3P8CD

Structure and control of the actin regulatory wave complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
244
structure length
204
Chain Sequence
GIKNELECVTNISLANIIRQLSSLSKYAEDIFGELFNEAHSFSFRVNSLQERVDRLSVSVTQLDPKEEELSLQDITMRKAFRSSTIQDQQLFDRKTLPIPLQETYDVCEQPPPLNILTPYRDDGKEGLKFYTNPSYFFDLWKEKMLQDTEDKRKEKRKQKQKNLDARSVLLEAIRKGIQLRKVEEQRENDVATILSRRIAVEYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and control of the actin regulatory WAVE complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Cytoplasmic FMR1-interacting protein 1
total genus 57
structure length 204
sequence length 244
ec nomenclature
pdb deposition date 2010-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02205 WH2 WH2 motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3p8cD01
1.20.58.1570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3p8cD02
1X79B 3BATA 5BU5A 4ZKPA 2POHA 4N78D 3N4XA 5BU8B 3P8CD 4O9BA 3U1CA 2JEEA 4GIFA 3U1AA 3HRNA 1NKNA 1IC2A 3VP9A 5BVZA 4N3YB 3VP8A 3OJAB 3BASA 1WT6A 3N7NA 4I1LA 4ZKUA 3U59A 3C9IA 2FXMA 5KTBA
chains in the Genus database with same CATH superfamily
3NRXA 2E5TA 1T98A 2JMHA 1NYHA 5FXXA 5CCGC 4JEUB 2K3RA 4U3FG 2R44A 2A3DA 4HWFA 4PJLA 1HBWA 5AFUL 1M7LA 2W2UA 5AVQB 2PP6A 3PE0A 2WBLA 2N1TA 3ZJ2A 2J59M 3F89A 3L70E 2AEFA 3F57A 4ILCA 3GN5B 5APQA 4HYTB 1CHUA 2YNYA 3L73J 2CRBA 4UB8E 3PUVF 2R3CA 2P1JA 5AVYB 1N73C 2B88A 5M4YA 2YO3A 4EI2A 5HXHA 5ADXL 2R3SA 2LSIA 1KYOI 3UQ4A 1YIJP 4YJ2E 2K1AA 4HTEA 3AAIA 1GW3A 1LT1A 4U3FJ 3CCMP 4KUMB 4PAGA 3RL0D 3RC3A 1KMIZ 4JI2T 1NEKA 3KQGA 3ZN1B 3OBVE 1YXRA 2WS3A 2C5KT 2E8IA 2MAWA 1NU1E 1BDCA 1W5CE 3U1CA 1I94T 2NWBA 3L71G 3OAKA 3UU8A 4H13B 2ZXXA 5CBOA 1BR4A 1EDKA 3RIAA 4B3MT 2JQHA 3AA1B 4H63H 5BU8B 4OGQC 4GYRA 3TDKA 3PUAA 2MTQA 5AW4B 4O2AE 1YJWP 3C64A 1VQ8P 3R4YA 4CN1A 5DJUB 2H88A 2A06E 3RGLA 5FMNA 4U2YA 3ANWA 2X68A 2X9WA 4AQYT 2HFED 1P84D 1NTKE 2YKPA 3AE8C 1X9BA 2KWIB 1IK9A 3SWKA 3MGNA 1MKMA 3AE6A 3UU5A 4N3YB 3WUVA 3CD6P 3N2KE 4CXXA 2WPQA 2O3JA 2Q9QA 5AW2B 1ZHCA 2KSRA 2K9AA 4PJ0E 5CMZA 1U4QA 5KJ7D 2ZM2A 3H1KG 3AEDA 5M1BA 4XA4A 5CCHD 3EI0A 3N9PA 2M6IA 2H43A 4QX8B 1VQNP 3WUTA 4IFMA 1J5ET 2CLYB 4LF7T 3I1AA 1ZOYC 4HWDA 2W0GA 2C9LY 4YPCA 4D6TG 1N33T 4GIWA 2H89A 5GTIH 4AQFA 2CXFA 4UXNB 1FZBA 3N9LA 3AEBC 1N32T 1YITP 2LM9A 4JBZA 3EQ2A 3M9QA 1RF1C 2LOSA 3RYHE 2G0UA 2LE8A 4JPZB 3TLUA 4WY4C 4DCKA 2NPSC 4U74A 2HN1A 1RE3A 3BCCE 2EHOA 1L0LK 3LK2B 3PH0A 2PFVA 3P32A 2QM8A 1CUNA 3VKHA 1URQD 3HD7C 4KMCA 3LIDA 2EHOB 2WPVB 2BKPA 3BCCG 4K3AA 2M3BA 2ZM0A 1J2JB 1VQ5P 2JJLA 2FFDA 2KWHA 3MUDC 2ZYDA 1SFCB 3UIAA 5AQSB 2HH7A 1V9DA 4K0UA 2O1KA 1JCDA 3AEAC 4QWNB 4O2BE 3QC9A 2QE7H 3TYYA 4H13C 4KP3C 4L76A 2HPLA 3CCJP 2N1GA 4YSYA 3CVRA 1LWUA 2YK0A 1FZCC 3UU6A 4ANJA 3RK2D 3AE1C 5E79E 2QYWA 4UEMA 1BE3D 2LRLA 3C4ZA 1RQVA 1KF6A 2YU1A 4H9PC 1DEBA 3CXHH 1NTMG 4E7SA 3V6IA 4QKNA 3KVBA 3NTNA 3NWIA 2IYOA 1JY2N 3RIUA 1GTWA 3A7OA 1J1EC 3H32B 4H9QC 5BVZA 1JNMA 3AXJA 3FB2A 5EK4A 4X5TA 1SHZC 2V8SV 4I4TE 3GF3A 1BGYJ 3JC22 4OFZA 2CBJA 4JV5T 5AVVB 1NJIQ 4JI6T 5F3JA 1MNEA 2V6XA 1S3JA 5FY1A 1J1JA 2GK9A 4K0KT 4ZKPA 1XNRT 5JRCA 4IDOA 1IBMT 1HVVA 2JO1A 5L4EA 2L8KA 3QWOC 2LSGA 2X51A 1FDIA 3B57A 4UF0A 3ZMTB 1BCCD 2RKLA 4U3CA 1JMMA 5AW7B 4DV0T 3A0HE 1ZV8A 1DIPA 1DX7A 2DLRA 3P4RA 2AXDS 4DR5T 2CXLA 2PBIA 2WVRA 3E08A 4BJNA 1SQBD 4DJGA 2C0XA 4DR7T 4KHPT 1D1CA 5AQOB 1VF5D 3PURA 4X1YE 2BDEA 2W62A 1JTHA 3H1IG 3RH3A 4L5GA 2UUBT 3CC2P 1HWTC 4RO0A 3D70A 3D0TA 1AVOA 1SFCC 2NW9A 4JI4T 3TF5A 3NZPA 4H44B 1JTHB 4X64T 2ZVNB 4DV6T 5FP3A 1XZYA 3L3PA 5AQQB 1NH4A 3RYIE 3H1IJ 1WRDA 3IAOA 3GWHA 4YTPA 2BG9B 4GOEA 2CPTA 3HRNA 3FZFB 3TLSA 3J7Yq 2VKOA 3BASA 3ZLIA 4ILAA 4IOIH 3VMAA 2WDVA 3EABA 4AUWA 4JI7T 4H9OC 1NTMD 2A72A 1AJYA 5EFWB 2OYIC 2XNDH 4DV5T 3H3AA 3AE2C 3PV0F 2ZVOB 4C7NB 2K3WA 1EZVI 3H1JE 2J4GA 3O6QB 2E75D 3CWBE 3VMZA 3MZWB 2KS1B 3L75G 2GUVA 1LTGC 2E74B 1N7SD 1LJ2A 2Q9QB 2E9XD 3M06A 2E42A 2KZJA 2X9HA 1BSNA 4L74A 3N9QA 2D2CB 3HL6A 1YYCA 4ZMDA 2YKQA 3CMEP 3EWKA 3OTOT 2MYSA 3GN5A 3A0BH 3G9RA 1MZ9A 1KC8Q 3VR9A 1YJNP 2PG8A 3CPZA 1H88A 3LK3B 1FC2C 1RF0C 3RKOA 2LLYA 2VRSA 4TWFA 2BG9C 2ACZA 3HR0A 4B3TT 3LFMA 4GOFA 4D6TD 2YN6A 5L2LA 4ADZA 3TK1A 4AKRB 5LJNA 3KV6A 1X0TA 3OJAA 2IDBA 4DT0A 4MN4C 3T1YT 2CHNA 2MJZA 5FXZA 5FXWA 4LF6T 1NTKG 3ZYLA 4AQFC 4P0BA 2RP4A 4BXLA 5F5WA 3QNUA 3QOFA 1Y47A 1NOHA 3NMDA 3ETVA 1Q7YQ 1K8AQ 3RYFE 2FYNC 3L72E 1SQPE 2XJ7A 2JIWA 2WCAA 1NTZG 4U3FE 1YKHB 2E9XB 4G63A 2QJYB 3PUSA 2E74D 2LKGA 2DNXA 1KFMA 3AE3C 1SS1A 3P7IA 3USSA 5EZYE 3KPEA 4IDQA 4N78E 2ZT9B 2DHRA 2I6HA 5JRCB 5JDHA 3L4FA 1UX4A 1X8YA 5APUA 1HX8A 2JP3A 5ETWA 3Q5RA 1ZRTD 1SQQJ 4L75A 1DU2A 1R8EA 2KSEA 3LG7A 1MIVA 2FBWC 2JWAA 1N34T 1NTZK 4WBOA 2AEJA 2Y48B 4EV6A 1FJPA 3O6QA 2LEHA 2IHR1 5TAOA 2M3EA 1T72A 1IC2A 3KZIH 3M9HA 1KB9D 3GMIA 4I7ZB 1FOSF 3NZQA 2I0MA 4JEHB 4YTNA 2H7OA 4BWNA 5CHXA 3KXDA 3CWBG 1ZRTE 4HB1A 1YQ4A 2D2CC 4JI1T 3VU7H 2X9XA 4O4JE 1HJBA 2R5BA 4X66T 3E22E 5AQVB 2P58A 3M0DA 3N4XA 1LTIC 3Q5XA 1LNQA 1OVVA 4HKZH 1HNWT 1EDIA 3H1HG 1EQ7A 3ZYMA 3ONJA 2IBZD 1LTSC 4ILBA 2M5AA 3IFMA 4OVNF 3ZYKA 3CXHD 1ZV4X 3PHLA 1ZOYA 4CPGA 2VVNA 3CQGB 3NVOA 5L3DB 2YU2A 3EDUA 1ZW0A 5GTHH 2H8PD 1LTJB 5LMNT 2YO2A 2E9XA 3P4WA 1CI6B 1KB9I 3HKEE 3O1HA 2I1JA 2YMKA 4M1PA 5LGUB 1ZLLA 4YLHA 3SWYA 1JO5A 1QL1A 4D6TE 1YI2P 3A5TA 2FKWB 4C7NA 3ESLA 2HYNA 2Q9QD 3UUMA 2OYHC 1SQQE 2AXTH 2UWJE 3ZT5A 1S5LE 1JY3O 2QG4A 1X79B 3FZLB 5KJ7A 3E1RA 2J62A 4QHOA 3PJAA 1QX8A 3L74J 3HE4A 4H44C 2OYIA 3AA0B 1MUUA 3CQXC 3JAFA 1RH5B 4PFOA 2HR3A 3N2GE 3CCSP 1SQPG 3NXSA 2V6YB 1U7MA 3CPWO 5AQKB 1OX3A 3TNUB 2C0SA 4MBQA 1MFTA 2C0WA 3RK3E 1WRGA 1US7B 3ZMVB 5KMGP 4IL9A 3M91A 3L74E 2X66A 5KKZC 4L73A 4ZZBA 2ZLYA 3AXJB 3TGUD 2VURA 2JR8A 3RK3C 3X1DA 4AKIA 2FJDA 1E5WA 1GK6A 1EZVG 1WYCA 3IBPA 3MTUE 3KZIE 3OW2O 2NR4A 2V7QJ 3FZMB 3EVYA 2BBHA 2VASA 2XSBA 4H0LD 3FGAD 4LF9T 2BCCJ 4W7YA 4NPDA 2PAJA 2OA5A 3QUJA 3L75D 3LSVA 4CXYA 4DOJA 4KI0F 1EC5A 1PV3A 4YXDA 2Y0CA 2E5YA 3S4UA 3TGUE 4GT1A 3CX8B 1NTZD 4PV1C 2KMFA 1S94A 1Z56A 2IBZG 2FYZA 4U72A 5L3CB 4XFJA 1W0AA 5AQIB 2IUBA 4AISA 2V7LA 5APTA 4TNWA 3II6A 1PGPA 3TGUG 1KQLA 2A2FX 3B13A 3M65A 4XZCA 3MP7B 3WMM0 2QVAA 5B66E 2FJAA 1D0YA 5AW8B 5KLVJ 1NTKJ 1T7SA 3K1SA 1MMDA 3GA8A 3AEDC 2G3AA 4EYYQ 2WAUA 2UUCT 2ZFCA 2BBJA 4FJOA 4U33A 5LXTE 4ZZCA 1QL2A 5HEUA 1IJ6A 5LYJE 4X20E 3EDVA 5K5GB 4EEDA 2CHOA 4UELA 3AE7A 3AEGC 3RQUA 3CIRA 3VP8A 1GDTA 4AKHA 3TNUA 2V6YA 3H32A 3RRCA 3TLWA 4L0RA 2HHHT 3ZC0A 3NRYA 1YHQP 2IBZE 2BEZF 2XU6A 3CI9A 3CWZB 4ZI2D 5LG3A 2OTKE 4DV7T 3AE8A 1ZKEA 2PJQA 4UB6E 2PGDA 1D1BA 4HFCA 1Q90D 3BCCJ 1J5WA 1IFMA 3HD7D 4HFDA 5HWYA 4ASWA 3C98B 3GF7A 1I6ZA 5APWA 4TZ4C 4I55E 5LGTB 3L72D 2YINA 2CPBA 3GHGA 4U7IA 4JI5T 3ZC1A 4YSZA 3JADA 4B6XA 1FDOA 3H1LG 1U7JA 1FZEA 4ISTA 1S4XA 4IE4A 2KXPB 1L4AC 1T6AA 3ZCJA 1SQPJ 3A0BE 1FIOA 2YEVC 4WBNE 4JYCA 5HEOA 3AE9C 1RY3A 2W63A 3M0AA 3C50A 4PJJA 2LSJA 4ASVA 1AQ5A 2FJBA 1WLXA 3HKDE 5KLIC 5LHGB 1FZCB 1JNZA 3SWFA 1H8AA 1FBMA 4XAXB 4IL6X 2AE9A 1PGJA 2Z6EA 3FBLA 3ZCIA 2VQFT 3CX5H 5KDMC 4C46A 2Y9YA 2PTFA 2Q1KA 3K8PC 2WU2A 4HFEA 1KNPA 3VTPC 3L39A 1NTMK 1JMBA 1VL2A 1OEDC 1GL2D 4IDNA 1NTZE 2DW3A 3SFEC 4U2ZA 4UVBB 1N73A 1IBLT 4YTMA 1BGYE 5AVRB 3ABVA 4ZI3D 3RIUC 2JWDA 3OJAB 3I9WA 3I56P 3KBUA 4WNKA 4IL4A 1KILB 4Y99B 1MMAA 3CX5D 5FL0A 1JY2P 1AJ3A 3O9XA 3JCFA 1UIIA 2KI7B 1ZR4A 2IX7C 3RC8A 3AECC 2O1JA 5KAIH 1YJ9P 2W61A 1EDJA 5JTGA 1N36T 2E76C 1CI6A 2BEQD 3EFGA 1NWQA 3RBXA 4C91A 2KUBA 4YHJA 3T1HT 1H0TA 1M7KA 4PNIA 1UIXA 5EK3A 3SFDA 4DV2T 5J2TE 4O8SA 1L2PA 1L0VA 2M5AB 4PFPA 1OFCX 2WSFJ 4TV9E 2V7MA 1XWMA 2H7VC 5H2FH 2POHA 1FE6A 1JY3P 2CWOA 5AQHB 4QXCB 5AW5B 1GQEA 3BK9A 4O9BA 4NXNT 3CWBJ 3JSVC 4N6JA 3OPCA 1MIWA 3RPUA 3HD7A 1NU1K 4C7RA 2QA4P 4BAYB 1SQPK 1E2AA 1OEDA 4GDOA 4BA9A 3AE3A 1KN7A 4LFAT 2KNDA 4O4LE 3V4QA 4LGDE 1QVGO 4IIJE 2XQ9A 1MV8A 3RLFF 1FZFA 1P84E 4JLEA 1K05A 4LF5T 3BRVB 4JF7A 1L0ND 1IFPA 3TKLB 3ONXA 2O01H 4ZNCA 5AQGB 1KNZA 1B7TA 1M1JA 1EZVD 3H1ID 2V1DB 3QK6A 1XTGB 2R5DA 3RL0g 3D71A 2IFMA 2P10A 5AQNB 1OIPA 1L0LG 4H9NC 1T2KC 1SQXE 5HWXA 3WU2H 4OGQB 4IGUA 2FYUD 2KINB 2XAJB 2X0HA 4RESB 1ZEEA 4EZ4A 2WZHA 1OWAA 5AW6B 4JBWF 3SFDC 5FL1A 3H37A 5FNVE 4CN4A 3CX7B 4YJ3E 1N7SC 1MMNA 1G2CB 1LTBC 5C3JA 3E7KA 3AE7C 4H9SE 1ZR2A 2HPCB 4PK4A 5AQFB 5JDMA 1WT6A 2ZT9D 1AV1A 2XV5A 5E79H 2NP9A 3TLVA 3L09A 2X0YA 1NAYA 2XNXA 5DQWA 4K35A 5C2TA 3U78A 4YXDC 5L3EB 1OW6A 3UFGA 4YTPC 1G8XA 4U7JA 4TNVA 3EHZA 4UV9B 1DD3A 1NTME 1FAVA 4NPEA 1LP1B 3BRTB 3PLNA 3CWBD 5CJ0A 3RKGA 3PU3A 3V2NA 2NW7A 2WSCH 3CC7P 4HN9A 1X79A 2WU5A 4GYSA 3HTKA 4MALA 2V7IA 2D2SA 1S2EA 3CCRP 1KB9H 4F6RC 4YSXA 1OW8A 3A7MA 5CA0E 5JR9A 2B9BA 4JUYA 1XTCC 1VQLP 3A3YB 1KK7A 1LKXA 2Y9ZA 4LC1A 2K9JA 2NTYA 2A06G 1RF1B 4D6TJ 2KYVA 1PL5A 3ZT7A 2JMKA 5CGMA 2KSJA 1BR1A 2K48A 3AA6B 4EIJA 2WP9A 4KX6A 4ZS3A 2NTXA 5FVLA 1WCRA 4IT4A 4IHJE 3B5NC 5KLVG 2V5CA 4GKGA 2CMRA 2IC9A 2VWAA 5CB4E 2V7KA 1MFZA 1PFIA 1CZQA 1T8ZA 1SVFA 5CCGD 2KT9A 4IE0A 2HPJA 5KLIB 5BR8T 1S72P 4WW0A 3FZHB 3ABVC 4CXWA 2X9YA 3H1KD 2ODUA 3Q5DA 1SQPD 3AAAB 3AEAA 1PPJE 4GKKT 3L74G 2C5JA 1HNZT 3HD7B 2RA1A 4HE8A 2FBWA 2XUEA 2D9DA 2WZIA 1VQ9P 1EXJA 5KLVE 2ITAA 1ZMEC 4IE5A 2KLVA 3AE1A 3AEFC 1R8IA 4PD4H 3G4SP 2GUSA 1NHLA 2CK3H 3I9YA 4IREA 2W66A 3LBXA 2UXNB 3I0QA 5CA1E 2J47A 3AB3B 4NXMT 1HJ0A 3AEEA 2W90A 2OV9A 4ZI7E 2YKOA 1URQB 1KYOE 2SPZA 4I43B 3H1HJ 2LXBA 3ZMSB 5ABEA 1KILD 1LVKA 5AQRB 5GTHE 1FEWA 3F2EA 3L73G 2ODVA 4CI3B 5CBNA 2XQ7A 3H1HE 5HAXA 5H2FE 1ZN5A 2QJKC 1UUSA 5IHYA 4DBRA 3CLQA 1A02F 1HS7A 4RJTA 3GHGC 3L73E 3H3MA 1LRZA 2H3RA 5AQUB 2YXQB 1UK5A 5HCMA 2RH0A 3OYZA 2D0TA 2M67A 4AI6A 2UUAT 4BRYB 1LT9C 1A02J 4NIQA 4I7ZC 1S9KD 1OVRA 1NTMJ 2ZM8A 5LOVE 2QJPB 1U57A 3FBZA 3LBXB 4COFA 4DBQA 1D0XA 5J2UE 3UUNA 1OVUA 2W6BA 4DMWA 3OYXA 3UUXB 4AYCA 1Y01A 3MXZA 2MKVA 4PD4I 1K04A 1SP4A 5KJ7C 3Q5SA 3CX6B 3IF8B 3U3IA 1KFNA 4AQRD 3W67A 5CCHC 3KBTA 3JC6C 5HEHA 2JRKA 3JCUH 3V5BA 2Q5UA 5AVXB 2IIUA 4LFBT 2W6AA 2KLQA 3PJSK 3CMLA 3PUZF 1FZAA 2VL8A 3V2RA 3L74D 5FKYA 2XZEA 5TJHA 1L0NE 5KKZB 3MZKB 5JDGA 3ANWB 3RK3D 3L72G 4YXWH 2OLTA 2WQYA 3M3ZB 4H9RC 3OKQA 2W67A 3DJBA 3CMAP 1QVFO 3VMYA 1SQXK 3WI3A 3AAEB 3L70G 4TT3H 3E0ZA 2DI4A 1L0NJ 5JH7E 4DR2T 2XHEB 1TU3F 4H0LC 5LBMA 2M6BA 3HI2A 3RIFA 2AXTE 2WSCJ 1Q86Q 4IE6A 2BVMA 2WDRA 1GU5A 1URQC 1D1AA 1MMGA 5AW0B 1UGOA 1VQ6P 2FFDB 1HG2A 3KYQA 2C5IT 5CCGA 3PUGA 1BE3J 2J5UA 3C4WA 3L73D 3RQWA 1VQOP 5AW1B 1VDFA 2KLUA 1L4AB 3GLMA 1SQBG 1SQBJ 3CCQP 3IR9A 3MHVA 1HCIA 1NENA 2N9YB 1KV4A 1FMWA 2BKOA 4TWDA 4CN6A 2HODB 4NPFX 3H1KE 1NU1G 2E2AA 4YY3T 2K37A 5AVTB 2IDOB 4UB6H 2Z5HA 1FZCA 3Q5EA 1SQBE 3NFQA 1KZUB 3H1LE 2WTYA 3UULA 4X1KE 5LGNB 4AKGA 2I59A 4WY4D 4PK6A 1LTJC 3O1IA 2IMLA 4UF0B 4IL6H 1N8RQ 3Q5WA 1DEEG 3BATA 2QSIA 1FS0E 4P09A 3ZT6A 3N9OA 4JI3T 3KDSE 2YIUC 3I5CA 5APVA 1RE4C 2RPAA 1O3XA 1YQ3A 1MNDA 2KZ7B 2H88C 4V1Av 4EOTA 3MD0A 4DR1T 1KFYA 1LWUB 5FXVA 2SPCA 2XAGB 2RN0A 3ZSSA 4AIUA 3Q1MA 1D0ZA 3RRWA 1MIYA 3UQ7A 1SQVK 2A9UA 3L37A 4WYVA 5AVZB 2E43A 1VOMA 1YQ4C 2IZ0A 3WAJA 1WR6A 1PP9D 2K9JB 3K3OA 4DVDA 5LHIB 1JB0J 3CX5I 3L75J 3RK2C 5H6QB 3Q3DA 2AXCA 3L70J 5AQJB 4X65T 3S4RA 1Q2NA 1BGYD 1FMVA 2WSEH 5AVWB 2K9YA 2XQ3A 4OH8B 3OA7A 2B76A 3S1KA 1LTAC 3R6NA 2K5BB 3KINB 2XAFB 3ZDMA 2GA1A 2LXCB 1L4AA 5IYZE 1EDLA 4JI0T 5GTIE 4G2AA 2XZRA 1IO4A 1VPCA 3D6YA 4UR9A 3A5XA 1LT9B 3HKBE 2WSFH 3PU8A 5DABA 1SQVG 1NKNA 3CCUP 4BJMA 3LW5H 1M56D 3HA4A 5APSA 2A45G 3FWNA 1L0NK 1VF5C 2XM1A 4F8HA 2NZ2A 1KNRA 1PP9G 3KHUA 3FX0A 1Y8AA 3H1LD 2D5UA 2QJYC 2XTLA 3BQLA 1FDMA 3GHGB 1SFCD 3PUYF 2GM4A 5HYAA 4GOUA 4KHZF 1R5SA 3KFWX 3OVUA 3HTKB 2WT7A 4ZI3C 4DR4T 3I55P 1SQXD 1AFOA 1VCSA 3HUSB 2FY8A 4HEAA 4YFSA 3UTKA 2JEEA 3WU2E 3CK6A 4AKLA 2N2NA 4EDFA 5A1LA 1ZP0A 1VQ7P 2NRGA 1VQPP 3RX6A 1XDPA 3R2PA 2BASA 2J58A 3AE6C 4IFFA 4JQ0D 3CKDA 1HH0A 2V7QH 4IFDK 2D0UA 3ZJ1A 1OW7A 3L36A 2IW5B 2E76D 2E5LT 3N9NA 2R32A 1HFAA 3HE5B 5CFBA 4WBAA 1NWMX 1X9VA 4DV4T 1PP9J 3K3QC 4ERRA 1AQTA 4QH5A 2ES0A 2M8RA 4EYYR 1GL2B 4NPPA 2E75C 2FYUE 1NTKK 4HH2A 3N7NA 4U7YA 3DP7A 4R4MA 2WZ7A 1YTZI 1JUNA 2LR2A 1N2DC 2E9XC 3CCVP 3QH9A 4PD4E 4B3ST 4NUVA 2I8DA 2KNCA 3H1JD 1G73A 3KV9A 4WY4A 1WMKA 4LMKA 2JKVA 3C51A 5J0ZA 3M9BA 1RHZB 2YXRB 3SS1A 5IUXA 3G06A 2N1TC 1R5LA 3MA9A 2HPCA 3PP5A 5E0OA 1W9RA 1HR0T 4KHXA 2VB6A 4I6MC 3CXHE 4P0AA 2JQ9A 1BR0A 1YKEB 1SQVE 3C9IA 5KX5E 4QXBB 1HF9A 1OXZA 1OZHA 4IDZA 4PW8A 2FYUG 3ZPOA 1SQVD 5DJQC 3H1JJ 2JPFA 2OYHB 2E75B 1N86A 5APYA 5AQPB 4NUUA 2WWVA 3N5LA 2X67A 2KP8A 4OHFA 2P9BA 4A97A 4UVAB 2L9QA 3L35A 3L70D 5HXSA 2UXDT 1BCCG 3W15B 1YW0A 3FWLA 5LG4A 3M0DC 2O01N 4GODA 4HFHA 1VQMP 3W68A 5ABGA 5FYMA 2LJLA 2YMYA 5FY7A 1SQXG 3G6EP 3QB5K 1DD4A 2UU9T 1LTTC 3N2OA 5HXEA 2EHOD 4X62T 1CSBA 1PP9E 5LCYA 4JI8T 2ZXEB 2LKHA 3A0HH 2G8YA 3LK42 5B5EE 1PZQA 1H89A 2PFXA 1URQA 1Q81Q 1XDOA 2Y0DA 3WUUA 2E74C 2FJEA 1YQ3C 5C8YE 4LFCT 3FXDA 1JOCA 2H7HA 4O4IE 1KTMA 1KB9E 2BCCD 5HXCA 3UUBA 4GKJT 5L3FB 4DMVA 1H7CA 3RI5A 3QB5A 3MJXA 4JYBA 2Q7CA 4ILUA 1G2CA 3CQCB 3HE5A 3AVRA 4WB4A 2OYHA 1L0LJ 2XPKA 1S35A 4L9IA 3VHLA 2MPKA 1SFCA 1SLQA 1H0TB 1E7PA 2XQ4A 2LKMA 2XASB 2XAHB 4DV3T 5AVSB 3KV5A 2WY2A 1VCTA 2F4VT 1NGMB 2Q6QA 1HNXT 2V4HA 3H1JG 1L0LE 2WT7B 2NPSA 3B71A 3HUSA 5KLVD 3H25A 3A2AA 1RE4A 4EOZB 1KQFB 2D2CD 2WSSH 2VVSA 3MACA 4OX9T 2NW8A 2Y8DA 3MKDA 2BCCG 3ZN0B 2CM0A 4EYUA 3K3NA 1KILA 1WR0A 4IL6E 4DNDA 4CI2B 2X0LB 3LDQB 2WPRA 3O1JA 3P50A 4GK5E 1SQQK 4Y99C 4U31A 2LHRA 1AA0A 3RK2B 2M0BA 3B5ND 5L8RJ 4Z91A 4AQGA 1OEDE 1G1JA 2OQQA 1NAFA 1GL2A 5JVDE 2KOGA 2QJKB 3L71J 2MBGA 2BG9A 1LWUC 3EUHA 2XY8B 4ZXLA 3VMXA 4QMAA 4ISSA 1IJ5A 2JJ9A 1KD1Q 2A45I 5JREA 3IF4A 2Q3EA 3RL0C 1VRBA 2MOZA 3T8OA 2JQKA 2JQQA 2XQ6A 2BCCE 2OTLP 3UU4A 3UU3A 3RHWA 1IFJA 2WMMA 4PJNA 1SQVJ 3G71P 1VQ4P 5JDNA 4LMJA 1NVOA 3P7KA 4M3LA 3GMAA 5AQMB 2IBZI 1JNRA 3B4SA 5B5EH 4H44D 1EZ3A 2YDSA 3AE5C 1KQGB 2KS1A 2OYOA 4OGQD 1NKZB 3Q2MA 1J1EB 2V26A 4FI5A 1JY3N 5HEGA 3AEGA 2FUPA 4CI1B 2B89A 1KILC 3JCUE 3R84B 2VKJA 2FXPA 3AEEC 3LJCA 2XDJA 4DZOA 3AE9A 1FJGT 2BKNA 3F31A 4H63V 4MHCA 5LBQB 2Q3IA 1OEDB 3P8CD 2OTJP 1KYOH 1QLBA 4DIDB 4PK5A 2LSYA 1D7MA 2Q9QC 4EXTA 4HWIB 1GMJA 4H0LB 3B5MA 5AW3B 1EZVE 1W09A 3AECA 5JR9B 3ITKA 1P84I 1S9KE 3DTOA 1T3UA 2N9BA 3P4SA 2P7JA 2WSEJ 3B5NB 3CL3D 5H6RB 2WB5A 3MUDA 4ZHQE 4LMLA 1USEA 5CJ4A 2LOPA 2YOEA 3CCEP 2E5VA 1SQQG 1QSDA 1S5LH 3PUQA 1M8OB 2H89C 2LRKA 2YDQA 3C4XA 1AVYA 3G3ZA 3H1IE 3AEBA 4OYJA 3J9X1 4YHHT 4TN7B 3AE4A 3FXEB 3ZMUB 1HTJF 2B87A 2O01J 3ZMZB 2Z5IA 4TLFA 2ZJSE 4UVCB 4HFIA 4Z90A 2IAKA 5ABHA 4OWFA 1T3JA 5L4HA 3JC6D 2DL1A 4WY4B 2YKSA 3JAEA 3PTZA 2XAQB 2FXOA 1BDDA 2NPSD 1XNQT 4TUYE 5KAFE 2LM2A 1HX1B 2ZYGA 3H1HD 1M90Q 2IZ1A 3Q5PA 1SA0E 3O4XE 1JEKA 3P4QA 3IHRA 1LGHB 1P84H 4Y28J 1LP1A 1K73Q 1IFDA 1LT9A 1W2BO 5LJMA 2W4XA 1SQQD 3AE2A 3L71E 2CLYC 3V5UA 2VKDA 1FJKA 3RL0B 4PV1D 4XBFB 2XQ8A 1IFIA 3B5NA 3E1IA 4GK0E 1GD2E 5ABFB 1E79H 1W0BA 1UCUA 2XSAA 2K88A 5LMUT 1NU1D 5C39A 2OGUA 2ACXA 1M1JC 3GW6A 2IYPA 2P2UA 2VL0A 2XQYA 2WM9A 4HGAA 2I1KA 5HXRA 5LHHB 4H13D 3PJAJ 1U5PA 2CPSA 4DR3T 2XM2A 4I1LA 1EXIA 2BS2A 1HGZA 2QM7A 1M62A 5F8PA 4HFBA 2W00A 2KIKA 4E7ZA 2PRRA 1L4AD 2FYUJ 4B3RT 5LB7B 3HKCE 5FVKA 2K24A 3O8ZA 1KORA 2BVLA 1NU1J 1BE3E 3TSIA 2WMNA 3AVSA 3F5HA 5AVUB 3VRBA 2IFNA 2B1EA 2Q9IA 4ZI2C 3VOPA 5KAIE 1BCCE 2W83C 3ZEFB 3FXDB 3GG2A 2V5DA 1SQXJ 1J1DC 1QUUA 4A56A 4O4HE 3SWHA 4HWHA 1BE3G 2FYUK 2NPSB 5BMVE 1KYOD 4HFVA 2CA5A 1BCCJ 3TGUJ 2IC6A 5L47A 4R4LA 3L8RA 1YBKA 3CC4P 4KT0J 3MK7C 2LT3A 3KDPB 3KVAA 2BS3A 3SOLA 3U1AA 2ZMAA 1K9MQ 2YDRA 3ETUA 1LVFA 1RF0A 1IJDB 4HWCA 4EZHA 1KQSO 3NKZA 3AEFA 4U3FD 1GK4A 5AQLB 4LF8T 1N7LA 1IAPA 4KJMA 4JYAT 4C90A 3FZKB 3BCCD 4EAHA 3N9MA 4DR6T 2L3LA 4N78D 3RF1A 1E1HB 2OYIB 3C1LA 1UX5A 1QEXA 4ZS2A 5HCJA 1RF1A 4W7ZA 2KB7P 1USDA 2UXCT 1JM0A 3VRAA 3VR8A 1Z8UA 3ZKRA 3P8MC 3V2QA 4A98A 1M57D 2CCQA 2VKHA 1WYBA 3AE5A 2WWWA 2IPPA 1FZGA 1GL2C 5HEJA 4DO0A 2HG5D 3RBZA 3D6ZA 2WWUA 2UXBT 3I0OA 4I2LC 2V7JA 1HUCA 3EFFK 2W8ZA 4X1IE 2AEMA 2B87B 2QRXA 3T97A 4UIGA 1Q82Q 4GIFA 2ZYAA 5GONE 1HTLC 1M1KQ 2J1DG 2W27A 3VYIA 3Q2YA 5DQVA 2XQ5A 3BQKA 4A7PA 1XMQT 3C8VA 2Y6XA 1BGYG 4TV8E 2LSKA 4A5XA 4KBMB 5JQGE 2FXMA 4Z1MH 1HGVA 1FU1A 2BS4A 4LF4T 4DUYT 3V4WA 4HKAA 1S5LX 2N1TB 4ZEYA 3HUSC 4WZXA 4RKUJ 2HODA 4XE5B 5KXJA 2CEAA 2FYNB 4J2CA 2A06D 3VN0A 3CXHI 2NOXA 3IN6A 4PJMA 1IZNB 4LLHA 3BQIA 2KK7A 3L75E 3PUWF 1N7SB 1ZP0C 4IE7A 2JDIH 3AA7B 4QH1A 5DJTB 1ZXGA 1HG5A 3IEEA 1OMIA 4DUZT 1Y9BA 3MIWA 1J1DB 1T2KD 1BR2A 2CXDA 3H6PA 1YTZT 4Q25A 4UV8B 5FY0A 2BG9E 2QGSA 2WQYC 5AQTB 3SRZA 2CE7A 2RMZA 1JY2O 4CZZB 4WWIA 4MFRA 4Z8XA 5ABFA 1W2EA 5LP6E 2KNCB 3CX5E 3UT5E 1JCCA 2QJPC 2WMOA 3FXEA 3L71D 2L91A 1KEYA 1SQBK 2ZT9C 2R6GF 4PJ0H 4ASKA 2XQAA 4EEBA 3RGUA 4P1NA 4HJGH 4QXHB 5BU5A 5KLVK 2N9DA 1XMOT 2N1TD 2W6JH 1SE7A 4I0UA 3T97B 4EB6E 3H1LJ 4EIWA 4TX5A 3NBXX 3P8CE 4OK0A 2KZIA 1G1IA 3EAMA 3VKGA 2QIWA 1PPJG 1IK7A 3AE4C 3LIEA 1PIXA 1M1JB 3IA3A 1IFNA 2CWYA 2BZBA 1T8BA 1WFDA 2DWGA 3FHNA 4B86A 4ZKUA 1NTZJ 2VK9A 2DCFA 4EGWA 2P67A 3SFEA 1VF5B 3CCLP 1PGOA 3ONLC 3PTRB 2A45H 5LA6E 5EK2A 3WAKA 1LTJA 1FOSE 4AXPA 1BSHA 1KILE 2DWKA 1N73B 1SUMB 3K5BA 5TISE 1NTKD 3UFEA 2HN2A 4OYKA 2L5GB 4PV1B 1GU4A 3P4PA 2XKMA 2UXXB 1N7SA 1S1CX 2WDQA 3S9OA 4PD4D 2Y0EA 3LW5J 5J1GA 2WITA 3BVHA 2WPSA 1RE3C 2Z4EA 2CBIA 2EHOC 1PPJD 4QH4A 1DH3A 3ZSTA 1RQUA 3Q9DA 3V5SA 1Y64B 1GZLA 4I50E 3A8YC 3RYCE 3PDYA 5JDFA 4MLKA 2FFDC 5KAFH 1YD8G 2C9NY 4QX7B 1QGKB 5B66H 2HLOA 4BRYA 1UURA 4TWHA 3PRJA 1HF8A 3RK3B 5TISH 4DV1T 4W80A 4ZOLE 3U59A 4UB8H 5CJ5A 1X22A 5KTBA 3V2PA 2QEXP 2LHNA 3L72J 5JR9C 3SSUA 2WSSV 3PUXF 5AW9B 2OARA 4CQIA 1PGQA 2YIUB 3KV4A 2ZM6T 1L0NG 1NO4A 4WVZA 1GW4A 3TLTA 5L3BB 3VP9A 1Z0PA 5L3GB 2ZAEB 2VQET 1IBKT 4IDPA 4YT0A 5CCHA 3HE4B 5JDLA 5APXA 5JDQA 3B8EB 3H1KJ 1CW5A 5LNKA 1QLED 1VQKP 2QA7A 5IWAT 1L0LD 2E76B
chains in the Genus database with same CATH topology
3AAAB 3NRXA 3VU7H 2X9XA 1T98A 4O4JE 1HJBA 2JMHA 4P0AA 1NAFA 5FXXA 2R5BA 2C5JA 5CCGC 3E22E 1GL2A 3HD7B 2RA1A 2KOGA 4HE8A 4JEUB 5JVDE 3M0DA 2A3DA 3N4XA 1LTIC 2XUEA 3Q5XA 2MBGA 1LWUC 1HBWA 3EUHA 4PJLA 5AFUL 1M7LA 4IE5A 2KLVA 3VMXA 4ISSA 1IJ5A 5AVQB 1EQ7A 2PP6A 3PE0A 4FJOA 2JJ9A 2WBLA 2N1TA 2A45I 2GUSA 1NHLA 3I9YA 5JREA 4AKHA 3RL0C 1VRBA 2MOZA 3LBXA 3T8OA 3ZJ2A 3ZYMA 2J59M 2JQQA 1LTSC 2UXNB 3I0QA 5CA1E 3IFMA 3F57A 3GN5B 1ZV4X 3ZYKA 5APQA 4HYTB 3AB3B 2YNYA 4ZI7E 1IFJA 2YKOA 3CQGB 1URQB 2P1JA 2R3CA 5AVYB 1N73C 4PJNA 4I43B 5L3DB 5M4YA 2YU2A 2YO3A 3EDUA 3ZMSB 5HXHA 5ADXL 5JDNA 2LSIA 1KILD 1LVKA 2H8PD 3P7KA 1LTJB 4M3LA 4YJ2E 2YO2A 1FEWA 2E9XA 3AAIA 3F2EA 1CI6B 1GW3A 2ODVA 3HKEE 4HTEA 4PAGA 3O1HA 4KUMB 3RL0D 3RC3A 4CI3B 2I1JA 1EZ3A 4M1PA 5LGUB 1ZLLA 5HAXA 3KQGA 3ZN1B 3OBVE 1ZN5A 4YLHA 3SWYA 1JO5A 5IHYA 4GK0E 1QL1A 4DBRA 1NKZB 3Q2MA 3A5TA 1J1EB 2FKWB 2V26A 3CLQA 4C7NA 1A02F 1HS7A 2C5KT 3GHGC 2E8IA 4FI5A 4U74A 1JY3N 1LRZA 2HYNA 2Q9QD 3ESLA 2H3RA 3UUMA 2OYHC 4CI1B 3OYZA 3U1CA 1KILC 2D0TA 2M67A 2NWBA 3OAKA 1JY3O 4AI6A 1X79B 2VKJA 3LJCA 3R84B 5KJ7A 2XDJA 4DZOA 1BR4A 4QHOA 1LT9C 1A02J 3HE4A 3AA1B 3F31A 4H63H 4H63V 2OYIA 1S9KD 3AA0B 4MHCA 1MUUA 5LBQB 3CQXC 2Q3IA 5BU8B 2ZM8A 5LOVE 4PFOA 3P8CD 4GYRA 3N2GE 3PUAA 5LP6E 5LXTE 3NXSA 3FBZA 2MTQA 4PK5A 2LSYA 5AW4B 2Q9QC 4O2AE 4EXTA 3TNUB 2C0SA 4MBQA 3LBXB 2C0WA 3C64A 4DBQA 1D0XA 5AW3B 5J2UE 3UUNA 1WRGA 1US7B 3ZMVB 4TV8E 5FMNA 5JR9B 2W6BA 4DMWA 5KMGP 3OYXA 3M91A 3ANWA 1S9KE 3DTOA 1T3UA 2X66A 3UUXB 2N9BA 4AYCA 2P7JA 3B5NB 3MXZA 3CL3D 2ZLYA 1SP4A 5H6RB 5KJ7C 3MUDA 3RK3C 2X68A 4ZHQE 4AKIA 2X9WA 3CX6B 1E5WA 5CJ4A 3IF8B 2HFED 1KFNA 1GK6A 4AQRD 2LOPA 3U3IA 5CCHC 1WYCA 3IBPA 2YKPA 3MTUE 2KWIB 1QSDA 3JC6C 3KBTA 1IK9A 2JRKA 3PUQA 3EVYA 3MGNA 3V5BA 2Q5UA 3C4XA 5AVXB 2W6AA 4N3YB 2KLQA 3G3ZA 3N2KE 2VASA 3CMLA 4OYJA 4CXXA 3J9X1 2WPQA 4TN7B 1FZAA 2Q9QA 2VL8A 3V2RA 4W7YA 5AW2B 1ZHCA 3FXEB 3ZMUB 1HTJF 3ZMZB 2PAJA 2Z5IA 2OA5A 3QUJA 2K9AA 5JDGA 3MZKB 4UVCB 5CMZA 1U4QA 3ANWB 5KJ7D 2IAKA 3RK3D 2ZM2A 4CXYA 4DOJA 4H9RC 3OKQA 1T3JA 4XA4A 5CCHD 3VMYA 3DJBA 1SQXK 3N9PA 3S4UA 3AAEB 2H43A 4GT1A 3CX8B 3JC6D 4QX8B 3V5UA 3WI3A 4WY4B 4IFMA 3E0ZA 2KMFA 2CLYB 2DI4A 1S94A 2XAQB 5JH7E 2NPSD 1Z56A 2XHEB 2FYZA 3I1AA 4TUYE 4U72A 5LBMA 5L3CB 3HI2A 2W0GA 2C9LY 2V7LA 5APTA 2BVMA 4GIWA 1SA0E 3O4XE 4IE6A 3II6A 1GU5A 1URQC 1D1AA 1KQLA 1LGHB 2A2FX 2CXFA 1FZBA 3B13A 3IHRA 3M65A 3N9LA 3WMM0 4UXNB 1MMGA 4XZCA 5AW0B 2LM9A 1IFDA 1LT9A 3EQ2A 3M9QA 1RF1C 5AW8B 3KYQA 2FFDB 5CCGA 1D0YA 1HG2A 2C5IT 2LOSA 3PUGA 2CLYC 1MMDA 3C4WA 3RYHE 2G0UA 1FJKA 3RL0B 2LE8A 5AW1B 1VDFA 4WY4C 2VKDA 3GA8A 4XBFB 1L4AB 2NPSC 2WAUA 1RE3A 2EHOA 2ZFCA 1IFIA 1L0LK 3B5NA 3E1IA 3IR9A 1HCIA 3LK2B 1QL2A 1GD2E 2PFVA 1IJ6A 3P32A 1FMWA 4X20E 5LYJE 1UCUA 3EDVA 2QM8A 2HODB 1CUNA 3VKHA 1URQD 2ACXA 1M1JC 4UELA 3HD7C 2P2UA 2XQYA 5AVTB 2WM9A 4HGAA 2I1KA 2Z5HA 3LIDA 3VP8A 1FZCA 3TNUA 1GDTA 3H32A 2EHOB 5HXRA 3RRCA 5LHHB 3NFQA 2ZM0A 2M3BA 1KZUB 2WTYA 4L0RA 3UULA 1J2JB 1U5PA 3NRYA 3ZC0A 4X1KE 2CPSA 2JJLA 2FFDA 2KWHA 4WY4D 4PK6A 5LGNB 4AKGA 4I1LA 2XU6A 3CI9A 3CWZB 4ZI2D 1LTJC 3O1IA 1HGZA 1SFCB 2QM7A 4UF0B 1ZKEA 3Q5WA 5F8PA 3BATA 2W00A 5EK4A 3UIAA 2PJQA 4E7ZA 1D1BA 4P09A 2HH7A 3N9OA 1V9DA 3KDSE 1L4AD 4K0UA 5JDMA 2O1KA 1JCDA 3I5CA 1IFMA 3HD7D 1RE4C 5APVA 2K24A 3HKCE 3QC9A 3C98B 1O3XA 4O2BE 3O8ZA 5HWYA 2KZ7B 1MNDA 3TYYA 5APWA 2BVLA 4TZ4C 4I55E 4KP3C 4V1Av 4EOTA 2HPLA 2N1GA 5LGTB 3TSIA 3MD0A 2WMNA 2YINA 3AVSA 2CPBA 3GHGA 1LWUB 5AVUB 3ZC1A 3CVRA 2SPCA 2IFNA 2B1EA 2Q9IA 1LWUA 2XAGB 3VOPA 2YK0A 5FXVA 4ZI2C 4B6XA 1FZCC 1D0ZA 4ANJA 3RRWA 3ZEFB 1FZEA 3RK2D 1MIYA 3FXDB 4ISTA 4IE4A 1J1DC 1QUUA 4UEMA 4A56A 4O4HE 3SWHA 1SQVK 2KXPB 2FYUK 1L4AC 2NPSB 3C4ZA 5BMVE 2YU1A 4H9PC 3ZCJA 3L37A 1FIOA 1DEBA 2YEVC 4WBNE 4JYCA 5AVZB 2E43A 2CA5A 4HFVA 1VOMA 1RY3A 2IC6A 2W63A 3M0AA 3WAJA 3C50A 1WR6A 4E7SA 4PJJA 2LSJA 3MK7C 1AQ5A 2LT3A 3KDPB 3K3OA 3KVAA 3KVBA 4QKNA 3NTNA 4DVDA 5LHIB 3SOLA 1JY2N 3U1AA 1GTWA 1WLXA 3HKDE 3RK2C 3A7OA 1FZCB 2ZMAA 5LHGB 3SWFA 3ETUA 5H6QB 1J1EC 3H32B 1H8AA 1FBMA 5BVZA 1RF0A 1JNMA 1LVFA 1IJDB 3FB2A 4XAXB 1SHZC 4I4TE 1FMVA 2Z6EA 3FBLA 2WSEH 5AVWB 3ZCIA 4EZHA 5KDMC 4C46A 4OH8B 3OA7A 1GK4A 4OFZA 5AVVB 4KMCA 1LTAC 3R6NA 2K5BB 3K8PC 3KINB 2XAFB 5F3JA 1MNEA 1N7LA 1IAPA 3VTPC 5IYZE 1L4AA 5FY1A 4G2AA 4C90A 1NTMK 2GK9A 4EAHA 2XZRA 1IO4A 4ZKPA 1VPCA 2L3LA 1GL2D 3N9MA 4N78D 5JRCA 4UVBB 1E1HB 1N73A 2OYIB 3A5XA 1HVVA 1LT9B 5AVRB 1UX5A 2WSFH 1RF1A 2L8KA 3HKBE 3PU8A 4W7ZA 2LSGA 2X51A 5DABA 1NKNA 2KB7P 3B57A 4UF0A 3ZMTB 4BJMA 3LW5H 4ZI3D 3HA4A 5APSA 2A45G 3OJAB 1L0NK 3P8MC 1JMMA 3V2QA 3I9WA 3KBUA 5AW7B 4WNKA 2CCQA 2VKHA 1ZV8A 1KILB 4Y99B 1MMAA 1WYBA 1JY2P 2WWWA 2D5UA 2XTLA 3BQLA 3O9XA 1AJ3A 2IPPA 1FZGA 1GL2C 1DX7A 1FDMA 3GHGB 2DLRA 1SFCD 2GM4A 2CXLA 2PBIA 4DO0A 5HYAA 2HG5D 4GOUA 3E08A 1ZR4A 2WWUA 2IX7C 3KFWX 3I0OA 4I2LC 4BJNA 2O1JA 2V7JA 3RC8A 3HTKB 2W61A 2C0XA 1HUCA 2WT7A 4ZI3C 1D1CA 1AFOA 4X1IE 3HUSB 4HEAA 4UIGA 3T97A 1CI6A 4QWNB 3PURA 4YFSA 4X1YE 2JEEA 3EFGA 4GIFA 1NWQA 1JTHA 2BDEA 2W62A 4AKLA 4C91A 2N2NA 5GONE 1HTLC 4YHJA 4L5GA 3RH3A 5A1LA 2J1DG 2W27A 3VYIA 1HWTC 4PNIA 5DQVA 3D0TA 5EK3A 3BQKA 3RX6A 2NW9A 1SFCC 3R2PA 5J2TE 2BASA 2J58A 4IFFA 2Y6XA 3CKDA 4O8SA 1HH0A 2LSKA 4IFDK 2D0UA 3NZPA 4PFPA 3ZJ1A 5LJMA 1JTHB 3L36A 4KBMB 5JQGE 2FXMA 4TV9E 5FP3A 2IW5B 2V7MA 1HGVA 1FU1A 3V4WA 2H7VC 3N9NA 4HKAA 2N1TB 2R32A 1HFAA 3HE5B 3HUSC 3L3PA 2POHA 4WBAA 1NH4A 1NWMX 1X9VA 1JY3P 2CWOA 3RYIE 4QXCB 2HODA 1WRDA 4XE5B 3GWHA 2CEAA 3K3QC 5AW5B 3BK9A 4ERRA 4O9BA 4J2CA 3VN0A 2ES0A 3HRNA 4N6JA 2NOXA 2M8RA 4PJMA 4EYYR 4LLHA 1IZNB 1MIWA 3BQIA 3RPUA 1GL2B 3HD7A 1NU1K 4C7RA 3J7Yq 2VKOA 3BASA 3ZLIA 1N7SB 1NTKK 3W15B 4HH2A 4BAYB 1SQPK 3N7NA 4IE7A 3DP7A 3AA7B 4BA9A 2WZ7A 4AUWA 4H9OC 2A72A 1YTZI 1HG5A 2KNDA 4O4LE 2OYIC 3V4QA 3IEEA 1JUNA 1N2DC 4LGDE 2E9XC 4IIJE 3H3AA 3MIWA 4NUVA 1MV8A 1FZFA 1J1DB 1T2KD 1BR2A 1G73A 2CXDA 3H6PA 1YTZT 3KV9A 4UV8B 5FY0A 4JLEA 4WY4A 4C7NB 2QGSA 3C51A 3BRVB 4JF7A 3M9BA 3SRZA 3SS1A 3ONXA 3TKLB 2O01H 3VMZA 2CE7A 2N1TC 1JY2O 3MA9A 4CZZB 1KNZA 2HPCA 3PP5A 1B7TA 5E0OA 2GUVA 1M1JA 4KHXA 2VB6A 4MFRA 4I6MC 1LTGC 1W2EA 4Z8XA 4ZS2A 1N7SD 2V1DB 1JCCA 1XTGB 3QK6A 3UT5E 2R5DA 2Q9QB 2E9XD 2IFMA 2WMOA 1BR0A 3M06A 1YKEB 3C9IA 2E42A 1SQBK 1T2KC 2X9HA 4H9NC 4QXBB 4ASKA 5HWXA 5KX5E 4H9QC 1OXZA 4PW8A 4IGUA 4IDZA 3N9QA 3ZPOA 4QXHB 5BU5A 5KLVK 2KINB 2XAJB 3HL6A 1YYCA 5DJQC 4RESB 2YKQA 1ZEEA 2N9DA 2JPFA 4AQFA 4EZ4A 2N1TD 2OYHB 1OWAA 1N86A 5AW6B 5APYA 3UTKA 4EB6E 4NUUA 4TX5A 4EIWA 2MYSA 3GN5A 3H37A 3P8CE 2X67A 2KP8A 3N5LA 3NBXX 4OK0A 3CX7B 4YJ3E 1G1IA 4OHFA 5FNVE 3VKGA 1N7SC 1MMNA 2P9BA 1MZ9A 1G2CB 1LTBC 2L9QA 4UVAB 3L35A 2PG8A 3LIEA 3CPZA 5HXSA 1M1JB 1H88A 1IFNA 3LK3B 2CWYA 4H9SE 1RF0C 1ZR2A 2HPCB 1YW0A 4PK4A 3RKOA 1WT6A 2VRSA 3M0DC 2XV5A 2BZBA 5LG4A 2NP9A 2DWGA 3FHNA 3L09A 4B86A 2XNXA 4ZKUA 3HR0A 5DQWA 3U78A 5FYMA 3LFMA 2LJLA 5L3EB 2VK9A 2DCFA 5L2LA 2YMYA 2P67A 5FY7A 1G8XA 4ADZA 3TK1A 4UV9B 3PTRB 2A45H 5LA6E 4AKRB 1LTTC 3N2OA 3WAKA 5EK2A 3KV6A 5HXEA 1FAVA 5LJNA 3OJAA 1LTJA 1FOSE 2EHOD 1CSBA 5LCYA 4AXPA 2ZXEB 3BRTB 5CJ0A 2MJZA 3LK42 2DWKA 3PU3A 1N73B 3V2NA 5FXWA 1H89A 5FXZA 3ZYLA 1URQA 3UFEA 4AQFC 2NW7A 4OYKA 2L5GB 2WSCH 1GU4A 2XKMA 4HN9A 4P0BA 1X79A 1N7SA 2RP4A 2UXXB 4GYSA 5C8YE 3HTKA 1JOCA 2H7HA 4MALA 4O4IE 2V7IA 2D2SA 1NOHA 3NMDA 5HXCA 5J1GA 5L3FB 4F6RC 4DMVA 2WITA 3ETVA 3BVHA 2WPSA 1H7CA 5CA0E 1RE3C 2Z4EA 2EHOC 3RYFE 3MJXA 5JR9A 4JYBA 2Q7CA 4ILUA 4JUYA 1XTCC 1DH3A 1G2CA 3CQCB 3HE5A 3AVRA 3A3YB 1KK7A 3Q9DA 1LKXA 4WB4A 1YKHB 2E9XB 4G63A 3V5SA 1Y64B 3PUSA 1GZLA 4I50E 4LC1A 2DNXA 2OYHA 3RYCE 3PDYA 1KFMA 2NTYA 5JDFA 1S35A 4L9IA 3VHLA 4MLKA 2FFDC 1RF1B 1YD8G 1SFCA 2KYVA 2C9NY 3P7IA 1SLQA 3KPEA 4QX7B 5EZYE 2JMKA 4N78E 2KSJA 2LKMA 2DHRA 5JRCB 1BR1A 2K48A 2XAHB 5AVSB 2XASB 3L4FA 3AA6B 2HLOA 4EIJA 3KV5A 5JDHA 1UX4A 1X8YA 5APUA 2NTXA 4ZS3A 3RK3B 1HF8A 1HX8A 5ETWA 2WT7B 2NPSA 4W80A 4ZOLE 3U59A 4IHJE 3HUSA 3B5NC 5KTBA 3V2PA 4GKGA 3LG7A 3A2AA 1MIVA 2CMRA 2IC9A 1RE4A 2LHNA 1NTZK 2VWAA 5CB4E 2V7KA 1MFZA 4EOZB 4WBOA 1PFIA 5JR9C 2Y48B 2WSSV 3MACA 1CZQA 2NW8A 2Y8DA 5AW9B 3MKDA 1T8ZA 1FJPA 3ZN0B 2CM0A 1SVFA 2LEHA 3K3NA 1KILA 2OARA 5CCGD 2KT9A 5TAOA 4CQIA 4EYUA 3KV4A 1NO4A 4IE0A 1GW4A 1IC2A 3M9HA 3VP9A 1Z0PA 3GMIA 4DNDA 4CI2B 5L3BB 2HPJA 5L3GB 2X0LB 2WPRA 1FOSF 3O1JA 3NZQA 1SQQK 4Y99C 4GK5E 2LHRA 3RK2B 3B5ND 4JEHB 4WW0A 2H7OA 5CCHA 3HE4B 4AQGA 5JDLA 5APXA 5JDQA 5CHXA 3B8EB 4CXWA 2X9YA 1CW5A 5LNKA 2ODUA 2QA7A 2I59A 1G1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X79 B;  3BAT A;  5BU5 A;  4ZKP A;  2POH A;  4N78 D;  3N4X A;  5BU8 B;  3P8C D;  4O9B A;  3U1C A;  2JEE A;  4GIF A;  3U1A A;  3HRN A;  1NKN A;  1IC2 A;  3VP9 A;  5BVZ A;  4N3Y B;  3VP8 A;  3OJA B;  3BAS A;  1WT6 A;  3N7N A;  4I1L A;  4ZKU A;  3U59 A;  3C9I A;  2FXM A;  5KTB A; 
#chains in the Genus database with same CATH topology
 3NRX A;  2E5T A;  1T98 A;  2JMH A;  1NYH A;  5FXX A;  5CCG C;  4JEU B;  2K3R A;  4U3F G;  2R44 A;  2A3D A;  4HWF A;  4PJL A;  1HBW A;  5AFU L;  1M7L A;  2W2U A;  5AVQ B;  2PP6 A;  3PE0 A;  2WBL A;  2N1T A;  3ZJ2 A;  2J59 M;  3F89 A;  3L70 E;  2AEF A;  3F57 A;  4ILC A;  3GN5 B;  5APQ A;  4HYT B;  1CHU A;  2YNY A;  3L73 J;  2CRB A;  4UB8 E;  3PUV F;  2R3C A;  2P1J A;  5AVY B;  1N73 C;  2B88 A;  5M4Y A;  2YO3 A;  4EI2 A;  5HXH A;  5ADX L;  2R3S A;  2LSI A;  1KYO I;  3UQ4 A;  1YIJ P;  4YJ2 E;  2K1A A;  4HTE A;  3AAI A;  1GW3 A;  1LT1 A;  4U3F J;  3CCM P;  4KUM B;  4PAG A;  3RL0 D;  3RC3 A;  1KMI Z;  4JI2 T;  1NEK A;  3KQG A;  3ZN1 B;  3OBV E;  1YXR A;  2WS3 A;  2C5K T;  2E8I A;  2MAW A;  1NU1 E;  1BDC A;  1W5C E;  3U1C A;  1I94 T;  2NWB A;  3L71 G;  3OAK A;  3UU8 A;  4H13 B;  2ZXX A;  5CBO A;  1BR4 A;  1EDK A;  3RIA A;  4B3M T;  2JQH A;  3AA1 B;  4H63 H;  5BU8 B;  4OGQ C;  4GYR A;  3TDK A;  3PUA A;  2MTQ A;  5AW4 B;  4O2A E;  1YJW P;  3C64 A;  1VQ8 P;  3R4Y A;  4CN1 A;  5DJU B;  2H88 A;  2A06 E;  3RGL A;  5FMN A;  4U2Y A;  3ANW A;  2X68 A;  2X9W A;  4AQY T;  2HFE D;  1P84 D;  1NTK E;  2YKP A;  3AE8 C;  1X9B A;  2KWI B;  1IK9 A;  3SWK A;  3MGN A;  1MKM A;  3AE6 A;  3UU5 A;  4N3Y B;  3WUV A;  3CD6 P;  3N2K E;  4CXX A;  2WPQ A;  2O3J A;  2Q9Q A;  5AW2 B;  1ZHC A;  2KSR A;  2K9A A;  4PJ0 E;  5CMZ A;  1U4Q A;  5KJ7 D;  2ZM2 A;  3H1K G;  3AED A;  5M1B A;  4XA4 A;  5CCH D;  3EI0 A;  3N9P A;  2M6I A;  2H43 A;  4QX8 B;  1VQN P;  3WUT A;  4IFM A;  1J5E T;  2CLY B;  4LF7 T;  3I1A A;  1ZOY C;  4HWD A;  2W0G A;  2C9L Y;  4YPC A;  4D6T G;  1N33 T;  4GIW A;  2H89 A;  5GTI H;  4AQF A;  2CXF A;  4UXN B;  1FZB A;  3N9L A;  3AEB C;  1N32 T;  1YIT P;  2LM9 A;  4JBZ A;  3EQ2 A;  3M9Q A;  1RF1 C;  2LOS A;  3RYH E;  2G0U A;  2LE8 A;  4JPZ B;  3TLU A;  4WY4 C;  4DCK A;  2NPS C;  4U74 A;  2HN1 A;  1RE3 A;  3BCC E;  2EHO A;  1L0L K;  3LK2 B;  3PH0 A;  2PFV A;  3P32 A;  2QM8 A;  1CUN A;  3VKH A;  1URQ D;  3HD7 C;  4KMC A;  3LID A;  2EHO B;  2WPV B;  2BKP A;  3BCC G;  4K3A A;  2M3B A;  2ZM0 A;  1J2J B;  1VQ5 P;  2JJL A;  2FFD A;  2KWH A;  3MUD C;  2ZYD A;  1SFC B;  3UIA A;  5AQS B;  2HH7 A;  1V9D A;  4K0U A;  2O1K A;  1JCD A;  3AEA C;  4QWN B;  4O2B E;  3QC9 A;  2QE7 H;  3TYY A;  4H13 C;  4KP3 C;  4L76 A;  2HPL A;  3CCJ P;  2N1G A;  4YSY A;  3CVR A;  1LWU A;  2YK0 A;  1FZC C;  3UU6 A;  4ANJ A;  3RK2 D;  3AE1 C;  5E79 E;  2QYW A;  4UEM A;  1BE3 D;  2LRL A;  3C4Z A;  1RQV A;  1KF6 A;  2YU1 A;  4H9P C;  1DEB A;  3CXH H;  1NTM G;  4E7S A;  3V6I A;  4QKN A;  3KVB A;  3NTN A;  3NWI A;  2IYO A;  1JY2 N;  3RIU A;  1GTW A;  3A7O A;  1J1E C;  3H32 B;  4H9Q C;  5BVZ A;  1JNM A;  3AXJ A;  3FB2 A;  5EK4 A;  4X5T A;  1SHZ C;  2V8S V;  4I4T E;  3GF3 A;  1BGY J;  3JC2 2;  4OFZ A;  2CBJ A;  4JV5 T;  5AVV B;  1NJI Q;  4JI6 T;  5F3J A;  1MNE A;  2V6X A;  1S3J A;  5FY1 A;  1J1J A;  2GK9 A;  4K0K T;  4ZKP A;  1XNR T;  5JRC A;  4IDO A;  1IBM T;  1HVV A;  2JO1 A;  5L4E A;  2L8K A;  3QWO C;  2LSG A;  2X51 A;  1FDI A;  3B57 A;  4UF0 A;  3ZMT B;  1BCC D;  2RKL A;  4U3C A;  1JMM A;  5AW7 B;  4DV0 T;  3A0H E;  1ZV8 A;  1DIP A;  1DX7 A;  2DLR A;  3P4R A;  2AXD S;  4DR5 T;  2CXL A;  2PBI A;  2WVR A;  3E08 A;  4BJN A;  1SQB D;  4DJG A;  2C0X A;  4DR7 T;  4KHP T;  1D1C A;  5AQO B;  1VF5 D;  3PUR A;  4X1Y E;  2BDE A;  2W62 A;  1JTH A;  3H1I G;  3RH3 A;  4L5G A;  2UUB T;  3CC2 P;  1HWT C;  4RO0 A;  3D70 A;  3D0T A;  1AVO A;  1SFC C;  2NW9 A;  4JI4 T;  3TF5 A;  3NZP A;  4H44 B;  1JTH B;  4X64 T;  2ZVN B;  4DV6 T;  5FP3 A;  1XZY A;  3L3P A;  5AQQ B;  1NH4 A;  3RYI E;  3H1I J;  1WRD A;  3IAO A;  3GWH A;  4YTP A;  2BG9 B;  4GOE A;  2CPT A;  3HRN A;  3FZF B;  3TLS A;  3J7Y q;  2VKO A;  3BAS A;  3ZLI A;  4ILA A;  4IOI H;  3VMA A;  2WDV A;  3EAB A;  4AUW A;  4JI7 T;  4H9O C;  1NTM D;  2A72 A;  1AJY A;  5EFW B;  2OYI C;  2XND H;  4DV5 T;  3H3A A;  3AE2 C;  3PV0 F;  2ZVO B;  4C7N B;  2K3W A;  1EZV I;  3H1J E;  2J4G A;  3O6Q B;  2E75 D;  3CWB E;  3VMZ A;  3MZW B;  2KS1 B;  3L75 G;  2GUV A;  1LTG C;  2E74 B;  1N7S D;  1LJ2 A;  2Q9Q B;  2E9X D;  3M06 A;  2E42 A;  2KZJ A;  2X9H A;  1BSN A;  4L74 A;  3N9Q A;  2D2C B;  3HL6 A;  1YYC A;  4ZMD A;  2YKQ A;  3CME P;  3EWK A;  3OTO T;  2MYS A;  3GN5 A;  3A0B H;  3G9R A;  1MZ9 A;  1KC8 Q;  3VR9 A;  1YJN P;  2PG8 A;  3CPZ A;  1H88 A;  3LK3 B;  1FC2 C;  1RF0 C;  3RKO A;  2LLY A;  2VRS A;  4TWF A;  2BG9 C;  2ACZ A;  3HR0 A;  4B3T T;  3LFM A;  4GOF A;  4D6T D;  2YN6 A;  5L2L A;  4ADZ A;  3TK1 A;  4AKR B;  5LJN A;  3KV6 A;  1X0T A;  3OJA A;  2IDB A;  4DT0 A;  4MN4 C;  3T1Y T;  2CHN A;  2MJZ A;  5FXZ A;  5FXW A;  4LF6 T;  1NTK G;  3ZYL A;  4AQF C;  4P0B A;  2RP4 A;  4BXL A;  5F5W A;  3QNU A;  3QOF A;  1Y47 A;  1NOH A;  3NMD A;  3ETV A;  1Q7Y Q;  1K8A Q;  3RYF E;  2FYN C;  3L72 E;  1SQP E;  2XJ7 A;  2JIW A;  2WCA A;  1NTZ G;  4U3F E;  1YKH B;  2E9X B;  4G63 A;  2QJY B;  3PUS A;  2E74 D;  2LKG A;  2DNX A;  1KFM A;  3AE3 C;  1SS1 A;  3P7I A;  3USS A;  5EZY E;  3KPE A;  4IDQ A;  4N78 E;  2ZT9 B;  2DHR A;  2I6H A;  5JRC B;  5JDH A;  3L4F A;  1UX4 A;  1X8Y A;  5APU A;  1HX8 A;  2JP3 A;  5ETW A;  3Q5R A;  1ZRT D;  1SQQ J;  4L75 A;  1DU2 A;  1R8E A;  2KSE A;  3LG7 A;  1MIV A;  2FBW C;  2JWA A;  1N34 T;  1NTZ K;  4WBO A;  2AEJ A;  2Y48 B;  4EV6 A;  1FJP A;  3O6Q A;  2LEH A;  2IHR 1;  5TAO A;  2M3E A;  1T72 A;  1IC2 A;  3KZI H;  3M9H A;  1KB9 D;  3GMI A;  4I7Z B;  1FOS F;  3NZQ A;  2I0M A;  4JEH B;  4YTN A;  2H7O A;  4BWN A;  5CHX A;  3KXD A;  3CWB G;  1ZRT E;  4HB1 A;  1YQ4 A;  2D2C C;  4JI1 T;  3VU7 H;  2X9X A;  4O4J E;  1HJB A;  2R5B A;  4X66 T;  3E22 E;  5AQV B;  2P58 A;  3M0D A;  3N4X A;  1LTI C;  3Q5X A;  1LNQ A;  1OVV A;  4HKZ H;  1HNW T;  1EDI A;  3H1H G;  1EQ7 A;  3ZYM A;  3ONJ A;  2IBZ D;  1LTS C;  4ILB A;  2M5A A;  3IFM A;  4OVN F;  3ZYK A;  3CXH D;  1ZV4 X;  3PHL A;  1ZOY A;  4CPG A;  2VVN A;  3CQG B;  3NVO A;  5L3D B;  2YU2 A;  3EDU A;  1ZW0 A;  5GTH H;  2H8P D;  1LTJ B;  5LMN T;  2YO2 A;  2E9X A;  3P4W A;  1CI6 B;  1KB9 I;  3HKE E;  3O1H A;  2I1J A;  2YMK A;  4M1P A;  5LGU B;  1ZLL A;  4YLH A;  3SWY A;  1JO5 A;  1QL1 A;  4D6T E;  1YI2 P;  3A5T A;  2FKW B;  4C7N A;  3ESL A;  2HYN A;  2Q9Q D;  3UUM A;  2OYH C;  1SQQ E;  2AXT H;  2UWJ E;  3ZT5 A;  1S5L E;  1JY3 O;  2QG4 A;  1X79 B;  3FZL B;  5KJ7 A;  3E1R A;  2J62 A;  4QHO A;  3PJA A;  1QX8 A;  3L74 J;  3HE4 A;  4H44 C;  2OYI A;  3AA0 B;  1MUU A;  3CQX C;  3JAF A;  1RH5 B;  4PFO A;  2HR3 A;  3N2G E;  3CCS P;  1SQP G;  3NXS A;  2V6Y B;  1U7M A;  3CPW O;  5AQK B;  1OX3 A;  3TNU B;  2C0S A;  4MBQ A;  1MFT A;  2C0W A;  3RK3 E;  1WRG A;  1US7 B;  3ZMV B;  5KMG P;  4IL9 A;  3M91 A;  3L74 E;  2X66 A;  5KKZ C;  4L73 A;  4ZZB A;  2ZLY A;  3AXJ B;  3TGU D;  2VUR A;  2JR8 A;  3RK3 C;  3X1D A;  4AKI A;  2FJD A;  1E5W A;  1GK6 A;  1EZV G;  1WYC A;  3IBP A;  3MTU E;  3KZI E;  3OW2 O;  2NR4 A;  2V7Q J;  3FZM B;  3EVY A;  2BBH A;  2VAS A;  2XSB A;  4H0L D;  3FGA D;  4LF9 T;  2BCC J;  4W7Y A;  4NPD A;  2PAJ A;  2OA5 A;  3QUJ A;  3L75 D;  3LSV A;  4CXY A;  4DOJ A;  4KI0 F;  1EC5 A;  1PV3 A;  4YXD A;  2Y0C A;  2E5Y A;  3S4U A;  3TGU E;  4GT1 A;  3CX8 B;  1NTZ D;  4PV1 C;  2KMF A;  1S94 A;  1Z56 A;  2IBZ G;  2FYZ A;  4U72 A;  5L3C B;  4XFJ A;  1W0A A;  5AQI B;  2IUB A;  4AIS A;  2V7L A;  5APT A;  4TNW A;  3II6 A;  1PGP A;  3TGU G;  1KQL A;  2A2F X;  3B13 A;  3M65 A;  4XZC A;  3MP7 B;  3WMM 0;  2QVA A;  5B66 E;  2FJA A;  1D0Y A;  5AW8 B;  5KLV J;  1NTK J;  1T7S A;  3K1S A;  1MMD A;  3GA8 A;  3AED C;  2G3A A;  4EYY Q;  2WAU A;  2UUC T;  2ZFC A;  2BBJ A;  4FJO A;  4U33 A;  5LXT E;  4ZZC A;  1QL2 A;  5HEU A;  1IJ6 A;  5LYJ E;  4X20 E;  3EDV A;  5K5G B;  4EED A;  2CHO A;  4UEL A;  3AE7 A;  3AEG C;  3RQU A;  3CIR A;  3VP8 A;  1GDT A;  4AKH A;  3TNU A;  2V6Y A;  3H32 A;  3RRC A;  3TLW A;  4L0R A;  2HHH T;  3ZC0 A;  3NRY A;  1YHQ P;  2IBZ E;  2BEZ F;  2XU6 A;  3CI9 A;  3CWZ B;  4ZI2 D;  5LG3 A;  2OTK E;  4DV7 T;  3AE8 A;  1ZKE A;  2PJQ A;  4UB6 E;  2PGD A;  1D1B A;  4HFC A;  1Q90 D;  3BCC J;  1J5W A;  1IFM A;  3HD7 D;  4HFD A;  5HWY A;  4ASW A;  3C98 B;  3GF7 A;  1I6Z A;  5APW A;  4TZ4 C;  4I55 E;  5LGT B;  3L72 D;  2YIN A;  2CPB A;  3GHG A;  4U7I A;  4JI5 T;  3ZC1 A;  4YSZ A;  3JAD A;  4B6X A;  1FDO A;  3H1L G;  1U7J A;  1FZE A;  4IST A;  1S4X A;  4IE4 A;  2KXP B;  1L4A C;  1T6A A;  3ZCJ A;  1SQP J;  3A0B E;  1FIO A;  2YEV C;  4WBN E;  4JYC A;  5HEO A;  3AE9 C;  1RY3 A;  2W63 A;  3M0A A;  3C50 A;  4PJJ A;  2LSJ A;  4ASV A;  1AQ5 A;  2FJB A;  1WLX A;  3HKD E;  5KLI C;  5LHG B;  1FZC B;  1JNZ A;  3SWF A;  1H8A A;  1FBM A;  4XAX B;  4IL6 X;  2AE9 A;  1PGJ A;  2Z6E A;  3FBL A;  3ZCI A;  2VQF T;  3CX5 H;  5KDM C;  4C46 A;  2Y9Y A;  2PTF A;  2Q1K A;  3K8P C;  2WU2 A;  4HFE A;  1KNP A;  3VTP C;  3L39 A;  1NTM K;  1JMB A;  1VL2 A;  1OED C;  1GL2 D;  4IDN A;  1NTZ E;  2DW3 A;  3SFE C;  4U2Z A;  4UVB B;  1N73 A;  1IBL T;  4YTM A;  1BGY E;  5AVR B;  3ABV A;  4ZI3 D;  3RIU C;  2JWD A;  3OJA B;  3I9W A;  3I56 P;  3KBU A;  4WNK A;  4IL4 A;  1KIL B;  4Y99 B;  1MMA A;  3CX5 D;  5FL0 A;  1JY2 P;  1AJ3 A;  3O9X A;  3JCF A;  1UII A;  2KI7 B;  1ZR4 A;  2IX7 C;  3RC8 A;  3AEC C;  2O1J A;  5KAI H;  1YJ9 P;  2W61 A;  1EDJ A;  5JTG A;  1N36 T;  2E76 C;  1CI6 A;  2BEQ D;  3EFG A;  1NWQ A;  3RBX A;  4C91 A;  2KUB A;  4YHJ A;  3T1H T;  1H0T A;  1M7K A;  4PNI A;  1UIX A;  5EK3 A;  3SFD A;  4DV2 T;  5J2T E;  4O8S A;  1L2P A;  1L0V A;  2M5A B;  4PFP A;  1OFC X;  2WSF J;  4TV9 E;  2V7M A;  1XWM A;  2H7V C;  5H2F H;  2POH A;  1FE6 A;  1JY3 P;  2CWO A;  5AQH B;  4QXC B;  5AW5 B;  1GQE A;  3BK9 A;  4O9B A;  4NXN T;  3CWB J;  3JSV C;  4N6J A;  3OPC A;  1MIW A;  3RPU A;  3HD7 A;  1NU1 K;  4C7R A;  2QA4 P;  4BAY B;  1SQP K;  1E2A A;  1OED A;  4GDO A;  4BA9 A;  3AE3 A;  1KN7 A;  4LFA T;  2KND A;  4O4L E;  3V4Q A;  4LGD E;  1QVG O;  4IIJ E;  2XQ9 A;  1MV8 A;  3RLF F;  1FZF A;  1P84 E;  4JLE A;  1K05 A;  4LF5 T;  3BRV B;  4JF7 A;  1L0N D;  1IFP A;  3TKL B;  3ONX A;  2O01 H;  4ZNC A;  5AQG B;  1KNZ A;  1B7T A;  1M1J A;  1EZV D;  3H1I D;  2V1D B;  3QK6 A;  1XTG B;  2R5D A;  3RL0 g;  3D71 A;  2IFM A;  2P10 A;  5AQN B;  1OIP A;  1L0L G;  4H9N C;  1T2K C;  1SQX E;  5HWX A;  3WU2 H;  4OGQ B;  4IGU A;  2FYU D;  2KIN B;  2XAJ B;  2X0H A;  4RES B;  1ZEE A;  4EZ4 A;  2WZH A;  1OWA A;  5AW6 B;  4JBW F;  3SFD C;  5FL1 A;  3H37 A;  5FNV E;  4CN4 A;  3CX7 B;  4YJ3 E;  1N7S C;  1MMN A;  1G2C B;  1LTB C;  5C3J A;  3E7K A;  3AE7 C;  4H9S E;  1ZR2 A;  2HPC B;  4PK4 A;  5AQF B;  5JDM A;  1WT6 A;  2ZT9 D;  1AV1 A;  2XV5 A;  5E79 H;  2NP9 A;  3TLV A;  3L09 A;  2X0Y A;  1NAY A;  2XNX A;  5DQW A;  4K35 A;  5C2T A;  3U78 A;  4YXD C;  5L3E B;  1OW6 A;  3UFG A;  4YTP C;  1G8X A;  4U7J A;  4TNV A;  3EHZ A;  4UV9 B;  1DD3 A;  1NTM E;  1FAV A;  4NPE A;  1LP1 B;  3BRT B;  3PLN A;  3CWB D;  5CJ0 A;  3RKG A;  3PU3 A;  3V2N A;  2NW7 A;  2WSC H;  3CC7 P;  4HN9 A;  1X79 A;  2WU5 A;  4GYS A;  3HTK A;  4MAL A;  2V7I A;  2D2S A;  1S2E A;  3CCR P;  1KB9 H;  4F6R C;  4YSX A;  1OW8 A;  3A7M A;  5CA0 E;  5JR9 A;  2B9B A;  4JUY A;  1XTC C;  1VQL P;  3A3Y B;  1KK7 A;  1LKX A;  2Y9Z A;  4LC1 A;  2K9J A;  2NTY A;  2A06 G;  1RF1 B;  4D6T J;  2KYV A;  1PL5 A;  3ZT7 A;  2JMK A;  5CGM A;  2KSJ A;  1BR1 A;  2K48 A;  3AA6 B;  4EIJ A;  2WP9 A;  4KX6 A;  4ZS3 A;  2NTX A;  5FVL A;  1WCR A;  4IT4 A;  4IHJ E;  3B5N C;  5KLV G;  2V5C A;  4GKG A;  2CMR A;  2IC9 A;  2VWA A;  5CB4 E;  2V7K A;  1MFZ A;  1PFI A;  1CZQ A;  1T8Z A;  1SVF A;  5CCG D;  2KT9 A;  4IE0 A;  2HPJ A;  5KLI B;  5BR8 T;  1S72 P;  4WW0 A;  3FZH B;  3ABV C;  4CXW A;  2X9Y A;  3H1K D;  2ODU A;  3Q5D A;  1SQP D;  3AAA B;  3AEA A;  1PPJ E;  4GKK T;  3L74 G;  2C5J A;  1HNZ T;  3HD7 B;  2RA1 A;  4HE8 A;  2FBW A;  2XUE A;  2D9D A;  2WZI A;  1VQ9 P;  1EXJ A;  5KLV E;  2ITA A;  1ZME C;  4IE5 A;  2KLV A;  3AE1 A;  3AEF C;  1R8I A;  4PD4 H;  3G4S P;  2GUS A;  1NHL A;  2CK3 H;  3I9Y A;  4IRE A;  2W66 A;  3LBX A;  2UXN B;  3I0Q A;  5CA1 E;  2J47 A;  3AB3 B;  4NXM T;  1HJ0 A;  3AEE A;  2W90 A;  2OV9 A;  4ZI7 E;  2YKO A;  1URQ B;  1KYO E;  2SPZ A;  4I43 B;  3H1H J;  2LXB A;  3ZMS B;  5ABE A;  1KIL D;  1LVK A;  5AQR B;  5GTH E;  1FEW A;  3F2E A;  3L73 G;  2ODV A;  4CI3 B;  5CBN A;  2XQ7 A;  3H1H E;  5HAX A;  5H2F E;  1ZN5 A;  2QJK C;  1UUS A;  5IHY A;  4DBR A;  3CLQ A;  1A02 F;  1HS7 A;  4RJT A;  3GHG C;  3L73 E;  3H3M A;  1LRZ A;  2H3R A;  5AQU B;  2YXQ B;  1UK5 A;  5HCM A;  2RH0 A;  3OYZ A;  2D0T A;  2M67 A;  4AI6 A;  2UUA T;  4BRY B;  1LT9 C;  1A02 J;  4NIQ A;  4I7Z C;  1S9K D;  1OVR A;  1NTM J;  2ZM8 A;  5LOV E;  2QJP B;  1U57 A;  3FBZ A;  3LBX B;  4COF A;  4DBQ A;  1D0X A;  5J2U E;  3UUN A;  1OVU A;  2W6B A;  4DMW A;  3OYX A;  3UUX B;  4AYC A;  1Y01 A;  3MXZ A;  2MKV A;  4PD4 I;  1K04 A;  1SP4 A;  5KJ7 C;  3Q5S A;  3CX6 B;  3IF8 B;  3U3I A;  1KFN A;  4AQR D;  3W67 A;  5CCH C;  3KBT A;  3JC6 C;  5HEH A;  2JRK A;  3JCU H;  3V5B A;  2Q5U A;  5AVX B;  2IIU A;  4LFB T;  2W6A A;  2KLQ A;  3PJS K;  3CML A;  3PUZ F;  1FZA A;  2VL8 A;  3V2R A;  3L74 D;  5FKY A;  2XZE A;  5TJH A;  1L0N E;  5KKZ B;  3MZK B;  5JDG A;  3ANW B;  3RK3 D;  3L72 G;  4YXW H;  2OLT A;  2WQY A;  3M3Z B;  4H9R C;  3OKQ A;  2W67 A;  3DJB A;  3CMA P;  1QVF O;  3VMY A;  1SQX K;  3WI3 A;  3AAE B;  3L70 G;  4TT3 H;  3E0Z A;  2DI4 A;  1L0N J;  5JH7 E;  4DR2 T;  2XHE B;  1TU3 F;  4H0L C;  5LBM A;  2M6B A;  3HI2 A;  3RIF A;  2AXT E;  2WSC J;  1Q86 Q;  4IE6 A;  2BVM A;  2WDR A;  1GU5 A;  1URQ C;  1D1A A;  1MMG A;  5AW0 B;  1UGO A;  1VQ6 P;  2FFD B;  1HG2 A;  3KYQ A;  2C5I T;  5CCG A;  3PUG A;  1BE3 J;  2J5U A;  3C4W A;  3L73 D;  3RQW A;  1VQO P;  5AW1 B;  1VDF A;  2KLU A;  1L4A B;  3GLM A;  1SQB G;  1SQB J;  3CCQ P;  3IR9 A;  3MHV A;  1HCI A;  1NEN A;  2N9Y B;  1KV4 A;  1FMW A;  2BKO A;  4TWD A;  4CN6 A;  2HOD B;  4NPF X;  3H1K E;  1NU1 G;  2E2A A;  4YY3 T;  2K37 A;  5AVT B;  2IDO B;  4UB6 H;  2Z5H A;  1FZC A;  3Q5E A;  1SQB E;  3NFQ A;  1KZU B;  3H1L E;  2WTY A;  3UUL A;  4X1K E;  5LGN B;  4AKG A;  2I59 A;  4WY4 D;  4PK6 A;  1LTJ C;  3O1I A;  2IML A;  4UF0 B;  4IL6 H;  1N8R Q;  3Q5W A;  1DEE G;  3BAT A;  2QSI A;  1FS0 E;  4P09 A;  3ZT6 A;  3N9O A;  4JI3 T;  3KDS E;  2YIU C;  3I5C A;  5APV A;  1RE4 C;  2RPA A;  1O3X A;  1YQ3 A;  1MND A;  2KZ7 B;  2H88 C;  4V1A v;  4EOT A;  3MD0 A;  4DR1 T;  1KFY A;  1LWU B;  5FXV A;  2SPC A;  2XAG B;  2RN0 A;  3ZSS A;  4AIU A;  3Q1M A;  1D0Z A;  3RRW A;  1MIY A;  3UQ7 A;  1SQV K;  2A9U A;  3L37 A;  4WYV A;  5AVZ B;  2E43 A;  1VOM A;  1YQ4 C;  2IZ0 A;  3WAJ A;  1WR6 A;  1PP9 D;  2K9J B;  3K3O A;  4DVD A;  5LHI B;  1JB0 J;  3CX5 I;  3L75 J;  3RK2 C;  5H6Q B;  3Q3D A;  2AXC A;  3L70 J;  5AQJ B;  4X65 T;  3S4R A;  1Q2N A;  1BGY D;  1FMV A;  2WSE H;  5AVW B;  2K9Y A;  2XQ3 A;  4OH8 B;  3OA7 A;  2B76 A;  3S1K A;  1LTA C;  3R6N A;  2K5B B;  3KIN B;  2XAF B;  3ZDM A;  2GA1 A;  2LXC B;  1L4A A;  5IYZ E;  1EDL A;  4JI0 T;  5GTI E;  4G2A A;  2XZR A;  1IO4 A;  1VPC A;  3D6Y A;  4UR9 A;  3A5X A;  1LT9 B;  3HKB E;  2WSF H;  3PU8 A;  5DAB A;  1SQV G;  1NKN A;  3CCU P;  4BJM A;  3LW5 H;  1M56 D;  3HA4 A;  5APS A;  2A45 G;  3FWN A;  1L0N K;  1VF5 C;  2XM1 A;  4F8H A;  2NZ2 A;  1KNR A;  1PP9 G;  3KHU A;  3FX0 A;  1Y8A A;  3H1L D;  2D5U A;  2QJY C;  2XTL A;  3BQL A;  1FDM A;  3GHG B;  1SFC D;  3PUY F;  2GM4 A;  5HYA A;  4GOU A;  4KHZ F;  1R5S A;  3KFW X;  3OVU A;  3HTK B;  2WT7 A;  4ZI3 C;  4DR4 T;  3I55 P;  1SQX D;  1AFO A;  1VCS A;  3HUS B;  2FY8 A;  4HEA A;  4YFS A;  3UTK A;  2JEE A;  3WU2 E;  3CK6 A;  4AKL A;  2N2N A;  4EDF A;  5A1L A;  1ZP0 A;  1VQ7 P;  2NRG A;  1VQP P;  3RX6 A;  1XDP A;  3R2P A;  2BAS A;  2J58 A;  3AE6 C;  4IFF A;  4JQ0 D;  3CKD A;  1HH0 A;  2V7Q H;  4IFD K;  2D0U A;  3ZJ1 A;  1OW7 A;  3L36 A;  2IW5 B;  2E76 D;  2E5L T;  3N9N A;  2R32 A;  1HFA A;  3HE5 B;  5CFB A;  4WBA A;  1NWM X;  1X9V A;  4DV4 T;  1PP9 J;  3K3Q C;  4ERR A;  1AQT A;  4QH5 A;  2ES0 A;  2M8R A;  4EYY R;  1GL2 B;  4NPP A;  2E75 C;  2FYU E;  1NTK K;  4HH2 A;  3N7N A;  4U7Y A;  3DP7 A;  4R4M A;  2WZ7 A;  1YTZ I;  1JUN A;  2LR2 A;  1N2D C;  2E9X C;  3CCV P;  3QH9 A;  4PD4 E;  4B3S T;  4NUV A;  2I8D A;  2KNC A;  3H1J D;  1G73 A;  3KV9 A;  4WY4 A;  1WMK A;  4LMK A;  2JKV A;  3C51 A;  5J0Z A;  3M9B A;  1RHZ B;  2YXR B;  3SS1 A;  5IUX A;  3G06 A;  2N1T C;  1R5L A;  3MA9 A;  2HPC A;  3PP5 A;  5E0O A;  1W9R A;  1HR0 T;  4KHX A;  2VB6 A;  4I6M C;  3CXH E;  4P0A A;  2JQ9 A;  1BR0 A;  1YKE B;  1SQV E;  3C9I A;  5KX5 E;  4QXB B;  1HF9 A;  1OXZ A;  1OZH A;  4IDZ A;  4PW8 A;  2FYU G;  3ZPO A;  1SQV D;  5DJQ C;  3H1J J;  2JPF A;  2OYH B;  2E75 B;  1N86 A;  5APY A;  5AQP B;  4NUU A;  2WWV A;  3N5L A;  2X67 A;  2KP8 A;  4OHF A;  2P9B A;  4A97 A;  4UVA B;  2L9Q A;  3L35 A;  3L70 D;  5HXS A;  2UXD T;  1BCC G;  3W15 B;  1YW0 A;  3FWL A;  5LG4 A;  3M0D C;  2O01 N;  4GOD A;  4HFH A;  1VQM P;  3W68 A;  5ABG A;  5FYM A;  2LJL A;  2YMY A;  5FY7 A;  1SQX G;  3G6E P;  3QB5 K;  1DD4 A;  2UU9 T;  1LTT C;  3N2O A;  5HXE A;  2EHO D;  4X62 T;  1CSB A;  1PP9 E;  5LCY A;  4JI8 T;  2ZXE B;  2LKH A;  3A0H H;  2G8Y A;  3LK4 2;  5B5E E;  1PZQ A;  1H89 A;  2PFX A;  1URQ A;  1Q81 Q;  1XDO A;  2Y0D A;  3WUU A;  2E74 C;  2FJE A;  1YQ3 C;  5C8Y E;  4LFC T;  3FXD A;  1JOC A;  2H7H A;  4O4I E;  1KTM A;  1KB9 E;  2BCC D;  5HXC A;  3UUB A;  4GKJ T;  5L3F B;  4DMV A;  1H7C A;  3RI5 A;  3QB5 A;  3MJX A;  4JYB A;  2Q7C A;  4ILU A;  1G2C A;  3CQC B;  3HE5 A;  3AVR A;  4WB4 A;  2OYH A;  1L0L J;  2XPK A;  1S35 A;  4L9I A;  3VHL A;  2MPK A;  1SFC A;  1SLQ A;  1H0T B;  1E7P A;  2XQ4 A;  2LKM A;  2XAS B;  2XAH B;  4DV3 T;  5AVS B;  3KV5 A;  2WY2 A;  1VCT A;  2F4V T;  1NGM B;  2Q6Q A;  1HNX T;  2V4H A;  3H1J G;  1L0L E;  2WT7 B;  2NPS A;  3B71 A;  3HUS A;  5KLV D;  3H25 A;  3A2A A;  1RE4 A;  4EOZ B;  1KQF B;  2D2C D;  2WSS H;  2VVS A;  3MAC A;  4OX9 T;  2NW8 A;  2Y8D A;  3MKD A;  2BCC G;  3ZN0 B;  2CM0 A;  4EYU A;  3K3N A;  1KIL A;  1WR0 A;  4IL6 E;  4DND A;  4CI2 B;  2X0L B;  3LDQ B;  2WPR A;  3O1J A;  3P50 A;  4GK5 E;  1SQQ K;  4Y99 C;  4U31 A;  2LHR A;  1AA0 A;  3RK2 B;  2M0B A;  3B5N D;  5L8R J;  4Z91 A;  4AQG A;  1OED E;  1G1J A;  2OQQ A;  1NAF A;  1GL2 A;  5JVD E;  2KOG A;  2QJK B;  3L71 J;  2MBG A;  2BG9 A;  1LWU C;  3EUH A;  2XY8 B;  4ZXL A;  3VMX A;  4QMA A;  4ISS A;  1IJ5 A;  2JJ9 A;  1KD1 Q;  2A45 I;  5JRE A;  3IF4 A;  2Q3E A;  3RL0 C;  1VRB A;  2MOZ A;  3T8O A;  2JQK A;  2JQQ A;  2XQ6 A;  2BCC E;  2OTL P;  3UU4 A;  3UU3 A;  3RHW A;  1IFJ A;  2WMM A;  4PJN A;  1SQV J;  3G71 P;  1VQ4 P;  5JDN A;  4LMJ A;  1NVO A;  3P7K A;  4M3L A;  3GMA A;  5AQM B;  2IBZ I;  1JNR A;  3B4S A;  5B5E H;  4H44 D;  1EZ3 A;  2YDS A;  3AE5 C;  1KQG B;  2KS1 A;  2OYO A;  4OGQ D;  1NKZ B;  3Q2M A;  1J1E B;  2V26 A;  4FI5 A;  1JY3 N;  5HEG A;  3AEG A;  2FUP A;  4CI1 B;  2B89 A;  1KIL C;  3JCU E;  3R84 B;  2VKJ A;  2FXP A;  3AEE C;  3LJC A;  2XDJ A;  4DZO A;  3AE9 A;  1FJG T;  2BKN A;  3F31 A;  4H63 V;  4MHC A;  5LBQ B;  2Q3I A;  1OED B;  3P8C D;  2OTJ P;  1KYO H;  1QLB A;  4DID B;  4PK5 A;  2LSY A;  1D7M A;  2Q9Q C;  4EXT A;  4HWI B;  1GMJ A;  4H0L B;  3B5M A;  5AW3 B;  1EZV E;  1W09 A;  3AEC A;  5JR9 B;  3ITK A;  1P84 I;  1S9K E;  3DTO A;  1T3U A;  2N9B A;  3P4S A;  2P7J A;  2WSE J;  3B5N B;  3CL3 D;  5H6R B;  2WB5 A;  3MUD A;  4ZHQ E;  4LML A;  1USE A;  5CJ4 A;  2LOP A;  2YOE A;  3CCE P;  2E5V A;  1SQQ G;  1QSD A;  1S5L H;  3PUQ A;  1M8O B;  2H89 C;  2LRK A;  2YDQ A;  3C4X A;  1AVY A;  3G3Z A;  3H1I E;  3AEB A;  4OYJ A;  3J9X 1;  4YHH T;  4TN7 B;  3AE4 A;  3FXE B;  3ZMU B;  1HTJ F;  2B87 A;  2O01 J;  3ZMZ B;  2Z5I A;  4TLF A;  2ZJS E;  4UVC B;  4HFI A;  4Z90 A;  2IAK A;  5ABH A;  4OWF A;  1T3J A;  5L4H A;  3JC6 D;  2DL1 A;  4WY4 B;  2YKS A;  3JAE A;  3PTZ A;  2XAQ B;  2FXO A;  1BDD A;  2NPS D;  1XNQ T;  4TUY E;  5KAF E;  2LM2 A;  1HX1 B;  2ZYG A;  3H1H D;  1M90 Q;  2IZ1 A;  3Q5P A;  1SA0 E;  3O4X E;  1JEK A;  3P4Q A;  3IHR A;  1LGH B;  1P84 H;  4Y28 J;  1LP1 A;  1K73 Q;  1IFD A;  1LT9 A;  1W2B O;  5LJM A;  2W4X A;  1SQQ D;  3AE2 A;  3L71 E;  2CLY C;  3V5U A;  2VKD A;  1FJK A;  3RL0 B;  4PV1 D;  4XBF B;  2XQ8 A;  1IFI A;  3B5N A;  3E1I A;  4GK0 E;  1GD2 E;  5ABF B;  1E79 H;  1W0B A;  1UCU A;  2XSA A;  2K88 A;  5LMU T;  1NU1 D;  5C39 A;  2OGU A;  2ACX A;  1M1J C;  3GW6 A;  2IYP A;  2P2U A;  2VL0 A;  2XQY A;  2WM9 A;  4HGA A;  2I1K A;  5HXR A;  5LHH B;  4H13 D;  3PJA J;  1U5P A;  2CPS A;  4DR3 T;  2XM2 A;  4I1L A;  1EXI A;  2BS2 A;  1HGZ A;  2QM7 A;  1M62 A;  5F8P A;  4HFB A;  2W00 A;  2KIK A;  4E7Z A;  2PRR A;  1L4A D;  2FYU J;  4B3R T;  5LB7 B;  3HKC E;  5FVK A;  2K24 A;  3O8Z A;  1KOR A;  2BVL A;  1NU1 J;  1BE3 E;  3TSI A;  2WMN A;  3AVS A;  3F5H A;  5AVU B;  3VRB A;  2IFN A;  2B1E A;  2Q9I A;  4ZI2 C;  3VOP A;  5KAI E;  1BCC E;  2W83 C;  3ZEF B;  3FXD B;  3GG2 A;  2V5D A;  1SQX J;  1J1D C;  1QUU A;  4A56 A;  4O4H E;  3SWH A;  4HWH A;  1BE3 G;  2FYU K;  2NPS B;  5BMV E;  1KYO D;  4HFV A;  2CA5 A;  1BCC J;  3TGU J;  2IC6 A;  5L47 A;  4R4L A;  3L8R A;  1YBK A;  3CC4 P;  4KT0 J;  3MK7 C;  2LT3 A;  3KDP B;  3KVA A;  2BS3 A;  3SOL A;  3U1A A;  2ZMA A;  1K9M Q;  2YDR A;  3ETU A;  1LVF A;  1RF0 A;  1IJD B;  4HWC A;  4EZH A;  1KQS O;  3NKZ A;  3AEF A;  4U3F D;  1GK4 A;  5AQL B;  4LF8 T;  1N7L A;  1IAP A;  4KJM A;  4JYA T;  4C90 A;  3FZK B;  3BCC D;  4EAH A;  3N9M A;  4DR6 T;  2L3L A;  4N78 D;  3RF1 A;  1E1H B;  2OYI B;  3C1L A;  1UX5 A;  1QEX A;  4ZS2 A;  5HCJ A;  1RF1 A;  4W7Z A;  2KB7 P;  1USD A;  2UXC T;  1JM0 A;  3VRA A;  3VR8 A;  1Z8U A;  3ZKR A;  3P8M C;  3V2Q A;  4A98 A;  1M57 D;  2CCQ A;  2VKH A;  1WYB A;  3AE5 A;  2WWW A;  2IPP A;  1FZG A;  1GL2 C;  5HEJ A;  4DO0 A;  2HG5 D;  3RBZ A;  3D6Z A;  2WWU A;  2UXB T;  3I0O A;  4I2L C;  2V7J A;  1HUC A;  3EFF K;  2W8Z A;  4X1I E;  2AEM A;  2B87 B;  2QRX A;  3T97 A;  4UIG A;  1Q82 Q;  4GIF A;  2ZYA A;  5GON E;  1HTL C;  1M1K Q;  2J1D G;  2W27 A;  3VYI A;  3Q2Y A;  5DQV A;  2XQ5 A;  3BQK A;  4A7P A;  1XMQ T;  3C8V A;  2Y6X A;  1BGY G;  4TV8 E;  2LSK A;  4A5X A;  4KBM B;  5JQG E;  2FXM A;  4Z1M H;  1HGV A;  1FU1 A;  2BS4 A;  4LF4 T;  4DUY T;  3V4W A;  4HKA A;  1S5L X;  2N1T B;  4ZEY A;  3HUS C;  4WZX A;  4RKU J;  2HOD A;  4XE5 B;  5KXJ A;  2CEA A;  2FYN B;  4J2C A;  2A06 D;  3VN0 A;  3CXH I;  2NOX A;  3IN6 A;  4PJM A;  1IZN B;  4LLH A;  3BQI A;  2KK7 A;  3L75 E;  3PUW F;  1N7S B;  1ZP0 C;  4IE7 A;  2JDI H;  3AA7 B;  4QH1 A;  5DJT B;  1ZXG A;  1HG5 A;  3IEE A;  1OMI A;  4DUZ T;  1Y9B A;  3MIW A;  1J1D B;  1T2K D;  1BR2 A;  2CXD A;  3H6P A;  1YTZ T;  4Q25 A;  4UV8 B;  5FY0 A;  2BG9 E;  2QGS A;  2WQY C;  5AQT B;  3SRZ A;  2CE7 A;  2RMZ A;  1JY2 O;  4CZZ B;  4WWI A;  4MFR A;  4Z8X A;  5ABF A;  1W2E A;  5LP6 E;  2KNC B;  3CX5 E;  3UT5 E;  1JCC A;  2QJP C;  2WMO A;  3FXE A;  3L71 D;  2L91 A;  1KEY A;  1SQB K;  2ZT9 C;  2R6G F;  4PJ0 H;  4ASK A;  2XQA A;  4EEB A;  3RGU A;  4P1N A;  4HJG H;  4QXH B;  5BU5 A;  5KLV K;  2N9D A;  1XMO T;  2N1T D;  2W6J H;  1SE7 A;  4I0U A;  3T97 B;  4EB6 E;  3H1L J;  4EIW A;  4TX5 A;  3NBX X;  3P8C E;  4OK0 A;  2KZI A;  1G1I A;  3EAM A;  3VKG A;  2QIW A;  1PPJ G;  1IK7 A;  3AE4 C;  3LIE A;  1PIX A;  1M1J B;  3IA3 A;  1IFN A;  2CWY A;  2BZB A;  1T8B A;  1WFD A;  2DWG A;  3FHN A;  4B86 A;  4ZKU A;  1NTZ J;  2VK9 A;  2DCF A;  4EGW A;  2P67 A;  3SFE A;  1VF5 B;  3CCL P;  1PGO A;  3ONL C;  3PTR B;  2A45 H;  5LA6 E;  5EK2 A;  3WAK A;  1LTJ A;  1FOS E;  4AXP A;  1BSH A;  1KIL E;  2DWK A;  1N73 B;  1SUM B;  3K5B A;  5TIS E;  1NTK D;  3UFE A;  2HN2 A;  4OYK A;  2L5G B;  4PV1 B;  1GU4 A;  3P4P A;  2XKM A;  2UXX B;  1N7S A;  1S1C X;  2WDQ A;  3S9O A;  4PD4 D;  2Y0E A;  3LW5 J;  5J1G A;  2WIT A;  3BVH A;  2WPS A;  1RE3 C;  2Z4E A;  2CBI A;  2EHO C;  1PPJ D;  4QH4 A;  1DH3 A;  3ZST A;  1RQU A;  3Q9D A;  3V5S A;  1Y64 B;  1GZL A;  4I50 E;  3A8Y C;  3RYC E;  3PDY A;  5JDF A;  4MLK A;  2FFD C;  5KAF H;  1YD8 G;  2C9N Y;  4QX7 B;  1QGK B;  5B66 H;  2HLO A;  4BRY A;  1UUR A;  4TWH A;  3PRJ A;  1HF8 A;  3RK3 B;  5TIS H;  4DV1 T;  4W80 A;  4ZOL E;  3U59 A;  4UB8 H;  5CJ5 A;  1X22 A;  5KTB A;  3V2P A;  2QEX P;  2LHN A;  3L72 J;  5JR9 C;  3SSU A;  2WSS V;  3PUX F;  5AW9 B;  2OAR A;  4CQI A;  1PGQ A;  2YIU B;  3KV4 A;  2ZM6 T;  1L0N G;  1NO4 A;  4WVZ A;  1GW4 A;  3TLT A;  5L3B B;  3VP9 A;  1Z0P A;  5L3G B;  2ZAE B;  2VQE T;  1IBK T;  4IDP A;  4YT0 A;  5CCH A;  3HE4 B;  5JDL A;  5APX A;  5JDQ A;  3B8E B;  3H1K J;  1CW5 A;  5LNK A;  1QLE D;  1VQK P;  2QA7 A;  5IWA T;  1L0L D;  2E76 B; 
#chains in the Genus database with same CATH homology
 3AAA B;  3NRX A;  3VU7 H;  2X9X A;  1T98 A;  4O4J E;  1HJB A;  2JMH A;  4P0A A;  1NAF A;  5FXX A;  2R5B A;  2C5J A;  5CCG C;  3E22 E;  1GL2 A;  3HD7 B;  2RA1 A;  2KOG A;  4HE8 A;  4JEU B;  5JVD E;  3M0D A;  2A3D A;  3N4X A;  1LTI C;  2XUE A;  3Q5X A;  2MBG A;  1LWU C;  1HBW A;  3EUH A;  4PJL A;  5AFU L;  1M7L A;  4IE5 A;  2KLV A;  3VMX A;  4ISS A;  1IJ5 A;  5AVQ B;  1EQ7 A;  2PP6 A;  3PE0 A;  4FJO A;  2JJ9 A;  2WBL A;  2N1T A;  2A45 I;  2GUS A;  1NHL A;  3I9Y A;  5JRE A;  4AKH A;  3RL0 C;  1VRB A;  2MOZ A;  3LBX A;  3T8O A;  3ZJ2 A;  3ZYM A;  2J59 M;  2JQQ A;  1LTS C;  2UXN B;  3I0Q A;  5CA1 E;  3IFM A;  3F57 A;  3GN5 B;  1ZV4 X;  3ZYK A;  5APQ A;  4HYT B;  3AB3 B;  2YNY A;  4ZI7 E;  1IFJ A;  2YKO A;  3CQG B;  1URQ B;  2P1J A;  2R3C A;  5AVY B;  1N73 C;  4PJN A;  4I43 B;  5L3D B;  5M4Y A;  2YU2 A;  2YO3 A;  3EDU A;  3ZMS B;  5HXH A;  5ADX L;  5JDN A;  2LSI A;  1KIL D;  1LVK A;  2H8P D;  3P7K A;  1LTJ B;  4M3L A;  4YJ2 E;  2YO2 A;  1FEW A;  2E9X A;  3AAI A;  3F2E A;  1CI6 B;  1GW3 A;  2ODV A;  3HKE E;  4HTE A;  4PAG A;  3O1H A;  4KUM B;  3RL0 D;  3RC3 A;  4CI3 B;  2I1J A;  1EZ3 A;  4M1P A;  5LGU B;  1ZLL A;  5HAX A;  3KQG A;  3ZN1 B;  3OBV E;  1ZN5 A;  4YLH A;  3SWY A;  1JO5 A;  5IHY A;  4GK0 E;  1QL1 A;  4DBR A;  1NKZ B;  3Q2M A;  3A5T A;  1J1E B;  2FKW B;  2V26 A;  3CLQ A;  4C7N A;  1A02 F;  1HS7 A;  2C5K T;  3GHG C;  2E8I A;  4FI5 A;  4U74 A;  1JY3 N;  1LRZ A;  2HYN A;  2Q9Q D;  3ESL A;  2H3R A;  3UUM A;  2OYH C;  4CI1 B;  3OYZ A;  3U1C A;  1KIL C;  2D0T A;  2M67 A;  2NWB A;  3OAK A;  1JY3 O;  4AI6 A;  1X79 B;  2VKJ A;  3LJC A;  3R84 B;  5KJ7 A;  2XDJ A;  4DZO A;  1BR4 A;  4QHO A;  1LT9 C;  1A02 J;  3HE4 A;  3AA1 B;  3F31 A;  4H63 H;  4H63 V;  2OYI A;  1S9K D;  3AA0 B;  4MHC A;  1MUU A;  5LBQ B;  3CQX C;  2Q3I A;  5BU8 B;  2ZM8 A;  5LOV E;  4PFO A;  3P8C D;  4GYR A;  3N2G E;  3PUA A;  5LP6 E;  5LXT E;  3NXS A;  3FBZ A;  2MTQ A;  4PK5 A;  2LSY A;  5AW4 B;  2Q9Q C;  4O2A E;  4EXT A;  3TNU B;  2C0S A;  4MBQ A;  3LBX B;  2C0W A;  3C64 A;  4DBQ A;  1D0X A;  5AW3 B;  5J2U E;  3UUN A;  1WRG A;  1US7 B;  3ZMV B;  4TV8 E;  5FMN A;  5JR9 B;  2W6B A;  4DMW A;  5KMG P;  3OYX A;  3M91 A;  3ANW A;  1S9K E;  3DTO A;  1T3U A;  2X66 A;  3UUX B;  2N9B A;  4AYC A;  2P7J A;  3B5N B;  3MXZ A;  3CL3 D;  2ZLY A;  1SP4 A;  5H6R B;  5KJ7 C;  3MUD A;  3RK3 C;  2X68 A;  4ZHQ E;  4AKI A;  2X9W A;  3CX6 B;  1E5W A;  5CJ4 A;  3IF8 B;  2HFE D;  1KFN A;  1GK6 A;  4AQR D;  2LOP A;  3U3I A;  5CCH C;  1WYC A;  3IBP A;  2YKP A;  3MTU E;  2KWI B;  1QSD A;  3JC6 C;  3KBT A;  1IK9 A;  2JRK A;  3PUQ A;  3EVY A;  3MGN A;  3V5B A;  2Q5U A;  3C4X A;  5AVX B;  2W6A A;  4N3Y B;  2KLQ A;  3G3Z A;  3N2K E;  2VAS A;  3CML A;  4OYJ A;  4CXX A;  3J9X 1;  2WPQ A;  4TN7 B;  1FZA A;  2Q9Q A;  2VL8 A;  3V2R A;  4W7Y A;  5AW2 B;  1ZHC A;  3FXE B;  3ZMU B;  1HTJ F;  3ZMZ B;  2PAJ A;  2Z5I A;  2OA5 A;  3QUJ A;  2K9A A;  5JDG A;  3MZK B;  4UVC B;  5CMZ A;  1U4Q A;  3ANW B;  5KJ7 D;  2IAK A;  3RK3 D;  2ZM2 A;  4CXY A;  4DOJ A;  4H9R C;  3OKQ A;  1T3J A;  4XA4 A;  5CCH D;  3VMY A;  3DJB A;  1SQX K;  3N9P A;  3S4U A;  3AAE B;  2H43 A;  4GT1 A;  3CX8 B;  3JC6 D;  4QX8 B;  3V5U A;  3WI3 A;  4WY4 B;  4IFM A;  3E0Z A;  2KMF A;  2CLY B;  2DI4 A;  1S94 A;  2XAQ B;  5JH7 E;  2NPS D;  1Z56 A;  2XHE B;  2FYZ A;  3I1A A;  4TUY E;  4U72 A;  5LBM A;  5L3C B;  3HI2 A;  2W0G A;  2C9L Y;  2V7L A;  5APT A;  2BVM A;  4GIW A;  1SA0 E;  3O4X E;  4IE6 A;  3II6 A;  1GU5 A;  1URQ C;  1D1A A;  1KQL A;  1LGH B;  2A2F X;  2CXF A;  1FZB A;  3B13 A;  3IHR A;  3M65 A;  3N9L A;  3WMM 0;  4UXN B;  1MMG A;  4XZC A;  5AW0 B;  2LM9 A;  1IFD A;  1LT9 A;  3EQ2 A;  3M9Q A;  1RF1 C;  5AW8 B;  3KYQ A;  2FFD B;  5CCG A;  1D0Y A;  1HG2 A;  2C5I T;  2LOS A;  3PUG A;  2CLY C;  1MMD A;  3C4W A;  3RYH E;  2G0U A;  1FJK A;  3RL0 B;  2LE8 A;  5AW1 B;  1VDF A;  4WY4 C;  2VKD A;  3GA8 A;  4XBF B;  1L4A B;  2NPS C;  2WAU A;  1RE3 A;  2EHO A;  2ZFC A;  1IFI A;  1L0L K;  3B5N A;  3E1I A;  3IR9 A;  1HCI A;  3LK2 B;  1QL2 A;  1GD2 E;  2PFV A;  1IJ6 A;  3P32 A;  1FMW A;  4X20 E;  5LYJ E;  1UCU A;  3EDV A;  2QM8 A;  2HOD B;  1CUN A;  3VKH A;  1URQ D;  2ACX A;  1M1J C;  4UEL A;  3HD7 C;  2P2U A;  2XQY A;  5AVT B;  2WM9 A;  4HGA A;  2I1K A;  2Z5H A;  3LID A;  3VP8 A;  1FZC A;  3TNU A;  1GDT A;  3H32 A;  2EHO B;  5HXR A;  3RRC A;  5LHH B;  3NFQ A;  2ZM0 A;  2M3B A;  1KZU B;  2WTY A;  4L0R A;  3UUL A;  1J2J B;  1U5P A;  3NRY A;  3ZC0 A;  4X1K E;  2CPS A;  2JJL A;  2FFD A;  2KWH A;  4WY4 D;  4PK6 A;  5LGN B;  4AKG A;  4I1L A;  2XU6 A;  3CI9 A;  3CWZ B;  4ZI2 D;  1LTJ C;  3O1I A;  1HGZ A;  1SFC B;  2QM7 A;  4UF0 B;  1ZKE A;  3Q5W A;  5F8P A;  3BAT A;  2W00 A;  5EK4 A;  3UIA A;  2PJQ A;  4E7Z A;  1D1B A;  4P09 A;  2HH7 A;  3N9O A;  1V9D A;  3KDS E;  1L4A D;  4K0U A;  5JDM A;  2O1K A;  1JCD A;  3I5C A;  1IFM A;  3HD7 D;  1RE4 C;  5APV A;  2K24 A;  3HKC E;  3QC9 A;  3C98 B;  1O3X A;  4O2B E;  3O8Z A;  5HWY A;  2KZ7 B;  1MND A;  3TYY A;  5APW A;  2BVL A;  4TZ4 C;  4I55 E;  4KP3 C;  4V1A v;  4EOT A;  2HPL A;  2N1G A;  5LGT B;  3TSI A;  3MD0 A;  2WMN A;  2YIN A;  3AVS A;  2CPB A;  3GHG A;  1LWU B;  5AVU B;  3ZC1 A;  3CVR A;  2SPC A;  2IFN A;  2B1E A;  2Q9I A;  1LWU A;  2XAG B;  3VOP A;  2YK0 A;  5FXV A;  4ZI2 C;  4B6X A;  1FZC C;  1D0Z A;  4ANJ A;  3RRW A;  3ZEF B;  1FZE A;  3RK2 D;  1MIY A;  3FXD B;  4IST A;  4IE4 A;  1J1D C;  1QUU A;  4UEM A;  4A56 A;  4O4H E;  3SWH A;  1SQV K;  2KXP B;  2FYU K;  1L4A C;  2NPS B;  3C4Z A;  5BMV E;  2YU1 A;  4H9P C;  3ZCJ A;  3L37 A;  1FIO A;  1DEB A;  2YEV C;  4WBN E;  4JYC A;  5AVZ B;  2E43 A;  2CA5 A;  4HFV A;  1VOM A;  1RY3 A;  2IC6 A;  2W63 A;  3M0A A;  3WAJ A;  3C50 A;  1WR6 A;  4E7S A;  4PJJ A;  2LSJ A;  3MK7 C;  1AQ5 A;  2LT3 A;  3KDP B;  3K3O A;  3KVA A;  3KVB A;  4QKN A;  3NTN A;  4DVD A;  5LHI B;  3SOL A;  1JY2 N;  3U1A A;  1GTW A;  1WLX A;  3HKD E;  3RK2 C;  3A7O A;  1FZC B;  2ZMA A;  5LHG B;  3SWF A;  3ETU A;  5H6Q B;  1J1E C;  3H32 B;  1H8A A;  1FBM A;  5BVZ A;  1RF0 A;  1JNM A;  1LVF A;  1IJD B;  3FB2 A;  4XAX B;  1SHZ C;  4I4T E;  1FMV A;  2Z6E A;  3FBL A;  2WSE H;  5AVW B;  3ZCI A;  4EZH A;  5KDM C;  4C46 A;  4OH8 B;  3OA7 A;  1GK4 A;  4OFZ A;  5AVV B;  4KMC A;  1LTA C;  3R6N A;  2K5B B;  3K8P C;  3KIN B;  2XAF B;  5F3J A;  1MNE A;  1N7L A;  1IAP A;  3VTP C;  5IYZ E;  1L4A A;  5FY1 A;  4G2A A;  4C90 A;  1NTM K;  2GK9 A;  4EAH A;  2XZR A;  1IO4 A;  4ZKP A;  1VPC A;  2L3L A;  1GL2 D;  3N9M A;  4N78 D;  5JRC A;  4UVB B;  1E1H B;  1N73 A;  2OYI B;  3A5X A;  1HVV A;  1LT9 B;  5AVR B;  1UX5 A;  2WSF H;  1RF1 A;  2L8K A;  3HKB E;  3PU8 A;  4W7Z A;  2LSG A;  2X51 A;  5DAB A;  1NKN A;  2KB7 P;  3B57 A;  4UF0 A;  3ZMT B;  4BJM A;  3LW5 H;  4ZI3 D;  3HA4 A;  5APS A;  2A45 G;  3OJA B;  1L0N K;  3P8M C;  1JMM A;  3V2Q A;  3I9W A;  3KBU A;  5AW7 B;  4WNK A;  2CCQ A;  2VKH A;  1ZV8 A;  1KIL B;  4Y99 B;  1MMA A;  1WYB A;  1JY2 P;  2WWW A;  2D5U A;  2XTL A;  3BQL A;  3O9X A;  1AJ3 A;  2IPP A;  1FZG A;  1GL2 C;  1DX7 A;  1FDM A;  3GHG B;  2DLR A;  1SFC D;  2GM4 A;  2CXL A;  2PBI A;  4DO0 A;  5HYA A;  2HG5 D;  4GOU A;  3E08 A;  1ZR4 A;  2WWU A;  2IX7 C;  3KFW X;  3I0O A;  4I2L C;  4BJN A;  2O1J A;  2V7J A;  3RC8 A;  3HTK B;  2W61 A;  2C0X A;  1HUC A;  2WT7 A;  4ZI3 C;  1D1C A;  1AFO A;  4X1I E;  3HUS B;  4HEA A;  4UIG A;  3T97 A;  1CI6 A;  4QWN B;  3PUR A;  4YFS A;  4X1Y E;  2JEE A;  3EFG A;  4GIF A;  1NWQ A;  1JTH A;  2BDE A;  2W62 A;  4AKL A;  4C91 A;  2N2N A;  5GON E;  1HTL C;  4YHJ A;  4L5G A;  3RH3 A;  5A1L A;  2J1D G;  2W27 A;  3VYI A;  1HWT C;  4PNI A;  5DQV A;  3D0T A;  5EK3 A;  3BQK A;  3RX6 A;  2NW9 A;  1SFC C;  3R2P A;  5J2T E;  2BAS A;  2J58 A;  4IFF A;  2Y6X A;  3CKD A;  4O8S A;  1HH0 A;  2LSK A;  4IFD K;  2D0U A;  3NZP A;  4PFP A;  3ZJ1 A;  5LJM A;  1JTH B;  3L36 A;  4KBM B;  5JQG E;  2FXM A;  4TV9 E;  5FP3 A;  2IW5 B;  2V7M A;  1HGV A;  1FU1 A;  3V4W A;  2H7V C;  3N9N A;  4HKA A;  2N1T B;  2R32 A;  1HFA A;  3HE5 B;  3HUS C;  3L3P A;  2POH A;  4WBA A;  1NH4 A;  1NWM X;  1X9V A;  1JY3 P;  2CWO A;  3RYI E;  4QXC B;  2HOD A;  1WRD A;  4XE5 B;  3GWH A;  2CEA A;  3K3Q C;  5AW5 B;  3BK9 A;  4ERR A;  4O9B A;  4J2C A;  3VN0 A;  2ES0 A;  3HRN A;  4N6J A;  2NOX A;  2M8R A;  4PJM A;  4EYY R;  4LLH A;  1IZN B;  1MIW A;  3BQI A;  3RPU A;  1GL2 B;  3HD7 A;  1NU1 K;  4C7R A;  3J7Y q;  2VKO A;  3BAS A;  3ZLI A;  1N7S B;  1NTK K;  3W15 B;  4HH2 A;  4BAY B;  1SQP K;  3N7N A;  4IE7 A;  3DP7 A;  3AA7 B;  4BA9 A;  2WZ7 A;  4AUW A;  4H9O C;  2A72 A;  1YTZ I;  1HG5 A;  2KND A;  4O4L E;  2OYI C;  3V4Q A;  3IEE A;  1JUN A;  1N2D C;  4LGD E;  2E9X C;  4IIJ E;  3H3A A;  3MIW A;  4NUV A;  1MV8 A;  1FZF A;  1J1D B;  1T2K D;  1BR2 A;  1G73 A;  2CXD A;  3H6P A;  1YTZ T;  3KV9 A;  4UV8 B;  5FY0 A;  4JLE A;  4WY4 A;  4C7N B;  2QGS A;  3C51 A;  3BRV B;  4JF7 A;  3M9B A;  3SRZ A;  3SS1 A;  3ONX A;  3TKL B;  2O01 H;  3VMZ A;  2CE7 A;  2N1T C;  1JY2 O;  3MA9 A;  4CZZ B;  1KNZ A;  2HPC A;  3PP5 A;  1B7T A;  5E0O A;  2GUV A;  1M1J A;  4KHX A;  2VB6 A;  4MFR A;  4I6M C;  1LTG C;  1W2E A;  4Z8X A;  4ZS2 A;  1N7S D;  2V1D B;  1JCC A;  1XTG B;  3QK6 A;  3UT5 E;  2R5D A;  2Q9Q B;  2E9X D;  2IFM A;  2WMO A;  1BR0 A;  3M06 A;  1YKE B;  3C9I A;  2E42 A;  1SQB K;  1T2K C;  2X9H A;  4H9N C;  4QXB B;  4ASK A;  5HWX A;  5KX5 E;  4H9Q C;  1OXZ A;  4PW8 A;  4IGU A;  4IDZ A;  3N9Q A;  3ZPO A;  4QXH B;  5BU5 A;  5KLV K;  2KIN B;  2XAJ B;  3HL6 A;  1YYC A;  5DJQ C;  4RES B;  2YKQ A;  1ZEE A;  2N9D A;  2JPF A;  4AQF A;  4EZ4 A;  2N1T D;  2OYH B;  1OWA A;  1N86 A;  5AW6 B;  5APY A;  3UTK A;  4EB6 E;  4NUU A;  4TX5 A;  4EIW A;  2MYS A;  3GN5 A;  3H37 A;  3P8C E;  2X67 A;  2KP8 A;  3N5L A;  3NBX X;  4OK0 A;  3CX7 B;  4YJ3 E;  1G1I A;  4OHF A;  5FNV E;  3VKG A;  1N7S C;  1MMN A;  2P9B A;  1MZ9 A;  1G2C B;  1LTB C;  2L9Q A;  4UVA B;  3L35 A;  2PG8 A;  3LIE A;  3CPZ A;  5HXS A;  1M1J B;  1H88 A;  1IFN A;  3LK3 B;  2CWY A;  4H9S E;  1RF0 C;  1ZR2 A;  2HPC B;  1YW0 A;  4PK4 A;  3RKO A;  1WT6 A;  2VRS A;  3M0D C;  2XV5 A;  2BZB A;  5LG4 A;  2NP9 A;  2DWG A;  3FHN A;  3L09 A;  4B86 A;  2XNX A;  4ZKU A;  3HR0 A;  5DQW A;  3U78 A;  5FYM A;  3LFM A;  2LJL A;  5L3E B;  2VK9 A;  2DCF A;  5L2L A;  2YMY A;  2P67 A;  5FY7 A;  1G8X A;  4ADZ A;  3TK1 A;  4UV9 B;  3PTR B;  2A45 H;  5LA6 E;  4AKR B;  1LTT C;  3N2O A;  3WAK A;  5EK2 A;  3KV6 A;  5HXE A;  1FAV A;  5LJN A;  3OJA A;  1LTJ A;  1FOS E;  2EHO D;  1CSB A;  5LCY A;  4AXP A;  2ZXE B;  3BRT B;  5CJ0 A;  2MJZ A;  3LK4 2;  2DWK A;  3PU3 A;  1N73 B;  3V2N A;  5FXW A;  1H89 A;  5FXZ A;  3ZYL A;  1URQ A;  3UFE A;  4AQF C;  2NW7 A;  4OYK A;  2L5G B;  2WSC H;  1GU4 A;  2XKM A;  4HN9 A;  4P0B A;  1X79 A;  1N7S A;  2RP4 A;  2UXX B;  4GYS A;  5C8Y E;  3HTK A;  1JOC A;  2H7H A;  4MAL A;  4O4I E;  2V7I A;  2D2S A;  1NOH A;  3NMD A;  5HXC A;  5J1G A;  5L3F B;  4F6R C;  4DMV A;  2WIT A;  3ETV A;  3BVH A;  2WPS A;  1H7C A;  5CA0 E;  1RE3 C;  2Z4E A;  2EHO C;  3RYF E;  3MJX A;  5JR9 A;  4JYB A;  2Q7C A;  4ILU A;  4JUY A;  1XTC C;  1DH3 A;  1G2C A;  3CQC B;  3HE5 A;  3AVR A;  3A3Y B;  1KK7 A;  3Q9D A;  1LKX A;  4WB4 A;  1YKH B;  2E9X B;  4G63 A;  3V5S A;  1Y64 B;  3PUS A;  1GZL A;  4I50 E;  4LC1 A;  2DNX A;  2OYH A;  3RYC E;  3PDY A;  1KFM A;  2NTY A;  5JDF A;  1S35 A;  4L9I A;  3VHL A;  4MLK A;  2FFD C;  1RF1 B;  1YD8 G;  1SFC A;  2KYV A;  2C9N Y;  3P7I A;  1SLQ A;  3KPE A;  4QX7 B;  5EZY E;  2JMK A;  4N78 E;  2KSJ A;  2LKM A;  2DHR A;  5JRC B;  1BR1 A;  2K48 A;  2XAH B;  5AVS B;  2XAS B;  3L4F A;  3AA6 B;  2HLO A;  4EIJ A;  3KV5 A;  5JDH A;  1UX4 A;  1X8Y A;  5APU A;  2NTX A;  4ZS3 A;  3RK3 B;  1HF8 A;  1HX8 A;  5ETW A;  2WT7 B;  2NPS A;  4W80 A;  4ZOL E;  3U59 A;  4IHJ E;  3HUS A;  3B5N C;  5KTB A;  3V2P A;  4GKG A;  3LG7 A;  3A2A A;  1MIV A;  2CMR A;  2IC9 A;  1RE4 A;  2LHN A;  1NTZ K;  2VWA A;  5CB4 E;  2V7K A;  1MFZ A;  4EOZ B;  4WBO A;  1PFI A;  5JR9 C;  2Y48 B;  2WSS V;  3MAC A;  1CZQ A;  2NW8 A;  2Y8D A;  5AW9 B;  3MKD A;  1T8Z A;  1FJP A;  3ZN0 B;  2CM0 A;  1SVF A;  2LEH A;  3K3N A;  1KIL A;  2OAR A;  5CCG D;  2KT9 A;  5TAO A;  4CQI A;  4EYU A;  3KV4 A;  1NO4 A;  4IE0 A;  1GW4 A;  1IC2 A;  3M9H A;  3VP9 A;  1Z0P A;  3GMI A;  4DND A;  4CI2 B;  5L3B B;  2HPJ A;  5L3G B;  2X0L B;  2WPR A;  1FOS F;  3O1J A;  3NZQ A;  1SQQ K;  4Y99 C;  4GK5 E;  2LHR A;  3RK2 B;  3B5N D;  4JEH B;  4WW0 A;  2H7O A;  5CCH A;  3HE4 B;  4AQG A;  5JDL A;  5APX A;  5JDQ A;  5CHX A;  3B8E B;  4CXW A;  2X9Y A;  1CW5 A;  5LNK A;  2ODU A;  2QA7 A;  2I59 A;  1G1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...