3P8CD

Structure and control of the actin regulatory wave complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
244
structure length
204
Chain Sequence
GIKNELECVTNISLANIIRQLSSLSKYAEDIFGELFNEAHSFSFRVNSLQERVDRLSVSVTQLDPKEEELSLQDITMRKAFRSSTIQDQQLFDRKTLPIPLQETYDVCEQPPPLNILTPYRDDGKEGLKFYTNPSYFFDLWKEKMLQDTEDKRKEKRKQKQKNLDARSVLLEAIRKGIQLRKVEEQRENDVATILSRRIAVEYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and control of the actin regulatory WAVE complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Cytoplasmic FMR1-interacting protein 1
total genus 57
structure length 204
sequence length 244
ec nomenclature
pdb deposition date 2010-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02205 WH2 WH2 motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3p8cD01
1.20.58.1570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3p8cD02
3BASA 3N4XA 3C9IA 3BATA 3P8CD 4I1LA 2FXMA 3N7NA 1NKNA 4N78D 4O9BA 3VP9A 5BVZA 4GIFA 3U1CA 4ZKPA 4N3YB 4ZKUA 3HRNA 3U1AA 5BU8B 1WT6A 5KTBA 2POHA 3OJAB 1X79B 5BU5A 2JEEA 3U59A 3VP8A 1IC2A
chains in the Genus database with same CATH superfamily
5JREA 3RYIE 2UXNB 4H9PC 1BR1A 3MIWA 3VMYA 3AE6A 3O6QA 3HD7D 4Z90A 4UF0A 4M1PA 2MAWA 4H9RC 3Q5RA 5DJUB 3JSVC 2QJPB 5CCHC 3WAJA 1L0NK 1LTGC 1FJKA 1URQA 1N32T 3G6EP 2LSIA 4O4JE 1CI6A 4ZNCA 4KX6A 2A06E 1YQ4C 5GTIH 1KB9I 3ZKRA 1JO5A 1G73A 2HPLA 1NWQA 1KYOE 2L91A 3AEEA 2W8ZA 1VQLP 3JC22 1JMBA 1MV8A 2LSYA 4HWIB 3B13A 3D71A 3NRXA 1IZNB 3V2QA 2E5VA 4ZS2A 1SQXD 4WYVA 2KSEA 5AVQB 3D70A 2CEAA 5L4HA 1I6ZA 2IBZE 4QKNA 3VR9A 2V6YA 2JWAA 3NWIA 3H1HJ 4MALA 3LFMA 3TNUB 5JVDE 1SHZC 1V9DA 2V5CA 4LFBT 4KP3C 2K37A 3HL6A 1NTKE 2ZT9C 1W2EA 3ZSTA 3IN6A 2HPJA 3VR8A 1JY2P 1D1CA 2LOPA 1U7MA 3L74G 1LNQA 5AW3B 4Y99B 5AW1B 2RP4A 1QEXA 1NJIQ 2W0GA 5IYZE 2KWHA 3HE5A 3UU6A 4JYAT 2IBZG 2NPSA 2WMNA 4BRYA 1L0LE 1PL5A 4OVNF 4IFDK 4LMLA 3SFEC 4BRYB 5HEHA 5H6QB 2DLRA 5AQVB 4A97A 1R8EA 1KNPA 3VN0A 3V5UA 1GK4A 4YSZA 4DV2T 2J1DG 1SQVG 1SQQJ 3KBTA 1KTMA 1N73C 2ACXA 2CBJA 3CWBD 4UR9A 3CPWO 1BR4A 4IE4A 2E8IA 2B87A 2HPCB 1HFAA 2XSAA 1BGYJ 1SFCD 2FYZA 2LLYA 3IF8B 1QLED 5JDFA 3FHNA 1IBMT 3CQCB 2W27A 1BSHA 1Z56A 2WY2A 3AECA 4MHCA 2PFVA 5IWAT 4GK0E 4OGQD 2JR8A 5KKZC 3PJAJ 3JC6C 3R6NA 5ABFB 4DR5T 1YHQP 5HXEA 4H9NC 4LF6T 2VRSA 1KORA 2EHOA 2BG9C 3EI0A 2VASA 4KHXA 4ZZCA 4B3RT 4GKGA 2LRLA 1SQVK 3FWNA 3CCJP 5APQA 3RK2D 1MMGA 1NAYA 1EZVG 4BA9A 1M8OB 3LW5H 1VDFA 4AIUA 4LFCT 1PPJD 4H13C 2JMHA 2BEZF 5DABA 5TJHA 3P8CD 3L70E 5M4YA 1IBLT 3J7Yq 1HNWT 3CCMP 3S9OA 4TZ4C 3GW6A 1MUUA 5CHXA 2A2FX 1BE3E 3BQIA 2I1KA 2HN2A 2LKGA 3ZJ2A 5A1LA 4EEDA 2UUAT 2E74D 2WWVA 3RQUA 4I7ZC 1SQQD 1R8IA 3MGNA 4IE7A 2XSBA 1FAVA 2JQQA 5JDLA 3C8VA 3O8ZA 2Y0CA 2ZT9B 2PFXA 3A0HH 3A3YB 3P4QA 3CLQA 3EUHA 2V26A 2WB5A 3RH3A 4W80A 2Q9QB 3B5NA 5AQIB 3KZIH 4BJMA 3CCSP 4IOIH 2B87B 3EABA 1LT1A 4B3ST 1G2CB 5LA6E 1IJDB 2XQ6A 5LBMA 3PV0F 3VMAA 4HH2A 4LFAT 1YTZT 4XE5B 3B5MA 3TNUA 3OW2O 3P8MC 3AE9A 1ZOYC 3RYHE 1Q86Q 5JDNA 4DMVA 3UULA 2E9XA 4GKJT 3AAAB 1FJPA 5AW5B 2AE9A 3TGUG 4AKIA 3C98B 4IE0A 5AW9B 1RF1A 2EHOB 2AEMA 1VQ7P 1RF1B 3B5NC 4K3AA 3NFQA 3L75J 1E5WA 1JNRA 3AE4A 3AEBA 4IE6A 1EXIA 2R3CA 3QB5A 5KLVK 5F3JA 3UUXB 1T6AA 2W6BA 5DJTB 3VP8A 2ACZA 2G3AA 3ZDMA 2W63A 3E0ZA 4DOJA 1N7SD 2UXXB 2KT9A 4UVBB 2IBZI 3V2NA 4ILCA 4L5GA 2CBIA 3ZMSB 1HF8A 3ZT5A 2KS1A 4J2CA 1BR0A 3H1JE 1S5LX 2OYIA 4C7RA 3LDQB 2VQFT 1RQUA 1FZEA 2IMLA 2VVSA 3SRZA 2BDEA 4IL4A 1IJ6A 1OWAA 1K73Q 1SQBE 4HFIA 3KPEA 3L39A 4K0KT 1NHLA 5AVWB 3M0AA 3UFEA 1MMDA 3H32A 4CXXA 3KYQA 1JY3O 2M3BA 3RK2C 1LP1A 2XM1A 4CXYA 1ZP0C 2BS4A 3CXHI 2AXCA 4CPGA 4H9SE 4LF4T 4KBMB 3U1AA 1N34T 1VRBA 4JQ0D 5KLIB 3SOLA 1BE3J 3CX5D 3A7OA 2R6GF 3L71D 4PV1D 2V7MA 3PRJA 2A45I 5HWXA 1SQQE 3H1IG 5J0ZA 5APWA 1JTHA 3M06A 2WSCJ 5KAIE 2NW8A 4KHZF 2BVLA 4TNVA 4PD4E 1Y64B 1XZYA 3N5LA 3AE5C 4GKKT 4GIFA 1WFDA 1RE4A 2VKHA 1Z0PA 2N9DA 3II6A 3PU8A 1L4AC 1SQXK 1NTKK 2BASA 1OVUA 4O4IE 4E7SA 1K9MQ 2WVRA 1OVRA 4IDQA 3H1IE 5K5GB 4RESB 3L70D 4HFEA 4DMWA 1GDTA 1H89A 1E79H 2XDJA 1TU3F 3C64A 3V2PA 3OYXA 2WU5A 2IW5B 4JBZA 4PW8A 3V6IA 1MNDA 3B5NB 4GK5E 2IYOA 2XPKA 1W0AA 2IX7C 4GYRA 3TLTA 1HNXT 5HEGA 2H89C 3MK7C 3N9LA 5AQJB 2XAQB 1FZCB 3M91A 5KKZB 3FZLB 3OJAB 2N1TA 4DO0A 3QK6A 1NTMG 1KZUB 1K05A 3BASA 5EK4A 4G63A 4JI0T 1SQBG 1U7JA 2H88C 2RMZA 1VPCA 2BKOA 1H88A 1NAFA 4DV4T 2MPKA 2V8SV 2PAJA 1LTAC 3OAKA 1HGZA 1AA0A 3S4UA 1GMJA 1FZCC 4HWCA 3TYYA 1AQ5A 2H89A 4UB6E 5FL1A 4YJ2E 3GN5B 5C39A 4AUWA 4IGUA 4YJ3E 3ZT7A 1W0BA 1OMIA 2RA1A 3UUMA 3FX0A 4A7PA 3C4WA 1RE3C 5CGMA 5KMGP 1Q82Q 4U3FE 4ILBA 3BATA 1FS0E 5JR9A 3RK2B 4YHJA 3L72G 1NGMB 2E75D 3AEBC 3AAIA 5AW4B 1M1JC 3O9XA 2XQ4A 3ETUA 4LC1A 3USSA 4COFA 3AE3A 4CZZB 3K3QC 1NU1K 1EDJA 1KNRA 3RPUA 3H1HG 2OYHC 5AVRB 3CXHH 5CB4E 1J1DB 1M1KQ 2QIWA 2Q9QC 4O4LE 2OA5A 2WPRA 2M8RA 4YTPC 4DCKA 2H3RA 1ZW0A 2HFED 2C9LY 1A02F 1SQPG 4NPPA 1PV3A 3PUGA 3AE2C 2QJKB 1E1HB 3UTKA 1GD2E 1KQLA 1CZQA 3MZWB 2LOSA 2M3EA 3ESLA 3PJSK 2KSRA 4YXWH 3AVSA 2KI7B 5LG4A 3H1LJ 3WMM0 3T97A 2WZIA 3HTKB 2VQET 2C5JA 2OTJP 4YXDC 1UGOA 3CXHE 4U74A 1GW3A 2RKLA 4JPZB 4DJGA 1T8BA 1XMQT 3AE8C 4TT3H 4EZ4A 2A06D 3V2RA 3GMAA 3H1JJ 1JY2O 4PK6A 3GG2A 2X0YA 4U31A 1CHUA 1NU1D 3WI3A 1Y9BA 3CMAP 2L8KA 5ABHA 1LT9A 2NZ2A 2R44A 3EDVA 2YXQB 1L0LJ 4AQFA 3F89A 2FFDC 3M9HA 3AE9C 4TNWA 2B1EA 1WT6A 2NTYA 4EEBA 1Q81Q 3DJBA 1NTZK 1S94A 1UX4A 2PRRA 2WP9A 3PJAA 4Z91A 3AE5A 5KXJA 4W7YA 3SWKA 3RBZA 4B3TT 4MBQA 1AQTA 4X64T 1HVVA 1FMWA 2B89A 3AEDC 4YPCA 2WZ7A 1UK5A 3ZEFB 3AE3C 4YTNA 4GOEA 2ZFCA 3EWKA 4EI2A 2LSKA 1D1AA 4BWNA 1SFCC 3N9OA 3AA6B 1VQMP 2OYHA 3BK9A 2FXPA 4TWFA 5GTIE 1VF5D 5B66H 1VQ9P 4YY3T 4U33A 3L36A 2C5IT 3CC7P 3KFWX 2O01N 2YO3A 2FJBA 3BCCJ 2C0SA 4QX8B 3N4XA 2K9AA 1P84E 4PAGA 3UU3A 3L3PA 1S4XA 3KZIE 4UB8E 1MIVA 4JI6T 2R5BA 2YOEA 4QWNB 3ONJA 1NYHA 4DV6T 2P58A 3F5HA 5IHYA 2I0MA 4PNIA 1PZQA 5AQFB 3H37A 3L35A 4WW0A 4JI8T 3M65A 4QXCB 1AVOA 3AE8A 1PGQA 4CI1B 5KLVJ 4DR2T 4YLHA 2X9YA 4ASKA 2QA7A 3KVBA 2AEFA 1FOSF 2JJ9A 3TF5A 4IDPA 1NTKD 3SSUA 5LNKA 3QB5K 3ETVA 1NTMJ 2ZM6T 5KX5E 1NEKA 3CCEP 5B66E 2H7OA 3AE1A 2UUBT 5ETWA 5KTBA 3JADA 3Q9DA 1X79A 2G0UA 2CXDA 3PTRB 1SP4A 2E9XC 4XZCA 3HUSA 1ZRTE 2YDQA 2Y48B 3AEGA 1DU2A 4DV1T 4NXNT 4I1LA 1SFCA 1S9KE 3TLUA 3N2GE 2KNCB 3CMLA 2B88A 2QM8A 3ABVC 1H8AA 4ILAA 3KXDA 2HH7A 2Q5UA 3P4RA 1DD4A 3MP7B 5L3BB 2E43A 1N36T 3HD7C 2CLYC 3H1KE 2FYNC 1NWMX 2VKDA 5JDQA 1M7KA 1IBKT 4TN7B 2M5AB 3HTKA 5L3DB 2M5AA 5AQQB 3X1DA 1XWMA 2WMMA 4KJMA 5CFBA 1BCCJ 2R3SA 3HUSC 5LHGB 3K3NA 3PDYA 4X66T 1UX5A 2IIUA 1GTWA 3L75E 2PG8A 1Q7YQ 4TV9E 1IK7A 2CA5A 4AKGA 2WPSA 2WWWA 2W66A 1T98A 3OA7A 2LXCB 3RK3B 1N2DC 3G4SP 3RL0C 1FC2C 5C3JA 3CCUP 4HFVA 1S35A 4KI0F 1X0TA 3C1LA 3H1HE 2XAHB 2FYUK 3MXZA 4U2YA 2NPSC 4DR7T 1QLBA 3TGUJ 3N9QA 3CI9A 1MMNA 1KYOD 1KEYA 1NTKJ 3UQ7A 4F6RC 2Z6EA 3GHGB 3PTZA 2W61A 4JEHB 3P4SA 3H1IJ 4IL6X 2AEJA 3AE1C 1YJ9P 2YU2A 2WPVB 1PP9J 3PUAA 4H13B 1OXZA 3P7IA 5E79H 5AW7B 3OVUA 3AE6C 5LGNB 5JR9C 2XQ8A 3IHRA 1X9BA 1EQ7A 1S3JA 2QEXP 2YMYA 1JM0A 2D5UA 2V7IA 5CA1E 1HJBA 2FUPA 2N1TD 3NZQA 1GK6A 2IDOB 2XQYA 4OFZA 1MZ9A 3NTNA 1FIOA 5F5WA 4DVDA 1SQQG 2KB7P 1VQ5P 3CCLP 1R5SA 3RK3E 4IHJE 2N1GA 4IDNA 4DV3T 3CX5H 3Q5XA 4UVCB 2WSEJ 2LHRA 1P84D 1GL2D 1IFJA 1FMVA 1G8XA 2Y0EA 2E75C 3CCVP 1XDPA 5CJ4A 3I9WA 1QVGO 1OFCX 4O9BA 3H3AA 5HCMA 4X1IE 3IR9A 3A7MA 5TISH 3N9MA 2E9XD 2UU9T 5FKYA 1N33T 4DR6T 4H9OC 4JYCA 1RY3A 4C7NA 1LTTC 2JQKA 4X65T 1MFZA 2YDSA 4O4HE 3CX6B 2BS3A 4NUVA 2D0TA 5CJ5A 4H0LC 3SFEA 3H1LE 1J5ET 5B5EH 2LM9A 3TKLB 1SFCB 4F8HA 3KV4A 2KNCA 3WAKA 3UQ4A 2XKMA 3I1AA 2VL0A 1KFYA 4I4TE 2OYHB 2BVMA 2HHHT 4ZKUA 2FYUE 1SQXG 2WBLA 2MOZA 1FDMA 1T3UA 4NXMT 1YJNP 2ZM2A 4L75A 1ZR2A 2CWYA 1IFPA 4CI3B 2KINB 2V5DA 2K24A 4WWIA 3JAFA 4AQGA 2Y6XA 4IE5A 1D1BA 3P32A 4H44D 1SQVJ 3Q5PA 2XTLA 4YSXA 2A45G 4IDOA 4LF8T 2AXTH 2XASB 3H1KG 3SS1A 1ZXGA 2JJLA 2ZMAA 4JI2T 4EIJA 4C46A 3BRTB 1BCCE 2X9XA 2DL1A 3JCUE 4YTPA 1KILE 2XV5A 2J47A 4OGQC 3L37A 1KFMA 2KIKA 4H63V 3EFGA 3C9IA 5APTA 4H0LB 1S5LH 2HN1A 3LBXA 5FY0A 1FBMA 1YQ4A 2MKVA 1KYOI 3U1CA 1EDKA 3WUUA 4EAHA 5KJ7C 2H7VC 1MIWA 4HFDA 4EGWA 2WSSH 2Q3EA 2CPBA 1IO4A 2CLYB 5L47A 2K9JA 4ASVA 4IL9A 3KINB 2DW3A 2IFNA 2KXPB 3JCUH 4ZEYA 3KDPB 3HUSB 2E75B 4GODA 4ZI3C 3UUBA 4AQRD 3AXJB 4PFOA 3N9NA 1JNMA 2N1TC 4MFRA 2R5DA 1S9KD 1NKNA 3ZMTB 1FZFA 3L74E 3ZMZB 3I0QA 3O4XE 1FOSE 5L2LA 3H3MA 2J59M 2KOGA 2XM2A 4OK0A 1VQ6P 1BCCD 3PU3A 1K04A 1J1EC 2Q6QA 1WR0A 3KDSE 1CI6B 1BE3G 1FDIA 3JCFA 1FZAA 2G8YA 4U7JA 5HXSA 3VYIA 3IEEA 2O1KA 4BAYB 1SQVE 3ZC0A 3H25A 1LTBC 2N9BA 4HWFA 1LJ2A 1PP9E 5AVUB 5AQGB 1DEEG 3PUYF 3BCCG 1ZN5A 4ZMDA 1WCRA 1QGKB 2M6IA 2JQ9A 2K5BB 2WSFH 4I55E 1RE4C 3ONLC 3VRAA 4ZI2C 1L4AB 5EK2A 1HUCA 2HODB 3AECC 2PJQA 2IUBA 5GONE 1Z8UA 3B5ND 3PE0A 2R32A 1N8RQ 1H0TA 2Q9QD 3Q3DA 5J2UE 3D6ZA 3CWZB 2AXDS 4HFHA 5AVZB 1OEDC 4LGDE 2LXBA 2WS3A 2D2CC 4HB1A 2ZXEB 1RQVA 2WQYC 3AEAC 1LTJB 4X20E 1J5WA 5BU8B 2Y9YA 2J62A 3NZPA 2C5KT 3L73G 4OGQB 5AFUL 2KNDA 4PJNA 4R4MA 4EB6E 4E7ZA 5LHHB 2E76C 4UVAB 3GF7A 2L3LA 2OYIC 1UURA 3NKZA 5JTGA 2P67A 3RIUA 1L0LD 2I59A 2FYNB 4ZKPA 4AKHA 3L75D 5AVXB 4PV1B 4H44C 4WBOA 4C91A 1NU1J 2JDIH 3CC2P 4Y99C 2UXDT 2MBGA 5KLVG 2V6YB 2I6HA 3QOFA 3LK42 2M67A 3CWBG 1T72A 4U7IA 1VQ4P 5AVTB 1VOMA 2YEVC 2KZJA 1R5LA 2IPPA 4N78E 4XBFB 1NOHA 4ERRA 5L3GB 3A5XA 3VHLA 5DQVA 1QL2A 5AQLB 2JPFA 1X22A 3RIUC 3M0DC 1VL2A 3CWBE 1WMKA 1LRZA 2D0UA 2YDRA 1XMOT 2VB6A 3ZSSA 2CM0A 5HEOA 2RN0A 4BXLA 1KILD 4HTEA 4QXHB 2BCCJ 4ADZA 1M1JA 1VF5C 2CCQA 4EYYQ 3FB2A 2BBHA 5AQRB 4P1NA 1RHZB 1KV4A 2ZAEB 3PUVF 3AEFC 2O3JA 2LSJA 3RL0g 4QX7B 5LJMA 3O6QB 2W6AA 2WQYA 4MN4C 3GMIA 4YSYA 3QH9A 2XUEA 3H1JD 4UF0B 1SQPJ 2NTXA 4N6JA 2X0LB 2BEQD 4PV1C 3P4PA 3GF3A 2SPCA 1NTZG 3Q2YA 4LF7T 4PJ0H 1PGPA 4JBWF 3CC4P 1HGVA 3RQWA 1OW8A 1OW6A 5LBQB 1LVKA 1YXRA 2YNYA 4OYJA 4TWHA 3L73D 3CL3D 5AQSB 1YKEB 3UU8A 4IIJE 4A5XA 4U2ZA 2V7QJ 1K8AQ 4XAXB 2Z5HA 3O1JA 2KYVA 1ZKEA 1NO4A 1JY3N 5ABGA 2H88A 1KILC 2CK3H 5APVA 2IAKA 3L4FA 2VVNA 3MA9A 2XU6A 3E08A 3AA7B 4U7YA 1H0TB 3G9RA 1JCCA 3MJXA 1HX8A 4IL6H 3VP9A 2VK9A 3FZFB 1SQPK 4P09A 1VCSA 2JO1A 4AI6A 3VTPC 2Q9IA 5CCGC 2LRKA 4JI1T 1FEWA 4CQIA 2NPSB 3BQKA 3HKDE 4GOFA 2FYUJ 3ZCIA 5KLIC 3E1IA 3RYCE 3UIAA 2Q1KA 3AXJA 1IC2A 3BVHA 2P1JA 3KQGA 3TLVA 5L4EA 1NTMK 1PPJE 4H63H 4PK4A 2H43A 5TISE 3NMDA 1NH4A 1GW4A 2YU1A 2BG9B 1G2CA 3MHVA 1RF1C 3KBUA 3KVAA 2L5GB 5LXTE 3OYZA 1BGYG 1Q90D 1URQB 5JDMA 2VWAA 4OYKA 3TGUD 2QJYB 3A0BE 2CPSA 1KILB 1WYBA 2YIUB 1KK7A 1DIPA 2D2SA 1XDOA 3NVOA 1OVVA 4DR1T 1ZHCA 2J5UA 1NTZD 4EOZB 3N9PA 1VCTA 3F57A 5AW0B 3RBXA 2E2AA 3I9YA 4ZI2D 4KHPT 4AISA 1RH5B 1E2AA 1KQGB 4NIQA 2DNXA 3Q5EA 4PJMA 4QXBB 1ZOYA 2CPTA 1KMIZ 1AFOA 3K5BA 4HEAA 5FVLA 1MNEA 2C0XA 3WUTA 3CMEP 3CCRP 3VOPA 4HFBA 4UV9B 1PGJA 2WMOA 4UB6H 2ZM8A 5HXHA 1HS7A 5CJ0A 3M3ZB 2FY8A 2W67A 1SQPD 1VQOP 1HBWA 3H1ID 4WNKA 4AKRB 2OYOA 1JY2N 3NBXX 3F2EA 1KQFB 3K3OA 3PP5A 3C4XA 2QE7H 1SQQK 5BMVE 3ZC1A 1QX8A 1YYCA 5AQUB 2BBJA 4ZHQE 5LCYA 3VRBA 3VMXA 4HWDA 2VL8A 4JEUB 3RRCA 2V4HA 2Q9QA 2CXLA 4ZS3A 2HLOA 3L71G 3LG7A 3ZCJA 2J4GA 2BG9A 5KJ7D 2KWIB 3HRNA 1IFIA 3C51A 3H1KJ 5B5EE 4B3MT 5FVKA 4R4LA 4GOUA 3D6YA 3ZMVB 4UXNB 5AQPB 4EYYR 4DV5T 2F4VT 5BU5A 3RF1A 3RC3A 3OJAA 2KK7A 3L74D 1WYCA 1IFMA 1J2JB 1USDA 4PFPA 4XFJA 2A9UA 1DD3A 2IBZD 2PP6A 3K8PC 1LTSC 1SE7A 3N7NA 1N73B 1Y01A 2LE8A 5CMZA 3H1LG 4UIGA 2KLQA 4JYBA 1FZGA 2BKNA 1URQC 3CPZA 3KV5A 1MFTA 3QWOC 5FXVA 2WDVA 1SQVD 4HE8A 4KUMB 5H2FH 3OKQA 1LWUB 5AW6B 3IFMA 2K1AA 2X68A 3P4WA 5HEUA 1YTZI 2D2CB 4FJOA 5JR9B 1VQKP 1EZVD 4LF9T 2BKPA 4H9QC 1LGHB 1FDOA 4L0RA 2WT7A 2LM2A 5J1GA 4JI5T 2V7QH 1L0NJ 1PGOA 3A0HE 4AQYT 3FZHB 3FXDA 4GIWA 3RL0D 3RKOA 4ILUA 3E1RA 1FZBA 1IK9A 1KILA 3I55P 5H2FE 2P9BA 4HKZH 1B7TA 5ADXL 4O2AE 2V6XA 3H32B 1OX3A 3TLWA 1MIYA 2ITAA 1BGYE 2XAFB 2UUCT 1LP1B 3AEAA 5EK3A 5AVSB 2YMKA 5HEJA 4H0LD 3L71E 3TSIA 1P84H 2XY8B 3WUVA 2A45H 3NXSA 3RYFE 3IBPA 1UIXA 1OZHA 2YKQA 1D0YA 3AE4C 5KJ7A 1JEKA 2JWDA 4NPFX 5M1BA 3SWFA 2YKSA 5CCHD 1KC8Q 2JEEA 4M3LA 1UIIA 2ODVA 2D2CD 4FI5A 3B57A 4LMKA 1HH0A 1AJ3A 4U3FJ 1L2PA 1Y47A 5AQTB 1JTHB 4OH8B 3C4ZA 3JAEA 3HR0A 3H1KD 3VMZA 1HTLC 1WRDA 1N73A 2OGUA 1SLQA 3B4SA 1L4AD 1GU5A 2WSFJ 2A06G 2HYNA 1S5LE 4OX9T 2BS2A 3CIRA 3LIEA 2WSCH 2FKWB 3PHLA 1VQNP 1IFDA 1T7SA 2FBWC 1U57A 2GA1A 3UT5E 1VQPP 1BE3D 1T2KD 2FXOA 2DCFA 4UV8B 1ZRTD 3S4RA 1EDIA 5LHIB 2V7JA 5APXA 5LP6E 2YINA 4I6MC 2QG4A 1L0LK 2C0WA 2QA4P 3B71A 5EFWB 2EHOC 2OTLP 2MJZA 1NKZB 2MTQA 2XQ9A 5FP3A 3R84B 3PLNA 2ZYDA 4W7ZA 4WBNE 2XZEA 3VKGA 1YITP 5J2TE 2IDBA 4QH5A 4HWHA 1EZVI 2N1TB 2P2UA 5AVYB 1W9RA 3O1HA 2BCCG 3H1LD 2CHNA 3AEEC 2WDQA 2Q7CA 2C9NY 5FY7A 4ISSA 3CQXC 5JDGA 2E9XB 5APUA 4TLFA 4QH1A 1L0VA 1OW7A 3CWBJ 1AVYA 2X9WA 2V7KA 3DP7A 2CHOA 2X66A 5LB7B 3U78A 4H13D 4EYUA 1EDLA 3KV9A 2QGSA 1DEBA 4U3CA 1QUUA 2LT3A 1HWTC 1SQBK 5AW2B 5FXZA 2RH0A 1HG5A 2NW9A 5C8YE 1M7LA 3HD7B 2XNDH 2XJ7A 2FYUD 4JUYA 5KAIH 4JI7T 3RL0B 1KB9H 2NPSD 3V5BA 4YTMA 3EHZA 3MUDC 4DV7T 1FJGT 2UXBT 1ZP0A 3RK3D 1GQEA 4YHHT 3CX5I 3GHGA 4OHFA 2NWBA 2FBWA 1HNZT 1IJ5A 1VF5B 2WTYA 2LEHA 4TV8E 4DR3T 1N7SB 2GUSA 3FXDB 1M57D 5HWYA 2J58A 1EZ3A 5LGUB 5HAXA 3L71J 3GLMA 1ZMEC 3FZKB 1HCIA 2W83C 2PBIA 2MYSA 4EZHA 2IFMA 1QL1A 3CX8B 4EV6A 1HJ0A 1JY3P 3ZLIA 4DBQA 1CW5A 2VKJA 5HYAA 5AQOB 3H6PA 5FL0A 2H8PD 4CN4A 5C2TA 2KMFA 3GHGC 4RO0A 4KMCA 4DUZT 3VKHA 2YIUC 1RF0C 4AQFC 1ZR4A 1JB0J 1FZCA 2Y8DA 4P0AA 3RC8A 1GL2B 3KHUA 3QNUA 4DBRA 3AE7A 2I1JA 2DHRA 4HYTB 1JOCA 1W09A 4NPDA 1NTKG 4WY4A 5DQWA 3ZYKA 3Q5SA 3EVYA 2BCCE 2ZYGA 3RGUA 3L75G 3AEFA 4N3YB 4Y28J 1LT9B 2IHR1 2X9HA 3HKBE 4ASWA 2K48A 3CVRA 3GA8A 1JCDA 2O01H 1XNRT 4HJGH 4O8SA 3WU2H 2DI4A 1BDCA 1YIJP 3HD7A 2W00A 2NW7A 3HKEE 4AXPA 4JF7A 2JRKA 1XTCC 2XAJB 5HXCA 4EOTA 2FXMA 1L0ND 2E74B 2A3DA 4WY4C 2PTFA 2Y0DA 2WSEH 2WT7B 3CCQP 2W62A 3SWHA 2KS1B 1IAPA 2P10A 2LKMA 4DNDA 2OYIB 3LK2B 1EC5A 4U72A 3W67A 2O01J 3A8YC 4PK5A 3ZPOA 5JH7E 4UEMA 3HA4A 3J9X1 3IA3A 5DJQC 3H1HD 3JC6D 2ZJSE 3D0TA 2YXRB 4PD4I 2NRGA 1DH3A 1SQXJ 2YN6A 2W90A 4CN1A 4WZXA 3PUXF 2W2UA 3L72J 2Y9ZA 2FYUG 2OV9A 3MACA 3RHWA 2QJYC 1NENA 5AVVB 2AXTE 2NOXA 1KQSO 3V4WA 2POHA 3WU2E 2X67A 1YKHB 1US7B 4TX5A 1J1JA 3LIDA 3N2KE 4HFCA 2WU2A 4IT4A 4Z8XA 3V5SA 1M90Q 2QRXA 3QC9A 3RIFA 4B86A 3E22E 1EZVE 1USEA 4JV5T 5TAOA 3UFGA 1SS1A 5APSA 3ZYLA 5F8PA 2GUVA 3VU7H 1KYOH 1N7SA 4DIDB 5L3FB 2NP9A 1MKMA 1SUMB 1I94T 3BRVB 1KNZA 3W15B 3T8OA 5AW8B 3FZMB 1HR0T 4JI4T 1ZV8A 4ZI3D 4GT1A 1CSBA 4LMJA 1NTME 3CD6P 1GZLA 5E0OA 2FJAA 5KAFH 4UB8H 2QVAA 3PUQA 1JUNA 3SWYA 4X1KE 4YFSA 2I8DA 1WRGA 2YKPA 2CWOA 2DWKA 2YK0A 3TLSA 4CI2B 3ZYMA 3T97B 2NR4A 1GL2A 5FMNA 4NPEA 3CX5E 1YD8G 3T1HT 2E76D 3AEDA 2E5TA 5AQNB 1W5CE 4DR4T 1AJYA 3Q5WA 2QM7A 2UXCT 3ZJ1A 4U3FG 3MUDA 2BG9E 3ABVA 3U3IA 3AA0B 3A5TA 3L09A 5FYMA 5KAFE 1S2EA 5LG3A 4O2BE 1KN7A 1OEDE 4EIWA 4HGAA 4DV0T 3L70J 1X8YA 2RPAA 2N9YB 3AE7C 2DWGA 3QUJA 1J1DC 5L3EB 1L0NG 2PGDA 3GN5A 4HN9A 1J1EB 2KUBA 3G06A 1FE6A 1L4AA 1PP9G 4TWDA 4AKLA 1NTMD 3U59A 2IZ1A 3RIAA 4EDFA 3G3ZA 3LSVA 1X9VA 3HKCE 3AEGC 1KFNA 2KSJA 2QJKC 1YQ3A 4ISTA 3P8CE 3ANWA 3TK1A 2Z5IA 3UU4A 4HKAA 1OEDB 5KLVD 1OEDA 1E7PA 2ODUA 1X79B 2WCAA 1MMAA 2WDRA 2WWUA 1EXJA 4I2LC 2K9YA 3FXEA 1W2BO 2CRBA 3ZT6A 3FXEB 5APYA 2V1DB 1WLXA 3K1SA 1GL2C 1JMMA 3IAOA 1YBKA 5LOVE 5LMUT 3RK3C 5AQKB 4X1YE 2XQ7A 2Q3IA 3CXHD 4I43B 3L74J 5LMNT 3EDUA 2W4XA 5HXRA 2XQAA 3IF4A 4WY4B 1LT9C 2K3RA 1PFIA 2KZ7B 3S1KA 3ZMUB 1SQPE 3FBLA 3EFFK 3T1YT 1RF0A 2N2NA 4ZI7E 3RKGA 2LKHA 3RLFF 2V7LA 3GWHA 2HR3A 5CBNA 1QVFO 1S72P 1D0ZA 2KLUA 3V4QA 2ZM0A 2IZ0A 3BCCE 3M0DA 4UELA 5JQGE 4P0BA 3PURA 1AV1A 3RX6A 1P84I 2SPZA 3TGUE 1BCCG 4X5TA 1L0NE 4LLHA 2JIWA 1XNQT 3BQLA 3OBVE 4DUYT 1IFNA 1PP9D 5FNVE 4DT0A 3ITKA 2E42A 4Z1MH 4EXTA 4I0UA 4QHOA 2WITA 1LVFA 1SA0E 2CXFA 1LTJA 3P50A 1ZEEA 4U3FD 3SFDC 1ZV4X 1A02J 1NU1E 4XA4A 1Y8AA 4NUUA 2XQ3A 1U4QA 3PUZF 3CK6A 2LHNA 3AAEB 4PJLA 5GTHE 4B6XA 5FXWA 3RGLA 1T2KC 3AE2A 2W6JH 2OTKE 4N78D 4YT0A 2JKVA 2OARA 4WB4A 1OIPA 3ZN0B 2LR2A 3FGAD 3MZKB 3PUWF 5CCHA 2IC6A 2WAUA 2JQHA 4D6TG 4GDOA 1T8ZA 4WBAA 3EQ2A 1H7CA 1L0LG 3ZN1B 1JNZA 4LF5T 1LTJC 1BR2A 3NRYA 2IYPA 4RJTA 1T3JA 2EHOD 3AB3B 3Q1MA 3OPCA 4IFFA 2M0BA 2HODA 3N2OA 4ZXLA 1S1CX 3L70G 2FFDA 3P7KA 2E5LT 4AYCA 4Q25A 1SVFA 4V1Av 1KD1Q 1CUNA 2JP3A 4PJ0E 3C50A 1UCUA 2XHEB 2XAGB 2UWJE 2B9BA 1GU4A 3E7KA 2ES0A 5LYJE 5JRCA 2OLTA 4PD4H 4JLEA 4IL6E 4QH4A 1D7MA 3UU5A 3OTOT 4C7NB 3AA1B 1U5PA 5CCGA 3FBZA 1M62A 2E5YA 5CBOA 3CKDA 2BCCD 3LK3B 5HCJA 1LWUA 1YW0A 4QMAA 2D9DA 4BJNA 1UUSA 1N7SC 4ANJA 3W68A 3L73E 5EZYE 4I50E 1NTZJ 2K88A 3Q5DA 3SFDA 3LW5J 2KZIA 4K0UA 2HPCA 4ZZBA 5L8RJ 5ABEA 4G2AA 1KB9E 1Q2NA 1SQXE 3PH0A 1KF6A 5E79E 2FJEA 1G1JA 3H1JG 2YKOA 2BZBA 3RRWA 1BSNA 1LKXA 1KB9D 1PPJG 5AQHB 5AQMB 1LWUC 1N86A 5JDHA 3ONXA 5ABFA 3HE4B 2Z4EA 1NVOA 5BVZA 3TDKA 3L72D 2OQQA 4K35A 1D0XA 1YQ3C 2WSSV 3M9QA 2X0HA 4YXDA 1HF9A 4KT0J 1FU1A 2M6BA 3DTOA 4PJJA 4D6TE 4C90A 1HTJF 4JI3T 1LTIC 5LJNA 1N7LA 2LJLA 1M1JB 3I56P 2KP8A 4ZOLE 4IREA 4CN6A 2WM9A 4D6TD 3AVRA 3RI5A 2IC9A 2B76A 1SQBD 1VQ8P 2QYWA 5FXXA 3LBXB 2ZYAA 4GYSA 2E76B 3A0BH 3A2AA 1G1IA 4WVZA 3ANWB 2XQ5A 4MLKA 1DX7A 1URQD 2ZLYA 3R2PA 2KLVA 4DZOA 3HE5B 3FWLA 2H7HA 5KLVE 2K3WA 2ZXXA 3B8EB 1RE3A 3I0OA 2E74C 1O3XA 3CQGB 4I7ZB 2A72A 1HG2A 3KV6A 5L3CB 5CCGD 5CA0E 4A56A 5LGTB 3CX7B 3L72E 2GK9A 2LSGA 2FJDA 2YO2A 1NTZE 1NU1G 3L73J 2QJPC 4L76A 1BDDA 3HI2A 3L8RA 3PUSA 3EAMA 4X62T 3Q2MA 1YI2P 2P7JA 3R4YA 1PIXA 3G71P 4L73A 4OWFA 4IDZA 2O1JA 4WY4D 4CXWA 2HG5D 1YJWP 3M9BA 3MTUE 5KDMC 2L9QA 5IUXA 2FFDB 1XTGB 2ZVOB 5GTHH 1M56D 2VKOA 1BGYD 3LJCA 4L9IA 3F31A 3HE4A 4H44B 2XZRA 1QSDA 2ZVNB 2GM4A 4A98A 5BR8T 5JRCB 5FY1A 2X51A 2CMRA 1SQBJ 2K9JB 2VURA 2JMKA 3MKDA 2WZHA 4TUYE 2WPQA 3I5CA 4D6TJ 3UUNA 2XNXA 3O1IA 4RKUJ 1ZLLA 1WR6A 4IFMA 2CE7A 3BCCD 2ZT9D 5H6RB 4L74A 4PD4D 2QSIA 1HX1B 3MD0A
chains in the Genus database with same CATH topology
4W7YA 2JRKA 1XTCC 2XAJB 5HXCA 3RYIE 2LSJA 2UXNB 4H9PC 4MBQA 1BR1A 4QX7B 1HVVA 2FXMA 4EOTA 3MIWA 3VMYA 1FMWA 2WZ7A 2A3DA 5LJMA 2W6AA 3ZEFB 4WY4C 2W62A 2WSEH 2WT7B 2ZFCA 3HD7D 4UF0A 3SWHA 3GMIA 4M1PA 2LSKA 1D1AA 2XUEA 1IAPA 4UF0B 1SFCC 2NTXA 4N6JA 2LKMA 3AA6B 2OYIB 3N9OA 2OYHA 2X0LB 3BK9A 3LK2B 4H9RC 4DNDA 5CCHC 4U72A 3WAJA 1L0NK 1LTGC 1FJKA 1URQA 4PK5A 4ZI3D 2LSIA 4O4JE 3ZPOA 3L36A 5JH7E 2SPCA 1CI6A 2C5IT 4UEMA 5LHHB 3HA4A 3KFWX 3J9X1 1HGVA 5DJQC 3JC6D 2YO3A 5LBQB 3D0TA 2C0SA 4QX8B 3N4XA 1JO5A 1G73A 1LVKA 2HPLA 2YNYA 1NWQA 2K9AA 4PAGA 1DH3A 4OYJA 3L3PA 3CL3D 1MV8A 1MIVA 2LSYA 3B13A 3NRXA 2R5BA 1IZNB 3V2QA 4QWNB 3MACA 1YKEB 4ZS2A 4IIJE 5AVVB 5IHYA 4XAXB 2Z5HA 3O1JA 5AVQB 4PNIA 2KYVA 2CEAA 1ZKEA 1NO4A 1JY3N 4QKNA 3H37A 3L35A 4WW0A 2NOXA 4CI2B 3M65A 4QXCB 1KILC 5APVA 2IAKA 3L4FA 3V4WA 2POHA 2X67A 4MALA 1YKHB 3MA9A 2XU6A 3E08A 3TNUB 1US7B 3AA7B 3LFMA 4TX5A 5JVDE 4CI1B 1SHZC 3LIDA 1V9DA 3N2KE 4KP3C 1JCCA 3HL6A 3MJXA 1HX8A 1W2EA 4YLHA 5JREA 2HPJA 1JY2P 1D1CA 2LOPA 2X9YA 4Z8XA 3V5SA 3VP9A 2QA7A 3KVBA 4ASKA 2VK9A 1SQPK 3QC9A 4P09A 4B86A 5AW3B 3E22E 4Y99B 5AW1B 1FOSF 3VTPC 2JJ9A 2Q9IA 5CCGC 2RP4A 2W0GA 5IYZE 5APSA 1FEWA 2KWHA 5TAOA 3HE5A 3ZYLA 4CQIA 5LNKA 3ETVA 5F8PA 2GUVA 3VU7H 2NPSA 1N7SA 2WMNA 2NPSB 4IFDK 5L3FB 5KX5E 2NP9A 5H6QB 2H7OA 3BQKA 5ETWA 5KTBA 3HKDE 3Q9DA 2DLRA 1X79A 2G0UA 3BRVB 3ZCIA 2CXDA 3E1IA 1KNZA 3RYCE 3PTRB 3W15B 3UIAA 1SP4A 2E9XC 4XZCA 3T8OA 4AI6A 3HUSA 5AW8B 2Y48B 1IC2A 3VN0A 1ZV8A 2P1JA 3KQGA 3BVHA 1GK4A 4GT1A 1CSBA 1NTMK 2J1DG 3V5UA 4I1LA 1SFCA 4H63H 4PK4A 1S9KE 3N2GE 1GZLA 5E0OA 2H43A 3KBTA 3CMLA 5LXTE 2QM8A 1H8AA 3NMDA 1N73C 2ACXA 1NH4A 1JUNA 3PUQA 1BR4A 1GW4A 2YU1A 2E8IA 4IE4A 2HPCB 3SWYA 1HFAA 2HH7A 1G2CA 2Q5UA 1RF1C 4X1KE 4YFSA 3KBUA 1SFCD 2FYZA 3KVAA 5L3BB 2E43A 3IF8B 1WRGA 2L5GB 2YKPA 2CWOA 2DWKA 2YK0A 5JDFA 3HD7C 2CLYC 1URQB 1NWMX 2VKDA 3FHNA 3OYZA 3CQCB 3ZYMA 2VWAA 5JDMA 4TN7B 5JDQA 1GL2A 3HTKA 4OYKA 2W27A 5L3DB 1Z56A 5FMNA 2CPSA 1YD8G 1KILB 1WYBA 4MHCA 2PFVA 1KK7A 4GK0E 3R6NA 2D2SA 3HUSC 3JC6C 5LHGB 1ZHCA 2QM7A 3K3NA 3Q5WA 3ZJ1A 3MUDA 3PDYA 1UX5A 4H9NC 3N9PA 1GTWA 4EOZB 5HXEA 2VRSA 2PG8A 4TV9E 2EHOA 3AA0B 3A5TA 3U3IA 2CA5A 3L09A 5FYMA 4AKGA 3F57A 2WPSA 5AW0B 2WWWA 4KHXA 2VASA 4O2BE 4EIWA 4GKGA 4HGAA 1T98A 3OA7A 3I9YA 4ZI2D 3RK3B 1N2DC 1SQVK 1X8YA 1MMGA 5APQA 3RK2D 3RL0C 2DWGA 3QUJA 1J1DC 4PJMA 2DNXA 5L3EB 4HFVA 4QXBB 4E7ZA 3GN5A 4HN9A 1J1EB 4BA9A 1S35A 3LW5H 1VDFA 1AFOA 1L4AA 2XAHB 2FYUK 3MXZA 4HEAA 4AKLA 3U59A 2NPSC 1MNEA 2JMHA 2C0XA 5DABA 3P8CD 3N9QA 3CI9A 3G3ZA 3VOPA 5M4YA 1MMNA 1X9VA 3HKCE 3J7Yq 4UV9B 1KFNA 2WMOA 4TZ4C 2ZM8A 4F6RC 2Z6EA 5HXHA 5CJ0A 2KSJA 3GHGB 5JDGA 1HS7A 1MUUA 5CHXA 2W61A 4JEHB 1HBWA 2A2FX 4ISTA 3P8CE 2I1KA 3TK1A 2YU2A 3ANWA 3BQIA 4WNKA 3ZJ2A 3ZMUB 2Z5IA 4AKRB 5A1LA 1JY2N 3PUAA 4HKAA 3NBXX 1OXZA 3P7IA 3MGNA 5AW7B 3F2EA 3K3OA 4IE7A 1FAVA 2ODUA 5LGNB 1X79B 5JR9C 1MMAA 2JQQA 5JDLA 3PP5A 4ZHQE 3IHRA 3O8ZA 2WWUA 3A3YB 3C4XA 1EQ7A 1SQQK 5BMVE 2YMYA 3ZC1A 1YYCA 2D5UA 3CLQA 3EUHA 4I2LC 2V7IA 2V26A 5LCYA 3RH3A 4W80A 3VMXA 1HJBA 2Q9QB 2VL8A 4JEUB 3B5NA 3RRCA 2Q9QA 2N1TD 3FXEB 3NZQA 1GK6A 2CXLA 2XQYA 4BJMA 4OFZA 1MZ9A 5APYA 2HLOA 3NTNA 1FIOA 1WLXA 2V1DB 3LG7A 1GL2C 4ZS3A 3ZCJA 1G2CB 1JMMA 5KJ7D 2KWIB 3HRNA 1IJDB 1IFIA 5LA6E 2KB7P 3C51A 5LBMA 5LOVE 4DVDA 4HH2A 4GOUA 4IHJE 1YTZT 4XE5B 2N1GA 3RK3C 4UXNB 3ZMVB 4X1YE 4EYYR 3Q5XA 5BU5A 4UVCB 3RC3A 2Q3IA 2LHRA 3OJAA 3TNUA 4I43B 1WYCA 3P8MC 1GL2D 1IFJA 3EDUA 1IFMA 1FMVA 1G8XA 1J2JB 3RYHE 5JDNA 4DMVA 4PFPA 5HXRA 3UULA 1PFIA 4WY4B 1LT9C 2E9XA 2KZ7B 2PP6A 3AAAB 1LTSC 5CJ4A 5AW5B 1FJPA 3N7NA 3FBLA 1N73B 3I9WA 3K8PC 4AKIA 3C98B 4O9BA 3H3AA 4IE0A 5AW9B 1RF1A 5CMZA 2EHOB 2LE8A 4X1IE 3IR9A 1RF1B 1RF0A 2N2NA 3B5NC 4ZI7E 4UIGA 5FY7A 3NFQA 2V7LA 2KLQA 3GWHA 4JYBA 1E5WA 1FZGA 3N9MA 1URQC 2E9XD 3CPZA 4IE6A 3KV5A 4H9OC 1D0ZA 4JYCA 5CA1E 5FXVA 1RY3A 3V4QA 2R3CA 4C7NA 2ZM0A 1LTTC 5KLVK 5F3JA 3M0DA 1MFZA 3UUXB 4UELA 4HE8A 4KUMB 4O4HE 2W6BA 3CX6B 5JQGE 3OKQA 1LWUB 5AW6B 2D0TA 3IFMA 3PURA 4NUVA 4P0BA 3RX6A 3VP8A 2X68A 2LM9A 3TKLB 1SFCB 2W63A 3E0ZA 3KV4A 4DOJA 1N7SD 1YTZI 4LLHA 2UXXB 2KT9A 4FJOA 3BQLA 4UVBB 3OBVE 3WAKA 2XKMA 5JR9B 3I1AA 4H9QC 3V2NA 1IFNA 1LGHB 4L0RA 4L5GA 2WT7A 1HF8A 5FNVE 2E42A 3ZMSB 4EXTA 4I4TE 4J2CA 1BR0A 2OYHB 2BVMA 4QHOA 2WITA 5J1GA 4ZKUA 2OYIA 4C7RA 1LVFA 1SA0E 2CXFA 2WBLA 1FZEA 1FDMA 2MOZA 1LTJA 1T3UA 2BDEA 1ZEEA 3SRZA 1IJ6A 1OWAA 2ZM2A 4GIWA 3RL0D 1ZR2A 2CWYA 1ZV4X 1A02J 3KPEA 4XA4A 1FZBA 2KINB 4ILUA 1IK9A 3RKOA 1KILA 4CI3B 2K24A 4NUUA 1U4QA 2P9BA 1NHLA 4AQGA 5AVWB 2Y6XA 2LHNA 3AAEB 1B7TA 3P32A 1D1BA 4IE5A 4PJLA 4B6XA 4O2AE 5ADXL 5FXWA 3M0AA 3UFEA 3H32B 1T2KC 2XTLA 2A45G 1MMDA 3H32A 1MIYA 4CXXA 2XASB 4N78D 3KYQA 2OARA 3ZN0B 4WB4A 1JY3O 3SS1A 2M3BA 3RK2C 2XAFB 2JJLA 3MZKB 2ZMAA 4CXYA 5EK3A 5AVSB 5CCHA 2IC6A 4EIJA 2WAUA 3TSIA 4C46A 1T8ZA 4WBAA 3EQ2A 2A45H 3BRTB 3NXSA 4H9SE 3RYFE 1H7CA 3U1AA 4KBMB 1VRBA 3IBPA 3SOLA 2YKQA 1D0YA 2X9XA 3ZN1B 5KJ7A 5L3CB 1LTJC 3A7OA 1BR2A 3NRYA 3AB3B 1T3JA 2EHOD 2XV5A 3SWFA 4IFFA 2JEEA 4M3LA 5CCHD 2ODVA 2HODA 2A45I 2V7MA 3B57A 3N2OA 3L37A 1KFMA 1HH0A 4FI5A 5HWXA 3P7KA 2FFDA 1AJ3A 5APWA 4AYCA 1JTHA 3M06A 4H63V 2NW8A 3EFGA 1SVFA 1JTHB 3C9IA 4OH8B 5APTA 1Y64B 1CUNA 1FBMA 2BVLA 3C4ZA 3LBXA 4V1Av 5FY0A 3HR0A 3N5LA 3VMZA 1HTLC 1WRDA 1N73A 4GIFA 3C50A 2VKHA 1RE4A 3U1CA 1UCUA 2XAGB 2XHEB 1GU4A 1Z0PA 2ES0A 2N9DA 3II6A 3PU8A 4EAHA 1SLQA 5KJ7C 5LYJE 2H7VC 1L4AD 1GU5A 1MIWA 5JRCA 1L4AC 2HYNA 1SQXK 2CPBA 1NTKK 1IO4A 2BASA 2CLYB 4JLEA 3KINB 3LIEA 2IFNA 2WSCH 2KXPB 2FKWB 4O4IE 4E7SA 1IFDA 4C7NB 3AA1B 5L3GB 1U5PA 3UT5E 5CCGA 1T2KD 3KDPB 3HUSB 2DCFA 3FBZA 4UV8B 4RESB 3CKDA 4ZI3C 4DMWA 1H89A 4AQRD 1GDTA 2V7JA 5APXA 2XDJA 1LWUA 3LK3B 5LHIB 3C64A 3V2PA 2YINA 4I6MC 3OYXA 4PFOA 3N9NA 2IW5B 1L0LK 2C0WA 1JNMA 1YW0A 2N1TC 2EHOC 4MFRA 4PW8A 1MNDA 2R5DA 1S9KD 1NKNA 3B5NB 4GK5E 3ZMTB 2MJZA 1FZFA 4BJNA 1NKZB 2MTQA 5FP3A 1N7SC 4ANJA 3ZMZB 3R84B 3I0QA 3O4XE 2IX7C 1FOSE 4I50E 5EZYE 5L2LA 4K0UA 4GYRA 2J59M 2KOGA 2HPCA 4OK0A 3MK7C 3N9LA 4W7ZA 3PU3A 2XAQB 4G2AA 1FZCB 3M91A 4WBNE 3VKGA 1J1EC 5J2TE 3KDSE 1G1JA 2N1TB 1CI6B 2P2UA 2YKOA 3OJAB 2N1TA 5AVYB 2BZBA 3RRWA 4DO0A 3QK6A 3O1HA 1FZAA 1LKXA 5HXSA 2Q7CA 1KZUB 3VYIA 2C9NY 3CQXC 3BASA 2O1KA 3IEEA 2E9XB 4ISSA 5EK4A 5APUA 4G63A 4BAYB 3ZC0A 1LWUC 1VPCA 1N86A 5JDHA 3ONXA 1H88A 1LTBC 1NAFA 3HE4B 2N9BA 2Z4EA 2X9WA 5BVZA 5AVUB 2PAJA 2V7KA 1LTAC 3DP7A 3OAKA 1HGZA 2X66A 1D0XA 1ZN5A 3S4UA 3U78A 4EYUA 1FZCC 2WSSV 3M9QA 3DTOA 1FU1A 4PJJA 3KV9A 2QGSA 2K5BB 4C90A 1DEBA 3TYYA 1HTJF 1QUUA 1AQ5A 1LTIC 1HWTC 2LT3A 2WSFH 4I55E 1RE4C 1SQBK 5AW2B 5FXZA 1HG5A 5LJNA 1N7LA 2LJLA 2NW9A 1M1JB 5C8YE 1M7LA 2KP8A 3HD7B 4ZOLE 4YJ2E 3GN5B 1L4AB 4AUWA 4IGUA 2WM9A 4YJ3E 4JUYA 4ZI2C 5EK2A 1HUCA 3AVRA 2HODB 2RA1A 3UUMA 3RL0B 2NPSD 3V5BA 2IC9A 2PJQA 1RE3C 3C4WA 5GONE 3B5ND 3PE0A 2R32A 3BATA 2Q9QD 5KMGP 5JR9A 3RK2B 3LBXB 4GYSA 4YHJA 5FXXA 5J2UE 3CWZB 3RK3D 3A2AA 1G1IA 5AVZB 3GHGA 4LGDE 3AAIA 3ANWB 4OHFA 5AW4B 1M1JC 2NWBA 1DX7A 1URQD 1IJ5A 2ZLYA 2WTYA 4MLKA 3O9XA 3ETUA 3R2PA 2KLVA 4LC1A 2ZXEB 3HE5B 4DZOA 2LEHA 2H7HA 4CZZB 4TV8E 1LTJB 4X20E 1N7SB 2GUSA 3K3QC 1NU1K 5BU8B 3FXDB 3NZPA 2C5KT 3B8EB 1RE3A 2J58A 1EZ3A 2OYHC 3I0OA 5HWYA 5AVRB 5HAXA 3RPUA 2KNDA 4PJNA 5AFUL 5LGUB 5CB4E 1J1DB 1O3XA 2Q9QC 1HCIA 3CQGB 4O4LE 4EB6E 2OA5A 2A72A 2PBIA 2WPRA 2M8RA 1HG2A 5CCGD 2IFMA 1QL1A 2MYSA 3KV6A 4A56A 3CX8B 4UVAB 2L3LA 5CA0E 1JY3P 2OYIC 5LGTB 3CX7B 3ZLIA 4DBQA 2GK9A 2LSGA 2H3RA 2P67A 2HFED 2C9LY 1A02F 1CW5A 2I59A 2VKJA 5HYAA 2YO2A 3PUGA 4ZKPA 5LP6E 3H6PA 4AKHA 2H8PD 5AVXB 3HI2A 3PUSA 2KMFA 3GHGC 1E1HB 3Q2MA 4KMCA 4WBOA 3UTKA 4C91A 1GD2E 2P7JA 1KQLA 4Y99C 3VKHA 1CZQA 2LOSA 3ESLA 2MBGA 1RF0C 4IDZA 3AVSA 4AQFC 1ZR4A 1FZCA 2O1JA 4WY4D 2Y8DA 5LG4A 4CXWA 3WMM0 2HG5D 3T97A 2M67A 3LK42 1GL2B 3HTKB 3M9BA 2C5JA 4P0AA 4DBRA 3RC8A 2I1JA 3MTUE 2DHRA 5KDMC 4U74A 2L9QA 4HYTB 1GW3A 1XTGB 1JOCA 5AVTB 2FFDB 1VOMA 2YEVC 2IPPA 4N78E 4XBFB 2VKOA 4EZ4A 3LJCA 1NOHA 3V2RA 4WY4A 4ERRA 4L9IA 3F31A 5DQWA 3ZYKA 1JY2O 3A5XA 4PK6A 3VHLA 5DQVA 3HE4A 1QSDA 2XZRA 3EVYA 2GM4A 1QL2A 2JPFA 3WI3A 4N3YB 3M0DC 5JRCB 4EZHA 5FY1A 1LRZA 2D0UA 2X51A 1LT9B 2CMRA 2L8KA 2X9HA 1LT9A 2VB6A 3HKBE 2K48A 3CVRA 3EDVA 4AQFA 2JMKA 3MKDA 3GA8A 2CM0A 4TUYE 2FFDC 2WPQA 3I5CA 3M9HA 1JCDA 2XNXA 1KILD 3O1IA 3UUNA 4HTEA 2O01H 2B1EA 4QXHB 1WT6A 1ZLLA 1WR6A 4O8SA 2NTYA 4IFMA 4ADZA 2CE7A 1M1JA 2DI4A 3DJBA 1NTZK 2CCQA 5H6RB 3HD7A 2W00A 1S94A 1UX4A 3FB2A 2NW7A 3HKEE 4AXPA 4JF7A 3MD0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BAS A;  3N4X A;  3C9I A;  3BAT A;  3P8C D;  4I1L A;  2FXM A;  3N7N A;  1NKN A;  4N78 D;  4O9B A;  3VP9 A;  5BVZ A;  4GIF A;  3U1C A;  4ZKP A;  4N3Y B;  4ZKU A;  3HRN A;  3U1A A;  5BU8 B;  1WT6 A;  5KTB A;  2POH A;  3OJA B;  1X79 B;  5BU5 A;  2JEE A;  3U59 A;  3VP8 A;  1IC2 A; 
#chains in the Genus database with same CATH topology
 5JRE A;  3RYI E;  2UXN B;  4H9P C;  1BR1 A;  3MIW A;  3VMY A;  3AE6 A;  3O6Q A;  3HD7 D;  4Z90 A;  4UF0 A;  4M1P A;  2MAW A;  4H9R C;  3Q5R A;  5DJU B;  3JSV C;  2QJP B;  5CCH C;  3WAJ A;  1L0N K;  1LTG C;  1FJK A;  1URQ A;  1N32 T;  3G6E P;  2LSI A;  4O4J E;  1CI6 A;  4ZNC A;  4KX6 A;  2A06 E;  1YQ4 C;  5GTI H;  1KB9 I;  3ZKR A;  1JO5 A;  1G73 A;  2HPL A;  1NWQ A;  1KYO E;  2L91 A;  3AEE A;  2W8Z A;  1VQL P;  3JC2 2;  1JMB A;  1MV8 A;  2LSY A;  4HWI B;  3B13 A;  3D71 A;  3NRX A;  1IZN B;  3V2Q A;  2E5V A;  4ZS2 A;  1SQX D;  4WYV A;  2KSE A;  5AVQ B;  3D70 A;  2CEA A;  5L4H A;  1I6Z A;  2IBZ E;  4QKN A;  3VR9 A;  2V6Y A;  2JWA A;  3NWI A;  3H1H J;  4MAL A;  3LFM A;  3TNU B;  5JVD E;  1SHZ C;  1V9D A;  2V5C A;  4LFB T;  4KP3 C;  2K37 A;  3HL6 A;  1NTK E;  2ZT9 C;  1W2E A;  3ZST A;  3IN6 A;  2HPJ A;  3VR8 A;  1JY2 P;  1D1C A;  2LOP A;  1U7M A;  3L74 G;  1LNQ A;  5AW3 B;  4Y99 B;  5AW1 B;  2RP4 A;  1QEX A;  1NJI Q;  2W0G A;  5IYZ E;  2KWH A;  3HE5 A;  3UU6 A;  4JYA T;  2IBZ G;  2NPS A;  2WMN A;  4BRY A;  1L0L E;  1PL5 A;  4OVN F;  4IFD K;  4LML A;  3SFE C;  4BRY B;  5HEH A;  5H6Q B;  2DLR A;  5AQV B;  4A97 A;  1R8E A;  1KNP A;  3VN0 A;  3V5U A;  1GK4 A;  4YSZ A;  4DV2 T;  2J1D G;  1SQV G;  1SQQ J;  3KBT A;  1KTM A;  1N73 C;  2ACX A;  2CBJ A;  3CWB D;  4UR9 A;  3CPW O;  1BR4 A;  4IE4 A;  2E8I A;  2B87 A;  2HPC B;  1HFA A;  2XSA A;  1BGY J;  1SFC D;  2FYZ A;  2LLY A;  3IF8 B;  1QLE D;  5JDF A;  3FHN A;  1IBM T;  3CQC B;  2W27 A;  1BSH A;  1Z56 A;  2WY2 A;  3AEC A;  4MHC A;  2PFV A;  5IWA T;  4GK0 E;  4OGQ D;  2JR8 A;  5KKZ C;  3PJA J;  3JC6 C;  3R6N A;  5ABF B;  4DR5 T;  1YHQ P;  5HXE A;  4H9N C;  4LF6 T;  2VRS A;  1KOR A;  2EHO A;  2BG9 C;  3EI0 A;  2VAS A;  4KHX A;  4ZZC A;  4B3R T;  4GKG A;  2LRL A;  1SQV K;  3FWN A;  3CCJ P;  5APQ A;  3RK2 D;  1MMG A;  1NAY A;  1EZV G;  4BA9 A;  1M8O B;  3LW5 H;  1VDF A;  4AIU A;  4LFC T;  1PPJ D;  4H13 C;  2JMH A;  2BEZ F;  5DAB A;  5TJH A;  3P8C D;  3L70 E;  5M4Y A;  1IBL T;  3J7Y q;  1HNW T;  3CCM P;  3S9O A;  4TZ4 C;  3GW6 A;  1MUU A;  5CHX A;  2A2F X;  1BE3 E;  3BQI A;  2I1K A;  2HN2 A;  2LKG A;  3ZJ2 A;  5A1L A;  4EED A;  2UUA T;  2E74 D;  2WWV A;  3RQU A;  4I7Z C;  1SQQ D;  1R8I A;  3MGN A;  4IE7 A;  2XSB A;  1FAV A;  2JQQ A;  5JDL A;  3C8V A;  3O8Z A;  2Y0C A;  2ZT9 B;  2PFX A;  3A0H H;  3A3Y B;  3P4Q A;  3CLQ A;  3EUH A;  2V26 A;  2WB5 A;  3RH3 A;  4W80 A;  2Q9Q B;  3B5N A;  5AQI B;  3KZI H;  4BJM A;  3CCS P;  4IOI H;  2B87 B;  3EAB A;  1LT1 A;  4B3S T;  1G2C B;  5LA6 E;  1IJD B;  2XQ6 A;  5LBM A;  3PV0 F;  3VMA A;  4HH2 A;  4LFA T;  1YTZ T;  4XE5 B;  3B5M A;  3TNU A;  3OW2 O;  3P8M C;  3AE9 A;  1ZOY C;  3RYH E;  1Q86 Q;  5JDN A;  4DMV A;  3UUL A;  2E9X A;  4GKJ T;  3AAA B;  1FJP A;  5AW5 B;  2AE9 A;  3TGU G;  4AKI A;  3C98 B;  4IE0 A;  5AW9 B;  1RF1 A;  2EHO B;  2AEM A;  1VQ7 P;  1RF1 B;  3B5N C;  4K3A A;  3NFQ A;  3L75 J;  1E5W A;  1JNR A;  3AE4 A;  3AEB A;  4IE6 A;  1EXI A;  2R3C A;  3QB5 A;  5KLV K;  5F3J A;  3UUX B;  1T6A A;  2W6B A;  5DJT B;  3VP8 A;  2ACZ A;  2G3A A;  3ZDM A;  2W63 A;  3E0Z A;  4DOJ A;  1N7S D;  2UXX B;  2KT9 A;  4UVB B;  2IBZ I;  3V2N A;  4ILC A;  4L5G A;  2CBI A;  3ZMS B;  1HF8 A;  3ZT5 A;  2KS1 A;  4J2C A;  1BR0 A;  3H1J E;  1S5L X;  2OYI A;  4C7R A;  3LDQ B;  2VQF T;  1RQU A;  1FZE A;  2IML A;  2VVS A;  3SRZ A;  2BDE A;  4IL4 A;  1IJ6 A;  1OWA A;  1K73 Q;  1SQB E;  4HFI A;  3KPE A;  3L39 A;  4K0K T;  1NHL A;  5AVW B;  3M0A A;  3UFE A;  1MMD A;  3H32 A;  4CXX A;  3KYQ A;  1JY3 O;  2M3B A;  3RK2 C;  1LP1 A;  2XM1 A;  4CXY A;  1ZP0 C;  2BS4 A;  3CXH I;  2AXC A;  4CPG A;  4H9S E;  4LF4 T;  4KBM B;  3U1A A;  1N34 T;  1VRB A;  4JQ0 D;  5KLI B;  3SOL A;  1BE3 J;  3CX5 D;  3A7O A;  2R6G F;  3L71 D;  4PV1 D;  2V7M A;  3PRJ A;  2A45 I;  5HWX A;  1SQQ E;  3H1I G;  5J0Z A;  5APW A;  1JTH A;  3M06 A;  2WSC J;  5KAI E;  2NW8 A;  4KHZ F;  2BVL A;  4TNV A;  4PD4 E;  1Y64 B;  1XZY A;  3N5L A;  3AE5 C;  4GKK T;  4GIF A;  1WFD A;  1RE4 A;  2VKH A;  1Z0P A;  2N9D A;  3II6 A;  3PU8 A;  1L4A C;  1SQX K;  1NTK K;  2BAS A;  1OVU A;  4O4I E;  4E7S A;  1K9M Q;  2WVR A;  1OVR A;  4IDQ A;  3H1I E;  5K5G B;  4RES B;  3L70 D;  4HFE A;  4DMW A;  1GDT A;  1H89 A;  1E79 H;  2XDJ A;  1TU3 F;  3C64 A;  3V2P A;  3OYX A;  2WU5 A;  2IW5 B;  4JBZ A;  4PW8 A;  3V6I A;  1MND A;  3B5N B;  4GK5 E;  2IYO A;  2XPK A;  1W0A A;  2IX7 C;  4GYR A;  3TLT A;  1HNX T;  5HEG A;  2H89 C;  3MK7 C;  3N9L A;  5AQJ B;  2XAQ B;  1FZC B;  3M91 A;  5KKZ B;  3FZL B;  3OJA B;  2N1T A;  4DO0 A;  3QK6 A;  1NTM G;  1KZU B;  1K05 A;  3BAS A;  5EK4 A;  4G63 A;  4JI0 T;  1SQB G;  1U7J A;  2H88 C;  2RMZ A;  1VPC A;  2BKO A;  1H88 A;  1NAF A;  4DV4 T;  2MPK A;  2V8S V;  2PAJ A;  1LTA C;  3OAK A;  1HGZ A;  1AA0 A;  3S4U A;  1GMJ A;  1FZC C;  4HWC A;  3TYY A;  1AQ5 A;  2H89 A;  4UB6 E;  5FL1 A;  4YJ2 E;  3GN5 B;  5C39 A;  4AUW A;  4IGU A;  4YJ3 E;  3ZT7 A;  1W0B A;  1OMI A;  2RA1 A;  3UUM A;  3FX0 A;  4A7P A;  3C4W A;  1RE3 C;  5CGM A;  5KMG P;  1Q82 Q;  4U3F E;  4ILB A;  3BAT A;  1FS0 E;  5JR9 A;  3RK2 B;  4YHJ A;  3L72 G;  1NGM B;  2E75 D;  3AEB C;  3AAI A;  5AW4 B;  1M1J C;  3O9X A;  2XQ4 A;  3ETU A;  4LC1 A;  3USS A;  4COF A;  3AE3 A;  4CZZ B;  3K3Q C;  1NU1 K;  1EDJ A;  1KNR A;  3RPU A;  3H1H G;  2OYH C;  5AVR B;  3CXH H;  5CB4 E;  1J1D B;  1M1K Q;  2QIW A;  2Q9Q C;  4O4L E;  2OA5 A;  2WPR A;  2M8R A;  4YTP C;  4DCK A;  2H3R A;  1ZW0 A;  2HFE D;  2C9L Y;  1A02 F;  1SQP G;  4NPP A;  1PV3 A;  3PUG A;  3AE2 C;  2QJK B;  1E1H B;  3UTK A;  1GD2 E;  1KQL A;  1CZQ A;  3MZW B;  2LOS A;  2M3E A;  3ESL A;  3PJS K;  2KSR A;  4YXW H;  3AVS A;  2KI7 B;  5LG4 A;  3H1L J;  3WMM 0;  3T97 A;  2WZI A;  3HTK B;  2VQE T;  2C5J A;  2OTJ P;  4YXD C;  1UGO A;  3CXH E;  4U74 A;  1GW3 A;  2RKL A;  4JPZ B;  4DJG A;  1T8B A;  1XMQ T;  3AE8 C;  4TT3 H;  4EZ4 A;  2A06 D;  3V2R A;  3GMA A;  3H1J J;  1JY2 O;  4PK6 A;  3GG2 A;  2X0Y A;  4U31 A;  1CHU A;  1NU1 D;  3WI3 A;  1Y9B A;  3CMA P;  2L8K A;  5ABH A;  1LT9 A;  2NZ2 A;  2R44 A;  3EDV A;  2YXQ B;  1L0L J;  4AQF A;  3F89 A;  2FFD C;  3M9H A;  3AE9 C;  4TNW A;  2B1E A;  1WT6 A;  2NTY A;  4EEB A;  1Q81 Q;  3DJB A;  1NTZ K;  1S94 A;  1UX4 A;  2PRR A;  2WP9 A;  3PJA A;  4Z91 A;  3AE5 A;  5KXJ A;  4W7Y A;  3SWK A;  3RBZ A;  4B3T T;  4MBQ A;  1AQT A;  4X64 T;  1HVV A;  1FMW A;  2B89 A;  3AED C;  4YPC A;  2WZ7 A;  1UK5 A;  3ZEF B;  3AE3 C;  4YTN A;  4GOE A;  2ZFC A;  3EWK A;  4EI2 A;  2LSK A;  1D1A A;  4BWN A;  1SFC C;  3N9O A;  3AA6 B;  1VQM P;  2OYH A;  3BK9 A;  2FXP A;  4TWF A;  5GTI E;  1VF5 D;  5B66 H;  1VQ9 P;  4YY3 T;  4U33 A;  3L36 A;  2C5I T;  3CC7 P;  3KFW X;  2O01 N;  2YO3 A;  2FJB A;  3BCC J;  2C0S A;  4QX8 B;  3N4X A;  2K9A A;  1P84 E;  4PAG A;  3UU3 A;  3L3P A;  1S4X A;  3KZI E;  4UB8 E;  1MIV A;  4JI6 T;  2R5B A;  2YOE A;  4QWN B;  3ONJ A;  1NYH A;  4DV6 T;  2P58 A;  3F5H A;  5IHY A;  2I0M A;  4PNI A;  1PZQ A;  5AQF B;  3H37 A;  3L35 A;  4WW0 A;  4JI8 T;  3M65 A;  4QXC B;  1AVO A;  3AE8 A;  1PGQ A;  4CI1 B;  5KLV J;  4DR2 T;  4YLH A;  2X9Y A;  4ASK A;  2QA7 A;  3KVB A;  2AEF A;  1FOS F;  2JJ9 A;  3TF5 A;  4IDP A;  1NTK D;  3SSU A;  5LNK A;  3QB5 K;  3ETV A;  1NTM J;  2ZM6 T;  5KX5 E;  1NEK A;  3CCE P;  5B66 E;  2H7O A;  3AE1 A;  2UUB T;  5ETW A;  5KTB A;  3JAD A;  3Q9D A;  1X79 A;  2G0U A;  2CXD A;  3PTR B;  1SP4 A;  2E9X C;  4XZC A;  3HUS A;  1ZRT E;  2YDQ A;  2Y48 B;  3AEG A;  1DU2 A;  4DV1 T;  4NXN T;  4I1L A;  1SFC A;  1S9K E;  3TLU A;  3N2G E;  2KNC B;  3CML A;  2B88 A;  2QM8 A;  3ABV C;  1H8A A;  4ILA A;  3KXD A;  2HH7 A;  2Q5U A;  3P4R A;  1DD4 A;  3MP7 B;  5L3B B;  2E43 A;  1N36 T;  3HD7 C;  2CLY C;  3H1K E;  2FYN C;  1NWM X;  2VKD A;  5JDQ A;  1M7K A;  1IBK T;  4TN7 B;  2M5A B;  3HTK A;  5L3D B;  2M5A A;  5AQQ B;  3X1D A;  1XWM A;  2WMM A;  4KJM A;  5CFB A;  1BCC J;  2R3S A;  3HUS C;  5LHG B;  3K3N A;  3PDY A;  4X66 T;  1UX5 A;  2IIU A;  1GTW A;  3L75 E;  2PG8 A;  1Q7Y Q;  4TV9 E;  1IK7 A;  2CA5 A;  4AKG A;  2WPS A;  2WWW A;  2W66 A;  1T98 A;  3OA7 A;  2LXC B;  3RK3 B;  1N2D C;  3G4S P;  3RL0 C;  1FC2 C;  5C3J A;  3CCU P;  4HFV A;  1S35 A;  4KI0 F;  1X0T A;  3C1L A;  3H1H E;  2XAH B;  2FYU K;  3MXZ A;  4U2Y A;  2NPS C;  4DR7 T;  1QLB A;  3TGU J;  3N9Q A;  3CI9 A;  1MMN A;  1KYO D;  1KEY A;  1NTK J;  3UQ7 A;  4F6R C;  2Z6E A;  3GHG B;  3PTZ A;  2W61 A;  4JEH B;  3P4S A;  3H1I J;  4IL6 X;  2AEJ A;  3AE1 C;  1YJ9 P;  2YU2 A;  2WPV B;  1PP9 J;  3PUA A;  4H13 B;  1OXZ A;  3P7I A;  5E79 H;  5AW7 B;  3OVU A;  3AE6 C;  5LGN B;  5JR9 C;  2XQ8 A;  3IHR A;  1X9B A;  1EQ7 A;  1S3J A;  2QEX P;  2YMY A;  1JM0 A;  2D5U A;  2V7I A;  5CA1 E;  1HJB A;  2FUP A;  2N1T D;  3NZQ A;  1GK6 A;  2IDO B;  2XQY A;  4OFZ A;  1MZ9 A;  3NTN A;  1FIO A;  5F5W A;  4DVD A;  1SQQ G;  2KB7 P;  1VQ5 P;  3CCL P;  1R5S A;  3RK3 E;  4IHJ E;  2N1G A;  4IDN A;  4DV3 T;  3CX5 H;  3Q5X A;  4UVC B;  2WSE J;  2LHR A;  1P84 D;  1GL2 D;  1IFJ A;  1FMV A;  1G8X A;  2Y0E A;  2E75 C;  3CCV P;  1XDP A;  5CJ4 A;  3I9W A;  1QVG O;  1OFC X;  4O9B A;  3H3A A;  5HCM A;  4X1I E;  3IR9 A;  3A7M A;  5TIS H;  3N9M A;  2E9X D;  2UU9 T;  5FKY A;  1N33 T;  4DR6 T;  4H9O C;  4JYC A;  1RY3 A;  4C7N A;  1LTT C;  2JQK A;  4X65 T;  1MFZ A;  2YDS A;  4O4H E;  3CX6 B;  2BS3 A;  4NUV A;  2D0T A;  5CJ5 A;  4H0L C;  3SFE A;  3H1L E;  1J5E T;  5B5E H;  2LM9 A;  3TKL B;  1SFC B;  4F8H A;  3KV4 A;  2KNC A;  3WAK A;  3UQ4 A;  2XKM A;  3I1A A;  2VL0 A;  1KFY A;  4I4T E;  2OYH B;  2BVM A;  2HHH T;  4ZKU A;  2FYU E;  1SQX G;  2WBL A;  2MOZ A;  1FDM A;  1T3U A;  4NXM T;  1YJN P;  2ZM2 A;  4L75 A;  1ZR2 A;  2CWY A;  1IFP A;  4CI3 B;  2KIN B;  2V5D A;  2K24 A;  4WWI A;  3JAF A;  4AQG A;  2Y6X A;  4IE5 A;  1D1B A;  3P32 A;  4H44 D;  1SQV J;  3Q5P A;  2XTL A;  4YSX A;  2A45 G;  4IDO A;  4LF8 T;  2AXT H;  2XAS B;  3H1K G;  3SS1 A;  1ZXG A;  2JJL A;  2ZMA A;  4JI2 T;  4EIJ A;  4C46 A;  3BRT B;  1BCC E;  2X9X A;  2DL1 A;  3JCU E;  4YTP A;  1KIL E;  2XV5 A;  2J47 A;  4OGQ C;  3L37 A;  1KFM A;  2KIK A;  4H63 V;  3EFG A;  3C9I A;  5APT A;  4H0L B;  1S5L H;  2HN1 A;  3LBX A;  5FY0 A;  1FBM A;  1YQ4 A;  2MKV A;  1KYO I;  3U1C A;  1EDK A;  3WUU A;  4EAH A;  5KJ7 C;  2H7V C;  1MIW A;  4HFD A;  4EGW A;  2WSS H;  2Q3E A;  2CPB A;  1IO4 A;  2CLY B;  5L47 A;  2K9J A;  4ASV A;  4IL9 A;  3KIN B;  2DW3 A;  2IFN A;  2KXP B;  3JCU H;  4ZEY A;  3KDP B;  3HUS B;  2E75 B;  4GOD A;  4ZI3 C;  3UUB A;  4AQR D;  3AXJ B;  4PFO A;  3N9N A;  1JNM A;  2N1T C;  4MFR A;  2R5D A;  1S9K D;  1NKN A;  3ZMT B;  1FZF A;  3L74 E;  3ZMZ B;  3I0Q A;  3O4X E;  1FOS E;  5L2L A;  3H3M A;  2J59 M;  2KOG A;  2XM2 A;  4OK0 A;  1VQ6 P;  1BCC D;  3PU3 A;  1K04 A;  1J1E C;  2Q6Q A;  1WR0 A;  3KDS E;  1CI6 B;  1BE3 G;  1FDI A;  3JCF A;  1FZA A;  2G8Y A;  4U7J A;  5HXS A;  3VYI A;  3IEE A;  2O1K A;  4BAY B;  1SQV E;  3ZC0 A;  3H25 A;  1LTB C;  2N9B A;  4HWF A;  1LJ2 A;  1PP9 E;  5AVU B;  5AQG B;  1DEE G;  3PUY F;  3BCC G;  1ZN5 A;  4ZMD A;  1WCR A;  1QGK B;  2M6I A;  2JQ9 A;  2K5B B;  2WSF H;  4I55 E;  1RE4 C;  3ONL C;  3VRA A;  4ZI2 C;  1L4A B;  5EK2 A;  1HUC A;  2HOD B;  3AEC C;  2PJQ A;  2IUB A;  5GON E;  1Z8U A;  3B5N D;  3PE0 A;  2R32 A;  1N8R Q;  1H0T A;  2Q9Q D;  3Q3D A;  5J2U E;  3D6Z A;  3CWZ B;  2AXD S;  4HFH A;  5AVZ B;  1OED C;  4LGD E;  2LXB A;  2WS3 A;  2D2C C;  4HB1 A;  2ZXE B;  1RQV A;  2WQY C;  3AEA C;  1LTJ B;  4X20 E;  1J5W A;  5BU8 B;  2Y9Y A;  2J62 A;  3NZP A;  2C5K T;  3L73 G;  4OGQ B;  5AFU L;  2KND A;  4PJN A;  4R4M A;  4EB6 E;  4E7Z A;  5LHH B;  2E76 C;  4UVA B;  3GF7 A;  2L3L A;  2OYI C;  1UUR A;  3NKZ A;  5JTG A;  2P67 A;  3RIU A;  1L0L D;  2I59 A;  2FYN B;  4ZKP A;  4AKH A;  3L75 D;  5AVX B;  4PV1 B;  4H44 C;  4WBO A;  4C91 A;  1NU1 J;  2JDI H;  3CC2 P;  4Y99 C;  2UXD T;  2MBG A;  5KLV G;  2V6Y B;  2I6H A;  3QOF A;  3LK4 2;  2M67 A;  3CWB G;  1T72 A;  4U7I A;  1VQ4 P;  5AVT B;  1VOM A;  2YEV C;  2KZJ A;  1R5L A;  2IPP A;  4N78 E;  4XBF B;  1NOH A;  4ERR A;  5L3G B;  3A5X A;  3VHL A;  5DQV A;  1QL2 A;  5AQL B;  2JPF A;  1X22 A;  3RIU C;  3M0D C;  1VL2 A;  3CWB E;  1WMK A;  1LRZ A;  2D0U A;  2YDR A;  1XMO T;  2VB6 A;  3ZSS A;  2CM0 A;  5HEO A;  2RN0 A;  4BXL A;  1KIL D;  4HTE A;  4QXH B;  2BCC J;  4ADZ A;  1M1J A;  1VF5 C;  2CCQ A;  4EYY Q;  3FB2 A;  2BBH A;  5AQR B;  4P1N A;  1RHZ B;  1KV4 A;  2ZAE B;  3PUV F;  3AEF C;  2O3J A;  2LSJ A;  3RL0 g;  4QX7 B;  5LJM A;  3O6Q B;  2W6A A;  2WQY A;  4MN4 C;  3GMI A;  4YSY A;  3QH9 A;  2XUE A;  3H1J D;  4UF0 B;  1SQP J;  2NTX A;  4N6J A;  2X0L B;  2BEQ D;  4PV1 C;  3P4P A;  3GF3 A;  2SPC A;  1NTZ G;  3Q2Y A;  4LF7 T;  4PJ0 H;  1PGP A;  4JBW F;  3CC4 P;  1HGV A;  3RQW A;  1OW8 A;  1OW6 A;  5LBQ B;  1LVK A;  1YXR A;  2YNY A;  4OYJ A;  4TWH A;  3L73 D;  3CL3 D;  5AQS B;  1YKE B;  3UU8 A;  4IIJ E;  4A5X A;  4U2Z A;  2V7Q J;  1K8A Q;  4XAX B;  2Z5H A;  3O1J A;  2KYV A;  1ZKE A;  1NO4 A;  1JY3 N;  5ABG A;  2H88 A;  1KIL C;  2CK3 H;  5APV A;  2IAK A;  3L4F A;  2VVN A;  3MA9 A;  2XU6 A;  3E08 A;  3AA7 B;  4U7Y A;  1H0T B;  3G9R A;  1JCC A;  3MJX A;  1HX8 A;  4IL6 H;  3VP9 A;  2VK9 A;  3FZF B;  1SQP K;  4P09 A;  1VCS A;  2JO1 A;  4AI6 A;  3VTP C;  2Q9I A;  5CCG C;  2LRK A;  4JI1 T;  1FEW A;  4CQI A;  2NPS B;  3BQK A;  3HKD E;  4GOF A;  2FYU J;  3ZCI A;  5KLI C;  3E1I A;  3RYC E;  3UIA A;  2Q1K A;  3AXJ A;  1IC2 A;  3BVH A;  2P1J A;  3KQG A;  3TLV A;  5L4E A;  1NTM K;  1PPJ E;  4H63 H;  4PK4 A;  2H43 A;  5TIS E;  3NMD A;  1NH4 A;  1GW4 A;  2YU1 A;  2BG9 B;  1G2C A;  3MHV A;  1RF1 C;  3KBU A;  3KVA A;  2L5G B;  5LXT E;  3OYZ A;  1BGY G;  1Q90 D;  1URQ B;  5JDM A;  2VWA A;  4OYK A;  3TGU D;  2QJY B;  3A0B E;  2CPS A;  1KIL B;  1WYB A;  2YIU B;  1KK7 A;  1DIP A;  2D2S A;  1XDO A;  3NVO A;  1OVV A;  4DR1 T;  1ZHC A;  2J5U A;  1NTZ D;  4EOZ B;  3N9P A;  1VCT A;  3F57 A;  5AW0 B;  3RBX A;  2E2A A;  3I9Y A;  4ZI2 D;  4KHP T;  4AIS A;  1RH5 B;  1E2A A;  1KQG B;  4NIQ A;  2DNX A;  3Q5E A;  4PJM A;  4QXB B;  1ZOY A;  2CPT A;  1KMI Z;  1AFO A;  3K5B A;  4HEA A;  5FVL A;  1MNE A;  2C0X A;  3WUT A;  3CME P;  3CCR P;  3VOP A;  4HFB A;  4UV9 B;  1PGJ A;  2WMO A;  4UB6 H;  2ZM8 A;  5HXH A;  1HS7 A;  5CJ0 A;  3M3Z B;  2FY8 A;  2W67 A;  1SQP D;  1VQO P;  1HBW A;  3H1I D;  4WNK A;  4AKR B;  2OYO A;  1JY2 N;  3NBX X;  3F2E A;  1KQF B;  3K3O A;  3PP5 A;  3C4X A;  2QE7 H;  1SQQ K;  5BMV E;  3ZC1 A;  1QX8 A;  1YYC A;  5AQU B;  2BBJ A;  4ZHQ E;  5LCY A;  3VRB A;  3VMX A;  4HWD A;  2VL8 A;  4JEU B;  3RRC A;  2V4H A;  2Q9Q A;  2CXL A;  4ZS3 A;  2HLO A;  3L71 G;  3LG7 A;  3ZCJ A;  2J4G A;  2BG9 A;  5KJ7 D;  2KWI B;  3HRN A;  1IFI A;  3C51 A;  3H1K J;  5B5E E;  4B3M T;  5FVK A;  4R4L A;  4GOU A;  3D6Y A;  3ZMV B;  4UXN B;  5AQP B;  4EYY R;  4DV5 T;  2F4V T;  5BU5 A;  3RF1 A;  3RC3 A;  3OJA A;  2KK7 A;  3L74 D;  1WYC A;  1IFM A;  1J2J B;  1USD A;  4PFP A;  4XFJ A;  2A9U A;  1DD3 A;  2IBZ D;  2PP6 A;  3K8P C;  1LTS C;  1SE7 A;  3N7N A;  1N73 B;  1Y01 A;  2LE8 A;  5CMZ A;  3H1L G;  4UIG A;  2KLQ A;  4JYB A;  1FZG A;  2BKN A;  1URQ C;  3CPZ A;  3KV5 A;  1MFT A;  3QWO C;  5FXV A;  2WDV A;  1SQV D;  4HE8 A;  4KUM B;  5H2F H;  3OKQ A;  1LWU B;  5AW6 B;  3IFM A;  2K1A A;  2X68 A;  3P4W A;  5HEU A;  1YTZ I;  2D2C B;  4FJO A;  5JR9 B;  1VQK P;  1EZV D;  4LF9 T;  2BKP A;  4H9Q C;  1LGH B;  1FDO A;  4L0R A;  2WT7 A;  2LM2 A;  5J1G A;  4JI5 T;  2V7Q H;  1L0N J;  1PGO A;  3A0H E;  4AQY T;  3FZH B;  3FXD A;  4GIW A;  3RL0 D;  3RKO A;  4ILU A;  3E1R A;  1FZB A;  1IK9 A;  1KIL A;  3I55 P;  5H2F E;  2P9B A;  4HKZ H;  1B7T A;  5ADX L;  4O2A E;  2V6X A;  3H32 B;  1OX3 A;  3TLW A;  1MIY A;  2ITA A;  1BGY E;  2XAF B;  2UUC T;  1LP1 B;  3AEA A;  5EK3 A;  5AVS B;  2YMK A;  5HEJ A;  4H0L D;  3L71 E;  3TSI A;  1P84 H;  2XY8 B;  3WUV A;  2A45 H;  3NXS A;  3RYF E;  3IBP A;  1UIX A;  1OZH A;  2YKQ A;  1D0Y A;  3AE4 C;  5KJ7 A;  1JEK A;  2JWD A;  4NPF X;  5M1B A;  3SWF A;  2YKS A;  5CCH D;  1KC8 Q;  2JEE A;  4M3L A;  1UII A;  2ODV A;  2D2C D;  4FI5 A;  3B57 A;  4LMK A;  1HH0 A;  1AJ3 A;  4U3F J;  1L2P A;  1Y47 A;  5AQT B;  1JTH B;  4OH8 B;  3C4Z A;  3JAE A;  3HR0 A;  3H1K D;  3VMZ A;  1HTL C;  1WRD A;  1N73 A;  2OGU A;  1SLQ A;  3B4S A;  1L4A D;  1GU5 A;  2WSF J;  2A06 G;  2HYN A;  1S5L E;  4OX9 T;  2BS2 A;  3CIR A;  3LIE A;  2WSC H;  2FKW B;  3PHL A;  1VQN P;  1IFD A;  1T7S A;  2FBW C;  1U57 A;  2GA1 A;  3UT5 E;  1VQP P;  1BE3 D;  1T2K D;  2FXO A;  2DCF A;  4UV8 B;  1ZRT D;  3S4R A;  1EDI A;  5LHI B;  2V7J A;  5APX A;  5LP6 E;  2YIN A;  4I6M C;  2QG4 A;  1L0L K;  2C0W A;  2QA4 P;  3B71 A;  5EFW B;  2EHO C;  2OTL P;  2MJZ A;  1NKZ B;  2MTQ A;  2XQ9 A;  5FP3 A;  3R84 B;  3PLN A;  2ZYD A;  4W7Z A;  4WBN E;  2XZE A;  3VKG A;  1YIT P;  5J2T E;  2IDB A;  4QH5 A;  4HWH A;  1EZV I;  2N1T B;  2P2U A;  5AVY B;  1W9R A;  3O1H A;  2BCC G;  3H1L D;  2CHN A;  3AEE C;  2WDQ A;  2Q7C A;  2C9N Y;  5FY7 A;  4ISS A;  3CQX C;  5JDG A;  2E9X B;  5APU A;  4TLF A;  4QH1 A;  1L0V A;  1OW7 A;  3CWB J;  1AVY A;  2X9W A;  2V7K A;  3DP7 A;  2CHO A;  2X66 A;  5LB7 B;  3U78 A;  4H13 D;  4EYU A;  1EDL A;  3KV9 A;  2QGS A;  1DEB A;  4U3C A;  1QUU A;  2LT3 A;  1HWT C;  1SQB K;  5AW2 B;  5FXZ A;  2RH0 A;  1HG5 A;  2NW9 A;  5C8Y E;  1M7L A;  3HD7 B;  2XND H;  2XJ7 A;  2FYU D;  4JUY A;  5KAI H;  4JI7 T;  3RL0 B;  1KB9 H;  2NPS D;  3V5B A;  4YTM A;  3EHZ A;  3MUD C;  4DV7 T;  1FJG T;  2UXB T;  1ZP0 A;  3RK3 D;  1GQE A;  4YHH T;  3CX5 I;  3GHG A;  4OHF A;  2NWB A;  2FBW A;  1HNZ T;  1IJ5 A;  1VF5 B;  2WTY A;  2LEH A;  4TV8 E;  4DR3 T;  1N7S B;  2GUS A;  3FXD B;  1M57 D;  5HWY A;  2J58 A;  1EZ3 A;  5LGU B;  5HAX A;  3L71 J;  3GLM A;  1ZME C;  3FZK B;  1HCI A;  2W83 C;  2PBI A;  2MYS A;  4EZH A;  2IFM A;  1QL1 A;  3CX8 B;  4EV6 A;  1HJ0 A;  1JY3 P;  3ZLI A;  4DBQ A;  1CW5 A;  2VKJ A;  5HYA A;  5AQO B;  3H6P A;  5FL0 A;  2H8P D;  4CN4 A;  5C2T A;  2KMF A;  3GHG C;  4RO0 A;  4KMC A;  4DUZ T;  3VKH A;  2YIU C;  1RF0 C;  4AQF C;  1ZR4 A;  1JB0 J;  1FZC A;  2Y8D A;  4P0A A;  3RC8 A;  1GL2 B;  3KHU A;  3QNU A;  4DBR A;  3AE7 A;  2I1J A;  2DHR A;  4HYT B;  1JOC A;  1W09 A;  4NPD A;  1NTK G;  4WY4 A;  5DQW A;  3ZYK A;  3Q5S A;  3EVY A;  2BCC E;  2ZYG A;  3RGU A;  3L75 G;  3AEF A;  4N3Y B;  4Y28 J;  1LT9 B;  2IHR 1;  2X9H A;  3HKB E;  4ASW A;  2K48 A;  3CVR A;  3GA8 A;  1JCD A;  2O01 H;  1XNR T;  4HJG H;  4O8S A;  3WU2 H;  2DI4 A;  1BDC A;  1YIJ P;  3HD7 A;  2W00 A;  2NW7 A;  3HKE E;  4AXP A;  4JF7 A;  2JRK A;  1XTC C;  2XAJ B;  5HXC A;  4EOT A;  2FXM A;  1L0N D;  2E74 B;  2A3D A;  4WY4 C;  2PTF A;  2Y0D A;  2WSE H;  2WT7 B;  3CCQ P;  2W62 A;  3SWH A;  2KS1 B;  1IAP A;  2P10 A;  2LKM A;  4DND A;  2OYI B;  3LK2 B;  1EC5 A;  4U72 A;  3W67 A;  2O01 J;  3A8Y C;  4PK5 A;  3ZPO A;  5JH7 E;  4UEM A;  3HA4 A;  3J9X 1;  3IA3 A;  5DJQ C;  3H1H D;  3JC6 D;  2ZJS E;  3D0T A;  2YXR B;  4PD4 I;  2NRG A;  1DH3 A;  1SQX J;  2YN6 A;  2W90 A;  4CN1 A;  4WZX A;  3PUX F;  2W2U A;  3L72 J;  2Y9Z A;  2FYU G;  2OV9 A;  3MAC A;  3RHW A;  2QJY C;  1NEN A;  5AVV B;  2AXT E;  2NOX A;  1KQS O;  3V4W A;  2POH A;  3WU2 E;  2X67 A;  1YKH B;  1US7 B;  4TX5 A;  1J1J A;  3LID A;  3N2K E;  4HFC A;  2WU2 A;  4IT4 A;  4Z8X A;  3V5S A;  1M90 Q;  2QRX A;  3QC9 A;  3RIF A;  4B86 A;  3E22 E;  1EZV E;  1USE A;  4JV5 T;  5TAO A;  3UFG A;  1SS1 A;  5APS A;  3ZYL A;  5F8P A;  2GUV A;  3VU7 H;  1KYO H;  1N7S A;  4DID B;  5L3F B;  2NP9 A;  1MKM A;  1SUM B;  1I94 T;  3BRV B;  1KNZ A;  3W15 B;  3T8O A;  5AW8 B;  3FZM B;  1HR0 T;  4JI4 T;  1ZV8 A;  4ZI3 D;  4GT1 A;  1CSB A;  4LMJ A;  1NTM E;  3CD6 P;  1GZL A;  5E0O A;  2FJA A;  5KAF H;  4UB8 H;  2QVA A;  3PUQ A;  1JUN A;  3SWY A;  4X1K E;  4YFS A;  2I8D A;  1WRG A;  2YKP A;  2CWO A;  2DWK A;  2YK0 A;  3TLS A;  4CI2 B;  3ZYM A;  3T97 B;  2NR4 A;  1GL2 A;  5FMN A;  4NPE A;  3CX5 E;  1YD8 G;  3T1H T;  2E76 D;  3AED A;  2E5T A;  5AQN B;  1W5C E;  4DR4 T;  1AJY A;  3Q5W A;  2QM7 A;  2UXC T;  3ZJ1 A;  4U3F G;  3MUD A;  2BG9 E;  3ABV A;  3U3I A;  3AA0 B;  3A5T A;  3L09 A;  5FYM A;  5KAF E;  1S2E A;  5LG3 A;  4O2B E;  1KN7 A;  1OED E;  4EIW A;  4HGA A;  4DV0 T;  3L70 J;  1X8Y A;  2RPA A;  2N9Y B;  3AE7 C;  2DWG A;  3QUJ A;  1J1D C;  5L3E B;  1L0N G;  2PGD A;  3GN5 A;  4HN9 A;  1J1E B;  2KUB A;  3G06 A;  1FE6 A;  1L4A A;  1PP9 G;  4TWD A;  4AKL A;  1NTM D;  3U59 A;  2IZ1 A;  3RIA A;  4EDF A;  3G3Z A;  3LSV A;  1X9V A;  3HKC E;  3AEG C;  1KFN A;  2KSJ A;  2QJK C;  1YQ3 A;  4IST A;  3P8C E;  3ANW A;  3TK1 A;  2Z5I A;  3UU4 A;  4HKA A;  1OED B;  5KLV D;  1OED A;  1E7P A;  2ODU A;  1X79 B;  2WCA A;  1MMA A;  2WDR A;  2WWU A;  1EXJ A;  4I2L C;  2K9Y A;  3FXE A;  1W2B O;  2CRB A;  3ZT6 A;  3FXE B;  5APY A;  2V1D B;  1WLX A;  3K1S A;  1GL2 C;  1JMM A;  3IAO A;  1YBK A;  5LOV E;  5LMU T;  3RK3 C;  5AQK B;  4X1Y E;  2XQ7 A;  2Q3I A;  3CXH D;  4I43 B;  3L74 J;  5LMN T;  3EDU A;  2W4X A;  5HXR A;  2XQA A;  3IF4 A;  4WY4 B;  1LT9 C;  2K3R A;  1PFI A;  2KZ7 B;  3S1K A;  3ZMU B;  1SQP E;  3FBL A;  3EFF K;  3T1Y T;  1RF0 A;  2N2N A;  4ZI7 E;  3RKG A;  2LKH A;  3RLF F;  2V7L A;  3GWH A;  2HR3 A;  5CBN A;  1QVF O;  1S72 P;  1D0Z A;  2KLU A;  3V4Q A;  2ZM0 A;  2IZ0 A;  3BCC E;  3M0D A;  4UEL A;  5JQG E;  4P0B A;  3PUR A;  1AV1 A;  3RX6 A;  1P84 I;  2SPZ A;  3TGU E;  1BCC G;  4X5T A;  1L0N E;  4LLH A;  2JIW A;  1XNQ T;  3BQL A;  3OBV E;  4DUY T;  1IFN A;  1PP9 D;  5FNV E;  4DT0 A;  3ITK A;  2E42 A;  4Z1M H;  4EXT A;  4I0U A;  4QHO A;  2WIT A;  1LVF A;  1SA0 E;  2CXF A;  1LTJ A;  3P50 A;  1ZEE A;  4U3F D;  3SFD C;  1ZV4 X;  1A02 J;  1NU1 E;  4XA4 A;  1Y8A A;  4NUU A;  2XQ3 A;  1U4Q A;  3PUZ F;  3CK6 A;  2LHN A;  3AAE B;  4PJL A;  5GTH E;  4B6X A;  5FXW A;  3RGL A;  1T2K C;  3AE2 A;  2W6J H;  2OTK E;  4N78 D;  4YT0 A;  2JKV A;  2OAR A;  4WB4 A;  1OIP A;  3ZN0 B;  2LR2 A;  3FGA D;  3MZK B;  3PUW F;  5CCH A;  2IC6 A;  2WAU A;  2JQH A;  4D6T G;  4GDO A;  1T8Z A;  4WBA A;  3EQ2 A;  1H7C A;  1L0L G;  3ZN1 B;  1JNZ A;  4LF5 T;  1LTJ C;  1BR2 A;  3NRY A;  2IYP A;  4RJT A;  1T3J A;  2EHO D;  3AB3 B;  3Q1M A;  3OPC A;  4IFF A;  2M0B A;  2HOD A;  3N2O A;  4ZXL A;  1S1C X;  3L70 G;  2FFD A;  3P7K A;  2E5L T;  4AYC A;  4Q25 A;  1SVF A;  4V1A v;  1KD1 Q;  1CUN A;  2JP3 A;  4PJ0 E;  3C50 A;  1UCU A;  2XHE B;  2XAG B;  2UWJ E;  2B9B A;  1GU4 A;  3E7K A;  2ES0 A;  5LYJ E;  5JRC A;  2OLT A;  4PD4 H;  4JLE A;  4IL6 E;  4QH4 A;  1D7M A;  3UU5 A;  3OTO T;  4C7N B;  3AA1 B;  1U5P A;  5CCG A;  3FBZ A;  1M62 A;  2E5Y A;  5CBO A;  3CKD A;  2BCC D;  3LK3 B;  5HCJ A;  1LWU A;  1YW0 A;  4QMA A;  2D9D A;  4BJN A;  1UUS A;  1N7S C;  4ANJ A;  3W68 A;  3L73 E;  5EZY E;  4I50 E;  1NTZ J;  2K88 A;  3Q5D A;  3SFD A;  3LW5 J;  2KZI A;  4K0U A;  2HPC A;  4ZZB A;  5L8R J;  5ABE A;  4G2A A;  1KB9 E;  1Q2N A;  1SQX E;  3PH0 A;  1KF6 A;  5E79 E;  2FJE A;  1G1J A;  3H1J G;  2YKO A;  2BZB A;  3RRW A;  1BSN A;  1LKX A;  1KB9 D;  1PPJ G;  5AQH B;  5AQM B;  1LWU C;  1N86 A;  5JDH A;  3ONX A;  5ABF A;  3HE4 B;  2Z4E A;  1NVO A;  5BVZ A;  3TDK A;  3L72 D;  2OQQ A;  4K35 A;  1D0X A;  1YQ3 C;  2WSS V;  3M9Q A;  2X0H A;  4YXD A;  1HF9 A;  4KT0 J;  1FU1 A;  2M6B A;  3DTO A;  4PJJ A;  4D6T E;  4C90 A;  1HTJ F;  4JI3 T;  1LTI C;  5LJN A;  1N7L A;  2LJL A;  1M1J B;  3I56 P;  2KP8 A;  4ZOL E;  4IRE A;  4CN6 A;  2WM9 A;  4D6T D;  3AVR A;  3RI5 A;  2IC9 A;  2B76 A;  1SQB D;  1VQ8 P;  2QYW A;  5FXX A;  3LBX B;  2ZYA A;  4GYS A;  2E76 B;  3A0B H;  3A2A A;  1G1I A;  4WVZ A;  3ANW B;  2XQ5 A;  4MLK A;  1DX7 A;  1URQ D;  2ZLY A;  3R2P A;  2KLV A;  4DZO A;  3HE5 B;  3FWL A;  2H7H A;  5KLV E;  2K3W A;  2ZXX A;  3B8E B;  1RE3 A;  3I0O A;  2E74 C;  1O3X A;  3CQG B;  4I7Z B;  2A72 A;  1HG2 A;  3KV6 A;  5L3C B;  5CCG D;  5CA0 E;  4A56 A;  5LGT B;  3CX7 B;  3L72 E;  2GK9 A;  2LSG A;  2FJD A;  2YO2 A;  1NTZ E;  1NU1 G;  3L73 J;  2QJP C;  4L76 A;  1BDD A;  3HI2 A;  3L8R A;  3PUS A;  3EAM A;  4X62 T;  3Q2M A;  1YI2 P;  2P7J A;  3R4Y A;  1PIX A;  3G71 P;  4L73 A;  4OWF A;  4IDZ A;  2O1J A;  4WY4 D;  4CXW A;  2HG5 D;  1YJW P;  3M9B A;  3MTU E;  5KDM C;  2L9Q A;  5IUX A;  2FFD B;  1XTG B;  2ZVO B;  5GTH H;  1M56 D;  2VKO A;  1BGY D;  3LJC A;  4L9I A;  3F31 A;  3HE4 A;  4H44 B;  2XZR A;  1QSD A;  2ZVN B;  2GM4 A;  4A98 A;  5BR8 T;  5JRC B;  5FY1 A;  2X51 A;  2CMR A;  1SQB J;  2K9J B;  2VUR A;  2JMK A;  3MKD A;  2WZH A;  4TUY E;  2WPQ A;  3I5C A;  4D6T J;  3UUN A;  2XNX A;  3O1I A;  4RKU J;  1ZLL A;  1WR6 A;  4IFM A;  2CE7 A;  3BCC D;  2ZT9 D;  5H6R B;  4L74 A;  4PD4 D;  2QSI A;  1HX1 B;  3MD0 A; 
#chains in the Genus database with same CATH homology
 4W7Y A;  2JRK A;  1XTC C;  2XAJ B;  5HXC A;  3RYI E;  2LSJ A;  2UXN B;  4H9P C;  4MBQ A;  1BR1 A;  4QX7 B;  1HVV A;  2FXM A;  4EOT A;  3MIW A;  3VMY A;  1FMW A;  2WZ7 A;  2A3D A;  5LJM A;  2W6A A;  3ZEF B;  4WY4 C;  2W62 A;  2WSE H;  2WT7 B;  2ZFC A;  3HD7 D;  4UF0 A;  3SWH A;  3GMI A;  4M1P A;  2LSK A;  1D1A A;  2XUE A;  1IAP A;  4UF0 B;  1SFC C;  2NTX A;  4N6J A;  2LKM A;  3AA6 B;  2OYI B;  3N9O A;  2OYH A;  2X0L B;  3BK9 A;  3LK2 B;  4H9R C;  4DND A;  5CCH C;  4U72 A;  3WAJ A;  1L0N K;  1LTG C;  1FJK A;  1URQ A;  4PK5 A;  4ZI3 D;  2LSI A;  4O4J E;  3ZPO A;  3L36 A;  5JH7 E;  2SPC A;  1CI6 A;  2C5I T;  4UEM A;  5LHH B;  3HA4 A;  3KFW X;  3J9X 1;  1HGV A;  5DJQ C;  3JC6 D;  2YO3 A;  5LBQ B;  3D0T A;  2C0S A;  4QX8 B;  3N4X A;  1JO5 A;  1G73 A;  1LVK A;  2HPL A;  2YNY A;  1NWQ A;  2K9A A;  4PAG A;  1DH3 A;  4OYJ A;  3L3P A;  3CL3 D;  1MV8 A;  1MIV A;  2LSY A;  3B13 A;  3NRX A;  2R5B A;  1IZN B;  3V2Q A;  4QWN B;  3MAC A;  1YKE B;  4ZS2 A;  4IIJ E;  5AVV B;  5IHY A;  4XAX B;  2Z5H A;  3O1J A;  5AVQ B;  4PNI A;  2KYV A;  2CEA A;  1ZKE A;  1NO4 A;  1JY3 N;  4QKN A;  3H37 A;  3L35 A;  4WW0 A;  2NOX A;  4CI2 B;  3M65 A;  4QXC B;  1KIL C;  5APV A;  2IAK A;  3L4F A;  3V4W A;  2POH A;  2X67 A;  4MAL A;  1YKH B;  3MA9 A;  2XU6 A;  3E08 A;  3TNU B;  1US7 B;  3AA7 B;  3LFM A;  4TX5 A;  5JVD E;  4CI1 B;  1SHZ C;  3LID A;  1V9D A;  3N2K E;  4KP3 C;  1JCC A;  3HL6 A;  3MJX A;  1HX8 A;  1W2E A;  4YLH A;  5JRE A;  2HPJ A;  1JY2 P;  1D1C A;  2LOP A;  2X9Y A;  4Z8X A;  3V5S A;  3VP9 A;  2QA7 A;  3KVB A;  4ASK A;  2VK9 A;  1SQP K;  3QC9 A;  4P09 A;  4B86 A;  5AW3 B;  3E22 E;  4Y99 B;  5AW1 B;  1FOS F;  3VTP C;  2JJ9 A;  2Q9I A;  5CCG C;  2RP4 A;  2W0G A;  5IYZ E;  5APS A;  1FEW A;  2KWH A;  5TAO A;  3HE5 A;  3ZYL A;  4CQI A;  5LNK A;  3ETV A;  5F8P A;  2GUV A;  3VU7 H;  2NPS A;  1N7S A;  2WMN A;  2NPS B;  4IFD K;  5L3F B;  5KX5 E;  2NP9 A;  5H6Q B;  2H7O A;  3BQK A;  5ETW A;  5KTB A;  3HKD E;  3Q9D A;  2DLR A;  1X79 A;  2G0U A;  3BRV B;  3ZCI A;  2CXD A;  3E1I A;  1KNZ A;  3RYC E;  3PTR B;  3W15 B;  3UIA A;  1SP4 A;  2E9X C;  4XZC A;  3T8O A;  4AI6 A;  3HUS A;  5AW8 B;  2Y48 B;  1IC2 A;  3VN0 A;  1ZV8 A;  2P1J A;  3KQG A;  3BVH A;  1GK4 A;  4GT1 A;  1CSB A;  1NTM K;  2J1D G;  3V5U A;  4I1L A;  1SFC A;  4H63 H;  4PK4 A;  1S9K E;  3N2G E;  1GZL A;  5E0O A;  2H43 A;  3KBT A;  3CML A;  5LXT E;  2QM8 A;  1H8A A;  3NMD A;  1N73 C;  2ACX A;  1NH4 A;  1JUN A;  3PUQ A;  1BR4 A;  1GW4 A;  2YU1 A;  2E8I A;  4IE4 A;  2HPC B;  3SWY A;  1HFA A;  2HH7 A;  1G2C A;  2Q5U A;  1RF1 C;  4X1K E;  4YFS A;  3KBU A;  1SFC D;  2FYZ A;  3KVA A;  5L3B B;  2E43 A;  3IF8 B;  1WRG A;  2L5G B;  2YKP A;  2CWO A;  2DWK A;  2YK0 A;  5JDF A;  3HD7 C;  2CLY C;  1URQ B;  1NWM X;  2VKD A;  3FHN A;  3OYZ A;  3CQC B;  3ZYM A;  2VWA A;  5JDM A;  4TN7 B;  5JDQ A;  1GL2 A;  3HTK A;  4OYK A;  2W27 A;  5L3D B;  1Z56 A;  5FMN A;  2CPS A;  1YD8 G;  1KIL B;  1WYB A;  4MHC A;  2PFV A;  1KK7 A;  4GK0 E;  3R6N A;  2D2S A;  3HUS C;  3JC6 C;  5LHG B;  1ZHC A;  2QM7 A;  3K3N A;  3Q5W A;  3ZJ1 A;  3MUD A;  3PDY A;  1UX5 A;  4H9N C;  3N9P A;  1GTW A;  4EOZ B;  5HXE A;  2VRS A;  2PG8 A;  4TV9 E;  2EHO A;  3AA0 B;  3A5T A;  3U3I A;  2CA5 A;  3L09 A;  5FYM A;  4AKG A;  3F57 A;  2WPS A;  5AW0 B;  2WWW A;  4KHX A;  2VAS A;  4O2B E;  4EIW A;  4GKG A;  4HGA A;  1T98 A;  3OA7 A;  3I9Y A;  4ZI2 D;  3RK3 B;  1N2D C;  1SQV K;  1X8Y A;  1MMG A;  5APQ A;  3RK2 D;  3RL0 C;  2DWG A;  3QUJ A;  1J1D C;  4PJM A;  2DNX A;  5L3E B;  4HFV A;  4QXB B;  4E7Z A;  3GN5 A;  4HN9 A;  1J1E B;  4BA9 A;  1S35 A;  3LW5 H;  1VDF A;  1AFO A;  1L4A A;  2XAH B;  2FYU K;  3MXZ A;  4HEA A;  4AKL A;  3U59 A;  2NPS C;  1MNE A;  2JMH A;  2C0X A;  5DAB A;  3P8C D;  3N9Q A;  3CI9 A;  3G3Z A;  3VOP A;  5M4Y A;  1MMN A;  1X9V A;  3HKC E;  3J7Y q;  4UV9 B;  1KFN A;  2WMO A;  4TZ4 C;  2ZM8 A;  4F6R C;  2Z6E A;  5HXH A;  5CJ0 A;  2KSJ A;  3GHG B;  5JDG A;  1HS7 A;  1MUU A;  5CHX A;  2W61 A;  4JEH B;  1HBW A;  2A2F X;  4IST A;  3P8C E;  2I1K A;  3TK1 A;  2YU2 A;  3ANW A;  3BQI A;  4WNK A;  3ZJ2 A;  3ZMU B;  2Z5I A;  4AKR B;  5A1L A;  1JY2 N;  3PUA A;  4HKA A;  3NBX X;  1OXZ A;  3P7I A;  3MGN A;  5AW7 B;  3F2E A;  3K3O A;  4IE7 A;  1FAV A;  2ODU A;  5LGN B;  1X79 B;  5JR9 C;  1MMA A;  2JQQ A;  5JDL A;  3PP5 A;  4ZHQ E;  3IHR A;  3O8Z A;  2WWU A;  3A3Y B;  3C4X A;  1EQ7 A;  1SQQ K;  5BMV E;  2YMY A;  3ZC1 A;  1YYC A;  2D5U A;  3CLQ A;  3EUH A;  4I2L C;  2V7I A;  2V26 A;  5LCY A;  3RH3 A;  4W80 A;  3VMX A;  1HJB A;  2Q9Q B;  2VL8 A;  4JEU B;  3B5N A;  3RRC A;  2Q9Q A;  2N1T D;  3FXE B;  3NZQ A;  1GK6 A;  2CXL A;  2XQY A;  4BJM A;  4OFZ A;  1MZ9 A;  5APY A;  2HLO A;  3NTN A;  1FIO A;  1WLX A;  2V1D B;  3LG7 A;  1GL2 C;  4ZS3 A;  3ZCJ A;  1G2C B;  1JMM A;  5KJ7 D;  2KWI B;  3HRN A;  1IJD B;  1IFI A;  5LA6 E;  2KB7 P;  3C51 A;  5LBM A;  5LOV E;  4DVD A;  4HH2 A;  4GOU A;  4IHJ E;  1YTZ T;  4XE5 B;  2N1G A;  3RK3 C;  4UXN B;  3ZMV B;  4X1Y E;  4EYY R;  3Q5X A;  5BU5 A;  4UVC B;  3RC3 A;  2Q3I A;  2LHR A;  3OJA A;  3TNU A;  4I43 B;  1WYC A;  3P8M C;  1GL2 D;  1IFJ A;  3EDU A;  1IFM A;  1FMV A;  1G8X A;  1J2J B;  3RYH E;  5JDN A;  4DMV A;  4PFP A;  5HXR A;  3UUL A;  1PFI A;  4WY4 B;  1LT9 C;  2E9X A;  2KZ7 B;  2PP6 A;  3AAA B;  1LTS C;  5CJ4 A;  5AW5 B;  1FJP A;  3N7N A;  3FBL A;  1N73 B;  3I9W A;  3K8P C;  4AKI A;  3C98 B;  4O9B A;  3H3A A;  4IE0 A;  5AW9 B;  1RF1 A;  5CMZ A;  2EHO B;  2LE8 A;  4X1I E;  3IR9 A;  1RF1 B;  1RF0 A;  2N2N A;  3B5N C;  4ZI7 E;  4UIG A;  5FY7 A;  3NFQ A;  2V7L A;  2KLQ A;  3GWH A;  4JYB A;  1E5W A;  1FZG A;  3N9M A;  1URQ C;  2E9X D;  3CPZ A;  4IE6 A;  3KV5 A;  4H9O C;  1D0Z A;  4JYC A;  5CA1 E;  5FXV A;  1RY3 A;  3V4Q A;  2R3C A;  4C7N A;  2ZM0 A;  1LTT C;  5KLV K;  5F3J A;  3M0D A;  1MFZ A;  3UUX B;  4UEL A;  4HE8 A;  4KUM B;  4O4H E;  2W6B A;  3CX6 B;  5JQG E;  3OKQ A;  1LWU B;  5AW6 B;  2D0T A;  3IFM A;  3PUR A;  4NUV A;  4P0B A;  3RX6 A;  3VP8 A;  2X68 A;  2LM9 A;  3TKL B;  1SFC B;  2W63 A;  3E0Z A;  3KV4 A;  4DOJ A;  1N7S D;  1YTZ I;  4LLH A;  2UXX B;  2KT9 A;  4FJO A;  3BQL A;  4UVB B;  3OBV E;  3WAK A;  2XKM A;  5JR9 B;  3I1A A;  4H9Q C;  3V2N A;  1IFN A;  1LGH B;  4L0R A;  4L5G A;  2WT7 A;  1HF8 A;  5FNV E;  2E42 A;  3ZMS B;  4EXT A;  4I4T E;  4J2C A;  1BR0 A;  2OYH B;  2BVM A;  4QHO A;  2WIT A;  5J1G A;  4ZKU A;  2OYI A;  4C7R A;  1LVF A;  1SA0 E;  2CXF A;  2WBL A;  1FZE A;  1FDM A;  2MOZ A;  1LTJ A;  1T3U A;  2BDE A;  1ZEE A;  3SRZ A;  1IJ6 A;  1OWA A;  2ZM2 A;  4GIW A;  3RL0 D;  1ZR2 A;  2CWY A;  1ZV4 X;  1A02 J;  3KPE A;  4XA4 A;  1FZB A;  2KIN B;  4ILU A;  1IK9 A;  3RKO A;  1KIL A;  4CI3 B;  2K24 A;  4NUU A;  1U4Q A;  2P9B A;  1NHL A;  4AQG A;  5AVW B;  2Y6X A;  2LHN A;  3AAE B;  1B7T A;  3P32 A;  1D1B A;  4IE5 A;  4PJL A;  4B6X A;  4O2A E;  5ADX L;  5FXW A;  3M0A A;  3UFE A;  3H32 B;  1T2K C;  2XTL A;  2A45 G;  1MMD A;  3H32 A;  1MIY A;  4CXX A;  2XAS B;  4N78 D;  3KYQ A;  2OAR A;  3ZN0 B;  4WB4 A;  1JY3 O;  3SS1 A;  2M3B A;  3RK2 C;  2XAF B;  2JJL A;  3MZK B;  2ZMA A;  4CXY A;  5EK3 A;  5AVS B;  5CCH A;  2IC6 A;  4EIJ A;  2WAU A;  3TSI A;  4C46 A;  1T8Z A;  4WBA A;  3EQ2 A;  2A45 H;  3BRT B;  3NXS A;  4H9S E;  3RYF E;  1H7C A;  3U1A A;  4KBM B;  1VRB A;  3IBP A;  3SOL A;  2YKQ A;  1D0Y A;  2X9X A;  3ZN1 B;  5KJ7 A;  5L3C B;  1LTJ C;  3A7O A;  1BR2 A;  3NRY A;  3AB3 B;  1T3J A;  2EHO D;  2XV5 A;  3SWF A;  4IFF A;  2JEE A;  4M3L A;  5CCH D;  2ODV A;  2HOD A;  2A45 I;  2V7M A;  3B57 A;  3N2O A;  3L37 A;  1KFM A;  1HH0 A;  4FI5 A;  5HWX A;  3P7K A;  2FFD A;  1AJ3 A;  5APW A;  4AYC A;  1JTH A;  3M06 A;  4H63 V;  2NW8 A;  3EFG A;  1SVF A;  1JTH B;  3C9I A;  4OH8 B;  5APT A;  1Y64 B;  1CUN A;  1FBM A;  2BVL A;  3C4Z A;  3LBX A;  4V1A v;  5FY0 A;  3HR0 A;  3N5L A;  3VMZ A;  1HTL C;  1WRD A;  1N73 A;  4GIF A;  3C50 A;  2VKH A;  1RE4 A;  3U1C A;  1UCU A;  2XAG B;  2XHE B;  1GU4 A;  1Z0P A;  2ES0 A;  2N9D A;  3II6 A;  3PU8 A;  4EAH A;  1SLQ A;  5KJ7 C;  5LYJ E;  2H7V C;  1L4A D;  1GU5 A;  1MIW A;  5JRC A;  1L4A C;  2HYN A;  1SQX K;  2CPB A;  1NTK K;  1IO4 A;  2BAS A;  2CLY B;  4JLE A;  3KIN B;  3LIE A;  2IFN A;  2WSC H;  2KXP B;  2FKW B;  4O4I E;  4E7S A;  1IFD A;  4C7N B;  3AA1 B;  5L3G B;  1U5P A;  3UT5 E;  5CCG A;  1T2K D;  3KDP B;  3HUS B;  2DCF A;  3FBZ A;  4UV8 B;  4RES B;  3CKD A;  4ZI3 C;  4DMW A;  1H89 A;  4AQR D;  1GDT A;  2V7J A;  5APX A;  2XDJ A;  1LWU A;  3LK3 B;  5LHI B;  3C64 A;  3V2P A;  2YIN A;  4I6M C;  3OYX A;  4PFO A;  3N9N A;  2IW5 B;  1L0L K;  2C0W A;  1JNM A;  1YW0 A;  2N1T C;  2EHO C;  4MFR A;  4PW8 A;  1MND A;  2R5D A;  1S9K D;  1NKN A;  3B5N B;  4GK5 E;  3ZMT B;  2MJZ A;  1FZF A;  4BJN A;  1NKZ B;  2MTQ A;  5FP3 A;  1N7S C;  4ANJ A;  3ZMZ B;  3R84 B;  3I0Q A;  3O4X E;  2IX7 C;  1FOS E;  4I50 E;  5EZY E;  5L2L A;  4K0U A;  4GYR A;  2J59 M;  2KOG A;  2HPC A;  4OK0 A;  3MK7 C;  3N9L A;  4W7Z A;  3PU3 A;  2XAQ B;  4G2A A;  1FZC B;  3M91 A;  4WBN E;  3VKG A;  1J1E C;  5J2T E;  3KDS E;  1G1J A;  2N1T B;  1CI6 B;  2P2U A;  2YKO A;  3OJA B;  2N1T A;  5AVY B;  2BZB A;  3RRW A;  4DO0 A;  3QK6 A;  3O1H A;  1FZA A;  1LKX A;  5HXS A;  2Q7C A;  1KZU B;  3VYI A;  2C9N Y;  3CQX C;  3BAS A;  2O1K A;  3IEE A;  2E9X B;  4ISS A;  5EK4 A;  5APU A;  4G63 A;  4BAY B;  3ZC0 A;  1LWU C;  1VPC A;  1N86 A;  5JDH A;  3ONX A;  1H88 A;  1LTB C;  1NAF A;  3HE4 B;  2N9B A;  2Z4E A;  2X9W A;  5BVZ A;  5AVU B;  2PAJ A;  2V7K A;  1LTA C;  3DP7 A;  3OAK A;  1HGZ A;  2X66 A;  1D0X A;  1ZN5 A;  3S4U A;  3U78 A;  4EYU A;  1FZC C;  2WSS V;  3M9Q A;  3DTO A;  1FU1 A;  4PJJ A;  3KV9 A;  2QGS A;  2K5B B;  4C90 A;  1DEB A;  3TYY A;  1HTJ F;  1QUU A;  1AQ5 A;  1LTI C;  1HWT C;  2LT3 A;  2WSF H;  4I55 E;  1RE4 C;  1SQB K;  5AW2 B;  5FXZ A;  1HG5 A;  5LJN A;  1N7L A;  2LJL A;  2NW9 A;  1M1J B;  5C8Y E;  1M7L A;  2KP8 A;  3HD7 B;  4ZOL E;  4YJ2 E;  3GN5 B;  1L4A B;  4AUW A;  4IGU A;  2WM9 A;  4YJ3 E;  4JUY A;  4ZI2 C;  5EK2 A;  1HUC A;  3AVR A;  2HOD B;  2RA1 A;  3UUM A;  3RL0 B;  2NPS D;  3V5B A;  2IC9 A;  2PJQ A;  1RE3 C;  3C4W A;  5GON E;  3B5N D;  3PE0 A;  2R32 A;  3BAT A;  2Q9Q D;  5KMG P;  5JR9 A;  3RK2 B;  3LBX B;  4GYS A;  4YHJ A;  5FXX A;  5J2U E;  3CWZ B;  3RK3 D;  3A2A A;  1G1I A;  5AVZ B;  3GHG A;  4LGD E;  3AAI A;  3ANW B;  4OHF A;  5AW4 B;  1M1J C;  2NWB A;  1DX7 A;  1URQ D;  1IJ5 A;  2ZLY A;  2WTY A;  4MLK A;  3O9X A;  3ETU A;  3R2P A;  2KLV A;  4LC1 A;  2ZXE B;  3HE5 B;  4DZO A;  2LEH A;  2H7H A;  4CZZ B;  4TV8 E;  1LTJ B;  4X20 E;  1N7S B;  2GUS A;  3K3Q C;  1NU1 K;  5BU8 B;  3FXD B;  3NZP A;  2C5K T;  3B8E B;  1RE3 A;  2J58 A;  1EZ3 A;  2OYH C;  3I0O A;  5HWY A;  5AVR B;  5HAX A;  3RPU A;  2KND A;  4PJN A;  5AFU L;  5LGU B;  5CB4 E;  1J1D B;  1O3X A;  2Q9Q C;  1HCI A;  3CQG B;  4O4L E;  4EB6 E;  2OA5 A;  2A72 A;  2PBI A;  2WPR A;  2M8R A;  1HG2 A;  5CCG D;  2IFM A;  1QL1 A;  2MYS A;  3KV6 A;  4A56 A;  3CX8 B;  4UVA B;  2L3L A;  5CA0 E;  1JY3 P;  2OYI C;  5LGT B;  3CX7 B;  3ZLI A;  4DBQ A;  2GK9 A;  2LSG A;  2H3R A;  2P67 A;  2HFE D;  2C9L Y;  1A02 F;  1CW5 A;  2I59 A;  2VKJ A;  5HYA A;  2YO2 A;  3PUG A;  4ZKP A;  5LP6 E;  3H6P A;  4AKH A;  2H8P D;  5AVX B;  3HI2 A;  3PUS A;  2KMF A;  3GHG C;  1E1H B;  3Q2M A;  4KMC A;  4WBO A;  3UTK A;  4C91 A;  1GD2 E;  2P7J A;  1KQL A;  4Y99 C;  3VKH A;  1CZQ A;  2LOS A;  3ESL A;  2MBG A;  1RF0 C;  4IDZ A;  3AVS A;  4AQF C;  1ZR4 A;  1FZC A;  2O1J A;  4WY4 D;  2Y8D A;  5LG4 A;  4CXW A;  3WMM 0;  2HG5 D;  3T97 A;  2M67 A;  3LK4 2;  1GL2 B;  3HTK B;  3M9B A;  2C5J A;  4P0A A;  4DBR A;  3RC8 A;  2I1J A;  3MTU E;  2DHR A;  5KDM C;  4U74 A;  2L9Q A;  4HYT B;  1GW3 A;  1XTG B;  1JOC A;  5AVT B;  2FFD B;  1VOM A;  2YEV C;  2IPP A;  4N78 E;  4XBF B;  2VKO A;  4EZ4 A;  3LJC A;  1NOH A;  3V2R A;  4WY4 A;  4ERR A;  4L9I A;  3F31 A;  5DQW A;  3ZYK A;  1JY2 O;  3A5X A;  4PK6 A;  3VHL A;  5DQV A;  3HE4 A;  1QSD A;  2XZR A;  3EVY A;  2GM4 A;  1QL2 A;  2JPF A;  3WI3 A;  4N3Y B;  3M0D C;  5JRC B;  4EZH A;  5FY1 A;  1LRZ A;  2D0U A;  2X51 A;  1LT9 B;  2CMR A;  2L8K A;  2X9H A;  1LT9 A;  2VB6 A;  3HKB E;  2K48 A;  3CVR A;  3EDV A;  4AQF A;  2JMK A;  3MKD A;  3GA8 A;  2CM0 A;  4TUY E;  2FFD C;  2WPQ A;  3I5C A;  3M9H A;  1JCD A;  2XNX A;  1KIL D;  3O1I A;  3UUN A;  4HTE A;  2O01 H;  2B1E A;  4QXH B;  1WT6 A;  1ZLL A;  1WR6 A;  4O8S A;  2NTY A;  4IFM A;  4ADZ A;  2CE7 A;  1M1J A;  2DI4 A;  3DJB A;  1NTZ K;  2CCQ A;  5H6R B;  3HD7 A;  2W00 A;  1S94 A;  1UX4 A;  3FB2 A;  2NW7 A;  3HKE E;  4AXP A;  4JF7 A;  3MD0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...