4HE8A

Crystal structure of the membrane domain of respiratory complex i from thermus thermophilus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
116
structure length
92
Chain Sequence
MAPIQEYVGTLIYVGVALFIGVAALLVGALKRFPVHFYVVAMLFILFDVEVAFLWPYAVSAGGLGLYGFLGVLAFTLLLFVGFLYEWWKGVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH-quinone oxidoreductase subunit 7
publication title Crystal structure of the entire respiratory complex I.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 32
structure length 92
sequence length 116
chains with identical sequence B
ec nomenclature ec 1.6.5.3: Transferred entry: 7.1.1.2.
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00507 Oxidored_q4 NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1610 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4he8A00
5LNKA 4HE8A 3RKOA 4HEAA
chains in the Genus database with same CATH superfamily
1J5ET 2BBHA 2E9XB 3AEEA 4HTEA 3JAFA 2MYSA 4LMJA 3ZYMA 4IDZA 5ABFB 1XDOA 2LSKA 4PAGA 3ZYLA 4ADZA 1AJ3A 2QYWA 3N9PA 4EOZB 3AE9A 4A97A 4H9QC 4YXDA 2D0TA 2E9XC 2B1EA 5HXEA 2V7MA 2N2NA 5AQSB 2UXCT 2BKOA 3OPCA 3MJXA 2V7LA 2VQFT 2IW5B 2ODUA 4Z90A 1KNPA 2V1DB 4L0RA 3VU7H 4U7IA 3LG7A 5HCMA 4Z91A 3PUGA 4QXBB 3N9NA 5ABGA 3O9XA 4IE7A 5AQTB 1T8BA 1BR1A 4ILUA 5EK3A 1S35A 2BS4A 4HFHA 3PUAA 4ZOLE 2CPTA 2IMLA 4O2AE 2YK0A 3RYCE 1Y01A 5LHGB 4OX9T 3T1HT 4PJNA 4TZ4C 2V6XA 3PUWF 5L3GB 2WP9A 2ACXA 5H6RB 3U3IA 4B3TT 3FZKB 5JDHA 1N36T 3GMIA 2UXDT 2UXNB 1BR0A 4JEUB 4DVDA 2LSGA 3RYIE 4ZI2C 5LG3A 4BAYB 3IBPA 2W66A 2XQ9A 4CQIA 4YTPA 4G63A 3V5UA 1R8IA 4X20E 1I6ZA 1KNRA 2CRBA 5HYAA 2IHR1 1X79A 3HKBE 3FHNA 4NIQA 3I9YA 4UF0A 2BVMA 4MALA 4NXNT 4TNWA 5C3JA 2DHRA 2ACZA 4UVCB 4GOUA 5AQRB 1UCUA 5LBMA 4IIJE 2MTQA 2I6HA 3CK6A 4O4JE 3E0ZA 2VKHA 2G0UA 3ZMSB 3RHWA 3L39A 4DNDA 4OYKA 3AEGA 2XHEB 5LJMA 1UURA 3QC9A 3MZKB 3AE1A 5F8PA 3ANWA 3IHRA 4JI7T 2WAUA 3AE2A 2DWGA 3O1JA 2J1DG 1MMNA 2VKDA 5L3DB 4U2YA 3ZEFB 4HFVA 2GK9A 3ZT5A 5FKYA 1MMDA 4N78D 3F2EA 4DR6T 3A8YC 4ILCA 4OFZA 2QA7A 2WQYA 4ZS3A 5HWXA 1MIYA 1FJGT 4B3RT 4GK0E 4ZXLA 2CXLA 3CQCB 2V5CA 4CI2B 3PTRB 4TNVA 4HEAA 4UVBB 4JI4T 3TLVA 2Y8DA 3O1IA 4QHOA 2LHRA 3LK2B 4PFOA 5LHHB 3ONJA 4OHFA 5LHIB 3UU3A 1IAPA 3NRXA 5JREA 2JQHA 3T8OA 3C4WA 4NXMT 1DU2A 4YHJA 3P4PA 1SE7A 4TX5A 3C4XA 4UF0B 4P09A 4ZHQE 3PUVF 3C50A 3UUMA 1WYCA 5IYZE 2CM0A 5E0OA 3ZT6A 1XMOT 3CX7B 3EHZA 1BR2A 4UVAB 2X51A 3ZJ1A 2I59A 5JQGE 3KBTA 4HWCA 1J5WA 1MIWA 4UV9B 3AXJB 2YDRA 2VWAA 1QUUA 2R6GF 5ETWA 3ZN1B 5LP6E 2KZ7B 3IF8B 5JR9B 3FZLB 3RIUA 2NTXA 3FB2A 4L9IA 3N9OA 2XTLA 3L09A 4I43B 1FEWA 2LKGA 1KNZA 4YLHA 5CJ5A 5J1GA 3MK7C 5J2UE 1ZV4X 1HNWT 3FBZA 2LSYA 3TLUA 1KEYA 4DV0T 3HL6A 2FBWA 2VK9A 5AQNB 4IL4A 3AVSA 2X67A 2XASB 2E5LT 2OLTA 4LMLA 2PG8A 1FMVA 3UU5A 5DQWA 1OEDB 2CMRA 2V7KA 2XQ3A 2XM2A 2H7VC 1OEDE 3Q5EA 3VHLA 1NWMX 2DCFA 4AXPA 2AE9A 2BG9A 3ESLA 1SA0E 2X9XA 5FNVE 4EB6E 4TWHA 4B3ST 4JI1T 2XQYA 2ZM0A 2N9DA 4P1NA 4LF7T 1GQEA 4YJ2E 3SFEA 1Z0PA 4UELA 1XMQT 4AQFA 4O4IE 4GK5E 5AQUB 2WWVA 3AVRA 1WRDA 5AQLB 3NRYA 3RQWA 2FJEA 2XAFB 4AKLA 3A7MA 4AKGA 1Y64B 4MBQA 2VKOA 3D0TA 3NZQA 2C0SA 2IC6A 3VR9A 3L8RA 4JBWF 4IL9A 4TV8E 1UK5A 2VURA 4KI0F 5DJQC 4CXWA 4IE6A 3GWHA 2XAHB 2XUEA 2Y6XA 1WYBA 1W9RA 3ZYKA 2CXFA 3KVBA 3EVYA 5LMUT 3RIUC 4JYAT 1YKEB 3OKQA 3PV0F 4MFRA 4DV4T 4U74A 1HR0T 3HKDE 4X1IE 4LFCT 2K5BB 2LSJA 2NP9A 3Q9DA 5AQMB 3KV4A 1HTJF 2BG9B 2YINA 2NTYA 2KT9A 2WU5A 1T98A 3C64A 5FVLA 3TKLB 2BG9E 4WBOA 1EZ3A 4BJMA 3T1YT 5FXVA 3AA6B 5HEGA 2XQ5A 4CI1B 5LBQB 2EHOA 2Q9QA 2XM1A 2WDVA 3LJCA 2LJLA 2VL8A 4XAXB 2K24A 2NW7A 4EEDA 2UXXB 4I0UA 2YDSA 5AQQB 2QGSA 1LRZA 4IE0A 4X64T 3AE3A 5LGTB 2BG9C 2W2UA 2KNDA 4JEHB 2SPCA 2V7IA 2VVNA 4O8SA 5L3FB 2XY8B 3SWHA 1ZOYA 2X9YA 2YU1A 3AB3B 2YOEA 4DMWA 2QVAA 4AQFC 2ZLYA 2CCQA 4DV2T 2H3RA 2F4VT 4TWDA 4ISSA 5LG4A 3CWZB 4EZHA 1UGOA 4WZXA 1MIVA 5C8YE 2YU2A 2X0YA 4TUYE 5FL0A 2E2AA 3W15B 4J2CA 1WR6A 2WZIA 3RYFE 3P4QA 3RRWA 1US7B 2JJ9A 2RPAA 3UFEA 2EHOD 4JI0T 2Q9QD 3LK42 3K8PC 1SUMB 2KXPB 2WM9A 4EV6A 5EK2A 4H9SE 3HA4A 4PNIA 3AEAA 3PJAA 1VRBA 4B3MT 5CFBA 4U72A 5ADXL 4C91A 3DTOA 4JI6T 4DR5T 2M6BA 2VVSA 5L3BB 5EZYE 4HGAA 2LE8A 5AQHB 2K9AA 4UIGA 3ZCJA 5AQOB 4YSXA 1IBLT 2ES0A 3MKDA 2JRKA 2XJ7A 3JADA 5IUXA 2EHOC 2Q9QC 1HCIA 2UUBT 1G73A 5AQGB 3CX6B 1N32T 2VQET 4A98A 4F6RC 1XNQT 1S94A 3LSVA 4CN6A 1M62A 3Q5WA 4JLEA 2ZMAA 5F3JA 3AA0B 2WS3A 4KX6A 3HKCE 2KSRA 2CE7A 5LOVE 4BA9A 2B76A 4KP3C 2UUCT 2HH7A 4TV9E 3LDQB 1BR4A 4H63V 2XQ8A 5CB4E 1D1CA 4HFIA 3M3ZB 3BK9A 3NWIA 2JQ9A 2LLYA 5FXZA 2V6YA 3ZC1A 3OYZA 3AEBA 3BQIA 4QH4A 3AECA 4L5GA 2XAGB 4IDOA 2HPJA 1D0ZA 4HKAA 3KBUA 4A56A 3RGLA 2LOSA 3MACA 1OXZA 3AEDA 2PFVA 3OVUA 3B57A 2BVLA 4X65T 2WWUA 1LVFA 3Q2MA 4GYRA 4HWDA 5FY1A 2KINB 5AQPB 4IREA 3UU8A 3PURA 1XNRT 5TAOA 3DP7A 2WSSV 4KMCA 3CX8B 4DUYT 2YDQA 4BJNA 2Y48B 2H88A 3ETVA 5ABHA 3G06A 3IEEA 3ONXA 2YEVC 4TWFA 2PJQA 4QH5A 4EYUA 3L3PA 3C4ZA 4QWNB 3AAIA 2C5JA 2KWHA 4HFDA 5C2TA 3QOFA 5L2LA 5AQVB 4GKJT 4XZCA 3JC6D 3HI2A 2L3LA 3VR8A 4UV8B 5LA6E 2WMOA 3LFMA 1OWAA 4U7YA 3KVAA 2JPFA 3H3AA 4YT0A 4M1PA 4IE5A 2IAKA 3VKHA 3OBVE 1E7PA 5IHYA 4DV5T 3EUHA 3EABA 1MMAA 2BS2A 4YY3T 2X9HA 3FXDB 3O1HA 3ANWB 4WNKA 2YKSA 2X9WA 4I55E 1CHUA 3EI0A 1CUNA 1IZNB 4DO0A 5L3CB 3QB5A 4X1YE 4DR4T 3AE5A 3F57A 3N9MA 5JRCA 2LT3A 3MXZA 4EZ4A 3JC6C 1HF8A 1V9DA 5JDNA 4OYJA 1HG5A 2UXBT 1D1AA 3KINB 3RIFA 4YSZA 4PK4A 3MA9A 2W67A 2VKJA 4DR2T 2X0HA 3AE4A 2D5UA 2CWYA 4GKKT 1UX5A 3ZMZB 3CQXC 1QLBA 2HN1A 4QXCB 3KV9A 3P7IA 5FP3A 3V5SA 1HS7A 5L4EA 4H9OC 2CLYB 2LM9A 3EAMA 4LMKA 3LBXA 5JDMA 4KHZF 2FUPA 4ISTA 3ZMTB 1HNXT 1W0AA 5J0ZA 3QB5K 2DWKA 3RC8A 3R84B 2LSIA 5GONE 4ILAA 2E5VA 3EDVA 4O4LE 3HR0A 2D0UA 2MPKA 4IDQA 1J1JA 2JIWA 1ZEEA 2LRLA 3I9WA 3TLSA 4UEMA 5LMNT 5LJNA 4I50E 4ZZBA 2XSAA 4E7SA 3PDYA 2L8KA 2CLYC 4PJLA 4YFSA 4IHJE 4Q25A 4AKHA 3PUYF 2W63A 3SOLA 5M4YA 5HXHA 2C5KT 3TLTA 2J47A 4I4TE 4QX8B 5LCYA 3JAEA 4AIUA 1XWMA 2HN2A 1VCTA 4LF5T 4HWIB 3N5LA 4O2BE 2E9XA 1Z8UA 4K0UA 2RA1A 1H7CA 4LFBT 4Z8XA 2BKPA 2HHHT 1IJ5A 3UQ7A 2LRKA 4DIDB 2CHOA 3N2GE 5JH7E 5A1LA 4YJ3E 5ABFA 4UXNB 1HX1B 3KV6A 4LF4T 3O4XE 5HAXA 3ZLIA 1D0YA 1LVKA 4JUYA 3ZPOA 4PJMA 2W62A 2XQAA 2UUAT 4DR7T 4DMVA 3RKGA 2WZHA 3HKEE 2X68A 1NENA 2LM2A 1UUSA 5IWAT 4ASKA 3ZCIA 3ZMVB 1YXRA 3UULA 1E1HB 4ZI7E 1B7TA 5HXRA 4CXYA 3J9X1 3FZMB 5EK4A 5KDMC 4CN1A 1JNZA 2OV9A 4YHHT 4P0AA 4YTNA 4NUVA 3P8CD 5FXWA 4HN9A 4U2ZA 5FXXA 3RYHE 3DJBA 3P4SA 2OA5A 1MMGA 5FY7A 3NZPA 5HEOA 3QUJA 4CN4A 2E9XD 2A3DA 4DV1T 2Z6EA 1XDPA 3RF1A 3AE8A 3OJAA 3FXEB 2FJAA 1W09A 2QRXA 4EGWA 1O3XA 2IIUA 4G2AA 3BQLA 1MNDA 4ZZCA 3RRCA 4LF9T 4ZS2A 3ZSTA 2IUBA 5J2TE 4GYSA 2P9BA 1JNRA 5FY0A 1W0BA 3S4UA 3QK6A 2HPLA 2BS3A 4YSYA 3AAEB 3CMLA 4H63H 2D2SA 1FMWA 5ABEA 5FYMA 3WAKA 2EHOB 2Q9QB 2CEAA 2X66A 2W00A 4P0BA 5JDFA 2K3WA 1YKHB 1YW0A 3RPUA 3F31A 4IGUA 4HWFA 3UQ4A 1QSDA 2VB6A 3M65A 5JVDE 4ZI2D 3K3NA 1UX4A 2WMNA 4CI3B 3CVRA 4PK5A 2D9DA 5HCJA 3K3QC 5CGMA 3UTKA 3ZMUB 3PU3A 3ABVA 3PJAJ 4FJOA 3ETUA 2NW8A 1WFDA 4O4HE 4DBRA 2DL1A 5LB7B 4IE4A 2XAJB 2H89A 3RLFF 3SFDA 1HX8A 3H3MA 2AXDS 3UUXB 5CA0E 1ZHCA 4HFEA 1D1BA 2UU9T 2NW9A 1MNEA 3KDSE 4KUMB 4LFAT 2K48A 2X0LB 3AA1B 2KMFA 3GN5A 1XZYA 1WCRA 5AQKB 3PUSA 1X9BA 3RKOA 3GA8A 4PJJA 4JI8T 2M67A 3PU8A 2C5IT 5HXSA 4DUZT 4ANJA 3FZHB 4U3CA 4PFPA 4JI2T 3JCFA 5H6QB 3WAJA 2WDRA 2JQKA 3N9LA 2PTFA 3PUQA 2W61A 3B5MA 2A9UA 3UUBA 4CXXA 2MAWA 1ZP0A 3ZSSA 1IBMT 3AXJA 4H9PC 1LKXA 4IT4A 3UFGA 2KLQA 3RI5A 2BZBA 4H9RC 4EIWA 5JR9A 2CBJA 5HXCA 1KK7A 3N2OA 3VRAA 5FVKA 4PW8A 4FI5A 2V8SV 4LF8T 2NWBA 3RQUA 3ZKRA 2J62A 4AKRB 5JTGA 2VL0A 2XZEA 1G8XA 5HWYA 1U4QA 5AQIB 2JMHA 5JDGA 1OEDA 3UUNA 3QNUA 3GN5B 4K0KT 5L4HA 2KWIB 3NVOA 3N2KE 3R6NA 3Q5DA 5DQVA 4QH1A 1KF6A 2IC9A 2L9QA 4JI5T 2WCAA 3RC3A 3H37A 3A5XA 2DNXA 4DV3T 4U31A 2PBIA 2V6YB 2CHNA 4DV6T 2LEHA 3U78A 4NUUA 1NEKA 1HNZT 3AE7A 2WY2A 4WBNE 3RIAA 5BR8T 3FBLA 2DI4A 2XSBA 2H7OA 1HFAA 3ZT7A 3CPZA 2XQ4A 5L3EB 1L0VA 3RX6A 2V7JA 4C90A 2NR4A 3CIRA 4QKNA 3UU6A 3LK3B 5KMGP 5JDLA 2WB5A 2XAQB 2JMKA 4EXTA 3FZFB 1VCSA 3OYXA 4KHPT 4WW0A 4AQYT 1YD8G 3AE6A 1SHZC 1N34T 3PUXF 3J7Yq 4HWHA 2BKNA 1ZKEA 4MHCA 5LXTE 2LOPA 2ZM2A 3C98B 2IDOB 3KFWX 2A2FX 3E22E 4ILBA 3KV5A 2CXDA 4X62T 1YQ4A 2W4XA 3E08A 5JR9C 3NKZA 5LGNB 4DR1T 4HE8A 3ZN0B 4QX7B 2M6IA 1VOMA 4AKIA 1T7SA 3I1AA 4MLKA 4AQGA 3B13A 1YQ3A 3CKDA 3P4RA 3ZJ2A 4AISA 3TLWA 2ZM8A 4X66T 3K1SA 2W0GA 3ZC0A 3P50A 4NPPA 4IDNA 3X1DA 3IA3A 5LGUB 1T72A 3WI3A 1E2AA 2J4GA 4B6XA 3BQKA 2A72A 5DABA 1OEDC 2RP4A 3OTOT 4OK0A 3K3OA 4ZI3D 5FL1A 4JI3T 4GIWA 1D0XA 4AI6A 1FIOA 3P4WA 3I0OA 2CA5A 5AQFB 4ERRA 4DR3T 5HEUA 1I94T 5JRCB 5LNKA 5KXJA 3UU4A 4IDPA 1IBKT 3Q5XA 5HEJA 3AAAB 5L47A 3SRZA 1N33T 2ODVA 5BMVE 3C51A 2MOZA 4EAHA 5CA1E 4DV7T 2N1GA 2FJDA 2CBIA 5HEHA 1HG2A 2ZM6T 5AQJB 4PK6A 5F5WA 2E8IA 4XBFB 1NAFA 4ZI3C 3EDUA 4CZZB 4E7ZA 2WBLA 5KX5E 2CWOA 4HFBA 4UR9A 4ZEYA 3I0QA 2LHNA 4X5TA 4EYYR 3SS1A 2YN6A 2I0MA 2WU2A 4HFCA 3AA7B 4QXHB 2BDEA 4V1Av 2XQ6A 4A5XA 3LBXB 1KFYA 3RH3A 1IJ6A 5AFUL 3CQGB 3ONLC 3VRBA 2FJBA 4YTMA 2MBGA 5FMNA 3VKGA 2NOXA 2DLRA 2XQ7A 3AEFA 4EEBA 2V5DA 3PE0A 3NBXX 4DBQA 1M7KA 4JV5T 1U5PA 4U33A 1WLXA 4LF6T 2LKHA 3N9QA 1WR0A 4H9NC 2WDQA 4WYVA 3PUZF 4COFA 5JDQA 5LYJE 2XPKA 4TN7B 2JQQA 4F8HA 3UT5E 2V26A 2VASA 2BBJA 4KBMB 4X1KE
chains in the Genus database with same CATH topology
3NRYA 4M1PA 4IE5A 2IAKA 3VKHA 2E9XB 3OBVE 5IHYA 3EUHA 2XAFB 4HTEA 4PFPA 1MMAA 4AKLA 4AKGA 1Y64B 4MBQA 2MYSA 5H6QB 2VKOA 2X9HA 3FXDB 3WAJA 3D0TA 3O1HA 3NZQA 2C0SA 3ZYMA 3ANWB 3N9LA 4WNKA 2IC6A 4IDZA 2X9WA 4I55E 2LSKA 4PAGA 4TV8E 1CUNA 3PUQA 1IZNB 3ZYLA 4ADZA 4DO0A 5L3CB 1AJ3A 5DJQC 2W61A 3N9PA 4CXWA 4X1YE 4EOZB 4IE6A 3GWHA 3F57A 3N9MA 2XAHB 2XUEA 4CXXA 5JRCA 2Y6XA 1WYBA 4H9QC 4H9PC 2LT3A 1LKXA 3MXZA 3ZYKA 4EZ4A 3JC6C 2D0TA 1HF8A 2E9XC 1V9DA 2CXFA 5JDNA 2KLQA 3KVBA 4OYJA 2B1EA 2BZBA 5HXEA 3EVYA 1HG5A 2V7MA 2N2NA 1YKEB 3OKQA 4H9RC 1D1AA 4EIWA 4MFRA 5JR9A 3KINB 4U74A 1KK7A 3MJXA 2V7LA 3N2OA 5HXCA 2IW5B 2ODUA 4PK4A 3MA9A 2V1DB 3HKDE 4L0RA 4X1IE 4PW8A 2K5BB 2LSJA 3VU7H 2NP9A 4FI5A 3Q9DA 3KV4A 2VKJA 3LG7A 1HTJF 3PUGA 4QXBB 2YINA 2NTYA 3N9NA 2KT9A 3C64A 1T98A 3O9XA 2D5UA 4IE7A 2NWBA 3TKLB 4WBOA 1EZ3A 4BJMA 1BR1A 2CWYA 1UX5A 5FXVA 3AA6B 3ZMZB 4CI1B 5LBQB 4AKRB 2EHOA 2Q9QA 4ILUA 3CQXC 5EK3A 4QXCB 1S35A 3KV9A 3PUAA 3P7IA 3LJCA 2LJLA 4ZOLE 1G8XA 5FP3A 5HWYA 1U4QA 2VL8A 4XAXB 4O2AE 2YK0A 3V5SA 2K24A 3RYCE 2JMHA 2NW7A 5JDGA 1HS7A 5LHGB 4H9OC 2CLYB 2LM9A 2UXXB 4PJNA 4TZ4C 3LBXA 3UUNA 5JDMA 5L3GB 3GN5B 2ACXA 5H6RB 3U3IA 2QGSA 4ISTA 1LRZA 4IE0A 3ZMTB 5JDHA 5LGTB 2DWKA 3GMIA 2KNDA 3RC8A 4JEHB 2LSIA 3R84B 2SPCA 2V7IA 2KWIB 2UXNB 5GONE 1BR0A 4JEUB 4DVDA 2LSGA 3N2KE 4O8SA 3R6NA 3RYIE 4ZI2C 3EDVA 4O4LE 5L3FB 4BAYB 3HR0A 3IBPA 2D0UA 5DQVA 2IC9A 1ZEEA 2L9QA 4CQIA 4G63A 3V5UA 3I9WA 3RC3A 4UEMA 3H37A 3SWHA 3A5XA 4X20E 5LJNA 2DNXA 2PBIA 5HYAA 2X9YA 2YU1A 3AB3B 4I50E 1X79A 4DMWA 3HKBE 2LEHA 3FHNA 3PDYA 2L8KA 2CLYC 4NUUA 4PJLA 4YFSA 3U78A 4AQFC 4E7SA 2ZLYA 2CCQA 4IHJE 4WBNE 3I9YA 2H3RA 4UF0A 3FBLA 2DI4A 2BVMA 4AKHA 4MALA 2W63A 3SOLA 5M4YA 5HXHA 2H7OA 2C5KT 1HFAA 3CPZA 4I4TE 4ISSA 2DHRA 5LG4A 3CWZB 4QX8B 5LCYA 4EZHA 4UVCB 5L3EB 4GOUA 1MIVA 1UCUA 5C8YE 5LBMA 2YU2A 4TUYE 4IIJE 3RX6A 2V7JA 4C90A 2MTQA 4O4JE 3E0ZA 3W15B 3N5LA 4J2CA 2VKHA 1WR6A 2G0UA 3ZMSB 4O2BE 2E9XA 3RYFE 4K0UA 2RA1A 4DNDA 1H7CA 4QKNA 4OYKA 3RRWA 2XHEB 1US7B 3LK3B 4Z8XA 2JJ9A 5JDLA 1IJ5A 5KMGP 5LJMA 3QC9A 3MZKB 2XAQB 2JMKA 5F8PA 4EXTA 3N2GE 3UFEA 3ANWA 2EHOD 3IHRA 2Q9QD 5A1LA 3LK42 5JH7E 2WAUA 3K8PC 4YJ3E 2KXPB 2WM9A 4UXNB 3OYXA 2DWGA 3O1JA 4WW0A 3KV6A 2J1DG 5EK2A 1YD8G 1MMNA 4H9SE 1SHZC 2VKDA 3HA4A 3O4XE 5L3DB 3J7Yq 4PNIA 3ZEFB 5HAXA 4HFVA 3ZLIA 1ZKEA 2GK9A 4MHCA 1VRBA 1D0YA 2LOPA 5LXTE 2ZM2A 1LVKA 1MMDA 3C98B 4N78D 3F2EA 4JUYA 4OFZA 3KFWX 3ZPOA 2A2FX 4PJMA 3E22E 4U72A 2QA7A 2W62A 5HWXA 4ZS3A 3KV5A 2CXDA 5ADXL 1MIYA 4DMVA 4C91A 3E08A 5JR9C 5LGNB 3DTOA 4HE8A 3ZN0B 3HKEE 4GK0E 4QX7B 1VOMA 2X68A 4AKIA 2CXLA 3I1AA 3CQCB 4MLKA 4AQGA 3B13A 4CI2B 3CKDA 3PTRB 4ASKA 5L3BB 5EZYE 3ZCIA 4HGAA 2LE8A 4HEAA 4UVBB 3ZJ2A 3ZMVB 2K9AA 1E1HB 3UULA 2ZM8A 4UIGA 4ZI7E 3ZCJA 1B7TA 5HXRA 2Y8DA 3O1IA 4CXYA 4QHOA 2ES0A 3MKDA 2JRKA 3J9X1 2W0GA 2LHRA 3ZC0A 3LK2B 4PFOA 5LHHB 2EHOC 2Q9QC 5EK4A 5KDMC 1HCIA 1G73A 4OHFA 5LHIB 3CX6B 4P0AA 5LGUB 1IAPA 4F6RC 3NRXA 5JREA 1S94A 3WI3A 4NUVA 3Q5WA 3T8OA 4JLEA 2ZMAA 3C4WA 5F3JA 3P8CD 4B6XA 3BQKA 3AA0B 2A72A 4YHJA 5DABA 3HKCE 4TX5A 3C4XA 2RP4A 4UF0B 4P09A 4HN9A 5FXWA 4OK0A 3K3OA 5FXXA 3RYHE 4ZHQE 3C50A 1WYCA 2CE7A 2OA5A 1MMGA 3DJBA 5IYZE 3UUMA 5LOVE 5FY7A 2CM0A 4BA9A 4ZI3D 3NZPA 4GIWA 1D0XA 4KP3C 5E0OA 3QUJA 2HH7A 3CX7B 2E9XD 4AI6A 2A3DA 1BR2A 1FIOA 2X51A 4UVAB 3ZJ1A 2I59A 2Z6EA 3I0OA 2CA5A 4ERRA 4TV9E 5JQGE 3KBTA 1BR4A 4H63V 5CB4E 5JRCB 1MIWA 4UV9B 5LNKA 1D1CA 3OJAA 3BK9A 3FXEB 2VWAA 1QUUA 3Q5XA 3AAAB 5ETWA 1O3XA 3SRZA 3ZN1B 5FXZA 5LP6E 4G2AA 3ZC1A 3BQLA 2KZ7B 3IF8B 1MNDA 2ODVA 3BQIA 3OYZA 5BMVE 5JR9B 3RRCA 4ZS2A 2NTXA 3FB2A 4L9IA 5J2TE 3N9OA 3C51A 2MOZA 4EAHA 4GYSA 2P9BA 2XTLA 4L5GA 3L09A 5CA1E 4I43B 2N1GA 2XAGB 1FEWA 5FY0A 1KNZA 3S4UA 4YLHA 1HG2A 3QK6A 2HPLA 4PK6A 2HPJA 1D0ZA 2E8IA 5J1GA 4HKAA 3MK7C 4XBFB 1NAFA 5J2UE 3AAEB 1ZV4X 3CMLA 4ZI3C 4H63H 2D2SA 3FBZA 2LSYA 3KBUA 4A56A 3EDUA 1FMWA 4CZZB 4E7ZA 5FYMA 2LOSA 2WBLA 2CWOA 3HL6A 2EHOB 3WAKA 2Q9QB 2VK9A 3MACA 5KX5E 1OXZA 3I0QA 2CEAA 2LHNA 2W00A 2X66A 3AVSA 4EYYR 2PFVA 3B57A 2X67A 2BVLA 2XASB 3SS1A 4P0BA 2WWUA 5JDFA 1LVFA 3Q2MA 1YKHB 1YW0A 4GYRA 3RPUA 3F31A 4IGUA 3AA7B 2PG8A 1QSDA 4QXHB 1FMVA 5FY1A 2VB6A 2KINB 3M65A 5DQWA 5JVDE 4ZI2D 3K3NA 3PURA 1UX4A 2BDEA 4V1Av 2WMNA 2CMRA 2V7KA 3LBXB 4CI3B 3RH3A 1IJ6A 3CVRA 4PK5A 2H7VC 3K3QC 5TAOA 3UTKA 3ZMUB 3DP7A 5AFUL 2WSSV 3PU3A 3CQGB 3CX8B 4KMCA 4FJOA 3VHLA 4BJNA 1NWMX 3ETUA 2NW8A 4X1KE 2Y48B 2DCFA 3ETVA 4AXPA 4O4HE 2MBGA 3ESLA 5FMNA 1SA0E 3IEEA 4DBRA 2X9XA 5FNVE 3VKGA 3ONXA 4EB6E 2NOXA 2YEVC 2DLRA 2PJQA 2XQYA 4IE4A 4EYUA 2XAJB 2ZM0A 2N9DA 3L3PA 3C4ZA 1HX8A 3PE0A 3UUXB 3NBXX 4YJ2E 1Z0PA 4DBQA 4UELA 4QWNB 5CA0E 3AAIA 2C5JA 1ZHCA 2KWHA 1D1BA 2NW9A 1U5PA 1MNEA 4AQFA 3KDSE 4KUMB 1WLXA 4O4IE 5L2LA 4GK5E 3N9QA 2K48A 2X0LB 3AA1B 4H9NC 4XZCA 2KMFA 3GN5A 3JC6D 3HI2A 5JDQA 2L3LA 4UV8B 3PUSA 3AVRA 5LYJE 5LA6E 2WMOA 3LFMA 1OWAA 3RKOA 1WRDA 4TN7B 2JQQA 3GA8A 3KVAA 4PJJA 3UT5E 2M67A 3PU8A 2C5IT 5HXSA 2V26A 2VASA 4KBMB 2JPFA 3H3AA 4ANJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LNK A;  4HE8 A;  3RKO A;  4HEA A; 
#chains in the Genus database with same CATH topology
 1J5E T;  2BBH A;  2E9X B;  3AEE A;  4HTE A;  3JAF A;  2MYS A;  4LMJ A;  3ZYM A;  4IDZ A;  5ABF B;  1XDO A;  2LSK A;  4PAG A;  3ZYL A;  4ADZ A;  1AJ3 A;  2QYW A;  3N9P A;  4EOZ B;  3AE9 A;  4A97 A;  4H9Q C;  4YXD A;  2D0T A;  2E9X C;  2B1E A;  5HXE A;  2V7M A;  2N2N A;  5AQS B;  2UXC T;  2BKO A;  3OPC A;  3MJX A;  2V7L A;  2VQF T;  2IW5 B;  2ODU A;  4Z90 A;  1KNP A;  2V1D B;  4L0R A;  3VU7 H;  4U7I A;  3LG7 A;  5HCM A;  4Z91 A;  3PUG A;  4QXB B;  3N9N A;  5ABG A;  3O9X A;  4IE7 A;  5AQT B;  1T8B A;  1BR1 A;  4ILU A;  5EK3 A;  1S35 A;  2BS4 A;  4HFH A;  3PUA A;  4ZOL E;  2CPT A;  2IML A;  4O2A E;  2YK0 A;  3RYC E;  1Y01 A;  5LHG B;  4OX9 T;  3T1H T;  4PJN A;  4TZ4 C;  2V6X A;  3PUW F;  5L3G B;  2WP9 A;  2ACX A;  5H6R B;  3U3I A;  4B3T T;  3FZK B;  5JDH A;  1N36 T;  3GMI A;  2UXD T;  2UXN B;  1BR0 A;  4JEU B;  4DVD A;  2LSG A;  3RYI E;  4ZI2 C;  5LG3 A;  4BAY B;  3IBP A;  2W66 A;  2XQ9 A;  4CQI A;  4YTP A;  4G63 A;  3V5U A;  1R8I A;  4X20 E;  1I6Z A;  1KNR A;  2CRB A;  5HYA A;  2IHR 1;  1X79 A;  3HKB E;  3FHN A;  4NIQ A;  3I9Y A;  4UF0 A;  2BVM A;  4MAL A;  4NXN T;  4TNW A;  5C3J A;  2DHR A;  2ACZ A;  4UVC B;  4GOU A;  5AQR B;  1UCU A;  5LBM A;  4IIJ E;  2MTQ A;  2I6H A;  3CK6 A;  4O4J E;  3E0Z A;  2VKH A;  2G0U A;  3ZMS B;  3RHW A;  3L39 A;  4DND A;  4OYK A;  3AEG A;  2XHE B;  5LJM A;  1UUR A;  3QC9 A;  3MZK B;  3AE1 A;  5F8P A;  3ANW A;  3IHR A;  4JI7 T;  2WAU A;  3AE2 A;  2DWG A;  3O1J A;  2J1D G;  1MMN A;  2VKD A;  5L3D B;  4U2Y A;  3ZEF B;  4HFV A;  2GK9 A;  3ZT5 A;  5FKY A;  1MMD A;  4N78 D;  3F2E A;  4DR6 T;  3A8Y C;  4ILC A;  4OFZ A;  2QA7 A;  2WQY A;  4ZS3 A;  5HWX A;  1MIY A;  1FJG T;  4B3R T;  4GK0 E;  4ZXL A;  2CXL A;  3CQC B;  2V5C A;  4CI2 B;  3PTR B;  4TNV A;  4HEA A;  4UVB B;  4JI4 T;  3TLV A;  2Y8D A;  3O1I A;  4QHO A;  2LHR A;  3LK2 B;  4PFO A;  5LHH B;  3ONJ A;  4OHF A;  5LHI B;  3UU3 A;  1IAP A;  3NRX A;  5JRE A;  2JQH A;  3T8O A;  3C4W A;  4NXM T;  1DU2 A;  4YHJ A;  3P4P A;  1SE7 A;  4TX5 A;  3C4X A;  4UF0 B;  4P09 A;  4ZHQ E;  3PUV F;  3C50 A;  3UUM A;  1WYC A;  5IYZ E;  2CM0 A;  5E0O A;  3ZT6 A;  1XMO T;  3CX7 B;  3EHZ A;  1BR2 A;  4UVA B;  2X51 A;  3ZJ1 A;  2I59 A;  5JQG E;  3KBT A;  4HWC A;  1J5W A;  1MIW A;  4UV9 B;  3AXJ B;  2YDR A;  2VWA A;  1QUU A;  2R6G F;  5ETW A;  3ZN1 B;  5LP6 E;  2KZ7 B;  3IF8 B;  5JR9 B;  3FZL B;  3RIU A;  2NTX A;  3FB2 A;  4L9I A;  3N9O A;  2XTL A;  3L09 A;  4I43 B;  1FEW A;  2LKG A;  1KNZ A;  4YLH A;  5CJ5 A;  5J1G A;  3MK7 C;  5J2U E;  1ZV4 X;  1HNW T;  3FBZ A;  2LSY A;  3TLU A;  1KEY A;  4DV0 T;  3HL6 A;  2FBW A;  2VK9 A;  5AQN B;  4IL4 A;  3AVS A;  2X67 A;  2XAS B;  2E5L T;  2OLT A;  4LML A;  2PG8 A;  1FMV A;  3UU5 A;  5DQW A;  1OED B;  2CMR A;  2V7K A;  2XQ3 A;  2XM2 A;  2H7V C;  1OED E;  3Q5E A;  3VHL A;  1NWM X;  2DCF A;  4AXP A;  2AE9 A;  2BG9 A;  3ESL A;  1SA0 E;  2X9X A;  5FNV E;  4EB6 E;  4TWH A;  4B3S T;  4JI1 T;  2XQY A;  2ZM0 A;  2N9D A;  4P1N A;  4LF7 T;  1GQE A;  4YJ2 E;  3SFE A;  1Z0P A;  4UEL A;  1XMQ T;  4AQF A;  4O4I E;  4GK5 E;  5AQU B;  2WWV A;  3AVR A;  1WRD A;  5AQL B;  3NRY A;  3RQW A;  2FJE A;  2XAF B;  4AKL A;  3A7M A;  4AKG A;  1Y64 B;  4MBQ A;  2VKO A;  3D0T A;  3NZQ A;  2C0S A;  2IC6 A;  3VR9 A;  3L8R A;  4JBW F;  4IL9 A;  4TV8 E;  1UK5 A;  2VUR A;  4KI0 F;  5DJQ C;  4CXW A;  4IE6 A;  3GWH A;  2XAH B;  2XUE A;  2Y6X A;  1WYB A;  1W9R A;  3ZYK A;  2CXF A;  3KVB A;  3EVY A;  5LMU T;  3RIU C;  4JYA T;  1YKE B;  3OKQ A;  3PV0 F;  4MFR A;  4DV4 T;  4U74 A;  1HR0 T;  3HKD E;  4X1I E;  4LFC T;  2K5B B;  2LSJ A;  2NP9 A;  3Q9D A;  5AQM B;  3KV4 A;  1HTJ F;  2BG9 B;  2YIN A;  2NTY A;  2KT9 A;  2WU5 A;  1T98 A;  3C64 A;  5FVL A;  3TKL B;  2BG9 E;  4WBO A;  1EZ3 A;  4BJM A;  3T1Y T;  5FXV A;  3AA6 B;  5HEG A;  2XQ5 A;  4CI1 B;  5LBQ B;  2EHO A;  2Q9Q A;  2XM1 A;  2WDV A;  3LJC A;  2LJL A;  2VL8 A;  4XAX B;  2K24 A;  2NW7 A;  4EED A;  2UXX B;  4I0U A;  2YDS A;  5AQQ B;  2QGS A;  1LRZ A;  4IE0 A;  4X64 T;  3AE3 A;  5LGT B;  2BG9 C;  2W2U A;  2KND A;  4JEH B;  2SPC A;  2V7I A;  2VVN A;  4O8S A;  5L3F B;  2XY8 B;  3SWH A;  1ZOY A;  2X9Y A;  2YU1 A;  3AB3 B;  2YOE A;  4DMW A;  2QVA A;  4AQF C;  2ZLY A;  2CCQ A;  4DV2 T;  2H3R A;  2F4V T;  4TWD A;  4ISS A;  5LG4 A;  3CWZ B;  4EZH A;  1UGO A;  4WZX A;  1MIV A;  5C8Y E;  2YU2 A;  2X0Y A;  4TUY E;  5FL0 A;  2E2A A;  3W15 B;  4J2C A;  1WR6 A;  2WZI A;  3RYF E;  3P4Q A;  3RRW A;  1US7 B;  2JJ9 A;  2RPA A;  3UFE A;  2EHO D;  4JI0 T;  2Q9Q D;  3LK4 2;  3K8P C;  1SUM B;  2KXP B;  2WM9 A;  4EV6 A;  5EK2 A;  4H9S E;  3HA4 A;  4PNI A;  3AEA A;  3PJA A;  1VRB A;  4B3M T;  5CFB A;  4U72 A;  5ADX L;  4C91 A;  3DTO A;  4JI6 T;  4DR5 T;  2M6B A;  2VVS A;  5L3B B;  5EZY E;  4HGA A;  2LE8 A;  5AQH B;  2K9A A;  4UIG A;  3ZCJ A;  5AQO B;  4YSX A;  1IBL T;  2ES0 A;  3MKD A;  2JRK A;  2XJ7 A;  3JAD A;  5IUX A;  2EHO C;  2Q9Q C;  1HCI A;  2UUB T;  1G73 A;  5AQG B;  3CX6 B;  1N32 T;  2VQE T;  4A98 A;  4F6R C;  1XNQ T;  1S94 A;  3LSV A;  4CN6 A;  1M62 A;  3Q5W A;  4JLE A;  2ZMA A;  5F3J A;  3AA0 B;  2WS3 A;  4KX6 A;  3HKC E;  2KSR A;  2CE7 A;  5LOV E;  4BA9 A;  2B76 A;  4KP3 C;  2UUC T;  2HH7 A;  4TV9 E;  3LDQ B;  1BR4 A;  4H63 V;  2XQ8 A;  5CB4 E;  1D1C A;  4HFI A;  3M3Z B;  3BK9 A;  3NWI A;  2JQ9 A;  2LLY A;  5FXZ A;  2V6Y A;  3ZC1 A;  3OYZ A;  3AEB A;  3BQI A;  4QH4 A;  3AEC A;  4L5G A;  2XAG B;  4IDO A;  2HPJ A;  1D0Z A;  4HKA A;  3KBU A;  4A56 A;  3RGL A;  2LOS A;  3MAC A;  1OXZ A;  3AED A;  2PFV A;  3OVU A;  3B57 A;  2BVL A;  4X65 T;  2WWU A;  1LVF A;  3Q2M A;  4GYR A;  4HWD A;  5FY1 A;  2KIN B;  5AQP B;  4IRE A;  3UU8 A;  3PUR A;  1XNR T;  5TAO A;  3DP7 A;  2WSS V;  4KMC A;  3CX8 B;  4DUY T;  2YDQ A;  4BJN A;  2Y48 B;  2H88 A;  3ETV A;  5ABH A;  3G06 A;  3IEE A;  3ONX A;  2YEV C;  4TWF A;  2PJQ A;  4QH5 A;  4EYU A;  3L3P A;  3C4Z A;  4QWN B;  3AAI A;  2C5J A;  2KWH A;  4HFD A;  5C2T A;  3QOF A;  5L2L A;  5AQV B;  4GKJ T;  4XZC A;  3JC6 D;  3HI2 A;  2L3L A;  3VR8 A;  4UV8 B;  5LA6 E;  2WMO A;  3LFM A;  1OWA A;  4U7Y A;  3KVA A;  2JPF A;  3H3A A;  4YT0 A;  4M1P A;  4IE5 A;  2IAK A;  3VKH A;  3OBV E;  1E7P A;  5IHY A;  4DV5 T;  3EUH A;  3EAB A;  1MMA A;  2BS2 A;  4YY3 T;  2X9H A;  3FXD B;  3O1H A;  3ANW B;  4WNK A;  2YKS A;  2X9W A;  4I55 E;  1CHU A;  3EI0 A;  1CUN A;  1IZN B;  4DO0 A;  5L3C B;  3QB5 A;  4X1Y E;  4DR4 T;  3AE5 A;  3F57 A;  3N9M A;  5JRC A;  2LT3 A;  3MXZ A;  4EZ4 A;  3JC6 C;  1HF8 A;  1V9D A;  5JDN A;  4OYJ A;  1HG5 A;  2UXB T;  1D1A A;  3KIN B;  3RIF A;  4YSZ A;  4PK4 A;  3MA9 A;  2W67 A;  2VKJ A;  4DR2 T;  2X0H A;  3AE4 A;  2D5U A;  2CWY A;  4GKK T;  1UX5 A;  3ZMZ B;  3CQX C;  1QLB A;  2HN1 A;  4QXC B;  3KV9 A;  3P7I A;  5FP3 A;  3V5S A;  1HS7 A;  5L4E A;  4H9O C;  2CLY B;  2LM9 A;  3EAM A;  4LMK A;  3LBX A;  5JDM A;  4KHZ F;  2FUP A;  4IST A;  3ZMT B;  1HNX T;  1W0A A;  5J0Z A;  3QB5 K;  2DWK A;  3RC8 A;  3R84 B;  2LSI A;  5GON E;  4ILA A;  2E5V A;  3EDV A;  4O4L E;  3HR0 A;  2D0U A;  2MPK A;  4IDQ A;  1J1J A;  2JIW A;  1ZEE A;  2LRL A;  3I9W A;  3TLS A;  4UEM A;  5LMN T;  5LJN A;  4I50 E;  4ZZB A;  2XSA A;  4E7S A;  3PDY A;  2L8K A;  2CLY C;  4PJL A;  4YFS A;  4IHJ E;  4Q25 A;  4AKH A;  3PUY F;  2W63 A;  3SOL A;  5M4Y A;  5HXH A;  2C5K T;  3TLT A;  2J47 A;  4I4T E;  4QX8 B;  5LCY A;  3JAE A;  4AIU A;  1XWM A;  2HN2 A;  1VCT A;  4LF5 T;  4HWI B;  3N5L A;  4O2B E;  2E9X A;  1Z8U A;  4K0U A;  2RA1 A;  1H7C A;  4LFB T;  4Z8X A;  2BKP A;  2HHH T;  1IJ5 A;  3UQ7 A;  2LRK A;  4DID B;  2CHO A;  3N2G E;  5JH7 E;  5A1L A;  4YJ3 E;  5ABF A;  4UXN B;  1HX1 B;  3KV6 A;  4LF4 T;  3O4X E;  5HAX A;  3ZLI A;  1D0Y A;  1LVK A;  4JUY A;  3ZPO A;  4PJM A;  2W62 A;  2XQA A;  2UUA T;  4DR7 T;  4DMV A;  3RKG A;  2WZH A;  3HKE E;  2X68 A;  1NEN A;  2LM2 A;  1UUS A;  5IWA T;  4ASK A;  3ZCI A;  3ZMV B;  1YXR A;  3UUL A;  1E1H B;  4ZI7 E;  1B7T A;  5HXR A;  4CXY A;  3J9X 1;  3FZM B;  5EK4 A;  5KDM C;  4CN1 A;  1JNZ A;  2OV9 A;  4YHH T;  4P0A A;  4YTN A;  4NUV A;  3P8C D;  5FXW A;  4HN9 A;  4U2Z A;  5FXX A;  3RYH E;  3DJB A;  3P4S A;  2OA5 A;  1MMG A;  5FY7 A;  3NZP A;  5HEO A;  3QUJ A;  4CN4 A;  2E9X D;  2A3D A;  4DV1 T;  2Z6E A;  1XDP A;  3RF1 A;  3AE8 A;  3OJA A;  3FXE B;  2FJA A;  1W09 A;  2QRX A;  4EGW A;  1O3X A;  2IIU A;  4G2A A;  3BQL A;  1MND A;  4ZZC A;  3RRC A;  4LF9 T;  4ZS2 A;  3ZST A;  2IUB A;  5J2T E;  4GYS A;  2P9B A;  1JNR A;  5FY0 A;  1W0B A;  3S4U A;  3QK6 A;  2HPL A;  2BS3 A;  4YSY A;  3AAE B;  3CML A;  4H63 H;  2D2S A;  1FMW A;  5ABE A;  5FYM A;  3WAK A;  2EHO B;  2Q9Q B;  2CEA A;  2X66 A;  2W00 A;  4P0B A;  5JDF A;  2K3W A;  1YKH B;  1YW0 A;  3RPU A;  3F31 A;  4IGU A;  4HWF A;  3UQ4 A;  1QSD A;  2VB6 A;  3M65 A;  5JVD E;  4ZI2 D;  3K3N A;  1UX4 A;  2WMN A;  4CI3 B;  3CVR A;  4PK5 A;  2D9D A;  5HCJ A;  3K3Q C;  5CGM A;  3UTK A;  3ZMU B;  3PU3 A;  3ABV A;  3PJA J;  4FJO A;  3ETU A;  2NW8 A;  1WFD A;  4O4H E;  4DBR A;  2DL1 A;  5LB7 B;  4IE4 A;  2XAJ B;  2H89 A;  3RLF F;  3SFD A;  1HX8 A;  3H3M A;  2AXD S;  3UUX B;  5CA0 E;  1ZHC A;  4HFE A;  1D1B A;  2UU9 T;  2NW9 A;  1MNE A;  3KDS E;  4KUM B;  4LFA T;  2K48 A;  2X0L B;  3AA1 B;  2KMF A;  3GN5 A;  1XZY A;  1WCR A;  5AQK B;  3PUS A;  1X9B A;  3RKO A;  3GA8 A;  4PJJ A;  4JI8 T;  2M67 A;  3PU8 A;  2C5I T;  5HXS A;  4DUZ T;  4ANJ A;  3FZH B;  4U3C A;  4PFP A;  4JI2 T;  3JCF A;  5H6Q B;  3WAJ A;  2WDR A;  2JQK A;  3N9L A;  2PTF A;  3PUQ A;  2W61 A;  3B5M A;  2A9U A;  3UUB A;  4CXX A;  2MAW A;  1ZP0 A;  3ZSS A;  1IBM T;  3AXJ A;  4H9P C;  1LKX A;  4IT4 A;  3UFG A;  2KLQ A;  3RI5 A;  2BZB A;  4H9R C;  4EIW A;  5JR9 A;  2CBJ A;  5HXC A;  1KK7 A;  3N2O A;  3VRA A;  5FVK A;  4PW8 A;  4FI5 A;  2V8S V;  4LF8 T;  2NWB A;  3RQU A;  3ZKR A;  2J62 A;  4AKR B;  5JTG A;  2VL0 A;  2XZE A;  1G8X A;  5HWY A;  1U4Q A;  5AQI B;  2JMH A;  5JDG A;  1OED A;  3UUN A;  3QNU A;  3GN5 B;  4K0K T;  5L4H A;  2KWI B;  3NVO A;  3N2K E;  3R6N A;  3Q5D A;  5DQV A;  4QH1 A;  1KF6 A;  2IC9 A;  2L9Q A;  4JI5 T;  2WCA A;  3RC3 A;  3H37 A;  3A5X A;  2DNX A;  4DV3 T;  4U31 A;  2PBI A;  2V6Y B;  2CHN A;  4DV6 T;  2LEH A;  3U78 A;  4NUU A;  1NEK A;  1HNZ T;  3AE7 A;  2WY2 A;  4WBN E;  3RIA A;  5BR8 T;  3FBL A;  2DI4 A;  2XSB A;  2H7O A;  1HFA A;  3ZT7 A;  3CPZ A;  2XQ4 A;  5L3E B;  1L0V A;  3RX6 A;  2V7J A;  4C90 A;  2NR4 A;  3CIR A;  4QKN A;  3UU6 A;  3LK3 B;  5KMG P;  5JDL A;  2WB5 A;  2XAQ B;  2JMK A;  4EXT A;  3FZF B;  1VCS A;  3OYX A;  4KHP T;  4WW0 A;  4AQY T;  1YD8 G;  3AE6 A;  1SHZ C;  1N34 T;  3PUX F;  3J7Y q;  4HWH A;  2BKN A;  1ZKE A;  4MHC A;  5LXT E;  2LOP A;  2ZM2 A;  3C98 B;  2IDO B;  3KFW X;  2A2F X;  3E22 E;  4ILB A;  3KV5 A;  2CXD A;  4X62 T;  1YQ4 A;  2W4X A;  3E08 A;  5JR9 C;  3NKZ A;  5LGN B;  4DR1 T;  4HE8 A;  3ZN0 B;  4QX7 B;  2M6I A;  1VOM A;  4AKI A;  1T7S A;  3I1A A;  4MLK A;  4AQG A;  3B13 A;  1YQ3 A;  3CKD A;  3P4R A;  3ZJ2 A;  4AIS A;  3TLW A;  2ZM8 A;  4X66 T;  3K1S A;  2W0G A;  3ZC0 A;  3P50 A;  4NPP A;  4IDN A;  3X1D A;  3IA3 A;  5LGU B;  1T72 A;  3WI3 A;  1E2A A;  2J4G A;  4B6X A;  3BQK A;  2A72 A;  5DAB A;  1OED C;  2RP4 A;  3OTO T;  4OK0 A;  3K3O A;  4ZI3 D;  5FL1 A;  4JI3 T;  4GIW A;  1D0X A;  4AI6 A;  1FIO A;  3P4W A;  3I0O A;  2CA5 A;  5AQF B;  4ERR A;  4DR3 T;  5HEU A;  1I94 T;  5JRC B;  5LNK A;  5KXJ A;  3UU4 A;  4IDP A;  1IBK T;  3Q5X A;  5HEJ A;  3AAA B;  5L47 A;  3SRZ A;  1N33 T;  2ODV A;  5BMV E;  3C51 A;  2MOZ A;  4EAH A;  5CA1 E;  4DV7 T;  2N1G A;  2FJD A;  2CBI A;  5HEH A;  1HG2 A;  2ZM6 T;  5AQJ B;  4PK6 A;  5F5W A;  2E8I A;  4XBF B;  1NAF A;  4ZI3 C;  3EDU A;  4CZZ B;  4E7Z A;  2WBL A;  5KX5 E;  2CWO A;  4HFB A;  4UR9 A;  4ZEY A;  3I0Q A;  2LHN A;  4X5T A;  4EYY R;  3SS1 A;  2YN6 A;  2I0M A;  2WU2 A;  4HFC A;  3AA7 B;  4QXH B;  2BDE A;  4V1A v;  2XQ6 A;  4A5X A;  3LBX B;  1KFY A;  3RH3 A;  1IJ6 A;  5AFU L;  3CQG B;  3ONL C;  3VRB A;  2FJB A;  4YTM A;  2MBG A;  5FMN A;  3VKG A;  2NOX A;  2DLR A;  2XQ7 A;  3AEF A;  4EEB A;  2V5D A;  3PE0 A;  3NBX X;  4DBQ A;  1M7K A;  4JV5 T;  1U5P A;  4U33 A;  1WLX A;  4LF6 T;  2LKH A;  3N9Q A;  1WR0 A;  4H9N C;  2WDQ A;  4WYV A;  3PUZ F;  4COF A;  5JDQ A;  5LYJ E;  2XPK A;  4TN7 B;  2JQQ A;  4F8H A;  3UT5 E;  2V26 A;  2VAS A;  2BBJ A;  4KBM B;  4X1K E; 
#chains in the Genus database with same CATH homology
 3NRY A;  4M1P A;  4IE5 A;  2IAK A;  3VKH A;  2E9X B;  3OBV E;  5IHY A;  3EUH A;  2XAF B;  4HTE A;  4PFP A;  1MMA A;  4AKL A;  4AKG A;  1Y64 B;  4MBQ A;  2MYS A;  5H6Q B;  2VKO A;  2X9H A;  3FXD B;  3WAJ A;  3D0T A;  3O1H A;  3NZQ A;  2C0S A;  3ZYM A;  3ANW B;  3N9L A;  4WNK A;  2IC6 A;  4IDZ A;  2X9W A;  4I55 E;  2LSK A;  4PAG A;  4TV8 E;  1CUN A;  3PUQ A;  1IZN B;  3ZYL A;  4ADZ A;  4DO0 A;  5L3C B;  1AJ3 A;  5DJQ C;  2W61 A;  3N9P A;  4CXW A;  4X1Y E;  4EOZ B;  4IE6 A;  3GWH A;  3F57 A;  3N9M A;  2XAH B;  2XUE A;  4CXX A;  5JRC A;  2Y6X A;  1WYB A;  4H9Q C;  4H9P C;  2LT3 A;  1LKX A;  3MXZ A;  3ZYK A;  4EZ4 A;  3JC6 C;  2D0T A;  1HF8 A;  2E9X C;  1V9D A;  2CXF A;  5JDN A;  2KLQ A;  3KVB A;  4OYJ A;  2B1E A;  2BZB A;  5HXE A;  3EVY A;  1HG5 A;  2V7M A;  2N2N A;  1YKE B;  3OKQ A;  4H9R C;  1D1A A;  4EIW A;  4MFR A;  5JR9 A;  3KIN B;  4U74 A;  1KK7 A;  3MJX A;  2V7L A;  3N2O A;  5HXC A;  2IW5 B;  2ODU A;  4PK4 A;  3MA9 A;  2V1D B;  3HKD E;  4L0R A;  4X1I E;  4PW8 A;  2K5B B;  2LSJ A;  3VU7 H;  2NP9 A;  4FI5 A;  3Q9D A;  3KV4 A;  2VKJ A;  3LG7 A;  1HTJ F;  3PUG A;  4QXB B;  2YIN A;  2NTY A;  3N9N A;  2KT9 A;  3C64 A;  1T98 A;  3O9X A;  2D5U A;  4IE7 A;  2NWB A;  3TKL B;  4WBO A;  1EZ3 A;  4BJM A;  1BR1 A;  2CWY A;  1UX5 A;  5FXV A;  3AA6 B;  3ZMZ B;  4CI1 B;  5LBQ B;  4AKR B;  2EHO A;  2Q9Q A;  4ILU A;  3CQX C;  5EK3 A;  4QXC B;  1S35 A;  3KV9 A;  3PUA A;  3P7I A;  3LJC A;  2LJL A;  4ZOL E;  1G8X A;  5FP3 A;  5HWY A;  1U4Q A;  2VL8 A;  4XAX B;  4O2A E;  2YK0 A;  3V5S A;  2K24 A;  3RYC E;  2JMH A;  2NW7 A;  5JDG A;  1HS7 A;  5LHG B;  4H9O C;  2CLY B;  2LM9 A;  2UXX B;  4PJN A;  4TZ4 C;  3LBX A;  3UUN A;  5JDM A;  5L3G B;  3GN5 B;  2ACX A;  5H6R B;  3U3I A;  2QGS A;  4IST A;  1LRZ A;  4IE0 A;  3ZMT B;  5JDH A;  5LGT B;  2DWK A;  3GMI A;  2KND A;  3RC8 A;  4JEH B;  2LSI A;  3R84 B;  2SPC A;  2V7I A;  2KWI B;  2UXN B;  5GON E;  1BR0 A;  4JEU B;  4DVD A;  2LSG A;  3N2K E;  4O8S A;  3R6N A;  3RYI E;  4ZI2 C;  3EDV A;  4O4L E;  5L3F B;  4BAY B;  3HR0 A;  3IBP A;  2D0U A;  5DQV A;  2IC9 A;  1ZEE A;  2L9Q A;  4CQI A;  4G63 A;  3V5U A;  3I9W A;  3RC3 A;  4UEM A;  3H37 A;  3SWH A;  3A5X A;  4X20 E;  5LJN A;  2DNX A;  2PBI A;  5HYA A;  2X9Y A;  2YU1 A;  3AB3 B;  4I50 E;  1X79 A;  4DMW A;  3HKB E;  2LEH A;  3FHN A;  3PDY A;  2L8K A;  2CLY C;  4NUU A;  4PJL A;  4YFS A;  3U78 A;  4AQF C;  4E7S A;  2ZLY A;  2CCQ A;  4IHJ E;  4WBN E;  3I9Y A;  2H3R A;  4UF0 A;  3FBL A;  2DI4 A;  2BVM A;  4AKH A;  4MAL A;  2W63 A;  3SOL A;  5M4Y A;  5HXH A;  2H7O A;  2C5K T;  1HFA A;  3CPZ A;  4I4T E;  4ISS A;  2DHR A;  5LG4 A;  3CWZ B;  4QX8 B;  5LCY A;  4EZH A;  4UVC B;  5L3E B;  4GOU A;  1MIV A;  1UCU A;  5C8Y E;  5LBM A;  2YU2 A;  4TUY E;  4IIJ E;  3RX6 A;  2V7J A;  4C90 A;  2MTQ A;  4O4J E;  3E0Z A;  3W15 B;  3N5L A;  4J2C A;  2VKH A;  1WR6 A;  2G0U A;  3ZMS B;  4O2B E;  2E9X A;  3RYF E;  4K0U A;  2RA1 A;  4DND A;  1H7C A;  4QKN A;  4OYK A;  3RRW A;  2XHE B;  1US7 B;  3LK3 B;  4Z8X A;  2JJ9 A;  5JDL A;  1IJ5 A;  5KMG P;  5LJM A;  3QC9 A;  3MZK B;  2XAQ B;  2JMK A;  5F8P A;  4EXT A;  3N2G E;  3UFE A;  3ANW A;  2EHO D;  3IHR A;  2Q9Q D;  5A1L A;  3LK4 2;  5JH7 E;  2WAU A;  3K8P C;  4YJ3 E;  2KXP B;  2WM9 A;  4UXN B;  3OYX A;  2DWG A;  3O1J A;  4WW0 A;  3KV6 A;  2J1D G;  5EK2 A;  1YD8 G;  1MMN A;  4H9S E;  1SHZ C;  2VKD A;  3HA4 A;  3O4X E;  5L3D B;  3J7Y q;  4PNI A;  3ZEF B;  5HAX A;  4HFV A;  3ZLI A;  1ZKE A;  2GK9 A;  4MHC A;  1VRB A;  1D0Y A;  2LOP A;  5LXT E;  2ZM2 A;  1LVK A;  1MMD A;  3C98 B;  4N78 D;  3F2E A;  4JUY A;  4OFZ A;  3KFW X;  3ZPO A;  2A2F X;  4PJM A;  3E22 E;  4U72 A;  2QA7 A;  2W62 A;  5HWX A;  4ZS3 A;  3KV5 A;  2CXD A;  5ADX L;  1MIY A;  4DMV A;  4C91 A;  3E08 A;  5JR9 C;  5LGN B;  3DTO A;  4HE8 A;  3ZN0 B;  3HKE E;  4GK0 E;  4QX7 B;  1VOM A;  2X68 A;  4AKI A;  2CXL A;  3I1A A;  3CQC B;  4MLK A;  4AQG A;  3B13 A;  4CI2 B;  3CKD A;  3PTR B;  4ASK A;  5L3B B;  5EZY E;  3ZCI A;  4HGA A;  2LE8 A;  4HEA A;  4UVB B;  3ZJ2 A;  3ZMV B;  2K9A A;  1E1H B;  3UUL A;  2ZM8 A;  4UIG A;  4ZI7 E;  3ZCJ A;  1B7T A;  5HXR A;  2Y8D A;  3O1I A;  4CXY A;  4QHO A;  2ES0 A;  3MKD A;  2JRK A;  3J9X 1;  2W0G A;  2LHR A;  3ZC0 A;  3LK2 B;  4PFO A;  5LHH B;  2EHO C;  2Q9Q C;  5EK4 A;  5KDM C;  1HCI A;  1G73 A;  4OHF A;  5LHI B;  3CX6 B;  4P0A A;  5LGU B;  1IAP A;  4F6R C;  3NRX A;  5JRE A;  1S94 A;  3WI3 A;  4NUV A;  3Q5W A;  3T8O A;  4JLE A;  2ZMA A;  3C4W A;  5F3J A;  3P8C D;  4B6X A;  3BQK A;  3AA0 B;  2A72 A;  4YHJ A;  5DAB A;  3HKC E;  4TX5 A;  3C4X A;  2RP4 A;  4UF0 B;  4P09 A;  4HN9 A;  5FXW A;  4OK0 A;  3K3O A;  5FXX A;  3RYH E;  4ZHQ E;  3C50 A;  1WYC A;  2CE7 A;  2OA5 A;  1MMG A;  3DJB A;  5IYZ E;  3UUM A;  5LOV E;  5FY7 A;  2CM0 A;  4BA9 A;  4ZI3 D;  3NZP A;  4GIW A;  1D0X A;  4KP3 C;  5E0O A;  3QUJ A;  2HH7 A;  3CX7 B;  2E9X D;  4AI6 A;  2A3D A;  1BR2 A;  1FIO A;  2X51 A;  4UVA B;  3ZJ1 A;  2I59 A;  2Z6E A;  3I0O A;  2CA5 A;  4ERR A;  4TV9 E;  5JQG E;  3KBT A;  1BR4 A;  4H63 V;  5CB4 E;  5JRC B;  1MIW A;  4UV9 B;  5LNK A;  1D1C A;  3OJA A;  3BK9 A;  3FXE B;  2VWA A;  1QUU A;  3Q5X A;  3AAA B;  5ETW A;  1O3X A;  3SRZ A;  3ZN1 B;  5FXZ A;  5LP6 E;  4G2A A;  3ZC1 A;  3BQL A;  2KZ7 B;  3IF8 B;  1MND A;  2ODV A;  3BQI A;  3OYZ A;  5BMV E;  5JR9 B;  3RRC A;  4ZS2 A;  2NTX A;  3FB2 A;  4L9I A;  5J2T E;  3N9O A;  3C51 A;  2MOZ A;  4EAH A;  4GYS A;  2P9B A;  2XTL A;  4L5G A;  3L09 A;  5CA1 E;  4I43 B;  2N1G A;  2XAG B;  1FEW A;  5FY0 A;  1KNZ A;  3S4U A;  4YLH A;  1HG2 A;  3QK6 A;  2HPL A;  4PK6 A;  2HPJ A;  1D0Z A;  2E8I A;  5J1G A;  4HKA A;  3MK7 C;  4XBF B;  1NAF A;  5J2U E;  3AAE B;  1ZV4 X;  3CML A;  4ZI3 C;  4H63 H;  2D2S A;  3FBZ A;  2LSY A;  3KBU A;  4A56 A;  3EDU A;  1FMW A;  4CZZ B;  4E7Z A;  5FYM A;  2LOS A;  2WBL A;  2CWO A;  3HL6 A;  2EHO B;  3WAK A;  2Q9Q B;  2VK9 A;  3MAC A;  5KX5 E;  1OXZ A;  3I0Q A;  2CEA A;  2LHN A;  2W00 A;  2X66 A;  3AVS A;  4EYY R;  2PFV A;  3B57 A;  2X67 A;  2BVL A;  2XAS B;  3SS1 A;  4P0B A;  2WWU A;  5JDF A;  1LVF A;  3Q2M A;  1YKH B;  1YW0 A;  4GYR A;  3RPU A;  3F31 A;  4IGU A;  3AA7 B;  2PG8 A;  1QSD A;  4QXH B;  1FMV A;  5FY1 A;  2VB6 A;  2KIN B;  3M65 A;  5DQW A;  5JVD E;  4ZI2 D;  3K3N A;  3PUR A;  1UX4 A;  2BDE A;  4V1A v;  2WMN A;  2CMR A;  2V7K A;  3LBX B;  4CI3 B;  3RH3 A;  1IJ6 A;  3CVR A;  4PK5 A;  2H7V C;  3K3Q C;  5TAO A;  3UTK A;  3ZMU B;  3DP7 A;  5AFU L;  2WSS V;  3PU3 A;  3CQG B;  3CX8 B;  4KMC A;  4FJO A;  3VHL A;  4BJN A;  1NWM X;  3ETU A;  2NW8 A;  4X1K E;  2Y48 B;  2DCF A;  3ETV A;  4AXP A;  4O4H E;  2MBG A;  3ESL A;  5FMN A;  1SA0 E;  3IEE A;  4DBR A;  2X9X A;  5FNV E;  3VKG A;  3ONX A;  4EB6 E;  2NOX A;  2YEV C;  2DLR A;  2PJQ A;  2XQY A;  4IE4 A;  4EYU A;  2XAJ B;  2ZM0 A;  2N9D A;  3L3P A;  3C4Z A;  1HX8 A;  3PE0 A;  3UUX B;  3NBX X;  4YJ2 E;  1Z0P A;  4DBQ A;  4UEL A;  4QWN B;  5CA0 E;  3AAI A;  2C5J A;  1ZHC A;  2KWH A;  1D1B A;  2NW9 A;  1U5P A;  1MNE A;  4AQF A;  3KDS E;  4KUM B;  1WLX A;  4O4I E;  5L2L A;  4GK5 E;  3N9Q A;  2K48 A;  2X0L B;  3AA1 B;  4H9N C;  4XZC A;  2KMF A;  3GN5 A;  3JC6 D;  3HI2 A;  5JDQ A;  2L3L A;  4UV8 B;  3PUS A;  3AVR A;  5LYJ E;  5LA6 E;  2WMO A;  3LFM A;  1OWA A;  3RKO A;  1WRD A;  4TN7 B;  2JQQ A;  3GA8 A;  3KVA A;  4PJJ A;  3UT5 E;  2M67 A;  3PU8 A;  2C5I T;  5HXS A;  2V26 A;  2VAS A;  4KBM B;  2JPF A;  3H3A A;  4ANJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...