3LBXB

Crystal structure of the erythrocyte spectrin tetramerization domain complex
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
184
structure length
182
Chain Sequence
GSTADKFRFFSMARDLLSWMESIIRQIETQERDVSSVELLMKYHQGINAEIETRSKNFSACLELGESLLQRQHQASEEIREKLQQVMSRRKEMNEKWEARWERLRMLLEVCQFSRDASVAEAWLIAQEPYLASGDFGHTVDSVEKLIKRHEAFEKSTASWAERFAALEKPTTLELKERQIAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure and functional interpretation of the erythrocyte spectrin tetramerization domain complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Spectrin alpha chain, erythrocyte
total genus 67
structure length 182
sequence length 184
ec nomenclature
pdb deposition date 2010-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00435 Spectrin Spectrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.60 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3lbxB01
1.20.58.60 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3lbxB02
3UUNA 3PE0A 3UUMA 3LBXA 3F31A 3EDVA 3UULA 1CUNA 3LBXB 1U5PA 1S35A 1AJ3A 2SPCA 1HCIA 2ODUA 1QUUA 3FB2A 1OWAA 1U4QA 2ODVA 1WLXA
chains in the Genus database with same CATH superfamily
1N34T 4HKAA 2ACXA 3KV6A 3N2KE 5HCMA 4JI2T 5AQVB 3QC9A 3RPUA 3ZMSB 1FJGT 2QVAA 2BZBA 2HH7A 2K9AA 2XAGB 2XQAA 3KBTA 3AXJB 3Q5XA 2WDRA 4NUUA 2WMOA 4TV9E 5FKYA 4AQYT 2UU9T 3AVRA 3VR9A 2DL1A 2X0HA 4HWCA 4TUYE 3RF1A 2M6BA 4X20E 5GONE 3X1DA 4QKNA 1HNXT 1LVFA 1OEDB 3GN5B 5H6RB 5AQGB 3RC8A 4X1IE 3LK3B 3PUXF 2IAKA 1AJ3A 4KHZF 2E9XA 4UV9B 2YDQA 1W9RA 2NR4A 3FZFB 4EZHA 4LF4T 3E0ZA 3UU4A 3CQCB 3EUHA 3PJAA 5LBMA 2L9QA 3UU5A 1EZ3A 2E5LT 2KWIB 4X1YE 2DHRA 2VKDA 4U74A 5JR9C 3JCFA 5HXSA 5ETWA 2CLYC 2BS3A 3S4UA 5DJQC 5LA6E 3UQ4A 5ABHA 2JIWA 2XAQB 4DR5T 4ISTA 3PUZF 5AQQB 2V26A 4ILBA 5L3GB 2V6YB 3AEDA 4J2CA 5FY1A 4ASKA 3PUQA 4DMVA 4DV5T 2YDSA 1N36T 3P4WA 3N9PA 4B3ST 1YD8G 1G8XA 2CRBA 4DBRA 2H7VC 2J1DG 2UXDT 1JNRA 1WCRA 3L8RA 2GK9A 2WCAA 3CWZB 3OKQA 2IUBA 4HEAA 4HWIB 2WAUA 4JEHB 4UVAB 5HEGA 3P4SA 2LLYA 2XQ7A 2V6YA 1X9BA 5FNVE 4AKRB 4DV0T 3B5MA 3KFWX 2WM9A 5AQKB 1J5WA 4O2AE 3BK9A 5JQGE 5CA1E 3H3AA 3ZJ1A 1YKHB 3RC3A 1CHUA 1SHZC 2H89A 2WQYA 3ZN0B 4UVBB 3WAJA 2LHNA 1HFAA 3JAFA 5BMVE 2XQ9A 4IDNA 1M62A 4LMLA 2DNXA 1OWAA 4PJLA 2YU2A 4U2YA 4ISSA 2F4VT 1I94T 2XQ6A 3SS1A 3ZT6A 2FJAA 3P8CD 3FBZA 3N9LA 2DLRA 1OEDA 3GN5A 1QLBA 3GWHA 4GIWA 3UUMA 4YSXA 4CN4A 3FZKB 2XTLA 3M65A 2EHOD 3JC6C 2X66A 5EK4A 5AQLB 2IHR1 3UU8A 4EOZB 5HEUA 2YK0A 2XHEB 2YINA 5JDQA 2XAJB 4CN6A 3CPZA 3RRWA 5IUXA 3OPCA 3ZC1A 3ZSTA 4CN1A 2MOZA 1XMQT 3Q9DA 3N9NA 4IDQA 4WW0A 3P4PA 4PK6A 1ZP0A 5L3DB 2D2SA 4IT4A 5HEJA 2VL8A 2VASA 3AE8A 5LCYA 2KINB 2LSIA 4QH1A 1QUUA 2LT3A 4EIWA 4EYUA 3CQXC 5AQHB 3K3OA 4AKIA 3HL6A 1J1JA 3MACA 3MK7C 4QXHB 4NXNT 1MMAA 4QXCB 2C0SA 4UF0B 3V5UA 4YHHT 3PJAJ 3PE0A 2X9YA 1FIOA 5KX5E 4KHPT 1XNQT 3O9XA 5AQJB 2W67A 1IZNB 2I6HA 2XUEA 3AE7A 3NRXA 1MMGA 1ZV4X 4DV3T 4EB6E 2DCFA 2WBLA 4PJMA 2NP9A 4ZHQE 4F8HA 2MTQA 2DWKA 2V7MA 2HPLA 4UIGA 4AXPA 3RYFE 4CI1B 1MMNA 1NAFA 2BVLA 2BVMA 2E9XB 3L3PA 2I0MA 2X0YA 1MMDA 4U7IA 4JI4T 3BQKA 1XZYA 2ZM0A 2KMFA 3RHWA 3ANWB 2WB5A 4HFBA 1Z8UA 2H7OA 2XPKA 4IDZA 1E7PA 3P50A 3C4WA 3FB2A 3VRAA 3UQ7A 4HFIA 1XMOT 2YOEA 3P4RA 4AKHA 3PUVF 2ES0A 2VURA 2Y6XA 3RIFA 3RKOA 4YJ2E 2ACZA 5H6QB 3CK6A 3VRBA 2W62A 4EAHA 5LYJE 3QB5A 3VKHA 3CVRA 2UXBT 1FMVA 2J47A 1OEDC 4H63H 2XQYA 3E08A 4A98A 5JVDE 2AE9A 2Q9QC 4LF8T 3IA3A 2FJBA 2FJDA 4C90A 5KDMC 5HAXA 4YTPA 3CX7B 2V5DA 2BKNA 2XAHB 3O1HA 3UTKA 1KNZA 5AQSB 4EGWA 2UUAT 2BG9B 2KLQA 4QX8B 2CHOA 2W0GA 2CCQA 4DR3T 1UK5A 4KI0F 1D0XA 4G2AA 4U72A 4AI6A 2I59A 3WAKA 5CFBA 3C4XA 2PBIA 2JPFA 3AA1B 4U7YA 3Q5DA 4IHJE 1YKEB 3PUYF 4NXMT 3NZQA 5J2TE 4H63V 5KMGP 4CXYA 4AKGA 1HX8A 2WMNA 4IE5A 1WLXA 4MLKA 4TV8E 4DIDB 2CBJA 2WDQA 4HWHA 4DR1T 4WYVA 2VKHA 3P4QA 5F8PA 2B76A 2X9XA 5FYMA 1WRDA 2YKSA 2CLYB 2K3WA 3LBXA 1BR1A 3CX8B 4JYAT 3LDQB 5JR9B 3LJCA 2IDOB 2AXDS 5LGUB 3QUJA 3MKDA 3LBXB 1HTJF 1W09A 1FMWA 4PAGA 4LFCT 3FZHB 5JRCB 2HPJA 2X0LB 5AQFB 2WP9A 4DR2T 2OLTA 3I9WA 4JI5T 2CXLA 3RH3A 3ANWA 3SWHA 3HKDE 4HFVA 4XAXB 4LMJA 3ZC0A 4XZCA 4ANJA 3Q5EA 1VCTA 2IC6A 3JAEA 3PU8A 3SFEA 3BQIA 3HKBE 2FBWA 3TLUA 5A1LA 2V6XA 2C5KT 4I55E 3DP7A 4HFDA 5HXEA 2CE7A 3K8PC 4HFEA 2NW9A 5CGMA 4ZZCA 4B3MT 4QHOA 4N78D 2K48A 4JUYA 2B1EA 3KDSE 3OJAA 5L3FB 1KF6A 2W00A 3QNUA 4PFPA 2QGSA 3AE6A 5FMNA 2NTXA 2VK9A 4HFHA 3TLTA 5KXJA 4F6RC 3PUGA 3HA4A 4HWDA 3IHRA 1Y01A 4QWNB 4DUYT 1YQ3A 2NW7A 2WU5A 2XM1A 2NWBA 4ILAA 3AA6B 2BDEA 2EHOC 3JC6D 4IDOA 2LM2A 4IREA 1H7CA 2IW5B 3UU3A 3ZCIA 1HG5A 3L09A 2Y48B 4YSZA 5LP6E 4PK5A 3ONJA 4O4IE 2JQHA 4P1NA 3VU7H 2E9XD 1WYCA 4FJOA 3UFGA 4GK0E 3ZPOA 1ZOYA 3SRZA 2V8SV 4ZI2C 2LHRA 2V7LA 4I4TE 4YTMA 2IIUA 5ABFA 1IBLT 1BR0A 1OEDE 4U31A 4DR7T 3RYIE 4A56A 3PTRB 4PW8A 3Q2MA 4KMCA 3FXEB 3ZKRA 3EVYA 3UUXB 3AE5A 3T1YT 4O4JE 3AB3B 3T8OA 2G0UA 2A3DA 3RIUC 1HR0T 1UURA 2V5CA 3EDVA 4JI0T 5JH7E 3AE9A 3AA0B 2PJQA 2BS4A 2VVNA 1WR6A 1KFYA 1YQ4A 3TLWA 3V5SA 3MA9A 5LHGB 3AVSA 2WS3A 4B3TT 1U5PA 2ZM6T 4DR4T 2JRKA 2UXNB 2XQ5A 4ILCA 5F5WA 4DVDA 4JEUB 5LJNA 1Y64B 2JQQA 2D5UA 2CA5A 4YFSA 2CEAA 2Z6EA 1D1CA 2WZIA 2JMHA 3IBPA 5HXRA 3C50A 4LF6T 3OYZA 3E22E 2LKGA 4ZS3A 4CI2B 5HWYA 1MIWA 3OYXA 3ZMUB 5L3EB 2LSYA 3EDUA 5HCJA 3ZMVB 4IL9A 2XY8B 2CWYA 2YU1A 3UUNA 4OYKA 3C64A 1B7TA 2QRXA 4DNDA 2V7JA 4LMKA 1Z0PA 2ZM8A 4E7ZA 4LF7T 2LRKA 3FZMB 4JV5T 3QB5K 5LG4A 5FL0A 4TNVA 2BBJA 3CQGB 3LSVA 4H9SE 1IAPA 1OXZA 4KP3C 2XZEA 1LKXA 1M7KA 4ZS2A 3U3IA 5ABGA 3AAIA 3B57A 3ONLC 2K24A 3J7Yq 4UVCB 2A9UA 1NWMX 4L0RA 5FVLA 5ABFB 5LOVE 5AQMB 5L3CB 4B3RT 1I6ZA 4GOUA 3IEEA 2PTFA 3A5XA 3F2EA 3UU6A 2HHHT 1ZHCA 3WI3A 3B13A 5LHIB 4WBNE 2ODUA 3AEBA 3TLSA 4EEBA 3MXZA 4AIUA 5JDMA 2DWGA 3AECA 3RYHE 4X66T 2KNDA 2P9BA 5LGTB 2W66A 3MZKB 4HGAA 5F3JA 1XDOA 3ZEFB 2EHOB 3CMLA 4YTNA 5L2LA 1T72A 2UUBT 4HFCA 3K1SA 4K0KT 1SUMB 3H37A 3PUSA 3RQUA 3ZT7A 2LSKA 4ZI3D 3OVUA 2X67A 5IWAT 5CB4E 2VL0A 3H3MA 1WFDA 2BKOA 3F31A 4I50E 5LBQB 4UELA 4L5GA 5AQNB 1G73A 1S94A 1W0AA 2X51A 3LG7A 4BAYB 2R6GF 4IE6A 4UEMA 3A8YC 2VB6A 3KV5A 2H88A 5IYZE 4OX9T 3RLFF 2A72A 4JLEA 3AA7B 3ZYLA 2KSRA 5J1GA 2L8KA 4OYJA 4YHJA 4KUMB 2YN6A 2JJ9A 4YLHA 5LMUT 4DV4T 2BG9E 2J62A 4EXTA 3RYCE 4O4HE 3KVAA 2VWAA 4CXXA 4HWFA 4FI5A 4TNWA 4IDPA 3HKCE 1D0YA 1HNWT 4HN9A 2X68A 3FZLB 4P0BA 3TLVA 2OV9A 1E1HB 2CXDA 1V9DA 3ETVA 1IBKT 5J0ZA 2RPAA 3PU3A 4DV6T 2CM0A 4LF5T 1WR0A 1MNEA 3VKGA 2LSGA 5JDFA 3N9OA 3NKZA 4G63A 3RKGA 3RX6A 4O4LE 4TWHA 4NIQA 3Q5WA 4GYSA 4QH5A 4QH4A 2VKOA 5DQWA 1KEYA 3RQWA 5C3JA 5LMNT 4JI8T 5E0OA 1E2AA 3UT5E 2UXCT 2HN2A 4KX6A 3KBUA 4H9QC 2BG9A 4MALA 5AQIB 3ZYMA 4TX5A 1L0VA 2LOSA 1QSDA 3RGLA 4H9PC 4UV8B 5DABA 4UXNB 3T1HT 4H9NC 5EK3A 3UFEA 1O3XA 4TWFA 2XSBA 5AFUL 2D0TA 2SPCA 2CHNA 4EV6A 4M1PA 3VHLA 3ESLA 4TN7B 4BA9A 4HE8A 3RI5A 3AAEB 4I0UA 3FXDB 3CIRA 3O1IA 4Z91A 3LK42 5L4EA 3ZCJA 4ZEYA 2ODVA 4PFOA 4TZ4C 1FEWA 5HEOA 3U78A 4MHCA 4CI3B 5BR8T 1X79A 1UX4A 4WZXA 3KV4A 2H3RA 2DI4A 4JI7T 4YT0A 3AXJA 4DBQA 3SOLA 5FXWA 2M6IA 5JDLA 5LGNB 1MIYA 3KINB 1IJ6A 5DQVA 3J9X1 4WBOA 3ZT5A 5C8YE 1NEKA 3KV9A 4X65T 2XQ8A 2KWHA 3OTOT 4IIJE 4Q25A 5ABEA 5JREA 3EABA 1VRBA 4ZI2D 2JMKA 3PURA 2XQ3A 2LEHA 4DV7T 4P0AA 2QYWA 3CKDA 3ZJ2A 2MYSA 3ZMTB 2NTYA 1UX5A 4ILUA 4U33A 3GA8A 2L3LA 2XSAA 2V7KA 2CBIA 3BQLA 3FBLA 1VOMA 3P7IA 3N5LA 2MPKA 3EHZA 5TAOA 5JTGA 3NWIA 1GQEA 5LB7B 4GKJT 2FUPA 3AE3A 2WWVA 2XASB 5LXTE 2CWOA 5AQUB 4AQFC 3N9MA 1BR2A 4H9RC 1HS7A 3OBVE 3ZSSA 4AKLA 4PJJA 5L47A 5CA0E 2IMLA 4AISA 5ADXL 4JBWF 1HX1B 4DMWA 3K3QC 1UCUA 3F57A 2LKHA 4ZI7E 4YJ3E 3R84B 4IE7A 3NVOA 3VR8A 2CMRA 5FXXA 5LJMA 4JI1T 5FY0A 4LFBT 1JNZA 2WSSV 2M67A 3AE1A 4IL4A 2W61A 5IHYA 4B6XA 5FP3A 5JDHA 2Q9QB 2RP4A 2EHOA 2Q9QD 2LJLA 5AQTB 3SFDA 5L4HA 3NBXX 4A5XA 2X9WA 1XDPA 2VKJA 2ZLYA 4COFA 1R8IA 1SA0E 1ZKEA 2RA1A 3M3ZB 3AEEA 5EK2A 2OA5A 4GKKT 2LSJA 2V7IA 2XJ7A 1KNPA 2JQ9A 2QA7A 1J5ET 5CJ5A 4PJNA 1XWMA 1VCSA 4IE0A 4TWDA 3TKLB 3I0OA 3PDYA 1W0BA 3ABVA 1U4QA 1DU2A 1HG2A 2ZMAA 3C98B 4NUVA 4UR9A 4UF0A 4OFZA 5EZYE 3I9YA 1IBMT 2VQET 4OK0A 4LF9T 3RIUA 2E8IA 5JDGA 2XAFB 3G06A 3I0QA 2JQKA 2MAWA 3NRYA 2J4GA 2PFVA 4E7SA 5JR9A 3UULA 1YW0A 3ZN1B 1YXRA 2D0UA 4P09A 2UXXB 4ADZA 5AQOB 1KK7A 1MIVA 1S35A 3PUAA 4JI6T 4KBMB 2A2FX 4I43B 3ZLIA 4CXWA 4YXDA 5LNKA 4DR6T 3RRCA 4YSYA 3AAAB 4A97A 1UUSA 3R6NA 3O4XE 2VVSA 2W4XA 3HKEE 4OHFA 3AE4A 4Z90A 4ZI3C 1LVKA 2D9DA 3HR0A 4EYYR 3O1JA 3DJBA 3PUWF 1MNDA 2W63A 1UGOA 3IF8B 4ERRA 5HXCA 3N9QA 5C2TA 1HNZT 3LK2B 5L3BB 2YDRA 4GK5E 3AEFA 4PNIA 4IE4A 4WNKA 4QXBB 3C51A 1IJ5A 3ZMZB 4LFAT 2CPTA 4X1KE 4MFRA 4U2ZA 5FY7A 1ZEEA 2WY2A 3ZYKA 5HXHA 1N33T 2KZ7B 3HI2A 2E5VA 4O2BE 4QX7B 4DV2T 2X9HA 3NZPA 4EEDA 1WYBA 5AQRB 4ZOLE 2MBGA 1N32T 1KNRA 1CUNA 3CX6B 3N2GE 5M4YA 2LRLA 4XBFB 2KXPB 4HTEA 2C5JA 1XNRT 4EZ4A 2CXFA 2IC9A 1BR4A 2E9XC 2LM9A 2PG8A 5HEHA 3W15B 5AQPB 2WWUA 5FL1A 1T8BA 2BKPA 5FXZA 2BS2A 2LOPA 2NW8A 5J2UE 2HN1A 4IGUA 3ONXA 4PK4A 3MJXA 4K0UA 3QOFA 3DTOA 4DO0A 2BG9C 3QK6A 4ZXLA 5HYAA 1SE7A 4CZZB 2K5BB 2KT9A 1NENA 5HWXA 1T98A 3C4ZA 1D1AA 1D1BA 2C5IT 2WZHA 2BBHA 3AEGA 3AE2A 3PV0F 4MBQA 4H9OC 3AEAA 4U3CA 5FXVA 5JDNA 2N1GA 2N2NA 3KVBA 2XM2A 3A7MA 3GMIA 4O8SA 4GYRA 4YY3T 1T7SA 3N2OA 1HF8A 2XQ4A 3K3NA 3UUBA 4JI3T 4BJNA 2NOXA 4ZZBA 2ZM2A 2V1DB 3D0TA 3I1AA 4AQFA 3FHNA 2FJEA 4NPPA 5LG3A 3L39A 4X62T 2Y8DA 4CQIA 2E2AA 2VQFT 4X64T 4AQGA 5LHHB 5FVKA 4C91A 5JRCA 4Z8XA 2W2UA 4V1Av 3EAMA 2YEVC 1HCIA 1US7B 2WU2A 2Q9QA 3RIAA 4X5TA 2LE8A 2UUCT 3LFMA 4DUZT 3EI0A 4L9IA 4DV1T 1LRZA 1D0ZA 2N9DA 3JADA 4BJMA 3ETUA 2WDVA
chains in the Genus database with same CATH topology
4HKAA 2ACXA 3KV6A 3N2KE 3RPUA 3QC9A 3ZMSB 2BZBA 2HH7A 2K9AA 2XAGB 3KBTA 4TV9E 3Q5XA 4NUUA 2WMOA 3AVRA 4TUYE 4X20E 5GONE 4QKNA 3RC8A 1LVFA 3GN5B 5H6RB 4X1IE 3LK3B 2IAKA 1AJ3A 2E9XA 4UV9B 4EZHA 3E0ZA 3CQCB 3EUHA 5LBMA 2L9QA 1EZ3A 2KWIB 4X1YE 2DHRA 2VKDA 4U74A 5JR9C 5HXSA 5ETWA 2CLYC 3S4UA 5DJQC 5LA6E 2XAQB 4ISTA 5L3GB 2V26A 4ASKA 4J2CA 5FY1A 4DMVA 3PUQA 3N9PA 1YD8G 1G8XA 4DBRA 2H7VC 2J1DG 3OKQA 4L5GA 3RYIE 2GK9A 5IYZE 3CWZB 4JEHB 4HEAA 4UVAB 4P0AA 2WAUA 4AKRB 5FNVE 3KFWX 2WM9A 4O2AE 3BK9A 5JQGE 5CA1E 3H3AA 3ZJ1A 1YKHB 3RC3A 1SHZC 4UVBB 3WAJA 2LHNA 1HFAA 5BMVE 4PJLA 2DNXA 1OWAA 2YU2A 4ISSA 3SS1A 3P8CD 3FBZA 3N9LA 2DLRA 3GN5A 4GIWA 3GWHA 3UUMA 3M65A 2XTLA 2EHOD 3JC6C 2X66A 5EK4A 4EOZB 2YK0A 2XHEB 2YINA 2XAJB 3CPZA 3RRWA 3ZC1A 2MOZA 3Q9DA 3N9NA 4WW0A 4PK6A 5L3DB 2D2SA 2VL8A 2VASA 5LCYA 2KINB 2LSIA 1QUUA 2LT3A 4EIWA 4EYUA 3CQXC 3K3OA 4AKIA 3HL6A 3MACA 3MK7C 4QXHB 1MMAA 4QXCB 2C0SA 4UF0B 3V5UA 3PE0A 2X9YA 1FIOA 5KX5E 3O9XA 2XUEA 1IZNB 3NRXA 1MMGA 1ZV4X 4EB6E 2DCFA 2WBLA 4PJMA 2NP9A 4ZHQE 2MTQA 2DWKA 2V7MA 2HPLA 4UIGA 4AXPA 3RYFE 4CI1B 1MMNA 1NAFA 2BVLA 2BVMA 2E9XB 3L3PA 1MMDA 3BQKA 2ZM0A 2KMFA 3ANWB 2H7OA 4IDZA 3C4WA 3FB2A 4AKHA 2ES0A 2Y6XA 3RKOA 4YJ2E 5H6QB 3VKHA 2W62A 4EAHA 5LYJE 3CVRA 1FMVA 4H63H 2XQYA 3E08A 5JVDE 2Q9QC 4C90A 5KDMC 5HAXA 3CX7B 3O1HA 2XAHB 3UTKA 1KNZA 2KLQA 4QX8B 2W0GA 2CCQA 1D0XA 4G2AA 4U72A 4AI6A 2I59A 3WAKA 3C4XA 2PBIA 2JPFA 3AA1B 4IHJE 1YKEB 3NZQA 5J2TE 4H63V 5KMGP 4CXYA 4AKGA 1HX8A 2WMNA 4IE5A 1WLXA 4MLKA 4TV8E 2VKHA 5F8PA 2X9XA 5FYMA 1WRDA 2CLYB 3LBXA 1BR1A 3CX8B 5JR9B 3LJCA 5LGUB 3QUJA 3MKDA 3LBXB 1HTJF 4PAGA 1FMWA 5JRCB 2HPJA 2X0LB 3I9WA 2CXLA 3RH3A 3ANWA 3SWHA 3HKDE 4HFVA 4XAXB 3ZC0A 4XZCA 4ANJA 5A1LA 2IC6A 3PU8A 3BQIA 3HKBE 4I55E 2C5KT 3DP7A 5HXEA 2CE7A 3K8PC 2NW9A 4QHOA 4N78D 2K48A 4JUYA 2B1EA 3KDSE 3OJAA 5L3FB 2W00A 5FMNA 4PFPA 2QGSA 2NTXA 2VK9A 4F6RC 3PUGA 3HA4A 3IHRA 4QWNB 2NW7A 5JDQA 2NWBA 3AA6B 2BDEA 2EHOC 3JC6D 1H7CA 2IW5B 3ZCIA 1HG5A 3L09A 2Y48B 5LP6E 4PK5A 4O4IE 3VU7H 2E9XD 1WYCA 4FJOA 3ZPOA 4GK0E 3SRZA 4ZI2C 2LHRA 2V7LA 4I4TE 1BR0A 4A56A 3PTRB 4PW8A 3Q2MA 4KMCA 3FXEB 3EVYA 3UUXB 4O4JE 3AB3B 3T8OA 2G0UA 2A3DA 3EDVA 5JH7E 3AA0B 2PJQA 3V5SA 1WR6A 5LHGB 5JRCA 3MA9A 3AVSA 1U5PA 2JRKA 2UXNB 4DVDA 4JEUB 5LJNA 1Y64B 2JQQA 2D5UA 2CA5A 4YFSA 2CEAA 2Z6EA 1D1CA 5HXRA 2JMHA 3IBPA 3C50A 3OYZA 3E22E 4ZS3A 4CI2B 5HWYA 1MIWA 3OYXA 3ZMUB 5L3EB 3EDUA 2LSYA 3ZMVB 2CWYA 2YU1A 3UUNA 4OYKA 3C64A 1B7TA 4DNDA 2V7JA 4E7ZA 1Z0PA 2ZM8A 5LG4A 3CQGB 4H9SE 1IAPA 1OXZA 4KP3C 4ZS2A 1LKXA 3U3IA 3AAIA 3B57A 2K24A 3J7Yq 4UVCB 1NWMX 4L0RA 5LOVE 5L3CB 4GOUA 3IEEA 3A5XA 3F2EA 1ZHCA 3WI3A 3B13A 5LHIB 4WBNE 2ODUA 5JDMA 3MXZA 2DWGA 3RYHE 2KNDA 2P9BA 5LGTB 4HGAA 3MZKB 5F3JA 3ZEFB 2EHOB 3CMLA 5L2LA 3H37A 3PUSA 4ZI3D 2LSKA 2X67A 5CB4E 3F31A 4I50E 5LBQB 4UELA 1G73A 1S94A 2X51A 3LG7A 4BAYB 4IE6A 4UEMA 2VB6A 3KV5A 2A72A 4JLEA 3AA7B 3ZYLA 2L8KA 4OYJA 4YHJA 4KUMB 4YLHA 2JJ9A 4EXTA 3RYCE 4O4HE 3KVAA 2VWAA 4CXXA 4FI5A 3HKCE 1D0YA 4HN9A 2X68A 4P0BA 1E1HB 2CXDA 1V9DA 3ETVA 3PU3A 2CM0A 1MNEA 2LSGA 5JDFA 3N9OA 4G63A 3RX6A 4O4LE 3Q5WA 4GYSA 5DQWA 2VKOA 5E0OA 3UT5E 4MALA 3KBUA 4H9QC 3ZYMA 4TX5A 2LOSA 1QSDA 4H9PC 4UV8B 5DABA 4UXNB 4H9NC 5EK3A 3UFEA 1O3XA 5AFUL 2D0TA 2SPCA 4M1PA 3VHLA 3ESLA 4TN7B 4BA9A 4HE8A 3AAEB 3FXDB 3O1IA 3LK42 3ZCJA 2ODVA 4PFOA 4TZ4C 1FEWA 3U78A 4CI3B 4MHCA 1X79A 1UX4A 3KV4A 2H3RA 2DI4A 4DBQA 3SOLA 5FXWA 5JDLA 5LGNB 3VKGA 1MIYA 3KINB 1IJ6A 5DQVA 3J9X1 4WBOA 5C8YE 3KV9A 2KWHA 4IIJE 5JREA 1VRBA 4ZI2D 2JMKA 3PURA 2LEHA 3CKDA 3ZJ2A 2MYSA 3ZMTB 2NTYA 1UX5A 4ILUA 3GA8A 2L3LA 2V7KA 3BQLA 5TAOA 3FBLA 1VOMA 3P7IA 3N5LA 5LXTE 2XASB 2CWOA 4AQFC 3N9MA 1BR2A 4H9RC 1HS7A 3OBVE 4AKLA 4PJJA 5CA0E 5ADXL 4DMWA 3K3QC 1UCUA 3F57A 4ZI7E 4YJ3E 3R84B 4IE7A 2CMRA 5FXXA 5LJMA 5FY0A 5IHYA 2WSSV 2M67A 4B6XA 2W61A 5JDHA 5FP3A 2Q9QB 2RP4A 2EHOA 2Q9QD 2LJLA 3NBXX 2X9WA 2ZLYA 2VKJA 1SA0E 1ZKEA 5EK2A 2RA1A 2OA5A 2LSJA 2V7IA 2QA7A 4PJNA 4IE0A 3TKLB 3I0OA 3PDYA 1U4QA 1HG2A 2ZMAA 3C98B 4NUVA 4UF0A 4OFZA 5EZYE 3I9YA 4OK0A 5JDGA 2E8IA 2XAFB 3I0QA 3NRYA 2PFVA 4E7SA 5JR9A 3UULA 1YW0A 3ZN1B 2D0UA 4P09A 2UXXB 4ADZA 1KK7A 1MIVA 1S35A 3PUAA 4KBMB 2A2FX 4I43B 3ZLIA 4CXWA 5LNKA 3RRCA 3AAAB 3R6NA 3O4XE 3HKEE 4EYYR 4OHFA 4ZI3C 1LVKA 3HR0A 3O1JA 3DJBA 1MNDA 2W63A 4ERRA 3IF8B 5HXCA 3N9QA 3LK2B 5L3BB 4GK5E 4PNIA 4IE4A 4WNKA 4QXBB 3C51A 1IJ5A 3ZMZB 4X1KE 4MFRA 5FY7A 1ZEEA 3ZYKA 5HXHA 2KZ7B 3HI2A 4O2BE 4QX7B 2X9HA 3NZPA 1WYBA 2MBGA 4ZOLE 3CX6B 1CUNA 3N2GE 5M4YA 4XBFB 2KXPB 4HTEA 2C5JA 4EZ4A 2CXFA 2IC9A 1BR4A 2E9XC 2LM9A 2PG8A 3W15B 2WWUA 5FXZA 2LOPA 2NW8A 5J2UE 4IGUA 3ONXA 4PK4A 3MJXA 4K0UA 3DTOA 4DO0A 3QK6A 5HYAA 4CZZB 2K5BB 2KT9A 5HWXA 1T98A 3C4ZA 1D1AA 1D1BA 2C5IT 5FXVA 5J1GA 3ZN0B 4MBQA 5JDNA 4H9OC 2N1GA 2N2NA 3KVBA 3GMIA 4O8SA 4GYRA 3N2OA 1HF8A 3K3NA 4BJNA 2NOXA 3D0TA 2ZM2A 2V1DB 3I1AA 4AQFA 3FHNA 2Y8DA 4CQIA 4AQGA 5LHHB 4C91A 4Z8XA 4V1Av 2YEVC 1HCIA 1US7B 2Q9QA 2LE8A 3LFMA 4L9IA 1LRZA 1D0ZA 2N9DA 4BJMA 3ETUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UUN A;  3PE0 A;  3UUM A;  3LBX A;  3F31 A;  3EDV A;  3UUL A;  1CUN A;  3LBX B;  1U5P A;  1S35 A;  1AJ3 A;  2SPC A;  1HCI A;  2ODU A;  1QUU A;  3FB2 A;  1OWA A;  1U4Q A;  2ODV A;  1WLX A; 
#chains in the Genus database with same CATH topology
 1N34 T;  4HKA A;  2ACX A;  3KV6 A;  3N2K E;  5HCM A;  4JI2 T;  5AQV B;  3QC9 A;  3RPU A;  3ZMS B;  1FJG T;  2QVA A;  2BZB A;  2HH7 A;  2K9A A;  2XAG B;  2XQA A;  3KBT A;  3AXJ B;  3Q5X A;  2WDR A;  4NUU A;  2WMO A;  4TV9 E;  5FKY A;  4AQY T;  2UU9 T;  3AVR A;  3VR9 A;  2DL1 A;  2X0H A;  4HWC A;  4TUY E;  3RF1 A;  2M6B A;  4X20 E;  5GON E;  3X1D A;  4QKN A;  1HNX T;  1LVF A;  1OED B;  3GN5 B;  5H6R B;  5AQG B;  3RC8 A;  4X1I E;  3LK3 B;  3PUX F;  2IAK A;  1AJ3 A;  4KHZ F;  2E9X A;  4UV9 B;  2YDQ A;  1W9R A;  2NR4 A;  3FZF B;  4EZH A;  4LF4 T;  3E0Z A;  3UU4 A;  3CQC B;  3EUH A;  3PJA A;  5LBM A;  2L9Q A;  3UU5 A;  1EZ3 A;  2E5L T;  2KWI B;  4X1Y E;  2DHR A;  2VKD A;  4U74 A;  5JR9 C;  3JCF A;  5HXS A;  5ETW A;  2CLY C;  2BS3 A;  3S4U A;  5DJQ C;  5LA6 E;  3UQ4 A;  5ABH A;  2JIW A;  2XAQ B;  4DR5 T;  4IST A;  3PUZ F;  5AQQ B;  2V26 A;  4ILB A;  5L3G B;  2V6Y B;  3AED A;  4J2C A;  5FY1 A;  4ASK A;  3PUQ A;  4DMV A;  4DV5 T;  2YDS A;  1N36 T;  3P4W A;  3N9P A;  4B3S T;  1YD8 G;  1G8X A;  2CRB A;  4DBR A;  2H7V C;  2J1D G;  2UXD T;  1JNR A;  1WCR A;  3L8R A;  2GK9 A;  2WCA A;  3CWZ B;  3OKQ A;  2IUB A;  4HEA A;  4HWI B;  2WAU A;  4JEH B;  4UVA B;  5HEG A;  3P4S A;  2LLY A;  2XQ7 A;  2V6Y A;  1X9B A;  5FNV E;  4AKR B;  4DV0 T;  3B5M A;  3KFW X;  2WM9 A;  5AQK B;  1J5W A;  4O2A E;  3BK9 A;  5JQG E;  5CA1 E;  3H3A A;  3ZJ1 A;  1YKH B;  3RC3 A;  1CHU A;  1SHZ C;  2H89 A;  2WQY A;  3ZN0 B;  4UVB B;  3WAJ A;  2LHN A;  1HFA A;  3JAF A;  5BMV E;  2XQ9 A;  4IDN A;  1M62 A;  4LML A;  2DNX A;  1OWA A;  4PJL A;  2YU2 A;  4U2Y A;  4ISS A;  2F4V T;  1I94 T;  2XQ6 A;  3SS1 A;  3ZT6 A;  2FJA A;  3P8C D;  3FBZ A;  3N9L A;  2DLR A;  1OED A;  3GN5 A;  1QLB A;  3GWH A;  4GIW A;  3UUM A;  4YSX A;  4CN4 A;  3FZK B;  2XTL A;  3M65 A;  2EHO D;  3JC6 C;  2X66 A;  5EK4 A;  5AQL B;  2IHR 1;  3UU8 A;  4EOZ B;  5HEU A;  2YK0 A;  2XHE B;  2YIN A;  5JDQ A;  2XAJ B;  4CN6 A;  3CPZ A;  3RRW A;  5IUX A;  3OPC A;  3ZC1 A;  3ZST A;  4CN1 A;  2MOZ A;  1XMQ T;  3Q9D A;  3N9N A;  4IDQ A;  4WW0 A;  3P4P A;  4PK6 A;  1ZP0 A;  5L3D B;  2D2S A;  4IT4 A;  5HEJ A;  2VL8 A;  2VAS A;  3AE8 A;  5LCY A;  2KIN B;  2LSI A;  4QH1 A;  1QUU A;  2LT3 A;  4EIW A;  4EYU A;  3CQX C;  5AQH B;  3K3O A;  4AKI A;  3HL6 A;  1J1J A;  3MAC A;  3MK7 C;  4QXH B;  4NXN T;  1MMA A;  4QXC B;  2C0S A;  4UF0 B;  3V5U A;  4YHH T;  3PJA J;  3PE0 A;  2X9Y A;  1FIO A;  5KX5 E;  4KHP T;  1XNQ T;  3O9X A;  5AQJ B;  2W67 A;  1IZN B;  2I6H A;  2XUE A;  3AE7 A;  3NRX A;  1MMG A;  1ZV4 X;  4DV3 T;  4EB6 E;  2DCF A;  2WBL A;  4PJM A;  2NP9 A;  4ZHQ E;  4F8H A;  2MTQ A;  2DWK A;  2V7M A;  2HPL A;  4UIG A;  4AXP A;  3RYF E;  4CI1 B;  1MMN A;  1NAF A;  2BVL A;  2BVM A;  2E9X B;  3L3P A;  2I0M A;  2X0Y A;  1MMD A;  4U7I A;  4JI4 T;  3BQK A;  1XZY A;  2ZM0 A;  2KMF A;  3RHW A;  3ANW B;  2WB5 A;  4HFB A;  1Z8U A;  2H7O A;  2XPK A;  4IDZ A;  1E7P A;  3P50 A;  3C4W A;  3FB2 A;  3VRA A;  3UQ7 A;  4HFI A;  1XMO T;  2YOE A;  3P4R A;  4AKH A;  3PUV F;  2ES0 A;  2VUR A;  2Y6X A;  3RIF A;  3RKO A;  4YJ2 E;  2ACZ A;  5H6Q B;  3CK6 A;  3VRB A;  2W62 A;  4EAH A;  5LYJ E;  3QB5 A;  3VKH A;  3CVR A;  2UXB T;  1FMV A;  2J47 A;  1OED C;  4H63 H;  2XQY A;  3E08 A;  4A98 A;  5JVD E;  2AE9 A;  2Q9Q C;  4LF8 T;  3IA3 A;  2FJB A;  2FJD A;  4C90 A;  5KDM C;  5HAX A;  4YTP A;  3CX7 B;  2V5D A;  2BKN A;  2XAH B;  3O1H A;  3UTK A;  1KNZ A;  5AQS B;  4EGW A;  2UUA T;  2BG9 B;  2KLQ A;  4QX8 B;  2CHO A;  2W0G A;  2CCQ A;  4DR3 T;  1UK5 A;  4KI0 F;  1D0X A;  4G2A A;  4U72 A;  4AI6 A;  2I59 A;  3WAK A;  5CFB A;  3C4X A;  2PBI A;  2JPF A;  3AA1 B;  4U7Y A;  3Q5D A;  4IHJ E;  1YKE B;  3PUY F;  4NXM T;  3NZQ A;  5J2T E;  4H63 V;  5KMG P;  4CXY A;  4AKG A;  1HX8 A;  2WMN A;  4IE5 A;  1WLX A;  4MLK A;  4TV8 E;  4DID B;  2CBJ A;  2WDQ A;  4HWH A;  4DR1 T;  4WYV A;  2VKH A;  3P4Q A;  5F8P A;  2B76 A;  2X9X A;  5FYM A;  1WRD A;  2YKS A;  2CLY B;  2K3W A;  3LBX A;  1BR1 A;  3CX8 B;  4JYA T;  3LDQ B;  5JR9 B;  3LJC A;  2IDO B;  2AXD S;  5LGU B;  3QUJ A;  3MKD A;  3LBX B;  1HTJ F;  1W09 A;  1FMW A;  4PAG A;  4LFC T;  3FZH B;  5JRC B;  2HPJ A;  2X0L B;  5AQF B;  2WP9 A;  4DR2 T;  2OLT A;  3I9W A;  4JI5 T;  2CXL A;  3RH3 A;  3ANW A;  3SWH A;  3HKD E;  4HFV A;  4XAX B;  4LMJ A;  3ZC0 A;  4XZC A;  4ANJ A;  3Q5E A;  1VCT A;  2IC6 A;  3JAE A;  3PU8 A;  3SFE A;  3BQI A;  3HKB E;  2FBW A;  3TLU A;  5A1L A;  2V6X A;  2C5K T;  4I55 E;  3DP7 A;  4HFD A;  5HXE A;  2CE7 A;  3K8P C;  4HFE A;  2NW9 A;  5CGM A;  4ZZC A;  4B3M T;  4QHO A;  4N78 D;  2K48 A;  4JUY A;  2B1E A;  3KDS E;  3OJA A;  5L3F B;  1KF6 A;  2W00 A;  3QNU A;  4PFP A;  2QGS A;  3AE6 A;  5FMN A;  2NTX A;  2VK9 A;  4HFH A;  3TLT A;  5KXJ A;  4F6R C;  3PUG A;  3HA4 A;  4HWD A;  3IHR A;  1Y01 A;  4QWN B;  4DUY T;  1YQ3 A;  2NW7 A;  2WU5 A;  2XM1 A;  2NWB A;  4ILA A;  3AA6 B;  2BDE A;  2EHO C;  3JC6 D;  4IDO A;  2LM2 A;  4IRE A;  1H7C A;  2IW5 B;  3UU3 A;  3ZCI A;  1HG5 A;  3L09 A;  2Y48 B;  4YSZ A;  5LP6 E;  4PK5 A;  3ONJ A;  4O4I E;  2JQH A;  4P1N A;  3VU7 H;  2E9X D;  1WYC A;  4FJO A;  3UFG A;  4GK0 E;  3ZPO A;  1ZOY A;  3SRZ A;  2V8S V;  4ZI2 C;  2LHR A;  2V7L A;  4I4T E;  4YTM A;  2IIU A;  5ABF A;  1IBL T;  1BR0 A;  1OED E;  4U31 A;  4DR7 T;  3RYI E;  4A56 A;  3PTR B;  4PW8 A;  3Q2M A;  4KMC A;  3FXE B;  3ZKR A;  3EVY A;  3UUX B;  3AE5 A;  3T1Y T;  4O4J E;  3AB3 B;  3T8O A;  2G0U A;  2A3D A;  3RIU C;  1HR0 T;  1UUR A;  2V5C A;  3EDV A;  4JI0 T;  5JH7 E;  3AE9 A;  3AA0 B;  2PJQ A;  2BS4 A;  2VVN A;  1WR6 A;  1KFY A;  1YQ4 A;  3TLW A;  3V5S A;  3MA9 A;  5LHG B;  3AVS A;  2WS3 A;  4B3T T;  1U5P A;  2ZM6 T;  4DR4 T;  2JRK A;  2UXN B;  2XQ5 A;  4ILC A;  5F5W A;  4DVD A;  4JEU B;  5LJN A;  1Y64 B;  2JQQ A;  2D5U A;  2CA5 A;  4YFS A;  2CEA A;  2Z6E A;  1D1C A;  2WZI A;  2JMH A;  3IBP A;  5HXR A;  3C50 A;  4LF6 T;  3OYZ A;  3E22 E;  2LKG A;  4ZS3 A;  4CI2 B;  5HWY A;  1MIW A;  3OYX A;  3ZMU B;  5L3E B;  2LSY A;  3EDU A;  5HCJ A;  3ZMV B;  4IL9 A;  2XY8 B;  2CWY A;  2YU1 A;  3UUN A;  4OYK A;  3C64 A;  1B7T A;  2QRX A;  4DND A;  2V7J A;  4LMK A;  1Z0P A;  2ZM8 A;  4E7Z A;  4LF7 T;  2LRK A;  3FZM B;  4JV5 T;  3QB5 K;  5LG4 A;  5FL0 A;  4TNV A;  2BBJ A;  3CQG B;  3LSV A;  4H9S E;  1IAP A;  1OXZ A;  4KP3 C;  2XZE A;  1LKX A;  1M7K A;  4ZS2 A;  3U3I A;  5ABG A;  3AAI A;  3B57 A;  3ONL C;  2K24 A;  3J7Y q;  4UVC B;  2A9U A;  1NWM X;  4L0R A;  5FVL A;  5ABF B;  5LOV E;  5AQM B;  5L3C B;  4B3R T;  1I6Z A;  4GOU A;  3IEE A;  2PTF A;  3A5X A;  3F2E A;  3UU6 A;  2HHH T;  1ZHC A;  3WI3 A;  3B13 A;  5LHI B;  4WBN E;  2ODU A;  3AEB A;  3TLS A;  4EEB A;  3MXZ A;  4AIU A;  5JDM A;  2DWG A;  3AEC A;  3RYH E;  4X66 T;  2KND A;  2P9B A;  5LGT B;  2W66 A;  3MZK B;  4HGA A;  5F3J A;  1XDO A;  3ZEF B;  2EHO B;  3CML A;  4YTN A;  5L2L A;  1T72 A;  2UUB T;  4HFC A;  3K1S A;  4K0K T;  1SUM B;  3H37 A;  3PUS A;  3RQU A;  3ZT7 A;  2LSK A;  4ZI3 D;  3OVU A;  2X67 A;  5IWA T;  5CB4 E;  2VL0 A;  3H3M A;  1WFD A;  2BKO A;  3F31 A;  4I50 E;  5LBQ B;  4UEL A;  4L5G A;  5AQN B;  1G73 A;  1S94 A;  1W0A A;  2X51 A;  3LG7 A;  4BAY B;  2R6G F;  4IE6 A;  4UEM A;  3A8Y C;  2VB6 A;  3KV5 A;  2H88 A;  5IYZ E;  4OX9 T;  3RLF F;  2A72 A;  4JLE A;  3AA7 B;  3ZYL A;  2KSR A;  5J1G A;  2L8K A;  4OYJ A;  4YHJ A;  4KUM B;  2YN6 A;  2JJ9 A;  4YLH A;  5LMU T;  4DV4 T;  2BG9 E;  2J62 A;  4EXT A;  3RYC E;  4O4H E;  3KVA A;  2VWA A;  4CXX A;  4HWF A;  4FI5 A;  4TNW A;  4IDP A;  3HKC E;  1D0Y A;  1HNW T;  4HN9 A;  2X68 A;  3FZL B;  4P0B A;  3TLV A;  2OV9 A;  1E1H B;  2CXD A;  1V9D A;  3ETV A;  1IBK T;  5J0Z A;  2RPA A;  3PU3 A;  4DV6 T;  2CM0 A;  4LF5 T;  1WR0 A;  1MNE A;  3VKG A;  2LSG A;  5JDF A;  3N9O A;  3NKZ A;  4G63 A;  3RKG A;  3RX6 A;  4O4L E;  4TWH A;  4NIQ A;  3Q5W A;  4GYS A;  4QH5 A;  4QH4 A;  2VKO A;  5DQW A;  1KEY A;  3RQW A;  5C3J A;  5LMN T;  4JI8 T;  5E0O A;  1E2A A;  3UT5 E;  2UXC T;  2HN2 A;  4KX6 A;  3KBU A;  4H9Q C;  2BG9 A;  4MAL A;  5AQI B;  3ZYM A;  4TX5 A;  1L0V A;  2LOS A;  1QSD A;  3RGL A;  4H9P C;  4UV8 B;  5DAB A;  4UXN B;  3T1H T;  4H9N C;  5EK3 A;  3UFE A;  1O3X A;  4TWF A;  2XSB A;  5AFU L;  2D0T A;  2SPC A;  2CHN A;  4EV6 A;  4M1P A;  3VHL A;  3ESL A;  4TN7 B;  4BA9 A;  4HE8 A;  3RI5 A;  3AAE B;  4I0U A;  3FXD B;  3CIR A;  3O1I A;  4Z91 A;  3LK4 2;  5L4E A;  3ZCJ A;  4ZEY A;  2ODV A;  4PFO A;  4TZ4 C;  1FEW A;  5HEO A;  3U78 A;  4MHC A;  4CI3 B;  5BR8 T;  1X79 A;  1UX4 A;  4WZX A;  3KV4 A;  2H3R A;  2DI4 A;  4JI7 T;  4YT0 A;  3AXJ A;  4DBQ A;  3SOL A;  5FXW A;  2M6I A;  5JDL A;  5LGN B;  1MIY A;  3KIN B;  1IJ6 A;  5DQV A;  3J9X 1;  4WBO A;  3ZT5 A;  5C8Y E;  1NEK A;  3KV9 A;  4X65 T;  2XQ8 A;  2KWH A;  3OTO T;  4IIJ E;  4Q25 A;  5ABE A;  5JRE A;  3EAB A;  1VRB A;  4ZI2 D;  2JMK A;  3PUR A;  2XQ3 A;  2LEH A;  4DV7 T;  4P0A A;  2QYW A;  3CKD A;  3ZJ2 A;  2MYS A;  3ZMT B;  2NTY A;  1UX5 A;  4ILU A;  4U33 A;  3GA8 A;  2L3L A;  2XSA A;  2V7K A;  2CBI A;  3BQL A;  3FBL A;  1VOM A;  3P7I A;  3N5L A;  2MPK A;  3EHZ A;  5TAO A;  5JTG A;  3NWI A;  1GQE A;  5LB7 B;  4GKJ T;  2FUP A;  3AE3 A;  2WWV A;  2XAS B;  5LXT E;  2CWO A;  5AQU B;  4AQF C;  3N9M A;  1BR2 A;  4H9R C;  1HS7 A;  3OBV E;  3ZSS A;  4AKL A;  4PJJ A;  5L47 A;  5CA0 E;  2IML A;  4AIS A;  5ADX L;  4JBW F;  1HX1 B;  4DMW A;  3K3Q C;  1UCU A;  3F57 A;  2LKH A;  4ZI7 E;  4YJ3 E;  3R84 B;  4IE7 A;  3NVO A;  3VR8 A;  2CMR A;  5FXX A;  5LJM A;  4JI1 T;  5FY0 A;  4LFB T;  1JNZ A;  2WSS V;  2M67 A;  3AE1 A;  4IL4 A;  2W61 A;  5IHY A;  4B6X A;  5FP3 A;  5JDH A;  2Q9Q B;  2RP4 A;  2EHO A;  2Q9Q D;  2LJL A;  5AQT B;  3SFD A;  5L4H A;  3NBX X;  4A5X A;  2X9W A;  1XDP A;  2VKJ A;  2ZLY A;  4COF A;  1R8I A;  1SA0 E;  1ZKE A;  2RA1 A;  3M3Z B;  3AEE A;  5EK2 A;  2OA5 A;  4GKK T;  2LSJ A;  2V7I A;  2XJ7 A;  1KNP A;  2JQ9 A;  2QA7 A;  1J5E T;  5CJ5 A;  4PJN A;  1XWM A;  1VCS A;  4IE0 A;  4TWD A;  3TKL B;  3I0O A;  3PDY A;  1W0B A;  3ABV A;  1U4Q A;  1DU2 A;  1HG2 A;  2ZMA A;  3C98 B;  4NUV A;  4UR9 A;  4UF0 A;  4OFZ A;  5EZY E;  3I9Y A;  1IBM T;  2VQE T;  4OK0 A;  4LF9 T;  3RIU A;  2E8I A;  5JDG A;  2XAF B;  3G06 A;  3I0Q A;  2JQK A;  2MAW A;  3NRY A;  2J4G A;  2PFV A;  4E7S A;  5JR9 A;  3UUL A;  1YW0 A;  3ZN1 B;  1YXR A;  2D0U A;  4P09 A;  2UXX B;  4ADZ A;  5AQO B;  1KK7 A;  1MIV A;  1S35 A;  3PUA A;  4JI6 T;  4KBM B;  2A2F X;  4I43 B;  3ZLI A;  4CXW A;  4YXD A;  5LNK A;  4DR6 T;  3RRC A;  4YSY A;  3AAA B;  4A97 A;  1UUS A;  3R6N A;  3O4X E;  2VVS A;  2W4X A;  3HKE E;  4OHF A;  3AE4 A;  4Z90 A;  4ZI3 C;  1LVK A;  2D9D A;  3HR0 A;  4EYY R;  3O1J A;  3DJB A;  3PUW F;  1MND A;  2W63 A;  1UGO A;  3IF8 B;  4ERR A;  5HXC A;  3N9Q A;  5C2T A;  1HNZ T;  3LK2 B;  5L3B B;  2YDR A;  4GK5 E;  3AEF A;  4PNI A;  4IE4 A;  4WNK A;  4QXB B;  3C51 A;  1IJ5 A;  3ZMZ B;  4LFA T;  2CPT A;  4X1K E;  4MFR A;  4U2Z A;  5FY7 A;  1ZEE A;  2WY2 A;  3ZYK A;  5HXH A;  1N33 T;  2KZ7 B;  3HI2 A;  2E5V A;  4O2B E;  4QX7 B;  4DV2 T;  2X9H A;  3NZP A;  4EED A;  1WYB A;  5AQR B;  4ZOL E;  2MBG A;  1N32 T;  1KNR A;  1CUN A;  3CX6 B;  3N2G E;  5M4Y A;  2LRL A;  4XBF B;  2KXP B;  4HTE A;  2C5J A;  1XNR T;  4EZ4 A;  2CXF A;  2IC9 A;  1BR4 A;  2E9X C;  2LM9 A;  2PG8 A;  5HEH A;  3W15 B;  5AQP B;  2WWU A;  5FL1 A;  1T8B A;  2BKP A;  5FXZ A;  2BS2 A;  2LOP A;  2NW8 A;  5J2U E;  2HN1 A;  4IGU A;  3ONX A;  4PK4 A;  3MJX A;  4K0U A;  3QOF A;  3DTO A;  4DO0 A;  2BG9 C;  3QK6 A;  4ZXL A;  5HYA A;  1SE7 A;  4CZZ B;  2K5B B;  2KT9 A;  1NEN A;  5HWX A;  1T98 A;  3C4Z A;  1D1A A;  1D1B A;  2C5I T;  2WZH A;  2BBH A;  3AEG A;  3AE2 A;  3PV0 F;  4MBQ A;  4H9O C;  3AEA A;  4U3C A;  5FXV A;  5JDN A;  2N1G A;  2N2N A;  3KVB A;  2XM2 A;  3A7M A;  3GMI A;  4O8S A;  4GYR A;  4YY3 T;  1T7S A;  3N2O A;  1HF8 A;  2XQ4 A;  3K3N A;  3UUB A;  4JI3 T;  4BJN A;  2NOX A;  4ZZB A;  2ZM2 A;  2V1D B;  3D0T A;  3I1A A;  4AQF A;  3FHN A;  2FJE A;  4NPP A;  5LG3 A;  3L39 A;  4X62 T;  2Y8D A;  4CQI A;  2E2A A;  2VQF T;  4X64 T;  4AQG A;  5LHH B;  5FVK A;  4C91 A;  5JRC A;  4Z8X A;  2W2U A;  4V1A v;  3EAM A;  2YEV C;  1HCI A;  1US7 B;  2WU2 A;  2Q9Q A;  3RIA A;  4X5T A;  2LE8 A;  2UUC T;  3LFM A;  4DUZ T;  3EI0 A;  4L9I A;  4DV1 T;  1LRZ A;  1D0Z A;  2N9D A;  3JAD A;  4BJM A;  3ETU A;  2WDV A; 
#chains in the Genus database with same CATH homology
 4HKA A;  2ACX A;  3KV6 A;  3N2K E;  3RPU A;  3QC9 A;  3ZMS B;  2BZB A;  2HH7 A;  2K9A A;  2XAG B;  3KBT A;  4TV9 E;  3Q5X A;  4NUU A;  2WMO A;  3AVR A;  4TUY E;  4X20 E;  5GON E;  4QKN A;  3RC8 A;  1LVF A;  3GN5 B;  5H6R B;  4X1I E;  3LK3 B;  2IAK A;  1AJ3 A;  2E9X A;  4UV9 B;  4EZH A;  3E0Z A;  3CQC B;  3EUH A;  5LBM A;  2L9Q A;  1EZ3 A;  2KWI B;  4X1Y E;  2DHR A;  2VKD A;  4U74 A;  5JR9 C;  5HXS A;  5ETW A;  2CLY C;  3S4U A;  5DJQ C;  5LA6 E;  2XAQ B;  4IST A;  5L3G B;  2V26 A;  4ASK A;  4J2C A;  5FY1 A;  4DMV A;  3PUQ A;  3N9P A;  1YD8 G;  1G8X A;  4DBR A;  2H7V C;  2J1D G;  3OKQ A;  4L5G A;  3RYI E;  2GK9 A;  5IYZ E;  3CWZ B;  4JEH B;  4HEA A;  4UVA B;  4P0A A;  2WAU A;  4AKR B;  5FNV E;  3KFW X;  2WM9 A;  4O2A E;  3BK9 A;  5JQG E;  5CA1 E;  3H3A A;  3ZJ1 A;  1YKH B;  3RC3 A;  1SHZ C;  4UVB B;  3WAJ A;  2LHN A;  1HFA A;  5BMV E;  4PJL A;  2DNX A;  1OWA A;  2YU2 A;  4ISS A;  3SS1 A;  3P8C D;  3FBZ A;  3N9L A;  2DLR A;  3GN5 A;  4GIW A;  3GWH A;  3UUM A;  3M65 A;  2XTL A;  2EHO D;  3JC6 C;  2X66 A;  5EK4 A;  4EOZ B;  2YK0 A;  2XHE B;  2YIN A;  2XAJ B;  3CPZ A;  3RRW A;  3ZC1 A;  2MOZ A;  3Q9D A;  3N9N A;  4WW0 A;  4PK6 A;  5L3D B;  2D2S A;  2VL8 A;  2VAS A;  5LCY A;  2KIN B;  2LSI A;  1QUU A;  2LT3 A;  4EIW A;  4EYU A;  3CQX C;  3K3O A;  4AKI A;  3HL6 A;  3MAC A;  3MK7 C;  4QXH B;  1MMA A;  4QXC B;  2C0S A;  4UF0 B;  3V5U A;  3PE0 A;  2X9Y A;  1FIO A;  5KX5 E;  3O9X A;  2XUE A;  1IZN B;  3NRX A;  1MMG A;  1ZV4 X;  4EB6 E;  2DCF A;  2WBL A;  4PJM A;  2NP9 A;  4ZHQ E;  2MTQ A;  2DWK A;  2V7M A;  2HPL A;  4UIG A;  4AXP A;  3RYF E;  4CI1 B;  1MMN A;  1NAF A;  2BVL A;  2BVM A;  2E9X B;  3L3P A;  1MMD A;  3BQK A;  2ZM0 A;  2KMF A;  3ANW B;  2H7O A;  4IDZ A;  3C4W A;  3FB2 A;  4AKH A;  2ES0 A;  2Y6X A;  3RKO A;  4YJ2 E;  5H6Q B;  3VKH A;  2W62 A;  4EAH A;  5LYJ E;  3CVR A;  1FMV A;  4H63 H;  2XQY A;  3E08 A;  5JVD E;  2Q9Q C;  4C90 A;  5KDM C;  5HAX A;  3CX7 B;  3O1H A;  2XAH B;  3UTK A;  1KNZ A;  2KLQ A;  4QX8 B;  2W0G A;  2CCQ A;  1D0X A;  4G2A A;  4U72 A;  4AI6 A;  2I59 A;  3WAK A;  3C4X A;  2PBI A;  2JPF A;  3AA1 B;  4IHJ E;  1YKE B;  3NZQ A;  5J2T E;  4H63 V;  5KMG P;  4CXY A;  4AKG A;  1HX8 A;  2WMN A;  4IE5 A;  1WLX A;  4MLK A;  4TV8 E;  2VKH A;  5F8P A;  2X9X A;  5FYM A;  1WRD A;  2CLY B;  3LBX A;  1BR1 A;  3CX8 B;  5JR9 B;  3LJC A;  5LGU B;  3QUJ A;  3MKD A;  3LBX B;  1HTJ F;  4PAG A;  1FMW A;  5JRC B;  2HPJ A;  2X0L B;  3I9W A;  2CXL A;  3RH3 A;  3ANW A;  3SWH A;  3HKD E;  4HFV A;  4XAX B;  3ZC0 A;  4XZC A;  4ANJ A;  5A1L A;  2IC6 A;  3PU8 A;  3BQI A;  3HKB E;  4I55 E;  2C5K T;  3DP7 A;  5HXE A;  2CE7 A;  3K8P C;  2NW9 A;  4QHO A;  4N78 D;  2K48 A;  4JUY A;  2B1E A;  3KDS E;  3OJA A;  5L3F B;  2W00 A;  5FMN A;  4PFP A;  2QGS A;  2NTX A;  2VK9 A;  4F6R C;  3PUG A;  3HA4 A;  3IHR A;  4QWN B;  2NW7 A;  5JDQ A;  2NWB A;  3AA6 B;  2BDE A;  2EHO C;  3JC6 D;  1H7C A;  2IW5 B;  3ZCI A;  1HG5 A;  3L09 A;  2Y48 B;  5LP6 E;  4PK5 A;  4O4I E;  3VU7 H;  2E9X D;  1WYC A;  4FJO A;  3ZPO A;  4GK0 E;  3SRZ A;  4ZI2 C;  2LHR A;  2V7L A;  4I4T E;  1BR0 A;  4A56 A;  3PTR B;  4PW8 A;  3Q2M A;  4KMC A;  3FXE B;  3EVY A;  3UUX B;  4O4J E;  3AB3 B;  3T8O A;  2G0U A;  2A3D A;  3EDV A;  5JH7 E;  3AA0 B;  2PJQ A;  3V5S A;  1WR6 A;  5LHG B;  5JRC A;  3MA9 A;  3AVS A;  1U5P A;  2JRK A;  2UXN B;  4DVD A;  4JEU B;  5LJN A;  1Y64 B;  2JQQ A;  2D5U A;  2CA5 A;  4YFS A;  2CEA A;  2Z6E A;  1D1C A;  5HXR A;  2JMH A;  3IBP A;  3C50 A;  3OYZ A;  3E22 E;  4ZS3 A;  4CI2 B;  5HWY A;  1MIW A;  3OYX A;  3ZMU B;  5L3E B;  3EDU A;  2LSY A;  3ZMV B;  2CWY A;  2YU1 A;  3UUN A;  4OYK A;  3C64 A;  1B7T A;  4DND A;  2V7J A;  4E7Z A;  1Z0P A;  2ZM8 A;  5LG4 A;  3CQG B;  4H9S E;  1IAP A;  1OXZ A;  4KP3 C;  4ZS2 A;  1LKX A;  3U3I A;  3AAI A;  3B57 A;  2K24 A;  3J7Y q;  4UVC B;  1NWM X;  4L0R A;  5LOV E;  5L3C B;  4GOU A;  3IEE A;  3A5X A;  3F2E A;  1ZHC A;  3WI3 A;  3B13 A;  5LHI B;  4WBN E;  2ODU A;  5JDM A;  3MXZ A;  2DWG A;  3RYH E;  2KND A;  2P9B A;  5LGT B;  4HGA A;  3MZK B;  5F3J A;  3ZEF B;  2EHO B;  3CML A;  5L2L A;  3H37 A;  3PUS A;  4ZI3 D;  2LSK A;  2X67 A;  5CB4 E;  3F31 A;  4I50 E;  5LBQ B;  4UEL A;  1G73 A;  1S94 A;  2X51 A;  3LG7 A;  4BAY B;  4IE6 A;  4UEM A;  2VB6 A;  3KV5 A;  2A72 A;  4JLE A;  3AA7 B;  3ZYL A;  2L8K A;  4OYJ A;  4YHJ A;  4KUM B;  4YLH A;  2JJ9 A;  4EXT A;  3RYC E;  4O4H E;  3KVA A;  2VWA A;  4CXX A;  4FI5 A;  3HKC E;  1D0Y A;  4HN9 A;  2X68 A;  4P0B A;  1E1H B;  2CXD A;  1V9D A;  3ETV A;  3PU3 A;  2CM0 A;  1MNE A;  2LSG A;  5JDF A;  3N9O A;  4G63 A;  3RX6 A;  4O4L E;  3Q5W A;  4GYS A;  5DQW A;  2VKO A;  5E0O A;  3UT5 E;  4MAL A;  3KBU A;  4H9Q C;  3ZYM A;  4TX5 A;  2LOS A;  1QSD A;  4H9P C;  4UV8 B;  5DAB A;  4UXN B;  4H9N C;  5EK3 A;  3UFE A;  1O3X A;  5AFU L;  2D0T A;  2SPC A;  4M1P A;  3VHL A;  3ESL A;  4TN7 B;  4BA9 A;  4HE8 A;  3AAE B;  3FXD B;  3O1I A;  3LK4 2;  3ZCJ A;  2ODV A;  4PFO A;  4TZ4 C;  1FEW A;  3U78 A;  4CI3 B;  4MHC A;  1X79 A;  1UX4 A;  3KV4 A;  2H3R A;  2DI4 A;  4DBQ A;  3SOL A;  5FXW A;  5JDL A;  5LGN B;  3VKG A;  1MIY A;  3KIN B;  1IJ6 A;  5DQV A;  3J9X 1;  4WBO A;  5C8Y E;  3KV9 A;  2KWH A;  4IIJ E;  5JRE A;  1VRB A;  4ZI2 D;  2JMK A;  3PUR A;  2LEH A;  3CKD A;  3ZJ2 A;  2MYS A;  3ZMT B;  2NTY A;  1UX5 A;  4ILU A;  3GA8 A;  2L3L A;  2V7K A;  3BQL A;  5TAO A;  3FBL A;  1VOM A;  3P7I A;  3N5L A;  5LXT E;  2XAS B;  2CWO A;  4AQF C;  3N9M A;  1BR2 A;  4H9R C;  1HS7 A;  3OBV E;  4AKL A;  4PJJ A;  5CA0 E;  5ADX L;  4DMW A;  3K3Q C;  1UCU A;  3F57 A;  4ZI7 E;  4YJ3 E;  3R84 B;  4IE7 A;  2CMR A;  5FXX A;  5LJM A;  5FY0 A;  5IHY A;  2WSS V;  2M67 A;  4B6X A;  2W61 A;  5JDH A;  5FP3 A;  2Q9Q B;  2RP4 A;  2EHO A;  2Q9Q D;  2LJL A;  3NBX X;  2X9W A;  2ZLY A;  2VKJ A;  1SA0 E;  1ZKE A;  5EK2 A;  2RA1 A;  2OA5 A;  2LSJ A;  2V7I A;  2QA7 A;  4PJN A;  4IE0 A;  3TKL B;  3I0O A;  3PDY A;  1U4Q A;  1HG2 A;  2ZMA A;  3C98 B;  4NUV A;  4UF0 A;  4OFZ A;  5EZY E;  3I9Y A;  4OK0 A;  5JDG A;  2E8I A;  2XAF B;  3I0Q A;  3NRY A;  2PFV A;  4E7S A;  5JR9 A;  3UUL A;  1YW0 A;  3ZN1 B;  2D0U A;  4P09 A;  2UXX B;  4ADZ A;  1KK7 A;  1MIV A;  1S35 A;  3PUA A;  4KBM B;  2A2F X;  4I43 B;  3ZLI A;  4CXW A;  5LNK A;  3RRC A;  3AAA B;  3R6N A;  3O4X E;  3HKE E;  4EYY R;  4OHF A;  4ZI3 C;  1LVK A;  3HR0 A;  3O1J A;  3DJB A;  1MND A;  2W63 A;  4ERR A;  3IF8 B;  5HXC A;  3N9Q A;  3LK2 B;  5L3B B;  4GK5 E;  4PNI A;  4IE4 A;  4WNK A;  4QXB B;  3C51 A;  1IJ5 A;  3ZMZ B;  4X1K E;  4MFR A;  5FY7 A;  1ZEE A;  3ZYK A;  5HXH A;  2KZ7 B;  3HI2 A;  4O2B E;  4QX7 B;  2X9H A;  3NZP A;  1WYB A;  2MBG A;  4ZOL E;  3CX6 B;  1CUN A;  3N2G E;  5M4Y A;  4XBF B;  2KXP B;  4HTE A;  2C5J A;  4EZ4 A;  2CXF A;  2IC9 A;  1BR4 A;  2E9X C;  2LM9 A;  2PG8 A;  3W15 B;  2WWU A;  5FXZ A;  2LOP A;  2NW8 A;  5J2U E;  4IGU A;  3ONX A;  4PK4 A;  3MJX A;  4K0U A;  3DTO A;  4DO0 A;  3QK6 A;  5HYA A;  4CZZ B;  2K5B B;  2KT9 A;  5HWX A;  1T98 A;  3C4Z A;  1D1A A;  1D1B A;  2C5I T;  5FXV A;  5J1G A;  3ZN0 B;  4MBQ A;  5JDN A;  4H9O C;  2N1G A;  2N2N A;  3KVB A;  3GMI A;  4O8S A;  4GYR A;  3N2O A;  1HF8 A;  3K3N A;  4BJN A;  2NOX A;  3D0T A;  2ZM2 A;  2V1D B;  3I1A A;  4AQF A;  3FHN A;  2Y8D A;  4CQI A;  4AQG A;  5LHH B;  4C91 A;  4Z8X A;  4V1A v;  2YEV C;  1HCI A;  1US7 B;  2Q9Q A;  2LE8 A;  3LFM A;  4L9I A;  1LRZ A;  1D0Z A;  2N9D A;  4BJM A;  3ETU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...