3LBXB

Crystal structure of the erythrocyte spectrin tetramerization domain complex
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
184
structure length
182
Chain Sequence
GSTADKFRFFSMARDLLSWMESIIRQIETQERDVSSVELLMKYHQGINAEIETRSKNFSACLELGESLLQRQHQASEEIREKLQQVMSRRKEMNEKWEARWERLRMLLEVCQFSRDASVAEAWLIAQEPYLASGDFGHTVDSVEKLIKRHEAFEKSTASWAERFAALEKPTTLELKERQIAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords Spectrin alpha chain, erythrocyte
publication title Crystal structure and functional interpretation of the erythrocyte spectrin tetramerization domain complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 67
structure length 182
sequence length 184
ec nomenclature
pdb deposition date 2010-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00435 Spectrin Spectrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.60 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3lbxB01
1.20.58.60 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3lbxB02
3FB2A 1WLXA 3F31A 3UUNA 3EDVA 3LBXB 1QUUA 1HCIA 3UUMA 2ODUA 2SPCA 3UULA 2ODVA 1CUNA 1U5PA 3PE0A 1U4QA 1OWAA 3LBXA 1S35A 1AJ3A
chains in the Genus database with same CATH superfamily
5L3GB 4YTPA 1L0VA 3DP7A 4YTMA 5JDFA 1X79A 3AECA 3EABA 2Q9QC 3EUHA 4F6RC 4LMJA 4CN1A 4QX7B 2HPJA 2Q9QA 2WB5A 2QGSA 3UT5E 3P4WA 3SRZA 5ADXL 4KI0F 2H3RA 4O4JE 3O1HA 4OFZA 2LSYA 2X66A 5AQSB 3FB2A 3PJAA 4AQYT 5FNVE 5FYMA 2KWHA 2ODVA 2N9DA 3H3AA 2VVNA 2LSGA 4A97A 2X9WA 3F31A 4DV4T 3Q5EA 5JRCB 3AEGA 4HFBA 3Q9DA 1CUNA 2A9UA 2YINA 3FBZA 2WCAA 3A7MA 3M65A 3CVRA 3LJCA 4ISSA 4IE4A 1LVKA 3CK6A 4L0RA 4MHCA 3UTKA 2W0GA 3AEFA 2CXFA 4DR4T 3QNUA 4ZOLE 2Q9QD 3Q5DA 2H7VC 4CI3B 3P4QA 5EK2A 4O4HE 5BR8T 2ZM6T 4OYJA 3CX8B 4AXPA 3RLFF 1M62A 5M4YA 2P9BA 5KXJA 5J0ZA 3ESLA 3E0ZA 4E7ZA 2K48A 2VKJA 2YDQA 4YY3T 4E7SA 4EGWA 4EYUA 3RI5A 4ILCA 2NP9A 3AE2A 3PU8A 4H9PC 1YQ3A 1SE7A 2E2AA 4X1YE 5CJ5A 4B3TT 1KFYA 4FJOA 5HXEA 2V7MA 3AA0B 5L3BB 4PW8A 2FJBA 2V6XA 2IW5B 2UU9T 1WR6A 1OXZA 1WR0A 3CMLA 2E9XB 2LOPA 4HFIA 3N9LA 4DV1T 3AVRA 1B7TA 4KHZF 2CPTA 1JNZA 1VCSA 2RA1A 4NXMT 4YLHA 5AQIB 1EZ3A 2WWVA 4JI7T 4EAHA 2MBGA 1N34T 4TV9E 1FEWA 5LNKA 2VB6A 3IA3A 2WDVA 2V7KA 4QWNB 4ISTA 2ES0A 3FZKB 4DVDA 4DR5T 4WZXA 4WYVA 4P0BA 4PAGA 2V1DB 3JADA 5FL1A 3ZT6A 1FJGT 3O4XE 4HTEA 2V7JA 4PK4A 2QA7A 3LK2B 4DUZT 4OX9T 1J1JA 2BKPA 2WQYA 4KHPT 2VASA 4EZ4A 4NPPA 2FJDA 2DCFA 4CXWA 3NBXX 3GN5B 2XQ9A 3NZPA 2M6BA 2VQET 3UU3A 5H6QB 1GQEA 2X68A 3PTRB 2ODUA 3AB3B 2XUEA 2UUAT 4AISA 2LM9A 2VKHA 4G2AA 3K3NA 2BG9A 4ILBA 4AIUA 2LEHA 5HCJA 1MIWA 3VRBA 2XSAA 5HEUA 2LM2A 5HWXA 3ZJ1A 3LFMA 2VL8A 4JI6T 3E08A 4A98A 4DV3T 4LFAT 1X9BA 5EZYE 4H9NC 5AQHB 1MNDA 1U4QA 5LGNB 2WM9A 4JV5T 5HXRA 2JMKA 2EHOA 5JH7E 1LVFA 5L3EB 3O1JA 5F8PA 3WI3A 2WP9A 4X1KE 5AQJB 5L3CB 1QUUA 3U78A 3EVYA 1V9DA 2ACZA 2UUCT 3ZN0B 3RQWA 3TLSA 3WAKA 5AQLB 3UU8A 1FMWA 4UF0B 3OBVE 3CQGB 3PUAA 4Q25A 2YDRA 3Q2MA 2VKDA 4TWHA 3KDSE 1D1CA 2WAUA 3CPZA 2V5CA 5AQPB 4I0UA 3PUXF 5LXTE 1S94A 1D1AA 3AE4A 1MMAA 3N9PA 4LF6T 5IWAT 1VRBA 5L47A 1HNXT 2W4XA 4JI5T 5JVDE 3ZYMA 1DU2A 4P09A 3BK9A 2M67A 4U2YA 2IC9A 2BS4A 2CWYA 1IAPA 2FUPA 3SWHA 1WFDA 2XTLA 4MFRA 4JLEA 3ZJ2A 4AQFA 2BG9B 2WU5A 3K1SA 4UV8B 4JYAT 3KBTA 3Q5XA 5AQFB 3E22E 2DL1A 4HEAA 5JQGE 3SS1A 1M7KA 5L4EA 3I0OA 4AQGA 1KEYA 4A56A 4HWCA 2EHOD 1E2AA 1WRDA 4A5XA 5BMVE 4DNDA 3OPCA 3JC6D 4TX5A 4CI1B 5LMNT 4NUUA 4IIJE 3L3PA 5JTGA 3N2GE 3PJAJ 2EHOB 4I55E 4ZHQE 1US7B 3DJBA 3ONXA 4ILAA 3UFGA 3AE6A 4YHJA 4O4LE 4ZS3A 3N5LA 2W63A 3C4XA 2V6YB 1OEDB 2W2UA 1HNWT 3FZFB 4L9IA 2PG8A 2QVAA 3D0TA 2A3DA 3RRCA 4LF9T 3P4RA 4IDOA 3HKEE 3CWZB 2UXDT 3M3ZB 1YKHB 3J9X1 5AQTB 5LMUT 2ZM2A 2XQ8A 3V5UA 2X0YA 5AQKB 4GOUA 4BJMA 2X0LB 4ZEYA 5FP3A 2X67A 3C64A 1MIVA 4J2CA 4EB6E 3FXEB 5FY1A 3ZPOA 1D0XA 4B3RT 2MOZA 3N2KE 1J5WA 4JI4T 2VVSA 4I50E 4PK5A 2KT9A 1YKEB 3ZKRA 4ZZCA 1XDOA 5FVLA 3ZC0A 4TWFA 1YQ4A 4ZI2D 3ZMVB 1XZYA 4NIQA 3HKBE 1YW0A 2M6IA 5LG3A 4P0AA 2X9HA 2DWGA 4JI2T 3AVSA 4YT0A 2KZ7B 2MAWA 4DV7T 3AE8A 2C5IT 3GWHA 4KP3C 2X9YA 3PUYF 3J7Yq 2BKNA 4O2BE 3UUMA 2XQ5A 3EAMA 1IBLT 2LSKA 4PK6A 4WBNE 2WU2A 3BQKA 2WS3A 2KSRA 4N78D 4YXDA 2CM0A 5DQVA 3VU7H 5CGMA 4X20E 3QB5A 2V26A 4IE6A 4HKAA 3JAFA 2JRKA 3KV9A 4UXNB 3IBPA 4DBQA 1HR0T 3RX6A 2XAFB 2AE9A 4IL4A 4DIDB 3SFEA 2XAHB 2CLYB 5ABEA 1MNEA 4BAYB 2E5LT 2WZIA 2E9XA 2KNDA 3ZT7A 5C3JA 2E8IA 5DABA 5GONE 5JDMA 1N32T 2PJQA 5IUXA 1NWMX 3PDYA 4IDZA 2CBIA 3WAJA 2KWIB 1MIYA 1T98A 3RRWA 3VRAA 3PUSA 4NUVA 2LKHA 2XQ4A 1KK7A 5JDQA 4O2AE 2KINB 2X51A 2WMOA 3G06A 3K3OA 2I6HA 4UIGA 2VWAA 3L8RA 2RPAA 4QH5A 2NW9A 2V8SV 3ZT5A 2YU2A 3PUGA 3RPUA 2BVMA 3GA8A 3RF1A 3CQCB 5ABGA 3HL6A 4JI8T 2GK9A 2C5JA 2XHEB 3B5MA 5AQQB 3ZMZB 4DR7T 2XQAA 4DV6T 1MMDA 2XJ7A 4HGAA 1HG5A 3GN5A 1WYCA 5DQWA 4JEUB 5ABFB 2PFVA 4ERRA 4YJ3E 1JNRA 4IE0A 3ZYLA 3JAEA 2E9XD 5AQGB 2HN2A 3RC8A 4DMWA 4U7IA 4IT4A 5LOVE 1QSDA 1XWMA 2G0UA 4BA9A 2NR4A 3RYCE 2C5KT 2Y8DA 4EZHA 3L09A 1HFAA 4B3MT 1SUMB 3FHNA 4ANJA 4P1NA 2DWKA 3N9QA 4ZS2A 4HWFA 4U31A 4V1Av 3VKHA 2IMLA 3ONJA 3PURA 2KMFA 3ZC1A 1D0ZA 1ZV4X 4AKLA 3AE1A 5AQOB 4MLKA 3C98B 4YSYA 3HR0A 1KNRA 1NAFA 3MKDA 1YXRA 2LLYA 5LA6E 4UF0A 1HTJF 3C51A 5CA1E 4YSXA 3KVBA 3AAAB 3CX7B 5JREA 2D0TA 4DR3T 4HFCA 4C91A 3OYZA 5HXSA 4LF4T 2RP4A 3UUNA 3I1AA 3O9XA 5AQRB 1VCTA 2YEVC 2BVLA 4IE7A 1Y01A 5FXZA 1HX1B 2L3LA 5DJQC 3EDVA 2BG9C 3B57A 4LFCT 2IUBA 2IDOB 2WWUA 3P4PA 3RIUC 2OLTA 2BS3A 3MXZA 5EK4A 3HA4A 4TNVA 3RIUA 3AAEB 5A1LA 5HEOA 2IIUA 2A2FX 2JIWA 2WBLA 1T7SA 2EHOC 2LJLA 3RGLA 3FZHB 4JUYA 4Z8XA 1OWAA 4CQIA 5F5WA 3JC6C 4EIWA 2K5BB 1UCUA 3P8CD 3AA1B 3PV0F 1Z8UA 3NRXA 1OEDC 2WZHA 4F8HA 5ABHA 3AA6B 1XDPA 4G63A 4MALA 4DR1T 3KV6A 4O8SA 4AKIA 2V6YA 1OEDA 3GMIA 4LFBT 4U72A 2NTXA 3PE0A 3A5XA 2Z6EA 4TWDA 2C0SA 1G73A 2BBJA 4WNKA 5HEHA 1D1BA 3RQUA 2LKGA 1IBMT 3AEDA 2ZLYA 2UXXB 4ZI7E 3QB5K 3RKGA 2IAKA 4EEDA 2DLRA 2V7IA 3IF8B 1E7PA 2L8KA 2VKOA 1J5ET 2VK9A 4GK5E 4DUYT 3K3QC 1WLXA 2A72A 2L9QA 1D0YA 4CZZB 2VURA 5FMNA 4CI2B 2CWOA 2LRKA 1W9RA 4TUYE 2AXDS 2WDQA 1N33T 4AQFC 3ABVA 5LGTB 4UVAB 2XAQB 2UXNB 5JDLA 2PTFA 3PUVF 4X62T 4IGUA 3FZLB 4CN4A 5IHYA 3UUBA 4ZZBA 2N1GA 4X64T 3IHRA 2CEAA 3QUJA 3QOFA 5LHGB 3TLVA 4B6XA 3UQ7A 5JDGA 1E1HB 2BG9E 3TLUA 3CX6B 3RC3A 2JPFA 4ZI2C 4X65T 3NRYA 4PFOA 2UUBT 2IC6A 1SHZC 3AA7B 2XZEA 5LHIB 4EOZB 2UXCT 3RHWA 1UURA 4PNIA 2JQ9A 2D5UA 3Q5WA 4X1IE 2LOSA 4ILUA 3ZYKA 4L5GA 2LHRA 2FBWA 1UX5A 3RYHE 1HF8A 1T8BA 4B3ST 5ETWA 3UFEA 2W62A 2YK0A 2QRXA 3FZMB 4K0KT 2I0MA 4UVCB 2BDEA 2JJ9A 4PJMA 2CLYC 1YD8G 3ZSSA 4LF7T 3OVUA 4HFEA 2NW7A 4QH4A 3ZMUB 2WSSV 3T1HT 3ZCJA 3X1DA 3VKGA 4WW0A 5AQUB 1BR4A 5EK3A 2YKSA 1KNPA 3ZMSB 4CN6A 4YTNA 3C50A 4JI1T 4EXTA 5C2TA 4DV2T 4NXNT 4ASKA 4CXXA 3AXJB 2BBHA 2MPKA 4O4IE 2K24A 4DV0T 4H63V 2FJAA 2MYSA 2B76A 1ZKEA 5JR9B 1AJ3A 4GKJT 4C90A 2CCQA 3P50A 3MACA 1H7CA 1XNRT 4UV9B 1IZNB 4DO0A 1VOMA 2WMNA 1HX8A 4GK0E 1I94T 4UELA 2NOXA 2LHNA 2FJEA 2CRBA 5LP6E 4PJJA 5FVKA 5HCMA 3FBLA 3AE7A 3LG7A 2KXPB 2JQQA 5ABFA 1HNZT 2XQ3A 2VL0A 5FXXA 3ZSTA 3F2EA 3MZKB 5J1GA 5J2UE 4KBMB 3P4SA 4YFSA 1NENA 4GYSA 4DR2T 2Y48B 3ANWB 5AQNB 2E9XC 3I9WA 4UEMA 4GIWA 4HFHA 1ZHCA 2QYWA 1UGOA 4HN9A 4QXHB 2W66A 2W61A 4PJLA 4PJNA 2JQKA 3UULA 2XQ6A 3LBXA 4TNWA 4QKNA 2J62A 4WBOA 2D9DA 4JEHB 4Z91A 3AE3A 1W0AA 3H37A 5AQVB 4AKRB 2J47A 4QXCB 3LK3B 4EEBA 4BJNA 2J4GA 2XPKA 2CE7A 2XM2A 2LSJA 1BR2A 4IDNA 5L3DB 2X9XA 2CMRA 4JBWF 3UU5A 1UUSA 3AE9A 3K8PC 5C8YE 3QC9A 3RH3A 1G8XA 5HAXA 1QLBA 3CKDA 2PBIA 5HEJA 5CA0E 4KX6A 2CHNA 1Y64B 2R6GF 3R84B 1O3XA 3N9OA 1IJ6A 5FY7A 2Q9QB 4H9QC 2K3WA 4OYKA 1ZEEA 5F3JA 2XAJB 2BZBA 4UR9A 3RKOA 4H9RC 3TLTA 3NWIA 4OK0A 5KX5E 2H7OA 3ETVA 4GYRA 1BR0A 4CXYA 1BR1A 1LKXA 3PUWF 1ZOYA 3ZLIA 4OHFA 3KVAA 3UQ4A 4XBFB 2XQ7A 3I9YA 4DV5T 1Z0PA 1MMNA 4XAXB 5LGUB 4I4TE 1KF6A 2XY8B 3AEAA 4XZCA 2OA5A 3LBXB 3OKQA 4DR6T 3A8YC 3KV4A 4U74A 4LMLA 5FXWA 2F4VT 5LB7B 4QXBB 2N2NA 3OTOT 2KLQA 3RYFE 4YJ2E 3ZN1B 5FY0A 1UK5A 3OJAA 1T72A 4LMKA 3VR9A 4ADZA 2HHHT 3RIAA 4FI5A 1W0BA 4K0UA 4EYYR 1FMVA 3AE5A 4QHOA 4IHJE 2ACXA 2UXBT 3R6NA 4AKGA 2CXLA 3CIRA 3DTOA 4Z90A 2H89A 3KBUA 1CHUA 2XASB 5LCYA 2CHOA 1MMGA 3NVOA 4U3CA 3S4UA 2JQHA 5H6RB 3KFWX 5HXCA 1FIOA 4AKHA 3ZMTB 3EI0A 3W15B 4IE5A 4HE8A 2D2SA 5LHHB 3H3MA 3RIFA 2WDRA 3LDQB 4TV8E 2NW8A 2YDSA 3C4WA 1N36T 3BQIA 3UU6A 3I0QA 4ZI3C 3B13A 5IYZE 3SOLA 1XMQT 2LSIA 4X5TA 2BS2A 3HI2A 4AI6A 4X66T 3JCFA 4UVBB 2V5DA 4U33A 3AEEA 2DNXA 3MA9A 1I6ZA 3T8OA 3TKLB 5AQMB 5LYJE 4LF8T 5LJMA 5LJNA 2LT3A 3KINB 1IBKT 5FXVA 5AFUL 3P7IA 4HFDA 3T1YT 5LG4A 4PFPA 2CBJA 4LF5T 3OYXA 4H9SE 1IJ5A 1W09A 3O1IA 1XNQT 1UX4A 3SFDA 2CA5A 2YN6A 2W00A 3NKZA 2LE8A 1WCRA 3N9NA 1LRZA 5HXHA 5L4HA 5HWYA 5FKYA 3N9MA 1KNZA 1S35A 4IDPA 2B1EA 5LBQB 2K9AA 4KMCA 2WY2A 2JMHA 3C4ZA 4TN7B 2CXDA 3EHZA 3LSVA 2E5VA 3VHLA 3F57A 2XQYA 4ZXLA 3QK6A 4QH1A 5KMGP 5FL0A 3PU3A 3MK7C 4HWIB 4COFA 3VR8A 4ZI3D 2X0HA 2D0UA 2Y6XA 3NZQA 1XMOT 4YSZA 3UU4A 5L3FB 3AEBA 2XAGB 3AXJA 3N2OA 1U5PA 4HFVA 2YU1A 3KV5A 3ONLC 4HWHA 3HKDE 3U3IA 5JR9C 2LRLA 5E0OA 5LBMA 4U2ZA 3MJXA 4IDQA 5JR9A 2W67A 5JDHA 4I43B 3V5SA 2NWBA 4MBQA 2ZM0A 4M1PA 4U7YA 2IHR1 5JDNA 2H88A 2XSBA 2BKOA 5HYAA 5J2TE 3AAIA 5CB4E 3LK42 2DI4A 4H9OC 1NEKA 2HPLA 3CQXC 3PUQA 1SA0E 3TLWA 1OEDE 3RYIE 4EV6A 3IEEA 4KUMB 3L39A 3ANWA 2HN1A 3BQLA 2I59A 5TAOA 5L2LA 2ZMAA 4JI3T 2ZM8A 5CFBA 4DBRA 3FXDB 1HG2A 4HWDA 4JI0T 3HKCE 2DHRA 3ETUA 4YHHT 4GKKT 3PUZF 4DMVA 4TZ4C 1R8IA 5KDMC 4QX8B 5JRCA 2XM1A 2MTQA 2OV9A 3EDUA 4H63H 1HCIA 3UUXB 1HS7A 3ZCIA 2J1DG 2V7LA 4IREA 2SPCA 3ZEFB 2YOEA 2HH7A 2NTYA 1ZP0A 5HEGA 1WYBA 2VQFT 4IL9A
chains in the Genus database with same CATH topology
4MFRA 5FXZA 1Y64B 4JLEA 5L3GB 3ZJ2A 2L3LA 4AQFA 4UV8B 5DJQC 3EDVA 3KBTA 3R84B 3DP7A 3B57A 1O3XA 3N9OA 3Q5XA 1IJ6A 5FY7A 2Q9QB 5JDFA 3E22E 4H9QC 1X79A 4HEAA 5JQGE 4OYKA 2WWUA 3SS1A 2Q9QC 3I0OA 4AQGA 4A56A 1ZEEA 2EHOD 5BMVE 1WRDA 5F3JA 4DNDA 2XAJB 2BZBA 3EUHA 4F6RC 3MXZA 5EK4A 3HA4A 4QX7B 2HPJA 2Q9QA 3JC6D 4TX5A 4CI1B 3RKOA 3AAEB 4H9RC 4NUUA 4OK0A 4IIJE 5KX5E 5A1LA 2QGSA 3L3PA 2H7OA 3ETVA 4GYRA 3UT5E 3SRZA 2A2FX 3N2GE 2EHOB 2WBLA 4I55E 1BR0A 4CXYA 4ZHQE 5ADXL 2H3RA 2EHOC 1US7B 3DJBA 3ONXA 1BR1A 2LJLA 1LKXA 4YHJA 4CQIA 4JUYA 4O4JE 1OWAA 3O1HA 4OHFA 4O4LE 4Z8XA 3KVAA 3JC6C 4ZS3A 3ZLIA 4EIWA 3N5LA 2K5BB 1UCUA 3I9YA 4OFZA 4XBFB 2W63A 3C4XA 3P8CD 2LSYA 1Z0PA 2X66A 1MMNA 3AA1B 3FB2A 4XAXB 3NRXA 5LGUB 4I4TE 4L9IA 2PG8A 4XZCA 3D0TA 2OA5A 3LBXB 3OKQA 3AA6B 2A3DA 4G63A 4MALA 3KV4A 4U74A 3RRCA 3KV6A 5FNVE 4O8SA 5FYMA 4AKIA 3GMIA 3HKEE 2KWHA 4U72A 2ODVA 3CWZB 2N9DA 2NTXA 3PE0A 5FXWA 3A5XA 2Z6EA 3H3AA 2LSGA 1YKHB 4QXBB 2C0SA 2N2NA 3J9X1 2KLQA 3RYFE 4YJ2E 1G73A 3ZN1B 2X9WA 4WNKA 5FY0A 3OJAA 3F31A 1D1BA 2ZM2A 2ZLYA 2UXXB 4ZI7E 5JRCB 4ADZA 2IAKA 3V5UA 3Q9DA 2DLRA 2V7IA 4GOUA 4FI5A 4K0UA 4BJMA 4EYYR 2X0LB 3IF8B 1CUNA 1FMVA 2L8KA 2VKOA 2X67A 4QHOA 5FP3A 4IHJE 2VK9A 3C64A 2YINA 4GK5E 3FBZA 1MIVA 4J2CA 4EB6E 3K3QC 2ACXA 1WLXA 2A72A 3FXEB 1D0XA 3M65A 5FY1A 3ZPOA 3CVRA 2L9QA 3LJCA 4ISSA 4IE4A 3R6NA 2MOZA 3N2KE 1LVKA 4AKGA 2CXLA 1D0YA 3DTOA 3KBUA 4CZZB 4L0RA 4MHCA 4CI2B 5FMNA 3UTKA 2W0GA 2XASB 2CWOA 2CXFA 5LCYA 4TUYE 4I50E 1MMGA 4PK5A 4ZOLE 2Q9QD 2KT9A 4AQFC 3S4UA 5LGTB 5H6RB 2H7VC 4UVAB 1YKEB 3KFWX 2XAQB 2UXNB 5HXCA 4CI3B 5JDLA 1FIOA 3ZC0A 5EK2A 4O4HE 4AKHA 3ZMTB 4IGUA 3W15B 4ZI2D 4IE5A 4HE8A 3ZMVB 2D2SA 4OYJA 5IHYA 5LHHB 3CX8B 4AXPA 2N1GA 5M4YA 3HKBE 2P9BA 4TV8E 1YW0A 2NW8A 3IHRA 4P0AA 3ESLA 2CEAA 3E0ZA 2K48A 3QUJA 4E7ZA 2X9HA 3C4WA 2DWGA 5LHGB 3AVSA 2VKJA 2KZ7B 3BQIA 4B6XA 3I0QA 4E7SA 4ZI3C 3B13A 5JDGA 4EYUA 1E1HB 3CX6B 2C5IT 3GWHA 3RC3A 2JPFA 4ZI2C 5IYZE 4KP3C 3SOLA 2LSIA 2X9YA 3NRYA 4PFOA 3J7Yq 4O2BE 3UUMA 2IC6A 3HI2A 1SHZC 3AA7B 2NP9A 5LHIB 4AI6A 2LSKA 4EOZB 4PK6A 4UVBB 4WBNE 3PU8A 2DNXA 4H9PC 3BQKA 4X1YE 3MA9A 4PNIA 3T8OA 4N78D 3TKLB 4FJOA 5HXEA 2CM0A 2V7MA 3AA0B 5DQVA 3VU7H 5LYJE 2D5UA 3Q5WA 4X1IE 5LJMA 5L3BB 2LOSA 5LJNA 4PW8A 2LT3A 3KINB 2IW5B 4ILUA 5FXVA 4X20E 5AFUL 3P7IA 4L5GA 3ZYKA 2LHRA 1UX5A 2V26A 3RYHE 1HF8A 4IE6A 5LG4A 4HKAA 4PFPA 2JRKA 3OYXA 4H9SE 3KV9A 4UXNB 5ETWA 3UFEA 1IJ5A 2W62A 2YK0A 3IBPA 1WR6A 4DBQA 1OXZA 3CMLA 3RX6A 2E9XB 2XAFB 2LOPA 3O1IA 3N9LA 3AVRA 1UX4A 4UVCB 2BDEA 2XAHB 2JJ9A 2CLYB 1B7TA 2CA5A 2RA1A 4PJMA 1MNEA 2CLYC 2W00A 4YLHA 4BAYB 1YD8G 2E9XA 2KNDA 2LE8A 1EZ3A 2E8IA 2NW7A 3N9NA 3ZMUB 2WSSV 5DABA 1LRZA 5GONE 3ZCJA 5HXHA 3VKGA 5HWYA 3N9MA 5JDMA 1KNZA 2PJQA 1S35A 4EAHA 1NWMX 4WW0A 4TV9E 2MBGA 1BR4A 1FEWA 3PDYA 4IDZA 5LNKA 2B1EA 5LBQB 2K9AA 2VB6A 5EK3A 4KMCA 2V7KA 2JMHA 3C4ZA 4QWNB 4TN7B 3WAJA 4ISTA 2ES0A 1MIYA 2KWIB 1T98A 2CXDA 3ZMSB 3RRWA 3C50A 4DVDA 3VHLA 3F57A 4EXTA 2XQYA 3PUSA 4ASKA 4NUVA 4P0BA 4PAGA 2V1DB 3QK6A 1KK7A 5JDQA 5KMGP 4O2AE 2KINB 2X51A 2WMOA 4CXXA 3PU3A 3K3OA 3MK7C 4UIGA 2VWAA 3O4XE 4HTEA 4ZI3D 2D0UA 2V7JA 2Y6XA 4O4IE 3NZQA 2NW9A 2K24A 4PK4A 5L3FB 2YU2A 3PUGA 3RPUA 2QA7A 3LK2B 2XAGB 2BVMA 4H63V 3N2OA 1U5PA 4HFVA 3GA8A 2YU1A 3KV5A 3CQCB 2MYSA 3HL6A 1ZKEA 3HKDE 2GK9A 5JR9B 3U3IA 1AJ3A 2VASA 4EZ4A 2C5JA 2XHEB 5JR9C 4C90A 2DCFA 5E0OA 4CXWA 3ZMZB 3NBXX 2CCQA 3GN5B 3MACA 5LBMA 3MJXA 1H7CA 3NZPA 1MMDA 5H6QB 5JR9A 2X68A 3PTRB 4UV9B 2ODUA 3AB3B 2XUEA 1IZNB 4DO0A 2LM9A 2VKHA 4G2AA 3K3NA 1VOMA 4HGAA 2WMNA 5JDHA 4I43B 3V5SA 1HG5A 3GN5A 1WYCA 1HX8A 5DQWA 4GK0E 4JEUB 2NWBA 4UELA 2PFVA 4MBQA 4ERRA 2NOXA 2LHNA 2LEHA 4YJ3E 2ZM0A 4M1PA 5LP6E 1MIWA 4IE0A 4PJJA 3ZYLA 3FBLA 5HWXA 3ZJ1A 3LFMA 5JDNA 2E9XD 2VL8A 3E08A 3LG7A 3RC8A 2KXPB 4DMWA 2JQQA 5HYAA 5J2TE 5LOVE 3AAIA 5CB4E 1QSDA 5EZYE 2G0UA 4H9NC 3LK42 4BA9A 3RYCE 2DI4A 5FXXA 1MNDA 1U4QA 3F2EA 3MZKB 4H9OC 5J1GA 2C5KT 5J2UE 2HPLA 3CQXC 2WM9A 4KBMB 5LGNB 4YFSA 2Y8DA 5HXRA 2JMKA 3L09A 1HFAA 2EHOA 4EZHA 5JH7E 3PUQA 1LVFA 4GYSA 5L3EB 2Y48B 1SA0E 3O1JA 3ANWB 5F8PA 2E9XC 3WI3A 3RYIE 3FHNA 4ANJA 4X1KE 2DWKA 3I9WA 3N9QA 4UEMA 4ZS2A 4GIWA 4V1Av 5L3CB 1ZHCA 3VKHA 1QUUA 3U78A 3EVYA 4HN9A 3IEEA 4KUMB 1V9DA 4QXHB 3ZN0B 2W61A 3PURA 4PJLA 2KMFA 3ZC1A 1D0ZA 1ZV4X 3ANWA 4PJNA 4AKLA 3UULA 4MLKA 3C98B 3BQLA 2I59A 5TAOA 3LBXA 3WAKA 5L2LA 1FMWA 2ZMAA 4UF0B 2ZM8A 4QKNA 4WBOA 3OBVE 3CQGB 4DBRA 3PUAA 4JEHB 3FXDB 3HR0A 1HG2A 1NAFA 3Q2MA 3MKDA 2VKDA 4AKRB 3H37A 3HKCE 4QXCB 5LA6E 2DHRA 3KDSE 3ETUA 3LK3B 4UF0A 1D1CA 2WAUA 3CPZA 1HTJF 3C51A 4BJNA 5CA1E 3KVBA 3AAAB 4DMVA 3CX7B 2CE7A 4TZ4C 2LSJA 5JREA 5KDMC 2D0TA 4QX8B 1BR2A 1S94A 4C91A 5LXTE 5JRCA 1D1AA 2MTQA 5L3DB 2X9XA 3OYZA 2CMRA 5HXSA 3K8PC 5C8YE 1MMAA 3N9PA 3QC9A 1VRBA 2RP4A 3RH3A 3UUNA 3EDUA 1G8XA 3I1AA 3O9XA 2YEVC 4IE7A 2BVLA 1HCIA 4H63H 3UUXB 1HS7A 3ZCIA 5JVDE 5HAXA 3ZYMA 2J1DG 3CKDA 2V7LA 2PBIA 2SPCA 3ZEFB 4P09A 3BK9A 2HH7A 2NTYA 2M67A 5CA0E 2IC9A 2CWYA 1IAPA 1WYBA 3SWHA 2XTLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FB2 A;  1WLX A;  3F31 A;  3UUN A;  3EDV A;  3LBX B;  1QUU A;  1HCI A;  3UUM A;  2ODU A;  2SPC A;  3UUL A;  2ODV A;  1CUN A;  1U5P A;  3PE0 A;  1U4Q A;  1OWA A;  3LBX A;  1S35 A;  1AJ3 A; 
#chains in the Genus database with same CATH topology
 5L3G B;  4YTP A;  1L0V A;  3DP7 A;  4YTM A;  5JDF A;  1X79 A;  3AEC A;  3EAB A;  2Q9Q C;  3EUH A;  4F6R C;  4LMJ A;  4CN1 A;  4QX7 B;  2HPJ A;  2Q9Q A;  2WB5 A;  2QGS A;  3UT5 E;  3P4W A;  3SRZ A;  5ADX L;  4KI0 F;  2H3R A;  4O4J E;  3O1H A;  4OFZ A;  2LSY A;  2X66 A;  5AQS B;  3FB2 A;  3PJA A;  4AQY T;  5FNV E;  5FYM A;  2KWH A;  2ODV A;  2N9D A;  3H3A A;  2VVN A;  2LSG A;  4A97 A;  2X9W A;  3F31 A;  4DV4 T;  3Q5E A;  5JRC B;  3AEG A;  4HFB A;  3Q9D A;  1CUN A;  2A9U A;  2YIN A;  3FBZ A;  2WCA A;  3A7M A;  3M65 A;  3CVR A;  3LJC A;  4ISS A;  4IE4 A;  1LVK A;  3CK6 A;  4L0R A;  4MHC A;  3UTK A;  2W0G A;  3AEF A;  2CXF A;  4DR4 T;  3QNU A;  4ZOL E;  2Q9Q D;  3Q5D A;  2H7V C;  4CI3 B;  3P4Q A;  5EK2 A;  4O4H E;  5BR8 T;  2ZM6 T;  4OYJ A;  3CX8 B;  4AXP A;  3RLF F;  1M62 A;  5M4Y A;  2P9B A;  5KXJ A;  5J0Z A;  3ESL A;  3E0Z A;  4E7Z A;  2K48 A;  2VKJ A;  2YDQ A;  4YY3 T;  4E7S A;  4EGW A;  4EYU A;  3RI5 A;  4ILC A;  2NP9 A;  3AE2 A;  3PU8 A;  4H9P C;  1YQ3 A;  1SE7 A;  2E2A A;  4X1Y E;  5CJ5 A;  4B3T T;  1KFY A;  4FJO A;  5HXE A;  2V7M A;  3AA0 B;  5L3B B;  4PW8 A;  2FJB A;  2V6X A;  2IW5 B;  2UU9 T;  1WR6 A;  1OXZ A;  1WR0 A;  3CML A;  2E9X B;  2LOP A;  4HFI A;  3N9L A;  4DV1 T;  3AVR A;  1B7T A;  4KHZ F;  2CPT A;  1JNZ A;  1VCS A;  2RA1 A;  4NXM T;  4YLH A;  5AQI B;  1EZ3 A;  2WWV A;  4JI7 T;  4EAH A;  2MBG A;  1N34 T;  4TV9 E;  1FEW A;  5LNK A;  2VB6 A;  3IA3 A;  2WDV A;  2V7K A;  4QWN B;  4IST A;  2ES0 A;  3FZK B;  4DVD A;  4DR5 T;  4WZX A;  4WYV A;  4P0B A;  4PAG A;  2V1D B;  3JAD A;  5FL1 A;  3ZT6 A;  1FJG T;  3O4X E;  4HTE A;  2V7J A;  4PK4 A;  2QA7 A;  3LK2 B;  4DUZ T;  4OX9 T;  1J1J A;  2BKP A;  2WQY A;  4KHP T;  2VAS A;  4EZ4 A;  4NPP A;  2FJD A;  2DCF A;  4CXW A;  3NBX X;  3GN5 B;  2XQ9 A;  3NZP A;  2M6B A;  2VQE T;  3UU3 A;  5H6Q B;  1GQE A;  2X68 A;  3PTR B;  2ODU A;  3AB3 B;  2XUE A;  2UUA T;  4AIS A;  2LM9 A;  2VKH A;  4G2A A;  3K3N A;  2BG9 A;  4ILB A;  4AIU A;  2LEH A;  5HCJ A;  1MIW A;  3VRB A;  2XSA A;  5HEU A;  2LM2 A;  5HWX A;  3ZJ1 A;  3LFM A;  2VL8 A;  4JI6 T;  3E08 A;  4A98 A;  4DV3 T;  4LFA T;  1X9B A;  5EZY E;  4H9N C;  5AQH B;  1MND A;  1U4Q A;  5LGN B;  2WM9 A;  4JV5 T;  5HXR A;  2JMK A;  2EHO A;  5JH7 E;  1LVF A;  5L3E B;  3O1J A;  5F8P A;  3WI3 A;  2WP9 A;  4X1K E;  5AQJ B;  5L3C B;  1QUU A;  3U78 A;  3EVY A;  1V9D A;  2ACZ A;  2UUC T;  3ZN0 B;  3RQW A;  3TLS A;  3WAK A;  5AQL B;  3UU8 A;  1FMW A;  4UF0 B;  3OBV E;  3CQG B;  3PUA A;  4Q25 A;  2YDR A;  3Q2M A;  2VKD A;  4TWH A;  3KDS E;  1D1C A;  2WAU A;  3CPZ A;  2V5C A;  5AQP B;  4I0U A;  3PUX F;  5LXT E;  1S94 A;  1D1A A;  3AE4 A;  1MMA A;  3N9P A;  4LF6 T;  5IWA T;  1VRB A;  5L47 A;  1HNX T;  2W4X A;  4JI5 T;  5JVD E;  3ZYM A;  1DU2 A;  4P09 A;  3BK9 A;  2M67 A;  4U2Y A;  2IC9 A;  2BS4 A;  2CWY A;  1IAP A;  2FUP A;  3SWH A;  1WFD A;  2XTL A;  4MFR A;  4JLE A;  3ZJ2 A;  4AQF A;  2BG9 B;  2WU5 A;  3K1S A;  4UV8 B;  4JYA T;  3KBT A;  3Q5X A;  5AQF B;  3E22 E;  2DL1 A;  4HEA A;  5JQG E;  3SS1 A;  1M7K A;  5L4E A;  3I0O A;  4AQG A;  1KEY A;  4A56 A;  4HWC A;  2EHO D;  1E2A A;  1WRD A;  4A5X A;  5BMV E;  4DND A;  3OPC A;  3JC6 D;  4TX5 A;  4CI1 B;  5LMN T;  4NUU A;  4IIJ E;  3L3P A;  5JTG A;  3N2G E;  3PJA J;  2EHO B;  4I55 E;  4ZHQ E;  1US7 B;  3DJB A;  3ONX A;  4ILA A;  3UFG A;  3AE6 A;  4YHJ A;  4O4L E;  4ZS3 A;  3N5L A;  2W63 A;  3C4X A;  2V6Y B;  1OED B;  2W2U A;  1HNW T;  3FZF B;  4L9I A;  2PG8 A;  2QVA A;  3D0T A;  2A3D A;  3RRC A;  4LF9 T;  3P4R A;  4IDO A;  3HKE E;  3CWZ B;  2UXD T;  3M3Z B;  1YKH B;  3J9X 1;  5AQT B;  5LMU T;  2ZM2 A;  2XQ8 A;  3V5U A;  2X0Y A;  5AQK B;  4GOU A;  4BJM A;  2X0L B;  4ZEY A;  5FP3 A;  2X67 A;  3C64 A;  1MIV A;  4J2C A;  4EB6 E;  3FXE B;  5FY1 A;  3ZPO A;  1D0X A;  4B3R T;  2MOZ A;  3N2K E;  1J5W A;  4JI4 T;  2VVS A;  4I50 E;  4PK5 A;  2KT9 A;  1YKE B;  3ZKR A;  4ZZC A;  1XDO A;  5FVL A;  3ZC0 A;  4TWF A;  1YQ4 A;  4ZI2 D;  3ZMV B;  1XZY A;  4NIQ A;  3HKB E;  1YW0 A;  2M6I A;  5LG3 A;  4P0A A;  2X9H A;  2DWG A;  4JI2 T;  3AVS A;  4YT0 A;  2KZ7 B;  2MAW A;  4DV7 T;  3AE8 A;  2C5I T;  3GWH A;  4KP3 C;  2X9Y A;  3PUY F;  3J7Y q;  2BKN A;  4O2B E;  3UUM A;  2XQ5 A;  3EAM A;  1IBL T;  2LSK A;  4PK6 A;  4WBN E;  2WU2 A;  3BQK A;  2WS3 A;  2KSR A;  4N78 D;  4YXD A;  2CM0 A;  5DQV A;  3VU7 H;  5CGM A;  4X20 E;  3QB5 A;  2V26 A;  4IE6 A;  4HKA A;  3JAF A;  2JRK A;  3KV9 A;  4UXN B;  3IBP A;  4DBQ A;  1HR0 T;  3RX6 A;  2XAF B;  2AE9 A;  4IL4 A;  4DID B;  3SFE A;  2XAH B;  2CLY B;  5ABE A;  1MNE A;  4BAY B;  2E5L T;  2WZI A;  2E9X A;  2KND A;  3ZT7 A;  5C3J A;  2E8I A;  5DAB A;  5GON E;  5JDM A;  1N32 T;  2PJQ A;  5IUX A;  1NWM X;  3PDY A;  4IDZ A;  2CBI A;  3WAJ A;  2KWI B;  1MIY A;  1T98 A;  3RRW A;  3VRA A;  3PUS A;  4NUV A;  2LKH A;  2XQ4 A;  1KK7 A;  5JDQ A;  4O2A E;  2KIN B;  2X51 A;  2WMO A;  3G06 A;  3K3O A;  2I6H A;  4UIG A;  2VWA A;  3L8R A;  2RPA A;  4QH5 A;  2NW9 A;  2V8S V;  3ZT5 A;  2YU2 A;  3PUG A;  3RPU A;  2BVM A;  3GA8 A;  3RF1 A;  3CQC B;  5ABG A;  3HL6 A;  4JI8 T;  2GK9 A;  2C5J A;  2XHE B;  3B5M A;  5AQQ B;  3ZMZ B;  4DR7 T;  2XQA A;  4DV6 T;  1MMD A;  2XJ7 A;  4HGA A;  1HG5 A;  3GN5 A;  1WYC A;  5DQW A;  4JEU B;  5ABF B;  2PFV A;  4ERR A;  4YJ3 E;  1JNR A;  4IE0 A;  3ZYL A;  3JAE A;  2E9X D;  5AQG B;  2HN2 A;  3RC8 A;  4DMW A;  4U7I A;  4IT4 A;  5LOV E;  1QSD A;  1XWM A;  2G0U A;  4BA9 A;  2NR4 A;  3RYC E;  2C5K T;  2Y8D A;  4EZH A;  3L09 A;  1HFA A;  4B3M T;  1SUM B;  3FHN A;  4ANJ A;  4P1N A;  2DWK A;  3N9Q A;  4ZS2 A;  4HWF A;  4U31 A;  4V1A v;  3VKH A;  2IML A;  3ONJ A;  3PUR A;  2KMF A;  3ZC1 A;  1D0Z A;  1ZV4 X;  4AKL A;  3AE1 A;  5AQO B;  4MLK A;  3C98 B;  4YSY A;  3HR0 A;  1KNR A;  1NAF A;  3MKD A;  1YXR A;  2LLY A;  5LA6 E;  4UF0 A;  1HTJ F;  3C51 A;  5CA1 E;  4YSX A;  3KVB A;  3AAA B;  3CX7 B;  5JRE A;  2D0T A;  4DR3 T;  4HFC A;  4C91 A;  3OYZ A;  5HXS A;  4LF4 T;  2RP4 A;  3UUN A;  3I1A A;  3O9X A;  5AQR B;  1VCT A;  2YEV C;  2BVL A;  4IE7 A;  1Y01 A;  5FXZ A;  1HX1 B;  2L3L A;  5DJQ C;  3EDV A;  2BG9 C;  3B57 A;  4LFC T;  2IUB A;  2IDO B;  2WWU A;  3P4P A;  3RIU C;  2OLT A;  2BS3 A;  3MXZ A;  5EK4 A;  3HA4 A;  4TNV A;  3RIU A;  3AAE B;  5A1L A;  5HEO A;  2IIU A;  2A2F X;  2JIW A;  2WBL A;  1T7S A;  2EHO C;  2LJL A;  3RGL A;  3FZH B;  4JUY A;  4Z8X A;  1OWA A;  4CQI A;  5F5W A;  3JC6 C;  4EIW A;  2K5B B;  1UCU A;  3P8C D;  3AA1 B;  3PV0 F;  1Z8U A;  3NRX A;  1OED C;  2WZH A;  4F8H A;  5ABH A;  3AA6 B;  1XDP A;  4G63 A;  4MAL A;  4DR1 T;  3KV6 A;  4O8S A;  4AKI A;  2V6Y A;  1OED A;  3GMI A;  4LFB T;  4U72 A;  2NTX A;  3PE0 A;  3A5X A;  2Z6E A;  4TWD A;  2C0S A;  1G73 A;  2BBJ A;  4WNK A;  5HEH A;  1D1B A;  3RQU A;  2LKG A;  1IBM T;  3AED A;  2ZLY A;  2UXX B;  4ZI7 E;  3QB5 K;  3RKG A;  2IAK A;  4EED A;  2DLR A;  2V7I A;  3IF8 B;  1E7P A;  2L8K A;  2VKO A;  1J5E T;  2VK9 A;  4GK5 E;  4DUY T;  3K3Q C;  1WLX A;  2A72 A;  2L9Q A;  1D0Y A;  4CZZ B;  2VUR A;  5FMN A;  4CI2 B;  2CWO A;  2LRK A;  1W9R A;  4TUY E;  2AXD S;  2WDQ A;  1N33 T;  4AQF C;  3ABV A;  5LGT B;  4UVA B;  2XAQ B;  2UXN B;  5JDL A;  2PTF A;  3PUV F;  4X62 T;  4IGU A;  3FZL B;  4CN4 A;  5IHY A;  3UUB A;  4ZZB A;  2N1G A;  4X64 T;  3IHR A;  2CEA A;  3QUJ A;  3QOF A;  5LHG B;  3TLV A;  4B6X A;  3UQ7 A;  5JDG A;  1E1H B;  2BG9 E;  3TLU A;  3CX6 B;  3RC3 A;  2JPF A;  4ZI2 C;  4X65 T;  3NRY A;  4PFO A;  2UUB T;  2IC6 A;  1SHZ C;  3AA7 B;  2XZE A;  5LHI B;  4EOZ B;  2UXC T;  3RHW A;  1UUR A;  4PNI A;  2JQ9 A;  2D5U A;  3Q5W A;  4X1I E;  2LOS A;  4ILU A;  3ZYK A;  4L5G A;  2LHR A;  2FBW A;  1UX5 A;  3RYH E;  1HF8 A;  1T8B A;  4B3S T;  5ETW A;  3UFE A;  2W62 A;  2YK0 A;  2QRX A;  3FZM B;  4K0K T;  2I0M A;  4UVC B;  2BDE A;  2JJ9 A;  4PJM A;  2CLY C;  1YD8 G;  3ZSS A;  4LF7 T;  3OVU A;  4HFE A;  2NW7 A;  4QH4 A;  3ZMU B;  2WSS V;  3T1H T;  3ZCJ A;  3X1D A;  3VKG A;  4WW0 A;  5AQU B;  1BR4 A;  5EK3 A;  2YKS A;  1KNP A;  3ZMS B;  4CN6 A;  4YTN A;  3C50 A;  4JI1 T;  4EXT A;  5C2T A;  4DV2 T;  4NXN T;  4ASK A;  4CXX A;  3AXJ B;  2BBH A;  2MPK A;  4O4I E;  2K24 A;  4DV0 T;  4H63 V;  2FJA A;  2MYS A;  2B76 A;  1ZKE A;  5JR9 B;  1AJ3 A;  4GKJ T;  4C90 A;  2CCQ A;  3P50 A;  3MAC A;  1H7C A;  1XNR T;  4UV9 B;  1IZN B;  4DO0 A;  1VOM A;  2WMN A;  1HX8 A;  4GK0 E;  1I94 T;  4UEL A;  2NOX A;  2LHN A;  2FJE A;  2CRB A;  5LP6 E;  4PJJ A;  5FVK A;  5HCM A;  3FBL A;  3AE7 A;  3LG7 A;  2KXP B;  2JQQ A;  5ABF A;  1HNZ T;  2XQ3 A;  2VL0 A;  5FXX A;  3ZST A;  3F2E A;  3MZK B;  5J1G A;  5J2U E;  4KBM B;  3P4S A;  4YFS A;  1NEN A;  4GYS A;  4DR2 T;  2Y48 B;  3ANW B;  5AQN B;  2E9X C;  3I9W A;  4UEM A;  4GIW A;  4HFH A;  1ZHC A;  2QYW A;  1UGO A;  4HN9 A;  4QXH B;  2W66 A;  2W61 A;  4PJL A;  4PJN A;  2JQK A;  3UUL A;  2XQ6 A;  3LBX A;  4TNW A;  4QKN A;  2J62 A;  4WBO A;  2D9D A;  4JEH B;  4Z91 A;  3AE3 A;  1W0A A;  3H37 A;  5AQV B;  4AKR B;  2J47 A;  4QXC B;  3LK3 B;  4EEB A;  4BJN A;  2J4G A;  2XPK A;  2CE7 A;  2XM2 A;  2LSJ A;  1BR2 A;  4IDN A;  5L3D B;  2X9X A;  2CMR A;  4JBW F;  3UU5 A;  1UUS A;  3AE9 A;  3K8P C;  5C8Y E;  3QC9 A;  3RH3 A;  1G8X A;  5HAX A;  1QLB A;  3CKD A;  2PBI A;  5HEJ A;  5CA0 E;  4KX6 A;  2CHN A;  1Y64 B;  2R6G F;  3R84 B;  1O3X A;  3N9O A;  1IJ6 A;  5FY7 A;  2Q9Q B;  4H9Q C;  2K3W A;  4OYK A;  1ZEE A;  5F3J A;  2XAJ B;  2BZB A;  4UR9 A;  3RKO A;  4H9R C;  3TLT A;  3NWI A;  4OK0 A;  5KX5 E;  2H7O A;  3ETV A;  4GYR A;  1BR0 A;  4CXY A;  1BR1 A;  1LKX A;  3PUW F;  1ZOY A;  3ZLI A;  4OHF A;  3KVA A;  3UQ4 A;  4XBF B;  2XQ7 A;  3I9Y A;  4DV5 T;  1Z0P A;  1MMN A;  4XAX B;  5LGU B;  4I4T E;  1KF6 A;  2XY8 B;  3AEA A;  4XZC A;  2OA5 A;  3LBX B;  3OKQ A;  4DR6 T;  3A8Y C;  3KV4 A;  4U74 A;  4LML A;  5FXW A;  2F4V T;  5LB7 B;  4QXB B;  2N2N A;  3OTO T;  2KLQ A;  3RYF E;  4YJ2 E;  3ZN1 B;  5FY0 A;  1UK5 A;  3OJA A;  1T72 A;  4LMK A;  3VR9 A;  4ADZ A;  2HHH T;  3RIA A;  4FI5 A;  1W0B A;  4K0U A;  4EYY R;  1FMV A;  3AE5 A;  4QHO A;  4IHJ E;  2ACX A;  2UXB T;  3R6N A;  4AKG A;  2CXL A;  3CIR A;  3DTO A;  4Z90 A;  2H89 A;  3KBU A;  1CHU A;  2XAS B;  5LCY A;  2CHO A;  1MMG A;  3NVO A;  4U3C A;  3S4U A;  2JQH A;  5H6R B;  3KFW X;  5HXC A;  1FIO A;  4AKH A;  3ZMT B;  3EI0 A;  3W15 B;  4IE5 A;  4HE8 A;  2D2S A;  5LHH B;  3H3M A;  3RIF A;  2WDR A;  3LDQ B;  4TV8 E;  2NW8 A;  2YDS A;  3C4W A;  1N36 T;  3BQI A;  3UU6 A;  3I0Q A;  4ZI3 C;  3B13 A;  5IYZ E;  3SOL A;  1XMQ T;  2LSI A;  4X5T A;  2BS2 A;  3HI2 A;  4AI6 A;  4X66 T;  3JCF A;  4UVB B;  2V5D A;  4U33 A;  3AEE A;  2DNX A;  3MA9 A;  1I6Z A;  3T8O A;  3TKL B;  5AQM B;  5LYJ E;  4LF8 T;  5LJM A;  5LJN A;  2LT3 A;  3KIN B;  1IBK T;  5FXV A;  5AFU L;  3P7I A;  4HFD A;  3T1Y T;  5LG4 A;  4PFP A;  2CBJ A;  4LF5 T;  3OYX A;  4H9S E;  1IJ5 A;  1W09 A;  3O1I A;  1XNQ T;  1UX4 A;  3SFD A;  2CA5 A;  2YN6 A;  2W00 A;  3NKZ A;  2LE8 A;  1WCR A;  3N9N A;  1LRZ A;  5HXH A;  5L4H A;  5HWY A;  5FKY A;  3N9M A;  1KNZ A;  1S35 A;  4IDP A;  2B1E A;  5LBQ B;  2K9A A;  4KMC A;  2WY2 A;  2JMH A;  3C4Z A;  4TN7 B;  2CXD A;  3EHZ A;  3LSV A;  2E5V A;  3VHL A;  3F57 A;  2XQY A;  4ZXL A;  3QK6 A;  4QH1 A;  5KMG P;  5FL0 A;  3PU3 A;  3MK7 C;  4HWI B;  4COF A;  3VR8 A;  4ZI3 D;  2X0H A;  2D0U A;  2Y6X A;  3NZQ A;  1XMO T;  4YSZ A;  3UU4 A;  5L3F B;  3AEB A;  2XAG B;  3AXJ A;  3N2O A;  1U5P A;  4HFV A;  2YU1 A;  3KV5 A;  3ONL C;  4HWH A;  3HKD E;  3U3I A;  5JR9 C;  2LRL A;  5E0O A;  5LBM A;  4U2Z A;  3MJX A;  4IDQ A;  5JR9 A;  2W67 A;  5JDH A;  4I43 B;  3V5S A;  2NWB A;  4MBQ A;  2ZM0 A;  4M1P A;  4U7Y A;  2IHR 1;  5JDN A;  2H88 A;  2XSB A;  2BKO A;  5HYA A;  5J2T E;  3AAI A;  5CB4 E;  3LK4 2;  2DI4 A;  4H9O C;  1NEK A;  2HPL A;  3CQX C;  3PUQ A;  1SA0 E;  3TLW A;  1OED E;  3RYI E;  4EV6 A;  3IEE A;  4KUM B;  3L39 A;  3ANW A;  2HN1 A;  3BQL A;  2I59 A;  5TAO A;  5L2L A;  2ZMA A;  4JI3 T;  2ZM8 A;  5CFB A;  4DBR A;  3FXD B;  1HG2 A;  4HWD A;  4JI0 T;  3HKC E;  2DHR A;  3ETU A;  4YHH T;  4GKK T;  3PUZ F;  4DMV A;  4TZ4 C;  1R8I A;  5KDM C;  4QX8 B;  5JRC A;  2XM1 A;  2MTQ A;  2OV9 A;  3EDU A;  4H63 H;  1HCI A;  3UUX B;  1HS7 A;  3ZCI A;  2J1D G;  2V7L A;  4IRE A;  2SPC A;  3ZEF B;  2YOE A;  2HH7 A;  2NTY A;  1ZP0 A;  5HEG A;  1WYB A;  2VQF T;  4IL9 A; 
#chains in the Genus database with same CATH homology
 4MFR A;  5FXZ A;  1Y64 B;  4JLE A;  5L3G B;  3ZJ2 A;  2L3L A;  4AQF A;  4UV8 B;  5DJQ C;  3EDV A;  3KBT A;  3R84 B;  3DP7 A;  3B57 A;  1O3X A;  3N9O A;  3Q5X A;  1IJ6 A;  5FY7 A;  2Q9Q B;  5JDF A;  3E22 E;  4H9Q C;  1X79 A;  4HEA A;  5JQG E;  4OYK A;  2WWU A;  3SS1 A;  2Q9Q C;  3I0O A;  4AQG A;  4A56 A;  1ZEE A;  2EHO D;  5BMV E;  1WRD A;  5F3J A;  4DND A;  2XAJ B;  2BZB A;  3EUH A;  4F6R C;  3MXZ A;  5EK4 A;  3HA4 A;  4QX7 B;  2HPJ A;  2Q9Q A;  3JC6 D;  4TX5 A;  4CI1 B;  3RKO A;  3AAE B;  4H9R C;  4NUU A;  4OK0 A;  4IIJ E;  5KX5 E;  5A1L A;  2QGS A;  3L3P A;  2H7O A;  3ETV A;  4GYR A;  3UT5 E;  3SRZ A;  2A2F X;  3N2G E;  2EHO B;  2WBL A;  4I55 E;  1BR0 A;  4CXY A;  4ZHQ E;  5ADX L;  2H3R A;  2EHO C;  1US7 B;  3DJB A;  3ONX A;  1BR1 A;  2LJL A;  1LKX A;  4YHJ A;  4CQI A;  4JUY A;  4O4J E;  1OWA A;  3O1H A;  4OHF A;  4O4L E;  4Z8X A;  3KVA A;  3JC6 C;  4ZS3 A;  3ZLI A;  4EIW A;  3N5L A;  2K5B B;  1UCU A;  3I9Y A;  4OFZ A;  4XBF B;  2W63 A;  3C4X A;  3P8C D;  2LSY A;  1Z0P A;  2X66 A;  1MMN A;  3AA1 B;  3FB2 A;  4XAX B;  3NRX A;  5LGU B;  4I4T E;  4L9I A;  2PG8 A;  4XZC A;  3D0T A;  2OA5 A;  3LBX B;  3OKQ A;  3AA6 B;  2A3D A;  4G63 A;  4MAL A;  3KV4 A;  4U74 A;  3RRC A;  3KV6 A;  5FNV E;  4O8S A;  5FYM A;  4AKI A;  3GMI A;  3HKE E;  2KWH A;  4U72 A;  2ODV A;  3CWZ B;  2N9D A;  2NTX A;  3PE0 A;  5FXW A;  3A5X A;  2Z6E A;  3H3A A;  2LSG A;  1YKH B;  4QXB B;  2C0S A;  2N2N A;  3J9X 1;  2KLQ A;  3RYF E;  4YJ2 E;  1G73 A;  3ZN1 B;  2X9W A;  4WNK A;  5FY0 A;  3OJA A;  3F31 A;  1D1B A;  2ZM2 A;  2ZLY A;  2UXX B;  4ZI7 E;  5JRC B;  4ADZ A;  2IAK A;  3V5U A;  3Q9D A;  2DLR A;  2V7I A;  4GOU A;  4FI5 A;  4K0U A;  4BJM A;  4EYY R;  2X0L B;  3IF8 B;  1CUN A;  1FMV A;  2L8K A;  2VKO A;  2X67 A;  4QHO A;  5FP3 A;  4IHJ E;  2VK9 A;  3C64 A;  2YIN A;  4GK5 E;  3FBZ A;  1MIV A;  4J2C A;  4EB6 E;  3K3Q C;  2ACX A;  1WLX A;  2A72 A;  3FXE B;  1D0X A;  3M65 A;  5FY1 A;  3ZPO A;  3CVR A;  2L9Q A;  3LJC A;  4ISS A;  4IE4 A;  3R6N A;  2MOZ A;  3N2K E;  1LVK A;  4AKG A;  2CXL A;  1D0Y A;  3DTO A;  3KBU A;  4CZZ B;  4L0R A;  4MHC A;  4CI2 B;  5FMN A;  3UTK A;  2W0G A;  2XAS B;  2CWO A;  2CXF A;  5LCY A;  4TUY E;  4I50 E;  1MMG A;  4PK5 A;  4ZOL E;  2Q9Q D;  2KT9 A;  4AQF C;  3S4U A;  5LGT B;  5H6R B;  2H7V C;  4UVA B;  1YKE B;  3KFW X;  2XAQ B;  2UXN B;  5HXC A;  4CI3 B;  5JDL A;  1FIO A;  3ZC0 A;  5EK2 A;  4O4H E;  4AKH A;  3ZMT B;  4IGU A;  3W15 B;  4ZI2 D;  4IE5 A;  4HE8 A;  3ZMV B;  2D2S A;  4OYJ A;  5IHY A;  5LHH B;  3CX8 B;  4AXP A;  2N1G A;  5M4Y A;  3HKB E;  2P9B A;  4TV8 E;  1YW0 A;  2NW8 A;  3IHR A;  4P0A A;  3ESL A;  2CEA A;  3E0Z A;  2K48 A;  3QUJ A;  4E7Z A;  2X9H A;  3C4W A;  2DWG A;  5LHG B;  3AVS A;  2VKJ A;  2KZ7 B;  3BQI A;  4B6X A;  3I0Q A;  4E7S A;  4ZI3 C;  3B13 A;  5JDG A;  4EYU A;  1E1H B;  3CX6 B;  2C5I T;  3GWH A;  3RC3 A;  2JPF A;  4ZI2 C;  5IYZ E;  4KP3 C;  3SOL A;  2LSI A;  2X9Y A;  3NRY A;  4PFO A;  3J7Y q;  4O2B E;  3UUM A;  2IC6 A;  3HI2 A;  1SHZ C;  3AA7 B;  2NP9 A;  5LHI B;  4AI6 A;  2LSK A;  4EOZ B;  4PK6 A;  4UVB B;  4WBN E;  3PU8 A;  2DNX A;  4H9P C;  3BQK A;  4X1Y E;  3MA9 A;  4PNI A;  3T8O A;  4N78 D;  3TKL B;  4FJO A;  5HXE A;  2CM0 A;  2V7M A;  3AA0 B;  5DQV A;  3VU7 H;  5LYJ E;  2D5U A;  3Q5W A;  4X1I E;  5LJM A;  5L3B B;  2LOS A;  5LJN A;  4PW8 A;  2LT3 A;  3KIN B;  2IW5 B;  4ILU A;  5FXV A;  4X20 E;  5AFU L;  3P7I A;  4L5G A;  3ZYK A;  2LHR A;  1UX5 A;  2V26 A;  3RYH E;  1HF8 A;  4IE6 A;  5LG4 A;  4HKA A;  4PFP A;  2JRK A;  3OYX A;  4H9S E;  3KV9 A;  4UXN B;  5ETW A;  3UFE A;  1IJ5 A;  2W62 A;  2YK0 A;  3IBP A;  1WR6 A;  4DBQ A;  1OXZ A;  3CML A;  3RX6 A;  2E9X B;  2XAF B;  2LOP A;  3O1I A;  3N9L A;  3AVR A;  1UX4 A;  4UVC B;  2BDE A;  2XAH B;  2JJ9 A;  2CLY B;  1B7T A;  2CA5 A;  2RA1 A;  4PJM A;  1MNE A;  2CLY C;  2W00 A;  4YLH A;  4BAY B;  1YD8 G;  2E9X A;  2KND A;  2LE8 A;  1EZ3 A;  2E8I A;  2NW7 A;  3N9N A;  3ZMU B;  2WSS V;  5DAB A;  1LRZ A;  5GON E;  3ZCJ A;  5HXH A;  3VKG A;  5HWY A;  3N9M A;  5JDM A;  1KNZ A;  2PJQ A;  1S35 A;  4EAH A;  1NWM X;  4WW0 A;  4TV9 E;  2MBG A;  1BR4 A;  1FEW A;  3PDY A;  4IDZ A;  5LNK A;  2B1E A;  5LBQ B;  2K9A A;  2VB6 A;  5EK3 A;  4KMC A;  2V7K A;  2JMH A;  3C4Z A;  4QWN B;  4TN7 B;  3WAJ A;  4IST A;  2ES0 A;  1MIY A;  2KWI B;  1T98 A;  2CXD A;  3ZMS B;  3RRW A;  3C50 A;  4DVD A;  3VHL A;  3F57 A;  4EXT A;  2XQY A;  3PUS A;  4ASK A;  4NUV A;  4P0B A;  4PAG A;  2V1D B;  3QK6 A;  1KK7 A;  5JDQ A;  5KMG P;  4O2A E;  2KIN B;  2X51 A;  2WMO A;  4CXX A;  3PU3 A;  3K3O A;  3MK7 C;  4UIG A;  2VWA A;  3O4X E;  4HTE A;  4ZI3 D;  2D0U A;  2V7J A;  2Y6X A;  4O4I E;  3NZQ A;  2NW9 A;  2K24 A;  4PK4 A;  5L3F B;  2YU2 A;  3PUG A;  3RPU A;  2QA7 A;  3LK2 B;  2XAG B;  2BVM A;  4H63 V;  3N2O A;  1U5P A;  4HFV A;  3GA8 A;  2YU1 A;  3KV5 A;  3CQC B;  2MYS A;  3HL6 A;  1ZKE A;  3HKD E;  2GK9 A;  5JR9 B;  3U3I A;  1AJ3 A;  2VAS A;  4EZ4 A;  2C5J A;  2XHE B;  5JR9 C;  4C90 A;  2DCF A;  5E0O A;  4CXW A;  3ZMZ B;  3NBX X;  2CCQ A;  3GN5 B;  3MAC A;  5LBM A;  3MJX A;  1H7C A;  3NZP A;  1MMD A;  5H6Q B;  5JR9 A;  2X68 A;  3PTR B;  4UV9 B;  2ODU A;  3AB3 B;  2XUE A;  1IZN B;  4DO0 A;  2LM9 A;  2VKH A;  4G2A A;  3K3N A;  1VOM A;  4HGA A;  2WMN A;  5JDH A;  4I43 B;  3V5S A;  1HG5 A;  3GN5 A;  1WYC A;  1HX8 A;  5DQW A;  4GK0 E;  4JEU B;  2NWB A;  4UEL A;  2PFV A;  4MBQ A;  4ERR A;  2NOX A;  2LHN A;  2LEH A;  4YJ3 E;  2ZM0 A;  4M1P A;  5LP6 E;  1MIW A;  4IE0 A;  4PJJ A;  3ZYL A;  3FBL A;  5HWX A;  3ZJ1 A;  3LFM A;  5JDN A;  2E9X D;  2VL8 A;  3E08 A;  3LG7 A;  3RC8 A;  2KXP B;  4DMW A;  2JQQ A;  5HYA A;  5J2T E;  5LOV E;  3AAI A;  5CB4 E;  1QSD A;  5EZY E;  2G0U A;  4H9N C;  3LK4 2;  4BA9 A;  3RYC E;  2DI4 A;  5FXX A;  1MND A;  1U4Q A;  3F2E A;  3MZK B;  4H9O C;  5J1G A;  2C5K T;  5J2U E;  2HPL A;  3CQX C;  2WM9 A;  4KBM B;  5LGN B;  4YFS A;  2Y8D A;  5HXR A;  2JMK A;  3L09 A;  1HFA A;  2EHO A;  4EZH A;  5JH7 E;  3PUQ A;  1LVF A;  4GYS A;  5L3E B;  2Y48 B;  1SA0 E;  3O1J A;  3ANW B;  5F8P A;  2E9X C;  3WI3 A;  3RYI E;  3FHN A;  4ANJ A;  4X1K E;  2DWK A;  3I9W A;  3N9Q A;  4UEM A;  4ZS2 A;  4GIW A;  4V1A v;  5L3C B;  1ZHC A;  3VKH A;  1QUU A;  3U78 A;  3EVY A;  4HN9 A;  3IEE A;  4KUM B;  1V9D A;  4QXH B;  3ZN0 B;  2W61 A;  3PUR A;  4PJL A;  2KMF A;  3ZC1 A;  1D0Z A;  1ZV4 X;  3ANW A;  4PJN A;  4AKL A;  3UUL A;  4MLK A;  3C98 B;  3BQL A;  2I59 A;  5TAO A;  3LBX A;  3WAK A;  5L2L A;  1FMW A;  2ZMA A;  4UF0 B;  2ZM8 A;  4QKN A;  4WBO A;  3OBV E;  3CQG B;  4DBR A;  3PUA A;  4JEH B;  3FXD B;  3HR0 A;  1HG2 A;  1NAF A;  3Q2M A;  3MKD A;  2VKD A;  4AKR B;  3H37 A;  3HKC E;  4QXC B;  5LA6 E;  2DHR A;  3KDS E;  3ETU A;  3LK3 B;  4UF0 A;  1D1C A;  2WAU A;  3CPZ A;  1HTJ F;  3C51 A;  4BJN A;  5CA1 E;  3KVB A;  3AAA B;  4DMV A;  3CX7 B;  2CE7 A;  4TZ4 C;  2LSJ A;  5JRE A;  5KDM C;  2D0T A;  4QX8 B;  1BR2 A;  1S94 A;  4C91 A;  5LXT E;  5JRC A;  1D1A A;  2MTQ A;  5L3D B;  2X9X A;  3OYZ A;  2CMR A;  5HXS A;  3K8P C;  5C8Y E;  1MMA A;  3N9P A;  3QC9 A;  1VRB A;  2RP4 A;  3RH3 A;  3UUN A;  3EDU A;  1G8X A;  3I1A A;  3O9X A;  2YEV C;  4IE7 A;  2BVL A;  1HCI A;  4H63 H;  3UUX B;  1HS7 A;  3ZCI A;  5JVD E;  5HAX A;  3ZYM A;  2J1D G;  3CKD A;  2V7L A;  2PBI A;  2SPC A;  3ZEF B;  4P09 A;  3BK9 A;  2HH7 A;  2NTY A;  2M67 A;  5CA0 E;  2IC9 A;  2CWY A;  1IAP A;  1WYB A;  3SWH A;  2XTL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...