3P8CD

Structure and control of the actin regulatory wave complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
244
structure length
204
Chain Sequence
GIKNELECVTNISLANIIRQLSSLSKYAEDIFGELFNEAHSFSFRVNSLQERVDRLSVSVTQLDPKEEELSLQDITMRKAFRSSTIQDQQLFDRKTLPIPLQETYDVCEQPPPLNILTPYRDDGKEGLKFYTNPSYFFDLWKEKMLQDTEDKRKEKRKQKQKNLDARSVLLEAIRKGIQLRKVEEQRENDVATILSRRIAVEYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Cytoplasmic FMR1-interacting protein 1
publication title Structure and control of the actin regulatory WAVE complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 204
sequence length 244
ec nomenclature
pdb deposition date 2010-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02205 WH2 WH2 motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3p8cD01
1.20.58.1570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3p8cD02
4I1LA 3BASA 1X79B 4O9BA 2POHA 1WT6A 3U59A 3U1AA 3HRNA 3U1CA 1IC2A 1NKNA 3VP9A 5BU8B 5BVZA 5KTBA 3VP8A 5BU5A 2JEEA 3C9IA 3N4XA 2FXMA 3N7NA 3BATA 4N3YB 4GIFA 4ZKPA 4ZKUA 3P8CD 4N78D 3OJAB
chains in the Genus database with same CATH superfamily
2KS1A 5KLVE 1N32T 1AQTA 1LT9C 1M1JA 4EYYR 5KJ7D 1AJ3A 2N9BA 2N1TB 5B66E 3CVRA 1KFYA 2D0UA 3RYIE 3MK7C 4YSYA 4JYCA 1D0YA 4IHJE 3GHGB 3M9BA 3RIAA 4YXWH 3V2RA 2C0XA 2QJPC 2A45I 2N1TA 4PD4H 2K3RA 1XWMA 4DV7T 2YKSA 2KI7B 1ZMEC 3OYZA 1FJKA 4DJGA 4ZKUA 1EZ3A 1GK4A 4ZS3A 3I55P 3EI0A 3GHGA 3H1HD 3N2KE 2ZYAA 2Y6XA 2XQ9A 3CXHI 3KDPB 2WWUA 1JM0A 5JDFA 3ZT7A 2HN2A 3FWNA 3Q5PA 2W00A 5AQRB 2Q3EA 1GW4A 1P84I 3V4QA 4D6TJ 1AVOA 1KK7A 2K9YA 4ZEYA 1OW8A 1GQEA 1K04A 2XKMA 3CD6P 1HF9A 2V6YB 1EZVI 2G0UA 1ZXGA 2JP3A 2W83C 4HFCA 4JEUB 4K3AA 4U31A 1W5CE 1VF5C 2B9BA 2NZ2A 1LTJC 2G3AA 3P4WA 3T8OA 1VDFA 2CLYC 3AE5C 2V6YA 3ZCJA 4AKRB 2H88C 5AVTB 1NTZJ 3E1IA 3WI3A 2XASB 3ZMUB 3KV6A 4ZI2C 4DR3T 2K1AA 3KDSE 3CX8B 2X0LB 2NTXA 3PE0A 2E2AA 1NWQA 2AXTH 3H1JG 1M1JC 4RJTA 2LSGA 2OV9A 5J1GA 2MBGA 1KTMA 2Y9YA 1RH5B 5CA0E 3ZKRA 2CWYA 1HH0A 1PP9E 1MMAA 1NTME 4LC1A 2OTLP 5TAOA 2LT3A 3AEGC 5FYMA 1JMMA 1L0NG 3E22E 3FXDB 2N1TC 1VOMA 2FYUJ 1ZV4X 2YDRA 3UU8A 3RX6A 3B4SA 4NPFX 4H9PC 5J2UE 1I6ZA 1SFCB 4H13B 2CXDA 4X65T 3ZMZB 1SQPE 3GHGC 4OYKA 2W27A 3C1LA 3QK6A 4M1PA 2PGDA 3UUBA 2WSEJ 3I5CA 1Q86Q 4U3FG 3UULA 2XAFB 4C7NB 1HUCA 2WPSA 1E79H 1SFCA 5B5EH 2YKQA 2E42A 1IJ6A 2WVRA 4GOUA 4PFOA 3RK2B 5JDHA 4DR5T 3AE9A 4N3YB 2HG5D 4L76A 3H1KE 1VQMP 1Q2NA 4C7NA 4HGAA 1HJ0A 4EYUA 4XFJA 2QSIA 5KAIH 2MOZA 1M57D 1T98A 1BGYJ 1G1IA 5HWXA 3FZHB 3J9X1 3ZC1A 2FYUK 1L0LJ 4HWDA 2O01N 4NPPA 3H1LE 4JI8T 2WY2A 4LF7T 3TLUA 1D1AA 2A72A 3QUJA 4KHXA 5E79E 1MFZA 4C46A 4AI6A 5AW5B 3GMAA 1CSBA 4EZHA 3N7NA 4E7SA 1LTTC 2XZEA 3BCCJ 1QVFO 5CCGA 1E2AA 4CPGA 2BBJA 3EUHA 3SFDA 1L0NJ 2A2FX 4B86A 2FXOA 2MJZA 1AQ5A 2LRLA 2V7KA 3PTRB 2J62A 2XUEA 4UB6H 5C39A 1M62A 2LOPA 2V7QJ 3IR9A 2XPKA 5LA6E 3QC9A 3RYFE 3F57A 4OHFA 4DR1T 3TLTA 2P67A 4U3CA 3RRWA 2VK9A 4IE0A 1PP9D 3AEDA 3EFGA 3GG2A 3ZN1B 2ZXEB 2POHA 5DQWA 2Q1KA 2LXCB 3CWBG 1GL2D 1NEKA 2WZHA 5JRCB 5EK4A 3N9QA 4BWNA 1SFCC 4H13C 4KJMA 2LXBA 1SQBK 2IYOA 4P0AA 1SQPD 1NU1G 3AE9C 5L3BB 2FJEA 4MHCA 4HWFA 1MMGA 1EC5A 1FZBA 1JY3N 3TK1A 2D0TA 3K8PC 2W6JH 4HWHA 3L70G 1FU1A 3RK2C 1NWMX 2K9JB 2L5GB 3NBXX 4C7RA 1VCTA 2CEAA 3CX7B 4DV2T 5J2TE 5AW8B 5AQQB 4CI2B 4JI0T 3H1KD 2Q9QD 1ZW0A 2KOGA 1KNPA 1A02F 2WSFH 5AVSB 4MLKA 2LOSA 5JTGA 1BR1A 2LKGA 3BQKA 2K9JA 1N7SB 1PPJG 1KORA 5CCGC 3ZJ2A 5APXA 1Y8AA 3SFDC 2RPAA 4WNKA 4DV3T 5HEUA 1JB0J 3H1LD 4LGDE 4U7YA 4ZMDA 5AVXB 4CI3B 4YFSA 5APWA 5CBNA 1IK7A 4WYVA 2J1DG 1N7SA 2IFNA 3P8CE 1KV4A 2WPVB 1FOSF 2LM9A 3B5ND 3IHRA 3VMAA 3CL3D 3PH0A 4L9IA 5EK2A 2E5TA 1N86A 3KHUA 3PU3A 5TISH 2ZT9D 4DZOA 3EFFK 2E9XD 4LFCT 4EEDA 2D2SA 3AEDC 2K3WA 1H0TB 2B76A 1QLBA 4YTPA 1NU1J 4I43B 2PG8A 4U33A 1FZAA 3L72D 1JY3O 4N78E 2RH0A 2ZJSE 4WZXA 4TLFA 3L70J 5ETWA 1H0TA 1SA0E 1URQB 4OGQB 5F5WA 1WCRA 4CN6A 4OYJA 4TN7B 3F31A 4DR4T 1U5PA 1RY3A 4DCKA 5HEJA 2WP9A 2PRRA 3L75G 4B3ST 4L73A 2E76D 3KZIE 1URQA 2QE7H 2CXLA 4U74A 1Y47A 3LW5H 2L91A 4V1Av 3Q3DA 1LTIC 2FKWB 3CX6B 3BVHA 4LF8T 1SQXK 1DIPA 1M7KA 1USEA 5M1BA 1D7MA 3CWBE 4IGUA 3TKLB 3B13A 2FBWA 4WBNE 1SQVG 1FBMA 1ZRTE 1OX3A 1S35A 3PUSA 5HXEA 2C9NY 2BDEA 1N7SC 2QJKB 3BRTB 1WFDA 3R4YA 2J47A 3MJXA 3H1IG 3ANWB 3AAIA 1LTBC 1ZHCA 3Q5EA 1N73B 3ZMVB 5LNKA 3P8CD 1Z0PA 2A45H 3KINB 4UF0B 1S5LE 2AXDS 4YTPC 1EDKA 2J58A 4L0RA 3ANWA 1KFMA 2CXFA 3MACA 1N73A 1FOSE 1U7MA 2WU2A 4Z91A 2XHEB 3L75J 3FBZA 3L37A 3CXHH 2WMOA 4UF0A 3IBPA 1Y9BA 5APSA 4DR6T 1IJ5A 1L4AB 3M9QA 2ZXXA 1U7JA 3SFEA 2B87B 4Z8XA 2BKNA 1GW3A 3RL0B 2PJQA 3GWHA 1P84H 2X0HA 3H1HG 4N78D 3PUZF 2I8DA 5AVYB 1URQC 3EQ2A 4EIJA 2WSSH 4OGQC 1L4AA 5CJ4A 1YQ3A 2N1GA 1IC2A 5LP6E 2PAJA 2XJ7A 2B87A 3ZC0A 3G3ZA 4HFVA 1DD4A 2E75B 2V26A 2AXTE 3QWOC 1G2CB 1N2DC 2YO2A 3N5LA 4K35A 1UX5A 3OPCA 4RKUJ 3UUNA 5AQSB 2KB7P 2FBWC 4GIFA 5HYAA 3UUMA 3RQWA 1YBKA 4P1NA 4IL6X 5LBQB 4YPCA 5LCYA 1XNQT 3MIWA 2IAKA 3ZYMA 3RRCA 3NRXA 2ODUA 3Q9DA 1M90Q 2UXNB 4DOJA 3M9HA 4GDOA 4PW8A 2Z6EA 4DIDB 1T2KD 5ABGA 4HWIB 3PUQA 2MYSA 4DR2T 3G9RA 1YJNP 3S1KA 1S2EA 5AVQB 5IUXA 2QJKC 1ZRTD 5L8RJ 2YDQA 4PD4D 2K9AA 4IE4A 2IBZE 1NAFA 5B5EE 1M8OB 3IEEA 2M8RA 1BCCJ 4O2AE 2BCCJ 2JQKA 5F8PA 2H43A 1JOCA 3O8ZA 5AW6B 3N9LA 2Y0DA 1HVVA 1N73C 4O4JE 3H1HJ 3CCSP 5AQHB 3CMEP 5C8YE 3B71A 4F8HA 3CK6A 5KAIE 2BASA 4UELA 3VOPA 5BU5A 2XZRA 2Z4EA 4QH1A 3N9OA 4UVCB 4WB4A 1BDCA 4OX9T 3SFEC 3L74E 3VYIA 3AEAA 3L3PA 1SQXD 1T3JA 1GTWA 2FJBA 3L09A 3UIAA 1PFIA 3RIUA 1NTKE 2NW9A 4WY4A 4X66T 1L4AC 2XNXA 3ZYLA 1YQ3C 3OKQA 1FAVA 3H1IE 3RL0C 1IFMA 1I94T 5ABFB 4IL4A 5GTIH 2Y8DA 3AA7B 4NUVA 2XM2A 3JC6D 3PJSK 4DMVA 1KEYA 2V7LA 4UB6E 1OEDB 2RKLA 3LBXB 5ABFA 1QGKB 1CI6B 2E75C 3LFMA 3NRYA 3CPWO 5JDLA 3CMLA 1FJPA 2WT7B 4PJMA 3QH9A 5KDMC 1OEDA 5AQOB 3O1JA 4LF6T 4COFA 2WPQA 2RA1A 5KXJA 3KVBA 4UEMA 1YTZI 2OARA 1M56D 1WRDA 5DJUB 4IREA 1J2JB 5CMZA 2WT7A 3HTKB 2NPSB 1LT1A 4LFAT 4X5TA 2XV5A 1FC2C 2YIUB 1S94A 5KLVJ 1YW0A 3UT5E 4GKJT 2FJAA 2CMRA 2IZ0A 3H3AA 4DR7T 5CJ5A 1BR4A 2BEQD 3K5BA 1WT6A 3HTKA 2OLTA 2V7QH 1RF0A 2NPSA 3SS1A 4X1IE 2PP6A 2KYVA 3F89A 1AJYA 4GIWA 1N36T 1HS7A 4HFIA 5KKZB 3V2NA 2H7OA 4OFZA 3AEFA 2KLQA 2KK7A 2IBZD 2A06E 3L36A 3HKBE 2GM4A 2GK9A 4AUWA 1PP9G 3AEAC 5AW9B 1OWAA 3AEBA 4XE5B 2CK3H 1VF5D 2X9YA 1RE4A 1KYOI 5JDGA 5CB4E 3S9OA 1WLXA 4JI2T 4CI1B 1LKXA 3Q2YA 5LOVE 4DUYT 3V5BA 4AYCA 3RGLA 2ZVOB 4ZI2D 2X9HA 3ZJ1A 3L74D 3MXZA 4JI6T 1SQPG 3VKGA 2QG4A 3ZT5A 4DT0A 4MBQA 1NTKD 4G63A 1J5WA 3BQLA 1SQQJ 4HTEA 3MHVA 3TLSA 3H1ID 1GDTA 1PIXA 3AEEA 4LMLA 2KZIA 4AIUA 2KXPB 5TISE 3WU2H 2M6IA 3RYCE 2KIKA 3JSVC 1HJBA 3PUWF 3FZFB 5FNVE 3H1KG 1KNRA 1OEDC 3II6A 2N1TD 2KZJA 2V7MA 3TLVA 4K0UA 1MZ9A 1YKHB 2IUBA 4H9RC 1L2PA 1HF8A 5C2TA 3AEGA 4O4IE 5JDQA 2ZVNB 4H44B 4CXYA 2M3EA 4QH4A 1LJ2A 2WMMA 5L3FB 5KAFH 3H1LG 3CCMP 5CFBA 3OJAB 4AKLA 2GA1A 3L71D 3Q5DA 3VR9A 2ES0A 1RF0C 2NPSC 1EDIA 2K24A 4HE8A 3SWYA 1NTMJ 4XZCA 4CN4A 1SQQK 2YIUC 4KX6A 3AEFC 5BVZA 3OJAA 3AECA 1T8BA 2NWBA 3P50A 5A1LA 2YDSA 1SVFA 2J59M 3AEBC 2JKVA 5LG4A 5KKZC 3N2GE 1T72A 1RE4C 3ITKA 2GUSA 1VPCA 1YTZT 3L72G 4U7IA 3I56P 1VQ4P 3U1AA 1FDOA 1IJDB 2XM1A 2A06D 2YN6A 3WAKA 5CGMA 3VN0A 4QKNA 1GMJA 3OBVE 1D1CA 3TLWA 2BVLA 2LE8A 1HNXT 4H9OC 2ZM0A 3NKZA 4C90A 5H2FH 2W90A 3RF1A 3CQGB 3I9YA 4WW0A 3AEEC 1IAPA 1SE7A 2HN1A 2WDRA 3ZEFB 5E0OA 1R5SA 1FMVA 1FEWA 1USDA 2XNDH 3FHNA 2DL1A 1Q81Q 2ZM8A 3HL6A 3UTKA 5ADXL 4K0KT 1WMKA 1IFPA 2I1KA 5FXWA 2V4HA 4I55E 1DEEG 3H32B 3HD7B 2FFDB 1PV3A 5FMNA 1BE3G 2M6BA 2KSRA 2KUBA 3KFWX 1SFCD 4H44C 4H13D 5CHXA 1NH4A 3C50A 4MALA 1VQPP 5L4HA 1NTZK 4WVZA 3FXDA 3H32A 2FFDA 3HD7A 1ZP0A 2IDBA 1RHZB 1CHUA 3G4SP 1DX7A 4PV1B 3AECC 3VMZA 4H0LB 3I0OA 3UU3A 3Q1MA 2CWOA 2CPTA 4ASWA 3N4XA 1SQBG 3G71P 2BKPA 3NXSA 1W0AA 3RK2D 4JUYA 5GTHH 1XDPA 3KXDA 2QEXP 3CLQA 4EOZB 3IN6A 1YJWP 2RMZA 2M0BA 4KT0J 2JMKA 2RN0A 2KINB 3MP7B 2KMFA 5BR8T 3OTOT 1L0VA 2VL0A 1SS1A 2YXRB 5CCGD 2W2UA 3H1JJ 4LLHA 4LF9T 3T1YT 2ACZA 4B3RT 2H89A 4Q25A 4CXWA 1J1JA 3D6ZA 3AE7A 1QL2A 5LGNB 4QXCB 4AISA 4Z90A 2ITAA 1NKNA 4UB8H 2BS3A 3UUXB 2W67A 1VQ6P 3M91A 4A5XA 4UVAB 2UWJE 3SOLA 2VVNA 2ZMAA 1KN7A 4H9NC 3L72E 1FS0E 2QJYB 4U3FJ 5H6QB 1YQ4C 1L0LK 1N8RQ 4PAGA 3CCLP 2FYUE 1HX8A 4XAXB 5AFUL 2LSKA 2KNCB 2HR3A 2VRSA 2K48A 1PGOA 4DNDA 1ZP0C 2FFDC 3HD7C 1HR0T 4EEBA 3H25A 2WWWA 3A5TA 2BG9B 2MAWA 3EWKA 1VQKP 3N9MA 5APUA 1L0NK 3PHLA 3FBLA 3CXHD 2YO3A 2KNCA 5AQIB 3MA9A 2E5YA 5AVVB 5JRCA 3VMXA 4IL6H 1KC8Q 2BG9A 2VVSA 4JI3T 4OH8B 4PV1C 5GTIE 4QMAA 4H0LC 1P84D 3IF8B 2ZYGA 4HJGH 3M0AA 2LM2A 4UXNB 3AAAB 4PK4A 1OW7A 5FL0A 1BGYE 4B6XA 3W15B 1EZVD 2D2CD 5AQJB 5DJQC 4UV8B 4QH5A 2I59A 1VQLP 2M67A 3EABA 2IDOB 1BE3E 1SQXG 4R4MA 2IC9A 4HKAA 5KX5E 2H89C 3BATA 4BJMA 1IFDA 1SP4A 1VQ5P 4YTNA 1BR0A 1JNMA 1N7SD 3AE7C 1D1BA 3AE6A 3QB5K 2UUAT 1S1CX 3CWZB 4IL9A 2YXQB 3BCCE 4W80A 2I6HA 2IFMA 1BDDA 2UUBT 5LB7B 3SWHA 2LKMA 3RK3B 1QUUA 1SQBE 1NTZD 1KB9I 4MFRA 3FGAD 4IDQA 3SRZA 2XQ6A 3P7IA 3DJBA 3CWBJ 2DCFA 4PFPA 4QX7B 4XBFB 2DLRA 3C9IA 1VQOP 1S5LX 4A56A 3UQ7A 3A8YC 3FB2A 1YI2P 3UU5A 3PUYF 3R2PA 2WSCH 1OVUA 3CCQP 1G73A 3G6EP 2X51A 4BJNA 2QJYC 2JJ9A 3CCUP 1A02J 2V5CA 1YJ9P 4WBAA 2DW3A 4NPDA 4Y28J 3A5XA 2FYUD 3GA8A 1KFNA 2W66A 2R6GF 2YOEA 2E9XB 5FXVA 2WU5A 2R3CA 1W2BO 1URQD 2WS3A 2EHOB 3HI2A 4UIGA 4PJLA 4JV5T 3AXJB 3NZQA 2BG9C 3A2AA 1H7CA 1IK9A 5AW0B 1BR2A 4NPEA 3LG7A 2F4VT 1EXIA 1JY2N 1KYOH 1BSHA 4BAYB 5HXCA 1HFAA 2EHOA 2WB5A 3P4QA 3AXJA 2HPJA 2XQ7A 2IBZG 2V6XA 1EDJA 3WU2E 1EDLA 4C91A 2YEVC 2E8IA 1NU1K 2GUVA 3FZMB 2R5DA 5LJMA 1KILB 2W8ZA 5FP3A 4EGWA 3CQXC 2YMYA 2CRBA 3AE6C 1BGYD 1ZKEA 1L0LD 3OA7A 4HWCA 2CE7A 1Z8UA 3PP5A 3U59A 1ZLLA 2V7JA 4U2ZA 3L74G 5KAFE 1KILA 4PD4E 1BE3D 4PK5A 3MTUE 2KWIB 4BRYB 1NTKG 3AVRA 3H3MA 4HYTB 1K8AQ 2DNXA 4I6MC 4GKKT 3AAEB 1H89A 4YXDA 3BCCD 4B3MT 1KQSO 2M3BA 3PLNA 3RK3C 2LLYA 3GN5B 3A0HH 4RESB 4BRYA 2LEHA 1SQBD 4JYAT 2N9YB 5L3DB 4X1YE 1LWUB 1MFTA 4MN4C 4FJOA 1S9KE 3HR0A 3VHLA 3RKGA 1SQXE 3KBUA 2PBIA 1UUSA 3RLFF 3GN5A 1MNDA 1LVKA 2VQET 1JY2O 1EQ7A 5LMNT 2FXPA 1LWUA 1JCDA 4LF4T 2JEEA 4I4TE 1Q82Q 2OYIB 4CN1A 1HGVA 4L75A 1VQ7P 2Z5IA 2WTYA 5CA1E 1JO5A 3CCJP 1L4AD 4Y99B 3L71G 3SSUA 5C3JA 2E74B 4AQRD 3BRVB 1HNWT 2QRXA 2B89A 4ZZBA 3CCEP 3RL0D 3WMM0 5CJ0A 2CA5A 2D5UA 5H2FE 2E9XC 2W63A 5CCHA 3E08A 2EHOC 3ZSSA 3MZWB 2ZM6T 5KLIB 5AW3B 1RQVA 1OEDE 2ACXA 2XQ8A 1SQVJ 2WPRA 2OA5A 3QB5A 3L74J 2NW7A 2V8SV 2R32A 2WBLA 3RH3A 5L3GB 2E75D 4ANJA 4DV1T 1HWTC 2UU9T 3LK2B 2FY8A 2LR2A 1HG5A 2QA7A 2A06G 3H1IJ 1YD8G 2NR4A 3V6IA 4B3TT 1KILC 4A7PA 2IHR1 4ADZA 2IIUA 1G2CA 3FZLB 5L2LA 4X64T 3Q2MA 3LIEA 3Q5SA 2X0YA 1LVFA 1VCSA 3JAEA 1IBLT 4JPZB 4YXDC 1IFIA 3FX0A 3CC7P 3RPUA 4IFFA 2XQ4A 5HXSA 3O6QB 1X9BA 1XMQT 1R8EA 2WZIA 4KBMB 4PK6A 2HH7A 1NENA 2A3DA 2W0GA 1SQVK 4DV0T 4AQGA 4ZOLE 4TWHA 3FWLA 1LRZA 5L3EB 3JCFA 3O6QA 5AW1B 2VL8A 1FMWA 1WR6A 2JJLA 4HN9A 1HGZA 2R5BA 3LDQB 3LK42 3MGNA 3RBXA 1LWUC 2CPBA 3MZKB 1UK5A 2LRKA 1S72P 3TSIA 4WY4D 3S4UA 1S9KD 2JQQA 4IFDK 4YJ3E 3K3QC 1NKZB 5FXZA 4ZHQE 5AQPB 2WSEH 1JY3P 1HNZT 1GK6A 1JTHB 4CQIA 2OYIC 4I50E 5CCHC 5L47A 4Y99C 2WITA 3ZDMA 2E74C 2P2UA 2AEJA 2FJDA 4I7ZB 3CX5I 3CC4P 1JTHA 1YITP 4KP3C 4IFMA 2IZ1A 5KLIC 4GK5E 3EAMA 4PJ0H 4QXBB 1IFJA 2WSFJ 3A7OA 3C64A 4ZI3C 2A9UA 2HFED 3OVUA 5HAXA 4L5GA 1UCUA 2WWVA 3AA1B 5H6RB 3D0TA 4GKGA 2CHNA 4DBRA 4J2CA 5JQGE 1V9DA 4LMKA 3PDYA 5HEGA 3CCVP 1LP1B 1OVRA 3TNUB 3L71E 3LBXA 3ONJA 1IO4A 1AV1A 2QGSA 1CI6A 1J5ET 1R8IA 4ASVA 2K88A 4F6RC 5AW7B 4H63V 2NPSD 1LP1A 1QVGO 3TNUA 2WAUA 3ZT6A 2BBHA 1UGOA 4RO0A 5JH7E 5AVZB 2MKVA 1BCCE 1ZOYA 2BCCE 4QWNB 2KLVA 1U4QA 2JQ9A 3ZLIA 3RL0g 2XQYA 1M1KQ 1XDOA 3T1HT 3CIRA 2BS2A 3JC22 3L4FA 2CPSA 4IDOA 4ZS2A 5HCJA 4U7JA 2YINA 2P58A 1HBWA 3S4RA 2CCQA 3LJCA 3RKOA 2Y9ZA 2W6AA 2A45G 3VU7H 4HFBA 4XA4A 5APVA 4ZI7E 1PZQA 4U2YA 3MKDA 4EI2A 2X9WA 2WDQA 3QNUA 4JI4T 2SPZA 3ZPOA 3IFMA 1FZEA 1G8XA 3PRJA 5KLVK 3ETUA 2OTKE 2VWAA 4IIJE 1MIYA 1KQGB 5AQMB 3AA0B 2XDJA 5GONE 1KNZA 3HKEE 5FKYA 1VQ9P 4AKHA 3TGUE 4ISTA 4I7ZC 5FXXA 1MUUA 3AA6B 2N9DA 2K37A 4I1LA 2IC6A 1EZVG 3C4ZA 4JBZA 2KNDA 4X1KE 2NP9A 2AEMA 2H8PD 2ODVA 4DV5T 4D6TG 2WM9A 2SPCA 2LHNA 2DI4A 2YK0A 5IHYA 3NTNA 3V2PA 3VMYA 2JRKA 3NVOA 3Q5XA 3UU6A 4LF5T 1KB9H 3U3IA 3OYXA 5KMGP 2C9LY 1PGJA 1UURA 2XAQB 4EB6E 4HFEA 1QL1A 3AVSA 4TWFA 2PFXA 1UX4A 2KSEA 2WSSV 2XY8B 2VKOA 4TWDA 1ZR2A 2R44A 2IYPA 3JAFA 4O4HE 1ZOYC 5M4YA 3L73E 1RE3A 3JADA 1PP9J 1NTZG 1K05A 5FL1A 1T6AA 3H6PA 2XSBA 5APQA 3R6NA 1GD2E 2JMHA 3K1SA 4GODA 5KJ7A 1CUNA 2OQQA 3E7KA 1KYOE 2L9QA 1MNEA 4CXXA 4ILCA 3M0DA 1QSDA 4LMJA 1BCCD 4IDPA 2BCCD 3P8MC 1SQPJ 2Y0EA 1WYCA 4H9QC 1AA0A 3HRNA 2Z5HA 1WYBA 2Q9IA 2KZ7B 2JR8A 1KMIZ 4QHOA 2WQYA 3IA3A 1YXRA 2FYUG 2BZBA 5JR9B 2ZFCA 1S5LH 3VKHA 3R84B 2LSJA 2BVMA 1DH3A 3H37A 3P7KA 3H1KJ 3CX5D 1NTMK 5JR9A 2Q7CA 1SQQE 1FE6A 4EDFA 4GYRA 2JIWA 1SUMB 2L8KA 5ABHA 1VRBA 1K9MQ 3H1LJ 3RIFA 4IE7A 3ABVA 3KQGA 3BQIA 4WBOA 3A0HE 1N33T 1SQPK 1X8YA 2XAJB 2C5JA 1KQLA 5HWYA 3TGUD 1SLQA 3M3ZB 1ZN5A 3USSA 1BGYG 5ABEA 1L0LG 3V4WA 1YQ4A 2BG9E 4AXPA 4CZZB 3CXHE 3HD7D 3RI5A 2UXDT 4W7YA 3N9NA 3P4PA 1RE3C 3GMIA 4QX8B 1OXZA 5AW2B 4E7ZA 5FVKA 5HCMA 4ILUA 2E43A 4YHJA 2NRGA 2YNYA 2VKHA 1P84E 3BCCG 3D70A 2OTJP 4OWFA 3L72J 2YU2A 5KJ7C 3AE3A 2Q5UA 3RBZA 4PJNA 4IOIH 4PV1D 5KLVD 4H0LD 5J0ZA 1EZVE 3M0DC 2KWHA 2O1JA 2M5AB 3L73D 1LTSC 4Z1MH 2X66A 1CZQA 3AE2A 5LMUT 4KHPT 3ESLA 1DU2A 4M3LA 4D6TE 3GF3A 3AE8A 3CCRP 3W68A 1R5LA 2QYWA 2HPLA 2VKJA 1KYOD 2FYZA 2WQYC 3L39A 2M5AA 4ILBA 2QVAA 5DQVA 2X9XA 1FZFA 5FVLA 1PGPA 1Q7YQ 1LNQA 3HKDE 4KI0F 4JF7A 3WUUA 5FY7A 4IDNA 4EOTA 5BMVE 4LFBT 5FY0A 3RK3E 1NTZE 3OW2O 5JR9C 2LKHA 2O01J 1VQNP 2PTFA 5AVRB 2JDIH 4DUZT 2DHRA 4TZ4C 2OYHB 3ABVC 3L35A 1XTCC 2IMLA 2H3RA 3SWKA 5BU8B 1BE3J 3P4SA 5KTBA 3WAJA 2CBJA 3LSVA 1SQQD 3LIDA 2MPKA 1AFOA 2OYHA 2E5LT 4P09A 2Y48B 5HXRA 3O1HA 2DWKA 3CQCB 1WR0A 4KHZF 1QEXA 1UIXA 3GF7A 1SQBJ 2HYNA 1JNZA 4GOEA 3U1CA 5APYA 2V5DA 2JO1A 1NYHA 3K3OA 2WZ7A 2Y0CA 4TV9E 4DO0A 3AE3C 3WUTA 5IYZE 3HUSB 1MIVA 3PU8A 5HEOA 2UXXB 2CHOA 4A98A 4JLEA 3VRBA 5DJTB 2X68A 3AE2C 1PL5A 4WWIA 1OZHA 1ZEEA 3AE8C 5LHGB 1NTMD 5CBOA 3HUSA 1GL2B 1ZV8A 3IF4A 2IPPA 1HX1B 3ZMSB 2XTLA 2ZM2A 3E0ZA 4PJ0E 3V5UA 1KILE 4TUYE 1X22A 4QXHB 2C5KT 2HODB 4YY3T 1XZYA 1L0LE 5JVDE 1VQ8P 1BSNA 4TT3H 2C5IT 4OVNF 1GL2A 3HE5B 4D6TD 1FDMA 3JCUH 2JWDA 3CX5H 3H1JE 4EXTA 3P4RA 2O3JA 2HODA 4ZKPA 3SWFA 2C0SA 2ZAEB 5LYJE 4HFHA 2AXCA 4UVBB 3HE5A 2D2CB 3A3YB 1L0NE 3PURA 3UFGA 1OFCX 1NO4A 5K5GB 4DBQA 4NUUA 2HHHT 1J1EB 3PUVF 1YKEB 1FJGT 1JNRA 2Q9QB 3CPZA 4TNWA 4A97A 1RQUA 2Q6QA 2HPCB 3Q5RA 1MIWA 3RK3D 1K73Q 3I0QA 1IFNA 4H9SE 3PUGA 1PGQA 1S3JA 3ZCIA 2UUCT 3A0BH 4N6JA 4U72A 4IE6A 2OYHC 2VKDA 3NFQA 2I1JA 2VASA 3C8VA 1FZCB 1QLED 2Q9QA 1X9VA 4U3FE 3TDKA 2HPCA 4TV8E 2NTYA 2KP8A 4ZZCA 1LTGC 1KF6A 2XQAA 1IZNB 2XQ5A 4O8SA 4JBWF 4KMCA 5DABA 3B5NB 1OIPA 2KT9A 1FZCA 4G2AA 5FY1A 5LBMA 4FI5A 2C0WA 3OAKA 1HG2A 2D9DA 4PD4I 2O1KA 2ZT9B 2L3LA 3DTOA 5HXHA 4YLHA 3B5NA 2XAGB 4NIQA 5B66H 4OGQD 4ASKA 3U78A 3DP7A 2EHOD 2IX7C 5LXTE 1MKMA 2JWAA 3HUSC 4ZXLA 1SQXJ 2YU1A 4O4LE 4AKIA 5AQTB 1XMOT 2E9XA 4ERRA 5F3JA 3C98B 4EV6A 4YSXA 5JREA 3AE1A 5AW4B 3V5SA 2IW5B 1JEKA 2LJLA 4GOFA 3ZYKA 3AB3B 1GL2C 3HKCE 1W9RA 4JEHB 3RQUA 2FXMA 1FDIA 2E76B 1KILD 1T8ZA 4H63H 3RHWA 3FZKB 5AQUB 1KB9E 3CMAP 1HCIA 1E5WA 2E5VA 2FUPA 1ZR4A 1NAYA 2YKOA 2QM7A 3H1JD 4IT4A 3I9WA 4NXMT 3KPEA 3UU4A 1JUNA 5APTA 4TNVA 4JI7T 2B88A 2D2CC 3TYYA 1J1EC 1N7LA 4YTMA 2QIWA 5LHHB 1L0ND 2Q9QC 1Z56A 3T97B 3KYQA 4PNIA 2BEZF 5JDNA 3E1RA 4HEAA 1AVYA 5LGTB 1X79B 1NVOA 2KLUA 2NOXA 4EAHA 4R4LA 5EZYE 1FZCC 1NU1E 3MUDA 5AQFB 2P7JA 3T97A 2MTQA 1B7TA 1HTJF 2G8YA 4BA9A 4U3FD 3PUXF 1X79A 2RP4A 3L70E 1EXJA 3B8EB 4AKGA 3B5NC 3FXEB 1RF1B 1KQFB 5CCHD 2HLOA 4KUMB 3W67A 2P1JA 1E1HB 2E74D 2AEFA 2ZT9C 3EVYA 3F5HA 2X67A 1JCCA 3ETVA 2OYIA 2UXBT 3FXEA 3TF5A 1RF1A 2IBZI 3PV0F 5EFWB 3AE1C 3PJAJ 1N34T 2XSAA 4YHHT 1NJIQ 1PPJE 4YJ2E 1G1JA 3AE4A 4JI5T 4ZI3D 1BCCG 2N2NA 2BCCG 5LG3A 1IBMT 4HH2A 3B57A 3HA4A 4YSZA 1NTKJ 2I0MA 4JQ0D 1IBKT 2P9BA 2AE9A 1FZGA 1YYCA 3GW6A 3M06A 4YT0A 1NGMB 1W0BA 1LTAC 1OMIA 3F2EA 3UQ4A 4HKZH 2E76C 2LSIA 4JI1T 5AQLB 1SHZC 2ZLYA 1T7SA 4TX5A 4NXNT 2OYOA 3WUVA 2B1EA 1NHLA 4AQYT 2K5BB 1FIOA 2V7IA 1KB9D 2FYNB 5AQKB 2JPFA 3J7Yq 4DV4T 3Q5WA 3VRAA 5EK3A 3BASA 1LGHB 3L8RA 1YIJP 5E79H 2CM0A 1WRGA 2Q3IA 3L71J 3MUDC 4I0UA 3VR8A 3CC2P 1OVVA 1NTKK 4HB1A 3TGUG 3CWBD 1US7B 5GTHE 1HTLC 3RC8A 3L75E 1J1DB 3KV4A 1QX8A 3KV5A 4IE5A 3ZN0B 3ONLC 4GYSA 1MMNA 5AQNB 1NU1D 3VTPC 4ISSA 4GK0E 2NW8A 3K3NA 1O3XA 1T3UA 2WCAA 3NMDA 4HFDA 1Y64B 5LGUB 3EHZA 1RF1C 3L70D 3P32A 3NZPA 4EZ4A 1S4XA 1D0ZA 5KLVG 3AE4C 4WY4B 2LHRA 4AQFA 4DMWA 3VP8A 4EIWA 4UV9B 3C4XA 1DEBA 3L73G 1SQVE 1KD1Q 5TJHA 1UIIA 3MD0A 3EDVA 5LJNA 3O4XE 4O2BE 4UB8E 2XQ3A 2XAHB 3D6YA 2H7HA 3M65A 2CBIA 3X1DA 4PJJA 2QA4P 3NWIA 1PPJD 1XNRT 3KBTA 3RYHE 2ZYDA 2WMNA 4W7ZA 3N9PA 2YMKA 2LSYA 3G06A 1D0XA 2VB6A 4X62T 1TU3F 4IDZA 3RC3A 3UFEA 1W09A 2H7VC 2V1DB 2O01H 5L3CB 2W62A 3RGUA 3I1AA 1LT9B 2VURA 2YKPA 3TGUJ 3C4WA 3GLMA 1M7LA 3A7MA 1KZUB 1CW5A 4DVDA 2VQFT 1X0TA 3BK9A 4O9BA 3O9XA 5HEHA 4L74A 4ZNCA 2JQHA 1LT9A 2FYNC 1XTGB 2QJPB 3VP9A 2WSCJ 2OGUA 3PUAA 1SQQG 4IL6E 4JYBA 3PTZA 3ZMTB 1GZLA 4DV6T 2XU6A 4X20E 3H1HE 3EDUA 5JDMA 1E7PA 1DD3A 3B5MA 3LK3B 5AQGB 2KSJA 5IWAT 1T2KC 1H88A 4ILAA 2BKOA 3IAOA 3L73J 1J1DC 2J5UA 3JCUE 3O1IA 5AVWB 3CX5E 3L75D 3V2QA 1JY2P 5AVUB 4UR9A 1VL2A 3N2OA 2QM8A 4AQFC 2W61A 3LW5J 3KVAA 1H8AA 1JMBA 3HE4B 1VF5B 1MMDA 4GT1A 1NTMG 4BXLA 1LTJB 1Q90D 3RIUC 3ZSTA 4WY4C 3KV9A 2CLYB 2R3SA 3C51A 3A0BE 5LHIB 2UXCT 3HE4A 1U57A 3QOFA 1SQVD 2DWGA 4P0BA 4OK0A 1LTJA 3CI9A 3CKDA 3PJAA 4EYYQ 1MV8A 3AE5A 1GU5A 2KS1B 1NOHA 3D71A 2H88A 3KZIH 3ONXA 1YHQP 1M1JB 4I2LC 2WDVA 2P10A 2W4XA 5L4EA 4H44D 2W6BA 1OW6A 1W2EA 2BS4A 1Y01A 2J4GA 2PFVA 3JC6C 1GU4A 5AQVB
chains in the Genus database with same CATH topology
1LT9C 1M1JA 4EYYR 5KJ7D 1AJ3A 2N9BA 2N1TB 3CVRA 2D0UA 3RYIE 3MK7C 4JYCA 1D0YA 4IHJE 3GHGB 3M9BA 3V2RA 2C0XA 2A45I 2N1TA 3OYZA 1FJKA 4ZKUA 1EZ3A 1GK4A 4ZS3A 3GHGA 3N2KE 2Y6XA 3KDPB 2WWUA 5JDFA 2W00A 1GW4A 3V4QA 1KK7A 2XKMA 2G0UA 4JEUB 1LTJC 3T8OA 1VDFA 2CLYC 3ZCJA 4AKRB 5AVTB 3E1IA 3WI3A 2XASB 3ZMUB 3KV6A 4ZI2C 3KDSE 3CX8B 2X0LB 2NTXA 3PE0A 1NWQA 2MBGA 1M1JC 2LSGA 5J1GA 5CA0E 2CWYA 1HH0A 1MMAA 4LC1A 5TAOA 2LT3A 5FYMA 1JMMA 3E22E 3FXDB 2N1TC 1VOMA 1ZV4X 3RX6A 4H9PC 5J2UE 1SFCB 2CXDA 3ZMZB 4OYKA 3GHGC 2W27A 3QK6A 4M1PA 3I5CA 3UULA 2XAFB 4C7NB 1HUCA 2WPSA 1SFCA 2YKQA 2E42A 1IJ6A 4GOUA 4PFOA 3RK2B 5JDHA 4N3YB 2HG5D 4HGAA 4C7NA 4EYUA 2MOZA 1T98A 1G1IA 5HWXA 3ZC1A 3J9X1 2FYUK 1D1AA 2A72A 3QUJA 4KHXA 1MFZA 4C46A 4AI6A 5AW5B 1CSBA 4EZHA 3N7NA 4E7SA 1LTTC 5CCGA 3EUHA 2A2FX 4B86A 2MJZA 1AQ5A 2V7KA 3PTRB 2XUEA 2LOPA 3IR9A 5LA6E 3QC9A 3RYFE 3F57A 4OHFA 2P67A 3RRWA 2VK9A 4IE0A 3EFGA 3ZN1B 2ZXEB 2POHA 5DQWA 1GL2D 5JRCB 5EK4A 3N9QA 1SFCC 1SQBK 4P0AA 5L3BB 4MHCA 1MMGA 1FZBA 1JY3N 3TK1A 2D0TA 3K8PC 1FU1A 3RK2C 1NWMX 2L5GB 3NBXX 4C7RA 2CEAA 3CX7B 5J2TE 5AW8B 4CI2B 2Q9QD 2KOGA 1A02F 2WSFH 5AVSB 4MLKA 2LOSA 1BR1A 3BQKA 1N7SB 3ZJ2A 5CCGC 5APXA 4WNKA 4LGDE 5AVXB 4CI3B 4YFSA 5APWA 2J1DG 1N7SA 2IFNA 3P8CE 1FOSF 2LM9A 3B5ND 3IHRA 3CL3D 4L9IA 5EK2A 1N86A 3PU3A 4DZOA 2E9XD 2D2SA 4I43B 2PG8A 1FZAA 1JY3O 4N78E 5ETWA 1SA0E 1URQB 4OYJA 4TN7B 3F31A 1U5PA 1RY3A 1URQA 2CXLA 4U74A 3LW5H 4V1Av 1LTIC 2FKWB 3CX6B 3BVHA 1SQXK 4IGUA 3TKLB 3B13A 4WBNE 1FBMA 3PUSA 1S35A 5HXEA 2C9NY 2BDEA 1N7SC 3BRTB 3MJXA 3ANWB 3AAIA 1LTBC 1ZHCA 1N73B 3ZMVB 5LNKA 3P8CD 1Z0PA 2A45H 3KINB 4UF0B 2J58A 4L0RA 3ANWA 1KFMA 2CXFA 3MACA 1N73A 1FOSE 2XHEB 3FBZA 3L37A 4UF0A 2WMOA 3IBPA 5APSA 1IJ5A 1L4AB 3M9QA 4Z8XA 4IE6A 1GW3A 3RL0B 2PJQA 3GWHA 4N78D 5AVYB 1URQC 3EQ2A 4EIJA 1L4AA 5CJ4A 2N1GA 1IC2A 5LP6E 2PAJA 3ZC0A 3G3ZA 4HFVA 2V26A 1G2CB 1N2DC 2YO2A 3N5LA 1UX5A 3UUNA 2KB7P 4GIFA 5HYAA 3UUMA 5LBQB 5LCYA 3MIWA 2IAKA 3ZYMA 3RRCA 3NRXA 2ODUA 3Q9DA 2UXNB 4DOJA 3M9HA 4PW8A 2Z6EA 1T2KD 3PUQA 2MYSA 5AVQB 2K9AA 4IE4A 1NAFA 3IEEA 2M8RA 4O2AE 5F8PA 2H43A 1JOCA 3O8ZA 5AW6B 3N9LA 1HVVA 1N73C 4O4JE 5C8YE 2BASA 4UELA 3VOPA 5BU5A 2XZRA 2Z4EA 3N9OA 4UVCB 4WB4A 3VYIA 3L3PA 1T3JA 1GTWA 3L09A 3UIAA 1PFIA 2NW9A 4WY4A 1L4AC 2XNXA 3ZYLA 3OKQA 1FAVA 3RL0C 1IFMA 2Y8DA 3AA7B 4NUVA 3JC6D 4DMVA 2V7LA 3LBXB 1CI6B 3LFMA 3NRYA 5JDLA 3CMLA 1FJPA 2WT7B 4PJMA 5KDMC 3O1JA 2WPQA 2RA1A 3KVBA 4UEMA 1YTZI 2OARA 1WRDA 1J2JB 5CMZA 2WT7A 3HTKB 2NPSB 2XV5A 3UT5E 1S94A 1YW0A 2CMRA 3H3AA 1BR4A 1WT6A 3HTKA 1RF0A 2NPSA 3SS1A 4X1IE 2PP6A 2KYVA 4GIWA 1HS7A 3V2NA 2H7OA 4OFZA 2KLQA 3L36A 3HKBE 2GM4A 2GK9A 4AUWA 5AW9B 1OWAA 4XE5B 2X9YA 1RE4A 5JDGA 5CB4E 1WLXA 4CI1B 1LKXA 5LOVE 3V5BA 4AYCA 4ZI2D 2X9HA 3ZJ1A 3MXZA 3VKGA 4MBQA 4G63A 3BQLA 4HTEA 1GDTA 2KXPB 3RYCE 1HJBA 5FNVE 3II6A 2N1TD 2V7MA 4K0UA 1MZ9A 1YKHB 4H9RC 1HF8A 4O4IE 5JDQA 4CXYA 5L3FB 3OJAB 4AKLA 2ES0A 1RF0C 2NPSC 4HE8A 2K24A 3SWYA 4XZCA 1SQQK 5BVZA 3OJAA 2NWBA 5A1LA 1SVFA 2J59M 5LG4A 3N2GE 1RE4C 2GUSA 1VPCA 1YTZT 3U1AA 1IJDB 3WAKA 3VN0A 4QKNA 3OBVE 1D1CA 2BVLA 2LE8A 4H9OC 2ZM0A 4C90A 3CQGB 3I9YA 4WW0A 1IAPA 3ZEFB 5E0OA 1FMVA 1FEWA 3FHNA 2ZM8A 3HL6A 3UTKA 5ADXL 2I1KA 5FXWA 4I55E 3H32B 2FFDB 3HD7B 5FMNA 3KFWX 1SFCD 5CHXA 1NH4A 3C50A 4MALA 1NTZK 3H32A 2FFDA 3HD7A 1DX7A 3VMZA 3I0OA 2CWOA 3N4XA 3NXSA 3RK2D 4JUYA 3CLQA 4EOZB 2JMKA 2KINB 2KMFA 5CCGD 4LLHA 4CXWA 1QL2A 5LGNB 4QXCB 1NKNA 3UUXB 3M91A 4UVAB 3SOLA 2ZMAA 4H9NC 5H6QB 1L0LK 4PAGA 1HX8A 4XAXB 5AFUL 2LSKA 2VRSA 2K48A 4DNDA 2FFDC 3HD7C 2WWWA 3A5TA 3N9MA 5APUA 1L0NK 3FBLA 2YO3A 3MA9A 5AVVB 5JRCA 3VMXA 4OH8B 3IF8B 3M0AA 4UXNB 3AAAB 4PK4A 4B6XA 3W15B 5DJQC 4UV8B 2I59A 2M67A 2IC9A 4HKAA 5KX5E 3BATA 4BJMA 1IFDA 1SP4A 1BR0A 1JNMA 1N7SD 1D1BA 3CWZB 4W80A 2IFMA 3SWHA 2LKMA 3RK3B 1QUUA 4MFRA 3SRZA 3P7IA 3DJBA 4QX7B 2DCFA 4PFPA 4XBFB 2DLRA 3C9IA 4A56A 3FB2A 3R2PA 2WSCH 1G73A 2X51A 4BJNA 2JJ9A 1A02J 4WBAA 3A5XA 3GA8A 1KFNA 2E9XB 5FXVA 2R3CA 3HI2A 1URQD 2EHOB 4UIGA 4PJLA 3NZQA 3A2AA 1H7CA 1IK9A 5AW0B 1BR2A 3LG7A 1JY2N 4BAYB 5HXCA 1HFAA 2EHOA 2HPJA 4C91A 2YEVC 2E8IA 1NU1K 2GUVA 2R5DA 5LJMA 1KILB 5FP3A 3CQXC 2YMYA 1ZKEA 3OA7A 2CE7A 3PP5A 3U59A 1ZLLA 2V7JA 1KILA 4PK5A 3MTUE 2KWIB 3AVRA 4HYTB 2DNXA 4I6MC 3AAEB 1H89A 2M3BA 3RK3C 3GN5B 4RESB 2LEHA 5L3DB 4X1YE 1LWUB 4FJOA 1S9KE 3HR0A 3VHLA 3KBUA 2PBIA 3GN5A 1MNDA 1LVKA 1JY2O 1EQ7A 1LWUA 1JCDA 2JEEA 4I4TE 2OYIB 1HGVA 2Z5IA 2WTYA 5CA1E 1JO5A 1L4AD 4Y99B 4AQRD 3BRVB 3RL0D 3WMM0 5CJ0A 2CA5A 2D5UA 2E9XC 2W63A 5CCHA 3E08A 2EHOC 5AW3B 2ACXA 2WPRA 2OA5A 2NW7A 2R32A 2WBLA 3RH3A 5L3GB 4ANJA 1HWTC 3LK2B 1HG5A 2QA7A 1YD8G 1KILC 4ADZA 5L2LA 1G2CA 3Q2MA 3LIEA 1LVFA 1IFIA 3RPUA 4IFFA 5HXSA 4PK6A 4KBMB 2HH7A 2A3DA 2W0GA 1SQVK 4AQGA 4ZOLE 1LRZA 5L3EB 5AW1B 2VL8A 1FMWA 1WR6A 2JJLA 4HN9A 1HGZA 2R5BA 3LK42 3MGNA 1LWUC 2CPBA 3MZKB 3TSIA 4WY4D 3S4UA 1S9KD 2JQQA 4IFDK 4YJ3E 3K3QC 1NKZB 5FXZA 4ZHQE 2WSEH 1JY3P 1GK6A 1JTHB 4CQIA 2OYIC 4I50E 5CCHC 4Y99C 2WITA 2P2UA 1JTHA 4KP3C 4IFMA 4GK5E 4QXBB 1IFJA 3A7OA 3C64A 4ZI3C 2HFED 5HAXA 4L5GA 1UCUA 3AA1B 5H6RB 3D0TA 4GKGA 4DBRA 4J2CA 5JQGE 1V9DA 3PDYA 3TNUB 3LBXA 1IO4A 2QGSA 1CI6A 4F6RC 5AW7B 4H63V 2NPSD 3TNUA 2WAUA 5JH7E 5AVZB 4QWNB 2KLVA 1U4QA 3ZLIA 2XQYA 3L4FA 2CPSA 4ZS2A 2YINA 1HBWA 2CCQA 3LJCA 3RKOA 2W6AA 2A45G 3VU7H 4XA4A 5APVA 4ZI7E 3MKDA 2X9WA 3ZPOA 3IFMA 1FZEA 1G8XA 5KLVK 3ETUA 2VWAA 4IIJE 1MIYA 3AA0B 2XDJA 5GONE 1KNZA 3HKEE 4AKHA 4ISTA 5FXXA 1MUUA 3AA6B 2N9DA 4I1LA 2IC6A 3C4ZA 2KNDA 4X1KE 2NP9A 2H8PD 2ODVA 2WM9A 2SPCA 2LHNA 2DI4A 2YK0A 5IHYA 3NTNA 3V2PA 3VMYA 2JRKA 3Q5XA 3U3IA 3OYXA 5KMGP 2C9LY 2XAQB 4EB6E 1QL1A 3AVSA 1UX4A 2WSSV 2VKOA 1ZR2A 4O4HE 5M4YA 1RE3A 3H6PA 5APQA 3R6NA 1GD2E 2JMHA 5KJ7A 1CUNA 2L9QA 1MNEA 4CXXA 3M0DA 1QSDA 3P8MC 1WYCA 4H9QC 3HRNA 2Z5HA 1WYBA 2Q9IA 2KZ7B 4QHOA 2BZBA 5JR9B 2ZFCA 3VKHA 3R84B 2LSJA 2BVMA 1DH3A 3H37A 3P7KA 1NTMK 5JR9A 2Q7CA 4GYRA 2L8KA 1VRBA 4IE7A 3KQGA 3BQIA 4WBOA 1SQPK 1X8YA 2XAJB 2C5JA 1KQLA 5HWYA 1SLQA 1ZN5A 3V4WA 4AXPA 4CZZB 3HD7D 4W7YA 3N9NA 1RE3C 3GMIA 4QX8B 1OXZA 5AW2B 4E7ZA 4ILUA 2E43A 4YHJA 2YNYA 2VKHA 2YU2A 5KJ7C 2Q5UA 4PJNA 3M0DC 2KWHA 2O1JA 1LTSC 2X66A 1CZQA 3ESLA 4M3LA 2HPLA 2VKJA 2FYZA 5DQVA 2X9XA 1FZFA 3HKDE 4JF7A 5FY7A 4EOTA 5BMVE 5FY0A 5JR9C 5AVRB 2DHRA 4TZ4C 2OYHB 3L35A 1XTCC 2H3RA 5BU8B 5KTBA 3WAJA 3LIDA 1AFOA 2OYHA 4P09A 2Y48B 5HXRA 3O1HA 2DWKA 3CQCB 2HYNA 3U1CA 5APYA 3K3OA 2WZ7A 4TV9E 4DO0A 5IYZE 3HUSB 1MIVA 3PU8A 2UXXB 4JLEA 2X68A 1ZEEA 5LHGB 3HUSA 1GL2B 1ZV8A 2IPPA 3ZMSB 2XTLA 2ZM2A 3E0ZA 3V5UA 4TUYE 4QXHB 2C5KT 2HODB 5JVDE 2C5IT 1GL2A 3HE5B 1FDMA 4EXTA 2HODA 4ZKPA 3SWFA 2C0SA 5LYJE 4UVBB 3HE5A 3A3YB 3PURA 4DBQA 1NO4A 4NUUA 1J1EB 1YKEB 2Q9QB 3CPZA 2HPCB 1MIWA 3RK3D 3I0QA 4H9SE 1IFNA 3PUGA 3ZCIA 4N6JA 4U72A 2OYHC 2VKDA 3NFQA 2I1JA 2VASA 1FZCB 2Q9QA 1X9VA 2HPCA 4TV8E 2NTYA 2KP8A 1LTGC 1IZNB 4O8SA 4KMCA 5DABA 3B5NB 2KT9A 1FZCA 4G2AA 5FY1A 5LBMA 4FI5A 2C0WA 3OAKA 1HG2A 2O1KA 2L3LA 3DTOA 5HXHA 4YLHA 3B5NA 2XAGB 4ASKA 3U78A 3DP7A 2EHOD 2IX7C 5LXTE 3HUSC 2YU1A 4O4LE 4AKIA 2E9XA 4ERRA 5F3JA 3C98B 5JREA 5AW4B 3V5SA 2IW5B 2LJLA 3ZYKA 3AB3B 1GL2C 3HKCE 4JEHB 2FXMA 1KILD 1T8ZA 4H63H 1HCIA 1E5WA 1ZR4A 2YKOA 2QM7A 3I9WA 3KPEA 1JUNA 5APTA 3TYYA 1J1EC 1N7LA 5LHHB 2Q9QC 1Z56A 3KYQA 4PNIA 5JDNA 4HEAA 5LGTB 1X79B 2NOXA 4EAHA 5EZYE 1FZCC 3MUDA 2P7JA 3T97A 2MTQA 1B7TA 1HTJF 4BA9A 1X79A 2RP4A 3B8EB 4AKGA 3B5NC 3FXEB 1RF1B 5CCHD 2HLOA 4KUMB 2P1JA 1E1HB 3EVYA 2X67A 1JCCA 3ETVA 2OYIA 1RF1A 4YJ2E 1G1JA 4ZI3D 2N2NA 4HH2A 3B57A 3HA4A 2P9BA 1FZGA 1YYCA 3M06A 1LTAC 3F2EA 2LSIA 1SHZC 2ZLYA 4TX5A 2B1EA 1NHLA 2K5BB 1FIOA 2V7IA 2JPFA 3J7Yq 3Q5WA 5EK3A 3BASA 1LGHB 2CM0A 1WRGA 2Q3IA 1NTKK 1US7B 1HTLC 3RC8A 1J1DB 3KV4A 3KV5A 4IE5A 3ZN0B 4GYSA 1MMNA 3VTPC 4ISSA 4GK0E 2NW8A 3K3NA 1O3XA 1T3UA 3NMDA 5LGUB 1Y64B 1RF1C 3P32A 3NZPA 4EZ4A 1D0ZA 2LHRA 4WY4B 4AQFA 4DMWA 4EIWA 3VP8A 4UV9B 3C4XA 1DEBA 3MD0A 3EDVA 5LJNA 3O4XE 4O2BE 2XAHB 2H7HA 3M65A 4PJJA 3KBTA 3RYHE 2WMNA 4W7ZA 3N9PA 2LSYA 1D0XA 2VB6A 4IDZA 3RC3A 3UFEA 2H7VC 2V1DB 5L3CB 2O01H 2W62A 3I1AA 1LT9B 3C4WA 2YKPA 1M7LA 1KZUB 1CW5A 4DVDA 3BK9A 4O9BA 3O9XA 1LT9A 1XTGB 3VP9A 3PUAA 4JYBA 3ZMTB 1GZLA 2XU6A 4X20E 3EDUA 5JDMA 3LK3B 2KSJA 1T2KC 1H88A 1J1DC 3O1IA 5AVWB 3V2QA 1JY2P 5AVUB 3N2OA 2QM8A 4AQFC 2W61A 3KVAA 3HE4B 1H8AA 1MMDA 4GT1A 1LTJB 4WY4C 3KV9A 2CLYB 3C51A 5LHIB 3HE4A 2DWGA 4P0BA 4OK0A 1LTJA 3CI9A 3CKDA 1MV8A 1GU5A 1NOHA 3ONXA 1M1JB 4I2LC 2W6BA 1W2EA 2PFVA 3JC6C 1GU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I1L A;  3BAS A;  1X79 B;  4O9B A;  2POH A;  1WT6 A;  3U59 A;  3U1A A;  3HRN A;  3U1C A;  1IC2 A;  1NKN A;  3VP9 A;  5BU8 B;  5BVZ A;  5KTB A;  3VP8 A;  5BU5 A;  2JEE A;  3C9I A;  3N4X A;  2FXM A;  3N7N A;  3BAT A;  4N3Y B;  4GIF A;  4ZKP A;  4ZKU A;  3P8C D;  4N78 D;  3OJA B; 
#chains in the Genus database with same CATH topology
 2KS1 A;  5KLV E;  1N32 T;  1AQT A;  1LT9 C;  1M1J A;  4EYY R;  5KJ7 D;  1AJ3 A;  2N9B A;  2N1T B;  5B66 E;  3CVR A;  1KFY A;  2D0U A;  3RYI E;  3MK7 C;  4YSY A;  4JYC A;  1D0Y A;  4IHJ E;  3GHG B;  3M9B A;  3RIA A;  4YXW H;  3V2R A;  2C0X A;  2QJP C;  2A45 I;  2N1T A;  4PD4 H;  2K3R A;  1XWM A;  4DV7 T;  2YKS A;  2KI7 B;  1ZME C;  3OYZ A;  1FJK A;  4DJG A;  4ZKU A;  1EZ3 A;  1GK4 A;  4ZS3 A;  3I55 P;  3EI0 A;  3GHG A;  3H1H D;  3N2K E;  2ZYA A;  2Y6X A;  2XQ9 A;  3CXH I;  3KDP B;  2WWU A;  1JM0 A;  5JDF A;  3ZT7 A;  2HN2 A;  3FWN A;  3Q5P A;  2W00 A;  5AQR B;  2Q3E A;  1GW4 A;  1P84 I;  3V4Q A;  4D6T J;  1AVO A;  1KK7 A;  2K9Y A;  4ZEY A;  1OW8 A;  1GQE A;  1K04 A;  2XKM A;  3CD6 P;  1HF9 A;  2V6Y B;  1EZV I;  2G0U A;  1ZXG A;  2JP3 A;  2W83 C;  4HFC A;  4JEU B;  4K3A A;  4U31 A;  1W5C E;  1VF5 C;  2B9B A;  2NZ2 A;  1LTJ C;  2G3A A;  3P4W A;  3T8O A;  1VDF A;  2CLY C;  3AE5 C;  2V6Y A;  3ZCJ A;  4AKR B;  2H88 C;  5AVT B;  1NTZ J;  3E1I A;  3WI3 A;  2XAS B;  3ZMU B;  3KV6 A;  4ZI2 C;  4DR3 T;  2K1A A;  3KDS E;  3CX8 B;  2X0L B;  2NTX A;  3PE0 A;  2E2A A;  1NWQ A;  2AXT H;  3H1J G;  1M1J C;  4RJT A;  2LSG A;  2OV9 A;  5J1G A;  2MBG A;  1KTM A;  2Y9Y A;  1RH5 B;  5CA0 E;  3ZKR A;  2CWY A;  1HH0 A;  1PP9 E;  1MMA A;  1NTM E;  4LC1 A;  2OTL P;  5TAO A;  2LT3 A;  3AEG C;  5FYM A;  1JMM A;  1L0N G;  3E22 E;  3FXD B;  2N1T C;  1VOM A;  2FYU J;  1ZV4 X;  2YDR A;  3UU8 A;  3RX6 A;  3B4S A;  4NPF X;  4H9P C;  5J2U E;  1I6Z A;  1SFC B;  4H13 B;  2CXD A;  4X65 T;  3ZMZ B;  1SQP E;  3GHG C;  4OYK A;  2W27 A;  3C1L A;  3QK6 A;  4M1P A;  2PGD A;  3UUB A;  2WSE J;  3I5C A;  1Q86 Q;  4U3F G;  3UUL A;  2XAF B;  4C7N B;  1HUC A;  2WPS A;  1E79 H;  1SFC A;  5B5E H;  2YKQ A;  2E42 A;  1IJ6 A;  2WVR A;  4GOU A;  4PFO A;  3RK2 B;  5JDH A;  4DR5 T;  3AE9 A;  4N3Y B;  2HG5 D;  4L76 A;  3H1K E;  1VQM P;  1Q2N A;  4C7N A;  4HGA A;  1HJ0 A;  4EYU A;  4XFJ A;  2QSI A;  5KAI H;  2MOZ A;  1M57 D;  1T98 A;  1BGY J;  1G1I A;  5HWX A;  3FZH B;  3J9X 1;  3ZC1 A;  2FYU K;  1L0L J;  4HWD A;  2O01 N;  4NPP A;  3H1L E;  4JI8 T;  2WY2 A;  4LF7 T;  3TLU A;  1D1A A;  2A72 A;  3QUJ A;  4KHX A;  5E79 E;  1MFZ A;  4C46 A;  4AI6 A;  5AW5 B;  3GMA A;  1CSB A;  4EZH A;  3N7N A;  4E7S A;  1LTT C;  2XZE A;  3BCC J;  1QVF O;  5CCG A;  1E2A A;  4CPG A;  2BBJ A;  3EUH A;  3SFD A;  1L0N J;  2A2F X;  4B86 A;  2FXO A;  2MJZ A;  1AQ5 A;  2LRL A;  2V7K A;  3PTR B;  2J62 A;  2XUE A;  4UB6 H;  5C39 A;  1M62 A;  2LOP A;  2V7Q J;  3IR9 A;  2XPK A;  5LA6 E;  3QC9 A;  3RYF E;  3F57 A;  4OHF A;  4DR1 T;  3TLT A;  2P67 A;  4U3C A;  3RRW A;  2VK9 A;  4IE0 A;  1PP9 D;  3AED A;  3EFG A;  3GG2 A;  3ZN1 B;  2ZXE B;  2POH A;  5DQW A;  2Q1K A;  2LXC B;  3CWB G;  1GL2 D;  1NEK A;  2WZH A;  5JRC B;  5EK4 A;  3N9Q A;  4BWN A;  1SFC C;  4H13 C;  4KJM A;  2LXB A;  1SQB K;  2IYO A;  4P0A A;  1SQP D;  1NU1 G;  3AE9 C;  5L3B B;  2FJE A;  4MHC A;  4HWF A;  1MMG A;  1EC5 A;  1FZB A;  1JY3 N;  3TK1 A;  2D0T A;  3K8P C;  2W6J H;  4HWH A;  3L70 G;  1FU1 A;  3RK2 C;  1NWM X;  2K9J B;  2L5G B;  3NBX X;  4C7R A;  1VCT A;  2CEA A;  3CX7 B;  4DV2 T;  5J2T E;  5AW8 B;  5AQQ B;  4CI2 B;  4JI0 T;  3H1K D;  2Q9Q D;  1ZW0 A;  2KOG A;  1KNP A;  1A02 F;  2WSF H;  5AVS B;  4MLK A;  2LOS A;  5JTG A;  1BR1 A;  2LKG A;  3BQK A;  2K9J A;  1N7S B;  1PPJ G;  1KOR A;  5CCG C;  3ZJ2 A;  5APX A;  1Y8A A;  3SFD C;  2RPA A;  4WNK A;  4DV3 T;  5HEU A;  1JB0 J;  3H1L D;  4LGD E;  4U7Y A;  4ZMD A;  5AVX B;  4CI3 B;  4YFS A;  5APW A;  5CBN A;  1IK7 A;  4WYV A;  2J1D G;  1N7S A;  2IFN A;  3P8C E;  1KV4 A;  2WPV B;  1FOS F;  2LM9 A;  3B5N D;  3IHR A;  3VMA A;  3CL3 D;  3PH0 A;  4L9I A;  5EK2 A;  2E5T A;  1N86 A;  3KHU A;  3PU3 A;  5TIS H;  2ZT9 D;  4DZO A;  3EFF K;  2E9X D;  4LFC T;  4EED A;  2D2S A;  3AED C;  2K3W A;  1H0T B;  2B76 A;  1QLB A;  4YTP A;  1NU1 J;  4I43 B;  2PG8 A;  4U33 A;  1FZA A;  3L72 D;  1JY3 O;  4N78 E;  2RH0 A;  2ZJS E;  4WZX A;  4TLF A;  3L70 J;  5ETW A;  1H0T A;  1SA0 E;  1URQ B;  4OGQ B;  5F5W A;  1WCR A;  4CN6 A;  4OYJ A;  4TN7 B;  3F31 A;  4DR4 T;  1U5P A;  1RY3 A;  4DCK A;  5HEJ A;  2WP9 A;  2PRR A;  3L75 G;  4B3S T;  4L73 A;  2E76 D;  3KZI E;  1URQ A;  2QE7 H;  2CXL A;  4U74 A;  1Y47 A;  3LW5 H;  2L91 A;  4V1A v;  3Q3D A;  1LTI C;  2FKW B;  3CX6 B;  3BVH A;  4LF8 T;  1SQX K;  1DIP A;  1M7K A;  1USE A;  5M1B A;  1D7M A;  3CWB E;  4IGU A;  3TKL B;  3B13 A;  2FBW A;  4WBN E;  1SQV G;  1FBM A;  1ZRT E;  1OX3 A;  1S35 A;  3PUS A;  5HXE A;  2C9N Y;  2BDE A;  1N7S C;  2QJK B;  3BRT B;  1WFD A;  3R4Y A;  2J47 A;  3MJX A;  3H1I G;  3ANW B;  3AAI A;  1LTB C;  1ZHC A;  3Q5E A;  1N73 B;  3ZMV B;  5LNK A;  3P8C D;  1Z0P A;  2A45 H;  3KIN B;  4UF0 B;  1S5L E;  2AXD S;  4YTP C;  1EDK A;  2J58 A;  4L0R A;  3ANW A;  1KFM A;  2CXF A;  3MAC A;  1N73 A;  1FOS E;  1U7M A;  2WU2 A;  4Z91 A;  2XHE B;  3L75 J;  3FBZ A;  3L37 A;  3CXH H;  2WMO A;  4UF0 A;  3IBP A;  1Y9B A;  5APS A;  4DR6 T;  1IJ5 A;  1L4A B;  3M9Q A;  2ZXX A;  1U7J A;  3SFE A;  2B87 B;  4Z8X A;  2BKN A;  1GW3 A;  3RL0 B;  2PJQ A;  3GWH A;  1P84 H;  2X0H A;  3H1H G;  4N78 D;  3PUZ F;  2I8D A;  5AVY B;  1URQ C;  3EQ2 A;  4EIJ A;  2WSS H;  4OGQ C;  1L4A A;  5CJ4 A;  1YQ3 A;  2N1G A;  1IC2 A;  5LP6 E;  2PAJ A;  2XJ7 A;  2B87 A;  3ZC0 A;  3G3Z A;  4HFV A;  1DD4 A;  2E75 B;  2V26 A;  2AXT E;  3QWO C;  1G2C B;  1N2D C;  2YO2 A;  3N5L A;  4K35 A;  1UX5 A;  3OPC A;  4RKU J;  3UUN A;  5AQS B;  2KB7 P;  2FBW C;  4GIF A;  5HYA A;  3UUM A;  3RQW A;  1YBK A;  4P1N A;  4IL6 X;  5LBQ B;  4YPC A;  5LCY A;  1XNQ T;  3MIW A;  2IAK A;  3ZYM A;  3RRC A;  3NRX A;  2ODU A;  3Q9D A;  1M90 Q;  2UXN B;  4DOJ A;  3M9H A;  4GDO A;  4PW8 A;  2Z6E A;  4DID B;  1T2K D;  5ABG A;  4HWI B;  3PUQ A;  2MYS A;  4DR2 T;  3G9R A;  1YJN P;  3S1K A;  1S2E A;  5AVQ B;  5IUX A;  2QJK C;  1ZRT D;  5L8R J;  2YDQ A;  4PD4 D;  2K9A A;  4IE4 A;  2IBZ E;  1NAF A;  5B5E E;  1M8O B;  3IEE A;  2M8R A;  1BCC J;  4O2A E;  2BCC J;  2JQK A;  5F8P A;  2H43 A;  1JOC A;  3O8Z A;  5AW6 B;  3N9L A;  2Y0D A;  1HVV A;  1N73 C;  4O4J E;  3H1H J;  3CCS P;  5AQH B;  3CME P;  5C8Y E;  3B71 A;  4F8H A;  3CK6 A;  5KAI E;  2BAS A;  4UEL A;  3VOP A;  5BU5 A;  2XZR A;  2Z4E A;  4QH1 A;  3N9O A;  4UVC B;  4WB4 A;  1BDC A;  4OX9 T;  3SFE C;  3L74 E;  3VYI A;  3AEA A;  3L3P A;  1SQX D;  1T3J A;  1GTW A;  2FJB A;  3L09 A;  3UIA A;  1PFI A;  3RIU A;  1NTK E;  2NW9 A;  4WY4 A;  4X66 T;  1L4A C;  2XNX A;  3ZYL A;  1YQ3 C;  3OKQ A;  1FAV A;  3H1I E;  3RL0 C;  1IFM A;  1I94 T;  5ABF B;  4IL4 A;  5GTI H;  2Y8D A;  3AA7 B;  4NUV A;  2XM2 A;  3JC6 D;  3PJS K;  4DMV A;  1KEY A;  2V7L A;  4UB6 E;  1OED B;  2RKL A;  3LBX B;  5ABF A;  1QGK B;  1CI6 B;  2E75 C;  3LFM A;  3NRY A;  3CPW O;  5JDL A;  3CML A;  1FJP A;  2WT7 B;  4PJM A;  3QH9 A;  5KDM C;  1OED A;  5AQO B;  3O1J A;  4LF6 T;  4COF A;  2WPQ A;  2RA1 A;  5KXJ A;  3KVB A;  4UEM A;  1YTZ I;  2OAR A;  1M56 D;  1WRD A;  5DJU B;  4IRE A;  1J2J B;  5CMZ A;  2WT7 A;  3HTK B;  2NPS B;  1LT1 A;  4LFA T;  4X5T A;  2XV5 A;  1FC2 C;  2YIU B;  1S94 A;  5KLV J;  1YW0 A;  3UT5 E;  4GKJ T;  2FJA A;  2CMR A;  2IZ0 A;  3H3A A;  4DR7 T;  5CJ5 A;  1BR4 A;  2BEQ D;  3K5B A;  1WT6 A;  3HTK A;  2OLT A;  2V7Q H;  1RF0 A;  2NPS A;  3SS1 A;  4X1I E;  2PP6 A;  2KYV A;  3F89 A;  1AJY A;  4GIW A;  1N36 T;  1HS7 A;  4HFI A;  5KKZ B;  3V2N A;  2H7O A;  4OFZ A;  3AEF A;  2KLQ A;  2KK7 A;  2IBZ D;  2A06 E;  3L36 A;  3HKB E;  2GM4 A;  2GK9 A;  4AUW A;  1PP9 G;  3AEA C;  5AW9 B;  1OWA A;  3AEB A;  4XE5 B;  2CK3 H;  1VF5 D;  2X9Y A;  1RE4 A;  1KYO I;  5JDG A;  5CB4 E;  3S9O A;  1WLX A;  4JI2 T;  4CI1 B;  1LKX A;  3Q2Y A;  5LOV E;  4DUY T;  3V5B A;  4AYC A;  3RGL A;  2ZVO B;  4ZI2 D;  2X9H A;  3ZJ1 A;  3L74 D;  3MXZ A;  4JI6 T;  1SQP G;  3VKG A;  2QG4 A;  3ZT5 A;  4DT0 A;  4MBQ A;  1NTK D;  4G63 A;  1J5W A;  3BQL A;  1SQQ J;  4HTE A;  3MHV A;  3TLS A;  3H1I D;  1GDT A;  1PIX A;  3AEE A;  4LML A;  2KZI A;  4AIU A;  2KXP B;  5TIS E;  3WU2 H;  2M6I A;  3RYC E;  2KIK A;  3JSV C;  1HJB A;  3PUW F;  3FZF B;  5FNV E;  3H1K G;  1KNR A;  1OED C;  3II6 A;  2N1T D;  2KZJ A;  2V7M A;  3TLV A;  4K0U A;  1MZ9 A;  1YKH B;  2IUB A;  4H9R C;  1L2P A;  1HF8 A;  5C2T A;  3AEG A;  4O4I E;  5JDQ A;  2ZVN B;  4H44 B;  4CXY A;  2M3E A;  4QH4 A;  1LJ2 A;  2WMM A;  5L3F B;  5KAF H;  3H1L G;  3CCM P;  5CFB A;  3OJA B;  4AKL A;  2GA1 A;  3L71 D;  3Q5D A;  3VR9 A;  2ES0 A;  1RF0 C;  2NPS C;  1EDI A;  2K24 A;  4HE8 A;  3SWY A;  1NTM J;  4XZC A;  4CN4 A;  1SQQ K;  2YIU C;  4KX6 A;  3AEF C;  5BVZ A;  3OJA A;  3AEC A;  1T8B A;  2NWB A;  3P50 A;  5A1L A;  2YDS A;  1SVF A;  2J59 M;  3AEB C;  2JKV A;  5LG4 A;  5KKZ C;  3N2G E;  1T72 A;  1RE4 C;  3ITK A;  2GUS A;  1VPC A;  1YTZ T;  3L72 G;  4U7I A;  3I56 P;  1VQ4 P;  3U1A A;  1FDO A;  1IJD B;  2XM1 A;  2A06 D;  2YN6 A;  3WAK A;  5CGM A;  3VN0 A;  4QKN A;  1GMJ A;  3OBV E;  1D1C A;  3TLW A;  2BVL A;  2LE8 A;  1HNX T;  4H9O C;  2ZM0 A;  3NKZ A;  4C90 A;  5H2F H;  2W90 A;  3RF1 A;  3CQG B;  3I9Y A;  4WW0 A;  3AEE C;  1IAP A;  1SE7 A;  2HN1 A;  2WDR A;  3ZEF B;  5E0O A;  1R5S A;  1FMV A;  1FEW A;  1USD A;  2XND H;  3FHN A;  2DL1 A;  1Q81 Q;  2ZM8 A;  3HL6 A;  3UTK A;  5ADX L;  4K0K T;  1WMK A;  1IFP A;  2I1K A;  5FXW A;  2V4H A;  4I55 E;  1DEE G;  3H32 B;  3HD7 B;  2FFD B;  1PV3 A;  5FMN A;  1BE3 G;  2M6B A;  2KSR A;  2KUB A;  3KFW X;  1SFC D;  4H44 C;  4H13 D;  5CHX A;  1NH4 A;  3C50 A;  4MAL A;  1VQP P;  5L4H A;  1NTZ K;  4WVZ A;  3FXD A;  3H32 A;  2FFD A;  3HD7 A;  1ZP0 A;  2IDB A;  1RHZ B;  1CHU A;  3G4S P;  1DX7 A;  4PV1 B;  3AEC C;  3VMZ A;  4H0L B;  3I0O A;  3UU3 A;  3Q1M A;  2CWO A;  2CPT A;  4ASW A;  3N4X A;  1SQB G;  3G71 P;  2BKP A;  3NXS A;  1W0A A;  3RK2 D;  4JUY A;  5GTH H;  1XDP A;  3KXD A;  2QEX P;  3CLQ A;  4EOZ B;  3IN6 A;  1YJW P;  2RMZ A;  2M0B A;  4KT0 J;  2JMK A;  2RN0 A;  2KIN B;  3MP7 B;  2KMF A;  5BR8 T;  3OTO T;  1L0V A;  2VL0 A;  1SS1 A;  2YXR B;  5CCG D;  2W2U A;  3H1J J;  4LLH A;  4LF9 T;  3T1Y T;  2ACZ A;  4B3R T;  2H89 A;  4Q25 A;  4CXW A;  1J1J A;  3D6Z A;  3AE7 A;  1QL2 A;  5LGN B;  4QXC B;  4AIS A;  4Z90 A;  2ITA A;  1NKN A;  4UB8 H;  2BS3 A;  3UUX B;  2W67 A;  1VQ6 P;  3M91 A;  4A5X A;  4UVA B;  2UWJ E;  3SOL A;  2VVN A;  2ZMA A;  1KN7 A;  4H9N C;  3L72 E;  1FS0 E;  2QJY B;  4U3F J;  5H6Q B;  1YQ4 C;  1L0L K;  1N8R Q;  4PAG A;  3CCL P;  2FYU E;  1HX8 A;  4XAX B;  5AFU L;  2LSK A;  2KNC B;  2HR3 A;  2VRS A;  2K48 A;  1PGO A;  4DND A;  1ZP0 C;  2FFD C;  3HD7 C;  1HR0 T;  4EEB A;  3H25 A;  2WWW A;  3A5T A;  2BG9 B;  2MAW A;  3EWK A;  1VQK P;  3N9M A;  5APU A;  1L0N K;  3PHL A;  3FBL A;  3CXH D;  2YO3 A;  2KNC A;  5AQI B;  3MA9 A;  2E5Y A;  5AVV B;  5JRC A;  3VMX A;  4IL6 H;  1KC8 Q;  2BG9 A;  2VVS A;  4JI3 T;  4OH8 B;  4PV1 C;  5GTI E;  4QMA A;  4H0L C;  1P84 D;  3IF8 B;  2ZYG A;  4HJG H;  3M0A A;  2LM2 A;  4UXN B;  3AAA B;  4PK4 A;  1OW7 A;  5FL0 A;  1BGY E;  4B6X A;  3W15 B;  1EZV D;  2D2C D;  5AQJ B;  5DJQ C;  4UV8 B;  4QH5 A;  2I59 A;  1VQL P;  2M67 A;  3EAB A;  2IDO B;  1BE3 E;  1SQX G;  4R4M A;  2IC9 A;  4HKA A;  5KX5 E;  2H89 C;  3BAT A;  4BJM A;  1IFD A;  1SP4 A;  1VQ5 P;  4YTN A;  1BR0 A;  1JNM A;  1N7S D;  3AE7 C;  1D1B A;  3AE6 A;  3QB5 K;  2UUA T;  1S1C X;  3CWZ B;  4IL9 A;  2YXQ B;  3BCC E;  4W80 A;  2I6H A;  2IFM A;  1BDD A;  2UUB T;  5LB7 B;  3SWH A;  2LKM A;  3RK3 B;  1QUU A;  1SQB E;  1NTZ D;  1KB9 I;  4MFR A;  3FGA D;  4IDQ A;  3SRZ A;  2XQ6 A;  3P7I A;  3DJB A;  3CWB J;  2DCF A;  4PFP A;  4QX7 B;  4XBF B;  2DLR A;  3C9I A;  1VQO P;  1S5L X;  4A56 A;  3UQ7 A;  3A8Y C;  3FB2 A;  1YI2 P;  3UU5 A;  3PUY F;  3R2P A;  2WSC H;  1OVU A;  3CCQ P;  1G73 A;  3G6E P;  2X51 A;  4BJN A;  2QJY C;  2JJ9 A;  3CCU P;  1A02 J;  2V5C A;  1YJ9 P;  4WBA A;  2DW3 A;  4NPD A;  4Y28 J;  3A5X A;  2FYU D;  3GA8 A;  1KFN A;  2W66 A;  2R6G F;  2YOE A;  2E9X B;  5FXV A;  2WU5 A;  2R3C A;  1W2B O;  1URQ D;  2WS3 A;  2EHO B;  3HI2 A;  4UIG A;  4PJL A;  4JV5 T;  3AXJ B;  3NZQ A;  2BG9 C;  3A2A A;  1H7C A;  1IK9 A;  5AW0 B;  1BR2 A;  4NPE A;  3LG7 A;  2F4V T;  1EXI A;  1JY2 N;  1KYO H;  1BSH A;  4BAY B;  5HXC A;  1HFA A;  2EHO A;  2WB5 A;  3P4Q A;  3AXJ A;  2HPJ A;  2XQ7 A;  2IBZ G;  2V6X A;  1EDJ A;  3WU2 E;  1EDL A;  4C91 A;  2YEV C;  2E8I A;  1NU1 K;  2GUV A;  3FZM B;  2R5D A;  5LJM A;  1KIL B;  2W8Z A;  5FP3 A;  4EGW A;  3CQX C;  2YMY A;  2CRB A;  3AE6 C;  1BGY D;  1ZKE A;  1L0L D;  3OA7 A;  4HWC A;  2CE7 A;  1Z8U A;  3PP5 A;  3U59 A;  1ZLL A;  2V7J A;  4U2Z A;  3L74 G;  5KAF E;  1KIL A;  4PD4 E;  1BE3 D;  4PK5 A;  3MTU E;  2KWI B;  4BRY B;  1NTK G;  3AVR A;  3H3M A;  4HYT B;  1K8A Q;  2DNX A;  4I6M C;  4GKK T;  3AAE B;  1H89 A;  4YXD A;  3BCC D;  4B3M T;  1KQS O;  2M3B A;  3PLN A;  3RK3 C;  2LLY A;  3GN5 B;  3A0H H;  4RES B;  4BRY A;  2LEH A;  1SQB D;  4JYA T;  2N9Y B;  5L3D B;  4X1Y E;  1LWU B;  1MFT A;  4MN4 C;  4FJO A;  1S9K E;  3HR0 A;  3VHL A;  3RKG A;  1SQX E;  3KBU A;  2PBI A;  1UUS A;  3RLF F;  3GN5 A;  1MND A;  1LVK A;  2VQE T;  1JY2 O;  1EQ7 A;  5LMN T;  2FXP A;  1LWU A;  1JCD A;  4LF4 T;  2JEE A;  4I4T E;  1Q82 Q;  2OYI B;  4CN1 A;  1HGV A;  4L75 A;  1VQ7 P;  2Z5I A;  2WTY A;  5CA1 E;  1JO5 A;  3CCJ P;  1L4A D;  4Y99 B;  3L71 G;  3SSU A;  5C3J A;  2E74 B;  4AQR D;  3BRV B;  1HNW T;  2QRX A;  2B89 A;  4ZZB A;  3CCE P;  3RL0 D;  3WMM 0;  5CJ0 A;  2CA5 A;  2D5U A;  5H2F E;  2E9X C;  2W63 A;  5CCH A;  3E08 A;  2EHO C;  3ZSS A;  3MZW B;  2ZM6 T;  5KLI B;  5AW3 B;  1RQV A;  1OED E;  2ACX A;  2XQ8 A;  1SQV J;  2WPR A;  2OA5 A;  3QB5 A;  3L74 J;  2NW7 A;  2V8S V;  2R32 A;  2WBL A;  3RH3 A;  5L3G B;  2E75 D;  4ANJ A;  4DV1 T;  1HWT C;  2UU9 T;  3LK2 B;  2FY8 A;  2LR2 A;  1HG5 A;  2QA7 A;  2A06 G;  3H1I J;  1YD8 G;  2NR4 A;  3V6I A;  4B3T T;  1KIL C;  4A7P A;  2IHR 1;  4ADZ A;  2IIU A;  1G2C A;  3FZL B;  5L2L A;  4X64 T;  3Q2M A;  3LIE A;  3Q5S A;  2X0Y A;  1LVF A;  1VCS A;  3JAE A;  1IBL T;  4JPZ B;  4YXD C;  1IFI A;  3FX0 A;  3CC7 P;  3RPU A;  4IFF A;  2XQ4 A;  5HXS A;  3O6Q B;  1X9B A;  1XMQ T;  1R8E A;  2WZI A;  4KBM B;  4PK6 A;  2HH7 A;  1NEN A;  2A3D A;  2W0G A;  1SQV K;  4DV0 T;  4AQG A;  4ZOL E;  4TWH A;  3FWL A;  1LRZ A;  5L3E B;  3JCF A;  3O6Q A;  5AW1 B;  2VL8 A;  1FMW A;  1WR6 A;  2JJL A;  4HN9 A;  1HGZ A;  2R5B A;  3LDQ B;  3LK4 2;  3MGN A;  3RBX A;  1LWU C;  2CPB A;  3MZK B;  1UK5 A;  2LRK A;  1S72 P;  3TSI A;  4WY4 D;  3S4U A;  1S9K D;  2JQQ A;  4IFD K;  4YJ3 E;  3K3Q C;  1NKZ B;  5FXZ A;  4ZHQ E;  5AQP B;  2WSE H;  1JY3 P;  1HNZ T;  1GK6 A;  1JTH B;  4CQI A;  2OYI C;  4I50 E;  5CCH C;  5L47 A;  4Y99 C;  2WIT A;  3ZDM A;  2E74 C;  2P2U A;  2AEJ A;  2FJD A;  4I7Z B;  3CX5 I;  3CC4 P;  1JTH A;  1YIT P;  4KP3 C;  4IFM A;  2IZ1 A;  5KLI C;  4GK5 E;  3EAM A;  4PJ0 H;  4QXB B;  1IFJ A;  2WSF J;  3A7O A;  3C64 A;  4ZI3 C;  2A9U A;  2HFE D;  3OVU A;  5HAX A;  4L5G A;  1UCU A;  2WWV A;  3AA1 B;  5H6R B;  3D0T A;  4GKG A;  2CHN A;  4DBR A;  4J2C A;  5JQG E;  1V9D A;  4LMK A;  3PDY A;  5HEG A;  3CCV P;  1LP1 B;  1OVR A;  3TNU B;  3L71 E;  3LBX A;  3ONJ A;  1IO4 A;  1AV1 A;  2QGS A;  1CI6 A;  1J5E T;  1R8I A;  4ASV A;  2K88 A;  4F6R C;  5AW7 B;  4H63 V;  2NPS D;  1LP1 A;  1QVG O;  3TNU A;  2WAU A;  3ZT6 A;  2BBH A;  1UGO A;  4RO0 A;  5JH7 E;  5AVZ B;  2MKV A;  1BCC E;  1ZOY A;  2BCC E;  4QWN B;  2KLV A;  1U4Q A;  2JQ9 A;  3ZLI A;  3RL0 g;  2XQY A;  1M1K Q;  1XDO A;  3T1H T;  3CIR A;  2BS2 A;  3JC2 2;  3L4F A;  2CPS A;  4IDO A;  4ZS2 A;  5HCJ A;  4U7J A;  2YIN A;  2P58 A;  1HBW A;  3S4R A;  2CCQ A;  3LJC A;  3RKO A;  2Y9Z A;  2W6A A;  2A45 G;  3VU7 H;  4HFB A;  4XA4 A;  5APV A;  4ZI7 E;  1PZQ A;  4U2Y A;  3MKD A;  4EI2 A;  2X9W A;  2WDQ A;  3QNU A;  4JI4 T;  2SPZ A;  3ZPO A;  3IFM A;  1FZE A;  1G8X A;  3PRJ A;  5KLV K;  3ETU A;  2OTK E;  2VWA A;  4IIJ E;  1MIY A;  1KQG B;  5AQM B;  3AA0 B;  2XDJ A;  5GON E;  1KNZ A;  3HKE E;  5FKY A;  1VQ9 P;  4AKH A;  3TGU E;  4IST A;  4I7Z C;  5FXX A;  1MUU A;  3AA6 B;  2N9D A;  2K37 A;  4I1L A;  2IC6 A;  1EZV G;  3C4Z A;  4JBZ A;  2KND A;  4X1K E;  2NP9 A;  2AEM A;  2H8P D;  2ODV A;  4DV5 T;  4D6T G;  2WM9 A;  2SPC A;  2LHN A;  2DI4 A;  2YK0 A;  5IHY A;  3NTN A;  3V2P A;  3VMY A;  2JRK A;  3NVO A;  3Q5X A;  3UU6 A;  4LF5 T;  1KB9 H;  3U3I A;  3OYX A;  5KMG P;  2C9L Y;  1PGJ A;  1UUR A;  2XAQ B;  4EB6 E;  4HFE A;  1QL1 A;  3AVS A;  4TWF A;  2PFX A;  1UX4 A;  2KSE A;  2WSS V;  2XY8 B;  2VKO A;  4TWD A;  1ZR2 A;  2R44 A;  2IYP A;  3JAF A;  4O4H E;  1ZOY C;  5M4Y A;  3L73 E;  1RE3 A;  3JAD A;  1PP9 J;  1NTZ G;  1K05 A;  5FL1 A;  1T6A A;  3H6P A;  2XSB A;  5APQ A;  3R6N A;  1GD2 E;  2JMH A;  3K1S A;  4GOD A;  5KJ7 A;  1CUN A;  2OQQ A;  3E7K A;  1KYO E;  2L9Q A;  1MNE A;  4CXX A;  4ILC A;  3M0D A;  1QSD A;  4LMJ A;  1BCC D;  4IDP A;  2BCC D;  3P8M C;  1SQP J;  2Y0E A;  1WYC A;  4H9Q C;  1AA0 A;  3HRN A;  2Z5H A;  1WYB A;  2Q9I A;  2KZ7 B;  2JR8 A;  1KMI Z;  4QHO A;  2WQY A;  3IA3 A;  1YXR A;  2FYU G;  2BZB A;  5JR9 B;  2ZFC A;  1S5L H;  3VKH A;  3R84 B;  2LSJ A;  2BVM A;  1DH3 A;  3H37 A;  3P7K A;  3H1K J;  3CX5 D;  1NTM K;  5JR9 A;  2Q7C A;  1SQQ E;  1FE6 A;  4EDF A;  4GYR A;  2JIW A;  1SUM B;  2L8K A;  5ABH A;  1VRB A;  1K9M Q;  3H1L J;  3RIF A;  4IE7 A;  3ABV A;  3KQG A;  3BQI A;  4WBO A;  3A0H E;  1N33 T;  1SQP K;  1X8Y A;  2XAJ B;  2C5J A;  1KQL A;  5HWY A;  3TGU D;  1SLQ A;  3M3Z B;  1ZN5 A;  3USS A;  1BGY G;  5ABE A;  1L0L G;  3V4W A;  1YQ4 A;  2BG9 E;  4AXP A;  4CZZ B;  3CXH E;  3HD7 D;  3RI5 A;  2UXD T;  4W7Y A;  3N9N A;  3P4P A;  1RE3 C;  3GMI A;  4QX8 B;  1OXZ A;  5AW2 B;  4E7Z A;  5FVK A;  5HCM A;  4ILU A;  2E43 A;  4YHJ A;  2NRG A;  2YNY A;  2VKH A;  1P84 E;  3BCC G;  3D70 A;  2OTJ P;  4OWF A;  3L72 J;  2YU2 A;  5KJ7 C;  3AE3 A;  2Q5U A;  3RBZ A;  4PJN A;  4IOI H;  4PV1 D;  5KLV D;  4H0L D;  5J0Z A;  1EZV E;  3M0D C;  2KWH A;  2O1J A;  2M5A B;  3L73 D;  1LTS C;  4Z1M H;  2X66 A;  1CZQ A;  3AE2 A;  5LMU T;  4KHP T;  3ESL A;  1DU2 A;  4M3L A;  4D6T E;  3GF3 A;  3AE8 A;  3CCR P;  3W68 A;  1R5L A;  2QYW A;  2HPL A;  2VKJ A;  1KYO D;  2FYZ A;  2WQY C;  3L39 A;  2M5A A;  4ILB A;  2QVA A;  5DQV A;  2X9X A;  1FZF A;  5FVL A;  1PGP A;  1Q7Y Q;  1LNQ A;  3HKD E;  4KI0 F;  4JF7 A;  3WUU A;  5FY7 A;  4IDN A;  4EOT A;  5BMV E;  4LFB T;  5FY0 A;  3RK3 E;  1NTZ E;  3OW2 O;  5JR9 C;  2LKH A;  2O01 J;  1VQN P;  2PTF A;  5AVR B;  2JDI H;  4DUZ T;  2DHR A;  4TZ4 C;  2OYH B;  3ABV C;  3L35 A;  1XTC C;  2IML A;  2H3R A;  3SWK A;  5BU8 B;  1BE3 J;  3P4S A;  5KTB A;  3WAJ A;  2CBJ A;  3LSV A;  1SQQ D;  3LID A;  2MPK A;  1AFO A;  2OYH A;  2E5L T;  4P09 A;  2Y48 B;  5HXR A;  3O1H A;  2DWK A;  3CQC B;  1WR0 A;  4KHZ F;  1QEX A;  1UIX A;  3GF7 A;  1SQB J;  2HYN A;  1JNZ A;  4GOE A;  3U1C A;  5APY A;  2V5D A;  2JO1 A;  1NYH A;  3K3O A;  2WZ7 A;  2Y0C A;  4TV9 E;  4DO0 A;  3AE3 C;  3WUT A;  5IYZ E;  3HUS B;  1MIV A;  3PU8 A;  5HEO A;  2UXX B;  2CHO A;  4A98 A;  4JLE A;  3VRB A;  5DJT B;  2X68 A;  3AE2 C;  1PL5 A;  4WWI A;  1OZH A;  1ZEE A;  3AE8 C;  5LHG B;  1NTM D;  5CBO A;  3HUS A;  1GL2 B;  1ZV8 A;  3IF4 A;  2IPP A;  1HX1 B;  3ZMS B;  2XTL A;  2ZM2 A;  3E0Z A;  4PJ0 E;  3V5U A;  1KIL E;  4TUY E;  1X22 A;  4QXH B;  2C5K T;  2HOD B;  4YY3 T;  1XZY A;  1L0L E;  5JVD E;  1VQ8 P;  1BSN A;  4TT3 H;  2C5I T;  4OVN F;  1GL2 A;  3HE5 B;  4D6T D;  1FDM A;  3JCU H;  2JWD A;  3CX5 H;  3H1J E;  4EXT A;  3P4R A;  2O3J A;  2HOD A;  4ZKP A;  3SWF A;  2C0S A;  2ZAE B;  5LYJ E;  4HFH A;  2AXC A;  4UVB B;  3HE5 A;  2D2C B;  3A3Y B;  1L0N E;  3PUR A;  3UFG A;  1OFC X;  1NO4 A;  5K5G B;  4DBQ A;  4NUU A;  2HHH T;  1J1E B;  3PUV F;  1YKE B;  1FJG T;  1JNR A;  2Q9Q B;  3CPZ A;  4TNW A;  4A97 A;  1RQU A;  2Q6Q A;  2HPC B;  3Q5R A;  1MIW A;  3RK3 D;  1K73 Q;  3I0Q A;  1IFN A;  4H9S E;  3PUG A;  1PGQ A;  1S3J A;  3ZCI A;  2UUC T;  3A0B H;  4N6J A;  4U72 A;  4IE6 A;  2OYH C;  2VKD A;  3NFQ A;  2I1J A;  2VAS A;  3C8V A;  1FZC B;  1QLE D;  2Q9Q A;  1X9V A;  4U3F E;  3TDK A;  2HPC A;  4TV8 E;  2NTY A;  2KP8 A;  4ZZC A;  1LTG C;  1KF6 A;  2XQA A;  1IZN B;  2XQ5 A;  4O8S A;  4JBW F;  4KMC A;  5DAB A;  3B5N B;  1OIP A;  2KT9 A;  1FZC A;  4G2A A;  5FY1 A;  5LBM A;  4FI5 A;  2C0W A;  3OAK A;  1HG2 A;  2D9D A;  4PD4 I;  2O1K A;  2ZT9 B;  2L3L A;  3DTO A;  5HXH A;  4YLH A;  3B5N A;  2XAG B;  4NIQ A;  5B66 H;  4OGQ D;  4ASK A;  3U78 A;  3DP7 A;  2EHO D;  2IX7 C;  5LXT E;  1MKM A;  2JWA A;  3HUS C;  4ZXL A;  1SQX J;  2YU1 A;  4O4L E;  4AKI A;  5AQT B;  1XMO T;  2E9X A;  4ERR A;  5F3J A;  3C98 B;  4EV6 A;  4YSX A;  5JRE A;  3AE1 A;  5AW4 B;  3V5S A;  2IW5 B;  1JEK A;  2LJL A;  4GOF A;  3ZYK A;  3AB3 B;  1GL2 C;  3HKC E;  1W9R A;  4JEH B;  3RQU A;  2FXM A;  1FDI A;  2E76 B;  1KIL D;  1T8Z A;  4H63 H;  3RHW A;  3FZK B;  5AQU B;  1KB9 E;  3CMA P;  1HCI A;  1E5W A;  2E5V A;  2FUP A;  1ZR4 A;  1NAY A;  2YKO A;  2QM7 A;  3H1J D;  4IT4 A;  3I9W A;  4NXM T;  3KPE A;  3UU4 A;  1JUN A;  5APT A;  4TNV A;  4JI7 T;  2B88 A;  2D2C C;  3TYY A;  1J1E C;  1N7L A;  4YTM A;  2QIW A;  5LHH B;  1L0N D;  2Q9Q C;  1Z56 A;  3T97 B;  3KYQ A;  4PNI A;  2BEZ F;  5JDN A;  3E1R A;  4HEA A;  1AVY A;  5LGT B;  1X79 B;  1NVO A;  2KLU A;  2NOX A;  4EAH A;  4R4L A;  5EZY E;  1FZC C;  1NU1 E;  3MUD A;  5AQF B;  2P7J A;  3T97 A;  2MTQ A;  1B7T A;  1HTJ F;  2G8Y A;  4BA9 A;  4U3F D;  3PUX F;  1X79 A;  2RP4 A;  3L70 E;  1EXJ A;  3B8E B;  4AKG A;  3B5N C;  3FXE B;  1RF1 B;  1KQF B;  5CCH D;  2HLO A;  4KUM B;  3W67 A;  2P1J A;  1E1H B;  2E74 D;  2AEF A;  2ZT9 C;  3EVY A;  3F5H A;  2X67 A;  1JCC A;  3ETV A;  2OYI A;  2UXB T;  3FXE A;  3TF5 A;  1RF1 A;  2IBZ I;  3PV0 F;  5EFW B;  3AE1 C;  3PJA J;  1N34 T;  2XSA A;  4YHH T;  1NJI Q;  1PPJ E;  4YJ2 E;  1G1J A;  3AE4 A;  4JI5 T;  4ZI3 D;  1BCC G;  2N2N A;  2BCC G;  5LG3 A;  1IBM T;  4HH2 A;  3B57 A;  3HA4 A;  4YSZ A;  1NTK J;  2I0M A;  4JQ0 D;  1IBK T;  2P9B A;  2AE9 A;  1FZG A;  1YYC A;  3GW6 A;  3M06 A;  4YT0 A;  1NGM B;  1W0B A;  1LTA C;  1OMI A;  3F2E A;  3UQ4 A;  4HKZ H;  2E76 C;  2LSI A;  4JI1 T;  5AQL B;  1SHZ C;  2ZLY A;  1T7S A;  4TX5 A;  4NXN T;  2OYO A;  3WUV A;  2B1E A;  1NHL A;  4AQY T;  2K5B B;  1FIO A;  2V7I A;  1KB9 D;  2FYN B;  5AQK B;  2JPF A;  3J7Y q;  4DV4 T;  3Q5W A;  3VRA A;  5EK3 A;  3BAS A;  1LGH B;  3L8R A;  1YIJ P;  5E79 H;  2CM0 A;  1WRG A;  2Q3I A;  3L71 J;  3MUD C;  4I0U A;  3VR8 A;  3CC2 P;  1OVV A;  1NTK K;  4HB1 A;  3TGU G;  3CWB D;  1US7 B;  5GTH E;  1HTL C;  3RC8 A;  3L75 E;  1J1D B;  3KV4 A;  1QX8 A;  3KV5 A;  4IE5 A;  3ZN0 B;  3ONL C;  4GYS A;  1MMN A;  5AQN B;  1NU1 D;  3VTP C;  4ISS A;  4GK0 E;  2NW8 A;  3K3N A;  1O3X A;  1T3U A;  2WCA A;  3NMD A;  4HFD A;  1Y64 B;  5LGU B;  3EHZ A;  1RF1 C;  3L70 D;  3P32 A;  3NZP A;  4EZ4 A;  1S4X A;  1D0Z A;  5KLV G;  3AE4 C;  4WY4 B;  2LHR A;  4AQF A;  4DMW A;  3VP8 A;  4EIW A;  4UV9 B;  3C4X A;  1DEB A;  3L73 G;  1SQV E;  1KD1 Q;  5TJH A;  1UII A;  3MD0 A;  3EDV A;  5LJN A;  3O4X E;  4O2B E;  4UB8 E;  2XQ3 A;  2XAH B;  3D6Y A;  2H7H A;  3M65 A;  2CBI A;  3X1D A;  4PJJ A;  2QA4 P;  3NWI A;  1PPJ D;  1XNR T;  3KBT A;  3RYH E;  2ZYD A;  2WMN A;  4W7Z A;  3N9P A;  2YMK A;  2LSY A;  3G06 A;  1D0X A;  2VB6 A;  4X62 T;  1TU3 F;  4IDZ A;  3RC3 A;  3UFE A;  1W09 A;  2H7V C;  2V1D B;  2O01 H;  5L3C B;  2W62 A;  3RGU A;  3I1A A;  1LT9 B;  2VUR A;  2YKP A;  3TGU J;  3C4W A;  3GLM A;  1M7L A;  3A7M A;  1KZU B;  1CW5 A;  4DVD A;  2VQF T;  1X0T A;  3BK9 A;  4O9B A;  3O9X A;  5HEH A;  4L74 A;  4ZNC A;  2JQH A;  1LT9 A;  2FYN C;  1XTG B;  2QJP B;  3VP9 A;  2WSC J;  2OGU A;  3PUA A;  1SQQ G;  4IL6 E;  4JYB A;  3PTZ A;  3ZMT B;  1GZL A;  4DV6 T;  2XU6 A;  4X20 E;  3H1H E;  3EDU A;  5JDM A;  1E7P A;  1DD3 A;  3B5M A;  3LK3 B;  5AQG B;  2KSJ A;  5IWA T;  1T2K C;  1H88 A;  4ILA A;  2BKO A;  3IAO A;  3L73 J;  1J1D C;  2J5U A;  3JCU E;  3O1I A;  5AVW B;  3CX5 E;  3L75 D;  3V2Q A;  1JY2 P;  5AVU B;  4UR9 A;  1VL2 A;  3N2O A;  2QM8 A;  4AQF C;  2W61 A;  3LW5 J;  3KVA A;  1H8A A;  1JMB A;  3HE4 B;  1VF5 B;  1MMD A;  4GT1 A;  1NTM G;  4BXL A;  1LTJ B;  1Q90 D;  3RIU C;  3ZST A;  4WY4 C;  3KV9 A;  2CLY B;  2R3S A;  3C51 A;  3A0B E;  5LHI B;  2UXC T;  3HE4 A;  1U57 A;  3QOF A;  1SQV D;  2DWG A;  4P0B A;  4OK0 A;  1LTJ A;  3CI9 A;  3CKD A;  3PJA A;  4EYY Q;  1MV8 A;  3AE5 A;  1GU5 A;  2KS1 B;  1NOH A;  3D71 A;  2H88 A;  3KZI H;  3ONX A;  1YHQ P;  1M1J B;  4I2L C;  2WDV A;  2P10 A;  2W4X A;  5L4E A;  4H44 D;  2W6B A;  1OW6 A;  1W2E A;  2BS4 A;  1Y01 A;  2J4G A;  2PFV A;  3JC6 C;  1GU4 A;  5AQV B; 
#chains in the Genus database with same CATH homology
 1LT9 C;  1M1J A;  4EYY R;  5KJ7 D;  1AJ3 A;  2N9B A;  2N1T B;  3CVR A;  2D0U A;  3RYI E;  3MK7 C;  4JYC A;  1D0Y A;  4IHJ E;  3GHG B;  3M9B A;  3V2R A;  2C0X A;  2A45 I;  2N1T A;  3OYZ A;  1FJK A;  4ZKU A;  1EZ3 A;  1GK4 A;  4ZS3 A;  3GHG A;  3N2K E;  2Y6X A;  3KDP B;  2WWU A;  5JDF A;  2W00 A;  1GW4 A;  3V4Q A;  1KK7 A;  2XKM A;  2G0U A;  4JEU B;  1LTJ C;  3T8O A;  1VDF A;  2CLY C;  3ZCJ A;  4AKR B;  5AVT B;  3E1I A;  3WI3 A;  2XAS B;  3ZMU B;  3KV6 A;  4ZI2 C;  3KDS E;  3CX8 B;  2X0L B;  2NTX A;  3PE0 A;  1NWQ A;  2MBG A;  1M1J C;  2LSG A;  5J1G A;  5CA0 E;  2CWY A;  1HH0 A;  1MMA A;  4LC1 A;  5TAO A;  2LT3 A;  5FYM A;  1JMM A;  3E22 E;  3FXD B;  2N1T C;  1VOM A;  1ZV4 X;  3RX6 A;  4H9P C;  5J2U E;  1SFC B;  2CXD A;  3ZMZ B;  4OYK A;  3GHG C;  2W27 A;  3QK6 A;  4M1P A;  3I5C A;  3UUL A;  2XAF B;  4C7N B;  1HUC A;  2WPS A;  1SFC A;  2YKQ A;  2E42 A;  1IJ6 A;  4GOU A;  4PFO A;  3RK2 B;  5JDH A;  4N3Y B;  2HG5 D;  4HGA A;  4C7N A;  4EYU A;  2MOZ A;  1T98 A;  1G1I A;  5HWX A;  3ZC1 A;  3J9X 1;  2FYU K;  1D1A A;  2A72 A;  3QUJ A;  4KHX A;  1MFZ A;  4C46 A;  4AI6 A;  5AW5 B;  1CSB A;  4EZH A;  3N7N A;  4E7S A;  1LTT C;  5CCG A;  3EUH A;  2A2F X;  4B86 A;  2MJZ A;  1AQ5 A;  2V7K A;  3PTR B;  2XUE A;  2LOP A;  3IR9 A;  5LA6 E;  3QC9 A;  3RYF E;  3F57 A;  4OHF A;  2P67 A;  3RRW A;  2VK9 A;  4IE0 A;  3EFG A;  3ZN1 B;  2ZXE B;  2POH A;  5DQW A;  1GL2 D;  5JRC B;  5EK4 A;  3N9Q A;  1SFC C;  1SQB K;  4P0A A;  5L3B B;  4MHC A;  1MMG A;  1FZB A;  1JY3 N;  3TK1 A;  2D0T A;  3K8P C;  1FU1 A;  3RK2 C;  1NWM X;  2L5G B;  3NBX X;  4C7R A;  2CEA A;  3CX7 B;  5J2T E;  5AW8 B;  4CI2 B;  2Q9Q D;  2KOG A;  1A02 F;  2WSF H;  5AVS B;  4MLK A;  2LOS A;  1BR1 A;  3BQK A;  1N7S B;  3ZJ2 A;  5CCG C;  5APX A;  4WNK A;  4LGD E;  5AVX B;  4CI3 B;  4YFS A;  5APW A;  2J1D G;  1N7S A;  2IFN A;  3P8C E;  1FOS F;  2LM9 A;  3B5N D;  3IHR A;  3CL3 D;  4L9I A;  5EK2 A;  1N86 A;  3PU3 A;  4DZO A;  2E9X D;  2D2S A;  4I43 B;  2PG8 A;  1FZA A;  1JY3 O;  4N78 E;  5ETW A;  1SA0 E;  1URQ B;  4OYJ A;  4TN7 B;  3F31 A;  1U5P A;  1RY3 A;  1URQ A;  2CXL A;  4U74 A;  3LW5 H;  4V1A v;  1LTI C;  2FKW B;  3CX6 B;  3BVH A;  1SQX K;  4IGU A;  3TKL B;  3B13 A;  4WBN E;  1FBM A;  3PUS A;  1S35 A;  5HXE A;  2C9N Y;  2BDE A;  1N7S C;  3BRT B;  3MJX A;  3ANW B;  3AAI A;  1LTB C;  1ZHC A;  1N73 B;  3ZMV B;  5LNK A;  3P8C D;  1Z0P A;  2A45 H;  3KIN B;  4UF0 B;  2J58 A;  4L0R A;  3ANW A;  1KFM A;  2CXF A;  3MAC A;  1N73 A;  1FOS E;  2XHE B;  3FBZ A;  3L37 A;  4UF0 A;  2WMO A;  3IBP A;  5APS A;  1IJ5 A;  1L4A B;  3M9Q A;  4Z8X A;  4IE6 A;  1GW3 A;  3RL0 B;  2PJQ A;  3GWH A;  4N78 D;  5AVY B;  1URQ C;  3EQ2 A;  4EIJ A;  1L4A A;  5CJ4 A;  2N1G A;  1IC2 A;  5LP6 E;  2PAJ A;  3ZC0 A;  3G3Z A;  4HFV A;  2V26 A;  1G2C B;  1N2D C;  2YO2 A;  3N5L A;  1UX5 A;  3UUN A;  2KB7 P;  4GIF A;  5HYA A;  3UUM A;  5LBQ B;  5LCY A;  3MIW A;  2IAK A;  3ZYM A;  3RRC A;  3NRX A;  2ODU A;  3Q9D A;  2UXN B;  4DOJ A;  3M9H A;  4PW8 A;  2Z6E A;  1T2K D;  3PUQ A;  2MYS A;  5AVQ B;  2K9A A;  4IE4 A;  1NAF A;  3IEE A;  2M8R A;  4O2A E;  5F8P A;  2H43 A;  1JOC A;  3O8Z A;  5AW6 B;  3N9L A;  1HVV A;  1N73 C;  4O4J E;  5C8Y E;  2BAS A;  4UEL A;  3VOP A;  5BU5 A;  2XZR A;  2Z4E A;  3N9O A;  4UVC B;  4WB4 A;  3VYI A;  3L3P A;  1T3J A;  1GTW A;  3L09 A;  3UIA A;  1PFI A;  2NW9 A;  4WY4 A;  1L4A C;  2XNX A;  3ZYL A;  3OKQ A;  1FAV A;  3RL0 C;  1IFM A;  2Y8D A;  3AA7 B;  4NUV A;  3JC6 D;  4DMV A;  2V7L A;  3LBX B;  1CI6 B;  3LFM A;  3NRY A;  5JDL A;  3CML A;  1FJP A;  2WT7 B;  4PJM A;  5KDM C;  3O1J A;  2WPQ A;  2RA1 A;  3KVB A;  4UEM A;  1YTZ I;  2OAR A;  1WRD A;  1J2J B;  5CMZ A;  2WT7 A;  3HTK B;  2NPS B;  2XV5 A;  3UT5 E;  1S94 A;  1YW0 A;  2CMR A;  3H3A A;  1BR4 A;  1WT6 A;  3HTK A;  1RF0 A;  2NPS A;  3SS1 A;  4X1I E;  2PP6 A;  2KYV A;  4GIW A;  1HS7 A;  3V2N A;  2H7O A;  4OFZ A;  2KLQ A;  3L36 A;  3HKB E;  2GM4 A;  2GK9 A;  4AUW A;  5AW9 B;  1OWA A;  4XE5 B;  2X9Y A;  1RE4 A;  5JDG A;  5CB4 E;  1WLX A;  4CI1 B;  1LKX A;  5LOV E;  3V5B A;  4AYC A;  4ZI2 D;  2X9H A;  3ZJ1 A;  3MXZ A;  3VKG A;  4MBQ A;  4G63 A;  3BQL A;  4HTE A;  1GDT A;  2KXP B;  3RYC E;  1HJB A;  5FNV E;  3II6 A;  2N1T D;  2V7M A;  4K0U A;  1MZ9 A;  1YKH B;  4H9R C;  1HF8 A;  4O4I E;  5JDQ A;  4CXY A;  5L3F B;  3OJA B;  4AKL A;  2ES0 A;  1RF0 C;  2NPS C;  4HE8 A;  2K24 A;  3SWY A;  4XZC A;  1SQQ K;  5BVZ A;  3OJA A;  2NWB A;  5A1L A;  1SVF A;  2J59 M;  5LG4 A;  3N2G E;  1RE4 C;  2GUS A;  1VPC A;  1YTZ T;  3U1A A;  1IJD B;  3WAK A;  3VN0 A;  4QKN A;  3OBV E;  1D1C A;  2BVL A;  2LE8 A;  4H9O C;  2ZM0 A;  4C90 A;  3CQG B;  3I9Y A;  4WW0 A;  1IAP A;  3ZEF B;  5E0O A;  1FMV A;  1FEW A;  3FHN A;  2ZM8 A;  3HL6 A;  3UTK A;  5ADX L;  2I1K A;  5FXW A;  4I55 E;  3H32 B;  2FFD B;  3HD7 B;  5FMN A;  3KFW X;  1SFC D;  5CHX A;  1NH4 A;  3C50 A;  4MAL A;  1NTZ K;  3H32 A;  2FFD A;  3HD7 A;  1DX7 A;  3VMZ A;  3I0O A;  2CWO A;  3N4X A;  3NXS A;  3RK2 D;  4JUY A;  3CLQ A;  4EOZ B;  2JMK A;  2KIN B;  2KMF A;  5CCG D;  4LLH A;  4CXW A;  1QL2 A;  5LGN B;  4QXC B;  1NKN A;  3UUX B;  3M91 A;  4UVA B;  3SOL A;  2ZMA A;  4H9N C;  5H6Q B;  1L0L K;  4PAG A;  1HX8 A;  4XAX B;  5AFU L;  2LSK A;  2VRS A;  2K48 A;  4DND A;  2FFD C;  3HD7 C;  2WWW A;  3A5T A;  3N9M A;  5APU A;  1L0N K;  3FBL A;  2YO3 A;  3MA9 A;  5AVV B;  5JRC A;  3VMX A;  4OH8 B;  3IF8 B;  3M0A A;  4UXN B;  3AAA B;  4PK4 A;  4B6X A;  3W15 B;  5DJQ C;  4UV8 B;  2I59 A;  2M67 A;  2IC9 A;  4HKA A;  5KX5 E;  3BAT A;  4BJM A;  1IFD A;  1SP4 A;  1BR0 A;  1JNM A;  1N7S D;  1D1B A;  3CWZ B;  4W80 A;  2IFM A;  3SWH A;  2LKM A;  3RK3 B;  1QUU A;  4MFR A;  3SRZ A;  3P7I A;  3DJB A;  4QX7 B;  2DCF A;  4PFP A;  4XBF B;  2DLR A;  3C9I A;  4A56 A;  3FB2 A;  3R2P A;  2WSC H;  1G73 A;  2X51 A;  4BJN A;  2JJ9 A;  1A02 J;  4WBA A;  3A5X A;  3GA8 A;  1KFN A;  2E9X B;  5FXV A;  2R3C A;  3HI2 A;  1URQ D;  2EHO B;  4UIG A;  4PJL A;  3NZQ A;  3A2A A;  1H7C A;  1IK9 A;  5AW0 B;  1BR2 A;  3LG7 A;  1JY2 N;  4BAY B;  5HXC A;  1HFA A;  2EHO A;  2HPJ A;  4C91 A;  2YEV C;  2E8I A;  1NU1 K;  2GUV A;  2R5D A;  5LJM A;  1KIL B;  5FP3 A;  3CQX C;  2YMY A;  1ZKE A;  3OA7 A;  2CE7 A;  3PP5 A;  3U59 A;  1ZLL A;  2V7J A;  1KIL A;  4PK5 A;  3MTU E;  2KWI B;  3AVR A;  4HYT B;  2DNX A;  4I6M C;  3AAE B;  1H89 A;  2M3B A;  3RK3 C;  3GN5 B;  4RES B;  2LEH A;  5L3D B;  4X1Y E;  1LWU B;  4FJO A;  1S9K E;  3HR0 A;  3VHL A;  3KBU A;  2PBI A;  3GN5 A;  1MND A;  1LVK A;  1JY2 O;  1EQ7 A;  1LWU A;  1JCD A;  2JEE A;  4I4T E;  2OYI B;  1HGV A;  2Z5I A;  2WTY A;  5CA1 E;  1JO5 A;  1L4A D;  4Y99 B;  4AQR D;  3BRV B;  3RL0 D;  3WMM 0;  5CJ0 A;  2CA5 A;  2D5U A;  2E9X C;  2W63 A;  5CCH A;  3E08 A;  2EHO C;  5AW3 B;  2ACX A;  2WPR A;  2OA5 A;  2NW7 A;  2R32 A;  2WBL A;  3RH3 A;  5L3G B;  4ANJ A;  1HWT C;  3LK2 B;  1HG5 A;  2QA7 A;  1YD8 G;  1KIL C;  4ADZ A;  5L2L A;  1G2C A;  3Q2M A;  3LIE A;  1LVF A;  1IFI A;  3RPU A;  4IFF A;  5HXS A;  4PK6 A;  4KBM B;  2HH7 A;  2A3D A;  2W0G A;  1SQV K;  4AQG A;  4ZOL E;  1LRZ A;  5L3E B;  5AW1 B;  2VL8 A;  1FMW A;  1WR6 A;  2JJL A;  4HN9 A;  1HGZ A;  2R5B A;  3LK4 2;  3MGN A;  1LWU C;  2CPB A;  3MZK B;  3TSI A;  4WY4 D;  3S4U A;  1S9K D;  2JQQ A;  4IFD K;  4YJ3 E;  3K3Q C;  1NKZ B;  5FXZ A;  4ZHQ E;  2WSE H;  1JY3 P;  1GK6 A;  1JTH B;  4CQI A;  2OYI C;  4I50 E;  5CCH C;  4Y99 C;  2WIT A;  2P2U A;  1JTH A;  4KP3 C;  4IFM A;  4GK5 E;  4QXB B;  1IFJ A;  3A7O A;  3C64 A;  4ZI3 C;  2HFE D;  5HAX A;  4L5G A;  1UCU A;  3AA1 B;  5H6R B;  3D0T A;  4GKG A;  4DBR A;  4J2C A;  5JQG E;  1V9D A;  3PDY A;  3TNU B;  3LBX A;  1IO4 A;  2QGS A;  1CI6 A;  4F6R C;  5AW7 B;  4H63 V;  2NPS D;  3TNU A;  2WAU A;  5JH7 E;  5AVZ B;  4QWN B;  2KLV A;  1U4Q A;  3ZLI A;  2XQY A;  3L4F A;  2CPS A;  4ZS2 A;  2YIN A;  1HBW A;  2CCQ A;  3LJC A;  3RKO A;  2W6A A;  2A45 G;  3VU7 H;  4XA4 A;  5APV A;  4ZI7 E;  3MKD A;  2X9W A;  3ZPO A;  3IFM A;  1FZE A;  1G8X A;  5KLV K;  3ETU A;  2VWA A;  4IIJ E;  1MIY A;  3AA0 B;  2XDJ A;  5GON E;  1KNZ A;  3HKE E;  4AKH A;  4IST A;  5FXX A;  1MUU A;  3AA6 B;  2N9D A;  4I1L A;  2IC6 A;  3C4Z A;  2KND A;  4X1K E;  2NP9 A;  2H8P D;  2ODV A;  2WM9 A;  2SPC A;  2LHN A;  2DI4 A;  2YK0 A;  5IHY A;  3NTN A;  3V2P A;  3VMY A;  2JRK A;  3Q5X A;  3U3I A;  3OYX A;  5KMG P;  2C9L Y;  2XAQ B;  4EB6 E;  1QL1 A;  3AVS A;  1UX4 A;  2WSS V;  2VKO A;  1ZR2 A;  4O4H E;  5M4Y A;  1RE3 A;  3H6P A;  5APQ A;  3R6N A;  1GD2 E;  2JMH A;  5KJ7 A;  1CUN A;  2L9Q A;  1MNE A;  4CXX A;  3M0D A;  1QSD A;  3P8M C;  1WYC A;  4H9Q C;  3HRN A;  2Z5H A;  1WYB A;  2Q9I A;  2KZ7 B;  4QHO A;  2BZB A;  5JR9 B;  2ZFC A;  3VKH A;  3R84 B;  2LSJ A;  2BVM A;  1DH3 A;  3H37 A;  3P7K A;  1NTM K;  5JR9 A;  2Q7C A;  4GYR A;  2L8K A;  1VRB A;  4IE7 A;  3KQG A;  3BQI A;  4WBO A;  1SQP K;  1X8Y A;  2XAJ B;  2C5J A;  1KQL A;  5HWY A;  1SLQ A;  1ZN5 A;  3V4W A;  4AXP A;  4CZZ B;  3HD7 D;  4W7Y A;  3N9N A;  1RE3 C;  3GMI A;  4QX8 B;  1OXZ A;  5AW2 B;  4E7Z A;  4ILU A;  2E43 A;  4YHJ A;  2YNY A;  2VKH A;  2YU2 A;  5KJ7 C;  2Q5U A;  4PJN A;  3M0D C;  2KWH A;  2O1J A;  1LTS C;  2X66 A;  1CZQ A;  3ESL A;  4M3L A;  2HPL A;  2VKJ A;  2FYZ A;  5DQV A;  2X9X A;  1FZF A;  3HKD E;  4JF7 A;  5FY7 A;  4EOT A;  5BMV E;  5FY0 A;  5JR9 C;  5AVR B;  2DHR A;  4TZ4 C;  2OYH B;  3L35 A;  1XTC C;  2H3R A;  5BU8 B;  5KTB A;  3WAJ A;  3LID A;  1AFO A;  2OYH A;  4P09 A;  2Y48 B;  5HXR A;  3O1H A;  2DWK A;  3CQC B;  2HYN A;  3U1C A;  5APY A;  3K3O A;  2WZ7 A;  4TV9 E;  4DO0 A;  5IYZ E;  3HUS B;  1MIV A;  3PU8 A;  2UXX B;  4JLE A;  2X68 A;  1ZEE A;  5LHG B;  3HUS A;  1GL2 B;  1ZV8 A;  2IPP A;  3ZMS B;  2XTL A;  2ZM2 A;  3E0Z A;  3V5U A;  4TUY E;  4QXH B;  2C5K T;  2HOD B;  5JVD E;  2C5I T;  1GL2 A;  3HE5 B;  1FDM A;  4EXT A;  2HOD A;  4ZKP A;  3SWF A;  2C0S A;  5LYJ E;  4UVB B;  3HE5 A;  3A3Y B;  3PUR A;  4DBQ A;  1NO4 A;  4NUU A;  1J1E B;  1YKE B;  2Q9Q B;  3CPZ A;  2HPC B;  1MIW A;  3RK3 D;  3I0Q A;  4H9S E;  1IFN A;  3PUG A;  3ZCI A;  4N6J A;  4U72 A;  2OYH C;  2VKD A;  3NFQ A;  2I1J A;  2VAS A;  1FZC B;  2Q9Q A;  1X9V A;  2HPC A;  4TV8 E;  2NTY A;  2KP8 A;  1LTG C;  1IZN B;  4O8S A;  4KMC A;  5DAB A;  3B5N B;  2KT9 A;  1FZC A;  4G2A A;  5FY1 A;  5LBM A;  4FI5 A;  2C0W A;  3OAK A;  1HG2 A;  2O1K A;  2L3L A;  3DTO A;  5HXH A;  4YLH A;  3B5N A;  2XAG B;  4ASK A;  3U78 A;  3DP7 A;  2EHO D;  2IX7 C;  5LXT E;  3HUS C;  2YU1 A;  4O4L E;  4AKI A;  2E9X A;  4ERR A;  5F3J A;  3C98 B;  5JRE A;  5AW4 B;  3V5S A;  2IW5 B;  2LJL A;  3ZYK A;  3AB3 B;  1GL2 C;  3HKC E;  4JEH B;  2FXM A;  1KIL D;  1T8Z A;  4H63 H;  1HCI A;  1E5W A;  1ZR4 A;  2YKO A;  2QM7 A;  3I9W A;  3KPE A;  1JUN A;  5APT A;  3TYY A;  1J1E C;  1N7L A;  5LHH B;  2Q9Q C;  1Z56 A;  3KYQ A;  4PNI A;  5JDN A;  4HEA A;  5LGT B;  1X79 B;  2NOX A;  4EAH A;  5EZY E;  1FZC C;  3MUD A;  2P7J A;  3T97 A;  2MTQ A;  1B7T A;  1HTJ F;  4BA9 A;  1X79 A;  2RP4 A;  3B8E B;  4AKG A;  3B5N C;  3FXE B;  1RF1 B;  5CCH D;  2HLO A;  4KUM B;  2P1J A;  1E1H B;  3EVY A;  2X67 A;  1JCC A;  3ETV A;  2OYI A;  1RF1 A;  4YJ2 E;  1G1J A;  4ZI3 D;  2N2N A;  4HH2 A;  3B57 A;  3HA4 A;  2P9B A;  1FZG A;  1YYC A;  3M06 A;  1LTA C;  3F2E A;  2LSI A;  1SHZ C;  2ZLY A;  4TX5 A;  2B1E A;  1NHL A;  2K5B B;  1FIO A;  2V7I A;  2JPF A;  3J7Y q;  3Q5W A;  5EK3 A;  3BAS A;  1LGH B;  2CM0 A;  1WRG A;  2Q3I A;  1NTK K;  1US7 B;  1HTL C;  3RC8 A;  1J1D B;  3KV4 A;  3KV5 A;  4IE5 A;  3ZN0 B;  4GYS A;  1MMN A;  3VTP C;  4ISS A;  4GK0 E;  2NW8 A;  3K3N A;  1O3X A;  1T3U A;  3NMD A;  5LGU B;  1Y64 B;  1RF1 C;  3P32 A;  3NZP A;  4EZ4 A;  1D0Z A;  2LHR A;  4WY4 B;  4AQF A;  4DMW A;  4EIW A;  3VP8 A;  4UV9 B;  3C4X A;  1DEB A;  3MD0 A;  3EDV A;  5LJN A;  3O4X E;  4O2B E;  2XAH B;  2H7H A;  3M65 A;  4PJJ A;  3KBT A;  3RYH E;  2WMN A;  4W7Z A;  3N9P A;  2LSY A;  1D0X A;  2VB6 A;  4IDZ A;  3RC3 A;  3UFE A;  2H7V C;  2V1D B;  5L3C B;  2O01 H;  2W62 A;  3I1A A;  1LT9 B;  3C4W A;  2YKP A;  1M7L A;  1KZU B;  1CW5 A;  4DVD A;  3BK9 A;  4O9B A;  3O9X A;  1LT9 A;  1XTG B;  3VP9 A;  3PUA A;  4JYB A;  3ZMT B;  1GZL A;  2XU6 A;  4X20 E;  3EDU A;  5JDM A;  3LK3 B;  2KSJ A;  1T2K C;  1H88 A;  1J1D C;  3O1I A;  5AVW B;  3V2Q A;  1JY2 P;  5AVU B;  3N2O A;  2QM8 A;  4AQF C;  2W61 A;  3KVA A;  3HE4 B;  1H8A A;  1MMD A;  4GT1 A;  1LTJ B;  4WY4 C;  3KV9 A;  2CLY B;  3C51 A;  5LHI B;  3HE4 A;  2DWG A;  4P0B A;  4OK0 A;  1LTJ A;  3CI9 A;  3CKD A;  1MV8 A;  1GU5 A;  1NOH A;  3ONX A;  1M1J B;  4I2L C;  2W6B A;  1W2E A;  2PFV A;  3JC6 C;  1GU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...