2BBJ A;  4DR6 T;  4QX8 B;  2ODU A;  3RK3 C;  4PV1 C;  3NRY A;  2WWW A;  3FZK B;  2WDR A;  2K9A A;  5JR9 B;  4AKI A;  3AE5 C;  3WAK A;  3R84 B;  3Q1M A;  3GF3 A;  3AVS A;  4IL9 A;  2IFN A;  5AQJ B;  1NKN A;  1PZQ A;  3PUR A;  2O1J A;  3AEE A;  4DVD A;  2QSI A;  2Y0C A;  4XE5 B;  5HEG A;  1SQB E;  2WMO A;  2BEZ F;  5AW3 B;  4O8S A;  3CX5 E;  2X67 A;  5AQU B;  1NTZ D;  3RGL A;  1SS1 A;  2V26 A;  5FXV A;  3H1I E;  3CQC B;  2Q7C A;  5FY7 A;  1JCD A;  4B86 A;  2KI7 B;  3IAO A;  1YIT P;  3HR0 A;  2QJY C;  5FVL A;  5AQH B;  4JF7 A;  5LMN T;  2NOX A;  5J2U E;  3V2P A;  3RYH E;  1BGY J;  3MGN A;  4IDN A;  1CZQ A;  5BMV E;  3FZH B;  5TAO A;  3HE4 A;  2AEM A;  1URQ C;  4W7Z A;  2J1D G;  1VQ8 P;  2MOZ A;  2WPS A;  4TN7 B;  4ILU A;  4DV1 T;  2XHE B;  3AE2 A;  4C91 A;  2B9B A;  3CCE P;  4CI3 B;  2N1T B;  2XQY A;  2O01 J;  2QG4 A;  4JLE A;  5L3F B;  1XTC C;  3QOF A;  2AXC A;  3M9B A;  5H6R B;  4AQF C;  4LMJ A;  3O1H A;  3RK2 D;  3UUL A;  1OWA A;  3PUA A;  4LF9 T;  2M5A B;  2W90 A;  2L5G B;  4ZZC A;  2QGS A;  2YO3 A;  4X1I E;  3Q5W A;  2D0T A;  2FXM A;  3R4Y A;  1VQ7 P;  1FDI A;  4WWI A;  2JMK A;  4GOU A;  1L2P A;  2W00 A;  1OZH A;  3CWB E;  4WY4 D;  3RPU A;  1PIX A;  2B87 B;  1KEY A;  2ZM8 A;  1OFC X;  2OAR A;  3TNU A;  2PRR A;  3V5B A;  4N3Y B;  2WPV B;  4U7Y A;  2BKP A;  3NZP A;  2LR2 A;  4TNV A;  4OGQ B;  3KV6 A;  3FXE B;  4YHJ A;  3L4F A;  2VRS A;  2Y6X A;  3G6E P;  1IO4 A;  4IL4 A;  1R5S A;  1RF0 C;  3M9H A;  2CEA A;  4UB8 H;  3L71 J;  4HH2 A;  3D71 A;  2Y0D A;  3AEC C;  1NTZ G;  3E1I A;  4YTM A;  1GD2 E;  3TYY A;  4P1N A;  1I6Z A;  3P8C E;  3ZMU B;  4IIJ E;  4OHF A;  3P50 A;  5AQI B;  4IDP A;  4B3R T;  3UUN A;  2NWB A;  1YQ3 C;  2E5L T;  4HWC A;  3JCU E;  2OTJ P;  1J2J B;  2OGU A;  1H7C A;  4DND A;  2LSG A;  2Q1K A;  1SQB K;  4R4M A;  1KF6 A;  1UX4 A;  3FZM B;  2YKQ A;  1Y64 B;  5JTG A;  5HXC A;  4DV5 T;  4EZH A;  1JM0 A;  1H0T B;  3CCU P;  3G71 P;  2UU9 T;  1S3J A;  4IL6 E;  2P58 A;  2H7H A;  2VQE T;  2JRK A;  1UX5 A;  1KNR A;  4MAL A;  2XAG B;  1L4A C;  2NTX A;  3JC6 C;  2IUB A;  4C7N A;  4BAY B;  1VQM P;  5H2F H;  3IEE A;  2IML A;  2Q9Q C;  5C39 A;  3UIA A;  1PL5 A;  4GOF A;  4KBM B;  3AEF A;  1NTZ E;  1HNX T;  5ADX L;  3VR9 A;  1UCU A;  4B3M T;  1OVV A;  3EAM A;  1Y9B A;  3JAF A;  2E74 D;  1KQF B;  1FMW A;  2P9B A;  3MHV A;  4DJG A;  3V2N A;  3ZKR A;  3H1I J;  3GN5 B;  1L0L D;  3RGU A;  1US7 B;  5HXH A;  2NTY A;  2X9Y A;  2HR3 A;  4H9O C;  1HTL C;  2G8Y A;  3MD0 A;  1AJ3 A;  1ZHC A;  2QM8 A;  4AQY T;  3FHN A;  2VQF T;  4DR3 T;  3N9L A;  1YIJ P;  1OXZ A;  1N73 C;  4L5G A;  4PK4 A;  3RLF F;  3L37 A;  1JY3 P;  4BRY B;  4PJN A;  3RC8 A;  1FEW A;  4H9R C;  2BS3 A;  2ZT9 C;  5CCH D;  3AE8 A;  3CCM P;  3DJB A;  1RE3 A;  5FY0 A;  3E22 E;  4XFJ A;  2E76 D;  1WR0 A;  1M57 D;  2WWV A;  2LLY A;  2F4V T;  3C4Z A;  2C0X A;  4UF0 A;  3AEG C;  1OIP A;  4I7Z C;  5CCG A;  2W66 A;  3P4R A;  4X65 T;  2V6Y B;  1UK5 A;  4PNI A;  1E1H B;  3VKH A;  3L74 D;  3UUB A;  1JMB A;  3B13 A;  5AW0 B;  2B88 A;  3K1S A;  1VF5 D;  2V4H A;  5JRC A;  1T3U A;  4WBO A;  3CWB J;  4HFC A;  1GL2 A;  2AEJ A;  4Y99 B;  1NTK J;  4YXW H;  1RF1 A;  4FI5 A;  2K5B B;  3RHW A;  2XQ6 A;  2KB7 P;  2V8S V;  2BBH A;  2E5T A;  2IC6 A;  3SWY A;  2I1K A;  1QL2 A;  3H3A A;  3S4U A;  1HX1 B;  1SUM B;  4EOT A;  2GUS A;  1ZXG A;  3M0D C;  1EDL A;  3WUU A;  5LXT E;  4D6T D;  1NTM K;  2KXP B;  2M5A A;  5JDF A;  3AE9 C;  1ZR2 A;  1L0L G;  2HPC B;  1HUC A;  3C8V A;  4AQR D;  1BSN A;  3A2A A;  2SPC A;  1NTZ K;  3WUT A;  4WBA A;  4ANJ A;  4HKA A;  2C9N Y;  1W09 A;  5LA6 E;  2B87 A;  3AED C;  4XA4 A;  3CXH H;  3KBT A;  3L73 D;  3S9O A;  2CPS A;  3MIW A;  1DX7 A;  1LT9 A;  3EQ2 A;  3C51 A;  3AEA A;  4HWI B;  3F5H A;  3GW6 A;  5HCJ A;  3T1Y T;  4GOD A;  2IYO A;  2DWG A;  1LVF A;  2MJZ A;  3I55 P;  1YHQ P;  4TT3 H;  2WDQ A;  3ZC1 A;  3Q5R A;  1AVY A;  3M91 A;  2DLR A;  2MTQ A;  3KXD A;  2JIW A;  4MN4 C;  5KX5 E;  3H37 A;  1LP1 A;  2CPB A;  3ABV C;  3L74 G;  4EIW A;  2XAJ B;  2FYN C;  5CHX A;  3WAJ A;  1CSB A;  3QWO C;  3E08 A;  2CM0 A;  3C50 A;  1NTZ J;  3MK7 C;  1L0L E;  4H44 D;  3CME P;  4I0U A;  2BZB A;  2NPS C;  2KNC B;  1H0T A;  3ETV A;  4YSY A;  3U78 A;  2XQ3 A;  4QH1 A;  3AE6 C;  4EOZ B;  3IHR A;  4GT1 A;  3PE0 A;  2KMF A;  1HBW A;  1SA0 E;  2JMH A;  1VQ5 P;  2H3R A;  4D6T G;  1JY2 N;  1EDI A;  1KD1 Q;  4H9S E;  1P84 D;  2WSF J;  4A7P A;  1VQ9 P;  5CA1 E;  3ETU A;  4IHJ E;  1SQV D;  4UXN B;  4JI4 T;  4JI6 T;  2V7M A;  2BG9 E;  3OTO T;  4X1K E;  3VU7 H;  2WQY C;  1FAV A;  3FWN A;  4CXY A;  3HKB E;  1HJB A;  3PDY A;  4Y28 J;  4ADZ A;  1T3J A;  5KAF H;  3CCR P;  2RKL A;  1W2E A;  2HPJ A;  3L73 G;  5L8R J;  1FZF A;  4DUY T;  5AQL B;  1BGY D;  3L74 E;  2FFD C;  3L8R A;  2WDV A;  2N9D A;  3DTO A;  4ZXL A;  3V2Q A;  5KDM C;  5ABF A;  3MUD A;  5KAI H;  1B7T A;  2I59 A;  2L3L A;  2JP3 A;  2K3R A;  4BA9 A;  4I1L A;  4PW8 A;  3CD6 P;  3IA3 A;  3S1K A;  5KKZ B;  2XM1 A;  4EYY Q;  1KYO I;  4HFV A;  5AQT B;  2W6A A;  1XNQ T;  2HFE D;  1LTJ B;  5AW9 B;  4MBQ A;  2NR4 A;  3LDQ B;  4R4L A;  3CQX C;  5FKY A;  1N2D C;  4D6T E;  2KSJ A;  3O6Q A;  2AEF A;  5B5E E;  1ZME C;  1AQ5 A;  1MV8 A;  3H32 A;  3EUH A;  1N7S A;  1M7L A;  3GA8 A;  3VMA A;  3CCJ P;  1BR2 A;  2V6Y A;  3H1L D;  3VP9 A;  4JBZ A;  3T1H T;  3AA1 B;  1M8O B;  1G1J A;  5L4H A;  3R2P A;  3L73 E;  3B5N B;  5JDQ A;  3Q9D A;  3VMX A;  2IHR 1;  2CBI A;  5DJQ C;  2ZM6 T;  1T2K C;  2A2F X;  4HYT B;  4COF A;  2LKG A;  2N1T D;  1ZRT E;  1ZV8 A;  5KJ7 D;  2E74 B;  1L0L K;  3F31 A;  1GMJ A;  5C3J A;  5HEH A;  5LHI B;  1D1C A;  2C5I T;  5FXX A;  1WMK A;  3RYI E;  2QM7 A;  3B5M A;  1ZLL A;  2WB5 A;  3UU8 A;  4GKJ T;  5FL1 A;  4IL6 X;  1UUS A;  2E9X B;  3W68 A;  1V9D A;  5JQG E;  1SFC B;  1QEX A;  4YXD C;  2KOG A;  3K5B A;  2PP6 A;  2HH7 A;  4U31 A;  1BGY G;  1RHZ B;  4ZI3 C;  1AV1 A;  1HFA A;  3CPZ A;  4A97 A;  4JV5 T;  2MKV A;  5AQN B;  4ZEY A;  3MXZ A;  2ZXX A;  1O3X A;  3A0B H;  2YU2 A;  5AVW B;  2ZLY A;  4J2C A;  4OGQ D;  3F2E A;  3LSV A;  4O4H E;  4UVA B;  5AW5 B;  2PBI A;  2M8R A;  1KIL C;  1PFI A;  4KJM A;  2LXC B;  2J4G A;  4X66 T;  1J1E B;  4BWN A;  4TV9 E;  2ZT9 D;  1ZR4 A;  3BQI A;  1ZP0 C;  1ZOY C;  3JC2 2;  1P84 E;  3C1L A;  3NVO A;  1H89 A;  4O4I E;  1HCI A;  5LJN A;  3CX5 H;  1MKM A;  2XQ5 A;  3L39 A;  1OED E;  1IAP A;  1RQU A;  3PUZ F;  4OK0 A;  2YDS A;  1NVO A;  1XWM A;  4O2B E;  3H1L G;  3CC2 P;  4ZMD A;  5FVK A;  3CXH I;  3VMY A;  3UFE A;  5E79 E;  1RH5 B;  2Z5H A;  5CB4 E;  4DV7 T;  2BVL A;  1FDM A;  1R8I A;  2UUA T;  1BGY E;  1ZV4 X;  2XAQ B;  3QC9 A;  1YJW P;  1U7M A;  3K3Q C;  1BCC D;  3P32 A;  3VTP C;  3LK4 2;  4HEA A;  1QGK B;  3CX8 B;  4H0L C;  1DEB A;  2PGD A;  2XUE A;  5LBQ B;  3AA0 B;  2R3C A;  2JPF A;  3ZST A;  4WY4 A;  1SLQ A;  3B4S A;  1N8R Q;  3RK3 B;  3QB5 K;  4PV1 B;  2D2C C;  5CJ0 A;  5TJH A;  1KN7 A;  5LJM A;  4MHC A;  2KS1 B;  5GTI E;  1NH4 A;  2P67 A;  3AE7 A;  1T7S A;  4U3F J;  3KDP B;  4A56 A;  2M0B A;  3L36 A;  1JCC A;  3IR9 A;  4HGA A;  3KIN B;  1FZA A;  2J47 A;  1SQP J;  3D0T A;  3AAI A;  3H1L E;  2V7K A;  5BU5 A;  3PJS K;  2POH A;  1LJ2 A;  4QKN A;  3TLT A;  3RL0 C;  4H13 C;  1HWT C;  2QJY B;  4IE6 A;  3AEE C;  1J1D C;  2O01 N;  3L73 J;  3E1R A;  3CC4 P;  4ASK A;  2X51 A;  3RH3 A;  4DR7 T;  1URQ B;  1N33 T;  2VWA A;  1LTJ A;  4L74 A;  2FJE A;  4DV3 T;  3RQU A;  1NWM X;  3FBZ A;  3JCU H;  1A02 J;  2G0U A;  2QVA A;  3AEB C;  1J5W A;  4U33 A;  3EDV A;  5CBN A;  5AVQ B;  3FBL A;  3RYC E;  5CGM A;  3OJA A;  5APV A;  2C5K T;  2GA1 A;  1EDJ A;  3A0H H;  2I8D A;  1YI2 P;  3ZN1 B;  3CVR A;  1U57 A;  5HXS A;  5APY A;  4ZI7 E;  1BCC G;  3SFD A;  2PFV A;  2BDE A;  3EDU A;  3BVH A;  4IL6 H;  4U3C A;  4L75 A;  3JAD A;  1GZL A;  3S4R A;  3AE2 C;  4ILA A;  1BR1 A;  2XPK A;  3IBP A;  3C4W A;  2CRB A;  1X79 B;  3Q5S A;  4NIQ A;  5L4E A;  1MMN A;  3C4X A;  5L3D B;  4H9Q C;  1G2C B;  3RIF A;  3M65 A;  2SPZ A;  2Y9Y A;  3PHL A;  2A45 G;  1S5L H;  2H7O A;  3FZL B;  3N2G E;  1EQ7 A;  1HG2 A;  4JEU B;  1NEK A;  3VOP A;  1MND A;  2CE7 A;  5HWX A;  2Z6E A;  4YY3 T;  3A7O A;  4TV8 E;  2VKD A;  2DL1 A;  1JTH B;  2E8I A;  3MZK B;  1SQV J;  1KZU B;  1VQK P;  3MJX A;  1IJD B;  2UWJ E;  1U4Q A;  1MMG A;  3HTK B;  3WUV A;  1J1J A;  3AB3 B;  3USS A;  1NAF A;  5JDH A;  5CCH A;  3PU3 A;  3ANW A;  5JVD E;  3CWB G;  2BG9 A;  5APW A;  1NTK G;  2K9J B;  2IW5 B;  3H6P A;  4FJO A;  4K35 A;  2CXD A;  3AE3 A;  2JQH A;  1KQS O;  3MP7 B;  1EC5 A;  5TIS E;  4L0R A;  4E7Z A;  2IPP A;  1BCC E;  5APU A;  1JB0 J;  2WBL A;  4B3S T;  3RI5 A;  3MAC A;  2W67 A;  2V7Q H;  5AQG B;  1K73 Q;  1IJ5 A;  1D0X A;  2WSS H;  1WRD A;  3NMD A;  4DR4 T;  1Q82 Q;  2W61 A;  4GIW A;  1USE A;  1ZKE A;  1NO4 A;  4PD4 H;  3ESL A;  1HJ0 A;  5C8Y E;  3ZCI A;  3W67 A;  4B6X A;  4UB6 H;  5FNV E;  2ZFC A;  1L4A B;  2WSC J;  3LW5 J;  2H88 A;  4O4J E;  2X0L B;  1PV3 A;  2Q9Q B;  2V5D A;  1R5L A;  1JY3 O;  1VQO P;  4DV2 T;  3Q3D A;  1YJ9 P;  2A72 A;  1R8E A;  3O4X E;  4O2A E;  2P10 A;  4JYC A;  3HL6 A;  2LOP A;  2ITA A;  1OW7 A;  2HN1 A;  2N1G A;  4HTE A;  1S72 P;  1OW6 A;  3H1L J;  2ODV A;  3BCC D;  2IZ1 A;  3EHZ A;  1FIO A;  3RBZ A;  4DBQ A;  1NTK E;  1X9V A;  3CX5 I;  4HWH A;  5F5W A;  1GU5 A;  1OX3 A;  3TKL B;  3CCV P;  5FY1 A;  2ZM2 A;  3AEF C;  4UR9 A;  2CLY C;  2HYN A;  2OA5 A;  5HCM A;  3I0O A;  5AVT B;  2OYH A;  1EZV I;  1RE4 A;  1FOS E;  1RY3 A;  3ZYL A;  4GKG A;  1N73 B;  2KIN B;  1USD A;  2KS1 A;  4ZI3 D;  5AQR B;  3GHG A;  3OYZ A;  3QB5 A;  3HRN A;  1YJN P;  2ZT9 B;  3RL0 g;  3I1A A;  4DT0 A;  3NWI A;  3LFM A;  5EK4 A;  2WAU A;  1HR0 T;  2K3W A;  4X64 T;  3KVA A;  2X66 A;  1KB9 H;  2DNX A;  2A06 D;  2YMK A;  3PLN A;  4RO0 A;  3HD7 C;  3P4P A;  4IDQ A;  1MZ9 A;  5AVY B;  3HE5 B;  3TLU A;  2X0Y A;  1SP4 A;  4I7Z B;  2FBW A;  5HEU A;  2M6B A;  2WPR A;  3GMI A;  3L35 A;  2M6I A;  2R44 A;  1RE3 C;  2KT9 A;  4O9B A;  3FB2 A;  2ZJS E;  4F6R C;  2FJB A;  4OYK A;  3A5X A;  2I1J A;  1RQV A;  3FXD A;  3UU3 A;  4I6M C;  4ZS2 A;  5ABH A;  4Z90 A;  3EFG A;  1FU1 A;  4ILB A;  4AKR B;  4DMV A;  4U2Y A;  2JQK A;  2WZH A;  4AKH A;  4OX9 T;  2LHN A;  4AQF A;  1CI6 A;  2NW9 A;  3I56 P;  3VR8 A;  4GIF A;  1QLE D;  5BVZ A;  2HLO A;  3B5N D;  1GL2 C;  3UU5 A;  1RF1 C;  3BCC G;  2WZ7 A;  1OED A;  3BK9 A;  1M1J A;  3I0Q A;  2R5B A;  3UU6 A;  4EEB A;  2RMZ A;  4ZZB A;  4H0L D;  2QEX P;  1HG5 A;  4DCK A;  2XQA A;  4YHH T;  1IC2 A;  5FL0 A;  3II6 A;  2FXO A;  4ZNC A;  4DUZ T;  1SE7 A;  1W5C E;  2E9X D;  2D2C D;  4IDO A;  2FUP A;  1N7L A;  1SFC D;  3TGU D;  1LTT C;  1BCC J;  1LTA C;  4PFP A;  3ZT6 A;  4YLH A;  1NTK K;  5KLV D;  4DBR A;  4YTN A;  4PAG A;  2CPT A;  4PK5 A;  1S2E A;  5JR9 A;  3ZPO A;  1RF0 A;  1AQT A;  4RKU J;  5CA0 E;  1IFJ A;  3AEC A;  4ZS3 A;  2A06 G;  4PJ0 E;  4ZHQ E;  1KYO D;  1LT9 C;  1E5W A;  1DD3 A;  3HTK A;  1L0V A;  3AEA C;  4A5X A;  3HI2 A;  2FYN B;  2K9J A;  2JR8 A;  2E5V A;  1D7M A;  4JUY A;  4F8H A;  4YSZ A;  1K9M Q;  5KTB A;  4TNW A;  1KFY A;  2D5U A;  3BCC E;  2M67 A;  3ZMT B;  1FE6 A;  3RYF E;  1QX8 A;  5GON E;  1KQL A;  3VRB A;  2DWK A;  2NPS B;  3LIE A;  4M1P A;  1AA0 A;  1M62 A;  2CXF A;  5APT A;  4HFE A;  1BE3 D;  1CHU A;  4GK0 E;  4JQ0 D;  3C9I A;  1YXR A;  3HA4 A;  4HB1 A;  1SQQ D;  2W6J H;  5L47 A;  4LLH A;  1W9R A;  2N1T A;  5KLI C;  5KJ7 A;  3MZW B;  4U3F D;  3N9P A;  3ZDM A;  3UFG A;  1KFM A;  4EYU A;  1Y47 A;  3OKQ A;  4P0A A;  4OWF A;  3ZMZ B;  1SQP D;  2Q9Q A;  2EHO C;  4NPF X;  1GK4 A;  4N6J A;  4CPG A;  4L9I A;  3GF7 A;  1WCR A;  1BR0 A;  4GYR A;  5AW2 B;  1VQ4 P;  2A06 E;  4LFB T;  2JDI H;  3K8P C;  3CL3 D;  2D2S A;  3NXS A;  3TGU G;  3VKG A;  4QMA A;  5KLV G;  2FFD B;  4CXX A;  4PD4 I;  2Q5U A;  3PRJ A;  5H6Q B;  3RK3 D;  3RF1 A;  3RKO A;  4PV1 D;  3LID A;  3H1J D;  2W0G A;  2BS2 A;  2R3S A;  1YKE B;  2IYP A;  3FXE A;  4IE7 A;  4YT0 A;  4TZ4 C;  1QSD A;  4UB8 E;  1LWU C;  4M3L A;  3E0Z A;  1N73 A;  2UUB T;  4IT4 A;  3CWZ B;  4V1A v;  4QH5 A;  5AQF B;  1MIY A;  3JCF A;  2XU6 A;  3PH0 A;  3CC7 P;  4IFM A;  3RIA A;  1X0T A;  4OFZ A;  2WVR A;  5AW7 B;  2LSI A;  3QK6 A;  1MUU A;  1QL1 A;  4NUU A;  4KT0 J;  2VL0 A;  3CXH D;  5APX A;  1Y01 A;  2N9Y B;  1NGM B;  1URQ D;  4KI0 F;  5ABE A;  2AE9 A;  3HKD E;  3D6Z A;  1S4X A;  2LSJ A;  4PJJ A;  4CN4 A;  3A7M A;  4UIG A;  3TGU E;  5CMZ A;  4GYS A;  4U3F G;  1N7S C;  2QJK C;  5KLV E;  3SFE A;  2D0U A;  2VKO A;  1LKX A;  3O1I A;  1SQP G;  3AE4 C;  4RES B;  1LVK A;  3B71 A;  1YBK A;  5H2F E;  5J2T E;  1HGZ A;  2H8P D;  4JI1 T;  1KB9 I;  5LOV E;  2YEV C;  4BXL A;  1G73 A;  2JWA A;  3M0D A;  3Q2M A;  1KYO E;  4TWD A;  4HFH A;  4XBF B;  3IF4 A;  2H89 A;  1Q2N A;  3BRV B;  2CMR A;  2XQ7 A;  2XTL A;  2PG8 A;  1JO5 A;  4O4L E;  2QRX A;  3ONX A;  2WTY A;  1VCS A;  1WT6 A;  3HUS C;  3GN5 A;  4HFB A;  5AQP B;  3HKE E;  2O01 H;  1D1B A;  3J7Y q;  2X9X A;  1GQE A;  3BCC J;  1DEE G;  3F89 A;  1KIL B;  2C9L Y;  2BAS A;  2Y9Z A;  2OYI C;  1BE3 E;  1Q81 Q;  4LF8 T;  3PUY F;  1FJK A;  2X9W A;  5AQQ B;  1LGH B;  3OA7 A;  4EI2 A;  3V4W A;  2LOS A;  4CN1 A;  1NHL A;  4BRY A;  3EWK A;  2C0W A;  4U3F E;  3WI3 A;  3K3N A;  2JJL A;  2IZ0 A;  1JOC A;  3KFW X;  1S94 A;  1SQP E;  3AXJ B;  3AE1 A;  4H9N C;  3VHL A;  2YU1 A;  3VYI A;  2UXX B;  1BR4 A;  2E5Y A;  4ERR A;  3WU2 E;  1FZC C;  4IOI H;  3N9Q A;  4LGD E;  1PGP A;  3UTK A;  4PFO A;  2JWD A;  2WT7 B;  5LNK A;  2K1A A;  3KBU A;  2YN6 A;  1PPJ D;  2CWO A;  4NXM T;  2WP9 A;  2HOD B;  4E7S A;  2W2U A;  3RK3 E;  3SWH A;  2ZYA A;  2HPL A;  3AE6 A;  2YO2 A;  1SQV G;  1L4A D;  4H0L B;  3LK2 B;  3N2O A;  2XJ7 A;  3JC6 D;  4UVB B;  1YD8 G;  5EK3 A;  3BQK A;  2Q9Q D;  2VKJ A;  1T98 A;  2QA4 P;  2ZYD A;  3RK2 C;  2PJQ A;  3NKZ A;  1FBM A;  4AKG A;  2KP8 A;  2D2C B;  1LRZ A;  2DW3 A;  2AXT H;  3JAE A;  3P7I A;  5E0O A;  2WQY A;  1FZB A;  3TDK A;  2K48 A;  3ONL C;  2IAK A;  1YTZ T;  2HPC A;  2D9D A;  3SS1 A;  4WY4 C;  2KND A;  1N86 A;  1YYC A;  1IJ6 A;  2XAF B;  5HXR A;  3R6N A;  1OVU A;  3PJA J;  1I94 T;  1KK7 A;  3CXH E;  1FZG A;  3RBX A;  3KDS E;  2BKO A;  3UUX B;  2FFD A;  4U2Z A;  1VPC A;  1IBM T;  1Q86 Q;  2MPK A;  3AE7 C;  2YXQ B;  3RL0 B;  4H13 B;  4LF7 T;  2H7V C;  5DJT B;  1L0N J;  2CCQ A;  3N9M A;  2R5D A;  3AAA B;  1J1D B;  4EDF A;  2WSS V;  2XQ9 A;  5AQO B;  1NU1 J;  2LM9 A;  3TGU J;  5LBM A;  4EAH A;  4I43 B;  5KLV J;  3B8E B;  5CJ4 A;  2WMM A;  1SQV E;  3KV9 A;  1NYH A;  5DAB A;  5LHH B;  3ZYK A;  3P7K A;  4ZOL E;  2Y48 B;  1M1K Q;  5LG3 A;  4JI8 T;  3H1H D;  5L3E B;  1PPJ G;  3EAB A;  1NOH A;  1SQP K;  2KWH A;  2XQ8 A;  4X1Y E;  3HE4 B;  2C0S A;  2Y0E A;  2J58 A;  3OBV E;  3O8Z A;  2CK3 H;  2W83 C;  3OPC A;  2V7L A;  2KLU A;  2IBZ I;  2KZJ A;  4H63 H;  1OVR A;  4IST A;  3L72 J;  2KNC A;  4YTP A;  3V5S A;  1MFT A;  5DJU B;  2WS3 A;  3ZJ2 A;  1E7P A;  2A45 H;  3FX0 A;  1LT1 A;  4P09 A;  5F8P A;  3M06 A;  2XDJ A;  2XNX A;  3L75 D;  5KXJ A;  2MAW A;  4AKL A;  3CX5 D;  3SFD C;  2XQ4 A;  1BE3 J;  4P0B A;  3T97 B;  2V1D B;  5KMG P;  1N36 T;  3PP5 A;  1EZV D;  2FYU D;  1SQQ J;  5AW1 B;  3AA7 B;  3NZQ A;  1UIX A;  3ZYM A;  2IIU A;  5KAF E;  3CCQ P;  1KOR A;  3TNU B;  4X5T A;  2YMY A;  2WIT A;  2LRK A;  3RIU A;  2V7J A;  4DV4 T;  5JRE A;  2LSK A;  4EYY R;  2CWY A;  3IN6 A;  2N9B A;  2M3B A;  3ZJ1 A;  1EZ3 A;  1CW5 A;  2BCC D;  2E42 A;  1IBK T;  1PPJ E;  1PGJ A;  4Z8X A;  2R32 A;  1IFD A;  4CXW A;  4ISS A;  1BDD A;  2UXN B;  2RH0 A;  3IFM A;  2O3J A;  4DZO A;  1JNM A;  3D70 A;  1WRG A;  4JI7 T;  3QUJ A;  5FXZ A;  5CCH C;  3H1J J;  2VUR A;  3H1H G;  2W27 A;  2BG9 C;  2M3E A;  1ZP0 A;  4DMW A;  4OVN F;  2K24 A;  2WSE H;  4A98 A;  2E76 C;  2VB6 A;  3Q5D A;  3FWL A;  2V7I A;  2YXR B;  3M9Q A;  1UGO A;  4YSX A;  1SQV K;  3SWF A;  1H88 A;  2QJP C;  2YDQ A;  3UQ4 A;  2NZ2 A;  3H3M A;  4NXN T;  1NJI Q;  3E7K A;  4UEL A;  2NPS D;  1U5P A;  1VF5 C;  2LSY A;  1OMI A;  2Q9I A;  4AUW A;  4QXB B;  2J59 M;  1WYC A;  3B5N A;  2RP4 A;  2VAS A;  3PJA A;  3L75 G;  3UT5 E;  2H88 C;  3UU4 A;  1YKH B;  3ZSS A;  4C7N B;  3TF5 A;  5K5G B;  3I5C A;  3N4X A;  4I2L C;  1EZV G;  2FYU G;  2IDB A;  3P8C D;  5IUX A;  4WW0 A;  1EXJ A;  4BJN A;  2CLY B;  1OW8 A;  4LF4 T;  4U7I A;  1HGV A;  2E9X A;  1LTB C;  2YIU C;  3A5T A;  1SFC A;  1VQP P;  3H1H E;  2BCC G;  3EVY A;  4I50 E;  5HEJ A;  2V5C A;  3VRA A;  1Y8A A;  3A0B E;  3NFQ A;  5AVX B;  2OYH C;  1M90 Q;  1Z56 A; 
#chains in the Genus database with same CATH homology
 3P8M C;  3HD7 B;  2CA5 A;  2WSF H;  4PJM A;  3GHG C;  1S9K D;  2MYS A;  3PUQ A;  1DH3 A;  2GM4 A;  3RRC A;  1WLX A;  2XKM A;  3CQG B;  1VOM A;  5LHG B;  5IHY A;  1FMV A;  5AVR B;  4C90 A;  4UF0 B;  1XTG B;  1JY2 P;  1X8Y A;  3DP7 A;  1A02 F;  4I55 E;  5DQV A;  3NTN A;  2H43 A;  2JQQ A;  1MMA A;  2DHR A;  3AA6 B;  4W7Y A;  5EZY E;  5AFU L;  5JRC B;  5AVU B;  2ZXE B;  3V2R A;  1GL2 B;  1RF1 B;  5L2L A;  2VKH A;  1T2K D;  2LJL A;  5J1G A;  4XAX B;  4DO0 A;  2LT3 A;  4OYJ A;  4EIJ A;  3CX7 B;  1MFZ A;  3OYX A;  3V5U A;  4IE5 A;  5APS A;  1LTS C;  1JUN A;  3AVR A;  1M1J C;  4U74 A;  2X9H A;  3O9X A;  3T97 A;  2W62 A;  5JDL A;  5FP3 A;  3HKC E;  2NP9 A;  1LT9 B;  4CZZ B;  5LYJ E;  2A45 I;  1KIL D;  5JR9 C;  5JDG A;  4BJM A;  2YNY A;  1KFN A;  4YJ2 E;  2XV5 A;  3U1A A;  3TK1 A;  3VN0 A;  2KLV A;  3NBX X;  2GUV A;  4N78 D;  1URQ A;  4ZKU A;  4KMC A;  4IGU A;  5CCG C;  3J9X 1;  4KUM B;  4PJL A;  4UV8 B;  3M0A A;  4TX5 A;  1YTZ I;  4G2A A;  4IDZ A;  2WMN A;  2FYU K;  2EHO B;  5EK2 A;  2FKW B;  1GK6 A;  1T8Z A;  2WM9 A;  4C46 A;  2N1T C;  5KJ7 C;  1S9K E;  1GTW A;  1SVF A;  5M4Y A;  1X79 A;  2XAH B;  4K0U A;  3NRX A;  1WR6 A;  4JEH B;  1G2C A;  2XZR A;  2PAJ A;  5ETW A;  4KP3 C;  4QHO A;  2P2U A;  3B57 A;  1IFM A;  1LWU B;  2E43 A;  3WMM 0;  4PK6 A;  5LGU B;  1HVV A;  2IC9 A;  4IE4 A;  1JTH A;  3N5L A;  4U72 A;  2Y8D A;  3PUS A;  3N9O A;  4CQI A;  3RL0 D;  4ZI2 C;  5JDN A;  3HD7 A;  3ZLI A;  2Z4E A;  1SHZ C;  3MTU E;  3RRW A;  1S35 A;  4LC1 A;  3L09 A;  2ACX A;  1NWQ A;  5FXW A;  2KYV A;  5HAX A;  1LTG C;  4H9P C;  4WB4 A;  3H32 B;  1N7S B;  4I4T E;  1YW0 A;  4DOJ A;  1WYB A;  5AVZ B;  5HYA A;  1L4A A;  2DCF A;  4WNK A;  3I9W A;  3KV4 A;  3VMZ A;  3ZMV B;  3T8O A;  2W6B A;  3HUS B;  2XAS B;  2IFM A;  1IZN B;  3CX6 B;  4N78 E;  1MIW A;  5A1L A;  3MKD A;  3N9N A;  1G1I A;  2KWI B;  2OYI B;  2Q3I A;  2L9Q A;  2LHR A;  1D0Y A;  1D1A A;  1D0Z A;  3C64 A;  3PTR B;  3N7N A;  1FZC B;  3CML A;  4QX7 B;  3HE5 A;  4H63 V;  3KPE A;  4CI2 B;  5LCY A;  4AI6 A;  5HWY A;  2LE8 A;  4X20 E;  3L3P A;  3KVB A;  1GW3 A;  1MNE A;  2YKO A;  4UVC B;  1FOS F;  1ZN5 A;  3RK2 B;  5FMN A;  3CLQ A;  1QUU A;  3GWH A;  4QXH B;  2EHO A;  3ZMS B;  1MMD A;  3IF8 B;  4WBN E;  4Y99 C;  2C5J A;  4MLK A;  3U59 A;  5IYZ E;  4WY4 B;  3AAE B;  2L8K A;  5AW6 B;  3ZN0 B;  3MA9 A;  2YK0 A;  2WSC H;  3LW5 H;  1IFN A;  3KYQ A;  5BU8 B;  3ZCJ A;  3OAK A;  5HXE A;  5JH7 E;  2HG5 D;  1LWU A;  3KV5 A;  5LP6 E;  1JMM A;  1HF8 A;  1HTJ F;  1ZEE A;  3SRZ A;  2WWU A;  3ZC0 A;  3LBX B;  3HD7 D;  2GK9 A;  2DI4 A;  1FZE A;  1NKZ B;  4IFD K;  2JEE A;  4YFS A;  2YKP A;  2JJ9 A;  3LG7 A;  2YIN A;  4AXP A;  2VL8 A;  1FJP A;  2NPS A;  4AYC A;  4MFR A;  5CCG D;  5L3G B;  2LKM A;  4GK5 E;  1L0N K;  2Z5I A;  3OJA B;  3CKD A;  1NU1 K;  3LJC A;  4KHX A;  4ZKP A;  5KLV K;  1GL2 D;  4EXT A;  3UUM A;  3ZEF B;  3TSI A;  2A3D A;  4IE0 A;  3PU8 A;  4XZC A;  5L3C B;  4UV9 B;  1AFO A;  1KNZ A;  4EZ4 A;  2RA1 A;  3CI9 A;  3HUS A;  3RX6 A;  2WPQ A;  5LGN B;  2OYI A;  2O1K A;  4HN9 A;  3BAT A;  5AVV B;  3ANW B;  1G8X A;  2QA7 A;  1SQQ K;  4ZI2 D;  4W80 A;  2KLQ A;  4C7R A;  2N2N A;  1FZC A;  3N2K E;  5LG4 A;  3KQG A;  3K3O A;  1LTJ C;  1CUN A;  1JY3 N;  4JYB A;  1LTI C;  2CXL A;  4HE8 A;  3U3I A;  2X68 A;  4UEM A;  4G63 A;  2EHO D;  3F57 A;  3C98 B;  4YJ3 E;  3B5N C;  3BAS A;  2KZ7 B;  1H8A A;  4EB6 E;  2ZM0 A;  5F3J A;  2B1E A;  1VRB A;  3LK3 B;  1JY2 O;  3BQL A;  1IK9 A;  5FYM A;  2OYH B;  2FYZ A;  2E9X C;  1MIV A;  2LEH A;  1SFC C;  5LGT B;  4QXC B;  1IFI A;  3BRT B;  3RC3 A;  3GHG B;  1VDF A;  5AVS B;  1GU4 A;  1KIL A;  3PUG A;  5DQW A;  5L3B B;  2IX7 C;  1SQX K;  5APQ A;  1GDT A;  2NW8 A;  1HS7 A;  5AW8 B;  4AQG A;  3V4Q A;  5AW4 B;  2MBG A;  4NUV A;  5JDM A;  3LBX A;  1J1E C;  2BVM A;  4QWN B;  4OH8 B;  2WT7 A;  3O1J A;  3FXD B;  4CI1 B;  2HOD A;  2P1J A;  1N7S D;  3A3Y B;  4TUY E;  1HX8 A;  3VP8 A;  1CI6 B;  3Q5X A;  2NW7 A;  2ZMA A;  1HH0 A;  3G3Z A;  3I9Y A;  1M1J B;  3SOL A;  3W15 B;  2VK9 A;  1GW4 A;  2ES0 A;  2P7J A;  1Z0P A;  2W63 A;  4IFF A;  3U1C A;  1RE4 C;  4QX8 B;  2ODU A;  3RK3 C;  3NRY A;  2WWW A;  2K9A A;  5JR9 B;  4AKI A;  3WAK A;  3R84 B;  3AVS A;  2IFN A;  1NKN A;  3PUR A;  2O1J A;  4DVD A;  4XE5 B;  2WMO A;  5AW3 B;  4O8S A;  2X67 A;  5FXV A;  2V26 A;  3CQC B;  5FY7 A;  2Q7C A;  1JCD A;  4B86 A;  3HR0 A;  4JF7 A;  2NOX A;  5J2U E;  3V2P A;  3RYH E;  3MGN A;  1CZQ A;  5BMV E;  5TAO A;  3HE4 A;  1URQ C;  4W7Z A;  2J1D G;  2MOZ A;  2WPS A;  4TN7 B;  4ILU A;  2XHE B;  4C91 A;  4CI3 B;  2N1T B;  2XQY A;  4JLE A;  5L3F B;  1XTC C;  3M9B A;  5H6R B;  4AQF C;  3O1H A;  3RK2 D;  3UUL A;  1OWA A;  3PUA A;  2L5G B;  2QGS A;  2YO3 A;  4X1I E;  3Q5W A;  2D0T A;  2FXM A;  2JMK A;  4GOU A;  2W00 A;  4WY4 D;  3RPU A;  2ZM8 A;  2OAR A;  3TNU A;  3V5B A;  4N3Y B;  3NZP A;  3KV6 A;  3FXE B;  4YHJ A;  3L4F A;  2VRS A;  2Y6X A;  1IO4 A;  1RF0 C;  3M9H A;  2CEA A;  4HH2 A;  3E1I A;  1GD2 E;  3TYY A;  3P8C E;  3ZMU B;  4IIJ E;  4OHF A;  3UUN A;  2NWB A;  1J2J B;  4DND A;  1H7C A;  2LSG A;  1SQB K;  1UX4 A;  2YKQ A;  1Y64 B;  5HXC A;  4EZH A;  2H7H A;  2JRK A;  1UX5 A;  4MAL A;  2XAG B;  1L4A C;  2NTX A;  3JC6 C;  4C7N A;  4BAY B;  3IEE A;  2Q9Q C;  3UIA A;  4KBM B;  5ADX L;  1UCU A;  1FMW A;  2P9B A;  3V2N A;  3GN5 B;  5HXH A;  1US7 B;  2NTY A;  2X9Y A;  4H9O C;  1AJ3 A;  1HTL C;  3MD0 A;  1ZHC A;  2QM8 A;  3FHN A;  3N9L A;  1OXZ A;  1N73 C;  4L5G A;  4PK4 A;  3L37 A;  1JY3 P;  4PJN A;  3RC8 A;  1FEW A;  4H9R C;  5CCH D;  3DJB A;  1RE3 A;  5FY0 A;  3E22 E;  3C4Z A;  2C0X A;  4UF0 A;  5CCG A;  4PNI A;  1E1H B;  3VKH A;  3B13 A;  5AW0 B;  5JRC A;  1T3U A;  4WBO A;  1GL2 A;  4Y99 B;  1RF1 A;  4FI5 A;  2K5B B;  2KB7 P;  2IC6 A;  3SWY A;  2I1K A;  1QL2 A;  3H3A A;  3S4U A;  4EOT A;  2GUS A;  3M0D C;  5LXT E;  1NTM K;  2KXP B;  5JDF A;  1ZR2 A;  2HPC B;  1HUC A;  4AQR D;  3A2A A;  2SPC A;  1NTZ K;  4WBA A;  4ANJ A;  4HKA A;  2C9N Y;  5LA6 E;  4XA4 A;  3KBT A;  2CPS A;  3MIW A;  1DX7 A;  1LT9 A;  3EQ2 A;  3C51 A;  2DWG A;  1LVF A;  2MJZ A;  3ZC1 A;  3M91 A;  2DLR A;  2MTQ A;  5KX5 E;  3H37 A;  2CPB A;  4EIW A;  2XAJ B;  5CHX A;  3WAJ A;  1CSB A;  3E08 A;  2CM0 A;  3C50 A;  3MK7 C;  1Z56 A;  2BZB A;  3ETV A;  2NPS C;  3U78 A;  4EOZ B;  3IHR A;  4GT1 A;  3PE0 A;  2KMF A;  1HBW A;  1SA0 E;  2JMH A;  2H3R A;  1JY2 N;  4H9S E;  5CA1 E;  3ETU A;  4IHJ E;  4UXN B;  2V7M A;  4X1K E;  3VU7 H;  1FAV A;  4CXY A;  3HKB E;  1HJB A;  3PDY A;  4ADZ A;  1T3J A;  1W2E A;  2HPJ A;  1FZF A;  2FFD C;  2N9D A;  3DTO A;  3V2Q A;  5KDM C;  3MUD A;  1B7T A;  2I59 A;  2L3L A;  4BA9 A;  4I1L A;  4PW8 A;  4HFV A;  2W6A A;  2HFE D;  1LTJ B;  5AW9 B;  4MBQ A;  3CQX C;  1N2D C;  2KSJ A;  1AQ5 A;  1MV8 A;  3H32 A;  3EUH A;  1N7S A;  1M7L A;  3GA8 A;  1BR2 A;  3VP9 A;  3AA1 B;  1G1J A;  3R2P A;  3B5N B;  5JDQ A;  3Q9D A;  3VMX A;  5DJQ C;  1T2K C;  2A2F X;  4HYT B;  2N1T D;  5KJ7 D;  1ZV8 A;  1L0L K;  3F31 A;  5LHI B;  1D1C A;  2C5I T;  5FXX A;  3RYI E;  2QM7 A;  1ZLL A;  2E9X B;  1V9D A;  5JQG E;  1SFC B;  2KOG A;  2PP6 A;  2HH7 A;  4ZI3 C;  1HFA A;  3CPZ A;  3MXZ A;  1O3X A;  2YU2 A;  5AVW B;  2ZLY A;  4J2C A;  3F2E A;  4O4H E;  4UVA B;  5AW5 B;  2PBI A;  2M8R A;  1KIL C;  1PFI A;  1J1E B;  4TV9 E;  1ZR4 A;  3BQI A;  1H89 A;  4O4I E;  1HCI A;  5LJN A;  1IAP A;  4OK0 A;  4O2B E;  3VMY A;  3UFE A;  2Z5H A;  5CB4 E;  2BVL A;  1FDM A;  1ZV4 X;  2XAQ B;  3QC9 A;  3K3Q C;  3P32 A;  3VTP C;  3LK4 2;  4HEA A;  3CX8 B;  1DEB A;  2XUE A;  5LBQ B;  3AA0 B;  2R3C A;  2JPF A;  4WY4 A;  1SLQ A;  3RK3 B;  5CJ0 A;  5LJM A;  4MHC A;  1NH4 A;  2P67 A;  3KDP B;  4A56 A;  3L36 A;  1JCC A;  3IR9 A;  4HGA A;  3KIN B;  1FZA A;  3D0T A;  3AAI A;  2V7K A;  5BU5 A;  2POH A;  4QKN A;  3RL0 C;  1HWT C;  4IE6 A;  1J1D C;  4ASK A;  2X51 A;  3RH3 A;  1URQ B;  2VWA A;  1LTJ A;  1NWM X;  3FBZ A;  1A02 J;  2G0U A;  3EDV A;  5AVQ B;  3FBL A;  3RYC E;  3OJA A;  5APV A;  2C5K T;  3ZN1 B;  3CVR A;  5HXS A;  5APY A;  4ZI7 E;  2PFV A;  2BDE A;  3EDU A;  3BVH A;  1GZL A;  1BR1 A;  3IBP A;  3C4W A;  1X79 B;  1MMN A;  3C4X A;  5L3D B;  4H9Q C;  1G2C B;  3M65 A;  2A45 G;  2H7O A;  3N2G E;  1EQ7 A;  1HG2 A;  4JEU B;  3VOP A;  1MND A;  2CE7 A;  5HWX A;  2Z6E A;  3A7O A;  4TV8 E;  2VKD A;  1JTH B;  2E8I A;  3MZK B;  1KZU B;  3MJX A;  1IJD B;  1U4Q A;  1MMG A;  3HTK B;  3AB3 B;  1NAF A;  5JDH A;  5CCH A;  3PU3 A;  3ANW A;  5JVD E;  5APW A;  2IW5 B;  3H6P A;  4FJO A;  2CXD A;  4L0R A;  4E7Z A;  2IPP A;  5APU A;  2WBL A;  3MAC A;  1IJ5 A;  1D0X A;  1WRD A;  3NMD A;  4GIW A;  2W61 A;  1ZKE A;  1NO4 A;  3ESL A;  5C8Y E;  3ZCI A;  4B6X A;  5FNV E;  2ZFC A;  1L4A B;  4O4J E;  2X0L B;  2Q9Q B;  1JY3 O;  2A72 A;  3O4X E;  4O2A E;  4JYC A;  3HL6 A;  2LOP A;  4HTE A;  2N1G A;  2ODV A;  1FIO A;  4DBQ A;  1X9V A;  1GU5 A;  3TKL B;  5FY1 A;  2ZM2 A;  2CLY C;  2HYN A;  2OA5 A;  3I0O A;  5AVT B;  2OYH A;  1RE4 A;  1FOS E;  1RY3 A;  3ZYL A;  4GKG A;  1N73 B;  2KIN B;  4ZI3 D;  3GHG A;  3OYZ A;  3HRN A;  3I1A A;  5EK4 A;  3LFM A;  2WAU A;  3KVA A;  2X66 A;  2DNX A;  3HD7 C;  1MZ9 A;  5AVY B;  3HE5 B;  1SP4 A;  2WPR A;  3GMI A;  3L35 A;  1RE3 C;  2KT9 A;  4O9B A;  3FB2 A;  4F6R C;  4OYK A;  3A5X A;  2I1J A;  4I6M C;  4ZS2 A;  3EFG A;  1FU1 A;  4AKR B;  4DMV A;  4AKH A;  2LHN A;  4AQF A;  1CI6 A;  2NW9 A;  4GIF A;  5BVZ A;  3B5N D;  2HLO A;  1GL2 C;  1RF1 C;  2WZ7 A;  3BK9 A;  1M1J A;  3I0Q A;  2R5B A;  1HG5 A;  1IC2 A;  3II6 A;  2E9X D;  4PFP A;  1N7L A;  1SFC D;  1LTT C;  1LTA C;  4YLH A;  1NTK K;  4DBR A;  4PAG A;  4PK5 A;  5JR9 A;  3ZPO A;  1RF0 A;  5CA0 E;  1IFJ A;  4ZS3 A;  4ZHQ E;  1LT9 C;  1E5W A;  3HTK A;  3HI2 A;  4JUY A;  5KTB A;  2D5U A;  2M67 A;  3ZMT B;  3RYF E;  5GON E;  1KQL A;  2DWK A;  2NPS B;  3LIE A;  4M1P A;  2CXF A;  5APT A;  4GK0 E;  3C9I A;  3HA4 A;  4LLH A;  2N1T A;  5KJ7 A;  3N9P A;  1KFM A;  4EYU A;  3OKQ A;  4P0A A;  3ZMZ B;  2Q9Q A;  2EHO C;  1GK4 A;  4N6J A;  4L9I A;  1BR0 A;  4GYR A;  5AW2 B;  3K8P C;  3CL3 D;  2D2S A;  3NXS A;  3VKG A;  2FFD B;  4CXX A;  2Q5U A;  5H6Q B;  3RK3 D;  3RKO A;  3LID A;  2W0G A;  1YKE B;  4IE7 A;  4TZ4 C;  1QSD A;  1LWU C;  4M3L A;  3E0Z A;  1N73 A;  3CWZ B;  4V1A v;  1MIY A;  2XU6 A;  4IFM A;  4OFZ A;  5AW7 B;  2LSI A;  3QK6 A;  1MUU A;  1QL1 A;  4NUU A;  5APX A;  1URQ D;  3HKD E;  2LSJ A;  4PJJ A;  4UIG A;  5CMZ A;  4GYS A;  1N7S C;  2D0U A;  2VKO A;  1LKX A;  3O1I A;  4RES B;  1LVK A;  5J2T E;  1HGZ A;  2H8P D;  5LOV E;  2YEV C;  1G73 A;  3Q2M A;  3M0D A;  4XBF B;  3BRV B;  2CMR A;  2XTL A;  2PG8 A;  1JO5 A;  4O4L E;  3ONX A;  2WTY A;  1WT6 A;  3HUS C;  3GN5 A;  3HKE E;  2O01 H;  1D1B A;  3J7Y q;  2X9X A;  2C9L Y;  1KIL B;  2BAS A;  2OYI C;  1FJK A;  2X9W A;  1LGH B;  3OA7 A;  3V4W A;  2LOS A;  1NHL A;  2C0W A;  3WI3 A;  3K3N A;  2JJL A;  1JOC A;  3KFW X;  1S94 A;  4H9N C;  3VHL A;  2YU1 A;  3VYI A;  2UXX B;  1BR4 A;  4ERR A;  1FZC C;  3N9Q A;  4LGD E;  4PFO A;  2WT7 B;  5LNK A;  3KBU A;  2CWO A;  2HOD B;  4E7S A;  3SWH A;  2HPL A;  2YO2 A;  1L4A D;  3LK2 B;  3N2O A;  3JC6 D;  4UVB B;  1YD8 G;  5EK3 A;  3BQK A;  2Q9Q D;  2VKJ A;  1T98 A;  3RK2 C;  2PJQ A;  1FBM A;  4AKG A;  2KP8 A;  1LRZ A;  3P7I A;  5E0O A;  1FZB A;  2K48 A;  2IAK A;  1YTZ T;  2HPC A;  3SS1 A;  4WY4 C;  2KND A;  5HXR A;  3R6N A;  1N86 A;  1YYC A;  1IJ6 A;  2XAF B;  1KK7 A;  1FZG A;  3KDS E;  3UUX B;  2FFD A;  1VPC A;  3RL0 B;  2H7V C;  2CCQ A;  3N9M A;  2R5D A;  3AAA B;  1J1D B;  2WSS V;  2LM9 A;  5LBM A;  4EAH A;  4I43 B;  3B8E B;  5CJ4 A;  3KV9 A;  5DAB A;  5LHH B;  3ZYK A;  3P7K A;  4ZOL E;  2Y48 B;  5L3E B;  1NOH A;  1SQP K;  2KWH A;  4X1Y E;  3HE4 B;  2C0S A;  2J58 A;  3OBV E;  3O8Z A;  2V7L A;  4H63 H;  4IST A;  3V5S A;  3ZJ2 A;  2A45 H;  4P09 A;  5F8P A;  3M06 A;  2XDJ A;  2XNX A;  4AKL A;  4P0B A;  2V1D B;  5KMG P;  3PP5 A;  3AA7 B;  5AW1 B;  3NZQ A;  3ZYM A;  3TNU B;  2YMY A;  2WIT A;  2V7J A;  5JRE A;  2LSK A;  4EYY R;  2CWY A;  2N9B A;  2M3B A;  3ZJ1 A;  1EZ3 A;  1CW5 A;  2E42 A;  4Z8X A;  2R32 A;  1IFD A;  4CXW A;  4ISS A;  2UXN B;  3IFM A;  4DZO A;  1JNM A;  1WRG A;  3QUJ A;  5FXZ A;  5CCH C;  2W27 A;  4DMW A;  2K24 A;  2WSE H;  2VB6 A;  2V7I A;  3M9Q A;  1SQV K;  3SWF A;  1H88 A;  4UEL A;  2NPS D;  1U5P A;  2LSY A;  2Q9I A;  4AUW A;  4QXB B;  2J59 M;  1WYC A;  3B5N A;  2RP4 A;  2VAS A;  3UT5 E;  1YKH B;  4C7N B;  3I5C A;  3N4X A;  4I2L C;  3P8C D;  4WW0 A;  4BJN A;  2CLY B;  1HGV A;  2E9X A;  1LTB C;  3A5T A;  1SFC A;  3EVY A;  4I50 E;  3NFQ A;  5AVX B;  2OYH C;  3UTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...