3P8CD

Structure and control of the actin regulatory wave complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
244
structure length
204
Chain Sequence
GIKNELECVTNISLANIIRQLSSLSKYAEDIFGELFNEAHSFSFRVNSLQERVDRLSVSVTQLDPKEEELSLQDITMRKAFRSSTIQDQQLFDRKTLPIPLQETYDVCEQPPPLNILTPYRDDGKEGLKFYTNPSYFFDLWKEKMLQDTEDKRKEKRKQKQKNLDARSVLLEAIRKGIQLRKVEEQRENDVATILSRRIAVEYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytoplasmic FMR1-interacting protein 1
publication title Structure and control of the actin regulatory WAVE complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 57
structure length 204
sequence length 244
ec nomenclature
pdb deposition date 2010-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02205 WH2 WH2 motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3p8cD01
1.20.58.1570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3p8cD02
5BVZA 4N3YB 3C9IA 3N7NA 4ZKUA 5BU8B 3N4XA 3U1CA 3P8CD 5KTBA 3VP8A 4GIFA 5BU5A 3BASA 4N78D 1WT6A 1X79B 4ZKPA 3U59A 4I1LA 3VP9A 2JEEA 3HRNA 3U1AA 3BATA 1NKNA 1IC2A 2POHA 4O9BA 2FXMA 3OJAB
chains in the Genus database with same CATH superfamily
1SQPD 5L4HA 3V6IA 3ZJ1A 2C0WA 4HEAA 2BKNA 2BVMA 2SPCA 1E7PA 1RY3A 1VL2A 1S2EA 5H6RB 3CWBG 2Y48B 1UX4A 3S4UA 2Y8DA 3PUSA 3FXDB 3RQWA 3QNUA 4I55E 1NGMB 3IA3A 3JC22 2KSRA 3ZLIA 3VMZA 3OJAB 3UQ4A 1M7KA 1SQVK 2YEVC 1KILD 1K05A 1NTZJ 1SLQA 2ZM8A 2GA1A 3L72D 4NPFX 1S72P 5AQFB 5HXEA 1L0LE 1ZR4A 4D6TE 5KKZC 5H6QB 3TNUB 3OA7A 1FU1A 1AA0A 4EZHA 3CC4P 3BQIA 4G2AA 2XPKA 1LVFA 3IF8B 4TUYE 1NKZB 3IR9A 1BGYD 2L8KA 3H3AA 2V5DA 2OARA 5FYMA 1VQ9P 2YK0A 1HUCA 2FYNB 3B5MA 2YOEA 5APXA 1T2KC 3MK7C 1HS7A 3AEBC 3AVSA 4DMWA 1Y8AA 1Q2NA 3A7OA 4W80A 5APWA 3GF3A 2E74D 2AXTH 2BG9B 2Z5HA 1WLXA 4U72A 3CX5I 3AXJB 4P1NA 2KZ7B 5LBQB 3WAKA 2ZMAA 1W0BA 5DJTB 1T6AA 4CI3B 4U7IA 2E8IA 1VQOP 5AQPB 2M6IA 3L71E 2WVRA 2BS2A 4DV2T 4YT0A 2C5IT 3L8RA 2HPCB 4WY4C 2BASA 3AECC 3OKQA 3B5NB 1OXZA 2V7MA 1OEDE 1OZHA 1SQVG 3RL0g 1Q82Q 2WSFJ 3H3MA 5KLVK 3FX0A 3I5CA 3CKDA 1L0LK 1IFDA 2LHNA 3HD7A 2YIUC 3ONLC 3HR0A 1FMWA 2ZLYA 5AVQB 5B66E 3AEEA 3CMAP 1NEKA 3L4FA 1NAFA 4BXLA 4H44C 1K8AQ 4EAHA 2WSEJ 3D6ZA 3UUMA 1URQD 5AVSB 1LT1A 5AQQB 1BR1A 2XSAA 2H7OA 4O2AE 2ES0A 1L2PA 5CMZA 3L37A 3KPEA 1H0TA 4J2CA 1J1DC 3CX7B 1UCUA 1J1EC 4PFPA 4QH5A 3HUSC 3RGLA 1BR2A 1GQEA 1DX7A 2FBWC 1RH5B 5LJNA 1WR6A 3BVHA 2V4HA 3TGUE 5KKZB 3X1DA 3UU4A 1WYBA 5JREA 3H32B 2ZM6T 5BR8T 2WT7A 5L3EB 4JI8T 1L0LG 4D6TG 4UB6E 1N7SC 2WSEH 4DT0A 3HE4B 5APYA 2WZ7A 4TT3H 1EZ3A 2FJEA 5GONE 4AISA 3CIRA 4NPDA 2KYVA 3EQ2A 2I6HA 5ABGA 1GL2A 5LP6E 1J1JA 3G71P 1S5LH 3C4ZA 4K3AA 4RKUJ 2W83C 5F3JA 3CL3D 4I6MC 1NU1J 2JO1A 2CE7A 5AQGB 3IF4A 3L35A 5TISE 1M57D 3RIFA 1YJ9P 5C2TA 2C9NY 2CRBA 3EWKA 2AEMA 3VMXA 3GHGC 5AW2B 2Z6EA 1NTMD 3C51A 4BRYB 1S3JA 5IWAT 2NRGA 2HN1A 3RK3C 4WY4B 3F2EA 1NO4A 4DIDB 1YITP 3BCCG 3L71G 3KFWX 1P84E 3CVRA 2I0MA 2N1TC 3MGNA 4NUVA 1IZNB 2YIUB 2VQET 2I8DA 2K1AA 2IX7C 4EYUA 4H44B 3KVBA 1HG2A 3L73J 3VKGA 1SQPJ 2IUBA 2O01H 4JF7A 3P8CD 4YY3T 3HD7D 1QSDA 4TV9E 1W0AA 1RQVA 4H9OC 2H88A 1HNXT 2P7JA 2MTQA 1J1DB 4GYRA 3EFGA 1KYOH 4C7NB 1J1EB 4IHJE 3SS1A 3HUSB 3CC7P 3PJAJ 3A2AA 3AE7C 4N3YB 2N1GA 5C3JA 2LR2A 1OVUA 4HB1A 2V7KA 1OWAA 3P4SA 1KORA 4UB8H 5L2LA 3L72J 4JPZB 3N5LA 4I4TE 1USDA 2X0HA 4LFCT 2D0TA 4AKRB 1KILC 3KDPB 3TGUG 1D1BA 1N7SB 2YKQA 3QK6A 2XZRA 2V7JA 4JEUB 2WCAA 1IFNA 1SQXJ 1GD2E 5L3DB 4K35A 1QEXA 5JDGA 1US7B 4HFHA 4YXDA 5JDMA 3UUNA 1FS0E 3RRWA 2XU6A 4IGUA 5HXSA 2WPVB 1QVFO 5CBNA 1MMGA 5CCHC 2K3RA 2IC6A 2K9AA 4HGAA 3UUBA 3PJSK 3P4PA 3CMEP 3O6QB 2LSKA 2H7HA 1AVOA 1VF5C 4H9PC 3VP9A 4C90A 3RYFE 3GHGB 4QX7B 2L9QA 3MJXA 1GL2D 3JCUH 1USEA 2FKWB 3USSA 3RK3B 3GA8A 4TZ4C 5FY7A 5CA0E 3NMDA 4DR6T 1KTMA 1FZGA 1HVVA 1M8OB 1PPJG 3AAIA 2KSEA 2F4VT 3H1ID 3AEFA 3MA9A 3WUUA 4H9SE 3VTPC 5JRCA 2N1TB 1EDKA 1IBMT 4IFDK 5CJ4A 3SWHA 3H1LE 4ILCA 1JNMA 4JI3T 1FDOA 1M7LA 4WYVA 2OYHA 4JI1T 1RE3C 1LTTC 1DEBA 2V1DB 5C39A 2DI4A 1NTKE 2OYIA 1JO5A 3RRCA 2D2SA 4IL4A 3AB3B 5L3BB 5FVKA 1FZBA 1P84I 1FOSF 3CXHD 2M67A 1X0TA 2IFMA 3EFFK 1D0YA 5HWXA 1HNWT 2Y9ZA 3RYIE 4YTPA 3AA0B 1FZEA 3PP5A 4EIWA 2VURA 2MBGA 4HH2A 3JAFA 2YINA 3OW2O 4EGWA 2ZVOB 2VWAA 1IJDB 1YKHB 5IHYA 5DQVA 3NVOA 2J62A 4DNDA 2IIUA 1UIIA 2H89A 3ZN1B 3VHLA 5HAXA 1BR0A 2BS3A 1JM0A 3SWFA 1SQQE 1BE3D 3L75D 1L4AC 1TU3F 2DWGA 3HKBE 3LBXA 3O8ZA 1VRBA 2XNDH 2KLUA 5KTBA 2UXXB 3EDUA 3MHVA 4NPEA 5CHXA 4OYKA 3HTKB 1G2CB 4U74A 1PP9D 1NTKK 1S9KD 5FXXA 1KB9D 2JR8A 5ABHA 5JDNA 4UF0B 4QXCB 4ZI2C 1Y47A 1G8XA 1WFDA 3LK42 3ZYKA 4U3FD 4EEDA 2OYOA 2FYUE 4DUYT 4ISTA 1BCCE 2B87A 1VF5B 3C8VA 1N8RQ 1ZV4X 1HWTC 4KHZF 1HTJF 2V6YB 3H37A 1ZOYA 4DZOA 3Q5SA 2GUVA 3JAEA 2H8PD 4AUWA 3G9RA 2BZBA 1Z0PA 4IDPA 3H1KJ 3T97B 1QL2A 3VU7H 1VPCA 2D2CD 3CWBD 2KK7A 1HJ0A 2FYZA 1SQQK 4HWCA 4ZMDA 4ADZA 4NXMT 2W66A 4LC1A 4ZS3A 4OHFA 1LGHB 5CBOA 5JVDE 3AE4C 3H1LG 1RF0C 4B3TT 2YO3A 5BU5A 1OX3A 3I9WA 3PU8A 3ONJA 2N9DA 4R4LA 2R5BA 4LF4T 2BCCE 4UVAB 1NTKG 2AEFA 2QJKC 2WMNA 2WSCH 3TDKA 1JEKA 1Q90D 4NXNT 1IFJA 2KNCA 3PUYF 2FXMA 2FYUK 1T7SA 3NZQA 4GK5E 3CX5D 3O1JA 2QEXP 1D0ZA 1LTAC 2K9JA 2G3AA 3PURA 3ONXA 2IPPA 1S94A 2KMFA 4E7SA 4PW8A 5HCMA 2WM9A 5E79H 4A7PA 4ILAA 3WAJA 1WT6A 3RL0D 2C9LY 3J7Yq 2WSSH 2DL1A 3DTOA 1HTLC 1LP1B 2J59M 4LGDE 3EI0A 2VKOA 3RGUA 1L4AB 4MLKA 1KFNA 1MNDA 3N9OA 3M0DA 1NKNA 1E2AA 3CCQP 1SQQG 3AVRA 2M5AB 3WI3A 1OEDA 3CPWO 4L9IA 5JDFA 1GW4A 4NUUA 2WP9A 2IZ0A 5DABA 2QGSA 2W8ZA 3LFMA 4BA9A 2N2NA 1SQVD 4EDFA 5TJHA 2Y0DA 5AQVB 1SHZC 5H2FE 3O1IA 3ANWA 2Z4EA 3C50A 2Q9QA 3KYQA 2VRSA 2OV9A 3HKCE 1BSNA 1MKMA 2SPZA 1LWUA 2BG9E 3V4WA 2KLVA 2FYUG 1BCCG 2KZJA 2CWYA 5LJMA 3ZT7A 2JRKA 2NW9A 4PJ0H 4XFJA 3UU8A 3RI5A 3MXZA 4I0UA 5CJ5A 1HBWA 2XKMA 1N33T 1K9MQ 4HJGH 5FMNA 3PUGA 2P1JA 2JQHA 4U33A 1YTZI 3ZDMA 3RX6A 3H1IJ 1EXJA 2WU5A 4UVBB 3W67A 4RJTA 2PJQA 4GT1A 3CMLA 4UVCB 1UGOA 2WDRA 3AEAA 4X1KE 2FJAA 2K9YA 2OTKE 5BVZA 4XA4A 4X66T 3C9IA 5GTIE 1VQPP 2KSJA 2IDBA 2J58A 2LM2A 2JP3A 2FXPA 2QJKB 5KLVD 4ZNCA 1KQFB 4ZZCA 4M3LA 2BCCG 1L0LD 2AEJA 4D6TD 4LF9T 2RPAA 3AE5A 1B7TA 5KDMC 5KX5E 1YQ4A 1KEYA 2RA1A 3NFQA 2LE8A 2LT3A 2K5BB 2YNYA 3A0HH 1NHLA 2KINB 3W68A 4ILUA 5J1GA 1KNPA 2J4GA 3H6PA 2LKGA 1SQBE 1BDDA 4L76A 3RLFF 2WU2A 3EUHA 1VDFA 1YYCA 3Q2YA 2JQKA 3G3ZA 1XNQT 4B86A 2DLRA 3AE3A 3L70J 1JUNA 3ABVC 4N6JA 5LBMA 4JI2T 1O3XA 3M06A 3P4WA 2C0SA 2PFVA 1CUNA 2E9XC 3AE6A 2LRLA 3BCCD 3L71D 3A0BH 4PJJA 4H9QC 2WWWA 1IJ6A 1S1CX 2RN0A 3CPZA 3O9XA 1A02J 4AQYT 3F5HA 4CI2B 1LTJA 2A06E 2W2UA 2LSYA 1S35A 3B8EB 1NWQA 1T3UA 4IIJE 3EDVA 1X8YA 5EK3A 4ILBA 2Q9QD 4YXDC 4UXNB 5F8PA 3SFEC 1I6ZA 3AE9A 2LHRA 2NTYA 3D70A 1MZ9A 2A45H 5HXCA 3MTUE 4ERRA 4PJLA 4ZXLA 2GM4A 3H1HD 3ZSSA 1AV1A 4UEMA 1SQBK 4YHHT 1KB9H 2LEHA 2D2CC 3PRJA 1W2EA 3P4QA 3CCEP 2KP8A 5JR9C 4DVDA 3NZPA 1M1KQ 2YMYA 2ZAEB 4V1Av 2BKPA 2HHHT 2XAJB 4I2LC 1RF1A 2K37A 4LMKA 4IL6H 3M9BA 3KHUA 3TGUD 4GOFA 2FFDC 3L74J 5M4YA 2V26A 5HXHA 3UFEA 3S4RA 5EK4A 3RIUA 3K3QC 2DWKA 3RK2D 4KHXA 4OYJA 4H13C 4YPCA 2UUBT 2YXRB 1D7MA 2OYIC 1D1CA 3T8OA 4YTMA 3D6YA 1PGOA 5AQTB 1HNZT 2O1JA 3Q3DA 1SA0E 1OVVA 5CCGA 2R5DA 4WW0A 1FIOA 1LNQA 3AEGA 1T8BA 4DV3T 1KV4A 2G0UA 2KS1B 3BRVB 3E22E 1SQBG 1MIWA 4JI7T 2XY8B 2IDOB 2E9XB 1PPJD 1JY2N 3ZMZB 4KI0F 2Q1KA 2LSIA 1MFTA 3AE2A 4CN6A 3EHZA 3H1JJ 2NZ2A 3CX5H 4HE8A 3ETUA 2MYSA 1P84D 4DUZT 3OAKA 1T72A 4L0RA 4EB6E 2M3EA 2WDQA 4DV6T 2X9YA 2HYNA 2I59A 3ZC0A 2ZT9D 4YJ2E 2XV5A 1PFIA 3WUVA 1M1JA 2RP4A 1RE4A 1NU1E 4JEHB 3UTKA 3UIAA 3KZIE 2EHOC 3RK3E 3GMIA 3MKDA 5E0OA 4P0BA 4U3CA 2CBIA 2KIKA 1R5LA 1G73A 3DP7A 1KYOE 4DR2T 2WSSV 4HWIB 1SFCA 4HFIA 1FZCA 3CCRP 1JTHA 3VMAA 4UR9A 2P67A 5JR9B 4AQFA 1ZOYC 2WWUA 1FMVA 3VR8A 1T8ZA 2PGDA 5AW3B 2IYOA 1JNRA 3U1CA 2WBLA 1E79H 5KAIE 4X1YE 5AQUB 4Y99C 5KAFE 2X51A 4BJMA 2OGUA 1ZEEA 1YXRA 5KLVJ 4F8HA 2XHEB 5AQNB 2FFDB 4PJMA 4OGQC 3L73E 1L0LJ 1SQPE 4EI2A 3A5TA 3MUDC 3CQCB 2IHR1 3V2RA 1RQUA 5APQA 4H13B 3W15B 4YSZA 5ABFA 1VQ8P 3G4SP 4WBNE 2KOGA 2ZM2A 2OYIB 2UXNB 4GKKT 1HH0A 3JC6D 4AKIA 4QMAA 1N73A 5AVYB 2IFNA 1VQKP 2Q9IA 1HG5A 1YBKA 2HR3A 3AE1A 4NPPA 1VQ4P 1OW7A 4PD4E 4JYAT 2NOXA 2A9UA 3DJBA 4AXPA 2O01N 2R32A 1KN7A 5AQKB 3CC2P 1KILE 4Q25A 1ZP0C 4DV5T 3I56P 1BR4A 3L72E 5CCGD 2O01J 1XDOA 5DJQC 4PV1D 2PG8A 1MV8A 5AQMB 2YU1A 3BCCJ 4KX6A 1UURA 3AE8A 3KDSE 3Q1MA 3ZJ2A 4O4IE 1SQXE 3VYIA 1FE6A 2V8SV 3EABA 5LG4A 5LYJE 4AKHA 3S9OA 2B9BA 3LBXB 3M0DC 2E76D 3IFMA 5JDLA 2PBIA 1N2DC 3H1LD 4O4LE 2BEZF 2I1JA 2WDVA 5FP3A 1L0NJ 4CXYA 2WPSA 3FBZA 1NTKD 3VN0A 2HPJA 5TAOA 2EHOB 2WITA 4WWIA 3E7KA 2BKOA 4F6RC 5CA1E 2AXCA 2Q9QC 1CI6B 3ZMVB 5CFBA 1SS1A 2VKDA 2B87B 1DD3A 2W67A 3H1HJ 1FC2C 3FXDA 3V5UA 1HGVA 4BWNA 2CHOA 3JCFA 4CI1B 1PZQA 2K48A 3LDQB 5AQHB 1DIPA 5GTHE 5AVVB 1FAVA 4Y99B 4DV0T 3TNUA 3R84B 1AQ5A 2VKJA 3CQXC 1GW3A 1SFCD 3SFDA 2B89A 1ZW0A 1GDTA 1Z8UA 4OGQB 2ZJSE 3TGUJ 1SQXK 3CWZB 4EOZB 5LHGB 1SQQD 4H0LD 2XSBA 1LT9C 3LIEA 2QG4A 4TNVA 3L73G 3Q5DA 4WZXA 1N86A 1W9RA 3HRNA 3CLQA 2XQ3A 2R3CA 4B3MT 1NYHA 1BGYJ 5JQGE 2POHA 2BG9A 2E5VA 2AXDS 5JDHA 3GN5B 3TK1A 3AXJA 4QKNA 2LXBA 2QM7A 3UU6A 3N4XA 2KNCB 3AE5C 2FYUD 1BCCD 1U7JA 5AVZB 3RYHE 3O1HA 2W27A 2JWAA 2WAUA 1Q7YQ 1YQ4C 2K9JB 2CHNA 2XQ5A 3L09A 2HPCA 2VB6A 3V5SA 2XQAA 3B5NA 2M6BA 1T3JA 2WQYA 4TWFA 5HEJA 1BDCA 3L72G 4H63H 4PD4I 2CLYC 4AIUA 2E74C 5CJ0A 2UXDT 1FDIA 1LTBC 4UB6H 1IK7A 1YD8G 3C64A 3E1IA 2UU9T 5EFWB 2E42A 2WZHA 1IFIA 1SQXG 2FUPA 4XE5B 4PK6A 3HE5B 3VOPA 4FJOA 4HFEA 3EAMA 5AW0B 1GK6A 1YQ3C 2KLQA 2NWBA 1YJWP 3TLSA 3AE6C 4AYCA 4DR3T 2ZT9C 3P32A 2Q9QB 5LGNB 3RPUA 2LRKA 5FKYA 4WBOA 2W4XA 2XQ4A 5JH7E 3BRTB 3H1KE 5LXTE 3KV9A 4N78E 4DR5T 3ZKRA 1Q81Q 2H43A 1JY3N 2VK9A 4LMLA 3OYXA 4C91A 1P84H 1URQC 1QL1A 4KUMB 1CW5A 2RMZA 3I1AA 3WMM0 4HFVA 3H32A 3AE9C 1WYCA 4QH4A 3U59A 3NXSA 5J2UE 2JJ9A 3FXEB 3B13A 4IE6A 1IFMA 4RO0A 3FZHB 1M56D 3HKDE 3HE4A 1PGJA 4YSXA 3P7IA 1NH4A 1IK9A 2IZ1A 1LT9B 3LW5J 5APTA 3Q5PA 4IL6X 1YI2P 4IDZA 4MHCA 5HEGA 3AEBA 2HODB 1KILB 1EC5A 2HG5D 1QGKB 1QUUA 1AVYA 3SWYA 4ASWA 3A7MA 1VOMA 1NAYA 3I0OA 4O8SA 5AQSB 3R6NA 3JC6C 3M9HA 3E1RA 1KFYA 3UU3A 1DH3A 4C46A 4BRYA 3PTRB 3RIUC 2BS4A 2C5JA 4WY4A 3S1KA 4GOEA 2J5UA 1SVFA 5FXWA 3HA4A 2DCFA 4UV8B 2CLYB 5LOVE 2E74B 3LW5H 1VQ6P 4JUYA 2WSCJ 2VL8A 1NTMJ 2X0YA 2V7LA 4JYCA 1JB0J 2H3RA 2LKHA 4X20E 4A97A 3B5ND 5KJ7A 4P0AA 4X65T 3QUJA 3Q5RA 3H1LJ 5LGTB 1PIXA 4L75A 4JI0T 3KV6A 4MALA 2OQQA 3BQLA 4LMJA 1X79A 3L36A 1YJNP 2OTLP 2CPBA 1D1AA 4C7NA 4IREA 4WVZA 3HUSA 2OLTA 2CXDA 5AW4B 2FBWA 4EYYQ 3BATA 1M90Q 1J5WA 1XTCC 3RYCE 3GWHA 2KT9A 3CCJP 2FXOA 3FHNA 3JADA 3HD7C 3H1KG 1URQB 3A0HE 1YIJP 2UUAT 4ZHQE 1N32T 3AEEC 1VQMP 2VL0A 1VQNP 4TWDA 3FZMB 2KWHA 1N7SA 3F89A 4IE4A 2QA4P 2KXPB 4AQRD 3P4RA 3ZT6A 2LXCB 1SQBD 3FWNA 4XZCA 4AI6A 1FZCC 2E75D 3IAOA 4L5GA 1ZRTE 5B5EE 3Q2MA 2X9XA 3CXHE 1IC2A 1MMNA 1GU5A 4I43B 2IYPA 2Q5UA 2QE7H 4AKLA 1QLBA 2WY2A 5AQLB 1T2KD 5AW6B 2W63A 4PFOA 3OVUA 5KXJA 3QH9A 1MFZA 1FBMA 3CCUP 3NKZA 1OIPA 5AW5B 4LLHA 1WR0A 4PK5A 4U7YA 2XTLA 1UIXA 3L70E 4WY4D 1H7CA 2J47A 3HL6A 4U31A 1IBLT 2LOPA 1GL2C 1KB9E 2CXFA 1LRZA 4KMCA 4C7RA 3C98B 4EYYR 2MAWA 1AFOA 5L3CB 4GYSA 4CQIA 5KJ7D 1N34T 4CPGA 1FZFA 4H44D 3C4WA 3FB2A 1HX1B 1MMDA 5LG3A 4ZKUA 2NPSA 3AE7A 1MNEA 4EZ4A 4HKZH 3BASA 4GK0E 3HD7B 3N9MA 4CN4A 3KV4A 4QWNB 1I94T 5LA6E 5K5GB 2D9DA 2CEAA 2XNXA 1VQLP 2ZFCA 4TX5A 3M0AA 5APVA 3LJCA 2WWVA 2R6GF 4H63V 3PHLA 3I55P 3HTKA 1G2CA 4JI5T 3PUVF 5AVRB 2H88C 2AXTE 1H0TB 4IDNA 4UF0A 1BE3J 1SE7A 3L75J 1H8AA 5C8YE 3T1YT 5CCHA 1N7SD 3JSVC 3N9PA 1NTZE 3L74E 3MIWA 2YU2A 2ACZA 2I1KA 1IJ5A 4LF5T 1K73Q 4ZI3D 1PP9J 5BMVE 2V6YA 1GZLA 4YSYA 1Y64B 1JMBA 2ZYGA 2J1DG 5HYAA 3KINB 2XJ7A 5FXVA 4PNIA 5FY1A 4U3FJ 2D0UA 4L74A 1NVOA 2WT7B 3CX8B 1U7MA 3T97A 2WMMA 3A8YC 3VMYA 2BBJA 4FI5A 4JV5T 5LMNT 4XAXB 5LMUT 4YJ3E 3TKLB 4OK0A 1U5PA 1RE3A 1CHUA 1GL2B 2HLOA 3L70G 4B3ST 2IBZE 2L5GB 2E5LT 3H1JE 5BU8B 3ZMSB 3CWBJ 2YKOA 3GMAA 5M1BA 3MZKB 2MOZA 3RIAA 3K8PC 3KQGA 5H2FH 3IN6A 4GIFA 2A3DA 2NW8A 3V2QA 2ZVNB 2B1EA 1NTZK 4PAGA 2JWDA 3D0TA 1GK4A 2A2FX 2K24A 5L3FB 4ISSA 2XZEA 4M1PA 3KVAA 5J2TE 3B71A 2Q7CA 1H89A 1J2JB 2V7QH 3L73D 2RKLA 2L3LA 3AEFC 2JKVA 3AA6B 2QA7A 3N2GE 1RHZB 1LP1A 2NPSD 4MFRA 2OYHC 4TN7B 2KUBA 1L4AA 3OTOT 4ANJA 4PD4D 2ZYDA 2M5AA 2BVLA 1LTIC 1H88A 5AW9B 1S5LE 2FJBA 1SQBJ 5KLIC 2R44A 5GTIH 1W09A 4ZZBA 4YTPC 5KLVE 3K3NA 1WRGA 2ZYAA 3RL0C 2LKMA 2X68A 4IL9A 2DW3A 2E75C 4JLEA 1XMOT 1NTZG 1AJYA 3L74G 4RESB 5ADXL 4DJGA 2JQQA 2WPRA 2M3BA 1SQXD 3V5BA 1SQVJ 3F57A 5CCHD 4I1LA 2H89C 2KWIB 3AEDA 3U1AA 2W0GA 4PJNA 3RKOA 2CBJA 1MUUA 3FZFB 2Y6XA 1IBKT 3GLMA 1E1HB 4O9BA 3O4XE 2ODVA 5HXRA 2PTFA 2NP9A 1VF5D 1KNZA 4JBZA 5AQIB 2W6JH 1QX8A 1EXIA 1EZVE 2A06G 3QB5K 1PL5A 4WBAA 4DV1T 2E5YA 2Y9YA 2XM2A 3LK2B 5FY0A 2A72A 3PUQA 2ZM0A 4EXTA 1OMIA 3G06A 3AE4A 3CCSP 4ZS2A 1RF0A 4DBQA 3BCCE 3PE0A 2JEEA 2WTYA 1EDLA 2XAGB 3PLNA 2ODUA 4TNWA 2B76A 3N9QA 3Q5XA 3UU5A 4X62T 2QRXA 2UUCT 2W62A 2ZXXA 3OYZA 4NIQA 1U57A 2C5KT 2IBZG 3PV0F 3ZCIA 3H1JG 1Y01A 2D2CB 2D5UA 1KZUB 4JBWF 3L3PA 1VQ7P 2KB7P 1OFCX 3I9YA 2X9WA 1L0NE 2P58A 3LK3B 1GU4A 2PAJA 3VP8A 1IAPA 3N2OA 4UB8E 5KJ7C 1FZAA 2IBZI 3WU2H 3FZKB 2ZXEB 4ZKPA 2DHRA 3FWLA 3M9QA 5JRCB 5LCYA 4CXWA 4HYTB 2LM9A 1JY2P 4D6TJ 1HF9A 2CXLA 3II6A 2PFXA 2OYHB 3H1HE 2QIWA 1Z56A 3CCVP 4I50E 5F5WA 4Z90A 4EOTA 1XTGB 5EZYE 4B6XA 1JCDA 1NU1K 2WSFH 2WS3A 5J0ZA 2VKHA 3V4QA 2YKSA 5KLIB 4L73A 4UV9B 3ZN0B 4ZI7E 3TLUA 1L4AD 4IDQA 3CI9A 1ZR2A 2XAQB 2P10A 4GODA 3RL0B 4ZEYA 2JPFA 4UIGA 4LF7T 2E75B 2UXBT 1XNRT 5KLVG 3JCUE 3N2KE 1HCIA 2YDSA 4QH1A 3M65A 1OVRA 1SP4A 2IMLA 1L0NK 1IO4A 1XZYA 4ZI2D 5ABEA 3L71J 4IT4A 3V2PA 1BGYE 1YKEB 1UUSA 2XQ7A 4YXWH 4ZI3C 5LHIB 5AVWB 1NENA 1XWMA 3FZLB 2JIWA 3U78A 1JY2O 1HF8A 1SQPK 2MPKA 3G6EP 4GDOA 2IW5B 1OEDC 4E7ZA 5APSA 2E43A 3N9NA 1ZXGA 1XMQT 1EZVG 2Q3IA 2H7VC 5L4EA 1Q86Q 4JQ0D 2LJLA 1PPJE 1OW8A 1CZQA 1NU1G 1L0VA 2O3JA 4QHOA 3H1KD 3N9LA 3NRXA 4HKAA 3NRYA 4N78D 3FBLA 1UX5A 1LWUC 3BQKA 1EZVI 3OJAA 2L91A 3L39A 3PUAA 2WMOA 4IE7A 5HEHA 3PUZF 3ZC1A 2X67A 4QXBB 1Y9BA 4H9RC 4KP3C 3KBUA 5APUA 1L0NG 3VR9A 2P9BA 1KYOI 2V7IA 2E2AA 3KZIH 3R4YA 5B66H 1KD1Q 4QX8B 1AJ3A 3RC3A 3NWIA 1FOSE 1VCTA 3AEAC 1X79B 4OH8B 1SQPG 2W00A 5JTGA 2KS1A 3H1HG 5CB4E 2C0XA 3ETVA 1LTGC 2NPSC 3LG7A 3ABVA 3ESLA 2Q6QA 3RK2C 3SRZA 2E9XA 1ZKEA 3GF7A 5KAIH 2NTXA 2Z5IA 2XAFB 3C4XA 5KAFH 3CX6B 1E5WA 3J9X1 1JNZA 3GG2A 5FNVE 4IOIH 4Z8XA 1ZV8A 2R3SA 4YFSA 3MP7B 4IFMA 2XM1A 4GKGA 1GMJA 3SOLA 3Q5WA 3VKHA 2G8YA 4IFFA 2OTJP 3R2PA 4JI4T 1KQSO 2V6XA 4X64T 4EIJA 2WZIA 3P8MC 3EVYA 3RBXA 3SFEA 4DCKA 4HWDA 4A5XA 4KJMA 1BGYG 4PD4H 2XUEA 3A5XA 4DR1T 2WPQA 3KXDA 4KT0J 4OWFA 1OEDB 5JDQA 1G1IA 2YO2A 2KZIA 3AE3C 2CPSA 1MIYA 2VVSA 1DU2A 1VCSA 1GTWA 4GKJT 1ZHCA 5JR9A 3TSIA 2OA5A 2YXQB 2BCCD 1G1JA 3ANWB 3ZEFB 1LJ2A 5TISH 4XBFB 1NTME 1LTJC 4LFBT 1HX8A 1LWUB 3GW6A 5AQJB 3ZCJA 3NBXX 2FFDA 3VRAA 4TLFA 2B88A 3ZMUB 4AKGA 1UK5A 3OPCA 1KFMA 4YHJA 5E79E 4DO0A 4LFAT 4I7ZC 3CD6P 4WB4A 1YHQP 4EEBA 1X9VA 1KC8Q 3TLTA 3UFGA 5AW7B 1W2BO 4A56A 1ZRTD 3IHRA 1BSHA 3QC9A 5LB7B 3P8CE 1FJKA 1DD4A 2XQ9A 1WMKA 2CMRA 3MZWB 1LKXA 1JMMA 2YDRA 2NPSB 2MJZA 2N9BA 2IAKA 2X0LB 3K1SA 1IFPA 4HFDA 3RK2B 1RF1C 3E0ZA 3RH3A 2BEQD 4HTEA 1PGPA 2ITAA 4DBRA 2E5TA 5GTHH 2LSGA 5HWYA 4QXHB 3TLVA 3V2NA 1HR0T 4DV7T 4W7YA 1NTMK 3ZYMA 1SUMB 1YTZT 5FXZA 2QSIA 4IE5A 3N7NA 4O4HE 3AECA 1CSBA 2YDQA 2CK3H 4PJ0E 2E9XD 5L47A 4H9NC 1OW6A 2Q3EA 4MN4C 5HEOA 3L70D 2MKVA 3CCLP 2DNXA 2X9HA 1KQLA 2NR4A 4IE0A 5CCGC 3I0QA 2JJLA 1R5SA 4PV1C 4CZZB 1JY3P 3CQGB 2EHOA 1J5ET 2M0BA 3AEGC 4ZOLE 3C1LA 1EDIA 2PRRA 2FJDA 2LLYA 3P50A 3UULA 3MD0A 5FL0A 1X22A 1CI6A 2XDJA 4HFBA 5AQOB 1MMAA 3FGAD 1NOHA 2E76C 3E08A 1NTKJ 2CPTA 4X1IE 4UELA 4HN9A 3M91A 3AE2C 4HWFA 2QJYC 2ZT9B 4U2ZA 3Q9DA 2VVNA 2JDIH 3QB5A 3AEDC 3BK9A 3RHWA 3SWKA 3P7KA 3PH0A 4KBMB 2UXCT 2NW7A 1LTJB 5AVXB 1FDMA 4DR7T 4G63A 5IUXA 1NTMG 2KNDA 1M62A 4CN1A 4TV8E 1X9BA 3H1IE 1LTSC 1JCCA 3MUDA 1M1JC 3AAEB 1RE4C 3B57A 4I7ZB 1U4QA 2QVAA 1KQGB 2LOSA 2QJPC 1R8IA 2X66A 3PUXF 5EK2A 1JY3O 1VQ5P 1SQQJ 3UT5E 1SFCC 3GN5A 3ZYLA 1NTZD 4H13D 2W6BA 3L74D 2QYWA 3NTNA 4AQFC 3T1HT 4JI6T 2O1KA 4W7ZA 2BBHA 4H0LC 2XAHB 1WCRA 1ZP0A 4TWHA 4DR4T 1RF1B 3A0BE 4O4JE 3RBZA 1NJIQ 1D0XA 3O6QA 4OFZA 1MIVA 4Y28J 2XQ8A 4U7JA 3GHGA 4COFA 3RQUA 5AFUL 2Y0EA 2A06D 2FYUJ 1BCCJ 3RKGA 2AE9A 2VQFT 2UWJE 4HFCA 2K3WA 5HCJA 2GUSA 4GOUA 2PP6A 3SSUA 1FJGT 1LVKA 3WUTA 4DOJA 2HN2A 1BE3E 5A1LA 3L75E 2QM8A 3UQ7A 1N73C 3HE5A 2W90A 3A3YB 2N1TA 5KMGP 3AE1C 4A98A 1R8EA 3CK6A 5IYZE 2N9YB 4PV1B 3KBTA 3IEEA 4HWHA 2IBZD 3H1JD 2CCQA 1PP9E 4X5TA 1S9KE 1AQTA 5DJUB 2K88A 5HEUA 3PDYA 4AQGA 3K5BA 1K04A 4U3FE 2E76B 4BJNA 1XDPA 3PUWF 5CGMA 3CCMP 4LF6T 1S5LX 1KF6A 2EHOD 2YMKA 2QJYB 2WB5A 1N36T 1QLED 3OBVE 3K3OA 4IL6E 3AE8C 2BCCJ 3KV5A 1HFAA 2XQYA 2W6AA 2XQ6A 4B3RT 3QWOC 1DEEG 2Y0CA 3FXEA 4O2BE 2W61A 2JMKA 2BDEA 4Z1MH 3IBPA 3PJAA 5LHHB 5AW1B 3ZMTB 3AAAB 1WRDA 5LNKA 1M1JB 3D71A 1LT9A 1PV3A 3CWBE 2LSJA 5AVUB 2M8RA 2RH0A 4DV4T 3LIDA 4WNKA 1ZLLA 4K0UA 3H1IG 2HODA 1KILA 2CWOA 2QJPB 3ITKA 4OX9T 3ZSTA 2JMHA 3ZPOA 4Z91A 3LSVA 4OGQD 3F31A 3TLWA 3MACA 5L3GB 3RC8A 4K0KT 1EDJA 4IDOA 1SFCB 1S4XA 1FZCB 4P09A 5AVTB 2ACXA 2GK9A 1JTHB 3UUXB 3H25A 4CXXA 4MBQA 4ASVA 5AW8B 4EV6A 2HPLA 3PU3A 4H0LB 3TYYA 4YLHA 4YTNA 2KI7B 4KHPT 2JQ9A 2XASB 5LGUB 1FJPA 1ZN5A 3TF5A 2IC9A 4JYBA 4BAYB 1V9DA 4R4MA 2V5CA 3U3IA 1T98A 3CX5E 1FEWA 3SFDC 1HJBA 1KK7A 3AA7B 3AA1B 1YW0A 2FYNC 1N7LA 1W5CE 2VASA 4LF8T 3CXHI 3VRBA 5ABFB 4DMVA 2P2UA 4ASKA 1QVGO 1EZVD 5FL1A 1N73B 3PTZA 2V7QJ 2HFED 5L8RJ 1NU1D 5B5EH 4U2YA 1KMIZ 3CXHH 1YQ3A 2BG9C 1KNRA 3RF1A 1BE3G 3L75G 3RK3D 2CA5A 5AQRB 4PK4A 3B4SA 4GIWA 5FVLA 2A45G 2YKPA 2HH7A 1KYOD 1SQVE 1NWMX 1EQ7A 3M3ZB 2N1TD 5ETWA 1PP9G 1A02F 3B5NC 4OVNF 3QOFA 2WQYC 3ZT5A 3HKEE 1L0ND 4U3FG 2A45I 3WU2E 3HI2A 3Q5EA 5DQWA 1URQA 2CM0A 2YN6A 1HGZA 1PGQA 1KB9I 1JOCA 2FY8A 1ZMEC
chains in the Genus database with same CATH topology
3ZJ1A 2C0WA 4HEAA 2BVMA 2SPCA 1RY3A 5H6RB 2Y48B 1UX4A 3S4UA 2Y8DA 3PUSA 3FXDB 4I55E 3ZLIA 3VMZA 3OJAB 1SQVK 2YEVC 1KILD 1SLQA 2ZM8A 5HXEA 1ZR4A 5H6QB 3TNUB 3OA7A 1FU1A 4EZHA 3BQIA 4G2AA 1LVFA 3IF8B 4TUYE 1NKZB 3IR9A 2L8KA 3H3AA 2OARA 5FYMA 2YK0A 1HUCA 3MK7C 5APXA 1T2KC 1HS7A 3AVSA 4DMWA 3A7OA 4W80A 5APWA 4U72A 2Z5HA 1WLXA 2KZ7B 5LBQB 3WAKA 2ZMAA 4CI3B 2E8IA 2C5IT 2HPCB 4WY4C 2BASA 3OKQA 3B5NB 1OXZA 2V7MA 3HKDE 5KLVK 3I5CA 3CKDA 1L0LK 1IFDA 2LHNA 3HD7A 3HR0A 1FMWA 2ZLYA 5AVQB 3L4FA 1NAFA 4EAHA 3UUMA 1URQD 5AVSB 1BR1A 2H7OA 4O2AE 2ES0A 5CMZA 3L37A 3KPEA 4J2CA 1J1DC 3CX7B 1UCUA 1J1EC 4PFPA 3HUSC 1BR2A 1DX7A 5LJNA 1WR6A 3BVHA 1WYBA 5JREA 3H32B 2WT7A 5L3EB 1N7SC 2WSEH 3HE4B 5APYA 2WZ7A 1EZ3A 5GONE 2KYVA 3EQ2A 1GL2A 5LP6E 3C4ZA 5F3JA 3CL3D 4I6MC 2CE7A 3L35A 2C9NY 3VMXA 3GHGC 5AW2B 2Z6EA 3C51A 3RK3C 4WY4B 3F2EA 1NO4A 3KFWX 3CVRA 2N1TC 3MGNA 4NUVA 1IZNB 2IX7C 4EYUA 3KVBA 1HG2A 3VKGA 2O01H 4JF7A 3P8CD 3HD7D 1QSDA 4TV9E 4H9OC 2P7JA 2MTQA 1J1DB 4GYRA 3EFGA 4C7NB 1J1EB 4IHJE 3SS1A 3HUSB 3A2AA 4N3YB 2N1GA 2V7KA 1OWAA 5L2LA 3N5LA 4I4TE 2D0TA 4AKRB 1KILC 3KDPB 1D1BA 1N7SB 2YKQA 3QK6A 2XZRA 2V7JA 4JEUB 1IFNA 1GD2E 5L3DB 5JDGA 1US7B 5JDMA 3UUNA 3RRWA 2XU6A 4IGUA 5HXSA 1MMGA 5CCHC 2IC6A 2K9AA 4HGAA 2LSKA 2H7HA 4H9PC 3VP9A 4C90A 3RYFE 3GHGB 4QX7B 2L9QA 3MJXA 1GL2D 2FKWB 3RK3B 3GA8A 4TZ4C 5FY7A 5CA0E 3NMDA 1FZGA 1HVVA 3AAIA 3MA9A 4H9SE 3VTPC 5JRCA 2N1TB 4IFDK 5CJ4A 3SWHA 1JNMA 1M7LA 2OYHA 1RE3C 1LTTC 1DEBA 2V1DB 2DI4A 2OYIA 1JO5A 3RRCA 2D2SA 3AB3B 5L3BB 1FZBA 1FOSF 2M67A 2IFMA 1D0YA 5HWXA 3RYIE 3AA0B 1FZEA 3PP5A 4EIWA 2MBGA 4HH2A 2YINA 2VWAA 1IJDB 1YKHB 5IHYA 5DQVA 4DNDA 3ZN1B 3VHLA 5HAXA 1BR0A 3SWFA 1L4AC 2DWGA 3HKBE 3LBXA 3O8ZA 1VRBA 5KTBA 2UXXB 3EDUA 5CHXA 4OYKA 3HTKB 1G2CB 4U74A 1NTKK 1S9KD 5FXXA 5JDNA 4UF0B 4QXCB 4ZI2C 3ZYKA 1G8XA 3LK42 4ISTA 1ZV4X 1HWTC 1HTJF 3H37A 4DZOA 2GUVA 2H8PD 4AUWA 2BZBA 1Z0PA 1QL2A 3VU7H 1VPCA 2FYZA 1SQQK 4ADZA 4LC1A 4ZS3A 4OHFA 1LGHB 5JVDE 1RF0C 2YO3A 5BU5A 3I9WA 3PU8A 2N9DA 2R5BA 4UVAB 2WMNA 2WSCH 1IFJA 2FXMA 2FYUK 3NZQA 4GK5E 3O1JA 1D0ZA 1LTAC 3PURA 3ONXA 2IPPA 1S94A 2KMFA 4E7SA 4PW8A 2WM9A 3WAJA 1WT6A 3RL0D 2C9LY 3J7Yq 3DTOA 1HTLC 2J59M 4LGDE 2VKOA 4MLKA 1L4AB 1KFNA 1MNDA 3N9OA 3M0DA 1NKNA 3AVRA 3WI3A 4L9IA 5JDFA 1GW4A 4NUUA 5DABA 2QGSA 3LFMA 4BA9A 2N2NA 1SHZC 3O1IA 3ANWA 2Z4EA 3C50A 2Q9QA 3KYQA 2VRSA 3HKCE 1LWUA 3V4WA 2KLVA 2CWYA 5LJMA 2JRKA 2NW9A 3MXZA 1HBWA 2XKMA 5FMNA 3PUGA 2P1JA 1YTZI 3RX6A 4UVBB 2PJQA 4GT1A 3CMLA 4UVCB 4X1KE 5BVZA 4XA4A 3C9IA 2KSJA 2J58A 4M3LA 1B7TA 5KDMC 5KX5E 2RA1A 3NFQA 2LE8A 2LT3A 2K5BB 2YNYA 1NHLA 2KINB 4ILUA 5J1GA 3H6PA 3EUHA 1VDFA 1YYCA 3G3ZA 4B86A 2DLRA 5LBMA 1JUNA 4N6JA 1O3XA 3M06A 2C0SA 2PFVA 1CUNA 2E9XC 4PJJA 4H9QC 2WWWA 1IJ6A 3CPZA 3O9XA 1A02J 4CI2B 1LTJA 2LSYA 1S35A 3B8EB 1NWQA 1T3UA 4IIJE 3EDVA 1X8YA 5EK3A 2Q9QD 4UXNB 5F8PA 2LHRA 2NTYA 1MZ9A 2A45H 5HXCA 3MTUE 4ERRA 4PJLA 2GM4A 4UEMA 1SQBK 2LEHA 1W2EA 2KP8A 5JR9C 4DVDA 3NZPA 2YMYA 4V1Av 2XAJB 4I2LC 1RF1A 3M9BA 2FFDC 5M4YA 2V26A 5HXHA 3UFEA 5EK4A 3K3QC 2DWKA 3RK2D 4KHXA 4OYJA 2OYIC 1D1CA 3T8OA 2O1JA 1SA0E 5CCGA 4WW0A 2R5DA 1FIOA 2G0UA 3BRVB 3E22E 1MIWA 2E9XB 3ZMZB 1JY2N 2LSIA 4HE8A 3ETUA 2MYSA 3OAKA 4L0RA 4EB6E 2X9YA 2HYNA 2I59A 3ZC0A 4YJ2E 2XV5A 1PFIA 1M1JA 2RP4A 1RE4A 4JEHB 3UTKA 3UIAA 2EHOC 3GMIA 3MKDA 5E0OA 4P0BA 1G73A 3DP7A 2WSSV 1SFCA 1FZCA 1JTHA 2P67A 5JR9B 4AQFA 2WWUA 1FMVA 1T8ZA 5AW3B 3U1CA 2WBLA 4X1YE 4Y99C 2X51A 4BJMA 1ZEEA 2XHEB 2FFDB 4PJMA 3A5TA 3CQCB 3V2RA 5APQA 3W15B 4WBNE 2KOGA 2ZM2A 2OYIB 2UXNB 1HH0A 3JC6D 4AKIA 1N73A 5AVYB 2IFNA 2Q9IA 1HG5A 2NOXA 3DJBA 4AXPA 2R32A 1BR4A 5CCGD 5DJQC 2PG8A 1MV8A 2YU1A 3KDSE 3ZJ2A 4O4IE 5LG4A 3VYIA 5LYJE 4AKHA 3LBXB 3M0DC 3IFMA 5JDLA 2PBIA 1N2DC 4O4LE 2I1JA 5FP3A 4CXYA 2WPSA 3FBZA 3VN0A 2HPJA 5TAOA 2EHOB 2WITA 4F6RC 5CA1E 2Q9QC 1CI6B 3ZMVB 2VKDA 3V5UA 1HGVA 4CI1B 2K48A 5AVVB 1FAVA 4Y99B 3TNUA 3R84B 1AQ5A 2VKJA 3CQXC 1GW3A 1SFCD 1GDTA 1SQXK 3CWZB 4EOZB 5LHGB 1LT9C 3LIEA 1N86A 3HRNA 3CLQA 2R3CA 5JQGE 2POHA 5JDHA 3GN5B 3TK1A 4QKNA 2QM7A 3N4XA 5AVZB 3RYHE 3O1HA 2W27A 2WAUA 3L09A 2HPCA 2VB6A 3V5SA 3B5NA 1T3JA 4H63H 2CLYC 5CJ0A 1LTBC 1YD8G 3C64A 3E1IA 2E42A 1IFIA 4XE5B 4PK6A 3HE5B 3VOPA 4FJOA 5AW0B 1GK6A 2KLQA 2NWBA 4AYCA 3P32A 2Q9QB 5LGNB 3RPUA 4WBOA 5JH7E 3BRTB 5LXTE 3KV9A 4N78E 2H43A 2VK9A 1JY3N 3OYXA 4C91A 1URQC 1QL1A 4KUMB 1CW5A 3I1AA 3WMM0 4HFVA 3H32A 1WYCA 3U59A 3NXSA 5J2UE 2JJ9A 3FXEB 3B13A 4IE6A 1IFMA 3HE4A 3P7IA 1NH4A 1IK9A 1LT9B 5APTA 4IDZA 4MHCA 2HODB 1KILB 2HG5D 1QUUA 3SWYA 1VOMA 3I0OA 4O8SA 3R6NA 3JC6C 3M9HA 1DH3A 4C46A 3PTRB 2C5JA 4WY4A 1SVFA 5FXWA 3HA4A 2DCFA 4UV8B 2CLYB 5LOVE 3LW5H 4JUYA 2VL8A 2V7LA 4JYCA 2H3RA 4X20E 3B5ND 5KJ7A 4P0AA 3QUJA 5LGTB 3KV6A 4MALA 3BQLA 1X79A 3L36A 2CPBA 1D1AA 4C7NA 3HUSA 2CXDA 5AW4B 3BATA 1XTCC 3RYCE 3GWHA 2KT9A 3FHNA 3HD7C 1URQB 4ZHQE 2KWHA 1N7SA 4IE4A 2KXPB 4AQRD 4AI6A 4XZCA 1FZCC 4L5GA 3Q2MA 2X9XA 1IC2A 1MMNA 1GU5A 4I43B 2Q5UA 4AKLA 1T2KD 5AW6B 2W63A 4PFOA 1MFZA 1FBMA 5AW5B 4LLHA 4PK5A 2XTLA 4WY4D 1H7CA 3HL6A 2LOPA 1GL2C 2CXFA 1LRZA 4KMCA 4C7RA 3C98B 4EYYR 1AFOA 5L3CB 4GYSA 4CQIA 5KJ7D 1FZFA 3C4WA 3FB2A 1MMDA 4ZKUA 2NPSA 1MNEA 4EZ4A 3BASA 4GK0E 3HD7B 3N9MA 3KV4A 4QWNB 5LA6E 2CEAA 2XNXA 2ZFCA 4TX5A 3M0AA 5APVA 3LJCA 4H63V 3HTKA 1G2CA 5AVRB 4UF0A 1H8AA 5C8YE 5CCHA 1N7SD 3N9PA 3MIWA 2YU2A 2I1KA 1IJ5A 4ZI3D 5BMVE 1GZLA 1Y64B 2J1DG 5HYAA 3KINB 5FXVA 4PNIA 5FY1A 2D0UA 2WT7B 3CX8B 3T97A 3VMYA 4FI5A 4XAXB 4YJ3E 3TKLB 4OK0A 1U5PA 1RE3A 1GL2B 2HLOA 2L5GB 5BU8B 3ZMSB 2YKOA 3MZKB 2MOZA 3K8PC 3KQGA 4GIFA 2A3DA 2NW8A 3V2QA 2B1EA 1NTZK 4PAGA 3D0TA 1GK4A 2A2FX 2K24A 5L3FB 4ISSA 4M1PA 3KVAA 5J2TE 2Q7CA 1H89A 1J2JB 2L3LA 3AA6B 2QA7A 3N2GE 2NPSD 4MFRA 2OYHC 4TN7B 1L4AA 4ANJA 2BVLA 1LTIC 1H88A 5AW9B 3K3NA 1WRGA 3RL0C 2LKMA 2X68A 4JLEA 4RESB 5ADXL 2JQQA 2WPRA 2M3BA 3V5BA 3F57A 5CCHD 4I1LA 2KWIB 3U1AA 2W0GA 4PJNA 3RKOA 1MUUA 2Y6XA 1E1HB 4O9BA 3O4XE 2ODVA 5HXRA 2NP9A 1KNZA 4WBAA 3LK2B 5FY0A 2A72A 3PUQA 2ZM0A 4EXTA 4ZS2A 1RF0A 4DBQA 3PE0A 2JEEA 2WTYA 2XAGB 2ODUA 3N9QA 3Q5XA 2W62A 3OYZA 2C5KT 3ZCIA 2D5UA 1KZUB 3L3PA 2KB7P 3I9YA 2X9WA 3LK3B 1GU4A 2PAJA 3VP8A 1IAPA 3N2OA 5KJ7C 1FZAA 2ZXEB 4ZKPA 2DHRA 3M9QA 5JRCB 5LCYA 4CXWA 4HYTB 2LM9A 1JY2P 2CXLA 3II6A 2OYHB 1Z56A 4I50E 4EOTA 1XTGB 5EZYE 4B6XA 1JCDA 1NU1K 2WSFH 2VKHA 3V4QA 4UV9B 3ZN0B 4ZI7E 1L4AD 3CI9A 1ZR2A 2XAQB 3RL0B 2JPFA 4UIGA 3N2KE 1HCIA 3M65A 1SP4A 1L0NK 1IO4A 4ZI2D 3V2PA 1YKEB 4ZI3C 5LHIB 5AVWB 3U78A 1JY2O 1HF8A 1SQPK 2IW5B 4E7ZA 5APSA 2E43A 3N9NA 2Q3IA 2H7VC 2LJLA 1CZQA 4QHOA 3N9LA 3NRXA 4HKAA 3NRYA 4N78D 3FBLA 1UX5A 1LWUC 3BQKA 3OJAA 3PUAA 2WMOA 4IE7A 3ZC1A 2X67A 4QXBB 4KP3C 4H9RC 3KBUA 5APUA 2P9BA 2V7IA 4QX8B 1AJ3A 3RC3A 1FOSE 1X79B 4OH8B 2W00A 5CB4E 2C0XA 3ETVA 1LTGC 2NPSC 3LG7A 3ESLA 3RK2C 3SRZA 2E9XA 1ZKEA 2NTXA 2Z5IA 2XAFB 3C4XA 3CX6B 1E5WA 3J9X1 5FNVE 4Z8XA 1ZV8A 4YFSA 4IFMA 4GKGA 3SOLA 3Q5WA 3VKHA 4IFFA 3R2PA 4EIJA 3P8MC 3EVYA 2XUEA 3A5XA 2WPQA 5JDQA 1G1IA 2YO2A 2CPSA 1MIYA 1GTWA 1ZHCA 5JR9A 3TSIA 2OA5A 1G1JA 3ANWB 3ZEFB 4XBFB 1LTJC 1HX8A 1LWUB 3ZCJA 3NBXX 2FFDA 3ZMUB 4AKGA 1KFMA 4YHJA 4DO0A 4WB4A 1X9VA 5AW7B 4A56A 3IHRA 3QC9A 3P8CE 1FJKA 2CMRA 1LKXA 1JMMA 2NPSB 2MJZA 2N9BA 2IAKA 2X0LB 3RK2B 1RF1C 3E0ZA 3RH3A 4HTEA 4DBRA 2LSGA 5HWYA 4QXHB 3V2NA 4W7YA 1NTMK 3ZYMA 1YTZT 5FXZA 4IE5A 3N7NA 4O4HE 1CSBA 2E9XD 4H9NC 2DNXA 2X9HA 1KQLA 4IE0A 5CCGC 3I0QA 2JJLA 4CZZB 1JY3P 3CQGB 2EHOA 4ZOLE 3UULA 3MD0A 1CI6A 2XDJA 1MMAA 1NOHA 3E08A 4X1IE 4UELA 4HN9A 3M91A 3Q9DA 3BK9A 3P7KA 4KBMB 2NW7A 1LTJB 5AVXB 1FDMA 4G63A 2KNDA 4TV8E 1LTSC 1JCCA 3MUDA 1M1JC 3AAEB 1RE4C 3B57A 1U4QA 2LOSA 2X66A 5EK2A 1JY3O 3UT5E 1SFCC 3GN5A 3ZYLA 2W6BA 3NTNA 4AQFC 2O1KA 4W7ZA 2XAHB 1RF1B 4O4JE 1D0XA 4OFZA 1MIVA 3GHGA 5AFUL 2GUSA 4GOUA 2PP6A 1LVKA 4DOJA 5A1LA 2QM8A 1N73C 3HE5A 3A3YB 2N1TA 5KMGP 5IYZE 3KBTA 3IEEA 2CCQA 1S9KE 3PDYA 4AQGA 4BJNA 2EHOD 3OBVE 3K3OA 3KV5A 1HFAA 2XQYA 2W6AA 4O2BE 2W61A 2JMKA 2BDEA 3IBPA 5LHHB 5AW1B 3ZMTB 3AAAB 1WRDA 5LNKA 1M1JB 1LT9A 2LSJA 5AVUB 2M8RA 3LIDA 4WNKA 1ZLLA 4K0UA 2HODA 1KILA 2CWOA 2JMHA 3ZPOA 5L3GB 3F31A 3MACA 3RC8A 1SFCB 1FZCB 4P09A 5AVTB 2ACXA 2GK9A 1JTHB 3UUXB 4CXXA 4MBQA 5AW8B 2HPLA 3PU3A 3TYYA 4YLHA 2XASB 5LGUB 1FJPA 1ZN5A 2IC9A 4JYBA 4BAYB 1V9DA 3U3IA 1T98A 1FEWA 1HJBA 1KK7A 3AA7B 3AA1B 1YW0A 1N7LA 2VASA 4DMVA 2P2UA 4ASKA 1N73B 2HFED 3RK3D 2CA5A 4PK4A 4GIWA 2A45G 2YKPA 2HH7A 1NWMX 1EQ7A 2N1TD 5ETWA 1A02F 3B5NC 3HKEE 2A45I 3HI2A 5DQWA 1URQA 2CM0A 1HGZA 1JOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BVZ A;  4N3Y B;  3C9I A;  3N7N A;  4ZKU A;  5BU8 B;  3N4X A;  3U1C A;  3P8C D;  5KTB A;  3VP8 A;  4GIF A;  5BU5 A;  3BAS A;  4N78 D;  1WT6 A;  1X79 B;  4ZKP A;  3U59 A;  4I1L A;  3VP9 A;  2JEE A;  3HRN A;  3U1A A;  3BAT A;  1NKN A;  1IC2 A;  2POH A;  4O9B A;  2FXM A;  3OJA B; 
#chains in the Genus database with same CATH topology
 1SQP D;  5L4H A;  3V6I A;  3ZJ1 A;  2C0W A;  4HEA A;  2BKN A;  2BVM A;  2SPC A;  1E7P A;  1RY3 A;  1VL2 A;  1S2E A;  5H6R B;  3CWB G;  2Y48 B;  1UX4 A;  3S4U A;  2Y8D A;  3PUS A;  3FXD B;  3RQW A;  3QNU A;  4I55 E;  1NGM B;  3IA3 A;  3JC2 2;  2KSR A;  3ZLI A;  3VMZ A;  3OJA B;  3UQ4 A;  1M7K A;  1SQV K;  2YEV C;  1KIL D;  1K05 A;  1NTZ J;  1SLQ A;  2ZM8 A;  2GA1 A;  3L72 D;  4NPF X;  1S72 P;  5AQF B;  5HXE A;  1L0L E;  1ZR4 A;  4D6T E;  5KKZ C;  5H6Q B;  3TNU B;  3OA7 A;  1FU1 A;  1AA0 A;  4EZH A;  3CC4 P;  3BQI A;  4G2A A;  2XPK A;  1LVF A;  3IF8 B;  4TUY E;  1NKZ B;  3IR9 A;  1BGY D;  2L8K A;  3H3A A;  2V5D A;  2OAR A;  5FYM A;  1VQ9 P;  2YK0 A;  1HUC A;  2FYN B;  3B5M A;  2YOE A;  5APX A;  1T2K C;  3MK7 C;  1HS7 A;  3AEB C;  3AVS A;  4DMW A;  1Y8A A;  1Q2N A;  3A7O A;  4W80 A;  5APW A;  3GF3 A;  2E74 D;  2AXT H;  2BG9 B;  2Z5H A;  1WLX A;  4U72 A;  3CX5 I;  3AXJ B;  4P1N A;  2KZ7 B;  5LBQ B;  3WAK A;  2ZMA A;  1W0B A;  5DJT B;  1T6A A;  4CI3 B;  4U7I A;  2E8I A;  1VQO P;  5AQP B;  2M6I A;  3L71 E;  2WVR A;  2BS2 A;  4DV2 T;  4YT0 A;  2C5I T;  3L8R A;  2HPC B;  4WY4 C;  2BAS A;  3AEC C;  3OKQ A;  3B5N B;  1OXZ A;  2V7M A;  1OED E;  1OZH A;  1SQV G;  3RL0 g;  1Q82 Q;  2WSF J;  3H3M A;  5KLV K;  3FX0 A;  3I5C A;  3CKD A;  1L0L K;  1IFD A;  2LHN A;  3HD7 A;  2YIU C;  3ONL C;  3HR0 A;  1FMW A;  2ZLY A;  5AVQ B;  5B66 E;  3AEE A;  3CMA P;  1NEK A;  3L4F A;  1NAF A;  4BXL A;  4H44 C;  1K8A Q;  4EAH A;  2WSE J;  3D6Z A;  3UUM A;  1URQ D;  5AVS B;  1LT1 A;  5AQQ B;  1BR1 A;  2XSA A;  2H7O A;  4O2A E;  2ES0 A;  1L2P A;  5CMZ A;  3L37 A;  3KPE A;  1H0T A;  4J2C A;  1J1D C;  3CX7 B;  1UCU A;  1J1E C;  4PFP A;  4QH5 A;  3HUS C;  3RGL A;  1BR2 A;  1GQE A;  1DX7 A;  2FBW C;  1RH5 B;  5LJN A;  1WR6 A;  3BVH A;  2V4H A;  3TGU E;  5KKZ B;  3X1D A;  3UU4 A;  1WYB A;  5JRE A;  3H32 B;  2ZM6 T;  5BR8 T;  2WT7 A;  5L3E B;  4JI8 T;  1L0L G;  4D6T G;  4UB6 E;  1N7S C;  2WSE H;  4DT0 A;  3HE4 B;  5APY A;  2WZ7 A;  4TT3 H;  1EZ3 A;  2FJE A;  5GON E;  4AIS A;  3CIR A;  4NPD A;  2KYV A;  3EQ2 A;  2I6H A;  5ABG A;  1GL2 A;  5LP6 E;  1J1J A;  3G71 P;  1S5L H;  3C4Z A;  4K3A A;  4RKU J;  2W83 C;  5F3J A;  3CL3 D;  4I6M C;  1NU1 J;  2JO1 A;  2CE7 A;  5AQG B;  3IF4 A;  3L35 A;  5TIS E;  1M57 D;  3RIF A;  1YJ9 P;  5C2T A;  2C9N Y;  2CRB A;  3EWK A;  2AEM A;  3VMX A;  3GHG C;  5AW2 B;  2Z6E A;  1NTM D;  3C51 A;  4BRY B;  1S3J A;  5IWA T;  2NRG A;  2HN1 A;  3RK3 C;  4WY4 B;  3F2E A;  1NO4 A;  4DID B;  1YIT P;  3BCC G;  3L71 G;  3KFW X;  1P84 E;  3CVR A;  2I0M A;  2N1T C;  3MGN A;  4NUV A;  1IZN B;  2YIU B;  2VQE T;  2I8D A;  2K1A A;  2IX7 C;  4EYU A;  4H44 B;  3KVB A;  1HG2 A;  3L73 J;  3VKG A;  1SQP J;  2IUB A;  2O01 H;  4JF7 A;  3P8C D;  4YY3 T;  3HD7 D;  1QSD A;  4TV9 E;  1W0A A;  1RQV A;  4H9O C;  2H88 A;  1HNX T;  2P7J A;  2MTQ A;  1J1D B;  4GYR A;  3EFG A;  1KYO H;  4C7N B;  1J1E B;  4IHJ E;  3SS1 A;  3HUS B;  3CC7 P;  3PJA J;  3A2A A;  3AE7 C;  4N3Y B;  2N1G A;  5C3J A;  2LR2 A;  1OVU A;  4HB1 A;  2V7K A;  1OWA A;  3P4S A;  1KOR A;  4UB8 H;  5L2L A;  3L72 J;  4JPZ B;  3N5L A;  4I4T E;  1USD A;  2X0H A;  4LFC T;  2D0T A;  4AKR B;  1KIL C;  3KDP B;  3TGU G;  1D1B A;  1N7S B;  2YKQ A;  3QK6 A;  2XZR A;  2V7J A;  4JEU B;  2WCA A;  1IFN A;  1SQX J;  1GD2 E;  5L3D B;  4K35 A;  1QEX A;  5JDG A;  1US7 B;  4HFH A;  4YXD A;  5JDM A;  3UUN A;  1FS0 E;  3RRW A;  2XU6 A;  4IGU A;  5HXS A;  2WPV B;  1QVF O;  5CBN A;  1MMG A;  5CCH C;  2K3R A;  2IC6 A;  2K9A A;  4HGA A;  3UUB A;  3PJS K;  3P4P A;  3CME P;  3O6Q B;  2LSK A;  2H7H A;  1AVO A;  1VF5 C;  4H9P C;  3VP9 A;  4C90 A;  3RYF E;  3GHG B;  4QX7 B;  2L9Q A;  3MJX A;  1GL2 D;  3JCU H;  1USE A;  2FKW B;  3USS A;  3RK3 B;  3GA8 A;  4TZ4 C;  5FY7 A;  5CA0 E;  3NMD A;  4DR6 T;  1KTM A;  1FZG A;  1HVV A;  1M8O B;  1PPJ G;  3AAI A;  2KSE A;  2F4V T;  3H1I D;  3AEF A;  3MA9 A;  3WUU A;  4H9S E;  3VTP C;  5JRC A;  2N1T B;  1EDK A;  1IBM T;  4IFD K;  5CJ4 A;  3SWH A;  3H1L E;  4ILC A;  1JNM A;  4JI3 T;  1FDO A;  1M7L A;  4WYV A;  2OYH A;  4JI1 T;  1RE3 C;  1LTT C;  1DEB A;  2V1D B;  5C39 A;  2DI4 A;  1NTK E;  2OYI A;  1JO5 A;  3RRC A;  2D2S A;  4IL4 A;  3AB3 B;  5L3B B;  5FVK A;  1FZB A;  1P84 I;  1FOS F;  3CXH D;  2M67 A;  1X0T A;  2IFM A;  3EFF K;  1D0Y A;  5HWX A;  1HNW T;  2Y9Z A;  3RYI E;  4YTP A;  3AA0 B;  1FZE A;  3PP5 A;  4EIW A;  2VUR A;  2MBG A;  4HH2 A;  3JAF A;  2YIN A;  3OW2 O;  4EGW A;  2ZVO B;  2VWA A;  1IJD B;  1YKH B;  5IHY A;  5DQV A;  3NVO A;  2J62 A;  4DND A;  2IIU A;  1UII A;  2H89 A;  3ZN1 B;  3VHL A;  5HAX A;  1BR0 A;  2BS3 A;  1JM0 A;  3SWF A;  1SQQ E;  1BE3 D;  3L75 D;  1L4A C;  1TU3 F;  2DWG A;  3HKB E;  3LBX A;  3O8Z A;  1VRB A;  2XND H;  2KLU A;  5KTB A;  2UXX B;  3EDU A;  3MHV A;  4NPE A;  5CHX A;  4OYK A;  3HTK B;  1G2C B;  4U74 A;  1PP9 D;  1NTK K;  1S9K D;  5FXX A;  1KB9 D;  2JR8 A;  5ABH A;  5JDN A;  4UF0 B;  4QXC B;  4ZI2 C;  1Y47 A;  1G8X A;  1WFD A;  3LK4 2;  3ZYK A;  4U3F D;  4EED A;  2OYO A;  2FYU E;  4DUY T;  4IST A;  1BCC E;  2B87 A;  1VF5 B;  3C8V A;  1N8R Q;  1ZV4 X;  1HWT C;  4KHZ F;  1HTJ F;  2V6Y B;  3H37 A;  1ZOY A;  4DZO A;  3Q5S A;  2GUV A;  3JAE A;  2H8P D;  4AUW A;  3G9R A;  2BZB A;  1Z0P A;  4IDP A;  3H1K J;  3T97 B;  1QL2 A;  3VU7 H;  1VPC A;  2D2C D;  3CWB D;  2KK7 A;  1HJ0 A;  2FYZ A;  1SQQ K;  4HWC A;  4ZMD A;  4ADZ A;  4NXM T;  2W66 A;  4LC1 A;  4ZS3 A;  4OHF A;  1LGH B;  5CBO A;  5JVD E;  3AE4 C;  3H1L G;  1RF0 C;  4B3T T;  2YO3 A;  5BU5 A;  1OX3 A;  3I9W A;  3PU8 A;  3ONJ A;  2N9D A;  4R4L A;  2R5B A;  4LF4 T;  2BCC E;  4UVA B;  1NTK G;  2AEF A;  2QJK C;  2WMN A;  2WSC H;  3TDK A;  1JEK A;  1Q90 D;  4NXN T;  1IFJ A;  2KNC A;  3PUY F;  2FXM A;  2FYU K;  1T7S A;  3NZQ A;  4GK5 E;  3CX5 D;  3O1J A;  2QEX P;  1D0Z A;  1LTA C;  2K9J A;  2G3A A;  3PUR A;  3ONX A;  2IPP A;  1S94 A;  2KMF A;  4E7S A;  4PW8 A;  5HCM A;  2WM9 A;  5E79 H;  4A7P A;  4ILA A;  3WAJ A;  1WT6 A;  3RL0 D;  2C9L Y;  3J7Y q;  2WSS H;  2DL1 A;  3DTO A;  1HTL C;  1LP1 B;  2J59 M;  4LGD E;  3EI0 A;  2VKO A;  3RGU A;  1L4A B;  4MLK A;  1KFN A;  1MND A;  3N9O A;  3M0D A;  1NKN A;  1E2A A;  3CCQ P;  1SQQ G;  3AVR A;  2M5A B;  3WI3 A;  1OED A;  3CPW O;  4L9I A;  5JDF A;  1GW4 A;  4NUU A;  2WP9 A;  2IZ0 A;  5DAB A;  2QGS A;  2W8Z A;  3LFM A;  4BA9 A;  2N2N A;  1SQV D;  4EDF A;  5TJH A;  2Y0D A;  5AQV B;  1SHZ C;  5H2F E;  3O1I A;  3ANW A;  2Z4E A;  3C50 A;  2Q9Q A;  3KYQ A;  2VRS A;  2OV9 A;  3HKC E;  1BSN A;  1MKM A;  2SPZ A;  1LWU A;  2BG9 E;  3V4W A;  2KLV A;  2FYU G;  1BCC G;  2KZJ A;  2CWY A;  5LJM A;  3ZT7 A;  2JRK A;  2NW9 A;  4PJ0 H;  4XFJ A;  3UU8 A;  3RI5 A;  3MXZ A;  4I0U A;  5CJ5 A;  1HBW A;  2XKM A;  1N33 T;  1K9M Q;  4HJG H;  5FMN A;  3PUG A;  2P1J A;  2JQH A;  4U33 A;  1YTZ I;  3ZDM A;  3RX6 A;  3H1I J;  1EXJ A;  2WU5 A;  4UVB B;  3W67 A;  4RJT A;  2PJQ A;  4GT1 A;  3CML A;  4UVC B;  1UGO A;  2WDR A;  3AEA A;  4X1K E;  2FJA A;  2K9Y A;  2OTK E;  5BVZ A;  4XA4 A;  4X66 T;  3C9I A;  5GTI E;  1VQP P;  2KSJ A;  2IDB A;  2J58 A;  2LM2 A;  2JP3 A;  2FXP A;  2QJK B;  5KLV D;  4ZNC A;  1KQF B;  4ZZC A;  4M3L A;  2BCC G;  1L0L D;  2AEJ A;  4D6T D;  4LF9 T;  2RPA A;  3AE5 A;  1B7T A;  5KDM C;  5KX5 E;  1YQ4 A;  1KEY A;  2RA1 A;  3NFQ A;  2LE8 A;  2LT3 A;  2K5B B;  2YNY A;  3A0H H;  1NHL A;  2KIN B;  3W68 A;  4ILU A;  5J1G A;  1KNP A;  2J4G A;  3H6P A;  2LKG A;  1SQB E;  1BDD A;  4L76 A;  3RLF F;  2WU2 A;  3EUH A;  1VDF A;  1YYC A;  3Q2Y A;  2JQK A;  3G3Z A;  1XNQ T;  4B86 A;  2DLR A;  3AE3 A;  3L70 J;  1JUN A;  3ABV C;  4N6J A;  5LBM A;  4JI2 T;  1O3X A;  3M06 A;  3P4W A;  2C0S A;  2PFV A;  1CUN A;  2E9X C;  3AE6 A;  2LRL A;  3BCC D;  3L71 D;  3A0B H;  4PJJ A;  4H9Q C;  2WWW A;  1IJ6 A;  1S1C X;  2RN0 A;  3CPZ A;  3O9X A;  1A02 J;  4AQY T;  3F5H A;  4CI2 B;  1LTJ A;  2A06 E;  2W2U A;  2LSY A;  1S35 A;  3B8E B;  1NWQ A;  1T3U A;  4IIJ E;  3EDV A;  1X8Y A;  5EK3 A;  4ILB A;  2Q9Q D;  4YXD C;  4UXN B;  5F8P A;  3SFE C;  1I6Z A;  3AE9 A;  2LHR A;  2NTY A;  3D70 A;  1MZ9 A;  2A45 H;  5HXC A;  3MTU E;  4ERR A;  4PJL A;  4ZXL A;  2GM4 A;  3H1H D;  3ZSS A;  1AV1 A;  4UEM A;  1SQB K;  4YHH T;  1KB9 H;  2LEH A;  2D2C C;  3PRJ A;  1W2E A;  3P4Q A;  3CCE P;  2KP8 A;  5JR9 C;  4DVD A;  3NZP A;  1M1K Q;  2YMY A;  2ZAE B;  4V1A v;  2BKP A;  2HHH T;  2XAJ B;  4I2L C;  1RF1 A;  2K37 A;  4LMK A;  4IL6 H;  3M9B A;  3KHU A;  3TGU D;  4GOF A;  2FFD C;  3L74 J;  5M4Y A;  2V26 A;  5HXH A;  3UFE A;  3S4R A;  5EK4 A;  3RIU A;  3K3Q C;  2DWK A;  3RK2 D;  4KHX A;  4OYJ A;  4H13 C;  4YPC A;  2UUB T;  2YXR B;  1D7M A;  2OYI C;  1D1C A;  3T8O A;  4YTM A;  3D6Y A;  1PGO A;  5AQT B;  1HNZ T;  2O1J A;  3Q3D A;  1SA0 E;  1OVV A;  5CCG A;  2R5D A;  4WW0 A;  1FIO A;  1LNQ A;  3AEG A;  1T8B A;  4DV3 T;  1KV4 A;  2G0U A;  2KS1 B;  3BRV B;  3E22 E;  1SQB G;  1MIW A;  4JI7 T;  2XY8 B;  2IDO B;  2E9X B;  1PPJ D;  1JY2 N;  3ZMZ B;  4KI0 F;  2Q1K A;  2LSI A;  1MFT A;  3AE2 A;  4CN6 A;  3EHZ A;  3H1J J;  2NZ2 A;  3CX5 H;  4HE8 A;  3ETU A;  2MYS A;  1P84 D;  4DUZ T;  3OAK A;  1T72 A;  4L0R A;  4EB6 E;  2M3E A;  2WDQ A;  4DV6 T;  2X9Y A;  2HYN A;  2I59 A;  3ZC0 A;  2ZT9 D;  4YJ2 E;  2XV5 A;  1PFI A;  3WUV A;  1M1J A;  2RP4 A;  1RE4 A;  1NU1 E;  4JEH B;  3UTK A;  3UIA A;  3KZI E;  2EHO C;  3RK3 E;  3GMI A;  3MKD A;  5E0O A;  4P0B A;  4U3C A;  2CBI A;  2KIK A;  1R5L A;  1G73 A;  3DP7 A;  1KYO E;  4DR2 T;  2WSS V;  4HWI B;  1SFC A;  4HFI A;  1FZC A;  3CCR P;  1JTH A;  3VMA A;  4UR9 A;  2P67 A;  5JR9 B;  4AQF A;  1ZOY C;  2WWU A;  1FMV A;  3VR8 A;  1T8Z A;  2PGD A;  5AW3 B;  2IYO A;  1JNR A;  3U1C A;  2WBL A;  1E79 H;  5KAI E;  4X1Y E;  5AQU B;  4Y99 C;  5KAF E;  2X51 A;  4BJM A;  2OGU A;  1ZEE A;  1YXR A;  5KLV J;  4F8H A;  2XHE B;  5AQN B;  2FFD B;  4PJM A;  4OGQ C;  3L73 E;  1L0L J;  1SQP E;  4EI2 A;  3A5T A;  3MUD C;  3CQC B;  2IHR 1;  3V2R A;  1RQU A;  5APQ A;  4H13 B;  3W15 B;  4YSZ A;  5ABF A;  1VQ8 P;  3G4S P;  4WBN E;  2KOG A;  2ZM2 A;  2OYI B;  2UXN B;  4GKK T;  1HH0 A;  3JC6 D;  4AKI A;  4QMA A;  1N73 A;  5AVY B;  2IFN A;  1VQK P;  2Q9I A;  1HG5 A;  1YBK A;  2HR3 A;  3AE1 A;  4NPP A;  1VQ4 P;  1OW7 A;  4PD4 E;  4JYA T;  2NOX A;  2A9U A;  3DJB A;  4AXP A;  2O01 N;  2R32 A;  1KN7 A;  5AQK B;  3CC2 P;  1KIL E;  4Q25 A;  1ZP0 C;  4DV5 T;  3I56 P;  1BR4 A;  3L72 E;  5CCG D;  2O01 J;  1XDO A;  5DJQ C;  4PV1 D;  2PG8 A;  1MV8 A;  5AQM B;  2YU1 A;  3BCC J;  4KX6 A;  1UUR A;  3AE8 A;  3KDS E;  3Q1M A;  3ZJ2 A;  4O4I E;  1SQX E;  3VYI A;  1FE6 A;  2V8S V;  3EAB A;  5LG4 A;  5LYJ E;  4AKH A;  3S9O A;  2B9B A;  3LBX B;  3M0D C;  2E76 D;  3IFM A;  5JDL A;  2PBI A;  1N2D C;  3H1L D;  4O4L E;  2BEZ F;  2I1J A;  2WDV A;  5FP3 A;  1L0N J;  4CXY A;  2WPS A;  3FBZ A;  1NTK D;  3VN0 A;  2HPJ A;  5TAO A;  2EHO B;  2WIT A;  4WWI A;  3E7K A;  2BKO A;  4F6R C;  5CA1 E;  2AXC A;  2Q9Q C;  1CI6 B;  3ZMV B;  5CFB A;  1SS1 A;  2VKD A;  2B87 B;  1DD3 A;  2W67 A;  3H1H J;  1FC2 C;  3FXD A;  3V5U A;  1HGV A;  4BWN A;  2CHO A;  3JCF A;  4CI1 B;  1PZQ A;  2K48 A;  3LDQ B;  5AQH B;  1DIP A;  5GTH E;  5AVV B;  1FAV A;  4Y99 B;  4DV0 T;  3TNU A;  3R84 B;  1AQ5 A;  2VKJ A;  3CQX C;  1GW3 A;  1SFC D;  3SFD A;  2B89 A;  1ZW0 A;  1GDT A;  1Z8U A;  4OGQ B;  2ZJS E;  3TGU J;  1SQX K;  3CWZ B;  4EOZ B;  5LHG B;  1SQQ D;  4H0L D;  2XSB A;  1LT9 C;  3LIE A;  2QG4 A;  4TNV A;  3L73 G;  3Q5D A;  4WZX A;  1N86 A;  1W9R A;  3HRN A;  3CLQ A;  2XQ3 A;  2R3C A;  4B3M T;  1NYH A;  1BGY J;  5JQG E;  2POH A;  2BG9 A;  2E5V A;  2AXD S;  5JDH A;  3GN5 B;  3TK1 A;  3AXJ A;  4QKN A;  2LXB A;  2QM7 A;  3UU6 A;  3N4X A;  2KNC B;  3AE5 C;  2FYU D;  1BCC D;  1U7J A;  5AVZ B;  3RYH E;  3O1H A;  2W27 A;  2JWA A;  2WAU A;  1Q7Y Q;  1YQ4 C;  2K9J B;  2CHN A;  2XQ5 A;  3L09 A;  2HPC A;  2VB6 A;  3V5S A;  2XQA A;  3B5N A;  2M6B A;  1T3J A;  2WQY A;  4TWF A;  5HEJ A;  1BDC A;  3L72 G;  4H63 H;  4PD4 I;  2CLY C;  4AIU A;  2E74 C;  5CJ0 A;  2UXD T;  1FDI A;  1LTB C;  4UB6 H;  1IK7 A;  1YD8 G;  3C64 A;  3E1I A;  2UU9 T;  5EFW B;  2E42 A;  2WZH A;  1IFI A;  1SQX G;  2FUP A;  4XE5 B;  4PK6 A;  3HE5 B;  3VOP A;  4FJO A;  4HFE A;  3EAM A;  5AW0 B;  1GK6 A;  1YQ3 C;  2KLQ A;  2NWB A;  1YJW P;  3TLS A;  3AE6 C;  4AYC A;  4DR3 T;  2ZT9 C;  3P32 A;  2Q9Q B;  5LGN B;  3RPU A;  2LRK A;  5FKY A;  4WBO A;  2W4X A;  2XQ4 A;  5JH7 E;  3BRT B;  3H1K E;  5LXT E;  3KV9 A;  4N78 E;  4DR5 T;  3ZKR A;  1Q81 Q;  2H43 A;  1JY3 N;  2VK9 A;  4LML A;  3OYX A;  4C91 A;  1P84 H;  1URQ C;  1QL1 A;  4KUM B;  1CW5 A;  2RMZ A;  3I1A A;  3WMM 0;  4HFV A;  3H32 A;  3AE9 C;  1WYC A;  4QH4 A;  3U59 A;  3NXS A;  5J2U E;  2JJ9 A;  3FXE B;  3B13 A;  4IE6 A;  1IFM A;  4RO0 A;  3FZH B;  1M56 D;  3HKD E;  3HE4 A;  1PGJ A;  4YSX A;  3P7I A;  1NH4 A;  1IK9 A;  2IZ1 A;  1LT9 B;  3LW5 J;  5APT A;  3Q5P A;  4IL6 X;  1YI2 P;  4IDZ A;  4MHC A;  5HEG A;  3AEB A;  2HOD B;  1KIL B;  1EC5 A;  2HG5 D;  1QGK B;  1QUU A;  1AVY A;  3SWY A;  4ASW A;  3A7M A;  1VOM A;  1NAY A;  3I0O A;  4O8S A;  5AQS B;  3R6N A;  3JC6 C;  3M9H A;  3E1R A;  1KFY A;  3UU3 A;  1DH3 A;  4C46 A;  4BRY A;  3PTR B;  3RIU C;  2BS4 A;  2C5J A;  4WY4 A;  3S1K A;  4GOE A;  2J5U A;  1SVF A;  5FXW A;  3HA4 A;  2DCF A;  4UV8 B;  2CLY B;  5LOV E;  2E74 B;  3LW5 H;  1VQ6 P;  4JUY A;  2WSC J;  2VL8 A;  1NTM J;  2X0Y A;  2V7L A;  4JYC A;  1JB0 J;  2H3R A;  2LKH A;  4X20 E;  4A97 A;  3B5N D;  5KJ7 A;  4P0A A;  4X65 T;  3QUJ A;  3Q5R A;  3H1L J;  5LGT B;  1PIX A;  4L75 A;  4JI0 T;  3KV6 A;  4MAL A;  2OQQ A;  3BQL A;  4LMJ A;  1X79 A;  3L36 A;  1YJN P;  2OTL P;  2CPB A;  1D1A A;  4C7N A;  4IRE A;  4WVZ A;  3HUS A;  2OLT A;  2CXD A;  5AW4 B;  2FBW A;  4EYY Q;  3BAT A;  1M90 Q;  1J5W A;  1XTC C;  3RYC E;  3GWH A;  2KT9 A;  3CCJ P;  2FXO A;  3FHN A;  3JAD A;  3HD7 C;  3H1K G;  1URQ B;  3A0H E;  1YIJ P;  2UUA T;  4ZHQ E;  1N32 T;  3AEE C;  1VQM P;  2VL0 A;  1VQN P;  4TWD A;  3FZM B;  2KWH A;  1N7S A;  3F89 A;  4IE4 A;  2QA4 P;  2KXP B;  4AQR D;  3P4R A;  3ZT6 A;  2LXC B;  1SQB D;  3FWN A;  4XZC A;  4AI6 A;  1FZC C;  2E75 D;  3IAO A;  4L5G A;  1ZRT E;  5B5E E;  3Q2M A;  2X9X A;  3CXH E;  1IC2 A;  1MMN A;  1GU5 A;  4I43 B;  2IYP A;  2Q5U A;  2QE7 H;  4AKL A;  1QLB A;  2WY2 A;  5AQL B;  1T2K D;  5AW6 B;  2W63 A;  4PFO A;  3OVU A;  5KXJ A;  3QH9 A;  1MFZ A;  1FBM A;  3CCU P;  3NKZ A;  1OIP A;  5AW5 B;  4LLH A;  1WR0 A;  4PK5 A;  4U7Y A;  2XTL A;  1UIX A;  3L70 E;  4WY4 D;  1H7C A;  2J47 A;  3HL6 A;  4U31 A;  1IBL T;  2LOP A;  1GL2 C;  1KB9 E;  2CXF A;  1LRZ A;  4KMC A;  4C7R A;  3C98 B;  4EYY R;  2MAW A;  1AFO A;  5L3C B;  4GYS A;  4CQI A;  5KJ7 D;  1N34 T;  4CPG A;  1FZF A;  4H44 D;  3C4W A;  3FB2 A;  1HX1 B;  1MMD A;  5LG3 A;  4ZKU A;  2NPS A;  3AE7 A;  1MNE A;  4EZ4 A;  4HKZ H;  3BAS A;  4GK0 E;  3HD7 B;  3N9M A;  4CN4 A;  3KV4 A;  4QWN B;  1I94 T;  5LA6 E;  5K5G B;  2D9D A;  2CEA A;  2XNX A;  1VQL P;  2ZFC A;  4TX5 A;  3M0A A;  5APV A;  3LJC A;  2WWV A;  2R6G F;  4H63 V;  3PHL A;  3I55 P;  3HTK A;  1G2C A;  4JI5 T;  3PUV F;  5AVR B;  2H88 C;  2AXT E;  1H0T B;  4IDN A;  4UF0 A;  1BE3 J;  1SE7 A;  3L75 J;  1H8A A;  5C8Y E;  3T1Y T;  5CCH A;  1N7S D;  3JSV C;  3N9P A;  1NTZ E;  3L74 E;  3MIW A;  2YU2 A;  2ACZ A;  2I1K A;  1IJ5 A;  4LF5 T;  1K73 Q;  4ZI3 D;  1PP9 J;  5BMV E;  2V6Y A;  1GZL A;  4YSY A;  1Y64 B;  1JMB A;  2ZYG A;  2J1D G;  5HYA A;  3KIN B;  2XJ7 A;  5FXV A;  4PNI A;  5FY1 A;  4U3F J;  2D0U A;  4L74 A;  1NVO A;  2WT7 B;  3CX8 B;  1U7M A;  3T97 A;  2WMM A;  3A8Y C;  3VMY A;  2BBJ A;  4FI5 A;  4JV5 T;  5LMN T;  4XAX B;  5LMU T;  4YJ3 E;  3TKL B;  4OK0 A;  1U5P A;  1RE3 A;  1CHU A;  1GL2 B;  2HLO A;  3L70 G;  4B3S T;  2IBZ E;  2L5G B;  2E5L T;  3H1J E;  5BU8 B;  3ZMS B;  3CWB J;  2YKO A;  3GMA A;  5M1B A;  3MZK B;  2MOZ A;  3RIA A;  3K8P C;  3KQG A;  5H2F H;  3IN6 A;  4GIF A;  2A3D A;  2NW8 A;  3V2Q A;  2ZVN B;  2B1E A;  1NTZ K;  4PAG A;  2JWD A;  3D0T A;  1GK4 A;  2A2F X;  2K24 A;  5L3F B;  4ISS A;  2XZE A;  4M1P A;  3KVA A;  5J2T E;  3B71 A;  2Q7C A;  1H89 A;  1J2J B;  2V7Q H;  3L73 D;  2RKL A;  2L3L A;  3AEF C;  2JKV A;  3AA6 B;  2QA7 A;  3N2G E;  1RHZ B;  1LP1 A;  2NPS D;  4MFR A;  2OYH C;  4TN7 B;  2KUB A;  1L4A A;  3OTO T;  4ANJ A;  4PD4 D;  2ZYD A;  2M5A A;  2BVL A;  1LTI C;  1H88 A;  5AW9 B;  1S5L E;  2FJB A;  1SQB J;  5KLI C;  2R44 A;  5GTI H;  1W09 A;  4ZZB A;  4YTP C;  5KLV E;  3K3N A;  1WRG A;  2ZYA A;  3RL0 C;  2LKM A;  2X68 A;  4IL9 A;  2DW3 A;  2E75 C;  4JLE A;  1XMO T;  1NTZ G;  1AJY A;  3L74 G;  4RES B;  5ADX L;  4DJG A;  2JQQ A;  2WPR A;  2M3B A;  1SQX D;  3V5B A;  1SQV J;  3F57 A;  5CCH D;  4I1L A;  2H89 C;  2KWI B;  3AED A;  3U1A A;  2W0G A;  4PJN A;  3RKO A;  2CBJ A;  1MUU A;  3FZF B;  2Y6X A;  1IBK T;  3GLM A;  1E1H B;  4O9B A;  3O4X E;  2ODV A;  5HXR A;  2PTF A;  2NP9 A;  1VF5 D;  1KNZ A;  4JBZ A;  5AQI B;  2W6J H;  1QX8 A;  1EXI A;  1EZV E;  2A06 G;  3QB5 K;  1PL5 A;  4WBA A;  4DV1 T;  2E5Y A;  2Y9Y A;  2XM2 A;  3LK2 B;  5FY0 A;  2A72 A;  3PUQ A;  2ZM0 A;  4EXT A;  1OMI A;  3G06 A;  3AE4 A;  3CCS P;  4ZS2 A;  1RF0 A;  4DBQ A;  3BCC E;  3PE0 A;  2JEE A;  2WTY A;  1EDL A;  2XAG B;  3PLN A;  2ODU A;  4TNW A;  2B76 A;  3N9Q A;  3Q5X A;  3UU5 A;  4X62 T;  2QRX A;  2UUC T;  2W62 A;  2ZXX A;  3OYZ A;  4NIQ A;  1U57 A;  2C5K T;  2IBZ G;  3PV0 F;  3ZCI A;  3H1J G;  1Y01 A;  2D2C B;  2D5U A;  1KZU B;  4JBW F;  3L3P A;  1VQ7 P;  2KB7 P;  1OFC X;  3I9Y A;  2X9W A;  1L0N E;  2P58 A;  3LK3 B;  1GU4 A;  2PAJ A;  3VP8 A;  1IAP A;  3N2O A;  4UB8 E;  5KJ7 C;  1FZA A;  2IBZ I;  3WU2 H;  3FZK B;  2ZXE B;  4ZKP A;  2DHR A;  3FWL A;  3M9Q A;  5JRC B;  5LCY A;  4CXW A;  4HYT B;  2LM9 A;  1JY2 P;  4D6T J;  1HF9 A;  2CXL A;  3II6 A;  2PFX A;  2OYH B;  3H1H E;  2QIW A;  1Z56 A;  3CCV P;  4I50 E;  5F5W A;  4Z90 A;  4EOT A;  1XTG B;  5EZY E;  4B6X A;  1JCD A;  1NU1 K;  2WSF H;  2WS3 A;  5J0Z A;  2VKH A;  3V4Q A;  2YKS A;  5KLI B;  4L73 A;  4UV9 B;  3ZN0 B;  4ZI7 E;  3TLU A;  1L4A D;  4IDQ A;  3CI9 A;  1ZR2 A;  2XAQ B;  2P10 A;  4GOD A;  3RL0 B;  4ZEY A;  2JPF A;  4UIG A;  4LF7 T;  2E75 B;  2UXB T;  1XNR T;  5KLV G;  3JCU E;  3N2K E;  1HCI A;  2YDS A;  4QH1 A;  3M65 A;  1OVR A;  1SP4 A;  2IML A;  1L0N K;  1IO4 A;  1XZY A;  4ZI2 D;  5ABE A;  3L71 J;  4IT4 A;  3V2P A;  1BGY E;  1YKE B;  1UUS A;  2XQ7 A;  4YXW H;  4ZI3 C;  5LHI B;  5AVW B;  1NEN A;  1XWM A;  3FZL B;  2JIW A;  3U78 A;  1JY2 O;  1HF8 A;  1SQP K;  2MPK A;  3G6E P;  4GDO A;  2IW5 B;  1OED C;  4E7Z A;  5APS A;  2E43 A;  3N9N A;  1ZXG A;  1XMQ T;  1EZV G;  2Q3I A;  2H7V C;  5L4E A;  1Q86 Q;  4JQ0 D;  2LJL A;  1PPJ E;  1OW8 A;  1CZQ A;  1NU1 G;  1L0V A;  2O3J A;  4QHO A;  3H1K D;  3N9L A;  3NRX A;  4HKA A;  3NRY A;  4N78 D;  3FBL A;  1UX5 A;  1LWU C;  3BQK A;  1EZV I;  3OJA A;  2L91 A;  3L39 A;  3PUA A;  2WMO A;  4IE7 A;  5HEH A;  3PUZ F;  3ZC1 A;  2X67 A;  4QXB B;  1Y9B A;  4H9R C;  4KP3 C;  3KBU A;  5APU A;  1L0N G;  3VR9 A;  2P9B A;  1KYO I;  2V7I A;  2E2A A;  3KZI H;  3R4Y A;  5B66 H;  1KD1 Q;  4QX8 B;  1AJ3 A;  3RC3 A;  3NWI A;  1FOS E;  1VCT A;  3AEA C;  1X79 B;  4OH8 B;  1SQP G;  2W00 A;  5JTG A;  2KS1 A;  3H1H G;  5CB4 E;  2C0X A;  3ETV A;  1LTG C;  2NPS C;  3LG7 A;  3ABV A;  3ESL A;  2Q6Q A;  3RK2 C;  3SRZ A;  2E9X A;  1ZKE A;  3GF7 A;  5KAI H;  2NTX A;  2Z5I A;  2XAF B;  3C4X A;  5KAF H;  3CX6 B;  1E5W A;  3J9X 1;  1JNZ A;  3GG2 A;  5FNV E;  4IOI H;  4Z8X A;  1ZV8 A;  2R3S A;  4YFS A;  3MP7 B;  4IFM A;  2XM1 A;  4GKG A;  1GMJ A;  3SOL A;  3Q5W A;  3VKH A;  2G8Y A;  4IFF A;  2OTJ P;  3R2P A;  4JI4 T;  1KQS O;  2V6X A;  4X64 T;  4EIJ A;  2WZI A;  3P8M C;  3EVY A;  3RBX A;  3SFE A;  4DCK A;  4HWD A;  4A5X A;  4KJM A;  1BGY G;  4PD4 H;  2XUE A;  3A5X A;  4DR1 T;  2WPQ A;  3KXD A;  4KT0 J;  4OWF A;  1OED B;  5JDQ A;  1G1I A;  2YO2 A;  2KZI A;  3AE3 C;  2CPS A;  1MIY A;  2VVS A;  1DU2 A;  1VCS A;  1GTW A;  4GKJ T;  1ZHC A;  5JR9 A;  3TSI A;  2OA5 A;  2YXQ B;  2BCC D;  1G1J A;  3ANW B;  3ZEF B;  1LJ2 A;  5TIS H;  4XBF B;  1NTM E;  1LTJ C;  4LFB T;  1HX8 A;  1LWU B;  3GW6 A;  5AQJ B;  3ZCJ A;  3NBX X;  2FFD A;  3VRA A;  4TLF A;  2B88 A;  3ZMU B;  4AKG A;  1UK5 A;  3OPC A;  1KFM A;  4YHJ A;  5E79 E;  4DO0 A;  4LFA T;  4I7Z C;  3CD6 P;  4WB4 A;  1YHQ P;  4EEB A;  1X9V A;  1KC8 Q;  3TLT A;  3UFG A;  5AW7 B;  1W2B O;  4A56 A;  1ZRT D;  3IHR A;  1BSH A;  3QC9 A;  5LB7 B;  3P8C E;  1FJK A;  1DD4 A;  2XQ9 A;  1WMK A;  2CMR A;  3MZW B;  1LKX A;  1JMM A;  2YDR A;  2NPS B;  2MJZ A;  2N9B A;  2IAK A;  2X0L B;  3K1S A;  1IFP A;  4HFD A;  3RK2 B;  1RF1 C;  3E0Z A;  3RH3 A;  2BEQ D;  4HTE A;  1PGP A;  2ITA A;  4DBR A;  2E5T A;  5GTH H;  2LSG A;  5HWY A;  4QXH B;  3TLV A;  3V2N A;  1HR0 T;  4DV7 T;  4W7Y A;  1NTM K;  3ZYM A;  1SUM B;  1YTZ T;  5FXZ A;  2QSI A;  4IE5 A;  3N7N A;  4O4H E;  3AEC A;  1CSB A;  2YDQ A;  2CK3 H;  4PJ0 E;  2E9X D;  5L47 A;  4H9N C;  1OW6 A;  2Q3E A;  4MN4 C;  5HEO A;  3L70 D;  2MKV A;  3CCL P;  2DNX A;  2X9H A;  1KQL A;  2NR4 A;  4IE0 A;  5CCG C;  3I0Q A;  2JJL A;  1R5S A;  4PV1 C;  4CZZ B;  1JY3 P;  3CQG B;  2EHO A;  1J5E T;  2M0B A;  3AEG C;  4ZOL E;  3C1L A;  1EDI A;  2PRR A;  2FJD A;  2LLY A;  3P50 A;  3UUL A;  3MD0 A;  5FL0 A;  1X22 A;  1CI6 A;  2XDJ A;  4HFB A;  5AQO B;  1MMA A;  3FGA D;  1NOH A;  2E76 C;  3E08 A;  1NTK J;  2CPT A;  4X1I E;  4UEL A;  4HN9 A;  3M91 A;  3AE2 C;  4HWF A;  2QJY C;  2ZT9 B;  4U2Z A;  3Q9D A;  2VVN A;  2JDI H;  3QB5 A;  3AED C;  3BK9 A;  3RHW A;  3SWK A;  3P7K A;  3PH0 A;  4KBM B;  2UXC T;  2NW7 A;  1LTJ B;  5AVX B;  1FDM A;  4DR7 T;  4G63 A;  5IUX A;  1NTM G;  2KND A;  1M62 A;  4CN1 A;  4TV8 E;  1X9B A;  3H1I E;  1LTS C;  1JCC A;  3MUD A;  1M1J C;  3AAE B;  1RE4 C;  3B57 A;  4I7Z B;  1U4Q A;  2QVA A;  1KQG B;  2LOS A;  2QJP C;  1R8I A;  2X66 A;  3PUX F;  5EK2 A;  1JY3 O;  1VQ5 P;  1SQQ J;  3UT5 E;  1SFC C;  3GN5 A;  3ZYL A;  1NTZ D;  4H13 D;  2W6B A;  3L74 D;  2QYW A;  3NTN A;  4AQF C;  3T1H T;  4JI6 T;  2O1K A;  4W7Z A;  2BBH A;  4H0L C;  2XAH B;  1WCR A;  1ZP0 A;  4TWH A;  4DR4 T;  1RF1 B;  3A0B E;  4O4J E;  3RBZ A;  1NJI Q;  1D0X A;  3O6Q A;  4OFZ A;  1MIV A;  4Y28 J;  2XQ8 A;  4U7J A;  3GHG A;  4COF A;  3RQU A;  5AFU L;  2Y0E A;  2A06 D;  2FYU J;  1BCC J;  3RKG A;  2AE9 A;  2VQF T;  2UWJ E;  4HFC A;  2K3W A;  5HCJ A;  2GUS A;  4GOU A;  2PP6 A;  3SSU A;  1FJG T;  1LVK A;  3WUT A;  4DOJ A;  2HN2 A;  1BE3 E;  5A1L A;  3L75 E;  2QM8 A;  3UQ7 A;  1N73 C;  3HE5 A;  2W90 A;  3A3Y B;  2N1T A;  5KMG P;  3AE1 C;  4A98 A;  1R8E A;  3CK6 A;  5IYZ E;  2N9Y B;  4PV1 B;  3KBT A;  3IEE A;  4HWH A;  2IBZ D;  3H1J D;  2CCQ A;  1PP9 E;  4X5T A;  1S9K E;  1AQT A;  5DJU B;  2K88 A;  5HEU A;  3PDY A;  4AQG A;  3K5B A;  1K04 A;  4U3F E;  2E76 B;  4BJN A;  1XDP A;  3PUW F;  5CGM A;  3CCM P;  4LF6 T;  1S5L X;  1KF6 A;  2EHO D;  2YMK A;  2QJY B;  2WB5 A;  1N36 T;  1QLE D;  3OBV E;  3K3O A;  4IL6 E;  3AE8 C;  2BCC J;  3KV5 A;  1HFA A;  2XQY A;  2W6A A;  2XQ6 A;  4B3R T;  3QWO C;  1DEE G;  2Y0C A;  3FXE A;  4O2B E;  2W61 A;  2JMK A;  2BDE A;  4Z1M H;  3IBP A;  3PJA A;  5LHH B;  5AW1 B;  3ZMT B;  3AAA B;  1WRD A;  5LNK A;  1M1J B;  3D71 A;  1LT9 A;  1PV3 A;  3CWB E;  2LSJ A;  5AVU B;  2M8R A;  2RH0 A;  4DV4 T;  3LID A;  4WNK A;  1ZLL A;  4K0U A;  3H1I G;  2HOD A;  1KIL A;  2CWO A;  2QJP B;  3ITK A;  4OX9 T;  3ZST A;  2JMH A;  3ZPO A;  4Z91 A;  3LSV A;  4OGQ D;  3F31 A;  3TLW A;  3MAC A;  5L3G B;  3RC8 A;  4K0K T;  1EDJ A;  4IDO A;  1SFC B;  1S4X A;  1FZC B;  4P09 A;  5AVT B;  2ACX A;  2GK9 A;  1JTH B;  3UUX B;  3H25 A;  4CXX A;  4MBQ A;  4ASV A;  5AW8 B;  4EV6 A;  2HPL A;  3PU3 A;  4H0L B;  3TYY A;  4YLH A;  4YTN A;  2KI7 B;  4KHP T;  2JQ9 A;  2XAS B;  5LGU B;  1FJP A;  1ZN5 A;  3TF5 A;  2IC9 A;  4JYB A;  4BAY B;  1V9D A;  4R4M A;  2V5C A;  3U3I A;  1T98 A;  3CX5 E;  1FEW A;  3SFD C;  1HJB A;  1KK7 A;  3AA7 B;  3AA1 B;  1YW0 A;  2FYN C;  1N7L A;  1W5C E;  2VAS A;  4LF8 T;  3CXH I;  3VRB A;  5ABF B;  4DMV A;  2P2U A;  4ASK A;  1QVG O;  1EZV D;  5FL1 A;  1N73 B;  3PTZ A;  2V7Q J;  2HFE D;  5L8R J;  1NU1 D;  5B5E H;  4U2Y A;  1KMI Z;  3CXH H;  1YQ3 A;  2BG9 C;  1KNR A;  3RF1 A;  1BE3 G;  3L75 G;  3RK3 D;  2CA5 A;  5AQR B;  4PK4 A;  3B4S A;  4GIW A;  5FVL A;  2A45 G;  2YKP A;  2HH7 A;  1KYO D;  1SQV E;  1NWM X;  1EQ7 A;  3M3Z B;  2N1T D;  5ETW A;  1PP9 G;  1A02 F;  3B5N C;  4OVN F;  3QOF A;  2WQY C;  3ZT5 A;  3HKE E;  1L0N D;  4U3F G;  2A45 I;  3WU2 E;  3HI2 A;  3Q5E A;  5DQW A;  1URQ A;  2CM0 A;  2YN6 A;  1HGZ A;  1PGQ A;  1KB9 I;  1JOC A;  2FY8 A;  1ZME C; 
#chains in the Genus database with same CATH homology
 3ZJ1 A;  2C0W A;  4HEA A;  2BVM A;  2SPC A;  1RY3 A;  5H6R B;  2Y48 B;  1UX4 A;  3S4U A;  2Y8D A;  3PUS A;  3FXD B;  4I55 E;  3ZLI A;  3VMZ A;  3OJA B;  1SQV K;  2YEV C;  1KIL D;  1SLQ A;  2ZM8 A;  5HXE A;  1ZR4 A;  5H6Q B;  3TNU B;  3OA7 A;  1FU1 A;  4EZH A;  3BQI A;  4G2A A;  1LVF A;  3IF8 B;  4TUY E;  1NKZ B;  3IR9 A;  2L8K A;  3H3A A;  2OAR A;  5FYM A;  2YK0 A;  1HUC A;  3MK7 C;  5APX A;  1T2K C;  1HS7 A;  3AVS A;  4DMW A;  3A7O A;  4W80 A;  5APW A;  4U72 A;  2Z5H A;  1WLX A;  2KZ7 B;  5LBQ B;  3WAK A;  2ZMA A;  4CI3 B;  2E8I A;  2C5I T;  2HPC B;  4WY4 C;  2BAS A;  3OKQ A;  3B5N B;  1OXZ A;  2V7M A;  3HKD E;  5KLV K;  3I5C A;  3CKD A;  1L0L K;  1IFD A;  2LHN A;  3HD7 A;  3HR0 A;  1FMW A;  2ZLY A;  5AVQ B;  3L4F A;  1NAF A;  4EAH A;  3UUM A;  1URQ D;  5AVS B;  1BR1 A;  2H7O A;  4O2A E;  2ES0 A;  5CMZ A;  3L37 A;  3KPE A;  4J2C A;  1J1D C;  3CX7 B;  1UCU A;  1J1E C;  4PFP A;  3HUS C;  1BR2 A;  1DX7 A;  5LJN A;  1WR6 A;  3BVH A;  1WYB A;  5JRE A;  3H32 B;  2WT7 A;  5L3E B;  1N7S C;  2WSE H;  3HE4 B;  5APY A;  2WZ7 A;  1EZ3 A;  5GON E;  2KYV A;  3EQ2 A;  1GL2 A;  5LP6 E;  3C4Z A;  5F3J A;  3CL3 D;  4I6M C;  2CE7 A;  3L35 A;  2C9N Y;  3VMX A;  3GHG C;  5AW2 B;  2Z6E A;  3C51 A;  3RK3 C;  4WY4 B;  3F2E A;  1NO4 A;  3KFW X;  3CVR A;  2N1T C;  3MGN A;  4NUV A;  1IZN B;  2IX7 C;  4EYU A;  3KVB A;  1HG2 A;  3VKG A;  2O01 H;  4JF7 A;  3P8C D;  3HD7 D;  1QSD A;  4TV9 E;  4H9O C;  2P7J A;  2MTQ A;  1J1D B;  4GYR A;  3EFG A;  4C7N B;  1J1E B;  4IHJ E;  3SS1 A;  3HUS B;  3A2A A;  4N3Y B;  2N1G A;  2V7K A;  1OWA A;  5L2L A;  3N5L A;  4I4T E;  2D0T A;  4AKR B;  1KIL C;  3KDP B;  1D1B A;  1N7S B;  2YKQ A;  3QK6 A;  2XZR A;  2V7J A;  4JEU B;  1IFN A;  1GD2 E;  5L3D B;  5JDG A;  1US7 B;  5JDM A;  3UUN A;  3RRW A;  2XU6 A;  4IGU A;  5HXS A;  1MMG A;  5CCH C;  2IC6 A;  2K9A A;  4HGA A;  2LSK A;  2H7H A;  4H9P C;  3VP9 A;  4C90 A;  3RYF E;  3GHG B;  4QX7 B;  2L9Q A;  3MJX A;  1GL2 D;  2FKW B;  3RK3 B;  3GA8 A;  4TZ4 C;  5FY7 A;  5CA0 E;  3NMD A;  1FZG A;  1HVV A;  3AAI A;  3MA9 A;  4H9S E;  3VTP C;  5JRC A;  2N1T B;  4IFD K;  5CJ4 A;  3SWH A;  1JNM A;  1M7L A;  2OYH A;  1RE3 C;  1LTT C;  1DEB A;  2V1D B;  2DI4 A;  2OYI A;  1JO5 A;  3RRC A;  2D2S A;  3AB3 B;  5L3B B;  1FZB A;  1FOS F;  2M67 A;  2IFM A;  1D0Y A;  5HWX A;  3RYI E;  3AA0 B;  1FZE A;  3PP5 A;  4EIW A;  2MBG A;  4HH2 A;  2YIN A;  2VWA A;  1IJD B;  1YKH B;  5IHY A;  5DQV A;  4DND A;  3ZN1 B;  3VHL A;  5HAX A;  1BR0 A;  3SWF A;  1L4A C;  2DWG A;  3HKB E;  3LBX A;  3O8Z A;  1VRB A;  5KTB A;  2UXX B;  3EDU A;  5CHX A;  4OYK A;  3HTK B;  1G2C B;  4U74 A;  1NTK K;  1S9K D;  5FXX A;  5JDN A;  4UF0 B;  4QXC B;  4ZI2 C;  3ZYK A;  1G8X A;  3LK4 2;  4IST A;  1ZV4 X;  1HWT C;  1HTJ F;  3H37 A;  4DZO A;  2GUV A;  2H8P D;  4AUW A;  2BZB A;  1Z0P A;  1QL2 A;  3VU7 H;  1VPC A;  2FYZ A;  1SQQ K;  4ADZ A;  4LC1 A;  4ZS3 A;  4OHF A;  1LGH B;  5JVD E;  1RF0 C;  2YO3 A;  5BU5 A;  3I9W A;  3PU8 A;  2N9D A;  2R5B A;  4UVA B;  2WMN A;  2WSC H;  1IFJ A;  2FXM A;  2FYU K;  3NZQ A;  4GK5 E;  3O1J A;  1D0Z A;  1LTA C;  3PUR A;  3ONX A;  2IPP A;  1S94 A;  2KMF A;  4E7S A;  4PW8 A;  2WM9 A;  3WAJ A;  1WT6 A;  3RL0 D;  2C9L Y;  3J7Y q;  3DTO A;  1HTL C;  2J59 M;  4LGD E;  2VKO A;  4MLK A;  1L4A B;  1KFN A;  1MND A;  3N9O A;  3M0D A;  1NKN A;  3AVR A;  3WI3 A;  4L9I A;  5JDF A;  1GW4 A;  4NUU A;  5DAB A;  2QGS A;  3LFM A;  4BA9 A;  2N2N A;  1SHZ C;  3O1I A;  3ANW A;  2Z4E A;  3C50 A;  2Q9Q A;  3KYQ A;  2VRS A;  3HKC E;  1LWU A;  3V4W A;  2KLV A;  2CWY A;  5LJM A;  2JRK A;  2NW9 A;  3MXZ A;  1HBW A;  2XKM A;  5FMN A;  3PUG A;  2P1J A;  1YTZ I;  3RX6 A;  4UVB B;  2PJQ A;  4GT1 A;  3CML A;  4UVC B;  4X1K E;  5BVZ A;  4XA4 A;  3C9I A;  2KSJ A;  2J58 A;  4M3L A;  1B7T A;  5KDM C;  5KX5 E;  2RA1 A;  3NFQ A;  2LE8 A;  2LT3 A;  2K5B B;  2YNY A;  1NHL A;  2KIN B;  4ILU A;  5J1G A;  3H6P A;  3EUH A;  1VDF A;  1YYC A;  3G3Z A;  4B86 A;  2DLR A;  5LBM A;  1JUN A;  4N6J A;  1O3X A;  3M06 A;  2C0S A;  2PFV A;  1CUN A;  2E9X C;  4PJJ A;  4H9Q C;  2WWW A;  1IJ6 A;  3CPZ A;  3O9X A;  1A02 J;  4CI2 B;  1LTJ A;  2LSY A;  1S35 A;  3B8E B;  1NWQ A;  1T3U A;  4IIJ E;  3EDV A;  1X8Y A;  5EK3 A;  2Q9Q D;  4UXN B;  5F8P A;  2LHR A;  2NTY A;  1MZ9 A;  2A45 H;  5HXC A;  3MTU E;  4ERR A;  4PJL A;  2GM4 A;  4UEM A;  1SQB K;  2LEH A;  1W2E A;  2KP8 A;  5JR9 C;  4DVD A;  3NZP A;  2YMY A;  4V1A v;  2XAJ B;  4I2L C;  1RF1 A;  3M9B A;  2FFD C;  5M4Y A;  2V26 A;  5HXH A;  3UFE A;  5EK4 A;  3K3Q C;  2DWK A;  3RK2 D;  4KHX A;  4OYJ A;  2OYI C;  1D1C A;  3T8O A;  2O1J A;  1SA0 E;  5CCG A;  4WW0 A;  2R5D A;  1FIO A;  2G0U A;  3BRV B;  3E22 E;  1MIW A;  2E9X B;  3ZMZ B;  1JY2 N;  2LSI A;  4HE8 A;  3ETU A;  2MYS A;  3OAK A;  4L0R A;  4EB6 E;  2X9Y A;  2HYN A;  2I59 A;  3ZC0 A;  4YJ2 E;  2XV5 A;  1PFI A;  1M1J A;  2RP4 A;  1RE4 A;  4JEH B;  3UTK A;  3UIA A;  2EHO C;  3GMI A;  3MKD A;  5E0O A;  4P0B A;  1G73 A;  3DP7 A;  2WSS V;  1SFC A;  1FZC A;  1JTH A;  2P67 A;  5JR9 B;  4AQF A;  2WWU A;  1FMV A;  1T8Z A;  5AW3 B;  3U1C A;  2WBL A;  4X1Y E;  4Y99 C;  2X51 A;  4BJM A;  1ZEE A;  2XHE B;  2FFD B;  4PJM A;  3A5T A;  3CQC B;  3V2R A;  5APQ A;  3W15 B;  4WBN E;  2KOG A;  2ZM2 A;  2OYI B;  2UXN B;  1HH0 A;  3JC6 D;  4AKI A;  1N73 A;  5AVY B;  2IFN A;  2Q9I A;  1HG5 A;  2NOX A;  3DJB A;  4AXP A;  2R32 A;  1BR4 A;  5CCG D;  5DJQ C;  2PG8 A;  1MV8 A;  2YU1 A;  3KDS E;  3ZJ2 A;  4O4I E;  5LG4 A;  3VYI A;  5LYJ E;  4AKH A;  3LBX B;  3M0D C;  3IFM A;  5JDL A;  2PBI A;  1N2D C;  4O4L E;  2I1J A;  5FP3 A;  4CXY A;  2WPS A;  3FBZ A;  3VN0 A;  2HPJ A;  5TAO A;  2EHO B;  2WIT A;  4F6R C;  5CA1 E;  2Q9Q C;  1CI6 B;  3ZMV B;  2VKD A;  3V5U A;  1HGV A;  4CI1 B;  2K48 A;  5AVV B;  1FAV A;  4Y99 B;  3TNU A;  3R84 B;  1AQ5 A;  2VKJ A;  3CQX C;  1GW3 A;  1SFC D;  1GDT A;  1SQX K;  3CWZ B;  4EOZ B;  5LHG B;  1LT9 C;  3LIE A;  1N86 A;  3HRN A;  3CLQ A;  2R3C A;  5JQG E;  2POH A;  5JDH A;  3GN5 B;  3TK1 A;  4QKN A;  2QM7 A;  3N4X A;  5AVZ B;  3RYH E;  3O1H A;  2W27 A;  2WAU A;  3L09 A;  2HPC A;  2VB6 A;  3V5S A;  3B5N A;  1T3J A;  4H63 H;  2CLY C;  5CJ0 A;  1LTB C;  1YD8 G;  3C64 A;  3E1I A;  2E42 A;  1IFI A;  4XE5 B;  4PK6 A;  3HE5 B;  3VOP A;  4FJO A;  5AW0 B;  1GK6 A;  2KLQ A;  2NWB A;  4AYC A;  3P32 A;  2Q9Q B;  5LGN B;  3RPU A;  4WBO A;  5JH7 E;  3BRT B;  5LXT E;  3KV9 A;  4N78 E;  2H43 A;  2VK9 A;  1JY3 N;  3OYX A;  4C91 A;  1URQ C;  1QL1 A;  4KUM B;  1CW5 A;  3I1A A;  3WMM 0;  4HFV A;  3H32 A;  1WYC A;  3U59 A;  3NXS A;  5J2U E;  2JJ9 A;  3FXE B;  3B13 A;  4IE6 A;  1IFM A;  3HE4 A;  3P7I A;  1NH4 A;  1IK9 A;  1LT9 B;  5APT A;  4IDZ A;  4MHC A;  2HOD B;  1KIL B;  2HG5 D;  1QUU A;  3SWY A;  1VOM A;  3I0O A;  4O8S A;  3R6N A;  3JC6 C;  3M9H A;  1DH3 A;  4C46 A;  3PTR B;  2C5J A;  4WY4 A;  1SVF A;  5FXW A;  3HA4 A;  2DCF A;  4UV8 B;  2CLY B;  5LOV E;  3LW5 H;  4JUY A;  2VL8 A;  2V7L A;  4JYC A;  2H3R A;  4X20 E;  3B5N D;  5KJ7 A;  4P0A A;  3QUJ A;  5LGT B;  3KV6 A;  4MAL A;  3BQL A;  1X79 A;  3L36 A;  2CPB A;  1D1A A;  4C7N A;  3HUS A;  2CXD A;  5AW4 B;  3BAT A;  1XTC C;  3RYC E;  3GWH A;  2KT9 A;  3FHN A;  3HD7 C;  1URQ B;  4ZHQ E;  2KWH A;  1N7S A;  4IE4 A;  2KXP B;  4AQR D;  4AI6 A;  4XZC A;  1FZC C;  4L5G A;  3Q2M A;  2X9X A;  1IC2 A;  1MMN A;  1GU5 A;  4I43 B;  2Q5U A;  4AKL A;  1T2K D;  5AW6 B;  2W63 A;  4PFO A;  1MFZ A;  1FBM A;  5AW5 B;  4LLH A;  4PK5 A;  2XTL A;  4WY4 D;  1H7C A;  3HL6 A;  2LOP A;  1GL2 C;  2CXF A;  1LRZ A;  4KMC A;  4C7R A;  3C98 B;  4EYY R;  1AFO A;  5L3C B;  4GYS A;  4CQI A;  5KJ7 D;  1FZF A;  3C4W A;  3FB2 A;  1MMD A;  4ZKU A;  2NPS A;  1MNE A;  4EZ4 A;  3BAS A;  4GK0 E;  3HD7 B;  3N9M A;  3KV4 A;  4QWN B;  5LA6 E;  2CEA A;  2XNX A;  2ZFC A;  4TX5 A;  3M0A A;  5APV A;  3LJC A;  4H63 V;  3HTK A;  1G2C A;  5AVR B;  4UF0 A;  1H8A A;  5C8Y E;  5CCH A;  1N7S D;  3N9P A;  3MIW A;  2YU2 A;  2I1K A;  1IJ5 A;  4ZI3 D;  5BMV E;  1GZL A;  1Y64 B;  2J1D G;  5HYA A;  3KIN B;  5FXV A;  4PNI A;  5FY1 A;  2D0U A;  2WT7 B;  3CX8 B;  3T97 A;  3VMY A;  4FI5 A;  4XAX B;  4YJ3 E;  3TKL B;  4OK0 A;  1U5P A;  1RE3 A;  1GL2 B;  2HLO A;  2L5G B;  5BU8 B;  3ZMS B;  2YKO A;  3MZK B;  2MOZ A;  3K8P C;  3KQG A;  4GIF A;  2A3D A;  2NW8 A;  3V2Q A;  2B1E A;  1NTZ K;  4PAG A;  3D0T A;  1GK4 A;  2A2F X;  2K24 A;  5L3F B;  4ISS A;  4M1P A;  3KVA A;  5J2T E;  2Q7C A;  1H89 A;  1J2J B;  2L3L A;  3AA6 B;  2QA7 A;  3N2G E;  2NPS D;  4MFR A;  2OYH C;  4TN7 B;  1L4A A;  4ANJ A;  2BVL A;  1LTI C;  1H88 A;  5AW9 B;  3K3N A;  1WRG A;  3RL0 C;  2LKM A;  2X68 A;  4JLE A;  4RES B;  5ADX L;  2JQQ A;  2WPR A;  2M3B A;  3V5B A;  3F57 A;  5CCH D;  4I1L A;  2KWI B;  3U1A A;  2W0G A;  4PJN A;  3RKO A;  1MUU A;  2Y6X A;  1E1H B;  4O9B A;  3O4X E;  2ODV A;  5HXR A;  2NP9 A;  1KNZ A;  4WBA A;  3LK2 B;  5FY0 A;  2A72 A;  3PUQ A;  2ZM0 A;  4EXT A;  4ZS2 A;  1RF0 A;  4DBQ A;  3PE0 A;  2JEE A;  2WTY A;  2XAG B;  2ODU A;  3N9Q A;  3Q5X A;  2W62 A;  3OYZ A;  2C5K T;  3ZCI A;  2D5U A;  1KZU B;  3L3P A;  2KB7 P;  3I9Y A;  2X9W A;  3LK3 B;  1GU4 A;  2PAJ A;  3VP8 A;  1IAP A;  3N2O A;  5KJ7 C;  1FZA A;  2ZXE B;  4ZKP A;  2DHR A;  3M9Q A;  5JRC B;  5LCY A;  4CXW A;  4HYT B;  2LM9 A;  1JY2 P;  2CXL A;  3II6 A;  2OYH B;  1Z56 A;  4I50 E;  4EOT A;  1XTG B;  5EZY E;  4B6X A;  1JCD A;  1NU1 K;  2WSF H;  2VKH A;  3V4Q A;  4UV9 B;  3ZN0 B;  4ZI7 E;  1L4A D;  3CI9 A;  1ZR2 A;  2XAQ B;  3RL0 B;  2JPF A;  4UIG A;  3N2K E;  1HCI A;  3M65 A;  1SP4 A;  1L0N K;  1IO4 A;  4ZI2 D;  3V2P A;  1YKE B;  4ZI3 C;  5LHI B;  5AVW B;  3U78 A;  1JY2 O;  1HF8 A;  1SQP K;  2IW5 B;  4E7Z A;  5APS A;  2E43 A;  3N9N A;  2Q3I A;  2H7V C;  2LJL A;  1CZQ A;  4QHO A;  3N9L A;  3NRX A;  4HKA A;  3NRY A;  4N78 D;  3FBL A;  1UX5 A;  1LWU C;  3BQK A;  3OJA A;  3PUA A;  2WMO A;  4IE7 A;  3ZC1 A;  2X67 A;  4QXB B;  4KP3 C;  4H9R C;  3KBU A;  5APU A;  2P9B A;  2V7I A;  4QX8 B;  1AJ3 A;  3RC3 A;  1FOS E;  1X79 B;  4OH8 B;  2W00 A;  5CB4 E;  2C0X A;  3ETV A;  1LTG C;  2NPS C;  3LG7 A;  3ESL A;  3RK2 C;  3SRZ A;  2E9X A;  1ZKE A;  2NTX A;  2Z5I A;  2XAF B;  3C4X A;  3CX6 B;  1E5W A;  3J9X 1;  5FNV E;  4Z8X A;  1ZV8 A;  4YFS A;  4IFM A;  4GKG A;  3SOL A;  3Q5W A;  3VKH A;  4IFF A;  3R2P A;  4EIJ A;  3P8M C;  3EVY A;  2XUE A;  3A5X A;  2WPQ A;  5JDQ A;  1G1I A;  2YO2 A;  2CPS A;  1MIY A;  1GTW A;  1ZHC A;  5JR9 A;  3TSI A;  2OA5 A;  1G1J A;  3ANW B;  3ZEF B;  4XBF B;  1LTJ C;  1HX8 A;  1LWU B;  3ZCJ A;  3NBX X;  2FFD A;  3ZMU B;  4AKG A;  1KFM A;  4YHJ A;  4DO0 A;  4WB4 A;  1X9V A;  5AW7 B;  4A56 A;  3IHR A;  3QC9 A;  3P8C E;  1FJK A;  2CMR A;  1LKX A;  1JMM A;  2NPS B;  2MJZ A;  2N9B A;  2IAK A;  2X0L B;  3RK2 B;  1RF1 C;  3E0Z A;  3RH3 A;  4HTE A;  4DBR A;  2LSG A;  5HWY A;  4QXH B;  3V2N A;  4W7Y A;  1NTM K;  3ZYM A;  1YTZ T;  5FXZ A;  4IE5 A;  3N7N A;  4O4H E;  1CSB A;  2E9X D;  4H9N C;  2DNX A;  2X9H A;  1KQL A;  4IE0 A;  5CCG C;  3I0Q A;  2JJL A;  4CZZ B;  1JY3 P;  3CQG B;  2EHO A;  4ZOL E;  3UUL A;  3MD0 A;  1CI6 A;  2XDJ A;  1MMA A;  1NOH A;  3E08 A;  4X1I E;  4UEL A;  4HN9 A;  3M91 A;  3Q9D A;  3BK9 A;  3P7K A;  4KBM B;  2NW7 A;  1LTJ B;  5AVX B;  1FDM A;  4G63 A;  2KND A;  4TV8 E;  1LTS C;  1JCC A;  3MUD A;  1M1J C;  3AAE B;  1RE4 C;  3B57 A;  1U4Q A;  2LOS A;  2X66 A;  5EK2 A;  1JY3 O;  3UT5 E;  1SFC C;  3GN5 A;  3ZYL A;  2W6B A;  3NTN A;  4AQF C;  2O1K A;  4W7Z A;  2XAH B;  1RF1 B;  4O4J E;  1D0X A;  4OFZ A;  1MIV A;  3GHG A;  5AFU L;  2GUS A;  4GOU A;  2PP6 A;  1LVK A;  4DOJ A;  5A1L A;  2QM8 A;  1N73 C;  3HE5 A;  3A3Y B;  2N1T A;  5KMG P;  5IYZ E;  3KBT A;  3IEE A;  2CCQ A;  1S9K E;  3PDY A;  4AQG A;  4BJN A;  2EHO D;  3OBV E;  3K3O A;  3KV5 A;  1HFA A;  2XQY A;  2W6A A;  4O2B E;  2W61 A;  2JMK A;  2BDE A;  3IBP A;  5LHH B;  5AW1 B;  3ZMT B;  3AAA B;  1WRD A;  5LNK A;  1M1J B;  1LT9 A;  2LSJ A;  5AVU B;  2M8R A;  3LID A;  4WNK A;  1ZLL A;  4K0U A;  2HOD A;  1KIL A;  2CWO A;  2JMH A;  3ZPO A;  5L3G B;  3F31 A;  3MAC A;  3RC8 A;  1SFC B;  1FZC B;  4P09 A;  5AVT B;  2ACX A;  2GK9 A;  1JTH B;  3UUX B;  4CXX A;  4MBQ A;  5AW8 B;  2HPL A;  3PU3 A;  3TYY A;  4YLH A;  2XAS B;  5LGU B;  1FJP A;  1ZN5 A;  2IC9 A;  4JYB A;  4BAY B;  1V9D A;  3U3I A;  1T98 A;  1FEW A;  1HJB A;  1KK7 A;  3AA7 B;  3AA1 B;  1YW0 A;  1N7L A;  2VAS A;  4DMV A;  2P2U A;  4ASK A;  1N73 B;  2HFE D;  3RK3 D;  2CA5 A;  4PK4 A;  4GIW A;  2A45 G;  2YKP A;  2HH7 A;  1NWM X;  1EQ7 A;  2N1T D;  5ETW A;  1A02 F;  3B5N C;  3HKE E;  2A45 I;  3HI2 A;  5DQW A;  1URQ A;  2CM0 A;  1HGZ A;  1JOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...