3LBXB

Crystal structure of the erythrocyte spectrin tetramerization domain complex
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
184
structure length
182
Chain Sequence
GSTADKFRFFSMARDLLSWMESIIRQIETQERDVSSVELLMKYHQGINAEIETRSKNFSACLELGESLLQRQHQASEEIREKLQQVMSRRKEMNEKWEARWERLRMLLEVCQFSRDASVAEAWLIAQEPYLASGDFGHTVDSVEKLIKRHEAFEKSTASWAERFAALEKPTTLELKERQIAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Spectrin alpha chain, erythrocyte
publication title Crystal structure and functional interpretation of the erythrocyte spectrin tetramerization domain complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 67
structure length 182
sequence length 184
ec nomenclature
pdb deposition date 2010-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00435 Spectrin Spectrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.60 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3lbxB01
1.20.58.60 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3lbxB02
3LBXB 3UULA 1AJ3A 1WLXA 3LBXA 3FB2A 3UUMA 1QUUA 1OWAA 1U4QA 1CUNA 3EDVA 3F31A 1HCIA 2ODUA 2SPCA 1U5PA 3UUNA 1S35A 2ODVA 3PE0A
chains in the Genus database with same CATH superfamily
3V5UA 5GONE 3GA8A 3OYZA 5ABGA 3O1IA 4DVDA 2ZMAA 4ZXLA 2QRXA 5AQVB 3UFGA 1XNQT 1HCIA 2XJ7A 3I1AA 1XWMA 2NW7A 1FIOA 1T7SA 2JMKA 5HEOA 4LF4T 2J62A 4TZ4C 3RYFE 3B57A 2X68A 4A5XA 4CXWA 4HFDA 2CWYA 3O1HA 3EDUA 2XQ9A 5FKYA 2K9AA 2DNXA 2IIUA 1T8BA 5HCJA 2UXDT 3T1YT 5KX5E 3AEBA 5H6QB 2HN1A 2WSSV 2UUAT 4QXCB 2C5JA 4NPPA 3C64A 2WU5A 5F3JA 2CEAA 4MALA 2KWIB 2JJ9A 4YY3T 1NEKA 4LF9T 2P9BA 2BBJA 3L3PA 3AB3B 3C4XA 2BDEA 4HFIA 1HTJF 3UT5E 3HL6A 2WP9A 3AE6A 2Q9QD 2KZ7B 4XZCA 2LHRA 5LCYA 4P09A 4E7ZA 1D1CA 1DU2A 1WFDA 3I0QA 3F2EA 2BVMA 3PURA 5FY0A 2LSIA 3P4PA 3AE2A 4DIDB 2V26A 4DNDA 4PFOA 3OTOT 4QXBB 2ES0A 4DUYT 4DBRA 3CQCB 1IBLT 2KT9A 3P4RA 5J1GA 4JI1T 2I59A 5IWAT 2V1DB 1KEYA 4U7IA 2YEVC 2C5IT 4AQGA 2W62A 2NTXA 2XQ7A 1BR2A 2DL1A 4IREA 2ACZA 3VRAA 3UQ7A 3RGLA 2MAWA 1HG2A 5LMUT 4ADZA 2VK9A 5LBQB 4YJ3E 4AQFC 2VL0A 3QUJA 3PUQA 4H63V 1WRDA 2YN6A 3TKLB 3UUBA 4AISA 3RIAA 4E7SA 4K0UA 3IA3A 4WYVA 3ZKRA 5AQSB 5LXTE 4HFEA 2J1DG 5FVLA 1M7KA 4TX5A 3CX6B 2Y6XA 4OFZA 3ANWA 3J7Yq 4PJLA 2KWHA 3LBXA 1X79A 2Q9QA 4EOZB 4B3MT 4DMWA 1UUSA 1WYCA 4B3ST 3QB5A 2VKDA 4ZOLE 2XQAA 5L3FB 1I6ZA 3PDYA 4JI2T 3Q5EA 2VVSA 2ZM6T 3OYXA 4JYAT 4P0AA 2E9XC 2CHOA 2UXXB 3QC9A 2CBJA 1LVFA 3RI5A 1FMWA 2IC6A 1HNWT 4X1KE 2H88A 4ILCA 5AQLB 2V7IA 3T1HT 4M1PA 3ZJ2A 3P50A 2JMHA 2BG9C 5JQGE 4WBOA 4TNVA 1HF8A 3MJXA 5L3EB 3M3ZB 3ZT5A 2EHOC 2XSBA 5J0ZA 2V6YB 4ZS3A 3RHWA 4PW8A 1KNRA 4TV8E 2BG9B 2LLYA 2Y8DA 2M6BA 3AE8A 3OPCA 1W9RA 3ZT7A 2KINB 1YD8G 4H9SE 4ZI2C 4C91A 1OEDA 1E7PA 4ZZBA 3JADA 2PFVA 4GYRA 2JRKA 2NTYA 2PBIA 1SUMB 1WR6A 2CLYC 4X20E 3DTOA 3RIUC 4IL9A 4CI2B 2CXDA 1JNZA 3E0ZA 1YW0A 2ODVA 4HEAA 3ZMUB 3AE9A 3OKQA 3AA6B 3AEAA 2CLYB 4PK4A 2X0HA 2XQ5A 3VKHA 2HPJA 4CXYA 3N5LA 2M6IA 5FMNA 1IBKT 4Z91A 2VKJA 3EABA 3EVYA 3RYIE 2ZLYA 5FY7A 4AKRB 5ABHA 4A98A 2K48A 3ZMVB 3UU4A 4YHHT 2BKOA 1E1HB 1CHUA 4U33A 2WQYA 2K24A 3ZPOA 5AQRB 3SFDA 1XNRT 4X65T 1LKXA 5LP6E 3CPZA 4TWHA 3PJAA 4ZHQE 1U4QA 2NR4A 4Z8XA 2RA1A 2WB5A 4YSYA 5JR9A 4JBWF 5AQFB 4BAYB 4YLHA 4YFSA 2YDRA 4U72A 4O4HE 5LJNA 4KBMB 3GMIA 5LGUB 2N1GA 2NOXA 2UXNB 5LGNB 3AEFA 3IBPA 3ZN0B 4KUMB 4C90A 4BJNA 3EHZA 5ADXL 4IDNA 2K5BB 2L3LA 3CMLA 4TUYE 3MK7C 3KDSE 3T8OA 4HFHA 4AQYT 2W67A 4X62T 3DJBA 5LA6E 2CBIA 4NXNT 2A3DA 2JIWA 3RYCE 3PU3A 4L5GA 4KP3C 1VCTA 3AA0B 2BBHA 3IHRA 1HS7A 4DR1T 2XAFB 5FY1A 3KBTA 4P1NA 4LMJA 4ASKA 5CA1E 2I0MA 5CFBA 3JAEA 3N9LA 3UU5A 2DHRA 4JI7T 4UF0A 2VKHA 4DR6T 1QUUA 2HN2A 4UR9A 2CE7A 3AAIA 3B13A 1UK5A 3NRXA 3PUVF 3AE4A 2D5UA 2XZEA 4EGWA 4AI6A 4QHOA 4TWFA 5AQIB 3HA4A 4ANJA 4TNWA 1Y01A 4IDPA 3Q2MA 1SE7A 1UURA 4DV2T 3K8PC 4QWNB 4NIQA 1KNZA 4JI8T 4B3TT 3F57A 2BS4A 2LOPA 3RC8A 3Q5DA 2PTFA 3R84B 1IJ5A 3PUZF 3AE1A 3V5SA 2B76A 4CN6A 3ETVA 3UFEA 3QB5K 4YSZA 3K1SA 5C2TA 2C5KT 2A72A 3HKDE 5HEGA 4F8HA 2V7LA 1JNRA 3AVSA 2YINA 3RIFA 4IL4A 3KV9A 2D9DA 4U3CA 3LSVA 5HYAA 3CVRA 3OBVE 4UV8B 1QSDA 5JDMA 3CIRA 5LG3A 4ZEYA 3J9X1 4IE4A 4KX6A 2NW9A 3UQ4A 4U74A 4JV5T 4ILUA 4MBQA 4TWDA 3R6NA 3MXZA 5LHHB 4ZI3C 5JTGA 2OLTA 1Y64B 3HI2A 2JPFA 5FP3A 1KFYA 4HWHA 1OXZA 1KK7A 3I9YA 2CHNA 4Z90A 3KBUA 3Q5WA 4QX7B 5DABA 4I50E 5HEJA 1NWMX 5ABFA 3UTKA 5AQTB 3K3QC 2LHNA 4ZS2A 2J4GA 1I94T 3B5MA 3ZMSB 5FVKA 3WI3A 3CX8B 3O4XE 1WLXA 5JH7E 2V7JA 4QH5A 3VR8A 4AIUA 2YU1A 3FB2A 2WY2A 5DQVA 3UU3A 3WAJA 5EK2A 4A97A 2OA5A 5HAXA 3AE3A 3QNUA 5HXEA 3ZCJA 4U2ZA 5C8YE 3N2GE 5JRCA 1IAPA 4BJMA 2FJAA 2E5LT 3ABVA 2CA5A 1N33T 3H3MA 4N78D 1IJ6A 4QH4A 2XUEA 2L9QA 3FBLA 5AQQB 2IUBA 2X9HA 4O2BE 3U3IA 3PJAJ 3PV0F 2NWBA 3P8CD 1V9DA 1YQ4A 2HH7A 4G63A 5AQOB 3FZKB 2E9XD 5LOVE 2R6GF 4KHPT 5AQHB 3OJAA 2IAKA 1FEWA 2X0YA 3RX6A 2XAQB 2D0TA 4H9QC 3HKEE 4DV3T 3A7MA 3N2OA 2KMFA 3FZLB 4EB6E 2LSKA 2FBWA 3AXJA 5TAOA 5L4HA 2CXLA 3VKGA 4HN9A 5JDNA 2JQ9A 5HXSA 3FZFB 3JCFA 5AQJB 2EHOD 3KINB 4LFAT 2WAUA 5F5WA 4I55E 5L4EA 1MMDA 4FJOA 4B6XA 3P4WA 5FXVA 3ANWB 3ESLA 4UIGA 3PE0A 5HWYA 3LBXB 2Q9QB 2JQKA 1N36T 2X51A 4DV5T 4I43B 3NZQA 3MACA 3IEEA 3P4SA 1ZOYA 4I0UA 2FJDA 3K3NA 3Q5XA 4YTNA 1KNPA 4GKKT 2J47A 3KFWX 1G8XA 3MZKB 3TLSA 5ABEA 2L8KA 2WZIA 3RRWA 5L3GB 3KVBA 2E9XA 3W15B 1FJGT 5J2UE 2B1EA 3UUNA 2V7KA 1VOMA 4HGAA 4ILBA 1S94A 4H63H 4PJMA 3N9OA 2XQ4A 5HEHA 4U31A 3CK6A 1T72A 4NUVA 1OEDC 3AECA 3I0OA 3RPUA 2WS3A 2UXBT 3LJCA 3FXDB 2QVAA 5JDFA 3ZT6A 4UVCB 5EK3A 2HHHT 4U2YA 3BQLA 2LOSA 5LHGB 3LFMA 1Z8UA 1UGOA 4WZXA 2RPAA 3PUWF 4HWCA 5FXXA 4DR3T 1OEDB 4G2AA 4ISSA 4DMVA 3E22E 3LK42 3CQXC 4LFBT 1ZKEA 3FZHB 3ZJ1A 4I4TE 2AE9A 4DR4T 4QKNA 4O2AE 4JI3T 1VRBA 3C4ZA 5L3BB 4UVBB 3UUXB 5J2TE 2YK0A 2WDRA 4DV1T 4CI3B 3MA9A 4L0RA 2A2FX 2XQ3A 1UX4A 3ONLC 4CN1A 1QLBA 4YJ2E 3NRYA 3EDVA 3X1DA 2W2UA 2HPLA 2M67A 1UX5A 3WAKA 3AEEA 4JEUB 5C3JA 3ZC0A 3ZMZB 2CWOA 4YTPA 5JR9C 1MNDA 4YHJA 3QOFA 2V5CA 1FMVA 4OK0A 4JEHB 3ZSSA 5HXRA 5EZYE 3JC6D 2DI4A 2UXCT 4HTEA 2CMRA 1L0VA 4PFPA 4OHFA 5JR9B 2PJQA 3LG7A 3K3OA 4A56A 3AA7B 4QX8B 3AAEB 4H9NC 1ZV4X 2A9UA 3LK3B 3FZMB 1G73A 5FL1A 2YKSA 2ZM0A 2WCAA 3M65A 4IE7A 2CM0A 4HFBA 3RH3A 2VWAA 3KV5A 4XAXB 4X66T 5HXCA 3FXEB 4O4LE 1J5ET 2UUBT 4IIJE 3C50A 3A8YC 3CKDA 4OX9T 2PG8A 4ERRA 5L3DB 5HXHA 2WDVA 2W0GA 1Z0PA 2LSJA 2E2AA 3NKZA 4WBNE 2D0UA 3ZCIA 4KI0F 2G0UA 2KLQA 2VL8A 3NZPA 1M62A 4JI6T 3PTRB 3RF1A 4EV6A 1YKHB 4OYJA 4EAHA 2XM1A 2BVLA 1W0AA 1HNZT 1XMQT 1U5PA 4DR2T 4IDQA 4AKHA 3FBZA 3UU6A 3N9QA 4CN4A 5JREA 1EZ3A 1N34T 4UF0B 4H9OC 2RP4A 3ONXA 4LMKA 2MYSA 4IE5A 3GN5A 2CXFA 4O4IE 1HG5A 2SPCA 3AE7A 4PAGA 3ZYMA 1ZP0A 2DLRA 3AAAB 1VCSA 2FUPA 3U78A 4IHJE 3SFEA 3N2KE 3EI0A 2XSAA 4EIWA 5H6RB 5L3CB 3BQIA 4B3RT 3NBXX 5DQWA 4GK5E 2E5VA 4MLKA 3PUGA 3G06A 3TLWA 3P7IA 2LKHA 2BS3A 4COFA 2XASB 5LMNT 5FXWA 4L9IA 3ZC1A 1IBMT 4PNIA 5A1LA 2JQQA 3HKCE 4EYUA 3GWHA 4DV4T 4EYYR 5LYJE 1J5WA 2KSRA 3ZLIA 2NP9A 5BR8T 4EXTA 2UUCT 4JLEA 4HE8A 3N9NA 3O1JA 2WMNA 3ZYKA 2VVNA 5ETWA 4QXHB 5CGMA 4DR5T 3UUMA 1OWAA 4YSXA 3LDQB 4LMLA 1NAFA 3S4UA 4NUUA 4HFCA 3RKOA 4PJJA 1HX1B 1D0XA 2DWKA 5FYMA 3RRCA 2X67A 5ABFB 2LRLA 2V8SV 5FNVE 1MMGA 1N32T 2CCQA 4GK0E 3HKBE 4X1IE 3MKDA 2LSGA 2XAHB 5IUXA 1J1JA 1S35A 3ZN1B 5KDMC 4KMCA 3RLFF 3HR0A 4HWIB 3EAMA 5LG4A 3OVUA 3ETUA 5LHIB 3EUHA 1D0YA 4IE6A 4CZZB 3CX7B 2ZM8A 1X9BA 3ZEFB 1KF6A 3NWIA 1B7TA 1O3XA 2AXDS 2VASA 2H89A 5JRCB 3Q9DA 4U7YA 4DBQA 2QA7A 1SHZC 4YXDA 3A5XA 4V1Av 4DV6T 3VU7H 4QH1A 2JQHA 1ZHCA 1XMOT 4F6RC 3KVAA 1XZYA 3N9PA 1ZEEA 2XTLA 4UVAB 4ZI7E 2D2SA 4UV9B 4WNKA 1SA0E 2QYWA 4X5TA 4IDZA 5AQPB 5EK4A 1D1BA 4HFVA 4JI5T 1W0BA 5CB4E 1MIWA 5DJQC 4CXXA 5JDQA 3PUXF 2XM2A 2W63A 2W00A 2LKGA 1WR0A 2Q9QC 1GQEA 5FXZA 4DO0A 1YXRA 3BK9A 2MOZA 3H3AA 2IDOB 2XHEB 4AQFA 2LE8A 3AXJB 4EZHA 5HEUA 5LB7B 2X9XA 4GIWA 4LF6T 1WCRA 2IW5B 3SRZA 4O8SA 3IF8B 3PU8A 1T98A 4ZI2D 5LJMA 3PUSA 5AQMB 1HR0T 3QK6A 2WWUA 2IHR1 4GOUA 1MIYA 4UEMA 3KV6A 4TN7B 2WWVA 3PUYF 2VURA 5AQNB 2ZM2A 4FI5A 4H9RC 3PUAA 4CQIA 3N9MA 1HNXT 2I6HA 2ODUA 4EEDA 4LFCT 4YT0A 4AXPA 2WM9A 2F4VT 3CQGB 2XQ6A 5LGTB 3C51A 5IHYA 3RYHE 2W61A 5L2LA 3UULA 2WZHA 4WW0A 1AJ3A 3NVOA 2E9XB 3I9WA 2V6YA 5JDGA 4LF5T 2W66A 2BG9A 2XQ8A 3F31A 2LM2A 5AQGB 4DV0T 2FJEA 2YDSA 2XAGB 2EHOA 4JUYA 3AEGA 4LF7T 3SS1A 2WMOA 3L09A 2BKPA 4O4JE 4DV7T 4AKLA 4Q25A 3KV4A 5AQKB 2VB6A 5M4YA 3ZYLA 4IE0A 2EHOB 2LEHA 2UU9T 1UCUA 2LJLA 2V7MA 3TLVA 3L8RA 2N2NA 4GKJT 1BR0A 4P0BA 2BG9E 3RIUA 3ONJA 4HWDA 1HX8A 3C98B 4UELA 2FJBA 4AKIA 2KXPB 2MTQA 3SOLA 2LM9A 3O9XA 2YDQA 2BKNA 3BQKA 2WBLA 3AE5A 3VHLA 5LBMA 1OEDE 3RKGA 2X9WA 2IC9A 2Z6EA 4X64T 3P4QA 4UXNB 5AFUL 1MNEA 2MPKA 1E2AA 4MHCA 1LVKA 1NENA 2XAJB 1BR4A 4ZZCA 2OV9A 4XBFB 3H37A 3AA1B 2NW8A 1MMNA 2YU2A 3VRBA 2LSYA 1W09A 4PK6A 5L47A 4NXMT 5JVDE 1MIVA 2Y48B 1BR1A 2XQYA 1D1AA 1CUNA 2ACXA 2BS2A 2H3RA 2BZBA 4BA9A 5JDLA 3RC3A 4ISTA 3TLUA 2E8IA 4KHZF 1HFAA 2KNDA 1MMAA 5AQUB 3TLTA 1YKEB 2H7OA 3D0TA 4PJNA 3L39A 3VR9A 4JI4T 4DR7T 3FHNA 4EEBA 2MBGA 4ILAA 5F8PA 3DP7A 2VKOA 2C0SA 4JI0T 2WDQA 2QGSA 2W4XA 3CWZB 5LNKA 2V5DA 5FL0A 2LT3A 2H7VC 2LRKA 2CPTA 2IMLA 2V6XA 4DUZT 2YOEA 4IT4A 3LK2B 4AKGA 4J2CA 3AVRA 3JC6C 4GYSA 2XY8B 2X0LB 3RQWA 2XPKA 1US7B 3UU8A 2X9YA 3E08A 4IGUA 2CRBA 5HCMA 4HKAA 4YTMA 4LF8T 5HWXA 5CA0E 3ZMTB 4H9PC 2DCFA 5CJ5A 3AEDA 2VQFT 3C4WA 4CI1B 3SWHA 2K3WA 4ZI3D 4EZ4A 1IZNB 2GK9A 3GN5B 5E0OA 1H7CA 2DWGA 4K0KT 3ZSTA 1XDOA 1R8IA 1WYBA 1D0ZA 5KXJA 1XDPA 2VQET 1LRZA 5JDHA 3JAFA 2N9DA 2WU2A 4IDOA 4HWFA 5BMVE 4TV9E 1YQ3A 5KMGP 5IYZE 4MFRA 3RQUA 2X66A 4OYKA 4X1YE 4PK5A
chains in the Genus database with same CATH topology
3Q9DA 4YLHA 3V5UA 2V7KA 4YFSA 4DBQA 1VOMA 4U72A 5GONE 3GA8A 4O4HE 2QA7A 3OYZA 4HGAA 1SHZC 5LJNA 3O1IA 1S94A 4KBMB 4DVDA 3GMIA 2ZMAA 4H63H 5LGUB 4PJMA 3N9OA 2N1GA 3A5XA 4V1Av 3VU7H 2NOXA 2UXNB 5LGNB 4NUVA 1ZHCA 3I0OA 3IBPA 4F6RC 3RPUA 3KVAA 3ZN0B 3N9PA 1ZEEA 1HCIA 3LJCA 4KUMB 2XTLA 3FXDB 4UVAB 3I1AA 5JDFA 2NW7A 4UVCB 5EK3A 4C90A 4ZI7E 4BJNA 2D2SA 4UV9B 4WNKA 3BQLA 1FIOA 2LOSA 1SA0E 5LHGB 5ADXL 3LFMA 2JMKA 4IDZA 2K5BB 2L3LA 5FXXA 3CMLA 4TZ4C 3RYFE 3B57A 5EK4A 1D1BA 4HFVA 2X68A 4TUYE 3MK7C 3KDSE 4G2AA 3T8OA 5CB4E 1MIWA 4ISSA 4DMVA 3E22E 5DJQC 4CXXA 5JDQA 4CXWA 3LK42 2CWYA 3CQXC 3O1HA 3EDUA 3DJBA 5LA6E 1ZKEA 2W63A 2W00A 3ZJ1A 4I4TE 2A3DA 4QKNA 2Q9QC 4O2AE 2K9AA 2DNXA 3RYCE 3PU3A 4L5GA 5FXZA 4KP3C 1VRBA 4DO0A 3BK9A 3C4ZA 5L3BB 4UVBB 3AA0B 2MOZA 3H3AA 3UUXB 3IHRA 1HS7A 2XHEB 4AQFA 2LE8A 5J2TE 5KX5E 2XAFB 2YK0A 4EZHA 5H6QB 5FY1A 2X9XA 3KBTA 4GIWA 2WSSV 4ASKA 4QXCB 4CI3B 3MA9A 4L0RA 2IW5B 5CA1E 2A2FX 3SRZA 4O8SA 3IF8B 3PU8A 2C5JA 1T98A 3N9LA 1UX4A 4ZI2D 2DHRA 5LJMA 3C64A 4UF0A 2VKHA 1QUUA 3PUSA 5F3JA 2CEAA 4YJ2E 3QK6A 2WWUA 2CE7A 3NRYA 3EDVA 4GOUA 3AAIA 3B13A 4MALA 1MIYA 2KWIB 2JJ9A 3NRXA 4AI6A 2D5UA 4QHOA 4UEMA 3KV6A 2HPLA 2M67A 4TN7B 1UX5A 2P9BA 3WAKA 3L3PA 3AB3B 3C4XA 2BDEA 4JEUB 3HA4A 1HTJF 3UT5E 4ANJA 3ZC0A 3HL6A 2ZM2A 4FI5A 4H9RC 3ZMZB 3PUAA 2Q9QD 2CWOA 5JR9C 4CQIA 1MNDA 4YHJA 2KZ7B 3N9MA 3Q2MA 4XZCA 2LHRA 1FMVA 4OK0A 4JEHB 2ODUA 5LCYA 4AXPA 4P09A 4E7ZA 2WM9A 3K8PC 1D1CA 5HXRA 3CQGB 5EZYE 5LGTB 3C51A 4QWNB 5IHYA 3RYHE 1KNZA 2W61A 5L2LA 3UULA 3I0QA 3JC6D 4WW0A 3F57A 1AJ3A 3F2EA 2LOPA 2BVMA 2DI4A 3PURA 4HTEA 3RC8A 5FY0A 2E9XB 3R84B 2LSIA 2CMRA 3I9WA 1IJ5A 4PFPA 5JDGA 4OHFA 5JR9B 3V5SA 2PJQA 2V26A 3ETVA 4DNDA 3LG7A 3UFEA 3F31A 3K3OA 4PFOA 4A56A 3AA7B 4QXBB 4QX8B 2C5KT 2A72A 3AAEB 2ES0A 3HKDE 4H9NC 1ZV4X 3LK3B 4DBRA 2XAGB 3CQCB 2EHOA 4JUYA 2V7LA 2KT9A 1G73A 3SS1A 2WMOA 3L09A 2ZM0A 3AVSA 2YINA 3M65A 5J1GA 4IE7A 2I59A 2CM0A 4O4JE 3KV9A 3RH3A 2V1DB 2VWAA 4AKLA 3KV5A 4XAXB 3KV4A 2VB6A 2YEVC 5M4YA 5HXCA 3ZYLA 3FXEB 2C5IT 4IE0A 4O4LE 4AQGA 5HYAA 2W62A 2EHOB 2NTXA 3CVRA 4IIJE 3OBVE 1BR2A 4UV8B 3C50A 2LEHA 1QSDA 5JDMA 3CKDA 1HG2A 3J9X1 4IE4A 2PG8A 4ADZA 2VK9A 5LBQB 2NW9A 1UCUA 4ERRA 2LJLA 2V7MA 4U74A 5L3DB 4YJ3E 4AQFC 4ILUA 2N2NA 4MBQA 3QUJA 3R6NA 3PUQA 4H63V 1WRDA 3TKLB 1BR0A 5HXHA 4P0BA 3MXZA 2W0GA 1Z0PA 2LSJA 4E7SA 5LHHB 4K0UA 4ZI3C 5LXTE 1Y64B 4WBNE 2D0UA 3HI2A 2JPFA 1HX8A 3ZCIA 3C98B 4UELA 2J1DG 5FP3A 4TX5A 2G0UA 3CX6B 1OXZA 2Y6XA 3ANWA 2KLQA 4OFZA 3J7Yq 4PJLA 2VL8A 2KWHA 4AKIA 1KK7A 3NZPA 3I9YA 2KXPB 3LBXA 1X79A 2Q9QA 3PTRB 4EOZB 3KBUA 1YKHB 4DMWA 3Q5WA 2MTQA 3SOLA 2LM9A 4OYJA 4QX7B 3O9XA 5DABA 1WYCA 4I50E 4EAHA 3BQKA 2WBLA 1NWMX 3UTKA 2BVLA 3VHLA 5LBMA 2X9WA 2IC9A 1U5PA 2VKDA 2Z6EA 3K3QC 4ZOLE 4AKHA 2LHNA 3FBZA 5L3FB 4ZS2A 3PDYA 4UXNB 3N9QA 5AFUL 1MNEA 5JREA 3ZMSB 3WI3A 1EZ3A 3CX8B 3O4XE 1WLXA 4UF0B 5JH7E 2V7JA 3OYXA 4H9OC 2YU1A 2RP4A 3ONXA 4MHCA 1LVKA 2MYSA 3FB2A 2E9XC 4P0AA 2XAJB 2UXXB 3QC9A 4IE5A 1BR4A 3GN5A 2CXFA 4XBFB 4O4IE 3H37A 5DQVA 3WAJA 3AA1B 1LVFA 5EK2A 2NW8A 1HG5A 1FMWA 1MMNA 2OA5A 2SPCA 5HAXA 2IC6A 2YU2A 5HXEA 3ZCJA 4PAGA 3ZYMA 2LSYA 4PK6A 5JVDE 5C8YE 4X1KE 2DLRA 2V7IA 3AAAB 3N2GE 5JRCA 1IAPA 4M1PA 3U78A 4BJMA 1MIVA 3ZJ2A 4IHJE 2JMHA 2Y48B 1BR1A 2XQYA 1D1AA 3N2KE 2CA5A 1CUNA 2ACXA 2H3RA 5JQGE 2BZBA 4BA9A 4EIWA 4WBOA 4N78D 5H6RB 1HF8A 1IJ6A 3MJXA 5JDLA 3BQIA 3RC3A 5L3CB 5L3EB 2XUEA 4ISTA 2L9QA 3NBXX 3FBLA 2EHOC 5DQWA 4GK5E 4MLKA 2X9HA 3PUGA 2E8IA 4O2BE 3U3IA 1HFAA 2KNDA 4ZS3A 1MMAA 3P7IA 4PW8A 4TV8E 2Y8DA 2NWBA 3P8CD 1YKEB 2H7OA 3D0TA 2XASB 1V9DA 5FXWA 4L9IA 2KINB 4PJNA 2HH7A 4G63A 1YD8G 3ZC1A 4H9SE 4ZI2C 4PNIA 4C91A 2E9XD 5LOVE 5A1LA 2JQQA 3HKCE 2PFVA 4GYRA 2JRKA 4EYUA 3FHNA 2NTYA 2PBIA 3GWHA 2MBGA 1WR6A 3OJAA 2IAKA 2CLYC 4X20E 1FEWA 3DP7A 5F8PA 3RX6A 4EYYR 5LYJE 3DTOA 2VKOA 2C0SA 2XAQB 2D0TA 4H9QC 3HKEE 4CI2B 3N2OA 2CXDA 2KMFA 3ZLIA 3E0ZA 4EB6E 2QGSA 2LSKA 1YW0A 2NP9A 3CWZB 5TAOA 4EXTA 2ODVA 4JLEA 4HEAA 5LNKA 4HE8A 2CXLA 3ZMUB 3VKGA 2LT3A 3N9NA 2H7VC 3O1JA 2WMNA 4HN9A 3OKQA 3ZYKA 5JDNA 3AA6B 5HXSA 2CLYB 5ETWA 2EHOD 3LK2B 4PK4A 3KINB 4QXHB 2WAUA 4AKGA 4I55E 3VKHA 3UUMA 1OWAA 2HPJA 4J2CA 4CXYA 3AVRA 1MMDA 3JC6C 3N5LA 4GYSA 1NAFA 4FJOA 5FMNA 4B6XA 2VKJA 5FXVA 3S4UA 3ANWB 3EVYA 4NUUA 2X0LB 3ESLA 3RYIE 3RKOA 4PJJA 4UIGA 3PE0A 5HWYA 3LBXB 2Q9QB 1D0XA 2ZLYA 5FY7A 1US7B 2DWKA 5FYMA 2X9YA 4AKRB 3RRCA 2X51A 3E08A 4IGUA 2X67A 4HKAA 2K48A 3ZMVB 4I43B 1E1HB 3NZQA 3MACA 5CA0E 5HWXA 5FNVE 1MMGA 3IEEA 3ZMTB 2CCQA 4GK0E 3HKBE 4X1IE 3K3NA 3Q5XA 4H9PC 2DCFA 3MKDA 2LSGA 2K24A 2XAHB 1S35A 3ZPOA 3ZN1B 5KDMC 3KFWX 1G8XA 3C4WA 4KMCA 4CI1B 3HR0A 3MZKB 3SWHA 1LKXA 4ZI3D 5LP6E 3CPZA 5LG4A 4EZ4A 1IZNB 2GK9A 3GN5B 5E0OA 2L8KA 1H7CA 2DWGA 3ETUA 3RRWA 1WYBA 1D0ZA 5L3GB 5LHIB 1LRZA 3EUHA 5JDHA 4ZHQE 3KVBA 1U4QA 1D0YA 4IE6A 4CZZB 2E9XA 3CX7B 2N9DA 3W15B 2ZM8A 5J2UE 5BMVE 4Z8XA 2RA1A 4TV9E 3ZEFB 5JR9A 2B1EA 5KMGP 5IYZE 3UUNA 4MFRA 4BAYB 1B7TA 2X66A 4OYKA 4X1YE 1O3XA 4PK5A 2VASA 5JRCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LBX B;  3UUL A;  1AJ3 A;  1WLX A;  3LBX A;  3FB2 A;  3UUM A;  1QUU A;  1OWA A;  1U4Q A;  1CUN A;  3EDV A;  3F31 A;  1HCI A;  2ODU A;  2SPC A;  1U5P A;  3UUN A;  1S35 A;  2ODV A;  3PE0 A; 
#chains in the Genus database with same CATH topology
 3V5U A;  5GON E;  3GA8 A;  3OYZ A;  5ABG A;  3O1I A;  4DVD A;  2ZMA A;  4ZXL A;  2QRX A;  5AQV B;  3UFG A;  1XNQ T;  1HCI A;  2XJ7 A;  3I1A A;  1XWM A;  2NW7 A;  1FIO A;  1T7S A;  2JMK A;  5HEO A;  4LF4 T;  2J62 A;  4TZ4 C;  3RYF E;  3B57 A;  2X68 A;  4A5X A;  4CXW A;  4HFD A;  2CWY A;  3O1H A;  3EDU A;  2XQ9 A;  5FKY A;  2K9A A;  2DNX A;  2IIU A;  1T8B A;  5HCJ A;  2UXD T;  3T1Y T;  5KX5 E;  3AEB A;  5H6Q B;  2HN1 A;  2WSS V;  2UUA T;  4QXC B;  2C5J A;  4NPP A;  3C64 A;  2WU5 A;  5F3J A;  2CEA A;  4MAL A;  2KWI B;  2JJ9 A;  4YY3 T;  1NEK A;  4LF9 T;  2P9B A;  2BBJ A;  3L3P A;  3AB3 B;  3C4X A;  2BDE A;  4HFI A;  1HTJ F;  3UT5 E;  3HL6 A;  2WP9 A;  3AE6 A;  2Q9Q D;  2KZ7 B;  4XZC A;  2LHR A;  5LCY A;  4P09 A;  4E7Z A;  1D1C A;  1DU2 A;  1WFD A;  3I0Q A;  3F2E A;  2BVM A;  3PUR A;  5FY0 A;  2LSI A;  3P4P A;  3AE2 A;  4DID B;  2V26 A;  4DND A;  4PFO A;  3OTO T;  4QXB B;  2ES0 A;  4DUY T;  4DBR A;  3CQC B;  1IBL T;  2KT9 A;  3P4R A;  5J1G A;  4JI1 T;  2I59 A;  5IWA T;  2V1D B;  1KEY A;  4U7I A;  2YEV C;  2C5I T;  4AQG A;  2W62 A;  2NTX A;  2XQ7 A;  1BR2 A;  2DL1 A;  4IRE A;  2ACZ A;  3VRA A;  3UQ7 A;  3RGL A;  2MAW A;  1HG2 A;  5LMU T;  4ADZ A;  2VK9 A;  5LBQ B;  4YJ3 E;  4AQF C;  2VL0 A;  3QUJ A;  3PUQ A;  4H63 V;  1WRD A;  2YN6 A;  3TKL B;  3UUB A;  4AIS A;  3RIA A;  4E7S A;  4K0U A;  3IA3 A;  4WYV A;  3ZKR A;  5AQS B;  5LXT E;  4HFE A;  2J1D G;  5FVL A;  1M7K A;  4TX5 A;  3CX6 B;  2Y6X A;  4OFZ A;  3ANW A;  3J7Y q;  4PJL A;  2KWH A;  3LBX A;  1X79 A;  2Q9Q A;  4EOZ B;  4B3M T;  4DMW A;  1UUS A;  1WYC A;  4B3S T;  3QB5 A;  2VKD A;  4ZOL E;  2XQA A;  5L3F B;  1I6Z A;  3PDY A;  4JI2 T;  3Q5E A;  2VVS A;  2ZM6 T;  3OYX A;  4JYA T;  4P0A A;  2E9X C;  2CHO A;  2UXX B;  3QC9 A;  2CBJ A;  1LVF A;  3RI5 A;  1FMW A;  2IC6 A;  1HNW T;  4X1K E;  2H88 A;  4ILC A;  5AQL B;  2V7I A;  3T1H T;  4M1P A;  3ZJ2 A;  3P50 A;  2JMH A;  2BG9 C;  5JQG E;  4WBO A;  4TNV A;  1HF8 A;  3MJX A;  5L3E B;  3M3Z B;  3ZT5 A;  2EHO C;  2XSB A;  5J0Z A;  2V6Y B;  4ZS3 A;  3RHW A;  4PW8 A;  1KNR A;  4TV8 E;  2BG9 B;  2LLY A;  2Y8D A;  2M6B A;  3AE8 A;  3OPC A;  1W9R A;  3ZT7 A;  2KIN B;  1YD8 G;  4H9S E;  4ZI2 C;  4C91 A;  1OED A;  1E7P A;  4ZZB A;  3JAD A;  2PFV A;  4GYR A;  2JRK A;  2NTY A;  2PBI A;  1SUM B;  1WR6 A;  2CLY C;  4X20 E;  3DTO A;  3RIU C;  4IL9 A;  4CI2 B;  2CXD A;  1JNZ A;  3E0Z A;  1YW0 A;  2ODV A;  4HEA A;  3ZMU B;  3AE9 A;  3OKQ A;  3AA6 B;  3AEA A;  2CLY B;  4PK4 A;  2X0H A;  2XQ5 A;  3VKH A;  2HPJ A;  4CXY A;  3N5L A;  2M6I A;  5FMN A;  1IBK T;  4Z91 A;  2VKJ A;  3EAB A;  3EVY A;  3RYI E;  2ZLY A;  5FY7 A;  4AKR B;  5ABH A;  4A98 A;  2K48 A;  3ZMV B;  3UU4 A;  4YHH T;  2BKO A;  1E1H B;  1CHU A;  4U33 A;  2WQY A;  2K24 A;  3ZPO A;  5AQR B;  3SFD A;  1XNR T;  4X65 T;  1LKX A;  5LP6 E;  3CPZ A;  4TWH A;  3PJA A;  4ZHQ E;  1U4Q A;  2NR4 A;  4Z8X A;  2RA1 A;  2WB5 A;  4YSY A;  5JR9 A;  4JBW F;  5AQF B;  4BAY B;  4YLH A;  4YFS A;  2YDR A;  4U72 A;  4O4H E;  5LJN A;  4KBM B;  3GMI A;  5LGU B;  2N1G A;  2NOX A;  2UXN B;  5LGN B;  3AEF A;  3IBP A;  3ZN0 B;  4KUM B;  4C90 A;  4BJN A;  3EHZ A;  5ADX L;  4IDN A;  2K5B B;  2L3L A;  3CML A;  4TUY E;  3MK7 C;  3KDS E;  3T8O A;  4HFH A;  4AQY T;  2W67 A;  4X62 T;  3DJB A;  5LA6 E;  2CBI A;  4NXN T;  2A3D A;  2JIW A;  3RYC E;  3PU3 A;  4L5G A;  4KP3 C;  1VCT A;  3AA0 B;  2BBH A;  3IHR A;  1HS7 A;  4DR1 T;  2XAF B;  5FY1 A;  3KBT A;  4P1N A;  4LMJ A;  4ASK A;  5CA1 E;  2I0M A;  5CFB A;  3JAE A;  3N9L A;  3UU5 A;  2DHR A;  4JI7 T;  4UF0 A;  2VKH A;  4DR6 T;  1QUU A;  2HN2 A;  4UR9 A;  2CE7 A;  3AAI A;  3B13 A;  1UK5 A;  3NRX A;  3PUV F;  3AE4 A;  2D5U A;  2XZE A;  4EGW A;  4AI6 A;  4QHO A;  4TWF A;  5AQI B;  3HA4 A;  4ANJ A;  4TNW A;  1Y01 A;  4IDP A;  3Q2M A;  1SE7 A;  1UUR A;  4DV2 T;  3K8P C;  4QWN B;  4NIQ A;  1KNZ A;  4JI8 T;  4B3T T;  3F57 A;  2BS4 A;  2LOP A;  3RC8 A;  3Q5D A;  2PTF A;  3R84 B;  1IJ5 A;  3PUZ F;  3AE1 A;  3V5S A;  2B76 A;  4CN6 A;  3ETV A;  3UFE A;  3QB5 K;  4YSZ A;  3K1S A;  5C2T A;  2C5K T;  2A72 A;  3HKD E;  5HEG A;  4F8H A;  2V7L A;  1JNR A;  3AVS A;  2YIN A;  3RIF A;  4IL4 A;  3KV9 A;  2D9D A;  4U3C A;  3LSV A;  5HYA A;  3CVR A;  3OBV E;  4UV8 B;  1QSD A;  5JDM A;  3CIR A;  5LG3 A;  4ZEY A;  3J9X 1;  4IE4 A;  4KX6 A;  2NW9 A;  3UQ4 A;  4U74 A;  4JV5 T;  4ILU A;  4MBQ A;  4TWD A;  3R6N A;  3MXZ A;  5LHH B;  4ZI3 C;  5JTG A;  2OLT A;  1Y64 B;  3HI2 A;  2JPF A;  5FP3 A;  1KFY A;  4HWH A;  1OXZ A;  1KK7 A;  3I9Y A;  2CHN A;  4Z90 A;  3KBU A;  3Q5W A;  4QX7 B;  5DAB A;  4I50 E;  5HEJ A;  1NWM X;  5ABF A;  3UTK A;  5AQT B;  3K3Q C;  2LHN A;  4ZS2 A;  2J4G A;  1I94 T;  3B5M A;  3ZMS B;  5FVK A;  3WI3 A;  3CX8 B;  3O4X E;  1WLX A;  5JH7 E;  2V7J A;  4QH5 A;  3VR8 A;  4AIU A;  2YU1 A;  3FB2 A;  2WY2 A;  5DQV A;  3UU3 A;  3WAJ A;  5EK2 A;  4A97 A;  2OA5 A;  5HAX A;  3AE3 A;  3QNU A;  5HXE A;  3ZCJ A;  4U2Z A;  5C8Y E;  3N2G E;  5JRC A;  1IAP A;  4BJM A;  2FJA A;  2E5L T;  3ABV A;  2CA5 A;  1N33 T;  3H3M A;  4N78 D;  1IJ6 A;  4QH4 A;  2XUE A;  2L9Q A;  3FBL A;  5AQQ B;  2IUB A;  2X9H A;  4O2B E;  3U3I A;  3PJA J;  3PV0 F;  2NWB A;  3P8C D;  1V9D A;  1YQ4 A;  2HH7 A;  4G63 A;  5AQO B;  3FZK B;  2E9X D;  5LOV E;  2R6G F;  4KHP T;  5AQH B;  3OJA A;  2IAK A;  1FEW A;  2X0Y A;  3RX6 A;  2XAQ B;  2D0T A;  4H9Q C;  3HKE E;  4DV3 T;  3A7M A;  3N2O A;  2KMF A;  3FZL B;  4EB6 E;  2LSK A;  2FBW A;  3AXJ A;  5TAO A;  5L4H A;  2CXL A;  3VKG A;  4HN9 A;  5JDN A;  2JQ9 A;  5HXS A;  3FZF B;  3JCF A;  5AQJ B;  2EHO D;  3KIN B;  4LFA T;  2WAU A;  5F5W A;  4I55 E;  5L4E A;  1MMD A;  4FJO A;  4B6X A;  3P4W A;  5FXV A;  3ANW B;  3ESL A;  4UIG A;  3PE0 A;  5HWY A;  3LBX B;  2Q9Q B;  2JQK A;  1N36 T;  2X51 A;  4DV5 T;  4I43 B;  3NZQ A;  3MAC A;  3IEE A;  3P4S A;  1ZOY A;  4I0U A;  2FJD A;  3K3N A;  3Q5X A;  4YTN A;  1KNP A;  4GKK T;  2J47 A;  3KFW X;  1G8X A;  3MZK B;  3TLS A;  5ABE A;  2L8K A;  2WZI A;  3RRW A;  5L3G B;  3KVB A;  2E9X A;  3W15 B;  1FJG T;  5J2U E;  2B1E A;  3UUN A;  2V7K A;  1VOM A;  4HGA A;  4ILB A;  1S94 A;  4H63 H;  4PJM A;  3N9O A;  2XQ4 A;  5HEH A;  4U31 A;  3CK6 A;  1T72 A;  4NUV A;  1OED C;  3AEC A;  3I0O A;  3RPU A;  2WS3 A;  2UXB T;  3LJC A;  3FXD B;  2QVA A;  5JDF A;  3ZT6 A;  4UVC B;  5EK3 A;  2HHH T;  4U2Y A;  3BQL A;  2LOS A;  5LHG B;  3LFM A;  1Z8U A;  1UGO A;  4WZX A;  2RPA A;  3PUW F;  4HWC A;  5FXX A;  4DR3 T;  1OED B;  4G2A A;  4ISS A;  4DMV A;  3E22 E;  3LK4 2;  3CQX C;  4LFB T;  1ZKE A;  3FZH B;  3ZJ1 A;  4I4T E;  2AE9 A;  4DR4 T;  4QKN A;  4O2A E;  4JI3 T;  1VRB A;  3C4Z A;  5L3B B;  4UVB B;  3UUX B;  5J2T E;  2YK0 A;  2WDR A;  4DV1 T;  4CI3 B;  3MA9 A;  4L0R A;  2A2F X;  2XQ3 A;  1UX4 A;  3ONL C;  4CN1 A;  1QLB A;  4YJ2 E;  3NRY A;  3EDV A;  3X1D A;  2W2U A;  2HPL A;  2M67 A;  1UX5 A;  3WAK A;  3AEE A;  4JEU B;  5C3J A;  3ZC0 A;  3ZMZ B;  2CWO A;  4YTP A;  5JR9 C;  1MND A;  4YHJ A;  3QOF A;  2V5C A;  1FMV A;  4OK0 A;  4JEH B;  3ZSS A;  5HXR A;  5EZY E;  3JC6 D;  2DI4 A;  2UXC T;  4HTE A;  2CMR A;  1L0V A;  4PFP A;  4OHF A;  5JR9 B;  2PJQ A;  3LG7 A;  3K3O A;  4A56 A;  3AA7 B;  4QX8 B;  3AAE B;  4H9N C;  1ZV4 X;  2A9U A;  3LK3 B;  3FZM B;  1G73 A;  5FL1 A;  2YKS A;  2ZM0 A;  2WCA A;  3M65 A;  4IE7 A;  2CM0 A;  4HFB A;  3RH3 A;  2VWA A;  3KV5 A;  4XAX B;  4X66 T;  5HXC A;  3FXE B;  4O4L E;  1J5E T;  2UUB T;  4IIJ E;  3C50 A;  3A8Y C;  3CKD A;  4OX9 T;  2PG8 A;  4ERR A;  5L3D B;  5HXH A;  2WDV A;  2W0G A;  1Z0P A;  2LSJ A;  2E2A A;  3NKZ A;  4WBN E;  2D0U A;  3ZCI A;  4KI0 F;  2G0U A;  2KLQ A;  2VL8 A;  3NZP A;  1M62 A;  4JI6 T;  3PTR B;  3RF1 A;  4EV6 A;  1YKH B;  4OYJ A;  4EAH A;  2XM1 A;  2BVL A;  1W0A A;  1HNZ T;  1XMQ T;  1U5P A;  4DR2 T;  4IDQ A;  4AKH A;  3FBZ A;  3UU6 A;  3N9Q A;  4CN4 A;  5JRE A;  1EZ3 A;  1N34 T;  4UF0 B;  4H9O C;  2RP4 A;  3ONX A;  4LMK A;  2MYS A;  4IE5 A;  3GN5 A;  2CXF A;  4O4I E;  1HG5 A;  2SPC A;  3AE7 A;  4PAG A;  3ZYM A;  1ZP0 A;  2DLR A;  3AAA B;  1VCS A;  2FUP A;  3U78 A;  4IHJ E;  3SFE A;  3N2K E;  3EI0 A;  2XSA A;  4EIW A;  5H6R B;  5L3C B;  3BQI A;  4B3R T;  3NBX X;  5DQW A;  4GK5 E;  2E5V A;  4MLK A;  3PUG A;  3G06 A;  3TLW A;  3P7I A;  2LKH A;  2BS3 A;  4COF A;  2XAS B;  5LMN T;  5FXW A;  4L9I A;  3ZC1 A;  1IBM T;  4PNI A;  5A1L A;  2JQQ A;  3HKC E;  4EYU A;  3GWH A;  4DV4 T;  4EYY R;  5LYJ E;  1J5W A;  2KSR A;  3ZLI A;  2NP9 A;  5BR8 T;  4EXT A;  2UUC T;  4JLE A;  4HE8 A;  3N9N A;  3O1J A;  2WMN A;  3ZYK A;  2VVN A;  5ETW A;  4QXH B;  5CGM A;  4DR5 T;  3UUM A;  1OWA A;  4YSX A;  3LDQ B;  4LML A;  1NAF A;  3S4U A;  4NUU A;  4HFC A;  3RKO A;  4PJJ A;  1HX1 B;  1D0X A;  2DWK A;  5FYM A;  3RRC A;  2X67 A;  5ABF B;  2LRL A;  2V8S V;  5FNV E;  1MMG A;  1N32 T;  2CCQ A;  4GK0 E;  3HKB E;  4X1I E;  3MKD A;  2LSG A;  2XAH B;  5IUX A;  1J1J A;  1S35 A;  3ZN1 B;  5KDM C;  4KMC A;  3RLF F;  3HR0 A;  4HWI B;  3EAM A;  5LG4 A;  3OVU A;  3ETU A;  5LHI B;  3EUH A;  1D0Y A;  4IE6 A;  4CZZ B;  3CX7 B;  2ZM8 A;  1X9B A;  3ZEF B;  1KF6 A;  3NWI A;  1B7T A;  1O3X A;  2AXD S;  2VAS A;  2H89 A;  5JRC B;  3Q9D A;  4U7Y A;  4DBQ A;  2QA7 A;  1SHZ C;  4YXD A;  3A5X A;  4V1A v;  4DV6 T;  3VU7 H;  4QH1 A;  2JQH A;  1ZHC A;  1XMO T;  4F6R C;  3KVA A;  1XZY A;  3N9P A;  1ZEE A;  2XTL A;  4UVA B;  4ZI7 E;  2D2S A;  4UV9 B;  4WNK A;  1SA0 E;  2QYW A;  4X5T A;  4IDZ A;  5AQP B;  5EK4 A;  1D1B A;  4HFV A;  4JI5 T;  1W0B A;  5CB4 E;  1MIW A;  5DJQ C;  4CXX A;  5JDQ A;  3PUX F;  2XM2 A;  2W63 A;  2W00 A;  2LKG A;  1WR0 A;  2Q9Q C;  1GQE A;  5FXZ A;  4DO0 A;  1YXR A;  3BK9 A;  2MOZ A;  3H3A A;  2IDO B;  2XHE B;  4AQF A;  2LE8 A;  3AXJ B;  4EZH A;  5HEU A;  5LB7 B;  2X9X A;  4GIW A;  4LF6 T;  1WCR A;  2IW5 B;  3SRZ A;  4O8S A;  3IF8 B;  3PU8 A;  1T98 A;  4ZI2 D;  5LJM A;  3PUS A;  5AQM B;  1HR0 T;  3QK6 A;  2WWU A;  2IHR 1;  4GOU A;  1MIY A;  4UEM A;  3KV6 A;  4TN7 B;  2WWV A;  3PUY F;  2VUR A;  5AQN B;  2ZM2 A;  4FI5 A;  4H9R C;  3PUA A;  4CQI A;  3N9M A;  1HNX T;  2I6H A;  2ODU A;  4EED A;  4LFC T;  4YT0 A;  4AXP A;  2WM9 A;  2F4V T;  3CQG B;  2XQ6 A;  5LGT B;  3C51 A;  5IHY A;  3RYH E;  2W61 A;  5L2L A;  3UUL A;  2WZH A;  4WW0 A;  1AJ3 A;  3NVO A;  2E9X B;  3I9W A;  2V6Y A;  5JDG A;  4LF5 T;  2W66 A;  2BG9 A;  2XQ8 A;  3F31 A;  2LM2 A;  5AQG B;  4DV0 T;  2FJE A;  2YDS A;  2XAG B;  2EHO A;  4JUY A;  3AEG A;  4LF7 T;  3SS1 A;  2WMO A;  3L09 A;  2BKP A;  4O4J E;  4DV7 T;  4AKL A;  4Q25 A;  3KV4 A;  5AQK B;  2VB6 A;  5M4Y A;  3ZYL A;  4IE0 A;  2EHO B;  2LEH A;  2UU9 T;  1UCU A;  2LJL A;  2V7M A;  3TLV A;  3L8R A;  2N2N A;  4GKJ T;  1BR0 A;  4P0B A;  2BG9 E;  3RIU A;  3ONJ A;  4HWD A;  1HX8 A;  3C98 B;  4UEL A;  2FJB A;  4AKI A;  2KXP B;  2MTQ A;  3SOL A;  2LM9 A;  3O9X A;  2YDQ A;  2BKN A;  3BQK A;  2WBL A;  3AE5 A;  3VHL A;  5LBM A;  1OED E;  3RKG A;  2X9W A;  2IC9 A;  2Z6E A;  4X64 T;  3P4Q A;  4UXN B;  5AFU L;  1MNE A;  2MPK A;  1E2A A;  4MHC A;  1LVK A;  1NEN A;  2XAJ B;  1BR4 A;  4ZZC A;  2OV9 A;  4XBF B;  3H37 A;  3AA1 B;  2NW8 A;  1MMN A;  2YU2 A;  3VRB A;  2LSY A;  1W09 A;  4PK6 A;  5L47 A;  4NXM T;  5JVD E;  1MIV A;  2Y48 B;  1BR1 A;  2XQY A;  1D1A A;  1CUN A;  2ACX A;  2BS2 A;  2H3R A;  2BZB A;  4BA9 A;  5JDL A;  3RC3 A;  4IST A;  3TLU A;  2E8I A;  4KHZ F;  1HFA A;  2KND A;  1MMA A;  5AQU B;  3TLT A;  1YKE B;  2H7O A;  3D0T A;  4PJN A;  3L39 A;  3VR9 A;  4JI4 T;  4DR7 T;  3FHN A;  4EEB A;  2MBG A;  4ILA A;  5F8P A;  3DP7 A;  2VKO A;  2C0S A;  4JI0 T;  2WDQ A;  2QGS A;  2W4X A;  3CWZ B;  5LNK A;  2V5D A;  5FL0 A;  2LT3 A;  2H7V C;  2LRK A;  2CPT A;  2IML A;  2V6X A;  4DUZ T;  2YOE A;  4IT4 A;  3LK2 B;  4AKG A;  4J2C A;  3AVR A;  3JC6 C;  4GYS A;  2XY8 B;  2X0L B;  3RQW A;  2XPK A;  1US7 B;  3UU8 A;  2X9Y A;  3E08 A;  4IGU A;  2CRB A;  5HCM A;  4HKA A;  4YTM A;  4LF8 T;  5HWX A;  5CA0 E;  3ZMT B;  4H9P C;  2DCF A;  5CJ5 A;  3AED A;  2VQF T;  3C4W A;  4CI1 B;  3SWH A;  2K3W A;  4ZI3 D;  4EZ4 A;  1IZN B;  2GK9 A;  3GN5 B;  5E0O A;  1H7C A;  2DWG A;  4K0K T;  3ZST A;  1XDO A;  1R8I A;  1WYB A;  1D0Z A;  5KXJ A;  1XDP A;  2VQE T;  1LRZ A;  5JDH A;  3JAF A;  2N9D A;  2WU2 A;  4IDO A;  4HWF A;  5BMV E;  4TV9 E;  1YQ3 A;  5KMG P;  5IYZ E;  4MFR A;  3RQU A;  2X66 A;  4OYK A;  4X1Y E;  4PK5 A; 
#chains in the Genus database with same CATH homology
 3Q9D A;  4YLH A;  3V5U A;  2V7K A;  4YFS A;  4DBQ A;  1VOM A;  4U72 A;  5GON E;  3GA8 A;  4O4H E;  2QA7 A;  3OYZ A;  4HGA A;  1SHZ C;  5LJN A;  3O1I A;  1S94 A;  4KBM B;  4DVD A;  3GMI A;  2ZMA A;  4H63 H;  5LGU B;  4PJM A;  3N9O A;  2N1G A;  3A5X A;  4V1A v;  3VU7 H;  2NOX A;  2UXN B;  5LGN B;  4NUV A;  1ZHC A;  3I0O A;  3IBP A;  4F6R C;  3RPU A;  3KVA A;  3ZN0 B;  3N9P A;  1ZEE A;  1HCI A;  3LJC A;  4KUM B;  2XTL A;  3FXD B;  4UVA B;  3I1A A;  5JDF A;  2NW7 A;  4UVC B;  5EK3 A;  4C90 A;  4ZI7 E;  4BJN A;  2D2S A;  4UV9 B;  4WNK A;  3BQL A;  1FIO A;  2LOS A;  1SA0 E;  5LHG B;  5ADX L;  3LFM A;  2JMK A;  4IDZ A;  2K5B B;  2L3L A;  5FXX A;  3CML A;  4TZ4 C;  3RYF E;  3B57 A;  5EK4 A;  1D1B A;  4HFV A;  2X68 A;  4TUY E;  3MK7 C;  3KDS E;  4G2A A;  3T8O A;  5CB4 E;  1MIW A;  4ISS A;  4DMV A;  3E22 E;  5DJQ C;  4CXX A;  5JDQ A;  4CXW A;  3LK4 2;  2CWY A;  3CQX C;  3O1H A;  3EDU A;  3DJB A;  5LA6 E;  1ZKE A;  2W63 A;  2W00 A;  3ZJ1 A;  4I4T E;  2A3D A;  4QKN A;  2Q9Q C;  4O2A E;  2K9A A;  2DNX A;  3RYC E;  3PU3 A;  4L5G A;  5FXZ A;  4KP3 C;  1VRB A;  4DO0 A;  3BK9 A;  3C4Z A;  5L3B B;  4UVB B;  3AA0 B;  2MOZ A;  3H3A A;  3UUX B;  3IHR A;  1HS7 A;  2XHE B;  4AQF A;  2LE8 A;  5J2T E;  5KX5 E;  2XAF B;  2YK0 A;  4EZH A;  5H6Q B;  5FY1 A;  2X9X A;  3KBT A;  4GIW A;  2WSS V;  4ASK A;  4QXC B;  4CI3 B;  3MA9 A;  4L0R A;  2IW5 B;  5CA1 E;  2A2F X;  3SRZ A;  4O8S A;  3IF8 B;  3PU8 A;  2C5J A;  1T98 A;  3N9L A;  1UX4 A;  4ZI2 D;  2DHR A;  5LJM A;  3C64 A;  4UF0 A;  2VKH A;  1QUU A;  3PUS A;  5F3J A;  2CEA A;  4YJ2 E;  3QK6 A;  2WWU A;  2CE7 A;  3NRY A;  3EDV A;  4GOU A;  3AAI A;  3B13 A;  4MAL A;  1MIY A;  2KWI B;  2JJ9 A;  3NRX A;  4AI6 A;  2D5U A;  4QHO A;  4UEM A;  3KV6 A;  2HPL A;  2M67 A;  4TN7 B;  1UX5 A;  2P9B A;  3WAK A;  3L3P A;  3AB3 B;  3C4X A;  2BDE A;  4JEU B;  3HA4 A;  1HTJ F;  3UT5 E;  4ANJ A;  3ZC0 A;  3HL6 A;  2ZM2 A;  4FI5 A;  4H9R C;  3ZMZ B;  3PUA A;  2Q9Q D;  2CWO A;  5JR9 C;  4CQI A;  1MND A;  4YHJ A;  2KZ7 B;  3N9M A;  3Q2M A;  4XZC A;  2LHR A;  1FMV A;  4OK0 A;  4JEH B;  2ODU A;  5LCY A;  4AXP A;  4P09 A;  4E7Z A;  2WM9 A;  3K8P C;  1D1C A;  5HXR A;  3CQG B;  5EZY E;  5LGT B;  3C51 A;  4QWN B;  5IHY A;  3RYH E;  1KNZ A;  2W61 A;  5L2L A;  3UUL A;  3I0Q A;  3JC6 D;  4WW0 A;  3F57 A;  1AJ3 A;  3F2E A;  2LOP A;  2BVM A;  2DI4 A;  3PUR A;  4HTE A;  3RC8 A;  5FY0 A;  2E9X B;  3R84 B;  2LSI A;  2CMR A;  3I9W A;  1IJ5 A;  4PFP A;  5JDG A;  4OHF A;  5JR9 B;  3V5S A;  2PJQ A;  2V26 A;  3ETV A;  4DND A;  3LG7 A;  3UFE A;  3F31 A;  3K3O A;  4PFO A;  4A56 A;  3AA7 B;  4QXB B;  4QX8 B;  2C5K T;  2A72 A;  3AAE B;  2ES0 A;  3HKD E;  4H9N C;  1ZV4 X;  3LK3 B;  4DBR A;  2XAG B;  3CQC B;  2EHO A;  4JUY A;  2V7L A;  2KT9 A;  1G73 A;  3SS1 A;  2WMO A;  3L09 A;  2ZM0 A;  3AVS A;  2YIN A;  3M65 A;  5J1G A;  4IE7 A;  2I59 A;  2CM0 A;  4O4J E;  3KV9 A;  3RH3 A;  2V1D B;  2VWA A;  4AKL A;  3KV5 A;  4XAX B;  3KV4 A;  2VB6 A;  2YEV C;  5M4Y A;  5HXC A;  3ZYL A;  3FXE B;  2C5I T;  4IE0 A;  4O4L E;  4AQG A;  5HYA A;  2W62 A;  2EHO B;  2NTX A;  3CVR A;  4IIJ E;  3OBV E;  1BR2 A;  4UV8 B;  3C50 A;  2LEH A;  1QSD A;  5JDM A;  3CKD A;  1HG2 A;  3J9X 1;  4IE4 A;  2PG8 A;  4ADZ A;  2VK9 A;  5LBQ B;  2NW9 A;  1UCU A;  4ERR A;  2LJL A;  2V7M A;  4U74 A;  5L3D B;  4YJ3 E;  4AQF C;  4ILU A;  2N2N A;  4MBQ A;  3QUJ A;  3R6N A;  3PUQ A;  4H63 V;  1WRD A;  3TKL B;  1BR0 A;  5HXH A;  4P0B A;  3MXZ A;  2W0G A;  1Z0P A;  2LSJ A;  4E7S A;  5LHH B;  4K0U A;  4ZI3 C;  5LXT E;  1Y64 B;  4WBN E;  2D0U A;  3HI2 A;  2JPF A;  1HX8 A;  3ZCI A;  3C98 B;  4UEL A;  2J1D G;  5FP3 A;  4TX5 A;  2G0U A;  3CX6 B;  1OXZ A;  2Y6X A;  3ANW A;  2KLQ A;  4OFZ A;  3J7Y q;  4PJL A;  2VL8 A;  2KWH A;  4AKI A;  1KK7 A;  3NZP A;  3I9Y A;  2KXP B;  3LBX A;  1X79 A;  2Q9Q A;  3PTR B;  4EOZ B;  3KBU A;  1YKH B;  4DMW A;  3Q5W A;  2MTQ A;  3SOL A;  2LM9 A;  4OYJ A;  4QX7 B;  3O9X A;  5DAB A;  1WYC A;  4I50 E;  4EAH A;  3BQK A;  2WBL A;  1NWM X;  3UTK A;  2BVL A;  3VHL A;  5LBM A;  2X9W A;  2IC9 A;  1U5P A;  2VKD A;  2Z6E A;  3K3Q C;  4ZOL E;  4AKH A;  2LHN A;  3FBZ A;  5L3F B;  4ZS2 A;  3PDY A;  4UXN B;  3N9Q A;  5AFU L;  1MNE A;  5JRE A;  3ZMS B;  3WI3 A;  1EZ3 A;  3CX8 B;  3O4X E;  1WLX A;  4UF0 B;  5JH7 E;  2V7J A;  3OYX A;  4H9O C;  2YU1 A;  2RP4 A;  3ONX A;  4MHC A;  1LVK A;  2MYS A;  3FB2 A;  2E9X C;  4P0A A;  2XAJ B;  2UXX B;  3QC9 A;  4IE5 A;  1BR4 A;  3GN5 A;  2CXF A;  4XBF B;  4O4I E;  3H37 A;  5DQV A;  3WAJ A;  3AA1 B;  1LVF A;  5EK2 A;  2NW8 A;  1HG5 A;  1FMW A;  1MMN A;  2OA5 A;  2SPC A;  5HAX A;  2IC6 A;  2YU2 A;  5HXE A;  3ZCJ A;  4PAG A;  3ZYM A;  2LSY A;  4PK6 A;  5JVD E;  5C8Y E;  4X1K E;  2DLR A;  2V7I A;  3AAA B;  3N2G E;  5JRC A;  1IAP A;  4M1P A;  3U78 A;  4BJM A;  1MIV A;  3ZJ2 A;  4IHJ E;  2JMH A;  2Y48 B;  1BR1 A;  2XQY A;  1D1A A;  3N2K E;  2CA5 A;  1CUN A;  2ACX A;  2H3R A;  5JQG E;  2BZB A;  4BA9 A;  4EIW A;  4WBO A;  4N78 D;  5H6R B;  1HF8 A;  1IJ6 A;  3MJX A;  5JDL A;  3BQI A;  3RC3 A;  5L3C B;  5L3E B;  2XUE A;  4IST A;  2L9Q A;  3NBX X;  3FBL A;  2EHO C;  5DQW A;  4GK5 E;  4MLK A;  2X9H A;  3PUG A;  2E8I A;  4O2B E;  3U3I A;  1HFA A;  2KND A;  4ZS3 A;  1MMA A;  3P7I A;  4PW8 A;  4TV8 E;  2Y8D A;  2NWB A;  3P8C D;  1YKE B;  2H7O A;  3D0T A;  2XAS B;  1V9D A;  5FXW A;  4L9I A;  2KIN B;  4PJN A;  2HH7 A;  4G63 A;  1YD8 G;  3ZC1 A;  4H9S E;  4ZI2 C;  4PNI A;  4C91 A;  2E9X D;  5LOV E;  5A1L A;  2JQQ A;  3HKC E;  2PFV A;  4GYR A;  2JRK A;  4EYU A;  3FHN A;  2NTY A;  2PBI A;  3GWH A;  2MBG A;  1WR6 A;  3OJA A;  2IAK A;  2CLY C;  4X20 E;  1FEW A;  3DP7 A;  5F8P A;  3RX6 A;  4EYY R;  5LYJ E;  3DTO A;  2VKO A;  2C0S A;  2XAQ B;  2D0T A;  4H9Q C;  3HKE E;  4CI2 B;  3N2O A;  2CXD A;  2KMF A;  3ZLI A;  3E0Z A;  4EB6 E;  2QGS A;  2LSK A;  1YW0 A;  2NP9 A;  3CWZ B;  5TAO A;  4EXT A;  2ODV A;  4JLE A;  4HEA A;  5LNK A;  4HE8 A;  2CXL A;  3ZMU B;  3VKG A;  2LT3 A;  3N9N A;  2H7V C;  3O1J A;  2WMN A;  4HN9 A;  3OKQ A;  3ZYK A;  5JDN A;  3AA6 B;  5HXS A;  2CLY B;  5ETW A;  2EHO D;  3LK2 B;  4PK4 A;  3KIN B;  4QXH B;  2WAU A;  4AKG A;  4I55 E;  3VKH A;  3UUM A;  1OWA A;  2HPJ A;  4J2C A;  4CXY A;  3AVR A;  1MMD A;  3JC6 C;  3N5L A;  4GYS A;  1NAF A;  4FJO A;  5FMN A;  4B6X A;  2VKJ A;  5FXV A;  3S4U A;  3ANW B;  3EVY A;  4NUU A;  2X0L B;  3ESL A;  3RYI E;  3RKO A;  4PJJ A;  4UIG A;  3PE0 A;  5HWY A;  3LBX B;  2Q9Q B;  1D0X A;  2ZLY A;  5FY7 A;  1US7 B;  2DWK A;  5FYM A;  2X9Y A;  4AKR B;  3RRC A;  2X51 A;  3E08 A;  4IGU A;  2X67 A;  4HKA A;  2K48 A;  3ZMV B;  4I43 B;  1E1H B;  3NZQ A;  3MAC A;  5CA0 E;  5HWX A;  5FNV E;  1MMG A;  3IEE A;  3ZMT B;  2CCQ A;  4GK0 E;  3HKB E;  4X1I E;  3K3N A;  3Q5X A;  4H9P C;  2DCF A;  3MKD A;  2LSG A;  2K24 A;  2XAH B;  1S35 A;  3ZPO A;  3ZN1 B;  5KDM C;  3KFW X;  1G8X A;  3C4W A;  4KMC A;  4CI1 B;  3HR0 A;  3MZK B;  3SWH A;  1LKX A;  4ZI3 D;  5LP6 E;  3CPZ A;  5LG4 A;  4EZ4 A;  1IZN B;  2GK9 A;  3GN5 B;  5E0O A;  2L8K A;  1H7C A;  2DWG A;  3ETU A;  3RRW A;  1WYB A;  1D0Z A;  5L3G B;  5LHI B;  1LRZ A;  3EUH A;  5JDH A;  4ZHQ E;  3KVB A;  1U4Q A;  1D0Y A;  4IE6 A;  4CZZ B;  2E9X A;  3CX7 B;  2N9D A;  3W15 B;  2ZM8 A;  5J2U E;  5BMV E;  4Z8X A;  2RA1 A;  4TV9 E;  3ZEF B;  5JR9 A;  2B1E A;  5KMG P;  5IYZ E;  3UUN A;  4MFR A;  4BAY B;  1B7T A;  2X66 A;  4OYK A;  4X1Y E;  1O3X A;  4PK5 A;  2VAS A;  5JRC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...