3ZCJA

Crystal structure of helicobacter pylori t4ss protein cagl in a tetragonal crystal form with a helical rgd-motif (6 mol per asu)
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
211
structure length
187
Chain Sequence
EDITSGLQLDSTYQETNQQVLNLDEIFSTNEMGEEDALNIAAIALRGDLALLANFEANELFFISEDVIFTYMSSPELLLTYMINPLDQNTAEQQCGISDVLVLYCEGLIEQEQNIRERLETSLAYQSNIGGTASLITASQTLVESLNNFIGIRLMLAHNVFLNYLEELDALERSLEQSRQYLQERQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAGL
publication title A Helical Rgd Motif Promoting Cell Adhesion: Crystal Structures of the Helicobacter Pylori Type Iv Secretion System Pilus Protein Cagl
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Protein binding
total genus 71
structure length 187
sequence length 211
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-11-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1660 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3zcjA00
3ZCJA 3ZCIA
chains in the Genus database with same CATH superfamily
1OEDC 2KLQA 1WYCA 3SRZA 4CQIA 2WCAA 3I9WA 4ZZCA 4ZXLA 5CFBA 4DV2T 2WM9A 1LVKA 1MMAA 2BVMA 4X1IE 3AE2A 2H7OA 3FB2A 1S35A 1XMQT 2WAUA 1I6ZA 5LGNB 4UXNB 4EAHA 2BKPA 3MJXA 2E2AA 4O8SA 1GQEA 5L3EB 3ZMTB 3O9XA 1OXZA 3V5UA 4TZ4C 3LG7A 4J2CA 4IHJE 3A7MA 2D5UA 1AJ3A 2VVNA 4DR7T 3I0OA 2XPKA 3ANWB 1FJGT 5JR9A 2BS3A 2EHOD 3AAEB 3ZCJA 2CM0A 2ODVA 1HF8A 3M3ZB 2VKOA 3V5SA 5L3BB 1OEDB 3NVOA 2E9XB 3KFWX 4AKLA 4PW8A 2Q9QA 2WQYA 5LP6E 2W0GA 3AE7A 3ZMUB 2KMFA 2LJLA 4QX8B 1IJ5A 3JCFA 4HGAA 5FYMA 4L9IA 3OTOT 1IBMT 2KT9A 3UFGA 4PNIA 1G73A 4ZEYA 1N33T 1UCUA 2XASB 4YTPA 2MTQA 4HKAA 4YHJA 1MNEA 3P4RA 3Q9DA 3PUXF 4AKRB 3RRCA 2DHRA 2V7MA 1QUUA 3U78A 4QXCB 3N2GE 2V5CA 1N36T 3GMIA 1DU2A 3AEBA 3I9YA 4DO0A 4L0RA 2NTXA 2WSSV 3ANWA 4KHPT 3MACA 4TNVA 3P4QA 3Q5XA 5FMNA 3AA1B 5JDNA 4JI1T 2J4GA 4Z91A 3Q5EA 2A72A 5L2LA 2KXPB 2E9XA 2RP4A 5AQMB 5LMUT 2BS2A 5AQGB 2VQET 2ZMAA 2VASA 3K3NA 5LBMA 3C4WA 2DNXA 5AQPB 5DJQC 4TUYE 3Q5WA 1HNXT 3ZYLA 2WS3A 5ABHA 4LFCT 3RYIE 3KBUA 4X64T 2CBIA 2CWOA 3ZMSB 3OPCA 4U2ZA 4MLKA 5J0ZA 4DV3T 4H9QC 3T1HT 1US7B 5AFUL 5JRCB 4DMVA 4JI7T 3UU8A 4DV6T 2DWKA 3ZC1A 3RC3A 2JQ9A 2AE9A 1UX4A 2E9XD 4JI8T 4AQYT 5JDGA 4K0UA 4C91A 2CMRA 5JDQA 2DLRA 3G06A 4O4IE 5LJNA 1V9DA 1LRZA 4QXHB 2XJ7A 1YKHB 3JAEA 2I6HA 4UIGA 4HWFA 4IDQA 2NR4A 2XAHB 4AKGA 2H7VC 1KK7A 5FL1A 2JMKA 2IAKA 5F5WA 1YW0A 4CN4A 2VK9A 5JDFA 3UTKA 2XQ7A 5HEOA 4IDZA 2H88A 5F8PA 4U72A 4YJ3E 3RYHE 4BJMA 3LDQB 3ONXA 3AE3A 3JAFA 1MIVA 1U5PA 2X51A 5JRCA 2PJQA 3HKBE 3N9QA 2XUEA 2XAQB 4AQGA 3AE8A 5HXEA 2VURA 2CEAA 5HCMA 3TLUA 5CGMA 2WWVA 3VR9A 2VL8A 5JREA 4YSYA 2CRBA 4DR2T 4HFVA 4I4TE 4JI2T 3BQLA 4ZZBA 4TV8E 1D0YA 3D0TA 2BZBA 2KINB 4P1NA 1X9BA 4JI5T 3QUJA 3T1YT 3FZKB 2SPCA 3ONJA 5LG4A 4COFA 4ZI2C 1WRDA 3L09A 3ZSTA 4EZ4A 2L9QA 5L3FB 4NUVA 3B5MA 3DP7A 3P4PA 4AQFA 2Z6EA 2UUAT 5L4EA 3ZYMA 2H3RA 3OBVE 1HG2A 1HNZT 2LT3A 2YOEA 4JI4T 2Y6XA 3N2KE 1FEWA 2ACXA 4YSZA 4UELA 2V6YB 3GA8A 4AI6A 4PK4A 2CXLA 2ZM0A 4TWHA 5JQGE 1D1BA 4CI1B 2CA5A 4U31A 2VKDA 3RIUA 4ZI3D 3C98B 4AKHA 2X68A 2W62A 2XQ5A 5HCJA 2B1EA 3KV9A 3N2OA 1VCSA 2XTLA 4CXXA 2C5KT 2EHOC 3ZC0A 3FBZA 3ZLIA 1U4QA 3EI0A 2NOXA 2OA5A 3ZKRA 3QB5K 2ZLYA 4YFSA 2CHOA 2LRLA 4LF8T 2CBJA 5AQUB 2BDEA 4TWFA 2CE7A 4JV5T 2JJ9A 3PUQA 2K3WA 3R84B 4WBNE 2X67A 2BKOA 3RHWA 2NTYA 3UQ4A 3P4SA 1CUNA 4I0UA 1LVFA 5LXTE 3RRWA 2LSJA 4DNDA 5LOVE 2V6YA 3N9OA 4DR5T 1WCRA 4FJOA 4YSXA 3PUWF 5JR9C 3UQ7A 3FZMB 3HKEE 5F3JA 4X1KE 2OLTA 2JIWA 2X0LB 3C50A 3NZQA 2EHOB 4KX6A 4UEMA 4HFEA 2Q9QC 2P9BA 5KMGP 2B76A 3RC8A 1IBLT 5ABEA 2XAFB 2UUBT 3PU3A 4Q25A 4DR6T 3ZJ1A 4DUYT 5M4YA 3CQCB 2YN6A 2V5DA 4HFIA 2RA1A 1KNPA 2WP9A 1IZNB 4EV6A 4C90A 1MMGA 2JQHA 3OYXA 2VB6A 4AISA 2LM9A 4YJ2E 1KEYA 2XAGB 2XZEA 3PUYF 3H3MA 2JQKA 1N32T 4IDPA 3CKDA 5E0OA 3ZJ2A 3PE0A 2YU1A 1NAFA 3OVUA 5JR9B 2ZM6T 3B57A 4DV5T 2ODUA 1ZEEA 2ES0A 1W9RA 3UULA 1HNWT 4P0AA 4GOUA 2LKHA 3T8OA 3VRBA 3C64A 4IE5A 2J47A 2EHOA 2IDOB 3AEGA 1N34T 2E9XC 2LHRA 3K1SA 2NP9A 1JNRA 1E7PA 2M6BA 3TLSA 5BMVE 2XQYA 2UXDT 1JNZA 4HFHA 1T72A 2X0HA 4H9PC 2QVAA 5DQVA 5LCYA 1T7SA 5LHGB 5HXCA 2PBIA 2PFVA 3RGLA 5FVLA 5L3GB 4LFAT 2MBGA 3NRYA 3FXDB 3OYZA 3AAAB 5CA0E 4LMKA 2K9AA 2A3DA 3IA3A 3ESLA 3KVBA 1Y01A 2WMOA 3SFEA 2L3LA 5J2UE 2UXNB 1MMNA 4PK5A 3DJBA 4X5TA 2CPTA 4M1PA 3JADA 2UXCT 4IIJE 4TNWA 3E0ZA 5HEUA 5HEJA 5LA6E 4CXYA 1B7TA 4KUMB 3F31A 2YU2A 4ILAA 3KV5A 1J5WA 4QX7B 3UU4A 3LK42 2LSGA 1XWMA 5JDMA 4LMJA 3IEEA 3MKDA 3VR8A 2XQ9A 5AQHB 5LGUB 3UFEA 1O3XA 3RQUA 5EK2A 1ZOYA 3LK3B 4ERRA 3RPUA 4CI3B 4H9OC 3E22E 2QGSA 4AXPA 5FY1A 4ZOLE 4BAYB 4IL4A 5ETWA 2WDVA 4UV9B 3ZMZB 2XSBA 2BKNA 4EIWA 5L47A 5HYAA 4EXTA 5AQQB 2I0MA 3AECA 2D0UA 4JUYA 3EAMA 3RLFF 3L8RA 2LHNA 4QKNA 4LF7T 4DV4T 1YD8G 4IE6A 3K8PC 4ISSA 3PDYA 4UVAB 4ZI3C 5C2TA 3PTRB 2W2UA 2MPKA 5LGTB 3H3AA 2V8SV 2C5JA 2FBWA 2WY2A 4KBMB 3L3PA 5H6RB 3AVRA 5J2TE 3ZCIA 1E2AA 2UXBT 1D1AA 4DR4T 3EDUA 2XSAA 4U7YA 4B3MT 4YT0A 4AQFC 2CXDA 2KZ7B 2WB5A 4NPPA 4TN7B 1J5ET 2PG8A 4O2AE 3AEAA 3LFMA 1OWAA 2DL1A 4ZS3A 3ZSSA 4UVCB 2A2FX 2WMNA 3C4XA 4PJLA 4A56A 5LJMA 5HXHA 3RIUC 3LBXB 4PJJA 2XY8B 1UUSA 2J1DG 2LLYA 4KMCA 2K24A 3AE9A 2C0SA 2J62A 2JRKA 1UGOA 4DUZT 3KVAA 5FXXA 1BR1A 3C51A 5KXJA 3UUBA 3EUHA 4JI3T 4IE7A 2UUCT 1FMWA 2WBLA 1MIWA 2WDRA 5AQIB 4FI5A 4DVDA 1VRBA 3VKGA 1M7KA 2X9HA 2D0TA 1HX1B 4NXMT 1ZP0A 2L8KA 1LKXA 2WWUA 5J1GA 3F2EA 2W63A 3R6NA 4ISTA 4JEUB 1SUMB 3CIRA 4U3CA 3LBXA 1YQ4A 2E5LT 3UU5A 4ILCA 3RIFA 1T8BA 4EZHA 3UU6A 4L5GA 3K3QC 3O1JA 3K3OA 1HS7A 2LRKA 2YEVC 4PJNA 2LE8A 1X79A 2HN1A 4H9NC 5ADXL 4BA9A 1WLXA 3UT5E 3CX8B 4GK0E 2Y48B 5IWAT 3N9NA 2W00A 4CI2B 2LOPA 2YK0A 5AQTB 4AKIA 2Y8DA 4HWCA 4UVBB 2PTFA 2X0YA 1HX8A 4QWNB 2HH7A 3FXEB 3VHLA 4UR9A 1NWMX 1QSDA 5FXWA 4DV7T 4XBFB 2JQQA 2QYWA 4EYYR 3HR0A 3CWZB 2DI4A 2YDRA 2E5VA 2FUPA 2W66A 1J1JA 5JVDE 3O1IA 1YQ3A 3TLVA 1D1CA 2G0UA 3HKCE 1E1HB 2IC6A 3RH3A 1UK5A 2UXXB 4KI0F 4OK0A 3TLTA 2XM1A 3P7IA 2CXFA 3F57A 4CXWA 5C8YE 3AA6B 4YY3T 4XAXB 5CB4E 1UURA 2KWIB 4Z8XA 1MIYA 4H63V 3KINB 4PAGA 2AXDS 5HEHA 3U3IA 3VRAA 2F4VT 3J9X1 1KFYA 4JEHB 3BQKA 2HHHT 3O4XE 3UU3A 3AE6A 4A97A 4MALA 2LM2A 3FZHB 4V1Av 5LB7B 3RYCE 1G8XA 4P0BA 4H63H 3AE5A 3NKZA 2BBHA 4UF0B 4IE4A 3H37A 1W0BA 2M6IA 2KNDA 4QXBB 3A5XA 4YTMA 1SA0E 2N2NA 2C5IT 4ZHQE 4U7IA 2XM2A 1HTJF 3ETUA 5ABGA 3PUVF 3I0QA 3RKGA 4QH5A 4X66T 4KHZF 2V6XA 4H9SE 1I94T 3PV0F 2CLYB 1YKEB 2BG9B 3A8YC 4UV8B 2ZM8A 4XZCA 2WZHA 3PJAA 2OV9A 2RPAA 4TV9E 1L0VA 4HWIB 2XQ4A 2N9DA 1H7CA 1VOMA 2HPLA 3W15B 4DBRA 2V7LA 1IAPA 2N1GA 2XQAA 2A9UA 4DR1T 2NWBA 5CJ5A 3ZMVB 2IC9A 1FMVA 4UF0A 3MK7C 1WR0A 4EEBA 4I50E 1YXRA 4HFDA 5AQLB 4EEDA 3Q2MA 3SWHA 1XNQT 2VKJA 4WNKA 2V1DB 2XQ6A 5IUXA 1NEKA 2LKGA 4E7SA 4WYVA 4DV0T 3GN5B 1WFDA 5FP3A 3CPZA 3P4WA 4QH1A 5ABFB 3TKLB 3UUNA 3CX7B 4EGWA 2BG9E 2M67A 5FY0A 4HTEA 3PUZF 3N9LA 2QRXA 1WR6A 5EK3A 1HCIA 1W0AA 2BG9A 4MFRA 3JC6D 4EB6E 4YXDA 4DBQA 3L39A 2YDSA 2YKSA 4IDOA 4O4LE 3AXJA 3RQWA 2XHEB 4JYAT 1XNRT 2V7JA 1XZYA 4EOZB 2YINA 4CN6A 2R6GF 5EZYE 1SHZC 4GKJT 3E08A 3KBTA 3I1AA 2FJAA 2JPFA 5L3DB 1BR0A 4E7ZA 4X65T 2NW7A 3CVRA 2NW8A 4DR3T 3PUAA 3GN5A 3ZEFB 4OHFA 4G2AA 3AEFA 3CK6A 3NZPA 3N5LA 5ABFA 1Z0PA 3AVSA 4A5XA 3BQIA 3HI2A 2V7IA 1D0ZA 4IL9A 2V26A 4GK5E 4EYUA 1MMDA 3LJCA 3EVYA 3Q5DA 3QOFA 5LNKA 3RX6A 2Q9QD 1OEDE 1QLBA 2DWGA 2VWAA 1EZ3A 4GIWA 3FZFB 4CZZB 3PJAJ 1IJ6A 1HR0T 4QH4A 4F8HA 1OEDA 3IHRA 4F6RC 4U74A 2MOZA 3MXZA 4HFCA 3ZN0B 5HAXA 4NXNT 4B6XA 5C3JA 4G63A 1KNZA 3VU7H 3HL6A 3X1DA 3AB3B 1SE7A 1VCTA 4HWDA 4LF4T 2E8IA 1Y64B 5HXRA 2XQ8A 3DTOA 1T98A 5L3CB 3AEDA 1D0XA 4JI0T 4HN9A 3HKDE 5DQWA 1HG5A 3EHZA 4ASKA 2H89A 2K48A 5AQOB 5LHIB 5HWXA 4IDNA 3AAIA 2DCFA 5AQNB 3N9PA 3PURA 5FKYA 5AQKB 2GK9A 5IYZE 2LSYA 1XDPA 4YHHT 2X9WA 5DABA 3P50A 2HPJA 3QB5A 4DV1T 3N9MA 5FXVA 4PFPA 2VKHA 5CA1E 3IF8B 4JLEA 2IIUA 3SS1A 3VKHA 5LYJE 3LSVA 3P8CD 2YDQA 3MZKB 4PK6A 4LF9T 4O2BE 3FBLA 3EDVA 3RF1A 1M62A 3M65A 4B3TT 2WDQA 2IHR1 3CQGB 4GYSA 3NBXX 1WYBA 3PUSA 2FJBA 2IW5B 2FJEA 2VQFT 5LMNT 4B3RT 3RIAA 3NWIA 5TAOA 2X66A 5JDLA 4IT4A 2VVSA 2BBJA 4X20E 2CCQA 4K0KT 4A98A 4ZI7E 2LOSA 3CMLA 2W4XA 2VL0A 3B13A 5FVKA 4H9RC 3TLWA 2I59A 4B3ST 4TWDA 5FL0A 3BK9A 4LMLA 4LF5T 3AE4A 5AQSB 3ABVA 3AE1A 4OFZA 2BS4A 4IE0A 4JI6T 4HWHA 5AQRB 2KWHA 3KDSE 4N78D 4I43B 2WU2A 3AEEA 2ZM2A 3PU8A 2K5BB 4LF6T 3UUMA 2D2SA 2XAJB 5HEGA 2IMLA 1R8IA 4Z90A 1KNRA 5LG3A 1Z8UA 4ADZA 5JTGA 3OJAA 4HFBA 3SOLA 2ACZA 2W67A 3RYFE 3J7Yq 2X9XA 3IBPA 5JH7E 1NENA 1HFAA 4X1YE 4HE8A 4PJMA 3JC6C 4QHOA 4WBOA 2WU5A 3LK2B 2JMHA 4OX9T 3NRXA 4X62T 2MYSA 2WZIA 3AA7B 4I55E 1UX5A 3CX6B 4DMWA 5LHHB 1ZKEA 2D9DA 3O1HA 1S94A 3UUXB 4ILUA 4OYKA 4MBQA 3ETVA 2CHNA 3ZT6A 4AIUA 1BR4A 5H6QB 1KF6A 3WAKA 4MHCA 3PUGA 4WZXA 4P09A 3RKOA 3QNUA 4ILBA 3WI3A 2LSKA 4O4HE 5KX5E 1ZV4X 2V7KA 3MA9A 2CLYC 2MAWA 3ZN1B 2UU9T 2BG9C 3EABA 3GWHA 1BR2A 4DIDB 4IGUA 3ONLC 5AQFB 2XQ3A 5AQJB 3ZT7A 3SFDA 3QK6A 4NIQA 4NUUA 2CWYA 3KV6A 3HA4A 4ANJA 3RI5A 5IHYA 5EK4A 4TX5A 2FJDA 1FIOA 5FXZA 5A1LA 5KDMC 2LSIA 4PFOA 2HN2A 1MNDA 1CHUA 3CQXC 3ZT5A 3FHNA 3WAJA 1IBKT 4O4JE 3AA0B 4CN1A 5GONE 4LFBT 4BJNA 2IUBA 5BR8T 3S4UA 3ZPOA 3ZYKA 5AQVB 4YTNA 5HXSA 5JDHA 2QA7A 4YLHA 2W61A 4ZS2A 5FY7A 4U33A 2NW9A 5FNVE 2LEHA 4WW0A 4KP3C 1XDOA 3OKQA 5LBQB 3FZLB 3AXJB 2BVLA 4U2YA 4GKKT 3QC9A 4HEAA 4IREA 4OYJA 2X9YA 4GYRA 1W09A 1ZHCA 5HWYA 3KV4A 3C4ZA 5L4HA 2KSRA 1XMOT 4JBWF 4ZI2D 2Q9QB
chains in the Genus database with same CATH topology
2BDEA 2CE7A 2D0TA 2KLQA 1WYCA 3SRZA 4CQIA 5LNKA 2JJ9A 3RX6A 2L8KA 3PUQA 3I9WA 2Q9QD 2DWGA 1LKXA 2VWAA 2WM9A 3R84B 1EZ3A 1LVKA 4GIWA 1MMAA 2WWUA 4WBNE 2BVMA 4X1IE 5J1GA 4CZZB 1IJ6A 2X67A 3F2EA 2W63A 3R6NA 4ISTA 2NTYA 4JEUB 2H7OA 1CUNA 3FB2A 3IHRA 1S35A 1LVFA 2WAUA 5LXTE 3LBXA 5LGNB 3RRWA 4UXNB 4F6RC 4EAHA 2LSJA 4DNDA 4U74A 2MOZA 3MXZA 3MJXA 5LOVE 4O8SA 3ZN0B 5HAXA 3N9OA 4B6XA 5L3EB 4FJOA 5JR9C 4EZHA 3HKEE 4L5GA 3ZMTB 5F3JA 3O9XA 3K3QC 1OXZA 4G63A 4TZ4C 3V5UA 3LG7A 4X1KE 3O1JA 4J2CA 1KNZA 3K3OA 3VU7H 2X0LB 3HL6A 4IHJE 2D5UA 3C50A 1AJ3A 1HS7A 3AB3B 2YEVC 4PJNA 2LE8A 3NZQA 2EHOB 1X79A 4UEMA 2E8IA 3I0OA 4H9NC 2Q9QC 3ANWB 2P9BA 1Y64B 5ADXL 5JR9A 4BA9A 5HXRA 2EHOD 1WLXA 5KMGP 3AAEB 3UT5E 3DTOA 3ZCJA 1T98A 3CX8B 5L3CB 4GK0E 2CM0A 2ODVA 3RC8A 1HF8A 2VKOA 2Y48B 1D0XA 3V5SA 5L3BB 3N9NA 4HN9A 2W00A 2E9XB 2XAFB 3HKDE 3KFWX 4PW8A 5DQWA 4AKLA 3PU3A 4CI2B 2LOPA 2YK0A 1HG5A 2Q9QA 3ZJ1A 5LP6E 2W0GA 4ASKA 2K48A 2KMFA 3ZMUB 5LHIB 5M4YA 3CQCB 5HWXA 4AKIA 2LJLA 4QX8B 1IJ5A 3AAIA 2DCFA 4HGAA 2Y8DA 2RA1A 5FYMA 4UVBB 1IZNB 3N9PA 3PURA 4L9IA 4C90A 1MMGA 3OYXA 2VB6A 2GK9A 4YJ2E 2LM9A 5IYZE 2LSYA 1HX8A 4QWNB 2HH7A 3FXEB 3VHLA 2XAGB 1NWMX 1QSDA 2KT9A 5FXWA 2X9WA 5DABA 4PNIA 2HPJA 3CKDA 5E0OA 3ZJ2A 4XBFB 3PE0A 1G73A 2YU1A 1UCUA 2XASB 2JQQA 3N9MA 5FXVA 1NAFA 2MTQA 4EYYR 3HR0A 5JR9B 4HKAA 4YHJA 1MNEA 4PFPA 3Q9DA 2VKHA 3B57A 3CWZB 4AKRB 2DI4A 3RRCA 2DHRA 2V7MA 2ODUA 1QUUA 5CA1E 1ZEEA 3IF8B 4JLEA 5JVDE 4QXCB 3U78A 2ES0A 3N2GE 3O1IA 3SS1A 3GMIA 1D1CA 2G0UA 3HKCE 3UULA 1E1HB 5LYJE 3VKHA 3P8CD 4P0AA 3MZKB 2IC6A 4GOUA 3RH3A 3I9YA 4PK6A 4O2BE 3T8OA 3C64A 3FBLA 3EDVA 4IE5A 4DO0A 2EHOA 2UXXB 4L0RA 2E9XC 2LHRA 2NTXA 4OK0A 3P7IA 2WSSV 3M65A 2NP9A 2CXFA 3ANWA 3MACA 3F57A 4CXWA 3CQGB 5C8YE 5BMVE 3Q5XA 4GYSA 2XQYA 3AA6B 5FMNA 3NBXX 4XAXB 5CB4E 3AA1B 1WYBA 5JDNA 2KWIB 4Z8XA 1MIYA 3PUSA 4H63V 2IW5B 3KINB 2A72A 4PAGA 5L2LA 2KXPB 2E9XA 2RP4A 5TAOA 2X66A 5JDLA 4H9PC 3U3IA 5DQVA 4X20E 2CCQA 5LCYA 3J9X1 2ZMAA 2VASA 4ZI7E 5LHGB 4JEHB 5HXCA 2PBIA 3K3NA 5LBMA 2PFVA 2LOSA 3C4WA 3CMLA 3BQKA 2DNXA 5DJQC 3O4XE 3B13A 4TUYE 3Q5WA 5L3GB 4H9RC 2I59A 3ZYLA 2MBGA 3BK9A 3FXDB 3NRYA 3RYIE 3OYZA 4MALA 3KBUA 3AAAB 4V1Av 3RYCE 2CWOA 5CA0E 3ZMSB 4OFZA 1G8XA 4IE0A 2K9AA 4P0BA 2KWHA 3KDSE 4H63H 2A3DA 3ESLA 3KVBA 2WMOA 4N78D 4MLKA 4I43B 2L3LA 4H9QC 5J2UE 2ZM2A 3PU8A 2K5BB 4UF0B 1US7B 4IE4A 3H37A 2UXNB 5AFUL 3UUMA 5JRCB 4DMVA 1MMNA 2D2SA 2XAJB 3DJBA 4PK5A 2KNDA 4QXBB 3A5XA 4M1PA 2DWKA 3ZC1A 1SA0E 3RC3A 2N2NA 2C5IT 1UX4A 2E9XD 4ZHQE 4IIJE 4ADZA 3E0ZA 3OJAA 1HTJF 3SOLA 5JDGA 5LA6E 3RYFE 3ETUA 4K0UA 4CXYA 4C91A 2CMRA 1B7TA 3I0QA 3J7Yq 5JDQA 2DLRA 2X9XA 4KUMB 4O4IE 5LJNA 3F31A 2YU2A 3IBPA 4H9SE 5JH7E 3KV5A 4QX7B 1V9DA 3LK42 1LRZA 2LSGA 4QXHB 5JDMA 1YKHB 1HFAA 3IEEA 4X1YE 4HE8A 2CLYB 1YKEB 3MKDA 4PJMA 4UIGA 5LGUB 2XAHB 4AKGA 2H7VC 3UFEA 1O3XA 5EK2A 4UV8B 3JC6C 1KK7A 4QHOA 4WBOA 2ZM8A 3LK3B 4XZCA 2JMKA 3LK2B 4ERRA 2JMHA 3RPUA 3NRXA 4CI3B 2IAKA 2MYSA 1YW0A 4H9OC 4TV9E 2VK9A 5JDFA 3AA7B 2QGSA 3E22E 4AXPA 2N9DA 4I55E 5FY1A 3UTKA 4ZOLE 1H7CA 1VOMA 4BAYB 1UX5A 3CX6B 4IDZA 4DMWA 5LHHB 5ETWA 2HPLA 5F8PA 3W15B 4U72A 4DBRA 1ZKEA 2V7LA 1IAPA 2N1GA 3O1HA 4YJ3E 1S94A 4UV9B 2NWBA 3UUXB 3ZMZB 3RYHE 4BJMA 4ILUA 4OYKA 4MBQA 3ZMVB 4EIWA 3ETVA 3ONXA 2IC9A 5HYAA 1FMVA 4UF0A 1BR4A 4EXTA 3MK7C 5H6QB 1MIVA 1U5PA 2X51A 3WAKA 5JRCA 4I50E 4MHCA 3PUGA 2D0UA 4JUYA 2PJQA 3HKBE 3Q2MA 3N9QA 4P09A 2XUEA 3RKOA 2XAQB 3SWHA 2LHNA 4QKNA 4AQGA 2VKJA 4WNKA 2V1DB 3WI3A 2LSKA 5HXEA 4O4HE 1YD8G 5KX5E 2CEAA 1ZV4X 4IE6A 4E7SA 2V7KA 3MA9A 2CLYC 3K8PC 3GN5B 2VL8A 3PDYA 4ISSA 4UVAB 4ZI3C 5JREA 3PTRB 3ZN1B 4HFVA 4I4TE 5FP3A 3CPZA 5LGTB 3H3AA 3BQLA 2C5JA 4KBMB 3TKLB 3GWHA 3UUNA 1BR2A 3L3PA 3CX7B 4IGUA 5H6RB 4TV8E 1D0YA 2M67A 5FY0A 4HTEA 3D0TA 3AVRA 5J2TE 3ZCIA 3N9LA 1D1AA 2BZBA 3EDUA 2KINB 1WR6A 5EK3A 1HCIA 3QUJA 4MFRA 3QK6A 4NUUA 2CWYA 3JC6D 4EB6E 3KV6A 2SPCA 3HA4A 4AQFC 4ANJA 4DBQA 2CXDA 2KZ7B 5LG4A 4ZI2C 5IHYA 1WRDA 4TN7B 5EK4A 2PG8A 4TX5A 4O2AE 3L09A 4O4LE 1FIOA 2L9QA 4EZ4A 5L3FB 4NUVA 3LFMA 5FXZA 5A1LA 2XHEB 1OWAA 4ZS3A 3DP7A 5KDMC 2LSIA 4PFOA 4UVCB 4AQFA 2Z6EA 1MNDA 2A2FX 2V7JA 3CQXC 3ZYMA 2H3RA 3FHNA 4EOZB 3OBVE 3WAJA 4O4JE 1HG2A 2WMNA 2YINA 3AA0B 2LT3A 3C4XA 4PJLA 5GONE 4A56A 5LJMA 5HXHA 2Y6XA 3LBXB 5EZYE 4BJNA 1SHZC 3S4UA 3ZPOA 4PJJA 3N2KE 3ZYKA 1FEWA 2ACXA 5HXSA 2J1DG 3E08A 3KBTA 4UELA 3I1AA 3GA8A 4KMCA 5JDHA 2QA7A 2K24A 4AI6A 4YLHA 2W61A 2JPFA 2C0SA 5L3DB 1BR0A 4PK4A 2CXLA 2JRKA 2ZM0A 5JQGE 4E7ZA 4ZS2A 1D1BA 2NW7A 3CVRA 5FY7A 4CI1B 2CA5A 2NW8A 3PUAA 3GN5A 2NW9A 3ZEFB 2VKDA 3KVAA 4ZI3D 4OHFA 3C98B 4AKHA 5FNVE 4G2AA 2X68A 2W62A 3NZPA 5FXXA 2LEHA 4WW0A 1BR1A 4KP3C 3C51A 3N5LA 3OKQA 5LBQB 1Z0PA 2B1EA 3KV9A 3N2OA 3AVSA 3EUHA 4IE7A 2XTLA 4CXXA 1FMWA 2C5KT 2BVLA 2WBLA 2EHOC 3BQIA 3HI2A 1MIWA 3FBZA 3ZC0A 3QC9A 2V7IA 4HEAA 1D0ZA 3ZLIA 1U4QA 4OYJA 2V26A 2X9YA 2NOXA 4FI5A 4DVDA 4GYRA 1VRBA 3VKGA 4GK5E 1ZHCA 5HWYA 3KV4A 2OA5A 3C4ZA 4EYUA 2ZLYA 4YFSA 1MMDA 4ZI2D 2Q9QB 2X9HA 3LJCA 3EVYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZCJ A;  3ZCI A; 
#chains in the Genus database with same CATH topology
 1OED C;  2KLQ A;  1WYC A;  3SRZ A;  4CQI A;  2WCA A;  3I9W A;  4ZZC A;  4ZXL A;  5CFB A;  4DV2 T;  2WM9 A;  1LVK A;  1MMA A;  2BVM A;  4X1I E;  3AE2 A;  2H7O A;  3FB2 A;  1S35 A;  1XMQ T;  2WAU A;  1I6Z A;  5LGN B;  4UXN B;  4EAH A;  2BKP A;  3MJX A;  2E2A A;  4O8S A;  1GQE A;  5L3E B;  3ZMT B;  3O9X A;  1OXZ A;  3V5U A;  4TZ4 C;  3LG7 A;  4J2C A;  4IHJ E;  3A7M A;  2D5U A;  1AJ3 A;  2VVN A;  4DR7 T;  3I0O A;  2XPK A;  3ANW B;  1FJG T;  5JR9 A;  2BS3 A;  2EHO D;  3AAE B;  3ZCJ A;  2CM0 A;  2ODV A;  1HF8 A;  3M3Z B;  2VKO A;  3V5S A;  5L3B B;  1OED B;  3NVO A;  2E9X B;  3KFW X;  4AKL A;  4PW8 A;  2Q9Q A;  2WQY A;  5LP6 E;  2W0G A;  3AE7 A;  3ZMU B;  2KMF A;  2LJL A;  4QX8 B;  1IJ5 A;  3JCF A;  4HGA A;  5FYM A;  4L9I A;  3OTO T;  1IBM T;  2KT9 A;  3UFG A;  4PNI A;  1G73 A;  4ZEY A;  1N33 T;  1UCU A;  2XAS B;  4YTP A;  2MTQ A;  4HKA A;  4YHJ A;  1MNE A;  3P4R A;  3Q9D A;  3PUX F;  4AKR B;  3RRC A;  2DHR A;  2V7M A;  1QUU A;  3U78 A;  4QXC B;  3N2G E;  2V5C A;  1N36 T;  3GMI A;  1DU2 A;  3AEB A;  3I9Y A;  4DO0 A;  4L0R A;  2NTX A;  2WSS V;  3ANW A;  4KHP T;  3MAC A;  4TNV A;  3P4Q A;  3Q5X A;  5FMN A;  3AA1 B;  5JDN A;  4JI1 T;  2J4G A;  4Z91 A;  3Q5E A;  2A72 A;  5L2L A;  2KXP B;  2E9X A;  2RP4 A;  5AQM B;  5LMU T;  2BS2 A;  5AQG B;  2VQE T;  2ZMA A;  2VAS A;  3K3N A;  5LBM A;  3C4W A;  2DNX A;  5AQP B;  5DJQ C;  4TUY E;  3Q5W A;  1HNX T;  3ZYL A;  2WS3 A;  5ABH A;  4LFC T;  3RYI E;  3KBU A;  4X64 T;  2CBI A;  2CWO A;  3ZMS B;  3OPC A;  4U2Z A;  4MLK A;  5J0Z A;  4DV3 T;  4H9Q C;  3T1H T;  1US7 B;  5AFU L;  5JRC B;  4DMV A;  4JI7 T;  3UU8 A;  4DV6 T;  2DWK A;  3ZC1 A;  3RC3 A;  2JQ9 A;  2AE9 A;  1UX4 A;  2E9X D;  4JI8 T;  4AQY T;  5JDG A;  4K0U A;  4C91 A;  2CMR A;  5JDQ A;  2DLR A;  3G06 A;  4O4I E;  5LJN A;  1V9D A;  1LRZ A;  4QXH B;  2XJ7 A;  1YKH B;  3JAE A;  2I6H A;  4UIG A;  4HWF A;  4IDQ A;  2NR4 A;  2XAH B;  4AKG A;  2H7V C;  1KK7 A;  5FL1 A;  2JMK A;  2IAK A;  5F5W A;  1YW0 A;  4CN4 A;  2VK9 A;  5JDF A;  3UTK A;  2XQ7 A;  5HEO A;  4IDZ A;  2H88 A;  5F8P A;  4U72 A;  4YJ3 E;  3RYH E;  4BJM A;  3LDQ B;  3ONX A;  3AE3 A;  3JAF A;  1MIV A;  1U5P A;  2X51 A;  5JRC A;  2PJQ A;  3HKB E;  3N9Q A;  2XUE A;  2XAQ B;  4AQG A;  3AE8 A;  5HXE A;  2VUR A;  2CEA A;  5HCM A;  3TLU A;  5CGM A;  2WWV A;  3VR9 A;  2VL8 A;  5JRE A;  4YSY A;  2CRB A;  4DR2 T;  4HFV A;  4I4T E;  4JI2 T;  3BQL A;  4ZZB A;  4TV8 E;  1D0Y A;  3D0T A;  2BZB A;  2KIN B;  4P1N A;  1X9B A;  4JI5 T;  3QUJ A;  3T1Y T;  3FZK B;  2SPC A;  3ONJ A;  5LG4 A;  4COF A;  4ZI2 C;  1WRD A;  3L09 A;  3ZST A;  4EZ4 A;  2L9Q A;  5L3F B;  4NUV A;  3B5M A;  3DP7 A;  3P4P A;  4AQF A;  2Z6E A;  2UUA T;  5L4E A;  3ZYM A;  2H3R A;  3OBV E;  1HG2 A;  1HNZ T;  2LT3 A;  2YOE A;  4JI4 T;  2Y6X A;  3N2K E;  1FEW A;  2ACX A;  4YSZ A;  4UEL A;  2V6Y B;  3GA8 A;  4AI6 A;  4PK4 A;  2CXL A;  2ZM0 A;  4TWH A;  5JQG E;  1D1B A;  4CI1 B;  2CA5 A;  4U31 A;  2VKD A;  3RIU A;  4ZI3 D;  3C98 B;  4AKH A;  2X68 A;  2W62 A;  2XQ5 A;  5HCJ A;  2B1E A;  3KV9 A;  3N2O A;  1VCS A;  2XTL A;  4CXX A;  2C5K T;  2EHO C;  3ZC0 A;  3FBZ A;  3ZLI A;  1U4Q A;  3EI0 A;  2NOX A;  2OA5 A;  3ZKR A;  3QB5 K;  2ZLY A;  4YFS A;  2CHO A;  2LRL A;  4LF8 T;  2CBJ A;  5AQU B;  2BDE A;  4TWF A;  2CE7 A;  4JV5 T;  2JJ9 A;  3PUQ A;  2K3W A;  3R84 B;  4WBN E;  2X67 A;  2BKO A;  3RHW A;  2NTY A;  3UQ4 A;  3P4S A;  1CUN A;  4I0U A;  1LVF A;  5LXT E;  3RRW A;  2LSJ A;  4DND A;  5LOV E;  2V6Y A;  3N9O A;  4DR5 T;  1WCR A;  4FJO A;  4YSX A;  3PUW F;  5JR9 C;  3UQ7 A;  3FZM B;  3HKE E;  5F3J A;  4X1K E;  2OLT A;  2JIW A;  2X0L B;  3C50 A;  3NZQ A;  2EHO B;  4KX6 A;  4UEM A;  4HFE A;  2Q9Q C;  2P9B A;  5KMG P;  2B76 A;  3RC8 A;  1IBL T;  5ABE A;  2XAF B;  2UUB T;  3PU3 A;  4Q25 A;  4DR6 T;  3ZJ1 A;  4DUY T;  5M4Y A;  3CQC B;  2YN6 A;  2V5D A;  4HFI A;  2RA1 A;  1KNP A;  2WP9 A;  1IZN B;  4EV6 A;  4C90 A;  1MMG A;  2JQH A;  3OYX A;  2VB6 A;  4AIS A;  2LM9 A;  4YJ2 E;  1KEY A;  2XAG B;  2XZE A;  3PUY F;  3H3M A;  2JQK A;  1N32 T;  4IDP A;  3CKD A;  5E0O A;  3ZJ2 A;  3PE0 A;  2YU1 A;  1NAF A;  3OVU A;  5JR9 B;  2ZM6 T;  3B57 A;  4DV5 T;  2ODU A;  1ZEE A;  2ES0 A;  1W9R A;  3UUL A;  1HNW T;  4P0A A;  4GOU A;  2LKH A;  3T8O A;  3VRB A;  3C64 A;  4IE5 A;  2J47 A;  2EHO A;  2IDO B;  3AEG A;  1N34 T;  2E9X C;  2LHR A;  3K1S A;  2NP9 A;  1JNR A;  1E7P A;  2M6B A;  3TLS A;  5BMV E;  2XQY A;  2UXD T;  1JNZ A;  4HFH A;  1T72 A;  2X0H A;  4H9P C;  2QVA A;  5DQV A;  5LCY A;  1T7S A;  5LHG B;  5HXC A;  2PBI A;  2PFV A;  3RGL A;  5FVL A;  5L3G B;  4LFA T;  2MBG A;  3NRY A;  3FXD B;  3OYZ A;  3AAA B;  5CA0 E;  4LMK A;  2K9A A;  2A3D A;  3IA3 A;  3ESL A;  3KVB A;  1Y01 A;  2WMO A;  3SFE A;  2L3L A;  5J2U E;  2UXN B;  1MMN A;  4PK5 A;  3DJB A;  4X5T A;  2CPT A;  4M1P A;  3JAD A;  2UXC T;  4IIJ E;  4TNW A;  3E0Z A;  5HEU A;  5HEJ A;  5LA6 E;  4CXY A;  1B7T A;  4KUM B;  3F31 A;  2YU2 A;  4ILA A;  3KV5 A;  1J5W A;  4QX7 B;  3UU4 A;  3LK4 2;  2LSG A;  1XWM A;  5JDM A;  4LMJ A;  3IEE A;  3MKD A;  3VR8 A;  2XQ9 A;  5AQH B;  5LGU B;  3UFE A;  1O3X A;  3RQU A;  5EK2 A;  1ZOY A;  3LK3 B;  4ERR A;  3RPU A;  4CI3 B;  4H9O C;  3E22 E;  2QGS A;  4AXP A;  5FY1 A;  4ZOL E;  4BAY B;  4IL4 A;  5ETW A;  2WDV A;  4UV9 B;  3ZMZ B;  2XSB A;  2BKN A;  4EIW A;  5L47 A;  5HYA A;  4EXT A;  5AQQ B;  2I0M A;  3AEC A;  2D0U A;  4JUY A;  3EAM A;  3RLF F;  3L8R A;  2LHN A;  4QKN A;  4LF7 T;  4DV4 T;  1YD8 G;  4IE6 A;  3K8P C;  4ISS A;  3PDY A;  4UVA B;  4ZI3 C;  5C2T A;  3PTR B;  2W2U A;  2MPK A;  5LGT B;  3H3A A;  2V8S V;  2C5J A;  2FBW A;  2WY2 A;  4KBM B;  3L3P A;  5H6R B;  3AVR A;  5J2T E;  3ZCI A;  1E2A A;  2UXB T;  1D1A A;  4DR4 T;  3EDU A;  2XSA A;  4U7Y A;  4B3M T;  4YT0 A;  4AQF C;  2CXD A;  2KZ7 B;  2WB5 A;  4NPP A;  4TN7 B;  1J5E T;  2PG8 A;  4O2A E;  3AEA A;  3LFM A;  1OWA A;  2DL1 A;  4ZS3 A;  3ZSS A;  4UVC B;  2A2F X;  2WMN A;  3C4X A;  4PJL A;  4A56 A;  5LJM A;  5HXH A;  3RIU C;  3LBX B;  4PJJ A;  2XY8 B;  1UUS A;  2J1D G;  2LLY A;  4KMC A;  2K24 A;  3AE9 A;  2C0S A;  2J62 A;  2JRK A;  1UGO A;  4DUZ T;  3KVA A;  5FXX A;  1BR1 A;  3C51 A;  5KXJ A;  3UUB A;  3EUH A;  4JI3 T;  4IE7 A;  2UUC T;  1FMW A;  2WBL A;  1MIW A;  2WDR A;  5AQI B;  4FI5 A;  4DVD A;  1VRB A;  3VKG A;  1M7K A;  2X9H A;  2D0T A;  1HX1 B;  4NXM T;  1ZP0 A;  2L8K A;  1LKX A;  2WWU A;  5J1G A;  3F2E A;  2W63 A;  3R6N A;  4IST A;  4JEU B;  1SUM B;  3CIR A;  4U3C A;  3LBX A;  1YQ4 A;  2E5L T;  3UU5 A;  4ILC A;  3RIF A;  1T8B A;  4EZH A;  3UU6 A;  4L5G A;  3K3Q C;  3O1J A;  3K3O A;  1HS7 A;  2LRK A;  2YEV C;  4PJN A;  2LE8 A;  1X79 A;  2HN1 A;  4H9N C;  5ADX L;  4BA9 A;  1WLX A;  3UT5 E;  3CX8 B;  4GK0 E;  2Y48 B;  5IWA T;  3N9N A;  2W00 A;  4CI2 B;  2LOP A;  2YK0 A;  5AQT B;  4AKI A;  2Y8D A;  4HWC A;  4UVB B;  2PTF A;  2X0Y A;  1HX8 A;  4QWN B;  2HH7 A;  3FXE B;  3VHL A;  4UR9 A;  1NWM X;  1QSD A;  5FXW A;  4DV7 T;  4XBF B;  2JQQ A;  2QYW A;  4EYY R;  3HR0 A;  3CWZ B;  2DI4 A;  2YDR A;  2E5V A;  2FUP A;  2W66 A;  1J1J A;  5JVD E;  3O1I A;  1YQ3 A;  3TLV A;  1D1C A;  2G0U A;  3HKC E;  1E1H B;  2IC6 A;  3RH3 A;  1UK5 A;  2UXX B;  4KI0 F;  4OK0 A;  3TLT A;  2XM1 A;  3P7I A;  2CXF A;  3F57 A;  4CXW A;  5C8Y E;  3AA6 B;  4YY3 T;  4XAX B;  5CB4 E;  1UUR A;  2KWI B;  4Z8X A;  1MIY A;  4H63 V;  3KIN B;  4PAG A;  2AXD S;  5HEH A;  3U3I A;  3VRA A;  2F4V T;  3J9X 1;  1KFY A;  4JEH B;  3BQK A;  2HHH T;  3O4X E;  3UU3 A;  3AE6 A;  4A97 A;  4MAL A;  2LM2 A;  3FZH B;  4V1A v;  5LB7 B;  3RYC E;  1G8X A;  4P0B A;  4H63 H;  3AE5 A;  3NKZ A;  2BBH A;  4UF0 B;  4IE4 A;  3H37 A;  1W0B A;  2M6I A;  2KND A;  4QXB B;  3A5X A;  4YTM A;  1SA0 E;  2N2N A;  2C5I T;  4ZHQ E;  4U7I A;  2XM2 A;  1HTJ F;  3ETU A;  5ABG A;  3PUV F;  3I0Q A;  3RKG A;  4QH5 A;  4X66 T;  4KHZ F;  2V6X A;  4H9S E;  1I94 T;  3PV0 F;  2CLY B;  1YKE B;  2BG9 B;  3A8Y C;  4UV8 B;  2ZM8 A;  4XZC A;  2WZH A;  3PJA A;  2OV9 A;  2RPA A;  4TV9 E;  1L0V A;  4HWI B;  2XQ4 A;  2N9D A;  1H7C A;  1VOM A;  2HPL A;  3W15 B;  4DBR A;  2V7L A;  1IAP A;  2N1G A;  2XQA A;  2A9U A;  4DR1 T;  2NWB A;  5CJ5 A;  3ZMV B;  2IC9 A;  1FMV A;  4UF0 A;  3MK7 C;  1WR0 A;  4EEB A;  4I50 E;  1YXR A;  4HFD A;  5AQL B;  4EED A;  3Q2M A;  3SWH A;  1XNQ T;  2VKJ A;  4WNK A;  2V1D B;  2XQ6 A;  5IUX A;  1NEK A;  2LKG A;  4E7S A;  4WYV A;  4DV0 T;  3GN5 B;  1WFD A;  5FP3 A;  3CPZ A;  3P4W A;  4QH1 A;  5ABF B;  3TKL B;  3UUN A;  3CX7 B;  4EGW A;  2BG9 E;  2M67 A;  5FY0 A;  4HTE A;  3PUZ F;  3N9L A;  2QRX A;  1WR6 A;  5EK3 A;  1HCI A;  1W0A A;  2BG9 A;  4MFR A;  3JC6 D;  4EB6 E;  4YXD A;  4DBQ A;  3L39 A;  2YDS A;  2YKS A;  4IDO A;  4O4L E;  3AXJ A;  3RQW A;  2XHE B;  4JYA T;  1XNR T;  2V7J A;  1XZY A;  4EOZ B;  2YIN A;  4CN6 A;  2R6G F;  5EZY E;  1SHZ C;  4GKJ T;  3E08 A;  3KBT A;  3I1A A;  2FJA A;  2JPF A;  5L3D B;  1BR0 A;  4E7Z A;  4X65 T;  2NW7 A;  3CVR A;  2NW8 A;  4DR3 T;  3PUA A;  3GN5 A;  3ZEF B;  4OHF A;  4G2A A;  3AEF A;  3CK6 A;  3NZP A;  3N5L A;  5ABF A;  1Z0P A;  3AVS A;  4A5X A;  3BQI A;  3HI2 A;  2V7I A;  1D0Z A;  4IL9 A;  2V26 A;  4GK5 E;  4EYU A;  1MMD A;  3LJC A;  3EVY A;  3Q5D A;  3QOF A;  5LNK A;  3RX6 A;  2Q9Q D;  1OED E;  1QLB A;  2DWG A;  2VWA A;  1EZ3 A;  4GIW A;  3FZF B;  4CZZ B;  3PJA J;  1IJ6 A;  1HR0 T;  4QH4 A;  4F8H A;  1OED A;  3IHR A;  4F6R C;  4U74 A;  2MOZ A;  3MXZ A;  4HFC A;  3ZN0 B;  5HAX A;  4NXN T;  4B6X A;  5C3J A;  4G63 A;  1KNZ A;  3VU7 H;  3HL6 A;  3X1D A;  3AB3 B;  1SE7 A;  1VCT A;  4HWD A;  4LF4 T;  2E8I A;  1Y64 B;  5HXR A;  2XQ8 A;  3DTO A;  1T98 A;  5L3C B;  3AED A;  1D0X A;  4JI0 T;  4HN9 A;  3HKD E;  5DQW A;  1HG5 A;  3EHZ A;  4ASK A;  2H89 A;  2K48 A;  5AQO B;  5LHI B;  5HWX A;  4IDN A;  3AAI A;  2DCF A;  5AQN B;  3N9P A;  3PUR A;  5FKY A;  5AQK B;  2GK9 A;  5IYZ E;  2LSY A;  1XDP A;  4YHH T;  2X9W A;  5DAB A;  3P50 A;  2HPJ A;  3QB5 A;  4DV1 T;  3N9M A;  5FXV A;  4PFP A;  2VKH A;  5CA1 E;  3IF8 B;  4JLE A;  2IIU A;  3SS1 A;  3VKH A;  5LYJ E;  3LSV A;  3P8C D;  2YDQ A;  3MZK B;  4PK6 A;  4LF9 T;  4O2B E;  3FBL A;  3EDV A;  3RF1 A;  1M62 A;  3M65 A;  4B3T T;  2WDQ A;  2IHR 1;  3CQG B;  4GYS A;  3NBX X;  1WYB A;  3PUS A;  2FJB A;  2IW5 B;  2FJE A;  2VQF T;  5LMN T;  4B3R T;  3RIA A;  3NWI A;  5TAO A;  2X66 A;  5JDL A;  4IT4 A;  2VVS A;  2BBJ A;  4X20 E;  2CCQ A;  4K0K T;  4A98 A;  4ZI7 E;  2LOS A;  3CML A;  2W4X A;  2VL0 A;  3B13 A;  5FVK A;  4H9R C;  3TLW A;  2I59 A;  4B3S T;  4TWD A;  5FL0 A;  3BK9 A;  4LML A;  4LF5 T;  3AE4 A;  5AQS B;  3ABV A;  3AE1 A;  4OFZ A;  2BS4 A;  4IE0 A;  4JI6 T;  4HWH A;  5AQR B;  2KWH A;  3KDS E;  4N78 D;  4I43 B;  2WU2 A;  3AEE A;  2ZM2 A;  3PU8 A;  2K5B B;  4LF6 T;  3UUM A;  2D2S A;  2XAJ B;  5HEG A;  2IML A;  1R8I A;  4Z90 A;  1KNR A;  5LG3 A;  1Z8U A;  4ADZ A;  5JTG A;  3OJA A;  4HFB A;  3SOL A;  2ACZ A;  2W67 A;  3RYF E;  3J7Y q;  2X9X A;  3IBP A;  5JH7 E;  1NEN A;  1HFA A;  4X1Y E;  4HE8 A;  4PJM A;  3JC6 C;  4QHO A;  4WBO A;  2WU5 A;  3LK2 B;  2JMH A;  4OX9 T;  3NRX A;  4X62 T;  2MYS A;  2WZI A;  3AA7 B;  4I55 E;  1UX5 A;  3CX6 B;  4DMW A;  5LHH B;  1ZKE A;  2D9D A;  3O1H A;  1S94 A;  3UUX B;  4ILU A;  4OYK A;  4MBQ A;  3ETV A;  2CHN A;  3ZT6 A;  4AIU A;  1BR4 A;  5H6Q B;  1KF6 A;  3WAK A;  4MHC A;  3PUG A;  4WZX A;  4P09 A;  3RKO A;  3QNU A;  4ILB A;  3WI3 A;  2LSK A;  4O4H E;  5KX5 E;  1ZV4 X;  2V7K A;  3MA9 A;  2CLY C;  2MAW A;  3ZN1 B;  2UU9 T;  2BG9 C;  3EAB A;  3GWH A;  1BR2 A;  4DID B;  4IGU A;  3ONL C;  5AQF B;  2XQ3 A;  5AQJ B;  3ZT7 A;  3SFD A;  3QK6 A;  4NIQ A;  4NUU A;  2CWY A;  3KV6 A;  3HA4 A;  4ANJ A;  3RI5 A;  5IHY A;  5EK4 A;  4TX5 A;  2FJD A;  1FIO A;  5FXZ A;  5A1L A;  5KDM C;  2LSI A;  4PFO A;  2HN2 A;  1MND A;  1CHU A;  3CQX C;  3ZT5 A;  3FHN A;  3WAJ A;  1IBK T;  4O4J E;  3AA0 B;  4CN1 A;  5GON E;  4LFB T;  4BJN A;  2IUB A;  5BR8 T;  3S4U A;  3ZPO A;  3ZYK A;  5AQV B;  4YTN A;  5HXS A;  5JDH A;  2QA7 A;  4YLH A;  2W61 A;  4ZS2 A;  5FY7 A;  4U33 A;  2NW9 A;  5FNV E;  2LEH A;  4WW0 A;  4KP3 C;  1XDO A;  3OKQ A;  5LBQ B;  3FZL B;  3AXJ B;  2BVL A;  4U2Y A;  4GKK T;  3QC9 A;  4HEA A;  4IRE A;  4OYJ A;  2X9Y A;  4GYR A;  1W09 A;  1ZHC A;  5HWY A;  3KV4 A;  3C4Z A;  5L4H A;  2KSR A;  1XMO T;  4JBW F;  4ZI2 D;  2Q9Q B; 
#chains in the Genus database with same CATH homology
 2BDE A;  2CE7 A;  2D0T A;  2KLQ A;  1WYC A;  3SRZ A;  4CQI A;  5LNK A;  2JJ9 A;  3RX6 A;  2L8K A;  3PUQ A;  3I9W A;  2Q9Q D;  2DWG A;  1LKX A;  2VWA A;  2WM9 A;  3R84 B;  1EZ3 A;  1LVK A;  4GIW A;  1MMA A;  2WWU A;  4WBN E;  2BVM A;  4X1I E;  5J1G A;  4CZZ B;  1IJ6 A;  2X67 A;  3F2E A;  2W63 A;  3R6N A;  4IST A;  2NTY A;  4JEU B;  2H7O A;  1CUN A;  3FB2 A;  3IHR A;  1S35 A;  1LVF A;  2WAU A;  5LXT E;  3LBX A;  5LGN B;  3RRW A;  4UXN B;  4F6R C;  4EAH A;  2LSJ A;  4DND A;  4U74 A;  2MOZ A;  3MXZ A;  3MJX A;  5LOV E;  4O8S A;  3ZN0 B;  5HAX A;  3N9O A;  4B6X A;  5L3E B;  4FJO A;  5JR9 C;  4EZH A;  3HKE E;  4L5G A;  3ZMT B;  5F3J A;  3O9X A;  3K3Q C;  1OXZ A;  4G63 A;  4TZ4 C;  3V5U A;  3LG7 A;  4X1K E;  3O1J A;  4J2C A;  1KNZ A;  3K3O A;  3VU7 H;  2X0L B;  3HL6 A;  4IHJ E;  2D5U A;  3C50 A;  1AJ3 A;  1HS7 A;  3AB3 B;  2YEV C;  4PJN A;  2LE8 A;  3NZQ A;  2EHO B;  1X79 A;  4UEM A;  2E8I A;  3I0O A;  4H9N C;  2Q9Q C;  3ANW B;  2P9B A;  1Y64 B;  5ADX L;  5JR9 A;  4BA9 A;  5HXR A;  2EHO D;  1WLX A;  5KMG P;  3AAE B;  3UT5 E;  3DTO A;  3ZCJ A;  1T98 A;  3CX8 B;  5L3C B;  4GK0 E;  2CM0 A;  2ODV A;  3RC8 A;  1HF8 A;  2VKO A;  2Y48 B;  1D0X A;  3V5S A;  5L3B B;  3N9N A;  4HN9 A;  2W00 A;  2E9X B;  2XAF B;  3HKD E;  3KFW X;  4PW8 A;  5DQW A;  4AKL A;  3PU3 A;  4CI2 B;  2LOP A;  2YK0 A;  1HG5 A;  2Q9Q A;  3ZJ1 A;  5LP6 E;  2W0G A;  4ASK A;  2K48 A;  2KMF A;  3ZMU B;  5LHI B;  5M4Y A;  3CQC B;  5HWX A;  4AKI A;  2LJL A;  4QX8 B;  1IJ5 A;  3AAI A;  2DCF A;  4HGA A;  2Y8D A;  2RA1 A;  5FYM A;  4UVB B;  1IZN B;  3N9P A;  3PUR A;  4L9I A;  4C90 A;  1MMG A;  3OYX A;  2VB6 A;  2GK9 A;  4YJ2 E;  2LM9 A;  5IYZ E;  2LSY A;  1HX8 A;  4QWN B;  2HH7 A;  3FXE B;  3VHL A;  2XAG B;  1NWM X;  1QSD A;  2KT9 A;  5FXW A;  2X9W A;  5DAB A;  4PNI A;  2HPJ A;  3CKD A;  5E0O A;  3ZJ2 A;  4XBF B;  3PE0 A;  1G73 A;  2YU1 A;  1UCU A;  2XAS B;  2JQQ A;  3N9M A;  5FXV A;  1NAF A;  2MTQ A;  4EYY R;  3HR0 A;  5JR9 B;  4HKA A;  4YHJ A;  1MNE A;  4PFP A;  3Q9D A;  2VKH A;  3B57 A;  3CWZ B;  4AKR B;  2DI4 A;  3RRC A;  2DHR A;  2V7M A;  2ODU A;  1QUU A;  5CA1 E;  1ZEE A;  3IF8 B;  4JLE A;  5JVD E;  4QXC B;  3U78 A;  2ES0 A;  3N2G E;  3O1I A;  3SS1 A;  3GMI A;  1D1C A;  2G0U A;  3HKC E;  3UUL A;  1E1H B;  5LYJ E;  3VKH A;  3P8C D;  4P0A A;  3MZK B;  2IC6 A;  4GOU A;  3RH3 A;  3I9Y A;  4PK6 A;  4O2B E;  3T8O A;  3C64 A;  3FBL A;  3EDV A;  4IE5 A;  4DO0 A;  2EHO A;  2UXX B;  4L0R A;  2E9X C;  2LHR A;  2NTX A;  4OK0 A;  3P7I A;  2WSS V;  3M65 A;  2NP9 A;  2CXF A;  3ANW A;  3MAC A;  3F57 A;  4CXW A;  3CQG B;  5C8Y E;  5BMV E;  3Q5X A;  4GYS A;  2XQY A;  3AA6 B;  5FMN A;  3NBX X;  4XAX B;  5CB4 E;  3AA1 B;  1WYB A;  5JDN A;  2KWI B;  4Z8X A;  1MIY A;  3PUS A;  4H63 V;  2IW5 B;  3KIN B;  2A72 A;  4PAG A;  5L2L A;  2KXP B;  2E9X A;  2RP4 A;  5TAO A;  2X66 A;  5JDL A;  4H9P C;  3U3I A;  5DQV A;  4X20 E;  2CCQ A;  5LCY A;  3J9X 1;  2ZMA A;  2VAS A;  4ZI7 E;  5LHG B;  4JEH B;  5HXC A;  2PBI A;  3K3N A;  5LBM A;  2PFV A;  2LOS A;  3C4W A;  3CML A;  3BQK A;  2DNX A;  5DJQ C;  3O4X E;  3B13 A;  4TUY E;  3Q5W A;  5L3G B;  4H9R C;  2I59 A;  3ZYL A;  2MBG A;  3BK9 A;  3FXD B;  3NRY A;  3RYI E;  3OYZ A;  4MAL A;  3KBU A;  3AAA B;  4V1A v;  3RYC E;  2CWO A;  5CA0 E;  3ZMS B;  4OFZ A;  1G8X A;  4IE0 A;  2K9A A;  4P0B A;  2KWH A;  3KDS E;  4H63 H;  2A3D A;  3ESL A;  3KVB A;  2WMO A;  4N78 D;  4MLK A;  4I43 B;  2L3L A;  4H9Q C;  5J2U E;  2ZM2 A;  3PU8 A;  2K5B B;  4UF0 B;  1US7 B;  4IE4 A;  3H37 A;  2UXN B;  5AFU L;  3UUM A;  5JRC B;  4DMV A;  1MMN A;  2D2S A;  2XAJ B;  3DJB A;  4PK5 A;  2KND A;  4QXB B;  3A5X A;  4M1P A;  2DWK A;  3ZC1 A;  1SA0 E;  3RC3 A;  2N2N A;  2C5I T;  1UX4 A;  2E9X D;  4ZHQ E;  4IIJ E;  4ADZ A;  3E0Z A;  3OJA A;  1HTJ F;  3SOL A;  5JDG A;  5LA6 E;  3RYF E;  3ETU A;  4K0U A;  4CXY A;  4C91 A;  2CMR A;  1B7T A;  3I0Q A;  3J7Y q;  5JDQ A;  2DLR A;  2X9X A;  4KUM B;  4O4I E;  5LJN A;  3F31 A;  2YU2 A;  3IBP A;  4H9S E;  5JH7 E;  3KV5 A;  4QX7 B;  1V9D A;  3LK4 2;  1LRZ A;  2LSG A;  4QXH B;  5JDM A;  1YKH B;  1HFA A;  3IEE A;  4X1Y E;  4HE8 A;  2CLY B;  1YKE B;  3MKD A;  4PJM A;  4UIG A;  5LGU B;  2XAH B;  4AKG A;  2H7V C;  3UFE A;  1O3X A;  5EK2 A;  4UV8 B;  3JC6 C;  1KK7 A;  4QHO A;  4WBO A;  2ZM8 A;  3LK3 B;  4XZC A;  2JMK A;  3LK2 B;  4ERR A;  2JMH A;  3RPU A;  3NRX A;  4CI3 B;  2IAK A;  2MYS A;  1YW0 A;  4H9O C;  4TV9 E;  2VK9 A;  5JDF A;  3AA7 B;  2QGS A;  3E22 E;  4AXP A;  2N9D A;  4I55 E;  5FY1 A;  3UTK A;  4ZOL E;  1H7C A;  1VOM A;  4BAY B;  1UX5 A;  3CX6 B;  4IDZ A;  4DMW A;  5LHH B;  5ETW A;  2HPL A;  5F8P A;  3W15 B;  4U72 A;  4DBR A;  1ZKE A;  2V7L A;  1IAP A;  2N1G A;  3O1H A;  4YJ3 E;  1S94 A;  4UV9 B;  2NWB A;  3UUX B;  3ZMZ B;  3RYH E;  4BJM A;  4ILU A;  4OYK A;  4MBQ A;  3ZMV B;  4EIW A;  3ETV A;  3ONX A;  2IC9 A;  5HYA A;  1FMV A;  4UF0 A;  1BR4 A;  4EXT A;  3MK7 C;  5H6Q B;  1MIV A;  1U5P A;  2X51 A;  3WAK A;  5JRC A;  4I50 E;  4MHC A;  3PUG A;  2D0U A;  4JUY A;  2PJQ A;  3HKB E;  3Q2M A;  3N9Q A;  4P09 A;  2XUE A;  3RKO A;  2XAQ B;  3SWH A;  2LHN A;  4QKN A;  4AQG A;  2VKJ A;  4WNK A;  2V1D B;  3WI3 A;  2LSK A;  5HXE A;  4O4H E;  1YD8 G;  5KX5 E;  2CEA A;  1ZV4 X;  4IE6 A;  4E7S A;  2V7K A;  3MA9 A;  2CLY C;  3K8P C;  3GN5 B;  2VL8 A;  3PDY A;  4ISS A;  4UVA B;  4ZI3 C;  5JRE A;  3PTR B;  3ZN1 B;  4HFV A;  4I4T E;  5FP3 A;  3CPZ A;  5LGT B;  3H3A A;  3BQL A;  2C5J A;  4KBM B;  3TKL B;  3GWH A;  3UUN A;  1BR2 A;  3L3P A;  3CX7 B;  4IGU A;  5H6R B;  4TV8 E;  1D0Y A;  2M67 A;  5FY0 A;  4HTE A;  3D0T A;  3AVR A;  5J2T E;  3ZCI A;  3N9L A;  1D1A A;  2BZB A;  3EDU A;  2KIN B;  1WR6 A;  5EK3 A;  1HCI A;  3QUJ A;  4MFR A;  3QK6 A;  4NUU A;  2CWY A;  3JC6 D;  4EB6 E;  3KV6 A;  2SPC A;  3HA4 A;  4AQF C;  4ANJ A;  4DBQ A;  2CXD A;  2KZ7 B;  5LG4 A;  4ZI2 C;  5IHY A;  1WRD A;  4TN7 B;  5EK4 A;  2PG8 A;  4TX5 A;  4O2A E;  3L09 A;  4O4L E;  1FIO A;  2L9Q A;  4EZ4 A;  5L3F B;  4NUV A;  3LFM A;  5FXZ A;  5A1L A;  2XHE B;  1OWA A;  4ZS3 A;  3DP7 A;  5KDM C;  2LSI A;  4PFO A;  4UVC B;  4AQF A;  2Z6E A;  1MND A;  2A2F X;  2V7J A;  3CQX C;  3ZYM A;  2H3R A;  3FHN A;  4EOZ B;  3OBV E;  3WAJ A;  4O4J E;  1HG2 A;  2WMN A;  2YIN A;  3AA0 B;  2LT3 A;  3C4X A;  4PJL A;  5GON E;  4A56 A;  5LJM A;  5HXH A;  2Y6X A;  3LBX B;  5EZY E;  4BJN A;  1SHZ C;  3S4U A;  3ZPO A;  4PJJ A;  3N2K E;  3ZYK A;  1FEW A;  2ACX A;  5HXS A;  2J1D G;  3E08 A;  3KBT A;  4UEL A;  3I1A A;  3GA8 A;  4KMC A;  5JDH A;  2QA7 A;  2K24 A;  4AI6 A;  4YLH A;  2W61 A;  2JPF A;  2C0S A;  5L3D B;  1BR0 A;  4PK4 A;  2CXL A;  2JRK A;  2ZM0 A;  5JQG E;  4E7Z A;  4ZS2 A;  1D1B A;  2NW7 A;  3CVR A;  5FY7 A;  4CI1 B;  2CA5 A;  2NW8 A;  3PUA A;  3GN5 A;  2NW9 A;  3ZEF B;  2VKD A;  3KVA A;  4ZI3 D;  4OHF A;  3C98 B;  4AKH A;  5FNV E;  4G2A A;  2X68 A;  2W62 A;  3NZP A;  5FXX A;  2LEH A;  4WW0 A;  1BR1 A;  4KP3 C;  3C51 A;  3N5L A;  3OKQ A;  5LBQ B;  1Z0P A;  2B1E A;  3KV9 A;  3N2O A;  3AVS A;  3EUH A;  4IE7 A;  2XTL A;  4CXX A;  1FMW A;  2C5K T;  2BVL A;  2WBL A;  2EHO C;  3BQI A;  3HI2 A;  1MIW A;  3FBZ A;  3ZC0 A;  3QC9 A;  2V7I A;  4HEA A;  1D0Z A;  3ZLI A;  1U4Q A;  4OYJ A;  2V26 A;  2X9Y A;  2NOX A;  4FI5 A;  4DVD A;  4GYR A;  1VRB A;  3VKG A;  4GK5 E;  1ZHC A;  5HWY A;  3KV4 A;  2OA5 A;  3C4Z A;  4EYU A;  2ZLY A;  4YFS A;  1MMD A;  4ZI2 D;  2Q9Q B;  2X9H A;  3LJC A;  3EVY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...