3ZCJA

Crystal structure of helicobacter pylori t4ss protein cagl in a tetragonal crystal form with a helical rgd-motif (6 mol per asu)
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
211
structure length
187
Chain Sequence
EDITSGLQLDSTYQETNQQVLNLDEIFSTNEMGEEDALNIAAIALRGDLALLANFEANELFFISEDVIFTYMSSPELLLTYMINPLDQNTAEQQCGISDVLVLYCEGLIEQEQNIRERLETSLAYQSNIGGTASLITASQTLVESLNNFIGIRLMLAHNVFLNYLEELDALERSLEQSRQYLQERQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords CAGL
publication title A Helical Rgd Motif Promoting Cell Adhesion: Crystal Structures of the Helicobacter Pylori Type Iv Secretion System Pilus Protein Cagl
pubmed doi rcsb
source organism Helicobacter pylori
total genus 71
structure length 187
sequence length 211
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-11-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1660 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3zcjA00
3ZCIA 3ZCJA
chains in the Genus database with same CATH superfamily
4Q25A 3AE9A 3CQGB 3CX7B 4X65T 3D0TA 4FI5A 2P9BA 5L4HA 3I0QA 3JAFA 4LFCT 2AE9A 3PUXF 4G63A 1XNRT 1IBKT 1QSDA 4L9IA 3SOLA 3T1HT 5FP3A 2IDOB 4DR1T 2E9XB 2XQ4A 3FBLA 4GKJT 3R6NA 3O1IA 2IUBA 3L09A 2VL8A 3EHZA 4B3RT 5L3CB 3CK6A 2M6IA 5HYAA 3UU4A 2BS4A 4DV1T 2VURA 4JI2T 2C5KT 1I6ZA 1FIOA 3CQCB 5LBMA 2H88A 5FXWA 1M7KA 1XNQT 3PUQA 3EAMA 2X66A 3E22E 4TUYE 4LF5T 1HCIA 3K3NA 4HE8A 4H9SE 1MNEA 2ZM2A 4HFVA 3S4UA 2QRXA 3FZKB 5C3JA 2BBJA 3LK3B 5LJMA 2LSIA 5LG4A 5JR9B 4PK6A 2E5LT 3UT5E 2GK9A 3AXJB 3A7MA 2B1EA 2V26A 5LJNA 4AKIA 3PV0F 5AQKB 1ZOYA 4JI1T 2X9HA 4UELA 4DV0T 2IAKA 2LKHA 4AKHA 2BKOA 1DU2A 2I6HA 3ZLIA 5LP6E 1J5WA 1OEDE 2NW7A 1IAPA 2W61A 3LG7A 4IE5A 3PTRB 2LT3A 4QXBB 2YOEA 4U72A 4O8SA 2A2FX 4JI0T 2KWIB 3ZMUB 1WRDA 3FZFB 2XM1A 5HWYA 2FJDA 3N9NA 3KV9A 4LMLA 2D0UA 1E2AA 2WCAA 4X1IE 1HTJF 1OWAA 4WBOA 4CN6A 3HKEE 5HCMA 4YHHT 2UUAT 5J1GA 3DTOA 2W4XA 5HXCA 4JI5T 2E9XC 2XUEA 5JDFA 3C4WA 2YDQA 3RGLA 2A9UA 2WWUA 5LYJE 2QVAA 3VKGA 4HEAA 1HX1B 2WQYA 2I59A 1UURA 4DMVA 3JC6D 4OHFA 1HNWT 2MTQA 1Y64B 4ILBA 2E2AA 2IW5B 2UU9T 3TKLB 3GMIA 4DIDB 2UXBT 4GOUA 2J1DG 3PU8A 3N5LA 3U3IA 1JNRA 2B76A 3KV6A 2EHOB 2WAUA 3FZHB 5DQVA 2KMFA 5FY1A 4CN1A 1E7PA 3LDQB 4KX6A 1D0YA 5LG3A 5FXXA 4QHOA 3N9QA 3UULA 4Z8XA 2X0HA 4HWHA 2XPKA 4JV5T 1H7CA 2K3WA 3DJBA 3ZC0A 2KZ7B 2LHNA 1SUMB 2K5BB 4DVDA 4IHJE 3L8RA 2Q9QB 5H6QB 2CA5A 3R84B 3F31A 1IBLT 4TWHA 4ZZBA 5FY7A 3C64A 3VKHA 3FZMB 4IE7A 1MMNA 3AE8A 3B57A 2ODUA 2XY8B 2W63A 3ZN0B 5FNVE 2BVMA 4LF7T 4V1Av 2XM2A 4DBQA 3BQIA 2QYWA 4DO0A 2BS3A 3PURA 5FXVA 4H9RC 5AQQB 2NW9A 2ZM8A 2I0MA 3JAEA 3P4PA 3ONLC 2MYSA 2BKNA 3Q9DA 4JUYA 4PJLA 4LF8T 2X67A 1I94T 2UUBT 4YJ2E 3HI2A 5FVKA 2VKJA 3LSVA 4AKLA 1R8IA 4ANJA 3AA6B 5LHHB 2WMNA 1SE7A 4MHCA 2CCQA 2XZEA 3OKQA 5FKYA 4CN4A 2LEHA 4QXHB 4O2BE 3UFGA 3MJXA 4BA9A 4K0KT 3ZPOA 3N9LA 3CVRA 4E7SA 4IL4A 4B3ST 2HH7A 3CKDA 5LCYA 3SWHA 2XSAA 3P8CD 1JNZA 2V6YB 5A1LA 2NWBA 2SPCA 4C91A 1XMOT 4DUYT 1W0AA 2X51A 4YTMA 4TV8E 2K48A 2IMLA 4LMKA 3RIUA 4IL9A 4JEHB 1W0BA 4WYVA 4ZEYA 3UUBA 1T8BA 3U78A 3NRYA 2VL0A 2KINB 4IE0A 2Q9QC 5DJQC 2L3LA 3LK42 1E1HB 3L3PA 1FMVA 4AQFC 2VK9A 4LFBT 4DR7T 5JDLA 2CPTA 3AECA 4X5TA 4IE6A 3T8OA 5HEGA 3ANWA 2XAHB 1KNRA 4PFOA 1G8XA 3WI3A 1OEDB 1MIWA 2LHRA 4O4JE 4X1KE 2KT9A 3C4ZA 2LSYA 5FL1A 2DI4A 5AQUB 2RPAA 2BS2A 4A56A 4YSZA 1UUSA 3UUNA 4HKAA 4ISTA 2LSJA 1NWMX 2DL1A 2V1DB 2CEAA 2H7VC 2YINA 4NIQA 2JQQA 1BR0A 1WLXA 4U31A 3ONJA 2JPFA 5FMNA 4AI6A 2NP9A 3RIAA 1IJ6A 5AFUL 2ZLYA 3QNUA 5CA0E 4YT0A 1BR4A 5LNKA 2VVNA 4F6RC 2J47A 3JC6C 4BJMA 3OVUA 4UR9A 3ZYKA 1S35A 4AIUA 4XBFB 3FBZA 4L5GA 2XQ8A 5FVLA 4KBMB 1ZHCA 1S94A 3VHLA 3RQUA 3T1YT 1LRZA 2E8IA 4DV3T 2CXLA 5KDMC 4CI2B 2C5IT 4HFEA 4EYUA 4X1YE 2UXXB 4P09A 4DV7T 4U7YA 4MBQA 3UU8A 2WY2A 3LFMA 5EK2A 1OEDC 3Q5XA 2BDEA 3AA7B 2OV9A 2X9XA 4JI8T 4ZZCA 4QWNB 4LFAT 3O1JA 4IIJE 2CWOA 5JVDE 3MZKB 4H63H 4QX8B 3I1AA 5H6RB 5L47A 2F4VT 2CRBA 2Y48B 4QXCB 4NXNT 2W67A 1HG5A 3LBXB 5CGMA 1MIVA 4JI6T 3WAJA 2D0TA 5LGTB 3FXEB 3AE2A 4NUUA 2W2UA 3RQWA 3ETVA 3TLSA 2WS3A 4HWDA 2CBJA 2CHNA 3AEEA 2BG9A 2XQ6A 2VKHA 2UXCT 4H9PC 4HGAA 4F8HA 1SA0E 1WFDA 4GYSA 4HN9A 4DR5T 3KBTA 2LSKA 2H89A 2LOPA 2HPJA 2N2NA 3PE0A 5HEUA 3PUYF 5IWAT 5LGNB 5FXZA 3RLFF 5LHGB 4HWIB 1WYCA 5JRCA 2CE7A 1MMDA 5L4EA 2IIUA 2V7KA 4HTEA 5C8YE 1N32T 4U3CA 3B5MA 3AA1B 2FJEA 4YFSA 2ES0A 2BKPA 2ZM0A 3RC3A 1WYBA 3PU3A 1YKHB 3AEAA 4I43B 5JDGA 1YKEB 5AQMB 2LE8A 4YSYA 5CFBA 4EV6A 1KNPA 2YDSA 5AQTB 1W09A 4WZXA 1LKXA 1US7B 2V7MA 3P4RA 4CI1B 5KMGP 2G0UA 4HWFA 1VOMA 1D1CA 4OK0A 2JMKA 2VWAA 2Y8DA 4ILCA 2J62A 2CXFA 2WMOA 1AJ3A 1NEKA 4UV9B 4P1NA 5EZYE 3EVYA 3B13A 2V7LA 4C90A 2VQET 2CHOA 2EHOA 1ZKEA 5EK3A 5HCJA 5IHYA 4LF4T 3ZT6A 4QKNA 3OTOT 1KK7A 4J2CA 4ZXLA 2A72A 2MOZA 3IA3A 3K3QC 3AE7A 3V5UA 3Q2MA 1D1AA 4GK5E 2V8SV 3I9YA 1VRBA 4WBNE 2VB6A 3PUVF 2WU2A 3RRCA 3P50A 4NUVA 3HA4A 4DV2T 3ZMTB 1MIYA 3NWIA 2C0SA 3IBPA 3BQLA 1VCTA 3ZMZB 3RYCE 1QUUA 3MACA 1KFYA 5ABFA 2KWHA 4YTPA 3EI0A 4ASKA 5E0OA 4L0RA 4CZZB 5F5WA 3UU3A 2X0LB 4XAXB 2ODVA 3KVAA 4KMCA 4U74A 2CLYC 5JTGA 1HF8A 2HN1A 4U2YA 4LF6T 3KINB 4DBRA 3M65A 2J4GA 4CXXA 4EOZB 2YK0A 2XAQB 3GN5A 1BR2A 5F3JA 2WDQA 1LVFA 3I9WA 2DNXA 1U5PA 4PFPA 3CIRA 1J5ET 2XAFB 3PUGA 3G06A 3MKDA 4CXWA 4UF0A 1O3XA 2XQAA 2BBHA 1SHZC 3V5SA 4UXNB 4H9NC 1HS7A 2KLQA 4Z91A 4IGUA 4PJNA 2UUCT 3QB5A 2LLYA 1YW0A 1HX8A 1UX4A 3C50A 5LBQB 4HFHA 2KSRA 3WAKA 4NXMT 3QOFA 3KVBA 2CXDA 4GYRA 3P4SA 4PJMA 3X1DA 3ZKRA 4TNVA 3CX6B 1M62A 2VASA 3O1HA 4JEUB 1T7SA 2X0YA 1Y01A 3SS1A 2N1GA 3ZT5A 1GQEA 1XMQT 2LJLA 1KNZA 3PJAA 1W9RA 2IHR1 3TLUA 4HWCA 4OFZA 3UQ7A 4AKRB 4IREA 4ZI2D 4OYKA 2WZHA 5L3DB 4CQIA 1MMAA 2CBIA 3RYHE 4JYAT 2WDRA 2XQ3A 4PK5A 1EZ3A 2YKSA 3DP7A 1UK5A 3UU5A 2D9DA 2UXNB 5EK4A 3ZT7A 4ZHQE 4GKKT 1IZNB 4O2AE 1WCRA 4X64T 3MA9A 2YN6A 3ONXA 1FMWA 3GA8A 5AQRB 2XHEB 2CMRA 4O4HE 3OJAA 3O9XA 2JMHA 3UUMA 3ANWB 5L3BB 2X9YA 2NOXA 3ZYLA 2ZM6T 3PUZF 1D0XA 2WWVA 3OYZA 4ZS3A 4B3MT 2X68A 1T72A 4HFBA 3F2EA 4P0AA 3C51A 3RF1A 1J1JA 2OA5A 4MFRA 5JDQA 4IE4A 4TV9E 3K3OA 1T98A 3UFEA 4ILAA 2DLRA 1FEWA 3AA0B 3NBXX 3FB2A 3P7IA 2WZIA 1NAFA 4ILUA 1LVKA 2FJBA 3N2KE 3AE5A 3N9OA 3ZJ1A 1OXZA 2KXPB 2Y6XA 1QLBA 3W15B 4CI3B 3RRWA 3EDVA 3ZMSB 1VCSA 2WB5A 2DHRA 2NTYA 3LJCA 5L2LA 3RIUC 2L9QA 4QH5A 4U2ZA 5JQGE 4I50E 3Q5WA 5ABHA 1BR1A 1G73A 2CWYA 3NRXA 1HNZT 5J0ZA 2ACXA 2V5DA 3CQXC 4HFIA 4PW8A 3KFWX 2FUPA 3HL6A 1N34T 3RKGA 3AEGA 5CA1E 2E9XA 4TZ4C 5F8PA 4IT4A 4TWFA 3ZEFB 4PJJA 2FBWA 1UCUA 3AE6A 5KXJA 1ZP0A 4EAHA 5TAOA 4DR3T 3ETUA 3P4QA 5AQVB 1L0VA 2RP4A 4YSXA 4UEMA 3VR8A 4I55E 3ZMVB 4COFA 3EDUA 2EHOD 3KV5A 2NR4A 1YD8G 4DNDA 2XAGB 4A97A 2XTLA 1HR0T 2XQ9A 3OBVE 5AQGB 2QGSA 4AKGA 1X79A 5JR9A 1U4QA 1V9DA 3HKCE 2VQFT 3CX8B 4B6XA 3UQ4A 3KDSE 2PG8A 1IJ5A 3RIFA 3AXJA 3JCFA 4XZCA 4O4LE 3AEFA 3H3AA 5ETWA 2BZBA 2UXDT 4JI3T 3PUAA 4I0UA 3OYXA 4YTNA 2LM9A 2Q9QD 2BG9B 3K8PC 3FXDB 2YU1A 2LRKA 4A5XA 3JADA 5HAXA 4AXPA 1ZEEA 5JDNA 3KBUA 3MXZA 4BAYB 2KNDA 3ZN1B 3RYFE 1D1BA 5HXSA 4DMWA 2AXDS 4G2AA 4IDPA 4KP3C 3AVRA 2H7OA 2MPKA 1CHUA 1X9BA 4P0BA 4EB6E 3OPCA 3RYIE 2M6BA 5GONE 4QH4A 5AQJB 3IEEA 4ZI3D 2JQHA 2XSBA 2H3RA 3I0OA 4U33A 2BVLA 3N9MA 3QB5K 3VRBA 5DABA 2CLYB 4ZI2C 1HFAA 2FJAA 1NENA 3UUXB 4ZOLE 5JRCB 3N2OA 5LXTE 4EEDA 1Z0PA 1N33T 4QH1A 5BR8T 4U7IA 3FHNA 1N36T 3SRZA 2V7JA 2LSGA 2YEVC 4N78D 4LMJA 3N9PA 4JLEA 2V5CA 4NPPA 2CM0A 3RX6A 4GIWA 2C5JA 5CB4E 2X9WA 4ADZA 1D0ZA 2RA1A 4KI0F 5JDHA 3PDYA 4ERRA 3SFEA 2DWGA 4A98A 2MBGA 1IBMT 4I4TE 1YQ4A 3GWHA 4X62T 5JREA 5L3FB 5JH7E 2PBIA 4OYJA 2IC9A 3HKBE 3AE1A 3RH3A 4DR6T 2R6GF 2WBLA 2BG9C 2HN2A 3HR0A 2Q9QA 1HG2A 4M1PA 1B7TA 4X20E 4AQFA 3BK9A 2JIWA 5JDMA 4DV6T 2W66A 4DUZT 4IDZA 4UVBB 5JR9C 2YU2A 4DR2T 2WU5A 3TLVA 3CPZA 4PAGA 3VU7H 3CWZB 3PJAJ 5ABEA 1XWMA 4H63V 1MMGA 4YJ3E 5HXHA 5L3GB 3ZYMA 3TLTA 3AAEB 4TX5A 5AQIB 5ABFB 3VR9A 5FYMA 4OX9T 5LOVE 3KV4A 3H3MA 3AE4A 3ZSTA 5J2TE 5LGUB 1Z8UA 4AQYT 2OLTA 5M4YA 4QX7B 5LA6E 2PFVA 3HKDE 2E5VA 2XQ7A 2JJ9A 4YHJA 2WSSV 3AAAB 3C4XA 4GK0E 3A8YC 4TNWA 4AQGA 1YQ3A 4ZS2A 4EZ4A 4TN7B 3ZCJA 4WW0A 3GN5B 4UV8B 3TLWA 3EABA 2V6YA 4FJOA 3Q5EA 5HEHA 4YY3T 2NTXA 5CJ5A 1XZYA 4DV5T 2LRLA 4UVCB 2VKOA 2V6XA 5AQFB 5HEJA 4EXTA 5LB7B 3RI5A 4KHZF 4UF0B 2WM9A 3PUSA 2W00A 3J7Yq 1MNDA 4JI7T 3UU6A 2HHHT 2L8KA 4Z90A 2XQYA 3AB3B 2MAWA 2BG9E 3J9X1 3AEBA 3ABVA 3F57A 3ZC1A 2EHOC 1YXRA 2V7IA 5LMUT 2NW8A 2VKDA 2IC6A 3FZLB 3AE3A 3IF8B 3K1SA 3UTKA 2XJ7A 5AQSB 3C98B 5FY0A 3VRAA 5AQHB 3E0ZA 5FL0A 2PJQA 4DV4T 3E08A 4UIGA 5HEOA 5ABGA 3CMLA 4EEBA 3RHWA 2ACZA 4HFCA 2K24A 1OEDA 5L3EB 5AQLB 1WR0A 4PNIA 3PUWF 3ZCIA 3ZSSA 2W0GA 4MALA 1KEYA 3BQKA 3H37A 4UVAB 1CUNA 2D5UA 5BMVE 2JRKA 4EIWA 3NVOA 2JQKA 5DQWA 2E9XD 4X66T 2DWKA 2ZMAA 2XASB 5HXRA 4CXYA 4LF9T 3RC8A 1XDOA 4WNKA 2LOSA 5LHIB 4ZI3C 1FJGT 4JBWF 2D2SA 5HXEA 3QC9A 4ZI7E 3P4WA 4DR4T 1WR6A 2M67A 2A3DA 2N9DA 3QUJA 4KHPT 3IHRA 1KF6A 4E7ZA 5IUXA 4KUMB 5LMNT 2LKGA 5ADXL 3L39A 4MLKA 4O4IE 2Z6EA 1UGOA 3AEDA 5IYZE 2W62A 5C2TA 3Q5DA 4IDOA 4H9OC 2HPLA 2VVSA 2K9AA 3O4XE 4AISA 3LK2B 2YDRA 3AVSA 4H9QC 3M3ZB 4EGWA 2WP9A 3QK6A 4JI4T 1XDPA 2WDVA 4PK4A 3ZJ2A 4BJNA 2QA7A 4EZHA 3SFDA 4IDQA 1HNXT 5AQOB 5KX5E 2XAJB 4HFDA 5AQNB 3NZQA 3RPUA 5HWXA 2PTFA 3NKZA 3NZPA 4IDNA 4K0UA 2DCFA 3A5XA 4YLHA 1ZV4X 5AQPB 2JQ9A 3ESLA 4YXDA 3EUHA 3AAIA 4B3TT 1UX5A 2LM2A 3N2GE 4ISSA 3MK7C 3RKOA 5J2UE 2XQ5A 4TWDA 3LBXA 4EYYR
chains in the Genus database with same CATH topology
3KINB 4DBRA 3M65A 3CQGB 2LHRA 3CX7B 3D0TA 4CXXA 4EOZB 5LXTE 2YK0A 1Z0PA 2XAQB 4O4JE 3GN5A 4FI5A 1BR2A 4X1KE 5F3JA 1LVFA 2P9BA 3FHNA 3I9WA 3SRZA 2KT9A 3I0QA 3C4ZA 2DNXA 2V7JA 2LSGA 1U5PA 2LSYA 2YEVC 4PFPA 4N78D 2DI4A 4G63A 4A56A 3N9PA 2XAFB 3PUGA 4CXWA 3MKDA 4UF0A 3UUNA 1QSDA 4L9IA 3SOLA 5FP3A 1O3XA 4JLEA 1SHZC 3V5SA 2CM0A 4HKAA 3RX6A 4GIWA 4ISTA 2LSJA 1NWMX 4UXNB 2E9XB 4H9NC 1HS7A 2KLQA 3FBLA 4IGUA 3R6NA 2V1DB 2C5JA 2CEAA 3O1IA 4PJNA 2H7VC 2YINA 2JQQA 1BR0A 3L09A 1WLXA 5CB4E 2VL8A 2X9WA 4ADZA 1D0ZA 2JPFA 2RA1A 5L3CB 5FMNA 5JDHA 5HYAA 3PDYA 4AI6A 4ERRA 2NP9A 1YW0A 1HX8A 2DWGA 2C5KT 1IJ6A 2MBGA 1UX4A 5AFUL 1FIOA 3CQCB 5LBMA 3C50A 4I4TE 5LBQB 2ZLYA 5FXWA 3GWHA 5JREA 5CA0E 5L3FB 5JH7E 2PBIA 3WAKA 1BR4A 3PUQA 4OYJA 2IC9A 2X66A 3KVBA 2CXDA 3HKBE 4GYRA 3RH3A 5LNKA 3E22E 4PJMA 4F6RC 2WBLA 4TUYE 1HCIA 3CX6B 2VASA 3O1HA 3K3NA 4JEUB 4HE8A 3JC6C 4H9SE 1MNEA 3HR0A 2Q9QA 4BJMA 1HG2A 4M1PA 1B7TA 4X20E 3SS1A 2ZM2A 3ZYKA 4HFVA 4AQFA 1S35A 3BK9A 3S4UA 4XBFB 2N1GA 5JDMA 3FBZA 4L5GA 2LJLA 4KBMB 1ZHCA 1KNZA 1S94A 3LK3B 3VHLA 5LJMA 2LSIA 5LG4A 4IDZA 4OFZA 4UVBB 5JR9B 1LRZA 2E8IA 5JR9C 2CXLA 4PK6A 4AKRB 2YU2A 4ZI2D 3UT5E 4OYKA 2GK9A 5KDMC 4CI2B 5L3DB 2C5IT 4CQIA 2B1EA 2V26A 5LJNA 4AKIA 1MMAA 3RYHE 4EYUA 3CPZA 4PAGA 4X1YE 2X9HA 4PK5A 4UELA 3VU7H 1EZ3A 3DP7A 2IAKA 3CWZB 2UXXB 4AKHA 4H63V 4P09A 3ZLIA 5LP6E 2UXNB 4MBQA 5EK4A 1MMGA 4YJ3E 4ZHQE 2NW7A 1IAPA 5HXHA 2W61A 1IZNB 3LFMA 4O2AE 3ZYMA 5EK2A 5L3GB 3Q5XA 2BDEA 3AAEB 3LG7A 4TX5A 3AA7B 4IE5A 5FYMA 3PTRB 2LT3A 5LOVE 3KV4A 4QXBB 2X9XA 3MA9A 4U72A 3ONXA 1FMWA 4O8SA 3GA8A 4QWNB 2A2FX 5J2TE 2KWIB 5LGUB 3ZMUB 1WRDA 5HWYA 3O1JA 3N9NA 5M4YA 4QX7B 5LA6E 2XHEB 2CMRA 2PFVA 2CWOA 3KV9A 4IIJE 5JVDE 3MZKB 2D0UA 3HKDE 4H63H 4QX8B 1HTJF 4X1IE 1OWAA 2JJ9A 4WBOA 3HKEE 3I1AA 4YHJA 2WSSV 4O4HE 3AAAB 3OJAA 3O9XA 2JMHA 5J1GA 3C4XA 5H6RB 3UUMA 3ANWB 3DTOA 4GK0E 5HXCA 4AQGA 5L3BB 2Y48B 2X9YA 4ZS2A 4QXCB 2NOXA 3ZYLA 4EZ4A 2E9XC 1HG5A 2XUEA 3LBXB 3C4WA 5JDFA 4TN7B 3ZCJA 1D0XA 3OYZA 4ZS3A 1MIVA 4WW0A 3WAJA 3GN5B 4UV8B 2X68A 2WWUA 2D0TA 5LGTB 5LYJE 3F2EA 4P0AA 3VKGA 3FXEB 4HEAA 4FJOA 3C51A 2NTXA 2OA5A 4NUUA 4MFRA 2I59A 3ETVA 4UVCB 2VKOA 4IE4A 5JDQA 4TV9E 4EXTA 3K3OA 4DMVA 3JC6D 4OHFA 1T98A 2MTQA 4UF0B 2WM9A 3PUSA 3UFEA 1Y64B 2VKHA 2IW5B 2DLRA 1FEWA 2W00A 3AA0B 3NBXX 1MNDA 4H9PC 4HGAA 3TKLB 3J7Yq 3FB2A 3GMIA 2L8KA 3P7IA 2XQYA 3AB3B 1NAFA 1SA0E 4GOUA 4ILUA 3J9X1 2J1DG 3PU8A 1LVKA 3N5LA 3N2KE 4GYSA 3U3IA 4HN9A 3KBTA 3F57A 3KV6A 3ZC1A 2EHOB 2WAUA 2EHOC 3N9OA 2LSKA 2LOPA 2V7IA 2NW8A 2VKDA 2IC6A 3ZJ1A 5DQVA 2KMFA 5FY1A 3IF8B 1OXZA 2KXPB 3UTKA 2HPJA 2Y6XA 2N2NA 1D0YA 3C98B 5FY0A 3W15B 4CI3B 3PE0A 5FXXA 4QHOA 3E0ZA 2PJQA 5LGNB 3N9QA 5FXZA 3E08A 3RRWA 4UIGA 4Z8XA 3UULA 3EDVA 5LHGB 3CMLA 3ZMSB 1WYCA 1H7CA 5JRCA 2DHRA 3DJBA 2CE7A 3ZC0A 2NTYA 2K24A 1MMDA 2KZ7B 2LHNA 3LJCA 2K5BB 5L3EB 4DVDA 4IHJE 2Q9QB 5H6QB 5L2LA 4PNIA 2CA5A 2L9QA 3R84B 3F31A 3ZCIA 2V7KA 5JQGE 4HTEA 2W0GA 3Q5WA 4I50E 4MALA 1BR1A 3BQKA 3H37A 4UVAB 5FY7A 5C8YE 1G73A 3C64A 3VKHA 2CWYA 3NRXA 1CUNA 2D5UA 3AA1B 4IE7A 1MMNA 2ACXA 4YFSA 2ES0A 2ZM0A 5BMVE 2JRKA 3CQXC 4EIWA 3B57A 3RC3A 2ODUA 1WYBA 4PW8A 2W63A 3PU3A 1YKHB 4I43B 3KFWX 3ZN0B 3HL6A 5FNVE 5DQWA 5JDGA 1YKEB 2E9XD 2LE8A 5CA1E 2BVMA 2DWKA 2ZMAA 2XASB 2E9XA 4TZ4C 5HXRA 4CXYA 4V1Av 5F8PA 4DBQA 3BQIA 3RC8A 1LKXA 1US7B 2V7MA 4WNKA 2LOSA 3ZEFB 5LHIB 4PJJA 4DO0A 4ZI3C 3PURA 4CI1B 5FXVA 4H9RC 5KMGP 2G0UA 1UCUA 2D2SA 5HXEA 3QC9A 1VOMA 4ZI7E 1D1CA 2NW9A 2ZM8A 4OK0A 1WR6A 2JMKA 2M67A 4EAHA 5TAOA 2A3DA 2N9DA 3QUJA 2VWAA 2MYSA 3IHRA 3Q9DA 2Y8DA 3ETUA 4JUYA 4PJLA 2CXFA 4E7ZA 2WMOA 2X67A 1AJ3A 2RP4A 4UV9B 4YJ2E 4KUMB 3HI2A 4UEMA 5ADXL 2VKJA 4MLKA 4O4IE 2Z6EA 5EZYE 3EVYA 4AKLA 4I55E 5IYZE 2W62A 3B13A 3ZMVB 2V7LA 4ANJA 4H9OC 3EDUA 3AA6B 4C90A 5LHHB 2WMNA 4MHCA 2EHOD 2HPLA 3O4XE 2K9AA 2CCQA 2EHOA 3KV5A 1ZKEA 3OKQA 5EK3A 5IHYA 3LK2B 3AVSA 4H9QC 1YD8G 4DNDA 2LEHA 2XAGB 4O2BE 4QKNA 4QXHB 1KK7A 3MJXA 4BA9A 3ZPOA 4J2CA 3N9LA 2A72A 3CVRA 4E7SA 2MOZA 2HH7A 2XTLA 3CKDA 3QK6A 3OBVE 5LCYA 3SWHA 3P8CD 2QGSA 4AKGA 1X79A 5A1LA 5JR9A 1U4QA 4PK4A 3ZJ2A 3K3QC 1V9DA 3HKCE 3V5UA 2NWBA 2SPCA 3CX8B 3Q2MA 1D1AA 2QA7A 4BJNA 4C91A 4EZHA 4B6XA 3KDSE 4GK5E 2PG8A 1IJ5A 4XZCA 4O4LE 3I9YA 3H3AA 1VRBA 5ETWA 2BZBA 2X51A 3PUAA 4WBNE 2VB6A 5KX5E 2XAJB 3OYXA 4TV8E 2LM9A 2Q9QD 3K8PC 2K48A 3RRCA 3NZQA 3FXDB 4NUVA 2YU1A 3HA4A 3ZMTB 1MIYA 4JEHB 3RPUA 5HAXA 2C0SA 3U78A 1ZEEA 4AXPA 3IBPA 3BQLA 3KBUA 3MXZA 3NRYA 5JDNA 4BAYB 2KNDA 3ZMZB 5HWXA 3NZPA 2KINB 3RYCE 1QUUA 3MACA 3ZN1B 4IE0A 4K0UA 3RYFE 2DCFA 2Q9QC 2KWHA 1D1BA 2L3LA 3A5XA 5DJQC 4DMWA 5HXSA 4ASKA 3LK42 4G2AA 4KP3C 4YLHA 1E1HB 3AVRA 4L0RA 3L3PA 1ZV4X 5E0OA 1FMVA 4AQFC 2H7OA 2VK9A 4CZZB 4P0BA 2X0LB 4EB6E 3ESLA 5JDLA 4XAXB 2ODVA 3RYIE 3KVAA 5GONE 3IEEA 3EUHA 3AAIA 4ZI3D 1UX5A 2H3RA 3I0OA 4IE6A 4KMCA 2BVLA 3N9MA 3N2GE 3T8OA 4U74A 5DABA 2CLYB 4ISSA 4ZI2C 3MK7C 3ANWA 1HFAA 2CLYC 2XAHB 3RKOA 5J2UE 3UUXB 4ZOLE 5JRCB 1HF8A 4PFOA 3N2OA 1G8XA 3LBXA 3WI3A 4EYYR 1MIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZCI A;  3ZCJ A; 
#chains in the Genus database with same CATH topology
 4Q25 A;  3AE9 A;  3CQG B;  3CX7 B;  4X65 T;  3D0T A;  4FI5 A;  2P9B A;  5L4H A;  3I0Q A;  3JAF A;  4LFC T;  2AE9 A;  3PUX F;  4G63 A;  1XNR T;  1IBK T;  1QSD A;  4L9I A;  3SOL A;  3T1H T;  5FP3 A;  2IDO B;  4DR1 T;  2E9X B;  2XQ4 A;  3FBL A;  4GKJ T;  3R6N A;  3O1I A;  2IUB A;  3L09 A;  2VL8 A;  3EHZ A;  4B3R T;  5L3C B;  3CK6 A;  2M6I A;  5HYA A;  3UU4 A;  2BS4 A;  4DV1 T;  2VUR A;  4JI2 T;  2C5K T;  1I6Z A;  1FIO A;  3CQC B;  5LBM A;  2H88 A;  5FXW A;  1M7K A;  1XNQ T;  3PUQ A;  3EAM A;  2X66 A;  3E22 E;  4TUY E;  4LF5 T;  1HCI A;  3K3N A;  4HE8 A;  4H9S E;  1MNE A;  2ZM2 A;  4HFV A;  3S4U A;  2QRX A;  3FZK B;  5C3J A;  2BBJ A;  3LK3 B;  5LJM A;  2LSI A;  5LG4 A;  5JR9 B;  4PK6 A;  2E5L T;  3UT5 E;  2GK9 A;  3AXJ B;  3A7M A;  2B1E A;  2V26 A;  5LJN A;  4AKI A;  3PV0 F;  5AQK B;  1ZOY A;  4JI1 T;  2X9H A;  4UEL A;  4DV0 T;  2IAK A;  2LKH A;  4AKH A;  2BKO A;  1DU2 A;  2I6H A;  3ZLI A;  5LP6 E;  1J5W A;  1OED E;  2NW7 A;  1IAP A;  2W61 A;  3LG7 A;  4IE5 A;  3PTR B;  2LT3 A;  4QXB B;  2YOE A;  4U72 A;  4O8S A;  2A2F X;  4JI0 T;  2KWI B;  3ZMU B;  1WRD A;  3FZF B;  2XM1 A;  5HWY A;  2FJD A;  3N9N A;  3KV9 A;  4LML A;  2D0U A;  1E2A A;  2WCA A;  4X1I E;  1HTJ F;  1OWA A;  4WBO A;  4CN6 A;  3HKE E;  5HCM A;  4YHH T;  2UUA T;  5J1G A;  3DTO A;  2W4X A;  5HXC A;  4JI5 T;  2E9X C;  2XUE A;  5JDF A;  3C4W A;  2YDQ A;  3RGL A;  2A9U A;  2WWU A;  5LYJ E;  2QVA A;  3VKG A;  4HEA A;  1HX1 B;  2WQY A;  2I59 A;  1UUR A;  4DMV A;  3JC6 D;  4OHF A;  1HNW T;  2MTQ A;  1Y64 B;  4ILB A;  2E2A A;  2IW5 B;  2UU9 T;  3TKL B;  3GMI A;  4DID B;  2UXB T;  4GOU A;  2J1D G;  3PU8 A;  3N5L A;  3U3I A;  1JNR A;  2B76 A;  3KV6 A;  2EHO B;  2WAU A;  3FZH B;  5DQV A;  2KMF A;  5FY1 A;  4CN1 A;  1E7P A;  3LDQ B;  4KX6 A;  1D0Y A;  5LG3 A;  5FXX A;  4QHO A;  3N9Q A;  3UUL A;  4Z8X A;  2X0H A;  4HWH A;  2XPK A;  4JV5 T;  1H7C A;  2K3W A;  3DJB A;  3ZC0 A;  2KZ7 B;  2LHN A;  1SUM B;  2K5B B;  4DVD A;  4IHJ E;  3L8R A;  2Q9Q B;  5H6Q B;  2CA5 A;  3R84 B;  3F31 A;  1IBL T;  4TWH A;  4ZZB A;  5FY7 A;  3C64 A;  3VKH A;  3FZM B;  4IE7 A;  1MMN A;  3AE8 A;  3B57 A;  2ODU A;  2XY8 B;  2W63 A;  3ZN0 B;  5FNV E;  2BVM A;  4LF7 T;  4V1A v;  2XM2 A;  4DBQ A;  3BQI A;  2QYW A;  4DO0 A;  2BS3 A;  3PUR A;  5FXV A;  4H9R C;  5AQQ B;  2NW9 A;  2ZM8 A;  2I0M A;  3JAE A;  3P4P A;  3ONL C;  2MYS A;  2BKN A;  3Q9D A;  4JUY A;  4PJL A;  4LF8 T;  2X67 A;  1I94 T;  2UUB T;  4YJ2 E;  3HI2 A;  5FVK A;  2VKJ A;  3LSV A;  4AKL A;  1R8I A;  4ANJ A;  3AA6 B;  5LHH B;  2WMN A;  1SE7 A;  4MHC A;  2CCQ A;  2XZE A;  3OKQ A;  5FKY A;  4CN4 A;  2LEH A;  4QXH B;  4O2B E;  3UFG A;  3MJX A;  4BA9 A;  4K0K T;  3ZPO A;  3N9L A;  3CVR A;  4E7S A;  4IL4 A;  4B3S T;  2HH7 A;  3CKD A;  5LCY A;  3SWH A;  2XSA A;  3P8C D;  1JNZ A;  2V6Y B;  5A1L A;  2NWB A;  2SPC A;  4C91 A;  1XMO T;  4DUY T;  1W0A A;  2X51 A;  4YTM A;  4TV8 E;  2K48 A;  2IML A;  4LMK A;  3RIU A;  4IL9 A;  4JEH B;  1W0B A;  4WYV A;  4ZEY A;  3UUB A;  1T8B A;  3U78 A;  3NRY A;  2VL0 A;  2KIN B;  4IE0 A;  2Q9Q C;  5DJQ C;  2L3L A;  3LK4 2;  1E1H B;  3L3P A;  1FMV A;  4AQF C;  2VK9 A;  4LFB T;  4DR7 T;  5JDL A;  2CPT A;  3AEC A;  4X5T A;  4IE6 A;  3T8O A;  5HEG A;  3ANW A;  2XAH B;  1KNR A;  4PFO A;  1G8X A;  3WI3 A;  1OED B;  1MIW A;  2LHR A;  4O4J E;  4X1K E;  2KT9 A;  3C4Z A;  2LSY A;  5FL1 A;  2DI4 A;  5AQU B;  2RPA A;  2BS2 A;  4A56 A;  4YSZ A;  1UUS A;  3UUN A;  4HKA A;  4IST A;  2LSJ A;  1NWM X;  2DL1 A;  2V1D B;  2CEA A;  2H7V C;  2YIN A;  4NIQ A;  2JQQ A;  1BR0 A;  1WLX A;  4U31 A;  3ONJ A;  2JPF A;  5FMN A;  4AI6 A;  2NP9 A;  3RIA A;  1IJ6 A;  5AFU L;  2ZLY A;  3QNU A;  5CA0 E;  4YT0 A;  1BR4 A;  5LNK A;  2VVN A;  4F6R C;  2J47 A;  3JC6 C;  4BJM A;  3OVU A;  4UR9 A;  3ZYK A;  1S35 A;  4AIU A;  4XBF B;  3FBZ A;  4L5G A;  2XQ8 A;  5FVL A;  4KBM B;  1ZHC A;  1S94 A;  3VHL A;  3RQU A;  3T1Y T;  1LRZ A;  2E8I A;  4DV3 T;  2CXL A;  5KDM C;  4CI2 B;  2C5I T;  4HFE A;  4EYU A;  4X1Y E;  2UXX B;  4P09 A;  4DV7 T;  4U7Y A;  4MBQ A;  3UU8 A;  2WY2 A;  3LFM A;  5EK2 A;  1OED C;  3Q5X A;  2BDE A;  3AA7 B;  2OV9 A;  2X9X A;  4JI8 T;  4ZZC A;  4QWN B;  4LFA T;  3O1J A;  4IIJ E;  2CWO A;  5JVD E;  3MZK B;  4H63 H;  4QX8 B;  3I1A A;  5H6R B;  5L47 A;  2F4V T;  2CRB A;  2Y48 B;  4QXC B;  4NXN T;  2W67 A;  1HG5 A;  3LBX B;  5CGM A;  1MIV A;  4JI6 T;  3WAJ A;  2D0T A;  5LGT B;  3FXE B;  3AE2 A;  4NUU A;  2W2U A;  3RQW A;  3ETV A;  3TLS A;  2WS3 A;  4HWD A;  2CBJ A;  2CHN A;  3AEE A;  2BG9 A;  2XQ6 A;  2VKH A;  2UXC T;  4H9P C;  4HGA A;  4F8H A;  1SA0 E;  1WFD A;  4GYS A;  4HN9 A;  4DR5 T;  3KBT A;  2LSK A;  2H89 A;  2LOP A;  2HPJ A;  2N2N A;  3PE0 A;  5HEU A;  3PUY F;  5IWA T;  5LGN B;  5FXZ A;  3RLF F;  5LHG B;  4HWI B;  1WYC A;  5JRC A;  2CE7 A;  1MMD A;  5L4E A;  2IIU A;  2V7K A;  4HTE A;  5C8Y E;  1N32 T;  4U3C A;  3B5M A;  3AA1 B;  2FJE A;  4YFS A;  2ES0 A;  2BKP A;  2ZM0 A;  3RC3 A;  1WYB A;  3PU3 A;  1YKH B;  3AEA A;  4I43 B;  5JDG A;  1YKE B;  5AQM B;  2LE8 A;  4YSY A;  5CFB A;  4EV6 A;  1KNP A;  2YDS A;  5AQT B;  1W09 A;  4WZX A;  1LKX A;  1US7 B;  2V7M A;  3P4R A;  4CI1 B;  5KMG P;  2G0U A;  4HWF A;  1VOM A;  1D1C A;  4OK0 A;  2JMK A;  2VWA A;  2Y8D A;  4ILC A;  2J62 A;  2CXF A;  2WMO A;  1AJ3 A;  1NEK A;  4UV9 B;  4P1N A;  5EZY E;  3EVY A;  3B13 A;  2V7L A;  4C90 A;  2VQE T;  2CHO A;  2EHO A;  1ZKE A;  5EK3 A;  5HCJ A;  5IHY A;  4LF4 T;  3ZT6 A;  4QKN A;  3OTO T;  1KK7 A;  4J2C A;  4ZXL A;  2A72 A;  2MOZ A;  3IA3 A;  3K3Q C;  3AE7 A;  3V5U A;  3Q2M A;  1D1A A;  4GK5 E;  2V8S V;  3I9Y A;  1VRB A;  4WBN E;  2VB6 A;  3PUV F;  2WU2 A;  3RRC A;  3P50 A;  4NUV A;  3HA4 A;  4DV2 T;  3ZMT B;  1MIY A;  3NWI A;  2C0S A;  3IBP A;  3BQL A;  1VCT A;  3ZMZ B;  3RYC E;  1QUU A;  3MAC A;  1KFY A;  5ABF A;  2KWH A;  4YTP A;  3EI0 A;  4ASK A;  5E0O A;  4L0R A;  4CZZ B;  5F5W A;  3UU3 A;  2X0L B;  4XAX B;  2ODV A;  3KVA A;  4KMC A;  4U74 A;  2CLY C;  5JTG A;  1HF8 A;  2HN1 A;  4U2Y A;  4LF6 T;  3KIN B;  4DBR A;  3M65 A;  2J4G A;  4CXX A;  4EOZ B;  2YK0 A;  2XAQ B;  3GN5 A;  1BR2 A;  5F3J A;  2WDQ A;  1LVF A;  3I9W A;  2DNX A;  1U5P A;  4PFP A;  3CIR A;  1J5E T;  2XAF B;  3PUG A;  3G06 A;  3MKD A;  4CXW A;  4UF0 A;  1O3X A;  2XQA A;  2BBH A;  1SHZ C;  3V5S A;  4UXN B;  4H9N C;  1HS7 A;  2KLQ A;  4Z91 A;  4IGU A;  4PJN A;  2UUC T;  3QB5 A;  2LLY A;  1YW0 A;  1HX8 A;  1UX4 A;  3C50 A;  5LBQ B;  4HFH A;  2KSR A;  3WAK A;  4NXM T;  3QOF A;  3KVB A;  2CXD A;  4GYR A;  3P4S A;  4PJM A;  3X1D A;  3ZKR A;  4TNV A;  3CX6 B;  1M62 A;  2VAS A;  3O1H A;  4JEU B;  1T7S A;  2X0Y A;  1Y01 A;  3SS1 A;  2N1G A;  3ZT5 A;  1GQE A;  1XMQ T;  2LJL A;  1KNZ A;  3PJA A;  1W9R A;  2IHR 1;  3TLU A;  4HWC A;  4OFZ A;  3UQ7 A;  4AKR B;  4IRE A;  4ZI2 D;  4OYK A;  2WZH A;  5L3D B;  4CQI A;  1MMA A;  2CBI A;  3RYH E;  4JYA T;  2WDR A;  2XQ3 A;  4PK5 A;  1EZ3 A;  2YKS A;  3DP7 A;  1UK5 A;  3UU5 A;  2D9D A;  2UXN B;  5EK4 A;  3ZT7 A;  4ZHQ E;  4GKK T;  1IZN B;  4O2A E;  1WCR A;  4X64 T;  3MA9 A;  2YN6 A;  3ONX A;  1FMW A;  3GA8 A;  5AQR B;  2XHE B;  2CMR A;  4O4H E;  3OJA A;  3O9X A;  2JMH A;  3UUM A;  3ANW B;  5L3B B;  2X9Y A;  2NOX A;  3ZYL A;  2ZM6 T;  3PUZ F;  1D0X A;  2WWV A;  3OYZ A;  4ZS3 A;  4B3M T;  2X68 A;  1T72 A;  4HFB A;  3F2E A;  4P0A A;  3C51 A;  3RF1 A;  1J1J A;  2OA5 A;  4MFR A;  5JDQ A;  4IE4 A;  4TV9 E;  3K3O A;  1T98 A;  3UFE A;  4ILA A;  2DLR A;  1FEW A;  3AA0 B;  3NBX X;  3FB2 A;  3P7I A;  2WZI A;  1NAF A;  4ILU A;  1LVK A;  2FJB A;  3N2K E;  3AE5 A;  3N9O A;  3ZJ1 A;  1OXZ A;  2KXP B;  2Y6X A;  1QLB A;  3W15 B;  4CI3 B;  3RRW A;  3EDV A;  3ZMS B;  1VCS A;  2WB5 A;  2DHR A;  2NTY A;  3LJC A;  5L2L A;  3RIU C;  2L9Q A;  4QH5 A;  4U2Z A;  5JQG E;  4I50 E;  3Q5W A;  5ABH A;  1BR1 A;  1G73 A;  2CWY A;  3NRX A;  1HNZ T;  5J0Z A;  2ACX A;  2V5D A;  3CQX C;  4HFI A;  4PW8 A;  3KFW X;  2FUP A;  3HL6 A;  1N34 T;  3RKG A;  3AEG A;  5CA1 E;  2E9X A;  4TZ4 C;  5F8P A;  4IT4 A;  4TWF A;  3ZEF B;  4PJJ A;  2FBW A;  1UCU A;  3AE6 A;  5KXJ A;  1ZP0 A;  4EAH A;  5TAO A;  4DR3 T;  3ETU A;  3P4Q A;  5AQV B;  1L0V A;  2RP4 A;  4YSX A;  4UEM A;  3VR8 A;  4I55 E;  3ZMV B;  4COF A;  3EDU A;  2EHO D;  3KV5 A;  2NR4 A;  1YD8 G;  4DND A;  2XAG B;  4A97 A;  2XTL A;  1HR0 T;  2XQ9 A;  3OBV E;  5AQG B;  2QGS A;  4AKG A;  1X79 A;  5JR9 A;  1U4Q A;  1V9D A;  3HKC E;  2VQF T;  3CX8 B;  4B6X A;  3UQ4 A;  3KDS E;  2PG8 A;  1IJ5 A;  3RIF A;  3AXJ A;  3JCF A;  4XZC A;  4O4L E;  3AEF A;  3H3A A;  5ETW A;  2BZB A;  2UXD T;  4JI3 T;  3PUA A;  4I0U A;  3OYX A;  4YTN A;  2LM9 A;  2Q9Q D;  2BG9 B;  3K8P C;  3FXD B;  2YU1 A;  2LRK A;  4A5X A;  3JAD A;  5HAX A;  4AXP A;  1ZEE A;  5JDN A;  3KBU A;  3MXZ A;  4BAY B;  2KND A;  3ZN1 B;  3RYF E;  1D1B A;  5HXS A;  4DMW A;  2AXD S;  4G2A A;  4IDP A;  4KP3 C;  3AVR A;  2H7O A;  2MPK A;  1CHU A;  1X9B A;  4P0B A;  4EB6 E;  3OPC A;  3RYI E;  2M6B A;  5GON E;  4QH4 A;  5AQJ B;  3IEE A;  4ZI3 D;  2JQH A;  2XSB A;  2H3R A;  3I0O A;  4U33 A;  2BVL A;  3N9M A;  3QB5 K;  3VRB A;  5DAB A;  2CLY B;  4ZI2 C;  1HFA A;  2FJA A;  1NEN A;  3UUX B;  4ZOL E;  5JRC B;  3N2O A;  5LXT E;  4EED A;  1Z0P A;  1N33 T;  4QH1 A;  5BR8 T;  4U7I A;  3FHN A;  1N36 T;  3SRZ A;  2V7J A;  2LSG A;  2YEV C;  4N78 D;  4LMJ A;  3N9P A;  4JLE A;  2V5C A;  4NPP A;  2CM0 A;  3RX6 A;  4GIW A;  2C5J A;  5CB4 E;  2X9W A;  4ADZ A;  1D0Z A;  2RA1 A;  4KI0 F;  5JDH A;  3PDY A;  4ERR A;  3SFE A;  2DWG A;  4A98 A;  2MBG A;  1IBM T;  4I4T E;  1YQ4 A;  3GWH A;  4X62 T;  5JRE A;  5L3F B;  5JH7 E;  2PBI A;  4OYJ A;  2IC9 A;  3HKB E;  3AE1 A;  3RH3 A;  4DR6 T;  2R6G F;  2WBL A;  2BG9 C;  2HN2 A;  3HR0 A;  2Q9Q A;  1HG2 A;  4M1P A;  1B7T A;  4X20 E;  4AQF A;  3BK9 A;  2JIW A;  5JDM A;  4DV6 T;  2W66 A;  4DUZ T;  4IDZ A;  4UVB B;  5JR9 C;  2YU2 A;  4DR2 T;  2WU5 A;  3TLV A;  3CPZ A;  4PAG A;  3VU7 H;  3CWZ B;  3PJA J;  5ABE A;  1XWM A;  4H63 V;  1MMG A;  4YJ3 E;  5HXH A;  5L3G B;  3ZYM A;  3TLT A;  3AAE B;  4TX5 A;  5AQI B;  5ABF B;  3VR9 A;  5FYM A;  4OX9 T;  5LOV E;  3KV4 A;  3H3M A;  3AE4 A;  3ZST A;  5J2T E;  5LGU B;  1Z8U A;  4AQY T;  2OLT A;  5M4Y A;  4QX7 B;  5LA6 E;  2PFV A;  3HKD E;  2E5V A;  2XQ7 A;  2JJ9 A;  4YHJ A;  2WSS V;  3AAA B;  3C4X A;  4GK0 E;  3A8Y C;  4TNW A;  4AQG A;  1YQ3 A;  4ZS2 A;  4EZ4 A;  4TN7 B;  3ZCJ A;  4WW0 A;  3GN5 B;  4UV8 B;  3TLW A;  3EAB A;  2V6Y A;  4FJO A;  3Q5E A;  5HEH A;  4YY3 T;  2NTX A;  5CJ5 A;  1XZY A;  4DV5 T;  2LRL A;  4UVC B;  2VKO A;  2V6X A;  5AQF B;  5HEJ A;  4EXT A;  5LB7 B;  3RI5 A;  4KHZ F;  4UF0 B;  2WM9 A;  3PUS A;  2W00 A;  3J7Y q;  1MND A;  4JI7 T;  3UU6 A;  2HHH T;  2L8K A;  4Z90 A;  2XQY A;  3AB3 B;  2MAW A;  2BG9 E;  3J9X 1;  3AEB A;  3ABV A;  3F57 A;  3ZC1 A;  2EHO C;  1YXR A;  2V7I A;  5LMU T;  2NW8 A;  2VKD A;  2IC6 A;  3FZL B;  3AE3 A;  3IF8 B;  3K1S A;  3UTK A;  2XJ7 A;  5AQS B;  3C98 B;  5FY0 A;  3VRA A;  5AQH B;  3E0Z A;  5FL0 A;  2PJQ A;  4DV4 T;  3E08 A;  4UIG A;  5HEO A;  5ABG A;  3CML A;  4EEB A;  3RHW A;  2ACZ A;  4HFC A;  2K24 A;  1OED A;  5L3E B;  5AQL B;  1WR0 A;  4PNI A;  3PUW F;  3ZCI A;  3ZSS A;  2W0G A;  4MAL A;  1KEY A;  3BQK A;  3H37 A;  4UVA B;  1CUN A;  2D5U A;  5BMV E;  2JRK A;  4EIW A;  3NVO A;  2JQK A;  5DQW A;  2E9X D;  4X66 T;  2DWK A;  2ZMA A;  2XAS B;  5HXR A;  4CXY A;  4LF9 T;  3RC8 A;  1XDO A;  4WNK A;  2LOS A;  5LHI B;  4ZI3 C;  1FJG T;  4JBW F;  2D2S A;  5HXE A;  3QC9 A;  4ZI7 E;  3P4W A;  4DR4 T;  1WR6 A;  2M67 A;  2A3D A;  2N9D A;  3QUJ A;  4KHP T;  3IHR A;  1KF6 A;  4E7Z A;  5IUX A;  4KUM B;  5LMN T;  2LKG A;  5ADX L;  3L39 A;  4MLK A;  4O4I E;  2Z6E A;  1UGO A;  3AED A;  5IYZ E;  2W62 A;  5C2T A;  3Q5D A;  4IDO A;  4H9O C;  2HPL A;  2VVS A;  2K9A A;  3O4X E;  4AIS A;  3LK2 B;  2YDR A;  3AVS A;  4H9Q C;  3M3Z B;  4EGW A;  2WP9 A;  3QK6 A;  4JI4 T;  1XDP A;  2WDV A;  4PK4 A;  3ZJ2 A;  4BJN A;  2QA7 A;  4EZH A;  3SFD A;  4IDQ A;  1HNX T;  5AQO B;  5KX5 E;  2XAJ B;  4HFD A;  5AQN B;  3NZQ A;  3RPU A;  5HWX A;  2PTF A;  3NKZ A;  3NZP A;  4IDN A;  4K0U A;  2DCF A;  3A5X A;  4YLH A;  1ZV4 X;  5AQP B;  2JQ9 A;  3ESL A;  4YXD A;  3EUH A;  3AAI A;  4B3T T;  1UX5 A;  2LM2 A;  3N2G E;  4ISS A;  3MK7 C;  3RKO A;  5J2U E;  2XQ5 A;  4TWD A;  3LBX A;  4EYY R; 
#chains in the Genus database with same CATH homology
 3KIN B;  4DBR A;  3M65 A;  3CQG B;  2LHR A;  3CX7 B;  3D0T A;  4CXX A;  4EOZ B;  5LXT E;  2YK0 A;  1Z0P A;  2XAQ B;  4O4J E;  3GN5 A;  4FI5 A;  1BR2 A;  4X1K E;  5F3J A;  1LVF A;  2P9B A;  3FHN A;  3I9W A;  3SRZ A;  2KT9 A;  3I0Q A;  3C4Z A;  2DNX A;  2V7J A;  2LSG A;  1U5P A;  2LSY A;  2YEV C;  4PFP A;  4N78 D;  2DI4 A;  4G63 A;  4A56 A;  3N9P A;  2XAF B;  3PUG A;  4CXW A;  3MKD A;  4UF0 A;  3UUN A;  1QSD A;  4L9I A;  3SOL A;  5FP3 A;  1O3X A;  4JLE A;  1SHZ C;  3V5S A;  2CM0 A;  4HKA A;  3RX6 A;  4GIW A;  4IST A;  2LSJ A;  1NWM X;  4UXN B;  2E9X B;  4H9N C;  1HS7 A;  2KLQ A;  3FBL A;  4IGU A;  3R6N A;  2V1D B;  2C5J A;  2CEA A;  3O1I A;  4PJN A;  2H7V C;  2YIN A;  2JQQ A;  1BR0 A;  3L09 A;  1WLX A;  5CB4 E;  2VL8 A;  2X9W A;  4ADZ A;  1D0Z A;  2JPF A;  2RA1 A;  5L3C B;  5FMN A;  5JDH A;  5HYA A;  3PDY A;  4AI6 A;  4ERR A;  2NP9 A;  1YW0 A;  1HX8 A;  2DWG A;  2C5K T;  1IJ6 A;  2MBG A;  1UX4 A;  5AFU L;  1FIO A;  3CQC B;  5LBM A;  3C50 A;  4I4T E;  5LBQ B;  2ZLY A;  5FXW A;  3GWH A;  5JRE A;  5CA0 E;  5L3F B;  5JH7 E;  2PBI A;  3WAK A;  1BR4 A;  3PUQ A;  4OYJ A;  2IC9 A;  2X66 A;  3KVB A;  2CXD A;  3HKB E;  4GYR A;  3RH3 A;  5LNK A;  3E22 E;  4PJM A;  4F6R C;  2WBL A;  4TUY E;  1HCI A;  3CX6 B;  2VAS A;  3O1H A;  3K3N A;  4JEU B;  4HE8 A;  3JC6 C;  4H9S E;  1MNE A;  3HR0 A;  2Q9Q A;  4BJM A;  1HG2 A;  4M1P A;  1B7T A;  4X20 E;  3SS1 A;  2ZM2 A;  3ZYK A;  4HFV A;  4AQF A;  1S35 A;  3BK9 A;  3S4U A;  4XBF B;  2N1G A;  5JDM A;  3FBZ A;  4L5G A;  2LJL A;  4KBM B;  1ZHC A;  1KNZ A;  1S94 A;  3LK3 B;  3VHL A;  5LJM A;  2LSI A;  5LG4 A;  4IDZ A;  4OFZ A;  4UVB B;  5JR9 B;  1LRZ A;  2E8I A;  5JR9 C;  2CXL A;  4PK6 A;  4AKR B;  2YU2 A;  4ZI2 D;  3UT5 E;  4OYK A;  2GK9 A;  5KDM C;  4CI2 B;  5L3D B;  2C5I T;  4CQI A;  2B1E A;  2V26 A;  5LJN A;  4AKI A;  1MMA A;  3RYH E;  4EYU A;  3CPZ A;  4PAG A;  4X1Y E;  2X9H A;  4PK5 A;  4UEL A;  3VU7 H;  1EZ3 A;  3DP7 A;  2IAK A;  3CWZ B;  2UXX B;  4AKH A;  4H63 V;  4P09 A;  3ZLI A;  5LP6 E;  2UXN B;  4MBQ A;  5EK4 A;  1MMG A;  4YJ3 E;  4ZHQ E;  2NW7 A;  1IAP A;  5HXH A;  2W61 A;  1IZN B;  3LFM A;  4O2A E;  3ZYM A;  5EK2 A;  5L3G B;  3Q5X A;  2BDE A;  3AAE B;  3LG7 A;  4TX5 A;  3AA7 B;  4IE5 A;  5FYM A;  3PTR B;  2LT3 A;  5LOV E;  3KV4 A;  4QXB B;  2X9X A;  3MA9 A;  4U72 A;  3ONX A;  1FMW A;  4O8S A;  3GA8 A;  4QWN B;  2A2F X;  5J2T E;  2KWI B;  5LGU B;  3ZMU B;  1WRD A;  5HWY A;  3O1J A;  3N9N A;  5M4Y A;  4QX7 B;  5LA6 E;  2XHE B;  2CMR A;  2PFV A;  2CWO A;  3KV9 A;  4IIJ E;  5JVD E;  3MZK B;  2D0U A;  3HKD E;  4H63 H;  4QX8 B;  1HTJ F;  4X1I E;  1OWA A;  2JJ9 A;  4WBO A;  3HKE E;  3I1A A;  4YHJ A;  2WSS V;  4O4H E;  3AAA B;  3OJA A;  3O9X A;  2JMH A;  5J1G A;  3C4X A;  5H6R B;  3UUM A;  3ANW B;  3DTO A;  4GK0 E;  5HXC A;  4AQG A;  5L3B B;  2Y48 B;  2X9Y A;  4ZS2 A;  4QXC B;  2NOX A;  3ZYL A;  4EZ4 A;  2E9X C;  1HG5 A;  2XUE A;  3LBX B;  3C4W A;  5JDF A;  4TN7 B;  3ZCJ A;  1D0X A;  3OYZ A;  4ZS3 A;  1MIV A;  4WW0 A;  3WAJ A;  3GN5 B;  4UV8 B;  2X68 A;  2WWU A;  2D0T A;  5LGT B;  5LYJ E;  3F2E A;  4P0A A;  3VKG A;  3FXE B;  4HEA A;  4FJO A;  3C51 A;  2NTX A;  2OA5 A;  4NUU A;  4MFR A;  2I59 A;  3ETV A;  4UVC B;  2VKO A;  4IE4 A;  5JDQ A;  4TV9 E;  4EXT A;  3K3O A;  4DMV A;  3JC6 D;  4OHF A;  1T98 A;  2MTQ A;  4UF0 B;  2WM9 A;  3PUS A;  3UFE A;  1Y64 B;  2VKH A;  2IW5 B;  2DLR A;  1FEW A;  2W00 A;  3AA0 B;  3NBX X;  1MND A;  4H9P C;  4HGA A;  3TKL B;  3J7Y q;  3FB2 A;  3GMI A;  2L8K A;  3P7I A;  2XQY A;  3AB3 B;  1NAF A;  1SA0 E;  4GOU A;  4ILU A;  3J9X 1;  2J1D G;  3PU8 A;  1LVK A;  3N5L A;  3N2K E;  4GYS A;  3U3I A;  4HN9 A;  3KBT A;  3F57 A;  3KV6 A;  3ZC1 A;  2EHO B;  2WAU A;  2EHO C;  3N9O A;  2LSK A;  2LOP A;  2V7I A;  2NW8 A;  2VKD A;  2IC6 A;  3ZJ1 A;  5DQV A;  2KMF A;  5FY1 A;  3IF8 B;  1OXZ A;  2KXP B;  3UTK A;  2HPJ A;  2Y6X A;  2N2N A;  1D0Y A;  3C98 B;  5FY0 A;  3W15 B;  4CI3 B;  3PE0 A;  5FXX A;  4QHO A;  3E0Z A;  2PJQ A;  5LGN B;  3N9Q A;  5FXZ A;  3E08 A;  3RRW A;  4UIG A;  4Z8X A;  3UUL A;  3EDV A;  5LHG B;  3CML A;  3ZMS B;  1WYC A;  1H7C A;  5JRC A;  2DHR A;  3DJB A;  2CE7 A;  3ZC0 A;  2NTY A;  2K24 A;  1MMD A;  2KZ7 B;  2LHN A;  3LJC A;  2K5B B;  5L3E B;  4DVD A;  4IHJ E;  2Q9Q B;  5H6Q B;  5L2L A;  4PNI A;  2CA5 A;  2L9Q A;  3R84 B;  3F31 A;  3ZCI A;  2V7K A;  5JQG E;  4HTE A;  2W0G A;  3Q5W A;  4I50 E;  4MAL A;  1BR1 A;  3BQK A;  3H37 A;  4UVA B;  5FY7 A;  5C8Y E;  1G73 A;  3C64 A;  3VKH A;  2CWY A;  3NRX A;  1CUN A;  2D5U A;  3AA1 B;  4IE7 A;  1MMN A;  2ACX A;  4YFS A;  2ES0 A;  2ZM0 A;  5BMV E;  2JRK A;  3CQX C;  4EIW A;  3B57 A;  3RC3 A;  2ODU A;  1WYB A;  4PW8 A;  2W63 A;  3PU3 A;  1YKH B;  4I43 B;  3KFW X;  3ZN0 B;  3HL6 A;  5FNV E;  5DQW A;  5JDG A;  1YKE B;  2E9X D;  2LE8 A;  5CA1 E;  2BVM A;  2DWK A;  2ZMA A;  2XAS B;  2E9X A;  4TZ4 C;  5HXR A;  4CXY A;  4V1A v;  5F8P A;  4DBQ A;  3BQI A;  3RC8 A;  1LKX A;  1US7 B;  2V7M A;  4WNK A;  2LOS A;  3ZEF B;  5LHI B;  4PJJ A;  4DO0 A;  4ZI3 C;  3PUR A;  4CI1 B;  5FXV A;  4H9R C;  5KMG P;  2G0U A;  1UCU A;  2D2S A;  5HXE A;  3QC9 A;  1VOM A;  4ZI7 E;  1D1C A;  2NW9 A;  2ZM8 A;  4OK0 A;  1WR6 A;  2JMK A;  2M67 A;  4EAH A;  5TAO A;  2A3D A;  2N9D A;  3QUJ A;  2VWA A;  2MYS A;  3IHR A;  3Q9D A;  2Y8D A;  3ETU A;  4JUY A;  4PJL A;  2CXF A;  4E7Z A;  2WMO A;  2X67 A;  1AJ3 A;  2RP4 A;  4UV9 B;  4YJ2 E;  4KUM B;  3HI2 A;  4UEM A;  5ADX L;  2VKJ A;  4MLK A;  4O4I E;  2Z6E A;  5EZY E;  3EVY A;  4AKL A;  4I55 E;  5IYZ E;  2W62 A;  3B13 A;  3ZMV B;  2V7L A;  4ANJ A;  4H9O C;  3EDU A;  3AA6 B;  4C90 A;  5LHH B;  2WMN A;  4MHC A;  2EHO D;  2HPL A;  3O4X E;  2K9A A;  2CCQ A;  2EHO A;  3KV5 A;  1ZKE A;  3OKQ A;  5EK3 A;  5IHY A;  3LK2 B;  3AVS A;  4H9Q C;  1YD8 G;  4DND A;  2LEH A;  2XAG B;  4O2B E;  4QKN A;  4QXH B;  1KK7 A;  3MJX A;  4BA9 A;  3ZPO A;  4J2C A;  3N9L A;  2A72 A;  3CVR A;  4E7S A;  2MOZ A;  2HH7 A;  2XTL A;  3CKD A;  3QK6 A;  3OBV E;  5LCY A;  3SWH A;  3P8C D;  2QGS A;  4AKG A;  1X79 A;  5A1L A;  5JR9 A;  1U4Q A;  4PK4 A;  3ZJ2 A;  3K3Q C;  1V9D A;  3HKC E;  3V5U A;  2NWB A;  2SPC A;  3CX8 B;  3Q2M A;  1D1A A;  2QA7 A;  4BJN A;  4C91 A;  4EZH A;  4B6X A;  3KDS E;  4GK5 E;  2PG8 A;  1IJ5 A;  4XZC A;  4O4L E;  3I9Y A;  3H3A A;  1VRB A;  5ETW A;  2BZB A;  2X51 A;  3PUA A;  4WBN E;  2VB6 A;  5KX5 E;  2XAJ B;  3OYX A;  4TV8 E;  2LM9 A;  2Q9Q D;  3K8P C;  2K48 A;  3RRC A;  3NZQ A;  3FXD B;  4NUV A;  2YU1 A;  3HA4 A;  3ZMT B;  1MIY A;  4JEH B;  3RPU A;  5HAX A;  2C0S A;  3U78 A;  1ZEE A;  4AXP A;  3IBP A;  3BQL A;  3KBU A;  3MXZ A;  3NRY A;  5JDN A;  4BAY B;  2KND A;  3ZMZ B;  5HWX A;  3NZP A;  2KIN B;  3RYC E;  1QUU A;  3MAC A;  3ZN1 B;  4IE0 A;  4K0U A;  3RYF E;  2DCF A;  2Q9Q C;  2KWH A;  1D1B A;  2L3L A;  3A5X A;  5DJQ C;  4DMW A;  5HXS A;  4ASK A;  3LK4 2;  4G2A A;  4KP3 C;  4YLH A;  1E1H B;  3AVR A;  4L0R A;  3L3P A;  1ZV4 X;  5E0O A;  1FMV A;  4AQF C;  2H7O A;  2VK9 A;  4CZZ B;  4P0B A;  2X0L B;  4EB6 E;  3ESL A;  5JDL A;  4XAX B;  2ODV A;  3RYI E;  3KVA A;  5GON E;  3IEE A;  3EUH A;  3AAI A;  4ZI3 D;  1UX5 A;  2H3R A;  3I0O A;  4IE6 A;  4KMC A;  2BVL A;  3N9M A;  3N2G E;  3T8O A;  4U74 A;  5DAB A;  2CLY B;  4ISS A;  4ZI2 C;  3MK7 C;  3ANW A;  1HFA A;  2CLY C;  2XAH B;  3RKO A;  5J2U E;  3UUX B;  4ZOL E;  5JRC B;  1HF8 A;  4PFO A;  3N2O A;  1G8X A;  3LBX A;  3WI3 A;  4EYY R;  1MIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...