4LF9T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4lf9T00
4B3MT 1N33T 4DV6T 4DR6T 1XNQT 4LFCT 4GKKT 4X62T 2E5LT 1HNWT 4LF4T 4DV1T 4LF9T 4GKJT 4DV0T 4DR4T 4JI5T 5IWAT 2VQET 4AQYT 1N32T 1IBKT 4JI8T 4NXNT 2F4VT 1IBLT 4JI6T 4DV5T 4JI2T 4JI0T 4DR3T 4LF7T 4JI3T 5LMUT 4DV7T 1I94T 4B3ST 1HNXT 4JI1T 1FJGT 4B3RT 4DV2T 4LF6T 5BR8T 1XMQT 2UXCT 4OX9T 4JV5T 4LF5T 1HNZT 4JYAT 2UUCT 4LFAT 4LFBT 4DUZT 4K0KT 4X66T 2UXDT 2ZM6T 4DR7T 3T1YT 1N36T 4YY3T 3T1HT 4YHHT 2UUAT 1IBMT 1XNRT 1J5ET 4DR5T 2VQFT 4JI4T 4X64T 4KHPT 3OTOT 4DV4T 4DR2T 4JI7T 2UUBT 1HR0T 4LF8T 2UXBT 1XMOT 2UU9T 4DR1T 4DV3T 4DUYT 5LMNT 4NXMT 1N34T 2HHHT 4X65T 4B3TT
chains in the Genus database with same CATH superfamily
3TKLB 3HKCE 5CJ5A 5LG4A 2EHOD 2ODVA 5FY7A 2LSGA 5FXWA 3C51A 3KBUA 2NW8A 3N9LA 4CN1A 1CHUA 5C8YE 1D0ZA 4LFCT 3ONLC 2XAFB 3ZEFB 4ZI3D 4P0AA 3B13A 3G06A 2YU1A 3QB5A 3MXZA 5ETWA 4OYKA 4HWHA 5JR9A 1Y64B 3FB2A 3N9PA 3RI5A 3RYCE 4JUYA 1QUUA 2K24A 2E9XD 2IAKA 2W2UA 2WU5A 3KVAA 4YJ3E 4GKJT 2KMFA 2ZMAA 4IE0A 2HPLA 5IHYA 4DV0T 1UK5A 4ILUA 3GA8A 3PV0F 1EZ3A 2DCFA 2H7VC 3AB3B 2RP4A 3E22E 4MALA 4QHOA 2EHOA 4A98A 2CHNA 4UF0A 4AQFC 5IWAT 3H3AA 1VCTA 3CWZB 5HEUA 4BJNA 4ADZA 3V5UA 2LHRA 4U2ZA 5GONE 2E8IA 4DV5T 4JI2T 1Y01A 2LKHA 3LBXA 2IIUA 4L0RA 4O8SA 5AQPB 3ZCIA 4BAYB 4YSZA 1WLXA 4IIJE 5JREA 2MBGA 4LF7T 4I55E 1YQ3A 4EYUA 3ZSTA 1M7KA 4EEDA 2CWOA 5L3EB 3ZJ1A 5LMUT 3NRYA 3PJAA 3RF1A 4YJ2E 1HF8A 4TN7B 1J1JA 2WZHA 5JR9C 2XM1A 4EIWA 4B3ST 2XSAA 4IDZA 1T98A 3I0OA 2N9DA 4EOZB 3K3OA 5J2TE 3J9X1 2XSBA 1S35A 4YTNA 1BR0A 2BBJA 2V7LA 4H9QC 4EAHA 3CPZA 4IGUA 4AXPA 1QLBA 5AQKB 2UXCT 2XASB 2HN2A 4KMCA 2CWYA 4DO0A 1UGOA 3ZMTB 5HWYA 4PK6A 1HNZT 2UUCT 4JLEA 2P9BA 4LFAT 4QX7B 2FJDA 1Z0PA 4ISTA 1WFDA 3ETUA 4A97A 3OYZA 3SFDA 1V9DA 4GK0E 4EB6E 2JPFA 4PAGA 2UXXB 3QC9A 1YKHB 3RH3A 4DR7T 2WZIA 4TV9E 5HCMA 3B5MA 2K48A 3FHNA 4ZXLA 4AQGA 2LHNA 2LM9A 3DJBA 2Y8DA 4QXCB 2W66A 3EDUA 3RGLA 5HXSA 3H3MA 3RIUC 4YHHT 1D1AA 2C0SA 2OLTA 1D0XA 2XAHB 4G63A 3FZFB 4TUYE 2H3RA 1D1CA 3PDYA 3ZN0B 4F8HA 4ZI2D 4UXNB 5HXHA 2YKSA 3MACA 3KINB 2MPKA 2KSRA 4DR5T 3ZT5A 3AE7A 4AISA 4H9RC 2UUAT 4QXHB 3UU8A 4B6XA 3ANWB 3BK9A 3KVBA 3EHZA 3AAEB 4HFHA 4X1KE 2WDVA 4HWFA 4ZI2C 2IUBA 5LG3A 2DWGA 2VQFT 4JI4T 1WR6A 2V26A 3FBZA 2J1DG 3UU5A 2BG9E 4X1YE 4ZZCA 1WRDA 5JDMA 5JDGA 1KNZA 3LK3B 2W61A 2CM0A 4ISSA 2N1GA 4NPPA 1YKEB 2JQ9A 5AQMB 4DV4T 4QH1A 5FL1A 2WM9A 2BG9C 3N9NA 2X9WA 5L3DB 3TLVA 5L4EA 5LGNB 3NBXX 4JEUB 5LNKA 2CA5A 4IE6A 4O4LE 1HCIA 1FMWA 2MYSA 1G8XA 4HFDA 1ZKEA 1MNEA 3CQCB 3M3ZB 1JNRA 4LF8T 4UR9A 3UTKA 2BVLA 2XUEA 3ZYMA 2CE7A 3C98B 3I9WA 4QX8B 5DABA 3RIFA 2L3LA 2Y6XA 2BZBA 3RQUA 4DR1T 3N5LA 3PU3A 3R6NA 2JQKA 3IHRA 4DV3T 3AA6B 3P50A 2X67A 2ZM0A 1LVKA 3C64A 3IEEA 3J7Yq 1N34T 4NXMT 5H6RB 4X65T 1WR0A 3N2OA 3A5XA 4B3TT 4K0UA 1ZP0A 4KBMB 2W62A 3AAIA 2YEVC 2YN6A 3PUWF 3MZKB 4IL4A 4N78D 5EK3A 5F5WA 1E2AA 3I9YA 5FXZA 3ZMUB 2RPAA 1US7B 2L8KA 1W09A 4PJNA 2DNXA 3P8CD 4A56A 2WB5A 4AQFA 5C2TA 4HFVA 2C5KT 4CXYA 4ZS2A 4HEAA 2BG9A 2Z6EA 4H9PC 3P7IA 1YW0A 3AEEA 3AE6A 4HWCA 4OHFA 4DNDA 1CUNA 2PBIA 4LF4T 4KX6A 1LRZA 3A7MA 3PUXF 4MLKA 2CCQA 2CBJA 2LM2A 4IE7A 4DV1T 2Q9QD 5FP3A 2DI4A 3HKDE 4HWDA 5FVLA 3V5SA 5HWXA 5JDNA 1B7TA 2D9DA 2WS3A 3RHWA 3CQGB 2AE9A 1MMDA 5JH7E 3GN5A 4GYSA 3QK6A 2G0UA 1UCUA 2VQET 2ZLYA 3ZN1B 2X0YA 3UU4A 4NXNT 3SWHA 1QSDA 3QNUA 1HG5A 3ZMZB 2NTXA 2F4VT 5LBMA 3RRCA 2KNDA 2VURA 4KUMB 3RKOA 3RX6A 1HX8A 2YDQA 3ZYLA 4EYYR 1U5PA 3AEBA 1DU2A 2I0MA 5J1GA 5AQJB 4UV8B 2LE8A 3VKHA 2VWAA 2VKOA 4NIQA 3IA3A 5JR9B 5FY1A 1UX4A 4HFIA 1BR1A 2NWBA 4TWDA 3E0ZA 4V1Av 2JIWA 2XQAA 3AA7B 5L4HA 3ZPOA 4AIUA 3EUHA 4YSXA 1HS7A 2ACXA 4ZEYA 2XQ6A 3RRWA 1VRBA 3EI0A 3JADA 5A1LA 2WBLA 3AA0B 2JMKA 3AVSA 3JCFA 3NKZA 2QA7A 2CXFA 3AE4A 2BS4A 3EDVA 4IE5A 2IC6A 4I43B 2LLYA 3LJCA 5JRCA 2WCAA 3ABVA 1D1BA 1WYCA 4P1NA 4LF6T 1XWMA 2BS2A 3LFMA 4OYJA 4FJOA 3ZMSB 1XMQT 3WAKA 3U3IA 2LKGA 4UVCB 5J2UE 1N33T 3TLTA 5HCJA 4HFCA 2QRXA 5LYJE 4IDPA 1SE7A 5F3JA 2KWHA 2X9HA 4XAXB 5ADXL 2NTYA 2VL8A 1YQ4A 2M6BA 2CXDA 2VVNA 3VR9A 4DUZT 2NR4A 3IF8B 3Q5XA 2BS3A 2UXDT 2XTLA 2J47A 4TX5A 5JDFA 4EV6A 1XNQT 4HKAA 2ZM8A 2A2FX 3CQXC 3T1YT 3OPCA 1OEDC 2H88A 3AE8A 4XZCA 3RC8A 3UUNA 1NWMX 1R8IA 2WDQA 2WAUA 2X66A 2FJAA 5FY0A 3SOLA 3TLUA 5CA1E 3T1HT 1IBMT 5FMNA 1XNRT 2ZM2A 2V6XA 4PJLA 2V1DB 3VHLA 2LOSA 2QGSA 3C4ZA 2WP9A 4WZXA 2X9XA 4H63H 4PW8A 5HYAA 4DIDB 2BKNA 1T7SA 2JMHA 5AQHB 3JC6D 3ZT6A 2W63A 4YTMA 2IHR1 3Q9DA 2X9YA 1MIYA 2JQQA 2VKHA 2R6GF 1KF6A 4X20E 3NZQA 5FVKA 5C3JA 1W0AA 3CX8B 4HGAA 2V6YA 4CI1B 5H6QB 2VL0A 2HN1A 2UXNB 3AVRA 1UUSA 2UUBT 1OEDA 3PTRB 3AAAB 3L8RA 4UF0B 5LOVE 4GKKT 3ZSSA 2CMRA 2HPJA 2GK9A 5KDMC 4ZI3C 2NW9A 5L2LA 3DP7A 1XMOT 1IJ6A 4GK5E 3N9OA 3ESLA 5AQQB 2IDOB 5L3FB 5M4YA 4CXXA 5FL0A 4ZI7E 4NUUA 4U2YA 4UELA 5L3CB 2W4XA 3RC3A 1WYBA 1YD8G 3QOFA 4U72A 4EZ4A 2KT9A 2A3DA 3KV5A 4Q25A 2Q9QC 2NOXA 4EXTA 4QKNA 1XDOA 2FBWA 3FZKB 4G2AA 2YK0A 3CX6B 4I4TE 4IT4A 2J62A 4KP3C 3SS1A 3F57A 1KFYA 1SUMB 5CGMA 4U31A 3P4SA 4DR6T 4UV9B 4AKHA 5CFBA 2B76A 1OEDB 4CI2B 5JTGA 4DMVA 2VKJA 2CLYB 2BKOA 2XHEB 3ETVA 3LBXB 3ONJA 4DVDA 3UUXB 5ABHA 5L47A 4X62T 2E5LT 1HNWT 4EZHA 4LMKA 3M65A 3DTOA 4GOUA 2V6YB 3P4PA 4Z8XA 5EK4A 3N2GE 1OEDE 2CEAA 1MNDA 2WU2A 2WQYA 3O1JA 4O4HE 1YXRA 4TWHA 4ASKA 4DR4T 3FZMB 5HXCA 1KK7A 2VKDA 3UFEA 5KXJA 3K3QC 4ZOLE 1W0BA 4NUVA 2LSJA 2D2SA 2N2NA 2V7JA 3OBVE 2E5VA 2IC9A 3Q2MA 3L39A 2ES0A 3NRXA 4OFZA 3AE1A 3ZMVB 4JI6T 4HWIB 3LK42 1UURA 4KI0F 4P09A 4UVBB 1UX5A 3SRZA 4H9SE 5JQGE 1MMNA 4YFSA 2AXDS 2VASA 4GIWA 3ZT7A 2X68A 4DR3T 4JI3T 2FJEA 1MMAA 4PK4A 3PUGA 2WWVA 3S4UA 1KEYA 4HFBA 4IDOA 4FI5A 4YLHA 3RIAA 1HG2A 4CQIA 5FXXA 1T8BA 3CK6A 1M62A 2V8SV 2CRBA 3BQKA 4L5GA 3UU3A 4PJMA 2QVAA 2NW7A 4ILBA 5DJQC 4AI6A 3VRBA 1NAFA 3HI2A 4IDNA 1E7PA 4HE8A 3F31A 1SHZC 1H7CA 3UUMA 2CXLA 5FKYA 2XZEA 2V5DA 4A5XA 4WBNE 5HXEA 4WNKA 1FJGT 3ZLIA 3AE9A 5DQWA 4DMWA 2QYWA 3GWHA 4COFA 2XQ4A 3A8YC 3P4WA 1IAPA 5AQVB 2LRLA 4JV5T 3AXJB 4UVAB 2Y48B 1ZHCA 4CN6A 5IUXA 3WAJA 2BVMA 3VKGA 3NWIA 2VVSA 2FUPA 1NENA 2LSYA 3AEAA 2H7OA 3I0QA 2V7KA 1BR2A 3N2KE 4I0UA 4MBQA 3RQWA 3UULA 3UU6A 1Z8UA 4K0KT 3OKQA 5CB4E 2ZM6T 2XPKA 5LHGB 4OK0A 3K3NA 2WSSV 3O1HA 4AKLA 3ONXA 4PK5A 2IMLA 5HAXA 4YY3T 5FNVE 3SFEA 3ZKRA 1ZEEA 3L3PA 1AJ3A 2PG8A 1HFAA 5LGUB 2M6IA 2DWKA 1SA0E 1ZOYA 3PUZF 3Q5WA 2JQHA 3N9MA 1LKXA 4U7YA 1JNZA 2K9AA 3ZCJA 4H63V 4ANJA 5LXTE 1J5ET 5LBQB 2E9XC 2XQ8A 4UIGA 1X79A 4AKRB 5DQVA 1HNXT 4O2AE 3TLSA 4HN9A 1FIOA 3LG7A 3PUYF 4L9IA 1OWAA 2A72A 3PE0A 5L3BB 5LP6E 1HX1B 3BQLA 4C91A 4PFOA 2H89A 2LT3A 2I6HA 4I50E 4KHPT 4QH5A 4WYVA 5HEHA 2LRKA 1HTJF 1U4QA 3T8OA 4YHJA 1IZNB 3IBPA 3C4WA 1HR0T 4M1PA 3LSVA 5L3GB 2B1EA 2BG9B 2J4GA 2LSKA 3FZHB 5JVDE 5LHHB 1GQEA 2XAGB 1MIWA 2D0UA 4IE4A 3MK7C 2XY8B 2W0GA 3KV6A 4TV8E 2UU9T 4ERRA 2KLQA 3UFGA 3RYIE 4ZZBA 1T72A 3AA1B 3MKDA 3OVUA 4DUYT 1D0YA 4DBRA 5ABFA 3GMIA 4MHCA 3WI3A 4KHZF 2E9XB 5E0OA 4BA9A 4B3MT 2LSIA 1KNRA 4YT0A 4X1IE 3BQIA 2BDEA 2PJQA 4PFPA 3HKEE 3P4QA 2XQYA 1LVFA 3LK2B 3ZJ2A 4AKIA 1ZV4X 3NZPA 3D0TA 4O2BE 1MIVA 5F8PA 4YSYA 5HEJA 1FMVA 5LB7B 3JAFA 2W67A 3K1SA 4TZ4C 4X64T 3EABA 3AEFA 5IYZE 1W9RA 1XZYA 4U7IA 4MFRA 4LMLA 5HEOA 4C90A 3KV4A 2KWIB 2D5UA 2X0HA 3OJAA 3PUQA 5AQIB 1L0VA 5KX5E 2XJ7A 3NVOA 5LHIB 4CXWA 1OXZA 3O9XA 4ILCA 4LF9T 2JJ9A 2XQ5A 5LJNA 3CX7B 4PJJA 2I59A 3ANWA 2DLRA 2HH7A 3JC6C 3N9QA 4H9OC 4E7SA 3MJXA 5KMGP 3K8PC 4AQYT 2XM2A 1IBKT 3UQ7A 3E08A 2IW5B 2BKPA 3TLWA 1N32T 5HEGA 4E7ZA 4XBFB 4O4JE 1IBLT 5AQOB 5J0ZA 2XQ3A 2WWUA 4J2CA 4JI0T 1X9BA 2XQ9A 2DHRA 3ZC1A 5AQSB 3AE5A 5ABGA 1VCSA 4IDQA 4O4IE 2Q9QA 3AE3A 4HFEA 2FJBA 3AEGA 2W00A 2MTQA 3FXEB 2M67A 3RLFF 5JDHA 4TNWA 4DV7T 1I94T 5CA0E 3PUAA 5LA6E 3I1AA 2YINA 3PUSA 3PURA 4IL9A 4ZS3A 3RKGA 5JRCB 5EZYE 4JI1T 2YOEA 4H9NC 4B3RT 1KNPA 4JI8T 5LGTB 4DV2T 3EAMA 5BR8T 5ABFB 3ZYKA 1BR4A 2DL1A 2KZ7B 4YXDA 4QH4A 3HA4A 2XAJB 3KFWX 4JEHB 3C4XA 2KXPB 3ZC0A 4TNVA 5HXRA 3RIUA 3RPUA 4YTPA 4OX9T 5FYMA 2RA1A 3FXDB 3PUVF 2X51A 4EEBA 2MOZA 1XDPA 3PJAJ 4Z90A 5AQLB 5AFUL 3O4XE 3KV9A 4LF5T 5AQGB 4JYAT 2K5BB 4ILAA 2XAQB 4LFBT 2OV9A 3PU8A 4U33A 1WCRA 2PFVA 2XQ7A 2LEHA 3FZLB 5EK2A 5AQUB 2C5JA 1NEKA 4IHJE 4X66T 2BBHA 5AQRB 3JAEA 4AKGA 2V7MA 1IJ5A 2CPTA 2WMNA 1G73A 2CLYC 2WDRA 4CN4A 3QUJA 3P4RA 5LCYA 1N36T 4CZZB 3GN5B 3CKDA 4BJMA 4DBQA 2CBIA 3UT5E 2ODUA 5BMVE 2WMOA 5FXVA 4JBWF 4QWNB 5AQFB 2L9QA 4CI3B 2MAWA 4DV6T 2Q9QB 3CMLA 3AE2A 2YDRA 4X5TA 2PTFA 3KDSE 3CIRA 1O3XA 3Q5EA 5TAOA 3U78A 2YDSA 2E2AA 2OA5A 3O1IA 3CVRA 2EHOB 3L09A 3RYHE 2V7IA 2X0LB 3FBLA 3H37A 3VR8A 2D0TA 2JRKA 4ZHQE 5ABEA 3HL6A 2ACZA 3HR0A 2VK9A 3AECA 4WW0A 3VU7H 4GYRA 3UQ4A 1MMGA 5JDQA 3EVYA 1I6ZA 3OTOT 1FEWA 5LJMA 2V5CA 3RYFE 4P0BA 4DR2T 4JI7T 3OYXA 4TWFA 3VRAA 5JDLA 3MA9A 2NP9A 3AEDA 3UUBA 2LJLA 3AXJA 2UXBT 3LDQB 3QB5K 3W15B 2C5IT 4LMJA 3KBTA 3X1DA 4F6RC 2A9UA 2LOPA 4U74A 4UEMA 2VB6A 4Z91A 3R84B 4WBOA 4EGWA 3B57A 2EHOC 2YU2A 4U3CA 1J5WA 2SPCA 3Q5DA 4QXBB 3C50A 1VOMA 1E1HB 2WY2A 3F2EA 3HKBE 4HTEA 2E9XA 5LMNT 2HHHT 1S94A 5AQNB 4PNIA 2CHOA 4IREA 5AQTB 4JI5T 2K3WA 2KINB
chains in the Genus database with same CATH topology
4B3MT 1N33T 4DV6T 4DR6T 1XNQT 4LFCT 4GKKT 4X62T 2E5LT 1HNWT 4LF4T 4DV1T 4LF9T 4GKJT 4DV0T 4DR4T 4JI5T 5IWAT 2VQET 4AQYT 1N32T 1IBKT 4JI8T 4NXNT 2F4VT 1IBLT 4JI6T 4DV5T 4JI2T 4JI0T 4DR3T 4LF7T 4JI3T 5LMUT 4DV7T 1I94T 4B3ST 1HNXT 4JI1T 1FJGT 4B3RT 4DV2T 4LF6T 5BR8T 1XMQT 2UXCT 4OX9T 4JV5T 4LF5T 1HNZT 4JYAT 2UUCT 4LFAT 4LFBT 4DUZT 4K0KT 4X66T 2UXDT 2ZM6T 4DR7T 3T1YT 1N36T 4YY3T 3T1HT 4YHHT 2UUAT 1IBMT 1XNRT 1J5ET 4DR5T 2VQFT 4JI4T 4X64T 4KHPT 3OTOT 4DV4T 4DR2T 4JI7T 2UUBT 1HR0T 4LF8T 2UXBT 1XMOT 2UU9T 4DR1T 4DV3T 4DUYT 5LMNT 4NXMT 1N34T 2HHHT 4X65T 4B3TT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3M T;  1N33 T;  4DV6 T;  4DR6 T;  1XNQ T;  4LFC T;  4GKK T;  4X62 T;  2E5L T;  1HNW T;  4LF4 T;  4DV1 T;  4LF9 T;  4GKJ T;  4DV0 T;  4DR4 T;  4JI5 T;  5IWA T;  2VQE T;  4AQY T;  1N32 T;  1IBK T;  4JI8 T;  4NXN T;  2F4V T;  1IBL T;  4JI6 T;  4DV5 T;  4JI2 T;  4JI0 T;  4DR3 T;  4LF7 T;  4JI3 T;  5LMU T;  4DV7 T;  1I94 T;  4B3S T;  1HNX T;  4JI1 T;  1FJG T;  4B3R T;  4DV2 T;  4LF6 T;  5BR8 T;  1XMQ T;  2UXC T;  4OX9 T;  4JV5 T;  4LF5 T;  1HNZ T;  4JYA T;  2UUC T;  4LFA T;  4LFB T;  4DUZ T;  4K0K T;  4X66 T;  2UXD T;  2ZM6 T;  4DR7 T;  3T1Y T;  1N36 T;  4YY3 T;  3T1H T;  4YHH T;  2UUA T;  1IBM T;  1XNR T;  1J5E T;  4DR5 T;  2VQF T;  4JI4 T;  4X64 T;  4KHP T;  3OTO T;  4DV4 T;  4DR2 T;  4JI7 T;  2UUB T;  1HR0 T;  4LF8 T;  2UXB T;  1XMO T;  2UU9 T;  4DR1 T;  4DV3 T;  4DUY T;  5LMN T;  4NXM T;  1N34 T;  2HHH T;  4X65 T;  4B3T T; 
#chains in the Genus database with same CATH topology
 3TKL B;  3HKC E;  5CJ5 A;  5LG4 A;  2EHO D;  2ODV A;  5FY7 A;  2LSG A;  5FXW A;  3C51 A;  3KBU A;  2NW8 A;  3N9L A;  4CN1 A;  1CHU A;  5C8Y E;  1D0Z A;  4LFC T;  3ONL C;  2XAF B;  3ZEF B;  4ZI3 D;  4P0A A;  3B13 A;  3G06 A;  2YU1 A;  3QB5 A;  3MXZ A;  5ETW A;  4OYK A;  4HWH A;  5JR9 A;  1Y64 B;  3FB2 A;  3N9P A;  3RI5 A;  3RYC E;  4JUY A;  1QUU A;  2K24 A;  2E9X D;  2IAK A;  2W2U A;  2WU5 A;  3KVA A;  4YJ3 E;  4GKJ T;  2KMF A;  2ZMA A;  4IE0 A;  2HPL A;  5IHY A;  4DV0 T;  1UK5 A;  4ILU A;  3GA8 A;  3PV0 F;  1EZ3 A;  2DCF A;  2H7V C;  3AB3 B;  2RP4 A;  3E22 E;  4MAL A;  4QHO A;  2EHO A;  4A98 A;  2CHN A;  4UF0 A;  4AQF C;  5IWA T;  3H3A A;  1VCT A;  3CWZ B;  5HEU A;  4BJN A;  4ADZ A;  3V5U A;  2LHR A;  4U2Z A;  5GON E;  2E8I A;  4DV5 T;  4JI2 T;  1Y01 A;  2LKH A;  3LBX A;  2IIU A;  4L0R A;  4O8S A;  5AQP B;  3ZCI A;  4BAY B;  4YSZ A;  1WLX A;  4IIJ E;  5JRE A;  2MBG A;  4LF7 T;  4I55 E;  1YQ3 A;  4EYU A;  3ZST A;  1M7K A;  4EED A;  2CWO A;  5L3E B;  3ZJ1 A;  5LMU T;  3NRY A;  3PJA A;  3RF1 A;  4YJ2 E;  1HF8 A;  4TN7 B;  1J1J A;  2WZH A;  5JR9 C;  2XM1 A;  4EIW A;  4B3S T;  2XSA A;  4IDZ A;  1T98 A;  3I0O A;  2N9D A;  4EOZ B;  3K3O A;  5J2T E;  3J9X 1;  2XSB A;  1S35 A;  4YTN A;  1BR0 A;  2BBJ A;  2V7L A;  4H9Q C;  4EAH A;  3CPZ A;  4IGU A;  4AXP A;  1QLB A;  5AQK B;  2UXC T;  2XAS B;  2HN2 A;  4KMC A;  2CWY A;  4DO0 A;  1UGO A;  3ZMT B;  5HWY A;  4PK6 A;  1HNZ T;  2UUC T;  4JLE A;  2P9B A;  4LFA T;  4QX7 B;  2FJD A;  1Z0P A;  4IST A;  1WFD A;  3ETU A;  4A97 A;  3OYZ A;  3SFD A;  1V9D A;  4GK0 E;  4EB6 E;  2JPF A;  4PAG A;  2UXX B;  3QC9 A;  1YKH B;  3RH3 A;  4DR7 T;  2WZI A;  4TV9 E;  5HCM A;  3B5M A;  2K48 A;  3FHN A;  4ZXL A;  4AQG A;  2LHN A;  2LM9 A;  3DJB A;  2Y8D A;  4QXC B;  2W66 A;  3EDU A;  3RGL A;  5HXS A;  3H3M A;  3RIU C;  4YHH T;  1D1A A;  2C0S A;  2OLT A;  1D0X A;  2XAH B;  4G63 A;  3FZF B;  4TUY E;  2H3R A;  1D1C A;  3PDY A;  3ZN0 B;  4F8H A;  4ZI2 D;  4UXN B;  5HXH A;  2YKS A;  3MAC A;  3KIN B;  2MPK A;  2KSR A;  4DR5 T;  3ZT5 A;  3AE7 A;  4AIS A;  4H9R C;  2UUA T;  4QXH B;  3UU8 A;  4B6X A;  3ANW B;  3BK9 A;  3KVB A;  3EHZ A;  3AAE B;  4HFH A;  4X1K E;  2WDV A;  4HWF A;  4ZI2 C;  2IUB A;  5LG3 A;  2DWG A;  2VQF T;  4JI4 T;  1WR6 A;  2V26 A;  3FBZ A;  2J1D G;  3UU5 A;  2BG9 E;  4X1Y E;  4ZZC A;  1WRD A;  5JDM A;  5JDG A;  1KNZ A;  3LK3 B;  2W61 A;  2CM0 A;  4ISS A;  2N1G A;  4NPP A;  1YKE B;  2JQ9 A;  5AQM B;  4DV4 T;  4QH1 A;  5FL1 A;  2WM9 A;  2BG9 C;  3N9N A;  2X9W A;  5L3D B;  3TLV A;  5L4E A;  5LGN B;  3NBX X;  4JEU B;  5LNK A;  2CA5 A;  4IE6 A;  4O4L E;  1HCI A;  1FMW A;  2MYS A;  1G8X A;  4HFD A;  1ZKE A;  1MNE A;  3CQC B;  3M3Z B;  1JNR A;  4LF8 T;  4UR9 A;  3UTK A;  2BVL A;  2XUE A;  3ZYM A;  2CE7 A;  3C98 B;  3I9W A;  4QX8 B;  5DAB A;  3RIF A;  2L3L A;  2Y6X A;  2BZB A;  3RQU A;  4DR1 T;  3N5L A;  3PU3 A;  3R6N A;  2JQK A;  3IHR A;  4DV3 T;  3AA6 B;  3P50 A;  2X67 A;  2ZM0 A;  1LVK A;  3C64 A;  3IEE A;  3J7Y q;  1N34 T;  4NXM T;  5H6R B;  4X65 T;  1WR0 A;  3N2O A;  3A5X A;  4B3T T;  4K0U A;  1ZP0 A;  4KBM B;  2W62 A;  3AAI A;  2YEV C;  2YN6 A;  3PUW F;  3MZK B;  4IL4 A;  4N78 D;  5EK3 A;  5F5W A;  1E2A A;  3I9Y A;  5FXZ A;  3ZMU B;  2RPA A;  1US7 B;  2L8K A;  1W09 A;  4PJN A;  2DNX A;  3P8C D;  4A56 A;  2WB5 A;  4AQF A;  5C2T A;  4HFV A;  2C5K T;  4CXY A;  4ZS2 A;  4HEA A;  2BG9 A;  2Z6E A;  4H9P C;  3P7I A;  1YW0 A;  3AEE A;  3AE6 A;  4HWC A;  4OHF A;  4DND A;  1CUN A;  2PBI A;  4LF4 T;  4KX6 A;  1LRZ A;  3A7M A;  3PUX F;  4MLK A;  2CCQ A;  2CBJ A;  2LM2 A;  4IE7 A;  4DV1 T;  2Q9Q D;  5FP3 A;  2DI4 A;  3HKD E;  4HWD A;  5FVL A;  3V5S A;  5HWX A;  5JDN A;  1B7T A;  2D9D A;  2WS3 A;  3RHW A;  3CQG B;  2AE9 A;  1MMD A;  5JH7 E;  3GN5 A;  4GYS A;  3QK6 A;  2G0U A;  1UCU A;  2VQE T;  2ZLY A;  3ZN1 B;  2X0Y A;  3UU4 A;  4NXN T;  3SWH A;  1QSD A;  3QNU A;  1HG5 A;  3ZMZ B;  2NTX A;  2F4V T;  5LBM A;  3RRC A;  2KND A;  2VUR A;  4KUM B;  3RKO A;  3RX6 A;  1HX8 A;  2YDQ A;  3ZYL A;  4EYY R;  1U5P A;  3AEB A;  1DU2 A;  2I0M A;  5J1G A;  5AQJ B;  4UV8 B;  2LE8 A;  3VKH A;  2VWA A;  2VKO A;  4NIQ A;  3IA3 A;  5JR9 B;  5FY1 A;  1UX4 A;  4HFI A;  1BR1 A;  2NWB A;  4TWD A;  3E0Z A;  4V1A v;  2JIW A;  2XQA A;  3AA7 B;  5L4H A;  3ZPO A;  4AIU A;  3EUH A;  4YSX A;  1HS7 A;  2ACX A;  4ZEY A;  2XQ6 A;  3RRW A;  1VRB A;  3EI0 A;  3JAD A;  5A1L A;  2WBL A;  3AA0 B;  2JMK A;  3AVS A;  3JCF A;  3NKZ A;  2QA7 A;  2CXF A;  3AE4 A;  2BS4 A;  3EDV A;  4IE5 A;  2IC6 A;  4I43 B;  2LLY A;  3LJC A;  5JRC A;  2WCA A;  3ABV A;  1D1B A;  1WYC A;  4P1N A;  4LF6 T;  1XWM A;  2BS2 A;  3LFM A;  4OYJ A;  4FJO A;  3ZMS B;  1XMQ T;  3WAK A;  3U3I A;  2LKG A;  4UVC B;  5J2U E;  1N33 T;  3TLT A;  5HCJ A;  4HFC A;  2QRX A;  5LYJ E;  4IDP A;  1SE7 A;  5F3J A;  2KWH A;  2X9H A;  4XAX B;  5ADX L;  2NTY A;  2VL8 A;  1YQ4 A;  2M6B A;  2CXD A;  2VVN A;  3VR9 A;  4DUZ T;  2NR4 A;  3IF8 B;  3Q5X A;  2BS3 A;  2UXD T;  2XTL A;  2J47 A;  4TX5 A;  5JDF A;  4EV6 A;  1XNQ T;  4HKA A;  2ZM8 A;  2A2F X;  3CQX C;  3T1Y T;  3OPC A;  1OED C;  2H88 A;  3AE8 A;  4XZC A;  3RC8 A;  3UUN A;  1NWM X;  1R8I A;  2WDQ A;  2WAU A;  2X66 A;  2FJA A;  5FY0 A;  3SOL A;  3TLU A;  5CA1 E;  3T1H T;  1IBM T;  5FMN A;  1XNR T;  2ZM2 A;  2V6X A;  4PJL A;  2V1D B;  3VHL A;  2LOS A;  2QGS A;  3C4Z A;  2WP9 A;  4WZX A;  2X9X A;  4H63 H;  4PW8 A;  5HYA A;  4DID B;  2BKN A;  1T7S A;  2JMH A;  5AQH B;  3JC6 D;  3ZT6 A;  2W63 A;  4YTM A;  2IHR 1;  3Q9D A;  2X9Y A;  1MIY A;  2JQQ A;  2VKH A;  2R6G F;  1KF6 A;  4X20 E;  3NZQ A;  5FVK A;  5C3J A;  1W0A A;  3CX8 B;  4HGA A;  2V6Y A;  4CI1 B;  5H6Q B;  2VL0 A;  2HN1 A;  2UXN B;  3AVR A;  1UUS A;  2UUB T;  1OED A;  3PTR B;  3AAA B;  3L8R A;  4UF0 B;  5LOV E;  4GKK T;  3ZSS A;  2CMR A;  2HPJ A;  2GK9 A;  5KDM C;  4ZI3 C;  2NW9 A;  5L2L A;  3DP7 A;  1XMO T;  1IJ6 A;  4GK5 E;  3N9O A;  3ESL A;  5AQQ B;  2IDO B;  5L3F B;  5M4Y A;  4CXX A;  5FL0 A;  4ZI7 E;  4NUU A;  4U2Y A;  4UEL A;  5L3C B;  2W4X A;  3RC3 A;  1WYB A;  1YD8 G;  3QOF A;  4U72 A;  4EZ4 A;  2KT9 A;  2A3D A;  3KV5 A;  4Q25 A;  2Q9Q C;  2NOX A;  4EXT A;  4QKN A;  1XDO A;  2FBW A;  3FZK B;  4G2A A;  2YK0 A;  3CX6 B;  4I4T E;  4IT4 A;  2J62 A;  4KP3 C;  3SS1 A;  3F57 A;  1KFY A;  1SUM B;  5CGM A;  4U31 A;  3P4S A;  4DR6 T;  4UV9 B;  4AKH A;  5CFB A;  2B76 A;  1OED B;  4CI2 B;  5JTG A;  4DMV A;  2VKJ A;  2CLY B;  2BKO A;  2XHE B;  3ETV A;  3LBX B;  3ONJ A;  4DVD A;  3UUX B;  5ABH A;  5L47 A;  4X62 T;  2E5L T;  1HNW T;  4EZH A;  4LMK A;  3M65 A;  3DTO A;  4GOU A;  2V6Y B;  3P4P A;  4Z8X A;  5EK4 A;  3N2G E;  1OED E;  2CEA A;  1MND A;  2WU2 A;  2WQY A;  3O1J A;  4O4H E;  1YXR A;  4TWH A;  4ASK A;  4DR4 T;  3FZM B;  5HXC A;  1KK7 A;  2VKD A;  3UFE A;  5KXJ A;  3K3Q C;  4ZOL E;  1W0B A;  4NUV A;  2LSJ A;  2D2S A;  2N2N A;  2V7J A;  3OBV E;  2E5V A;  2IC9 A;  3Q2M A;  3L39 A;  2ES0 A;  3NRX A;  4OFZ A;  3AE1 A;  3ZMV B;  4JI6 T;  4HWI B;  3LK4 2;  1UUR A;  4KI0 F;  4P09 A;  4UVB B;  1UX5 A;  3SRZ A;  4H9S E;  5JQG E;  1MMN A;  4YFS A;  2AXD S;  2VAS A;  4GIW A;  3ZT7 A;  2X68 A;  4DR3 T;  4JI3 T;  2FJE A;  1MMA A;  4PK4 A;  3PUG A;  2WWV A;  3S4U A;  1KEY A;  4HFB A;  4IDO A;  4FI5 A;  4YLH A;  3RIA A;  1HG2 A;  4CQI A;  5FXX A;  1T8B A;  3CK6 A;  1M62 A;  2V8S V;  2CRB A;  3BQK A;  4L5G A;  3UU3 A;  4PJM A;  2QVA A;  2NW7 A;  4ILB A;  5DJQ C;  4AI6 A;  3VRB A;  1NAF A;  3HI2 A;  4IDN A;  1E7P A;  4HE8 A;  3F31 A;  1SHZ C;  1H7C A;  3UUM A;  2CXL A;  5FKY A;  2XZE A;  2V5D A;  4A5X A;  4WBN E;  5HXE A;  4WNK A;  1FJG T;  3ZLI A;  3AE9 A;  5DQW A;  4DMW A;  2QYW A;  3GWH A;  4COF A;  2XQ4 A;  3A8Y C;  3P4W A;  1IAP A;  5AQV B;  2LRL A;  4JV5 T;  3AXJ B;  4UVA B;  2Y48 B;  1ZHC A;  4CN6 A;  5IUX A;  3WAJ A;  2BVM A;  3VKG A;  3NWI A;  2VVS A;  2FUP A;  1NEN A;  2LSY A;  3AEA A;  2H7O A;  3I0Q A;  2V7K A;  1BR2 A;  3N2K E;  4I0U A;  4MBQ A;  3RQW A;  3UUL A;  3UU6 A;  1Z8U A;  4K0K T;  3OKQ A;  5CB4 E;  2ZM6 T;  2XPK A;  5LHG B;  4OK0 A;  3K3N A;  2WSS V;  3O1H A;  4AKL A;  3ONX A;  4PK5 A;  2IML A;  5HAX A;  4YY3 T;  5FNV E;  3SFE A;  3ZKR A;  1ZEE A;  3L3P A;  1AJ3 A;  2PG8 A;  1HFA A;  5LGU B;  2M6I A;  2DWK A;  1SA0 E;  1ZOY A;  3PUZ F;  3Q5W A;  2JQH A;  3N9M A;  1LKX A;  4U7Y A;  1JNZ A;  2K9A A;  3ZCJ A;  4H63 V;  4ANJ A;  5LXT E;  1J5E T;  5LBQ B;  2E9X C;  2XQ8 A;  4UIG A;  1X79 A;  4AKR B;  5DQV A;  1HNX T;  4O2A E;  3TLS A;  4HN9 A;  1FIO A;  3LG7 A;  3PUY F;  4L9I A;  1OWA A;  2A72 A;  3PE0 A;  5L3B B;  5LP6 E;  1HX1 B;  3BQL A;  4C91 A;  4PFO A;  2H89 A;  2LT3 A;  2I6H A;  4I50 E;  4KHP T;  4QH5 A;  4WYV A;  5HEH A;  2LRK A;  1HTJ F;  1U4Q A;  3T8O A;  4YHJ A;  1IZN B;  3IBP A;  3C4W A;  1HR0 T;  4M1P A;  3LSV A;  5L3G B;  2B1E A;  2BG9 B;  2J4G A;  2LSK A;  3FZH B;  5JVD E;  5LHH B;  1GQE A;  2XAG B;  1MIW A;  2D0U A;  4IE4 A;  3MK7 C;  2XY8 B;  2W0G A;  3KV6 A;  4TV8 E;  2UU9 T;  4ERR A;  2KLQ A;  3UFG A;  3RYI E;  4ZZB A;  1T72 A;  3AA1 B;  3MKD A;  3OVU A;  4DUY T;  1D0Y A;  4DBR A;  5ABF A;  3GMI A;  4MHC A;  3WI3 A;  4KHZ F;  2E9X B;  5E0O A;  4BA9 A;  4B3M T;  2LSI A;  1KNR A;  4YT0 A;  4X1I E;  3BQI A;  2BDE A;  2PJQ A;  4PFP A;  3HKE E;  3P4Q A;  2XQY A;  1LVF A;  3LK2 B;  3ZJ2 A;  4AKI A;  1ZV4 X;  3NZP A;  3D0T A;  4O2B E;  1MIV A;  5F8P A;  4YSY A;  5HEJ A;  1FMV A;  5LB7 B;  3JAF A;  2W67 A;  3K1S A;  4TZ4 C;  4X64 T;  3EAB A;  3AEF A;  5IYZ E;  1W9R A;  1XZY A;  4U7I A;  4MFR A;  4LML A;  5HEO A;  4C90 A;  3KV4 A;  2KWI B;  2D5U A;  2X0H A;  3OJA A;  3PUQ A;  5AQI B;  1L0V A;  5KX5 E;  2XJ7 A;  3NVO A;  5LHI B;  4CXW A;  1OXZ A;  3O9X A;  4ILC A;  4LF9 T;  2JJ9 A;  2XQ5 A;  5LJN A;  3CX7 B;  4PJJ A;  2I59 A;  3ANW A;  2DLR A;  2HH7 A;  3JC6 C;  3N9Q A;  4H9O C;  4E7S A;  3MJX A;  5KMG P;  3K8P C;  4AQY T;  2XM2 A;  1IBK T;  3UQ7 A;  3E08 A;  2IW5 B;  2BKP A;  3TLW A;  1N32 T;  5HEG A;  4E7Z A;  4XBF B;  4O4J E;  1IBL T;  5AQO B;  5J0Z A;  2XQ3 A;  2WWU A;  4J2C A;  4JI0 T;  1X9B A;  2XQ9 A;  2DHR A;  3ZC1 A;  5AQS B;  3AE5 A;  5ABG A;  1VCS A;  4IDQ A;  4O4I E;  2Q9Q A;  3AE3 A;  4HFE A;  2FJB A;  3AEG A;  2W00 A;  2MTQ A;  3FXE B;  2M67 A;  3RLF F;  5JDH A;  4TNW A;  4DV7 T;  1I94 T;  5CA0 E;  3PUA A;  5LA6 E;  3I1A A;  2YIN A;  3PUS A;  3PUR A;  4IL9 A;  4ZS3 A;  3RKG A;  5JRC B;  5EZY E;  4JI1 T;  2YOE A;  4H9N C;  4B3R T;  1KNP A;  4JI8 T;  5LGT B;  4DV2 T;  3EAM A;  5BR8 T;  5ABF B;  3ZYK A;  1BR4 A;  2DL1 A;  2KZ7 B;  4YXD A;  4QH4 A;  3HA4 A;  2XAJ B;  3KFW X;  4JEH B;  3C4X A;  2KXP B;  3ZC0 A;  4TNV A;  5HXR A;  3RIU A;  3RPU A;  4YTP A;  4OX9 T;  5FYM A;  2RA1 A;  3FXD B;  3PUV F;  2X51 A;  4EEB A;  2MOZ A;  1XDP A;  3PJA J;  4Z90 A;  5AQL B;  5AFU L;  3O4X E;  3KV9 A;  4LF5 T;  5AQG B;  4JYA T;  2K5B B;  4ILA A;  2XAQ B;  4LFB T;  2OV9 A;  3PU8 A;  4U33 A;  1WCR A;  2PFV A;  2XQ7 A;  2LEH A;  3FZL B;  5EK2 A;  5AQU B;  2C5J A;  1NEK A;  4IHJ E;  4X66 T;  2BBH A;  5AQR B;  3JAE A;  4AKG A;  2V7M A;  1IJ5 A;  2CPT A;  2WMN A;  1G73 A;  2CLY C;  2WDR A;  4CN4 A;  3QUJ A;  3P4R A;  5LCY A;  1N36 T;  4CZZ B;  3GN5 B;  3CKD A;  4BJM A;  4DBQ A;  2CBI A;  3UT5 E;  2ODU A;  5BMV E;  2WMO A;  5FXV A;  4JBW F;  4QWN B;  5AQF B;  2L9Q A;  4CI3 B;  2MAW A;  4DV6 T;  2Q9Q B;  3CML A;  3AE2 A;  2YDR A;  4X5T A;  2PTF A;  3KDS E;  3CIR A;  1O3X A;  3Q5E A;  5TAO A;  3U78 A;  2YDS A;  2E2A A;  2OA5 A;  3O1I A;  3CVR A;  2EHO B;  3L09 A;  3RYH E;  2V7I A;  2X0L B;  3FBL A;  3H37 A;  3VR8 A;  2D0T A;  2JRK A;  4ZHQ E;  5ABE A;  3HL6 A;  2ACZ A;  3HR0 A;  2VK9 A;  3AEC A;  4WW0 A;  3VU7 H;  4GYR A;  3UQ4 A;  1MMG A;  5JDQ A;  3EVY A;  1I6Z A;  3OTO T;  1FEW A;  5LJM A;  2V5C A;  3RYF E;  4P0B A;  4DR2 T;  4JI7 T;  3OYX A;  4TWF A;  3VRA A;  5JDL A;  3MA9 A;  2NP9 A;  3AED A;  3UUB A;  2LJL A;  3AXJ A;  2UXB T;  3LDQ B;  3QB5 K;  3W15 B;  2C5I T;  4LMJ A;  3KBT A;  3X1D A;  4F6R C;  2A9U A;  2LOP A;  4U74 A;  4UEM A;  2VB6 A;  4Z91 A;  3R84 B;  4WBO A;  4EGW A;  3B57 A;  2EHO C;  2YU2 A;  4U3C A;  1J5W A;  2SPC A;  3Q5D A;  4QXB B;  3C50 A;  1VOM A;  1E1H B;  2WY2 A;  3F2E A;  3HKB E;  4HTE A;  2E9X A;  5LMN T;  2HHH T;  1S94 A;  5AQN B;  4PNI A;  2CHO A;  4IRE A;  5AQT B;  4JI5 T;  2K3W A;  2KIN B; 
#chains in the Genus database with same CATH homology
 4B3M T;  1N33 T;  4DV6 T;  4DR6 T;  1XNQ T;  4LFC T;  4GKK T;  4X62 T;  2E5L T;  1HNW T;  4LF4 T;  4DV1 T;  4LF9 T;  4GKJ T;  4DV0 T;  4DR4 T;  4JI5 T;  5IWA T;  2VQE T;  4AQY T;  1N32 T;  1IBK T;  4JI8 T;  4NXN T;  2F4V T;  1IBL T;  4JI6 T;  4DV5 T;  4JI2 T;  4JI0 T;  4DR3 T;  4LF7 T;  4JI3 T;  5LMU T;  4DV7 T;  1I94 T;  4B3S T;  1HNX T;  4JI1 T;  1FJG T;  4B3R T;  4DV2 T;  4LF6 T;  5BR8 T;  1XMQ T;  2UXC T;  4OX9 T;  4JV5 T;  4LF5 T;  1HNZ T;  4JYA T;  2UUC T;  4LFA T;  4LFB T;  4DUZ T;  4K0K T;  4X66 T;  2UXD T;  2ZM6 T;  4DR7 T;  3T1Y T;  1N36 T;  4YY3 T;  3T1H T;  4YHH T;  2UUA T;  1IBM T;  1XNR T;  1J5E T;  4DR5 T;  2VQF T;  4JI4 T;  4X64 T;  4KHP T;  3OTO T;  4DV4 T;  4DR2 T;  4JI7 T;  2UUB T;  1HR0 T;  4LF8 T;  2UXB T;  1XMO T;  2UU9 T;  4DR1 T;  4DV3 T;  4DUY T;  5LMN T;  4NXM T;  1N34 T;  2HHH T;  4X65 T;  4B3T T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...