4HE8A

Crystal structure of the membrane domain of respiratory complex i from thermus thermophilus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
116
structure length
92
Chain Sequence
MAPIQEYVGTLIYVGVALFIGVAALLVGALKRFPVHFYVVAMLFILFDVEVAFLWPYAVSAGGLGLYGFLGVLAFTLLLFVGFLYEWWKGVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NADH-quinone oxidoreductase subunit 7
publication title Crystal structure of the entire respiratory complex I.
pubmed doi rcsb
total genus 32
structure length 92
sequence length 116
chains with identical sequence B
ec nomenclature ec 1.6.5.3: Transferred entry: 7.1.1.2.
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00507 Oxidored_q4 NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1610 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4he8A00
3RKOA 4HE8A 4HEAA 5LNKA
chains in the Genus database with same CATH superfamily
4HE8A 4ISSA 4U7IA 4I50E 3VR8A 4AI6A 2BG9A 2W66A 4O4HE 2CLYC 2BBHA 4QXHB 4NIQA 3ZC1A 4UVAB 4JLEA 2DHRA 3AE3A 4IDQA 5LJMA 4O2AE 3ZMUB 4DR7T 5HXRA 2BZBA 5FMNA 2E9XA 2CPTA 4YY3T 5AQKB 5LG4A 1LKXA 4ADZA 2K48A 4TWDA 3KV9A 4MBQA 4CZZB 4EB6E 4JEUB 2Q9QB 2V1DB 3F2EA 1Z0PA 2JQ9A 1N32T 4U33A 5FL0A 2MBGA 2A9UA 2E5VA 4IDPA 1MMNA 2D5UA 2HHHT 4QH5A 1NEKA 2J1DG 4DBRA 3QUJA 3N2KE 4PAGA 3SFEA 3HL6A 1N36T 1M62A 5FY1A 3VRBA 3JADA 2CBJA 2HPLA 4A56A 4I0UA 2X9XA 3UTKA 3FHNA 3K3OA 4DMWA 4TX5A 3CQCB 4AKHA 5JVDE 4EGWA 2V6YA 2CA5A 2RA1A 3LFMA 4COFA 3OVUA 1U5PA 2WCAA 4BJMA 3FZHB 2DWGA 2XZEA 4HTEA 2ACXA 4Q25A 3PUAA 3RYHE 1MIYA 1WYBA 2CLYB 4TNWA 3UU5A 5J1GA 4ZI7E 3P4RA 5L3EB 4YXDA 2LSYA 1XNQT 1YW0A 4A97A 4YTPA 5H6QB 2I0MA 3ZN1B 3IF8B 3AA0B 3MA9A 2Y6XA 3RRCA 3EHZA 2JMKA 3RIAA 4M1PA 4P0AA 2E5LT 4JI8T 2PBIA 2LE8A 3AAEB 1B7TA 3KVBA 4KHPT 5LHGB 1OEDB 4MALA 3CKDA 3IEEA 4CI2B 1J1JA 1XDOA 1E1HB 4Z8XA 2VASA 3N9NA 4L5GA 3VU7H 3NZPA 1R8IA 3QB5K 3RF1A 2BBJA 3UU4A 3OJAA 4ZXLA 2VKJA 1BR1A 3RYFE 3P4WA 4EOZB 1JNRA 2Y48B 3RRWA 3J7Yq 2Z6EA 2IHR1 2XASB 3UUBA 2W63A 5HAXA 4G63A 4K0UA 2K3WA 4PNIA 3L3PA 2EHOD 2ZLYA 3C50A 4X62T 5LOVE 2A72A 1FMWA 4U72A 2EHOC 2ZMAA 3NVOA 4YSZA 3PDYA 4KX6A 3CK6A 3PE0A 5AQPB 5HXEA 4X5TA 3EAMA 4CQIA 3TKLB 1VOMA 3SFDA 4IL9A 5IUXA 3C4WA 3RX6A 3VRAA 1W9RA 2LSJA 3H37A 1HS7A 2BKPA 5AQMB 3ONJA 1XZYA 4IDZA 3EVYA 1BR2A 5JR9C 2HH7A 2UXDT 4WBNE 2CWOA 1FJGT 5L3DB 5HCJA 1US7B 5A1LA 3CPZA 3KFWX 2X9YA 2LEHA 4ZI3D 1WFDA 3UFEA 5F5WA 2JQQA 2NOXA 3AECA 1IBKT 4ZI3C 2VKDA 4AQYT 4EZ4A 5ABHA 4GKJT 4EZHA 3T1YT 4I55E 3C4XA 2WDVA 3ZSTA 4J2CA 5DJQC 4U2ZA 3OPCA 3ABVA 3A7MA 4IIJE 3MK7C 5HCMA 5AQIB 4CI3B 3GMIA 4LF7T 2UXCT 2I59A 2LRKA 2LM2A 1YKEB 5ADXL 4IE5A 4HKAA 2WB5A 4EV6A 3C98B 2KSRA 1FMVA 2YU1A 2C5KT 3AA7B 2J4GA 1XWMA 1QLBA 5ABFA 3P4QA 5F3JA 4FI5A 3KDSE 3Q2MA 4WBOA 4X1YE 5LMUT 2EHOB 4OHFA 2WU5A 2JQHA 5AQJB 2XUEA 1VCTA 2FJEA 3QNUA 1ZKEA 4DV0T 4IE6A 3AA1B 3K8PC 5LBMA 4QXCB 1DU2A 1YQ3A 3SS1A 3BQLA 1UURA 2NW7A 1S35A 4KUMB 2BDEA 2BS4A 2JJ9A 3ETUA 3NBXX 2V7MA 4H9RC 2H7OA 2V7KA 3CVRA 2X68A 3N9PA 3NRYA 1MMDA 1X79A 4PW8A 3TLUA 2BVMA 3B13A 2L8KA 3ZMTB 2XQ9A 2HN2A 4H9QC 5FXXA 2D2SA 3PURA 2L9QA 1MIWA 2SPCA 5JRCA 2CBIA 3N5LA 4IE0A 4DR4T 2W61A 5KX5E 2Q9QD 4IT4A 4YLHA 5AQNB 5GONE 4YHHT 5H6RB 2J47A 3AE8A 2Q9QC 3PJAJ 4JBWF 1KFYA 1G73A 1H7CA 4LF4T 1GQEA 2BVLA 5CGMA 4OYJA 2H3RA 3FZLB 2V7IA 5L3BB 3DJBA 1J5WA 2VKHA 4JV5T 5DABA 2LKGA 4ANJA 2BG9E 2YN6A 2CM0A 2BKOA 3PTRB 3U78A 5ABEA 1SE7A 1KK7A 3H3MA 2X66A 5AFUL 3SRZA 5J2UE 3RLFF 4JEHB 3EDUA 5IYZE 4HWFA 2YEVC 4QHOA 4ISTA 3LBXB 3ZCIA 5DQWA 1N34T 4E7ZA 2CHOA 1WR6A 2PTFA 4UVBB 3CQGB 4MHCA 5LGTB 3PU8A 2XSAA 3Q5WA 4HFIA 2J62A 4IGUA 4O4LE 3N9QA 2D0TA 3NKZA 4NXMT 1JNZA 2OV9A 2IMLA 2XM1A 3CMLA 2UUCT 1D1BA 3ANWA 4KP3C 3P50A 1T7SA 3KINB 3E08A 4LMJA 2LHNA 4ZZCA 2CRBA 4O8SA 3P4SA 1WR0A 3HI2A 4UV8B 2ACZA 2WBLA 2WMNA 3ZN0B 1KF6A 5HEJA 4KMCA 2CXFA 2V5CA 1OEDC 4PJMA 4ERRA 2EHOA 3PUWF 3RHWA 3AE7A 2BS3A 3O4XE 2L3LA 3D0TA 4A5XA 4WZXA 4WW0A 3HA4A 4HFDA 2D9DA 4N78D 2XSBA 2HN1A 4JI2T 1MIVA 4KBMB 4KI0F 4U3CA 4XZCA 3I0OA 5JR9A 4C90A 3ZYLA 5LHIB 2DLRA 4ASKA 5JDMA 4HFVA 1MMAA 2V7LA 5FVLA 2NWBA 3CX6B 1UK5A 3N2GE 3PUSA 2QA7A 1W0BA 5FXWA 3K3QC 2KLQA 2R6GF 4WYVA 2M6IA 4DR3T 3VKHA 4LFAT 5LYJE 3M3ZB 5LJNA 3VR9A 1IJ6A 1S94A 4UV9B 3EUHA 5EZYE 3TLTA 2HPJA 4EYUA 5CFBA 4DNDA 5FP3A 1HNXT 2ODUA 2P9BA 3C51A 1Z8UA 4DMVA 4PJNA 3KV6A 3JAEA 1UUSA 2CHNA 2OLTA 5JREA 4AQGA 4DR6T 3PUZF 4UXNB 1KNPA 5AQGB 3TLWA 4Z91A 3L39A 2A2FX 5LXTE 3KBTA 1NAFA 5L2LA 1WCRA 5ETWA 3AVRA 4AISA 1W09A 1HFAA 1U4QA 5LGUB 4ZI2D 4O4IE 2YDQA 3AE2A 3TLSA 2NTXA 2VQFT 3HKBE 4ZI2C 2CXDA 4U31A 1WLXA 3UQ7A 3H3AA 3O9XA 2C5JA 2IUBA 2JMHA 1Y64B 1UX4A 2X9WA 5TAOA 1XMOT 2XAFB 3FBLA 3OBVE 4UVCB 2LOPA 3FBZA 3F31A 5JH7E 4B6XA 2WY2A 4HFCA 4GYRA 3EI0A 3RQUA 5FY7A 2IW5B 5EK2A 2I6HA 1XNRT 2NP9A 1HG2A 4XBFB 1EZ3A 3K3NA 1QSDA 3AXJB 2VK9A 2VWAA 1D0YA 2LJLA 2CEAA 3AEFA 4I4TE 2WZHA 3O1IA 4ZEYA 4GOUA 4YSYA 2B76A 1HG5A 4DR5T 3RGLA 5FYMA 5BMVE 1J5ET 3RIFA 2Q9QA 5LG3A 4UF0B 4EAHA 3IA3A 3CWZB 2K24A 4GK5E 4PFOA 2MPKA 1VRBA 4DR1T 2X0HA 4PK5A 4X1KE 3UUNA 5HXHA 2V8SV 1HX8A 4X66T 3MZKB 2DCFA 2BKNA 4E7SA 3PUGA 1XDPA 2C5IT 2QVAA 3IBPA 1T98A 4HFHA 1IBMT 4XAXB 4LFBT 3UU8A 4PJJA 4NUVA 3FZFB 2YK0A 4QH4A 2WDQA 4ILCA 2VKOA 3MXZA 4YFSA 4HFBA 4YJ2E 3ZLIA 2BG9B 5FY0A 2ZM0A 2CWYA 5LMNT 4X1IE 4YSXA 1MMGA 5AQUB 3P7IA 3AAIA 3N9MA 3BQKA 2W0GA 4EEBA 4HGAA 3WAJA 3J9X1 1MNEA 4TWHA 3V5SA 3LSVA 5CA1E 4X20E 3JCFA 4HWHA 4DBQA 4CN1A 3VKGA 4QWNB 4ZS3A 5BR8T 3OYXA 4HN9A 2NTYA 3DTOA 5L4HA 2WDRA 5AQFB 3ZC0A 3L09A 5CB4E 2QYWA 5FXVA 3PUXF 4HEAA 5DQVA 4MFRA 2IC9A 5KXJA 1I6ZA 4CN4A 1FIOA 5JTGA 3PUYF 4OX9T 4CXXA 2XJ7A 5L4EA 3ZT7A 1OEDA 4UIGA 2N2NA 2YDSA 5EK4A 2V7JA 1ZEEA 3C4ZA 3OYZA 2RP4A 3ETVA 2CMRA 4PFPA 5JQGE 2LSKA 1IJ5A 4H9SE 2LT3A 4JI3T 3EABA 4DIDB 3ZMVB 2V26A 5KDMC 4GKKT 3PUQA 3K1SA 2KWHA 3F57A 3ONLC 2V6YB 4ILAA 2H88A 1CUNA 1BR0A 3PJAA 2VB6A 2IAKA 4IE4A 3RYCE 2KNDA 3I0QA 3CQXC 2VVNA 4TNVA 2PJQA 3AXJA 2M6BA 2DWKA 2RPAA 2WSSV 1HNZT 5AQHB 1SA0E 4I43B 5JDFA 1T72A 3W15B 5CA0E 2MOZA 2X0LB 2WWVA 4IL4A 5CJ5A 3TLVA 3AA6B 1UCUA 5AQOB 4LF8T 2QRXA 2IIUA 2LSGA 2YDRA 4P09A 3L8RA 2JPFA 3IHRA 4UF0A 1OXZA 3AEDA 2XAJB 4P1NA 4YHJA 3ZJ2A 2CCQA 4F8HA 4AXPA 3RKOA 4TV8E 3QC9A 2V6XA 4EYYR 2WMOA 3UT5E 2N1GA 2LSIA 5JDNA 4HFEA 1NENA 4CI1B 3B57A 4O4JE 1KEYA 2WS3A 3HKCE 5HEGA 4AKIA 3AE4A 2KZ7B 5F8PA 2G0UA 1AJ3A 2JQKA 1E2AA 1HCIA 4X65T 1IZNB 2C0SA 3P8CD 1HF8A 3NWIA 3NRXA 5LBQB 4EEDA 3ZMZB 1X9BA 1WYCA 3AE5A 4AQFC 2IDOB 4H63H 2VVSA 4JI5T 3UUMA 1W0AA 4JI6T 5AQRB 3ZT6A 4G2AA 3U3IA 5L47A 2XY8B 3P4PA 5HEOA 2FJDA 4YJ3E 2A3DA 1Y01A 2XTLA 4H63V 2YINA 3RIUC 4DUZT 3R6NA 1YXRA 5E0OA 3JAFA 4BJNA 5M4YA 5AQSB 2VURA 2NW9A 4EXTA 2LRLA 3T8OA 3PV0F 3AB3B 4Z90A 3C64A 4O2BE 3RPUA 2XQ3A 3E0ZA 5FL1A 3HKDE 3KV5A 1IBLT 4B3MT 4H9PC 4DV7T 4TZ4C 5JDHA 4DV5T 2PFVA 3UU6A 1L0VA 3OTOT 2PG8A 4JUYA 4WNKA 4BA9A 4ZOLE 3UFGA 5FNVE 2W62A 3KVAA 1NWMX 2YU2A 1HX1B 3AE6A 4HWCA 5LP6E 2WWUA 5AQLB 3UUXB 4LF5T 1BR4A 1KNZA 1D1CA 3V5UA 4IDOA 2QGSA 2DL1A 3RI5A 4UEMA 3CX7B 5HWXA 4GK0E 4HWDA 3ZKRA 3AEAA 3VHLA 2XQ5A 3FB2A 3ONXA 5C8YE 2Y8DA 5FKYA 5ABGA 2CE7A 3RYIE 5ABFB 3WI3A 3I9WA 2XQAA 4ZZBA 1FEWA 3MACA 5HEUA 4DV6T 3S4UA 2ZM8A 3ESLA 4ILUA 2MYSA 4X64T 3HKEE 1D0ZA 3R84B 4ZS2A 2LOSA 5AQQB 5C3JA 2XHEB 3LBXA 5L3CB 3RH3A 5C2TA 4YT0A 2FUPA 2ZM2A 2BG9C 3QK6A 2KXPB 4DV4T 3EDVA 4V1Av 4NUUA 3M65A 3ZYKA 5L3GB 3QOFA 2WM9A 4DR2T 4HWIB 5AQVB 3B5MA 3N2OA 4QX7B 3AEBA 2E9XD 1SHZC 3ZJ1A 5J2TE 3UULA 2UU9T 3ZEFB 2ODVA 3FZKB 2E9XC 1LVKA 1ZV4X 3I9YA 5JRCB 4H9OC 4DV2T 3MKDA 3GN5B 4PK4A 1YQ4A 2FBWA 4LFCT 1HNWT 3GA8A 4L0RA 2LLYA 5KMGP 1D0XA 4DUYT 1LRZA 2LKHA 4B3RT 3GWHA 4K0KT 2B1EA 4TWFA 4BAYB 4IREA 1YKHB 4TN7B 3PU3A 1VCSA 2KMFA 2K9AA 2XAGB 4DVDA 3LK42 5LCYA 3LDQB 2LM9A 2N9DA 3O1JA 3BK9A 3Q5XA 2WU2A 2F4VT 4NXNT 2ES0A 4P0BA 4AKLA 3CIRA 5L3FB 1ZHCA 2VL8A 1O3XA 3DP7A 2XQ6A 2LHRA 2WAUA 4ILBA 2H7VC 4AKGA 3LG7A 4DV1T 4YTNA 5JDQA 5LB7B 3Q5DA 3UU3A 4DO0A 5LNKA 4GYSA 3ZSSA 3RC8A 1OEDE 3ZCJA 3AE1A 2VQET 3ANWB 4LF6T 4DV3T 2W00A 5J0ZA 3AEGA 2X51A 4PJLA 4LMLA 4KHZF 2WZIA 4A98A 2KT9A 1OWAA 3HR0A 4AQFA 2WP9A 4JI1T 2E9XB 1LVFA 2DI4A 4L9IA 4CN6A 2MTQA 1T8BA 2W4XA 2X67A 4F6RC 2FJBA 1UX5A 5EK3A 4AKRB 2W2UA 2XQYA 3E22E 1V9DA 5IHYA 1KNRA 2XAHB 2K5BB 5LHHB 3SWHA 2XPKA 3MJXA 3FZMB 4U7YA 1SUMB 3A5XA 5JDGA 4FJOA 4U74A 5HEHA 4TV9E 4YTMA 2W67A 3PUVF 2UUAT 4JI4T 3RIUA 3ZYMA 2NW8A 2KWIB 3UQ4A 2JIWA 1G8XA 5JR9B 1HTJF 4PK6A 3LK2B 5HXSA 4LMKA 2CXLA 3NZQA 5HXCA 1I94T 1N33T 2GK9A 2UXBT 2NR4A 3Q5EA 4IE7A 3FXDB 1CHUA 3FXEB 2YKSA 2XAQB 4H9NC 3ZT5A 3A8YC 4OYKA 3Q9DA 1IAPA 4C91A 1QUUA 3CX8B 3N9OA 4GIWA 3O1HA 2BS2A 2FJAA 3JC6D 2KINB 2OA5A 1ZOYA 1M7KA 4IDNA 3X1DA 4QX8B 3JC6C 2XM2A 3AE9A 5LGNB 2XQ8A 2ZM6T 4MLKA 4JI0T 2X9HA 4UELA 1E7PA 2UXNB 3GN5A 5HYAA 5LA6E 4ZHQE 2XQ4A 4OFZA 4UR9A 3KV4A 2X0YA 2VL0A 1D1AA 3T1HT 3AAAB 4IHJE 4NPPA 4QXBB 3QB5A 2JRKA 2DNXA 4QKNA 2D0UA 2H89A 3LJCA 1XMQT 4QH1A 4TUYE 3KBUA 2E2AA 4CXYA 1HR0T 5IWAT 3AEEA 3I1AA 5FVKA 2WQYA 4AIUA 5HWYA 5JDLA 2UUBT 4EIWA 2M67A 5FXZA 4JYAT 2XQ7A 4B3TT 4JI7T 3N9LA 1UGOA 4B3ST 4OK0A 3BQIA 1ZP0A 2V5DA 3ZMSB 3SOLA 1MNDA 3RKGA 3WAKA 3AVSA 2AXDS 2UXXB 2YOEA 2MAWA 2AE9A 2IC6A 3ZPOA 4LF9T 1WRDA 4U2YA 3RC3A 3LK3B 3G06A 4CXWA 3RQWA 3OKQA 1YD8G 2E8IA 5AQTB
chains in the Genus database with same CATH topology
4HE8A 3SS1A 4ISSA 3BQLA 5BMVE 4I50E 2NW7A 1S35A 2Q9QA 4AI6A 4UF0B 4KUMB 4O4HE 3VHLA 2BDEA 3FB2A 3ONXA 4EAHA 2JJ9A 3ETUA 5C8YE 3NBXX 2V7MA 2K24A 3CWZB 4GK5E 2CLYC 2Y8DA 4H9RC 4PFOA 4QXHB 2CE7A 3RYIE 2H7OA 3WI3A 3I9WA 3ZC1A 2V7KA 1VRBA 4UVAB 1FEWA 3CVRA 2X68A 3MACA 3N9PA 2DHRA 1MMDA 3NRYA 4JLEA 1X79A 4PW8A 4PK5A 2BVMA 5LJMA 4O2AE 3S4UA 3ZMUB 3B13A 2L8KA 4X1KE 5HXRA 3UUNA 2ZM8A 3ESLA 4ILUA 3ZMTB 5HXHA 1HX8A 2MYSA 3MZKB 4H9QC 2BZBA 5FMNA 5FXXA 2D2SA 2DCFA 3HKEE 2E9XA 4E7SA 3PURA 1D0ZA 2L9QA 3PUGA 3R84B 1MIWA 4ZS2A 2C5IT 3IBPA 2E8IA 5LG4A 2SPCA 1T98A 2LOSA 5JRCA 4XAXB 3N5LA 4IE0A 2XHEB 1LKXA 4PJJA 4NUVA 4ADZA 2W61A 2K48A 3LBXA 5KX5E 5L3CB 2YK0A 3KV9A 4MBQA 3RH3A 2Q9QD 4CZZB 4YLHA 4EB6E 2VKOA 3MXZA 5GONE 4JEUB 4YFSA 2Q9QB 2V1DB 2ZM2A 1Z0PA 3F2EA 5H6RB 3ZLIA 4YJ2E 2Q9QC 5FY0A 2ZM0A 2CWYA 1G73A 2MBGA 3QK6A 1H7CA 2KXPB 2BVLA 4X1IE 1MMGA 4OYJA 3P7IA 1MMNA 3EDVA 2D5UA 2H3RA 4V1Av 3AAIA 4NUUA 2V7IA 3N9MA 5L3BB 3DJBA 3M65A 3ZYKA 3BQKA 2W0GA 2VKHA 4HGAA 3WAJA 5L3GB 5DABA 3J9X1 1MNEA 2J1DG 3V5SA 5CA1E 4X20E 4DBRA 2WM9A 4ANJA 4DBQA 3QUJA 3N2KE 4PAGA 3HL6A 3N2OA 2CM0A 4QX7B 3PTRB 3U78A 3VKGA 4QWNB 4ZS3A 2E9XD 5FY1A 3OYXA 1SHZC 3ZJ1A 1KK7A 5J2TE 3UULA 4HN9A 2HPLA 2NTYA 4A56A 3DTOA 3ZEFB 2ODVA 2X66A 5AFUL 3SRZA 2E9XC 5J2UE 1LVKA 3ZC0A 1ZV4X 3I9YA 3L09A 4JEHB 3EDUA 5IYZE 5CB4E 2X9XA 3UTKA 5JRCB 5FXVA 4HEAA 3FHNA 2YEVC 4H9OC 5DQVA 3K3OA 4QHOA 4DMWA 3MKDA 3GN5B 4TX5A 4ISTA 3CQCB 4AKHA 5JVDE 4PK4A 3LBXB 4MFRA 2IC9A 3GA8A 4L0RA 3ZCIA 5KMGP 5DQWA 1FIOA 2CA5A 1D0XA 4E7ZA 4CXXA 1LRZA 2RA1A 1WR6A 3LFMA 1U5PA 4BJMA 3GWHA 4UIGA 2B1EA 2N2NA 4UVBB 3CQGB 5EK4A 2DWGA 4MHCA 4HTEA 2ACXA 5LGTB 2V7JA 1ZEEA 3PU8A 3C4ZA 3PUAA 3OYZA 3RYHE 2RP4A 4BAYB 1MIYA 3ETVA 2CMRA 3Q5WA 4PFPA 4IGUA 1WYBA 2CLYB 1IJ5A 2LSKA 1YKHB 3N9QA 4O4LE 5JQGE 4TN7B 3PU3A 4H9SE 5J1GA 2D0TA 2LT3A 2KMFA 2K9AA 2XAGB 4DVDA 3CMLA 4ZI7E 3LK42 5LCYA 1D1BA 3ANWA 5L3EB 4KP3C 2LSYA 2LM9A 1YW0A 3ZMVB 2V26A 5KDMC 2N9DA 3O1JA 5H6QB 3KINB 3BK9A 3E08A 3PUQA 3Q5XA 3ZN1B 2KWHA 2LHNA 3IF8B 3AA0B 3MA9A 2Y6XA 4O8SA 3F57A 3RRCA 2ES0A 4P0BA 1CUNA 2JMKA 4AKLA 3HI2A 1BR0A 4M1PA 5L3FB 2VB6A 1ZHCA 4UV8B 4P0AA 2IAKA 2VL8A 1O3XA 2PBIA 4IE4A 2WBLA 3DP7A 3RYCE 2KNDA 2WMNA 2LE8A 3AAEB 3I0QA 3ZN0B 3CQXC 2LHRA 1B7TA 3KVBA 5LHGB 2PJQA 2WAUA 4KMCA 2CXFA 4MALA 2H7VC 3CKDA 3IEEA 4PJMA 2DWKA 4CI2B 4ERRA 2EHOA 4AKGA 3LG7A 2WSSV 5JDQA 1SA0E 1E1HB 4Z8XA 4I43B 5JDFA 2VASA 3N9NA 4DO0A 4L5GA 3O4XE 3VU7H 3W15B 3NZPA 5LNKA 5CA0E 2L3LA 3D0TA 2MOZA 4GYSA 2X0LB 3HA4A 4WW0A 3RC8A 3OJAA 4N78D 3ZCJA 2VKJA 1BR1A 3ANWB 3RYFE 1MIVA 4EOZB 2W00A 4KBMB 2Y48B 3AA6B 1UCUA 2X51A 4PJLA 3RRWA 2LSGA 3J7Yq 4P09A 4XZCA 3I0OA 2JPFA 5JR9A 2Z6EA 2KT9A 3IHRA 1OWAA 3HR0A 4AQFA 4UF0A 1OXZA 4C90A 3ZYLA 2E9XB 2XAJB 5LHIB 2DLRA 4YHJA 4ASKA 5JDMA 3ZJ2A 4HFVA 2XASB 2CCQA 1MMAA 2V7LA 1LVFA 2NWBA 2W63A 3CX6B 4AXPA 5HAXA 2DI4A 4L9IA 3RKOA 2MTQA 2X67A 4G63A 4TV8E 4F6RC 3QC9A 3N2GE 4EYYR 2WMOA 4K0UA 3UT5E 3PUSA 2QA7A 1UX5A 5EK3A 4AKRB 2XQYA 3E22E 4PNIA 5FXWA 3L3PA 2N1GA 1V9DA 2EHOD 2ZLYA 2LSIA 5IHYA 3C50A 5JDNA 3K3QC 2A72A 2XAHB 5LOVE 2K5BB 2KLQA 1FMWA 5LHHB 4U72A 4CI1B 3SWHA 3MJXA 2EHOC 2ZMAA 3B57A 3VKHA 4O4JE 3A5XA 3PDYA 5JDGA 3HKCE 4FJOA 4U74A 5LYJE 3PE0A 5HXEA 5LJNA 1IJ6A 1S94A 4TV9E 4UV9B 4CQIA 4AKIA 3TKLB 1VOMA 3EUHA 2KZ7B 5F8PA 2G0UA 1AJ3A 5EZYE 3C4WA 3RX6A 1HCIA 2HPJA 1IZNB 4EYUA 4DNDA 5FP3A 2C0SA 2LSJA 3H37A 2ODUA 2P9BA 3P8CD 3C51A 1HS7A 3ZYMA 2NW8A 2KWIB 1HF8A 3NRXA 4IDZA 5LBQB 1G8XA 3EVYA 4DMVA 3ZMZB 4PJNA 3KV6A 5JR9B 1BR2A 1HTJF 1WYCA 4PK6A 3LK2B 5JR9C 2HH7A 5HXSA 4AQFC 2CXLA 5JREA 4AQGA 4WBNE 4H63H 3NZQA 4UXNB 5HXCA 2CWOA 5L3DB 2GK9A 1US7B 3UUMA 5A1LA 3CPZA 3KFWX 2X9YA 4IE7A 3FXDB 2A2FX 2LEHA 5LXTE 3FXEB 4ZI3D 2XAQB 3KBTA 4G2AA 1NAFA 4H9NC 3UFEA 5L2LA 3U3IA 5ETWA 3AVRA 2JQQA 3Q9DA 1IAPA 1QUUA 2NOXA 3CX8B 3N9OA 4GIWA 4OYKA 4C91A 4ZI3C 3O1HA 2VKDA 4YJ3E 1HFAA 3JC6D 2KINB 1U4QA 4EZ4A 2OA5A 5LGUB 4ZI2D 2A3DA 4O4IE 2NTXA 3JC6C 4QX8B 5LGNB 4MLKA 3HKBE 4ZI2C 2XTLA 4EZHA 2X9HA 4H63V 4UELA 4I55E 2CXDA 3C4XA 2YINA 4J2CA 5DJQC 1WLXA 2UXNB 3GN5A 5HYAA 3R6NA 3H3AA 3O9XA 4IIJE 2C5JA 5LA6E 2JMHA 5E0OA 4ZHQE 3MK7C 4OFZA 1Y64B 4GK0E 4BJNA 3KV4A 1UX4A 4CI3B 2X9WA 1D1AA 3GMIA 5TAOA 3AAAB 4IHJE 5M4YA 2XAFB 2I59A 3FBLA 1YKEB 2NW9A 4QXBB 3OBVE 4EXTA 5ADXL 4IE5A 3T8OA 4UVCB 2DNXA 2LOPA 4QKNA 2D0UA 3LJCA 3FBZA 4TUYE 3KBUA 3AB3B 4HKAA 4CXYA 3C64A 3F31A 4O2BE 5JH7E 3C98B 3RPUA 4B6XA 3E0ZA 3I1AA 1FMVA 2YU1A 2C5KT 3AA7B 3HKDE 3KV5A 4GYRA 4H9PC 5HWYA 5FY7A 2IW5B 5EK2A 5JDLA 2NP9A 4TZ4C 4EIWA 5JDHA 5F3JA 2M67A 5FXZA 4FI5A 1HG2A 4XBFB 2PFVA 1EZ3A 3KDSE 3N9LA 3K3NA 2PG8A 1QSDA 3Q2MA 4WBOA 4X1YE 4JUYA 4WNKA 4OK0A 2EHOB 4OHFA 2VK9A 3BQIA 4BA9A 4ZOLE 2VWAA 5FNVE 2W62A 3ZMSB 3SOLA 1MNDA 1D0YA 3KVAA 2LJLA 2CEAA 1NWMX 4I4TE 2YU2A 5LP6E 3WAKA 2XUEA 3AVSA 2WWUA 3O1IA 2UXXB 3UUXB 1BR4A 1KNZA 2IC6A 1D1CA 1ZKEA 3ZPOA 4IE6A 1WRDA 3V5UA 4GOUA 2QGSA 3AA1B 3K8PC 1HG5A 3RC3A 3LK3B 4UEMA 3CX7B 5HWXA 4CXWA 5LBMA 3OKQA 1YD8G 4QXCB 2JRKA 5FYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RKO A;  4HE8 A;  4HEA A;  5LNK A; 
#chains in the Genus database with same CATH topology
 4HE8 A;  4ISS A;  4U7I A;  4I50 E;  3VR8 A;  4AI6 A;  2BG9 A;  2W66 A;  4O4H E;  2CLY C;  2BBH A;  4QXH B;  4NIQ A;  3ZC1 A;  4UVA B;  4JLE A;  2DHR A;  3AE3 A;  4IDQ A;  5LJM A;  4O2A E;  3ZMU B;  4DR7 T;  5HXR A;  2BZB A;  5FMN A;  2E9X A;  2CPT A;  4YY3 T;  5AQK B;  5LG4 A;  1LKX A;  4ADZ A;  2K48 A;  4TWD A;  3KV9 A;  4MBQ A;  4CZZ B;  4EB6 E;  4JEU B;  2Q9Q B;  2V1D B;  3F2E A;  1Z0P A;  2JQ9 A;  1N32 T;  4U33 A;  5FL0 A;  2MBG A;  2A9U A;  2E5V A;  4IDP A;  1MMN A;  2D5U A;  2HHH T;  4QH5 A;  1NEK A;  2J1D G;  4DBR A;  3QUJ A;  3N2K E;  4PAG A;  3SFE A;  3HL6 A;  1N36 T;  1M62 A;  5FY1 A;  3VRB A;  3JAD A;  2CBJ A;  2HPL A;  4A56 A;  4I0U A;  2X9X A;  3UTK A;  3FHN A;  3K3O A;  4DMW A;  4TX5 A;  3CQC B;  4AKH A;  5JVD E;  4EGW A;  2V6Y A;  2CA5 A;  2RA1 A;  3LFM A;  4COF A;  3OVU A;  1U5P A;  2WCA A;  4BJM A;  3FZH B;  2DWG A;  2XZE A;  4HTE A;  2ACX A;  4Q25 A;  3PUA A;  3RYH E;  1MIY A;  1WYB A;  2CLY B;  4TNW A;  3UU5 A;  5J1G A;  4ZI7 E;  3P4R A;  5L3E B;  4YXD A;  2LSY A;  1XNQ T;  1YW0 A;  4A97 A;  4YTP A;  5H6Q B;  2I0M A;  3ZN1 B;  3IF8 B;  3AA0 B;  3MA9 A;  2Y6X A;  3RRC A;  3EHZ A;  2JMK A;  3RIA A;  4M1P A;  4P0A A;  2E5L T;  4JI8 T;  2PBI A;  2LE8 A;  3AAE B;  1B7T A;  3KVB A;  4KHP T;  5LHG B;  1OED B;  4MAL A;  3CKD A;  3IEE A;  4CI2 B;  1J1J A;  1XDO A;  1E1H B;  4Z8X A;  2VAS A;  3N9N A;  4L5G A;  3VU7 H;  3NZP A;  1R8I A;  3QB5 K;  3RF1 A;  2BBJ A;  3UU4 A;  3OJA A;  4ZXL A;  2VKJ A;  1BR1 A;  3RYF E;  3P4W A;  4EOZ B;  1JNR A;  2Y48 B;  3RRW A;  3J7Y q;  2Z6E A;  2IHR 1;  2XAS B;  3UUB A;  2W63 A;  5HAX A;  4G63 A;  4K0U A;  2K3W A;  4PNI A;  3L3P A;  2EHO D;  2ZLY A;  3C50 A;  4X62 T;  5LOV E;  2A72 A;  1FMW A;  4U72 A;  2EHO C;  2ZMA A;  3NVO A;  4YSZ A;  3PDY A;  4KX6 A;  3CK6 A;  3PE0 A;  5AQP B;  5HXE A;  4X5T A;  3EAM A;  4CQI A;  3TKL B;  1VOM A;  3SFD A;  4IL9 A;  5IUX A;  3C4W A;  3RX6 A;  3VRA A;  1W9R A;  2LSJ A;  3H37 A;  1HS7 A;  2BKP A;  5AQM B;  3ONJ A;  1XZY A;  4IDZ A;  3EVY A;  1BR2 A;  5JR9 C;  2HH7 A;  2UXD T;  4WBN E;  2CWO A;  1FJG T;  5L3D B;  5HCJ A;  1US7 B;  5A1L A;  3CPZ A;  3KFW X;  2X9Y A;  2LEH A;  4ZI3 D;  1WFD A;  3UFE A;  5F5W A;  2JQQ A;  2NOX A;  3AEC A;  1IBK T;  4ZI3 C;  2VKD A;  4AQY T;  4EZ4 A;  5ABH A;  4GKJ T;  4EZH A;  3T1Y T;  4I55 E;  3C4X A;  2WDV A;  3ZST A;  4J2C A;  5DJQ C;  4U2Z A;  3OPC A;  3ABV A;  3A7M A;  4IIJ E;  3MK7 C;  5HCM A;  5AQI B;  4CI3 B;  3GMI A;  4LF7 T;  2UXC T;  2I59 A;  2LRK A;  2LM2 A;  1YKE B;  5ADX L;  4IE5 A;  4HKA A;  2WB5 A;  4EV6 A;  3C98 B;  2KSR A;  1FMV A;  2YU1 A;  2C5K T;  3AA7 B;  2J4G A;  1XWM A;  1QLB A;  5ABF A;  3P4Q A;  5F3J A;  4FI5 A;  3KDS E;  3Q2M A;  4WBO A;  4X1Y E;  5LMU T;  2EHO B;  4OHF A;  2WU5 A;  2JQH A;  5AQJ B;  2XUE A;  1VCT A;  2FJE A;  3QNU A;  1ZKE A;  4DV0 T;  4IE6 A;  3AA1 B;  3K8P C;  5LBM A;  4QXC B;  1DU2 A;  1YQ3 A;  3SS1 A;  3BQL A;  1UUR A;  2NW7 A;  1S35 A;  4KUM B;  2BDE A;  2BS4 A;  2JJ9 A;  3ETU A;  3NBX X;  2V7M A;  4H9R C;  2H7O A;  2V7K A;  3CVR A;  2X68 A;  3N9P A;  3NRY A;  1MMD A;  1X79 A;  4PW8 A;  3TLU A;  2BVM A;  3B13 A;  2L8K A;  3ZMT B;  2XQ9 A;  2HN2 A;  4H9Q C;  5FXX A;  2D2S A;  3PUR A;  2L9Q A;  1MIW A;  2SPC A;  5JRC A;  2CBI A;  3N5L A;  4IE0 A;  4DR4 T;  2W61 A;  5KX5 E;  2Q9Q D;  4IT4 A;  4YLH A;  5AQN B;  5GON E;  4YHH T;  5H6R B;  2J47 A;  3AE8 A;  2Q9Q C;  3PJA J;  4JBW F;  1KFY A;  1G73 A;  1H7C A;  4LF4 T;  1GQE A;  2BVL A;  5CGM A;  4OYJ A;  2H3R A;  3FZL B;  2V7I A;  5L3B B;  3DJB A;  1J5W A;  2VKH A;  4JV5 T;  5DAB A;  2LKG A;  4ANJ A;  2BG9 E;  2YN6 A;  2CM0 A;  2BKO A;  3PTR B;  3U78 A;  5ABE A;  1SE7 A;  1KK7 A;  3H3M A;  2X66 A;  5AFU L;  3SRZ A;  5J2U E;  3RLF F;  4JEH B;  3EDU A;  5IYZ E;  4HWF A;  2YEV C;  4QHO A;  4IST A;  3LBX B;  3ZCI A;  5DQW A;  1N34 T;  4E7Z A;  2CHO A;  1WR6 A;  2PTF A;  4UVB B;  3CQG B;  4MHC A;  5LGT B;  3PU8 A;  2XSA A;  3Q5W A;  4HFI A;  2J62 A;  4IGU A;  4O4L E;  3N9Q A;  2D0T A;  3NKZ A;  4NXM T;  1JNZ A;  2OV9 A;  2IML A;  2XM1 A;  3CML A;  2UUC T;  1D1B A;  3ANW A;  4KP3 C;  3P50 A;  1T7S A;  3KIN B;  3E08 A;  4LMJ A;  2LHN A;  4ZZC A;  2CRB A;  4O8S A;  3P4S A;  1WR0 A;  3HI2 A;  4UV8 B;  2ACZ A;  2WBL A;  2WMN A;  3ZN0 B;  1KF6 A;  5HEJ A;  4KMC A;  2CXF A;  2V5C A;  1OED C;  4PJM A;  4ERR A;  2EHO A;  3PUW F;  3RHW A;  3AE7 A;  2BS3 A;  3O4X E;  2L3L A;  3D0T A;  4A5X A;  4WZX A;  4WW0 A;  3HA4 A;  4HFD A;  2D9D A;  4N78 D;  2XSB A;  2HN1 A;  4JI2 T;  1MIV A;  4KBM B;  4KI0 F;  4U3C A;  4XZC A;  3I0O A;  5JR9 A;  4C90 A;  3ZYL A;  5LHI B;  2DLR A;  4ASK A;  5JDM A;  4HFV A;  1MMA A;  2V7L A;  5FVL A;  2NWB A;  3CX6 B;  1UK5 A;  3N2G E;  3PUS A;  2QA7 A;  1W0B A;  5FXW A;  3K3Q C;  2KLQ A;  2R6G F;  4WYV A;  2M6I A;  4DR3 T;  3VKH A;  4LFA T;  5LYJ E;  3M3Z B;  5LJN A;  3VR9 A;  1IJ6 A;  1S94 A;  4UV9 B;  3EUH A;  5EZY E;  3TLT A;  2HPJ A;  4EYU A;  5CFB A;  4DND A;  5FP3 A;  1HNX T;  2ODU A;  2P9B A;  3C51 A;  1Z8U A;  4DMV A;  4PJN A;  3KV6 A;  3JAE A;  1UUS A;  2CHN A;  2OLT A;  5JRE A;  4AQG A;  4DR6 T;  3PUZ F;  4UXN B;  1KNP A;  5AQG B;  3TLW A;  4Z91 A;  3L39 A;  2A2F X;  5LXT E;  3KBT A;  1NAF A;  5L2L A;  1WCR A;  5ETW A;  3AVR A;  4AIS A;  1W09 A;  1HFA A;  1U4Q A;  5LGU B;  4ZI2 D;  4O4I E;  2YDQ A;  3AE2 A;  3TLS A;  2NTX A;  2VQF T;  3HKB E;  4ZI2 C;  2CXD A;  4U31 A;  1WLX A;  3UQ7 A;  3H3A A;  3O9X A;  2C5J A;  2IUB A;  2JMH A;  1Y64 B;  1UX4 A;  2X9W A;  5TAO A;  1XMO T;  2XAF B;  3FBL A;  3OBV E;  4UVC B;  2LOP A;  3FBZ A;  3F31 A;  5JH7 E;  4B6X A;  2WY2 A;  4HFC A;  4GYR A;  3EI0 A;  3RQU A;  5FY7 A;  2IW5 B;  5EK2 A;  2I6H A;  1XNR T;  2NP9 A;  1HG2 A;  4XBF B;  1EZ3 A;  3K3N A;  1QSD A;  3AXJ B;  2VK9 A;  2VWA A;  1D0Y A;  2LJL A;  2CEA A;  3AEF A;  4I4T E;  2WZH A;  3O1I A;  4ZEY A;  4GOU A;  4YSY A;  2B76 A;  1HG5 A;  4DR5 T;  3RGL A;  5FYM A;  5BMV E;  1J5E T;  3RIF A;  2Q9Q A;  5LG3 A;  4UF0 B;  4EAH A;  3IA3 A;  3CWZ B;  2K24 A;  4GK5 E;  4PFO A;  2MPK A;  1VRB A;  4DR1 T;  2X0H A;  4PK5 A;  4X1K E;  3UUN A;  5HXH A;  2V8S V;  1HX8 A;  4X66 T;  3MZK B;  2DCF A;  2BKN A;  4E7S A;  3PUG A;  1XDP A;  2C5I T;  2QVA A;  3IBP A;  1T98 A;  4HFH A;  1IBM T;  4XAX B;  4LFB T;  3UU8 A;  4PJJ A;  4NUV A;  3FZF B;  2YK0 A;  4QH4 A;  2WDQ A;  4ILC A;  2VKO A;  3MXZ A;  4YFS A;  4HFB A;  4YJ2 E;  3ZLI A;  2BG9 B;  5FY0 A;  2ZM0 A;  2CWY A;  5LMN T;  4X1I E;  4YSX A;  1MMG A;  5AQU B;  3P7I A;  3AAI A;  3N9M A;  3BQK A;  2W0G A;  4EEB A;  4HGA A;  3WAJ A;  3J9X 1;  1MNE A;  4TWH A;  3V5S A;  3LSV A;  5CA1 E;  4X20 E;  3JCF A;  4HWH A;  4DBQ A;  4CN1 A;  3VKG A;  4QWN B;  4ZS3 A;  5BR8 T;  3OYX A;  4HN9 A;  2NTY A;  3DTO A;  5L4H A;  2WDR A;  5AQF B;  3ZC0 A;  3L09 A;  5CB4 E;  2QYW A;  5FXV A;  3PUX F;  4HEA A;  5DQV A;  4MFR A;  2IC9 A;  5KXJ A;  1I6Z A;  4CN4 A;  1FIO A;  5JTG A;  3PUY F;  4OX9 T;  4CXX A;  2XJ7 A;  5L4E A;  3ZT7 A;  1OED A;  4UIG A;  2N2N A;  2YDS A;  5EK4 A;  2V7J A;  1ZEE A;  3C4Z A;  3OYZ A;  2RP4 A;  3ETV A;  2CMR A;  4PFP A;  5JQG E;  2LSK A;  1IJ5 A;  4H9S E;  2LT3 A;  4JI3 T;  3EAB A;  4DID B;  3ZMV B;  2V26 A;  5KDM C;  4GKK T;  3PUQ A;  3K1S A;  2KWH A;  3F57 A;  3ONL C;  2V6Y B;  4ILA A;  2H88 A;  1CUN A;  1BR0 A;  3PJA A;  2VB6 A;  2IAK A;  4IE4 A;  3RYC E;  2KND A;  3I0Q A;  3CQX C;  2VVN A;  4TNV A;  2PJQ A;  3AXJ A;  2M6B A;  2DWK A;  2RPA A;  2WSS V;  1HNZ T;  5AQH B;  1SA0 E;  4I43 B;  5JDF A;  1T72 A;  3W15 B;  5CA0 E;  2MOZ A;  2X0L B;  2WWV A;  4IL4 A;  5CJ5 A;  3TLV A;  3AA6 B;  1UCU A;  5AQO B;  4LF8 T;  2QRX A;  2IIU A;  2LSG A;  2YDR A;  4P09 A;  3L8R A;  2JPF A;  3IHR A;  4UF0 A;  1OXZ A;  3AED A;  2XAJ B;  4P1N A;  4YHJ A;  3ZJ2 A;  2CCQ A;  4F8H A;  4AXP A;  3RKO A;  4TV8 E;  3QC9 A;  2V6X A;  4EYY R;  2WMO A;  3UT5 E;  2N1G A;  2LSI A;  5JDN A;  4HFE A;  1NEN A;  4CI1 B;  3B57 A;  4O4J E;  1KEY A;  2WS3 A;  3HKC E;  5HEG A;  4AKI A;  3AE4 A;  2KZ7 B;  5F8P A;  2G0U A;  1AJ3 A;  2JQK A;  1E2A A;  1HCI A;  4X65 T;  1IZN B;  2C0S A;  3P8C D;  1HF8 A;  3NWI A;  3NRX A;  5LBQ B;  4EED A;  3ZMZ B;  1X9B A;  1WYC A;  3AE5 A;  4AQF C;  2IDO B;  4H63 H;  2VVS A;  4JI5 T;  3UUM A;  1W0A A;  4JI6 T;  5AQR B;  3ZT6 A;  4G2A A;  3U3I A;  5L47 A;  2XY8 B;  3P4P A;  5HEO A;  2FJD A;  4YJ3 E;  2A3D A;  1Y01 A;  2XTL A;  4H63 V;  2YIN A;  3RIU C;  4DUZ T;  3R6N A;  1YXR A;  5E0O A;  3JAF A;  4BJN A;  5M4Y A;  5AQS B;  2VUR A;  2NW9 A;  4EXT A;  2LRL A;  3T8O A;  3PV0 F;  3AB3 B;  4Z90 A;  3C64 A;  4O2B E;  3RPU A;  2XQ3 A;  3E0Z A;  5FL1 A;  3HKD E;  3KV5 A;  1IBL T;  4B3M T;  4H9P C;  4DV7 T;  4TZ4 C;  5JDH A;  4DV5 T;  2PFV A;  3UU6 A;  1L0V A;  3OTO T;  2PG8 A;  4JUY A;  4WNK A;  4BA9 A;  4ZOL E;  3UFG A;  5FNV E;  2W62 A;  3KVA A;  1NWM X;  2YU2 A;  1HX1 B;  3AE6 A;  4HWC A;  5LP6 E;  2WWU A;  5AQL B;  3UUX B;  4LF5 T;  1BR4 A;  1KNZ A;  1D1C A;  3V5U A;  4IDO A;  2QGS A;  2DL1 A;  3RI5 A;  4UEM A;  3CX7 B;  5HWX A;  4GK0 E;  4HWD A;  3ZKR A;  3AEA A;  3VHL A;  2XQ5 A;  3FB2 A;  3ONX A;  5C8Y E;  2Y8D A;  5FKY A;  5ABG A;  2CE7 A;  3RYI E;  5ABF B;  3WI3 A;  3I9W A;  2XQA A;  4ZZB A;  1FEW A;  3MAC A;  5HEU A;  4DV6 T;  3S4U A;  2ZM8 A;  3ESL A;  4ILU A;  2MYS A;  4X64 T;  3HKE E;  1D0Z A;  3R84 B;  4ZS2 A;  2LOS A;  5AQQ B;  5C3J A;  2XHE B;  3LBX A;  5L3C B;  3RH3 A;  5C2T A;  4YT0 A;  2FUP A;  2ZM2 A;  2BG9 C;  3QK6 A;  2KXP B;  4DV4 T;  3EDV A;  4V1A v;  4NUU A;  3M65 A;  3ZYK A;  5L3G B;  3QOF A;  2WM9 A;  4DR2 T;  4HWI B;  5AQV B;  3B5M A;  3N2O A;  4QX7 B;  3AEB A;  2E9X D;  1SHZ C;  3ZJ1 A;  5J2T E;  3UUL A;  2UU9 T;  3ZEF B;  2ODV A;  3FZK B;  2E9X C;  1LVK A;  1ZV4 X;  3I9Y A;  5JRC B;  4H9O C;  4DV2 T;  3MKD A;  3GN5 B;  4PK4 A;  1YQ4 A;  2FBW A;  4LFC T;  1HNW T;  3GA8 A;  4L0R A;  2LLY A;  5KMG P;  1D0X A;  4DUY T;  1LRZ A;  2LKH A;  4B3R T;  3GWH A;  4K0K T;  2B1E A;  4TWF A;  4BAY B;  4IRE A;  1YKH B;  4TN7 B;  3PU3 A;  1VCS A;  2KMF A;  2K9A A;  2XAG B;  4DVD A;  3LK4 2;  5LCY A;  3LDQ B;  2LM9 A;  2N9D A;  3O1J A;  3BK9 A;  3Q5X A;  2WU2 A;  2F4V T;  4NXN T;  2ES0 A;  4P0B A;  4AKL A;  3CIR A;  5L3F B;  1ZHC A;  2VL8 A;  1O3X A;  3DP7 A;  2XQ6 A;  2LHR A;  2WAU A;  4ILB A;  2H7V C;  4AKG A;  3LG7 A;  4DV1 T;  4YTN A;  5JDQ A;  5LB7 B;  3Q5D A;  3UU3 A;  4DO0 A;  5LNK A;  4GYS A;  3ZSS A;  3RC8 A;  1OED E;  3ZCJ A;  3AE1 A;  2VQE T;  3ANW B;  4LF6 T;  4DV3 T;  2W00 A;  5J0Z A;  3AEG A;  2X51 A;  4PJL A;  4LML A;  4KHZ F;  2WZI A;  4A98 A;  2KT9 A;  1OWA A;  3HR0 A;  4AQF A;  2WP9 A;  4JI1 T;  2E9X B;  1LVF A;  2DI4 A;  4L9I A;  4CN6 A;  2MTQ A;  1T8B A;  2W4X A;  2X67 A;  4F6R C;  2FJB A;  1UX5 A;  5EK3 A;  4AKR B;  2W2U A;  2XQY A;  3E22 E;  1V9D A;  5IHY A;  1KNR A;  2XAH B;  2K5B B;  5LHH B;  3SWH A;  2XPK A;  3MJX A;  3FZM B;  4U7Y A;  1SUM B;  3A5X A;  5JDG A;  4FJO A;  4U74 A;  5HEH A;  4TV9 E;  4YTM A;  2W67 A;  3PUV F;  2UUA T;  4JI4 T;  3RIU A;  3ZYM A;  2NW8 A;  2KWI B;  3UQ4 A;  2JIW A;  1G8X A;  5JR9 B;  1HTJ F;  4PK6 A;  3LK2 B;  5HXS A;  4LMK A;  2CXL A;  3NZQ A;  5HXC A;  1I94 T;  1N33 T;  2GK9 A;  2UXB T;  2NR4 A;  3Q5E A;  4IE7 A;  3FXD B;  1CHU A;  3FXE B;  2YKS A;  2XAQ B;  4H9N C;  3ZT5 A;  3A8Y C;  4OYK A;  3Q9D A;  1IAP A;  4C91 A;  1QUU A;  3CX8 B;  3N9O A;  4GIW A;  3O1H A;  2BS2 A;  2FJA A;  3JC6 D;  2KIN B;  2OA5 A;  1ZOY A;  1M7K A;  4IDN A;  3X1D A;  4QX8 B;  3JC6 C;  2XM2 A;  3AE9 A;  5LGN B;  2XQ8 A;  2ZM6 T;  4MLK A;  4JI0 T;  2X9H A;  4UEL A;  1E7P A;  2UXN B;  3GN5 A;  5HYA A;  5LA6 E;  4ZHQ E;  2XQ4 A;  4OFZ A;  4UR9 A;  3KV4 A;  2X0Y A;  2VL0 A;  1D1A A;  3T1H T;  3AAA B;  4IHJ E;  4NPP A;  4QXB B;  3QB5 A;  2JRK A;  2DNX A;  4QKN A;  2D0U A;  2H89 A;  3LJC A;  1XMQ T;  4QH1 A;  4TUY E;  3KBU A;  2E2A A;  4CXY A;  1HR0 T;  5IWA T;  3AEE A;  3I1A A;  5FVK A;  2WQY A;  4AIU A;  5HWY A;  5JDL A;  2UUB T;  4EIW A;  2M67 A;  5FXZ A;  4JYA T;  2XQ7 A;  4B3T T;  4JI7 T;  3N9L A;  1UGO A;  4B3S T;  4OK0 A;  3BQI A;  1ZP0 A;  2V5D A;  3ZMS B;  3SOL A;  1MND A;  3RKG A;  3WAK A;  3AVS A;  2AXD S;  2UXX B;  2YOE A;  2MAW A;  2AE9 A;  2IC6 A;  3ZPO A;  4LF9 T;  1WRD A;  4U2Y A;  3RC3 A;  3LK3 B;  3G06 A;  4CXW A;  3RQW A;  3OKQ A;  1YD8 G;  2E8I A;  5AQT B; 
#chains in the Genus database with same CATH homology
 4HE8 A;  3SS1 A;  4ISS A;  3BQL A;  5BMV E;  4I50 E;  2NW7 A;  1S35 A;  2Q9Q A;  4AI6 A;  4UF0 B;  4KUM B;  4O4H E;  3VHL A;  2BDE A;  3FB2 A;  3ONX A;  4EAH A;  2JJ9 A;  3ETU A;  5C8Y E;  3NBX X;  2V7M A;  2K24 A;  3CWZ B;  4GK5 E;  2CLY C;  2Y8D A;  4H9R C;  4PFO A;  4QXH B;  2CE7 A;  3RYI E;  2H7O A;  3WI3 A;  3I9W A;  3ZC1 A;  2V7K A;  1VRB A;  4UVA B;  1FEW A;  3CVR A;  2X68 A;  3MAC A;  3N9P A;  2DHR A;  1MMD A;  3NRY A;  4JLE A;  1X79 A;  4PW8 A;  4PK5 A;  2BVM A;  5LJM A;  4O2A E;  3S4U A;  3ZMU B;  3B13 A;  2L8K A;  4X1K E;  5HXR A;  3UUN A;  2ZM8 A;  3ESL A;  4ILU A;  3ZMT B;  5HXH A;  1HX8 A;  2MYS A;  3MZK B;  4H9Q C;  2BZB A;  5FMN A;  5FXX A;  2D2S A;  2DCF A;  3HKE E;  2E9X A;  4E7S A;  3PUR A;  1D0Z A;  2L9Q A;  3PUG A;  3R84 B;  1MIW A;  4ZS2 A;  2C5I T;  3IBP A;  2E8I A;  5LG4 A;  2SPC A;  1T98 A;  2LOS A;  5JRC A;  4XAX B;  3N5L A;  4IE0 A;  2XHE B;  1LKX A;  4PJJ A;  4NUV A;  4ADZ A;  2W61 A;  2K48 A;  3LBX A;  5KX5 E;  5L3C B;  2YK0 A;  3KV9 A;  4MBQ A;  3RH3 A;  2Q9Q D;  4CZZ B;  4YLH A;  4EB6 E;  2VKO A;  3MXZ A;  5GON E;  4JEU B;  4YFS A;  2Q9Q B;  2V1D B;  2ZM2 A;  1Z0P A;  3F2E A;  5H6R B;  3ZLI A;  4YJ2 E;  2Q9Q C;  5FY0 A;  2ZM0 A;  2CWY A;  1G73 A;  2MBG A;  3QK6 A;  1H7C A;  2KXP B;  2BVL A;  4X1I E;  1MMG A;  4OYJ A;  3P7I A;  1MMN A;  3EDV A;  2D5U A;  2H3R A;  4V1A v;  3AAI A;  4NUU A;  2V7I A;  3N9M A;  5L3B B;  3DJB A;  3M65 A;  3ZYK A;  3BQK A;  2W0G A;  2VKH A;  4HGA A;  3WAJ A;  5L3G B;  5DAB A;  3J9X 1;  1MNE A;  2J1D G;  3V5S A;  5CA1 E;  4X20 E;  4DBR A;  2WM9 A;  4ANJ A;  4DBQ A;  3QUJ A;  3N2K E;  4PAG A;  3HL6 A;  3N2O A;  2CM0 A;  4QX7 B;  3PTR B;  3U78 A;  3VKG A;  4QWN B;  4ZS3 A;  2E9X D;  5FY1 A;  3OYX A;  1SHZ C;  3ZJ1 A;  1KK7 A;  5J2T E;  3UUL A;  4HN9 A;  2HPL A;  2NTY A;  4A56 A;  3DTO A;  3ZEF B;  2ODV A;  2X66 A;  5AFU L;  3SRZ A;  2E9X C;  5J2U E;  1LVK A;  3ZC0 A;  1ZV4 X;  3I9Y A;  3L09 A;  4JEH B;  3EDU A;  5IYZ E;  5CB4 E;  2X9X A;  3UTK A;  5JRC B;  5FXV A;  4HEA A;  3FHN A;  2YEV C;  4H9O C;  5DQV A;  3K3O A;  4QHO A;  4DMW A;  3MKD A;  3GN5 B;  4TX5 A;  4IST A;  3CQC B;  4AKH A;  5JVD E;  4PK4 A;  3LBX B;  4MFR A;  2IC9 A;  3GA8 A;  4L0R A;  3ZCI A;  5KMG P;  5DQW A;  1FIO A;  2CA5 A;  1D0X A;  4E7Z A;  4CXX A;  1LRZ A;  2RA1 A;  1WR6 A;  3LFM A;  1U5P A;  4BJM A;  3GWH A;  4UIG A;  2B1E A;  2N2N A;  4UVB B;  3CQG B;  5EK4 A;  2DWG A;  4MHC A;  4HTE A;  2ACX A;  5LGT B;  2V7J A;  1ZEE A;  3PU8 A;  3C4Z A;  3PUA A;  3OYZ A;  3RYH E;  2RP4 A;  4BAY B;  1MIY A;  3ETV A;  2CMR A;  3Q5W A;  4PFP A;  4IGU A;  1WYB A;  2CLY B;  1IJ5 A;  2LSK A;  1YKH B;  3N9Q A;  4O4L E;  5JQG E;  4TN7 B;  3PU3 A;  4H9S E;  5J1G A;  2D0T A;  2LT3 A;  2KMF A;  2K9A A;  2XAG B;  4DVD A;  3CML A;  4ZI7 E;  3LK4 2;  5LCY A;  1D1B A;  3ANW A;  5L3E B;  4KP3 C;  2LSY A;  2LM9 A;  1YW0 A;  3ZMV B;  2V26 A;  5KDM C;  2N9D A;  3O1J A;  5H6Q B;  3KIN B;  3BK9 A;  3E08 A;  3PUQ A;  3Q5X A;  3ZN1 B;  2KWH A;  2LHN A;  3IF8 B;  3AA0 B;  3MA9 A;  2Y6X A;  4O8S A;  3F57 A;  3RRC A;  2ES0 A;  4P0B A;  1CUN A;  2JMK A;  4AKL A;  3HI2 A;  1BR0 A;  4M1P A;  5L3F B;  2VB6 A;  1ZHC A;  4UV8 B;  4P0A A;  2IAK A;  2VL8 A;  1O3X A;  2PBI A;  4IE4 A;  2WBL A;  3DP7 A;  3RYC E;  2KND A;  2WMN A;  2LE8 A;  3AAE B;  3I0Q A;  3ZN0 B;  3CQX C;  2LHR A;  1B7T A;  3KVB A;  5LHG B;  2PJQ A;  2WAU A;  4KMC A;  2CXF A;  4MAL A;  2H7V C;  3CKD A;  3IEE A;  4PJM A;  2DWK A;  4CI2 B;  4ERR A;  2EHO A;  4AKG A;  3LG7 A;  2WSS V;  5JDQ A;  1SA0 E;  1E1H B;  4Z8X A;  4I43 B;  5JDF A;  2VAS A;  3N9N A;  4DO0 A;  4L5G A;  3O4X E;  3VU7 H;  3W15 B;  3NZP A;  5LNK A;  5CA0 E;  2L3L A;  3D0T A;  2MOZ A;  4GYS A;  2X0L B;  3HA4 A;  4WW0 A;  3RC8 A;  3OJA A;  4N78 D;  3ZCJ A;  2VKJ A;  1BR1 A;  3ANW B;  3RYF E;  1MIV A;  4EOZ B;  2W00 A;  4KBM B;  2Y48 B;  3AA6 B;  1UCU A;  2X51 A;  4PJL A;  3RRW A;  2LSG A;  3J7Y q;  4P09 A;  4XZC A;  3I0O A;  2JPF A;  5JR9 A;  2Z6E A;  2KT9 A;  3IHR A;  1OWA A;  3HR0 A;  4AQF A;  4UF0 A;  1OXZ A;  4C90 A;  3ZYL A;  2E9X B;  2XAJ B;  5LHI B;  2DLR A;  4YHJ A;  4ASK A;  5JDM A;  3ZJ2 A;  4HFV A;  2XAS B;  2CCQ A;  1MMA A;  2V7L A;  1LVF A;  2NWB A;  2W63 A;  3CX6 B;  4AXP A;  5HAX A;  2DI4 A;  4L9I A;  3RKO A;  2MTQ A;  2X67 A;  4G63 A;  4TV8 E;  4F6R C;  3QC9 A;  3N2G E;  4EYY R;  2WMO A;  4K0U A;  3UT5 E;  3PUS A;  2QA7 A;  1UX5 A;  5EK3 A;  4AKR B;  2XQY A;  3E22 E;  4PNI A;  5FXW A;  3L3P A;  2N1G A;  1V9D A;  2EHO D;  2ZLY A;  2LSI A;  5IHY A;  3C50 A;  5JDN A;  3K3Q C;  2A72 A;  2XAH B;  5LOV E;  2K5B B;  2KLQ A;  1FMW A;  5LHH B;  4U72 A;  4CI1 B;  3SWH A;  3MJX A;  2EHO C;  2ZMA A;  3B57 A;  3VKH A;  4O4J E;  3A5X A;  3PDY A;  5JDG A;  3HKC E;  4FJO A;  4U74 A;  5LYJ E;  3PE0 A;  5HXE A;  5LJN A;  1IJ6 A;  1S94 A;  4TV9 E;  4UV9 B;  4CQI A;  4AKI A;  3TKL B;  1VOM A;  3EUH A;  2KZ7 B;  5F8P A;  2G0U A;  1AJ3 A;  5EZY E;  3C4W A;  3RX6 A;  1HCI A;  2HPJ A;  1IZN B;  4EYU A;  4DND A;  5FP3 A;  2C0S A;  2LSJ A;  3H37 A;  2ODU A;  2P9B A;  3P8C D;  3C51 A;  1HS7 A;  3ZYM A;  2NW8 A;  2KWI B;  1HF8 A;  3NRX A;  4IDZ A;  5LBQ B;  1G8X A;  3EVY A;  4DMV A;  3ZMZ B;  4PJN A;  3KV6 A;  5JR9 B;  1BR2 A;  1HTJ F;  1WYC A;  4PK6 A;  3LK2 B;  5JR9 C;  2HH7 A;  5HXS A;  4AQF C;  2CXL A;  5JRE A;  4AQG A;  4WBN E;  4H63 H;  3NZQ A;  4UXN B;  5HXC A;  2CWO A;  5L3D B;  2GK9 A;  1US7 B;  3UUM A;  5A1L A;  3CPZ A;  3KFW X;  2X9Y A;  4IE7 A;  3FXD B;  2A2F X;  2LEH A;  5LXT E;  3FXE B;  4ZI3 D;  2XAQ B;  3KBT A;  4G2A A;  1NAF A;  4H9N C;  3UFE A;  5L2L A;  3U3I A;  5ETW A;  3AVR A;  2JQQ A;  3Q9D A;  1IAP A;  1QUU A;  2NOX A;  3CX8 B;  3N9O A;  4GIW A;  4OYK A;  4C91 A;  4ZI3 C;  3O1H A;  2VKD A;  4YJ3 E;  1HFA A;  3JC6 D;  2KIN B;  1U4Q A;  4EZ4 A;  2OA5 A;  5LGU B;  4ZI2 D;  2A3D A;  4O4I E;  2NTX A;  3JC6 C;  4QX8 B;  5LGN B;  4MLK A;  3HKB E;  4ZI2 C;  2XTL A;  4EZH A;  2X9H A;  4H63 V;  4UEL A;  4I55 E;  2CXD A;  3C4X A;  2YIN A;  4J2C A;  5DJQ C;  1WLX A;  2UXN B;  3GN5 A;  5HYA A;  3R6N A;  3H3A A;  3O9X A;  4IIJ E;  2C5J A;  5LA6 E;  2JMH A;  5E0O A;  4ZHQ E;  3MK7 C;  4OFZ A;  1Y64 B;  4GK0 E;  4BJN A;  3KV4 A;  1UX4 A;  4CI3 B;  2X9W A;  1D1A A;  3GMI A;  5TAO A;  3AAA B;  4IHJ E;  5M4Y A;  2XAF B;  2I59 A;  3FBL A;  1YKE B;  2NW9 A;  4QXB B;  3OBV E;  4EXT A;  5ADX L;  4IE5 A;  3T8O A;  4UVC B;  2DNX A;  2LOP A;  4QKN A;  2D0U A;  3LJC A;  3FBZ A;  4TUY E;  3KBU A;  3AB3 B;  4HKA A;  4CXY A;  3C64 A;  3F31 A;  4O2B E;  5JH7 E;  3C98 B;  3RPU A;  4B6X A;  3E0Z A;  3I1A A;  1FMV A;  2YU1 A;  2C5K T;  3AA7 B;  3HKD E;  3KV5 A;  4GYR A;  4H9P C;  5HWY A;  5FY7 A;  2IW5 B;  5EK2 A;  5JDL A;  2NP9 A;  4TZ4 C;  4EIW A;  5JDH A;  5F3J A;  2M67 A;  5FXZ A;  4FI5 A;  1HG2 A;  4XBF B;  2PFV A;  1EZ3 A;  3KDS E;  3N9L A;  3K3N A;  2PG8 A;  1QSD A;  3Q2M A;  4WBO A;  4X1Y E;  4JUY A;  4WNK A;  4OK0 A;  2EHO B;  4OHF A;  2VK9 A;  3BQI A;  4BA9 A;  4ZOL E;  2VWA A;  5FNV E;  2W62 A;  3ZMS B;  3SOL A;  1MND A;  1D0Y A;  3KVA A;  2LJL A;  2CEA A;  1NWM X;  4I4T E;  2YU2 A;  5LP6 E;  3WAK A;  2XUE A;  3AVS A;  2WWU A;  3O1I A;  2UXX B;  3UUX B;  1BR4 A;  1KNZ A;  2IC6 A;  1D1C A;  1ZKE A;  3ZPO A;  4IE6 A;  1WRD A;  3V5U A;  4GOU A;  2QGS A;  3AA1 B;  3K8P C;  1HG5 A;  3RC3 A;  3LK3 B;  4UEM A;  3CX7 B;  5HWX A;  4CXW A;  5LBM A;  3OKQ A;  1YD8 G;  4QXC B;  2JRK A;  5FYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...