4LF9T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4lf9T00
4DV0T 4X66T 4JI0T 4DV1T 1IBKT 1N36T 4JI5T 4DR4T 4JI3T 4LF6T 1XMOT 4B3MT 4B3TT 4JV5T 2VQET 4JI4T 2UUAT 4DR6T 4DV2T 2HHHT 5BR8T 2F4VT 5IWAT 4GKKT 4LF5T 4LF9T 4DR3T 1J5ET 3T1HT 1I94T 4LF8T 4DUYT 4DUZT 4X62T 4LFCT 2UUBT 1IBLT 5LMNT 4DR7T 4B3ST 4X65T 4DR2T 4OX9T 2UU9T 4DV3T 4JI6T 1FJGT 2VQFT 4KHPT 4DV5T 1N32T 3T1YT 1HR0T 4JI8T 1IBMT 1XNQT 4LF7T 4NXNT 2UUCT 4K0KT 4DV7T 4LFBT 4DV6T 5LMUT 1N33T 2ZM6T 3OTOT 4B3RT 2E5LT 4YHHT 4DV4T 4NXMT 1HNWT 4JI2T 1HNXT 2UXDT 1N34T 4YY3T 4LFAT 4JYAT 4JI7T 1XNRT 2UXCT 4JI1T 1XMQT 4DR5T 1HNZT 2UXBT 4DR1T 4LF4T 4X64T 4GKJT 4AQYT
chains in the Genus database with same CATH superfamily
3KVAA 2WU5A 4HFHA 1CHUA 2DCFA 1MNEA 4CZZB 4YLHA 4OYKA 1US7B 2J47A 2WU2A 2WWVA 1G73A 4PK6A 3EVYA 4GKKT 4KHZF 5HXCA 3ZMSB 4CI2B 4E7SA 1SHZC 1T7SA 2MOZA 2XM2A 4TV9E 2VL8A 2AE9A 4H63H 4CXYA 2IAKA 2E8IA 2WB5A 2W00A 2X9WA 2ZM8A 1O3XA 2Q9QA 4IE5A 4TWHA 3ZMTB 2CM0A 3L39A 1JNRA 3ONLC 4UV9B 4B3RT 4P0AA 3E22E 3I9YA 1WR6A 3GN5B 3RYIE 1IJ5A 4NXMT 2V7IA 2IW5B 5HXHA 5JDHA 5M4YA 4YJ3E 2LOSA 4YTPA 4AKRB 3PUZF 3EABA 1BR1A 3R84B 1HF8A 2Q9QB 2JMKA 4GKJT 2XTLA 3PU3A 2CXDA 5LXTE 2EHOD 2CWOA 4HGAA 3GA8A 4PW8A 4MFRA 4IGUA 5ABGA 4C91A 1E1HB 4HTEA 3IA3A 4I43B 4HKAA 4Z90A 1HX8A 4YTNA 5JRCA 4AXPA 3AEAA 4HEAA 4UELA 1I94T 5AQSB 3OBVE 3PTRB 2VKOA 3QUJA 1LVFA 2UU9T 2K24A 3UT5E 4IE7A 3PURA 1J1JA 2VL0A 3SFDA 4QH5A 4IHJE 3QB5K 3KDSE 5JRCB 2LJLA 5HXSA 2J1DG 2VURA 4O4LE 4J2CA 5J1GA 3CX8B 3AA1B 5C8YE 2NWBA 3OVUA 3HKEE 3LBXB 1W0AA 2IMLA 2C5JA 3IF8B 3RC3A 5CJ5A 1XDOA 3C51A 2L3LA 4HE8A 4GOUA 4DVDA 2WS3A 2IIUA 2XQ9A 2V26A 4H63V 2NOXA 3ZC1A 1N36T 4EYYR 4B3MT 3ZT7A 4ZOLE 3U78A 2XAJB 4JI4T 1WYCA 2D0UA 3RIFA 3QK6A 2CA5A 4H9NC 5FL0A 2BKOA 4MLKA 2E9XD 3F2EA 2VKDA 3RRWA 3UUXB 3UU4A 3RPUA 1HG2A 5HEHA 2IHR1 3ZC0A 4ILBA 1WYBA 1IBLT 4WYVA 3ANWA 1FJGT 4AI6A 5LCYA 1M62A 2CEAA 5IUXA 3N5LA 5ABHA 4DV5T 3Q2MA 3T8OA 5AQKB 3A8YC 2G0UA 3ZMVB 3LSVA 5ADXL 2D2SA 3I1AA 3RYFE 2FJAA 1W9RA 3MZKB 4O2BE 2MYSA 3BQLA 1ZV4X 4PNIA 2KT9A 1W09A 3AAIA 1IZNB 5HEOA 2A2FX 2CPTA 4YHHT 3IBPA 1WCRA 5IYZE 3JC6C 5AQLB 4TX5A 5C2TA 1V9DA 3K3NA 2X0HA 3IEEA 2BBJA 2NTYA 4U74A 5F5WA 2ZM2A 4CN1A 2XSBA 3H37A 4EIWA 4AQFA 2BVLA 1MMDA 2WBLA 3AVRA 4ERRA 4AQYT 2VKHA 2KNDA 5FVKA 2XQ6A 3BK9A 3A5XA 2W2UA 3PDYA 4AIUA 2W67A 2YDSA 4O8SA 5HYAA 5L3DB 1OEDE 1BR4A 1IAPA 2BBHA 1D1CA 1UUSA 2UUAT 4V1Av 1UGOA 4ANJA 4EYUA 4EB6E 2D9DA 3RF1A 2CBIA 4Z8XA 5LP6E 4DR3T 2VKJA 3IHRA 3RQWA 3ZYKA 2QA7A 2YINA 2J62A 2VVNA 2WZHA 3AEEA 3VRAA 5AQNB 2N1GA 4H9PC 4HWIB 1IBMT 4PJNA 3Q5EA 2K48A 1MNDA 4TNWA 5KDMC 4P1NA 3PJAJ 4CI3B 5L3GB 2HPJA 3FXDB 2K5BB 3B57A 2LKHA 5ABEA 2IDOB 5F3JA 3EDVA 3TKLB 3C4XA 2OLTA 4A5XA 3C64A 2I6HA 2FBWA 3H3AA 2LM9A 5AQHB 4X1YE 3PE0A 3UFEA 3HL6A 2X51A 2WMNA 2CCQA 3BQIA 5LBMA 4YFSA 4U33A 4PK4A 5C3JA 3CQCB 3GWHA 3UU8A 4G63A 4X1IE 3M65A 2PG8A 4LF5T 4ZI2D 2YN6A 4DUYT 4DUZT 4EXTA 5L3CB 2XQYA 3MKDA 3P4SA 3NWIA 3K1SA 4PJMA 1LVKA 2JRKA 4DV3T 4NIQA 2VQFT 1G8XA 5HEGA 2V5CA 2GK9A 2CXFA 1N32T 4E7ZA 2JIWA 4G2AA 2H88A 3CX6B 4GYSA 4N78D 2UUCT 3N9PA 3MA9A 1ZHCA 3AE8A 2EHOC 3KV5A 5LG3A 3FZKB 3SRZA 4O2AE 3OTOT 2IC9A 2QRXA 4ASKA 2DLRA 4TZ4C 3AB3B 1HNXT 2UXDT 5DABA 4U7IA 4DNDA 2V6YA 3AE9A 5ETWA 1XMQT 5LA6E 2BKNA 1ZP0A 4H9RC 4DR1T 4WNKA 2KXPB 3SS1A 4JUYA 5LG4A 3L8RA 4DV1T 3TLTA 3E08A 4JI3T 3FBLA 2C5IT 1LKXA 3RX6A 2WM9A 2XQ3A 5FP3A 1UX4A 2Q9QC 4YSXA 1KF6A 3PUYF 2CRBA 2EHOA 3ZN0B 4O4HE 1Z0PA 3ETVA 4DIDB 2QYWA 1YQ3A 1Z8UA 2NR4A 2WDRA 5CA0E 5LJNA 2JQ9A 1XDPA 1MMGA 4DMWA 5AQQB 3EDUA 4JEHB 4DR7T 3DP7A 4DR2T 3AA7B 5HWYA 5JDNA 2W0GA 4ILUA 3LFMA 2ACZA 5LGTB 2CHNA 4PFOA 4ISTA 4JI8T 3ZCIA 2WCAA 3MACA 2ODUA 1N33T 4TN7B 2XAHB 3RIUA 2EHOB 2X9YA 3ZMZB 2MPKA 2LRKA 3PUSA 2ACXA 2MAWA 4DV4T 5TAOA 4UF0A 4QHOA 4OK0A 3C98B 2WDQA 3HA4A 2ZMAA 2X0LB 3J9X1 3P7IA 4Q25A 4GK0E 1HTJF 3VKGA 5CA1E 4HFEA 2JJ9A 3RKOA 4UXNB 1OXZA 2BG9C 1HS7A 2M6BA 4JI0T 3RRCA 4O4IE 4EEBA 4IE0A 4HFCA 3NRYA 4JEUB 4WBOA 3PUVF 4UF0B 3RYCE 5JVDE 2LSYA 1ZKEA 3A7MA 3OPCA 2XSAA 2FJDA 2L9QA 2LT3A 1D0YA 4XZCA 4IDPA 4LF8T 4H9QC 1QSDA 2ZM0A 4U7YA 4LFCT 4EZ4A 5CGMA 1KFYA 2D5UA 5JR9A 1E2AA 1U5PA 4JI6T 3O1IA 5HEUA 1NENA 2E9XA 3VR9A 2WDVA 1HR0T 4COFA 3VHLA 2BG9A 3L09A 5AQFB 2XJ7A 4TWDA 2CLYB 2WP9A 3PUQA 4PFPA 2LE8A 3OKQA 4LMJA 1X9BA 1WFDA 4YJ2E 2V7MA 3RGLA 5JTGA 3UULA 4IDZA 4JI7T 2BDEA 1WLXA 4WBNE 2XY8B 2MTQA 1KEYA 3PU8A 5CFBA 5JDGA 3RH3A 3MK7C 4UV8B 1D1AA 2BG9B 4ZI3D 2HN1A 4DO0A 2XZEA 5FNVE 4BJNA 3FZHB 2WMOA 4QX7B 5AQIB 5FXXA 3TLVA 2E2AA 5FXZA 2N9DA 3VR8A 3ZT6A 3FHNA 3CKDA 3DTOA 4HFBA 2OV9A 2BKPA 4ISSA 2HHHT 3UUNA 4A97A 2QVAA 3Q5DA 2CMRA 3F31A 5IHYA 4X62T 5L3BB 4U2YA 3PUXF 4A98A 4LMLA 4MALA 3JADA 3ESLA 1ZEEA 2K9AA 2XM1A 2CBJA 1MIVA 3T1YT 1OEDA 2X67A 2JQQA 3H3MA 1X79A 4AQFC 3P50A 4F8HA 3PV0F 4F6RC 4DV6T 2VK9A 2P9BA 3LK42 3FB2A 1ZOYA 2LM2A 2KLQA 4AKGA 2UXXB 4QH4A 2BS2A 3SOLA 3W15B 4BJMA 3O1JA 2XAQB 2VASA 3SWHA 5HCJA 3UU5A 1J5WA 2UXCT 2XUEA 4U31A 1BR0A 4C90A 2Z6EA 2UXBT 4IREA 1FMVA 2B76A 3N2OA 1QLBA 3V5UA 3AA6B 3TLWA 3AE2A 4L0RA 3AVSA 1T8BA 3ANWB 4CI1B 4UVBB 4CXWA 3CWZB 4M1PA 2FJEA 2V1DB 2WAUA 3D0TA 5IWAT 5FYMA 2JPFA 1YQ4A 2I0MA 4IE4A 2XQ5A 4U2ZA 4ZEYA 4LF9T 2SPCA 3KV6A 1D0XA 2IC6A 3AAEB 2XHEB 3KBUA 1QUUA 3ZPOA 5LJMA 2I59A 5DQWA 3MXZA 2VB6A 5FY1A 5AQOB 5HEJA 3AXJA 2MBGA 1W0BA 4KI0F 3CPZA 4TNVA 5JDLA 5GONE 4DV7T 1WRDA 3WAJA 2A9UA 2H7OA 4A56A 4FJOA 2HPLA 2FUPA 1R8IA 5L2LA 2LSIA 2XQAA 3RC8A 3NBXX 3L3PA 4YSZA 3FBZA 4OHFA 2NW7A 3RHWA 3LJCA 5JREA 1SA0E 4DR5T 2XASB 3P4PA 4GIWA 1MMNA 3AXJB 1HFAA 1NWMX 4X64T 2V7JA 2PTFA 1H7CA 2NP9A 3UUMA 4UVAB 4LF6T 1XMOT 2W63A 1LRZA 3RQUA 4IL9A 1I6ZA 3VU7H 4I4TE 1VCTA 1BR2A 2BZBA 5BR8T 4XBFB 2KSRA 3AEBA 3GMIA 4ZS3A 2YU1A 3EUHA 2DWKA 2IUBA 1L0VA 4IE6A 1SE7A 2DHRA 4YHJA 3AEFA 3KV4A 3N2KE 2V5DA 2A72A 4UR9A 4EZHA 2PFVA 4BAYB 4LMKA 4CN4A 4U72A 3AE1A 3UQ4A 2XQ7A 5AQPB 3KV9A 5KXJA 2K3WA 3SFEA 5LGUB 4K0KT 1VRBA 5L4EA 5LHIB 4TUYE 2ZM6T 2XAFB 2E5LT 5LNKA 3UTKA 2JMHA 1MIYA 2KMFA 3CQXC 5AQGB 5J2TE 4CQIA 4JI2T 1YW0A 4P0BA 2LSKA 5LOVE 1B7TA 1S35A 4QX8B 2WSSV 2JQHA 3CQGB 4JI1T 3JC6D 3OJAA 4ZZBA 3ZSSA 4HWCA 4L9IA 4EOZB 2XAGB 2CHOA 3N9LA 2LLYA 1S94A 3LG7A 3NVOA 3KBTA 2RP4A 2WWUA 3MJXA 2CXLA 4IDQA 1FEWA 5DJQC 2XQ8A 1XWMA 3M3ZB 3V5SA 5J0ZA 3RIUC 2ODVA 3AE3A 5FVLA 3LK2B 5J2UE 4P09A 3ZN1B 4X5TA 4QWNB 4KX6A 3EI0A 3N9QA 2KWIB 4GYRA 4IDOA 2V6YB 4PAGA 4TV8E 3PUWF 3N9MA 4KMCA 5EZYE 3AAAB 1UK5A 4MBQA 2X66A 1HNWT 2Y6XA 1YXRA 5KX5E 2LRLA 1YKEB 4LFAT 4KUMB 5JDFA 3BQKA 4K0UA 2V8SV 2CLYC 4QXBB 4HFIA 5AQMB 4UEMA 4ZHQE 3KINB 4UVCB 4YSYA 5AQVB 4QXHB 4ZZCA 3GN5A 5FY7A 3RKGA 5JR9C 4DR4T 3AECA 5JDQA 2A3DA 2X9XA 3X1DA 3P4QA 2E9XC 2LSGA 5LHHB 4DV2T 5JQGE 4KP3C 3ABVA 3O1HA 4HN9A 4CXXA 3AEDA 2M67A 4NUUA 5A1LA 4B3ST 4X65T 3LK3B 4ZS2A 1HX1B 2LOPA 5LYJE 4JBWF 4AISA 2BS4A 4IL4A 4WZXA 4I55E 3QB5A 4LF7T 3HI2A 3OYXA 1FIOA 3AE7A 3I0OA 5EK4A 1YD8G 3P4WA 2DI4A 1UCUA 3J7Yq 3ZYMA 1N34T 2KINB 2YU2A 4AKHA 1XNRT 1EZ3A 4HWFA 5AQTB 3CVRA 3AE4A 2AXDS 3UFGA 3G06A 2C5KT 3NZPA 3FXEB 5BMVE 3K8PC 5JR9B 4DBRA 2FJBA 4HWHA 4IT4A 4OFZA 1WR0A 5H6QB 1T72A 4PK5A 4JV5T 4YT0A 3LBXA 2YOEA 2E9XB 1OEDC 1VCSA 3B5MA 4FI5A 5KMGP 2ES0A 4EAHA 3EHZA 2F4VT 3VRBA 2CWYA 4EGWA 1J5ET 3ZEFB 2Q9QD 4H9SE 2CE7A 1MMAA 2YEVC 2V6XA 5FY0A 3U3IA 2W4XA 5AQUB 4YXDA 4IIJE 4HFVA 4ILAA 1XZYA 2NTXA 3RLFF 4GK5E 1OWAA 3WI3A 2YDQA 5EK3A 1XNQT 1JNZA 5LB7B 2N2NA 5LHGB 4O4JE 4QXCB 3ZLIA 1VOMA 3NKZA 5LMUT 3NRXA 1DU2A 2M6IA 2L8KA 2WZIA 2PJQA 2W61A 4HWDA 4I50E 1GQEA 3CX7B 3QC9A 4JYAT 4L5GA 3F57A 2X0YA 3P4RA 5FMNA 4KBMB 2BG9E 3N2GE 4LF4T 5FKYA 1IJ6A 2WQYA 3ETUA 3ZCJA 4JI5T 4U3CA 2E5VA 3EAMA 4NPPA 5L4HA 2R6GF 4ZI2C 2LSJA 3B13A 1FMWA 4H9OC 4IDNA 2B1EA 5FXVA 1OEDB 3TLUA 4BA9A 3K3OA 4ADZA 3JAFA 1U4QA 2JQKA 3UU6A 3Q5XA 3C50A 2DL1A 2YKSA 4ZXLA 5LMNT 4I0UA 2KZ7B 4OYJA 5JH7E 4X20E 4PJLA 2QGSA 3KFWX 4KHPT 4YTMA 1KNZA 4NXNT 3TLSA 5L3FB 3AE6A 2J4GA 4CN6A 5CB4E 2WY2A 3N9NA 5AQRB 3ONJA 3ZMUB 1D0ZA 1SUMB 3N9OA 4YY3T 2RPAA 3ZT5A 2RA1A 5HCMA 2UXNB 3HR0A 2BS3A 2NW9A 4MHCA 1KNRA 1Y64B 2LEHA 2HH7A 3ZSTA 2H7VC 4X66T 4DV0T 3QOFA 3UU3A 2ZLYA 3P8CD 2VVSA 1UURA 4XAXB 4B3TT 3ZYLA 4B6XA 4NUVA 3C4ZA 1M7KA 5HXRA 4WW0A 1NEKA 4Z91A 4PJJA 2W62A 1HCIA 4X1KE 2D0TA 3T1HT 2BVMA 1AJ3A 3VKHA 1KK7A 5HWXA 3RIAA 3KVBA 2UUBT 5EK2A 2HN2A 5L47A 3FZMB 5F8PA 2Y8DA 4UIGA 2W66A 3FZLB 2X68A 5FXWA 3AA0B 5LGNB 2C0SA 2LKGA 1KNPA 3DJBA 1Y01A 1MIWA 5E0OA 3QNUA 2LHRA 3CIRA 3O9XA 2DNXA 4ZI7E 4AQGA 2H3RA 4DBQA 4AKLA 4EEDA 2PBIA 3I0QA 3UUBA 3CMLA 2YDRA 4ILCA 5L3EB 3CK6A 1HG5A 5ABFA 3R6NA 1D1BA 3O4XE 3RYHE 1IBKT 1CUNA 3ZJ1A 4HFDA 3OYZA 2DWGA 2VQET 5H6RB 2Y48B 3ONXA 2VWAA 4EV6A 2KWHA 4DR6T 5HAXA 2OA5A 2XQ4A 3S4UA 3NZQA 2V7LA 3PUGA 5ABFB 2V7KA 1T98A 3PJAA 1NAFA 5HXEA 1UX5A 3Q9DA 3C4WA 5DQVA 3JCFA 3JAEA 2NW8A 4OX9T 3ZJ2A 5AQJB 3RI5A 3FZFB 1YKHB 2H89A 3HKBE 3WAKA 5FL1A 3PUAA 3AEGA 2YK0A 4LFBT 5JDMA 4DMVA 1E7PA 5AFUL 3ZKRA 4QKNA 3I9WA 2LHNA 4JLEA 3AE5A 2X9HA 3HKCE 2XPKA 3Q5WA 4QH1A 4ZI3C 3E0ZA 3UQ7A 4TWFA 1HNZT 3HKDE 3K3QC 3LDQB 5LBQB 4AKIA
chains in the Genus database with same CATH topology
4DV0T 4X66T 4JI0T 4DV1T 1IBKT 1N36T 4JI5T 4DR4T 4JI3T 4LF6T 1XMOT 4B3MT 4B3TT 4JV5T 2VQET 4JI4T 2UUAT 4DR6T 4DV2T 2HHHT 5BR8T 2F4VT 5IWAT 4GKKT 4LF5T 4LF9T 4DR3T 1J5ET 3T1HT 1I94T 4LF8T 4DUYT 4DUZT 4X62T 4LFCT 2UUBT 1IBLT 5LMNT 4DR7T 4B3ST 4X65T 4DR2T 4OX9T 2UU9T 4DV3T 4JI6T 1FJGT 2VQFT 4KHPT 4DV5T 1N32T 3T1YT 1HR0T 4JI8T 1IBMT 1XNQT 4LF7T 4NXNT 2UUCT 4K0KT 4DV7T 4LFBT 4DV6T 5LMUT 1N33T 2ZM6T 3OTOT 4B3RT 2E5LT 4YHHT 4DV4T 4NXMT 1HNWT 4JI2T 1HNXT 2UXDT 1N34T 4YY3T 4LFAT 4JYAT 4JI7T 1XNRT 2UXCT 4JI1T 1XMQT 4DR5T 1HNZT 2UXBT 4DR1T 4LF4T 4X64T 4GKJT 4AQYT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV0 T;  4X66 T;  4JI0 T;  4DV1 T;  1IBK T;  1N36 T;  4JI5 T;  4DR4 T;  4JI3 T;  4LF6 T;  1XMO T;  4B3M T;  4B3T T;  4JV5 T;  2VQE T;  4JI4 T;  2UUA T;  4DR6 T;  4DV2 T;  2HHH T;  5BR8 T;  2F4V T;  5IWA T;  4GKK T;  4LF5 T;  4LF9 T;  4DR3 T;  1J5E T;  3T1H T;  1I94 T;  4LF8 T;  4DUY T;  4DUZ T;  4X62 T;  4LFC T;  2UUB T;  1IBL T;  5LMN T;  4DR7 T;  4B3S T;  4X65 T;  4DR2 T;  4OX9 T;  2UU9 T;  4DV3 T;  4JI6 T;  1FJG T;  2VQF T;  4KHP T;  4DV5 T;  1N32 T;  3T1Y T;  1HR0 T;  4JI8 T;  1IBM T;  1XNQ T;  4LF7 T;  4NXN T;  2UUC T;  4K0K T;  4DV7 T;  4LFB T;  4DV6 T;  5LMU T;  1N33 T;  2ZM6 T;  3OTO T;  4B3R T;  2E5L T;  4YHH T;  4DV4 T;  4NXM T;  1HNW T;  4JI2 T;  1HNX T;  2UXD T;  1N34 T;  4YY3 T;  4LFA T;  4JYA T;  4JI7 T;  1XNR T;  2UXC T;  4JI1 T;  1XMQ T;  4DR5 T;  1HNZ T;  2UXB T;  4DR1 T;  4LF4 T;  4X64 T;  4GKJ T;  4AQY T; 
#chains in the Genus database with same CATH topology
 3KVA A;  2WU5 A;  4HFH A;  1CHU A;  2DCF A;  1MNE A;  4CZZ B;  4YLH A;  4OYK A;  1US7 B;  2J47 A;  2WU2 A;  2WWV A;  1G73 A;  4PK6 A;  3EVY A;  4GKK T;  4KHZ F;  5HXC A;  3ZMS B;  4CI2 B;  4E7S A;  1SHZ C;  1T7S A;  2MOZ A;  2XM2 A;  4TV9 E;  2VL8 A;  2AE9 A;  4H63 H;  4CXY A;  2IAK A;  2E8I A;  2WB5 A;  2W00 A;  2X9W A;  2ZM8 A;  1O3X A;  2Q9Q A;  4IE5 A;  4TWH A;  3ZMT B;  2CM0 A;  3L39 A;  1JNR A;  3ONL C;  4UV9 B;  4B3R T;  4P0A A;  3E22 E;  3I9Y A;  1WR6 A;  3GN5 B;  3RYI E;  1IJ5 A;  4NXM T;  2V7I A;  2IW5 B;  5HXH A;  5JDH A;  5M4Y A;  4YJ3 E;  2LOS A;  4YTP A;  4AKR B;  3PUZ F;  3EAB A;  1BR1 A;  3R84 B;  1HF8 A;  2Q9Q B;  2JMK A;  4GKJ T;  2XTL A;  3PU3 A;  2CXD A;  5LXT E;  2EHO D;  2CWO A;  4HGA A;  3GA8 A;  4PW8 A;  4MFR A;  4IGU A;  5ABG A;  4C91 A;  1E1H B;  4HTE A;  3IA3 A;  4I43 B;  4HKA A;  4Z90 A;  1HX8 A;  4YTN A;  5JRC A;  4AXP A;  3AEA A;  4HEA A;  4UEL A;  1I94 T;  5AQS B;  3OBV E;  3PTR B;  2VKO A;  3QUJ A;  1LVF A;  2UU9 T;  2K24 A;  3UT5 E;  4IE7 A;  3PUR A;  1J1J A;  2VL0 A;  3SFD A;  4QH5 A;  4IHJ E;  3QB5 K;  3KDS E;  5JRC B;  2LJL A;  5HXS A;  2J1D G;  2VUR A;  4O4L E;  4J2C A;  5J1G A;  3CX8 B;  3AA1 B;  5C8Y E;  2NWB A;  3OVU A;  3HKE E;  3LBX B;  1W0A A;  2IML A;  2C5J A;  3IF8 B;  3RC3 A;  5CJ5 A;  1XDO A;  3C51 A;  2L3L A;  4HE8 A;  4GOU A;  4DVD A;  2WS3 A;  2IIU A;  2XQ9 A;  2V26 A;  4H63 V;  2NOX A;  3ZC1 A;  1N36 T;  4EYY R;  4B3M T;  3ZT7 A;  4ZOL E;  3U78 A;  2XAJ B;  4JI4 T;  1WYC A;  2D0U A;  3RIF A;  3QK6 A;  2CA5 A;  4H9N C;  5FL0 A;  2BKO A;  4MLK A;  2E9X D;  3F2E A;  2VKD A;  3RRW A;  3UUX B;  3UU4 A;  3RPU A;  1HG2 A;  5HEH A;  2IHR 1;  3ZC0 A;  4ILB A;  1WYB A;  1IBL T;  4WYV A;  3ANW A;  1FJG T;  4AI6 A;  5LCY A;  1M62 A;  2CEA A;  5IUX A;  3N5L A;  5ABH A;  4DV5 T;  3Q2M A;  3T8O A;  5AQK B;  3A8Y C;  2G0U A;  3ZMV B;  3LSV A;  5ADX L;  2D2S A;  3I1A A;  3RYF E;  2FJA A;  1W9R A;  3MZK B;  4O2B E;  2MYS A;  3BQL A;  1ZV4 X;  4PNI A;  2KT9 A;  1W09 A;  3AAI A;  1IZN B;  5HEO A;  2A2F X;  2CPT A;  4YHH T;  3IBP A;  1WCR A;  5IYZ E;  3JC6 C;  5AQL B;  4TX5 A;  5C2T A;  1V9D A;  3K3N A;  2X0H A;  3IEE A;  2BBJ A;  2NTY A;  4U74 A;  5F5W A;  2ZM2 A;  4CN1 A;  2XSB A;  3H37 A;  4EIW A;  4AQF A;  2BVL A;  1MMD A;  2WBL A;  3AVR A;  4ERR A;  4AQY T;  2VKH A;  2KND A;  5FVK A;  2XQ6 A;  3BK9 A;  3A5X A;  2W2U A;  3PDY A;  4AIU A;  2W67 A;  2YDS A;  4O8S A;  5HYA A;  5L3D B;  1OED E;  1BR4 A;  1IAP A;  2BBH A;  1D1C A;  1UUS A;  2UUA T;  4V1A v;  1UGO A;  4ANJ A;  4EYU A;  4EB6 E;  2D9D A;  3RF1 A;  2CBI A;  4Z8X A;  5LP6 E;  4DR3 T;  2VKJ A;  3IHR A;  3RQW A;  3ZYK A;  2QA7 A;  2YIN A;  2J62 A;  2VVN A;  2WZH A;  3AEE A;  3VRA A;  5AQN B;  2N1G A;  4H9P C;  4HWI B;  1IBM T;  4PJN A;  3Q5E A;  2K48 A;  1MND A;  4TNW A;  5KDM C;  4P1N A;  3PJA J;  4CI3 B;  5L3G B;  2HPJ A;  3FXD B;  2K5B B;  3B57 A;  2LKH A;  5ABE A;  2IDO B;  5F3J A;  3EDV A;  3TKL B;  3C4X A;  2OLT A;  4A5X A;  3C64 A;  2I6H A;  2FBW A;  3H3A A;  2LM9 A;  5AQH B;  4X1Y E;  3PE0 A;  3UFE A;  3HL6 A;  2X51 A;  2WMN A;  2CCQ A;  3BQI A;  5LBM A;  4YFS A;  4U33 A;  4PK4 A;  5C3J A;  3CQC B;  3GWH A;  3UU8 A;  4G63 A;  4X1I E;  3M65 A;  2PG8 A;  4LF5 T;  4ZI2 D;  2YN6 A;  4DUY T;  4DUZ T;  4EXT A;  5L3C B;  2XQY A;  3MKD A;  3P4S A;  3NWI A;  3K1S A;  4PJM A;  1LVK A;  2JRK A;  4DV3 T;  4NIQ A;  2VQF T;  1G8X A;  5HEG A;  2V5C A;  2GK9 A;  2CXF A;  1N32 T;  4E7Z A;  2JIW A;  4G2A A;  2H88 A;  3CX6 B;  4GYS A;  4N78 D;  2UUC T;  3N9P A;  3MA9 A;  1ZHC A;  3AE8 A;  2EHO C;  3KV5 A;  5LG3 A;  3FZK B;  3SRZ A;  4O2A E;  3OTO T;  2IC9 A;  2QRX A;  4ASK A;  2DLR A;  4TZ4 C;  3AB3 B;  1HNX T;  2UXD T;  5DAB A;  4U7I A;  4DND A;  2V6Y A;  3AE9 A;  5ETW A;  1XMQ T;  5LA6 E;  2BKN A;  1ZP0 A;  4H9R C;  4DR1 T;  4WNK A;  2KXP B;  3SS1 A;  4JUY A;  5LG4 A;  3L8R A;  4DV1 T;  3TLT A;  3E08 A;  4JI3 T;  3FBL A;  2C5I T;  1LKX A;  3RX6 A;  2WM9 A;  2XQ3 A;  5FP3 A;  1UX4 A;  2Q9Q C;  4YSX A;  1KF6 A;  3PUY F;  2CRB A;  2EHO A;  3ZN0 B;  4O4H E;  1Z0P A;  3ETV A;  4DID B;  2QYW A;  1YQ3 A;  1Z8U A;  2NR4 A;  2WDR A;  5CA0 E;  5LJN A;  2JQ9 A;  1XDP A;  1MMG A;  4DMW A;  5AQQ B;  3EDU A;  4JEH B;  4DR7 T;  3DP7 A;  4DR2 T;  3AA7 B;  5HWY A;  5JDN A;  2W0G A;  4ILU A;  3LFM A;  2ACZ A;  5LGT B;  2CHN A;  4PFO A;  4IST A;  4JI8 T;  3ZCI A;  2WCA A;  3MAC A;  2ODU A;  1N33 T;  4TN7 B;  2XAH B;  3RIU A;  2EHO B;  2X9Y A;  3ZMZ B;  2MPK A;  2LRK A;  3PUS A;  2ACX A;  2MAW A;  4DV4 T;  5TAO A;  4UF0 A;  4QHO A;  4OK0 A;  3C98 B;  2WDQ A;  3HA4 A;  2ZMA A;  2X0L B;  3J9X 1;  3P7I A;  4Q25 A;  4GK0 E;  1HTJ F;  3VKG A;  5CA1 E;  4HFE A;  2JJ9 A;  3RKO A;  4UXN B;  1OXZ A;  2BG9 C;  1HS7 A;  2M6B A;  4JI0 T;  3RRC A;  4O4I E;  4EEB A;  4IE0 A;  4HFC A;  3NRY A;  4JEU B;  4WBO A;  3PUV F;  4UF0 B;  3RYC E;  5JVD E;  2LSY A;  1ZKE A;  3A7M A;  3OPC A;  2XSA A;  2FJD A;  2L9Q A;  2LT3 A;  1D0Y A;  4XZC A;  4IDP A;  4LF8 T;  4H9Q C;  1QSD A;  2ZM0 A;  4U7Y A;  4LFC T;  4EZ4 A;  5CGM A;  1KFY A;  2D5U A;  5JR9 A;  1E2A A;  1U5P A;  4JI6 T;  3O1I A;  5HEU A;  1NEN A;  2E9X A;  3VR9 A;  2WDV A;  1HR0 T;  4COF A;  3VHL A;  2BG9 A;  3L09 A;  5AQF B;  2XJ7 A;  4TWD A;  2CLY B;  2WP9 A;  3PUQ A;  4PFP A;  2LE8 A;  3OKQ A;  4LMJ A;  1X9B A;  1WFD A;  4YJ2 E;  2V7M A;  3RGL A;  5JTG A;  3UUL A;  4IDZ A;  4JI7 T;  2BDE A;  1WLX A;  4WBN E;  2XY8 B;  2MTQ A;  1KEY A;  3PU8 A;  5CFB A;  5JDG A;  3RH3 A;  3MK7 C;  4UV8 B;  1D1A A;  2BG9 B;  4ZI3 D;  2HN1 A;  4DO0 A;  2XZE A;  5FNV E;  4BJN A;  3FZH B;  2WMO A;  4QX7 B;  5AQI B;  5FXX A;  3TLV A;  2E2A A;  5FXZ A;  2N9D A;  3VR8 A;  3ZT6 A;  3FHN A;  3CKD A;  3DTO A;  4HFB A;  2OV9 A;  2BKP A;  4ISS A;  2HHH T;  3UUN A;  4A97 A;  2QVA A;  3Q5D A;  2CMR A;  3F31 A;  5IHY A;  4X62 T;  5L3B B;  4U2Y A;  3PUX F;  4A98 A;  4LML A;  4MAL A;  3JAD A;  3ESL A;  1ZEE A;  2K9A A;  2XM1 A;  2CBJ A;  1MIV A;  3T1Y T;  1OED A;  2X67 A;  2JQQ A;  3H3M A;  1X79 A;  4AQF C;  3P50 A;  4F8H A;  3PV0 F;  4F6R C;  4DV6 T;  2VK9 A;  2P9B A;  3LK4 2;  3FB2 A;  1ZOY A;  2LM2 A;  2KLQ A;  4AKG A;  2UXX B;  4QH4 A;  2BS2 A;  3SOL A;  3W15 B;  4BJM A;  3O1J A;  2XAQ B;  2VAS A;  3SWH A;  5HCJ A;  3UU5 A;  1J5W A;  2UXC T;  2XUE A;  4U31 A;  1BR0 A;  4C90 A;  2Z6E A;  2UXB T;  4IRE A;  1FMV A;  2B76 A;  3N2O A;  1QLB A;  3V5U A;  3AA6 B;  3TLW A;  3AE2 A;  4L0R A;  3AVS A;  1T8B A;  3ANW B;  4CI1 B;  4UVB B;  4CXW A;  3CWZ B;  4M1P A;  2FJE A;  2V1D B;  2WAU A;  3D0T A;  5IWA T;  5FYM A;  2JPF A;  1YQ4 A;  2I0M A;  4IE4 A;  2XQ5 A;  4U2Z A;  4ZEY A;  4LF9 T;  2SPC A;  3KV6 A;  1D0X A;  2IC6 A;  3AAE B;  2XHE B;  3KBU A;  1QUU A;  3ZPO A;  5LJM A;  2I59 A;  5DQW A;  3MXZ A;  2VB6 A;  5FY1 A;  5AQO B;  5HEJ A;  3AXJ A;  2MBG A;  1W0B A;  4KI0 F;  3CPZ A;  4TNV A;  5JDL A;  5GON E;  4DV7 T;  1WRD A;  3WAJ A;  2A9U A;  2H7O A;  4A56 A;  4FJO A;  2HPL A;  2FUP A;  1R8I A;  5L2L A;  2LSI A;  2XQA A;  3RC8 A;  3NBX X;  3L3P A;  4YSZ A;  3FBZ A;  4OHF A;  2NW7 A;  3RHW A;  3LJC A;  5JRE A;  1SA0 E;  4DR5 T;  2XAS B;  3P4P A;  4GIW A;  1MMN A;  3AXJ B;  1HFA A;  1NWM X;  4X64 T;  2V7J A;  2PTF A;  1H7C A;  2NP9 A;  3UUM A;  4UVA B;  4LF6 T;  1XMO T;  2W63 A;  1LRZ A;  3RQU A;  4IL9 A;  1I6Z A;  3VU7 H;  4I4T E;  1VCT A;  1BR2 A;  2BZB A;  5BR8 T;  4XBF B;  2KSR A;  3AEB A;  3GMI A;  4ZS3 A;  2YU1 A;  3EUH A;  2DWK A;  2IUB A;  1L0V A;  4IE6 A;  1SE7 A;  2DHR A;  4YHJ A;  3AEF A;  3KV4 A;  3N2K E;  2V5D A;  2A72 A;  4UR9 A;  4EZH A;  2PFV A;  4BAY B;  4LMK A;  4CN4 A;  4U72 A;  3AE1 A;  3UQ4 A;  2XQ7 A;  5AQP B;  3KV9 A;  5KXJ A;  2K3W A;  3SFE A;  5LGU B;  4K0K T;  1VRB A;  5L4E A;  5LHI B;  4TUY E;  2ZM6 T;  2XAF B;  2E5L T;  5LNK A;  3UTK A;  2JMH A;  1MIY A;  2KMF A;  3CQX C;  5AQG B;  5J2T E;  4CQI A;  4JI2 T;  1YW0 A;  4P0B A;  2LSK A;  5LOV E;  1B7T A;  1S35 A;  4QX8 B;  2WSS V;  2JQH A;  3CQG B;  4JI1 T;  3JC6 D;  3OJA A;  4ZZB A;  3ZSS A;  4HWC A;  4L9I A;  4EOZ B;  2XAG B;  2CHO A;  3N9L A;  2LLY A;  1S94 A;  3LG7 A;  3NVO A;  3KBT A;  2RP4 A;  2WWU A;  3MJX A;  2CXL A;  4IDQ A;  1FEW A;  5DJQ C;  2XQ8 A;  1XWM A;  3M3Z B;  3V5S A;  5J0Z A;  3RIU C;  2ODV A;  3AE3 A;  5FVL A;  3LK2 B;  5J2U E;  4P09 A;  3ZN1 B;  4X5T A;  4QWN B;  4KX6 A;  3EI0 A;  3N9Q A;  2KWI B;  4GYR A;  4IDO A;  2V6Y B;  4PAG A;  4TV8 E;  3PUW F;  3N9M A;  4KMC A;  5EZY E;  3AAA B;  1UK5 A;  4MBQ A;  2X66 A;  1HNW T;  2Y6X A;  1YXR A;  5KX5 E;  2LRL A;  1YKE B;  4LFA T;  4KUM B;  5JDF A;  3BQK A;  4K0U A;  2V8S V;  2CLY C;  4QXB B;  4HFI A;  5AQM B;  4UEM A;  4ZHQ E;  3KIN B;  4UVC B;  4YSY A;  5AQV B;  4QXH B;  4ZZC A;  3GN5 A;  5FY7 A;  3RKG A;  5JR9 C;  4DR4 T;  3AEC A;  5JDQ A;  2A3D A;  2X9X A;  3X1D A;  3P4Q A;  2E9X C;  2LSG A;  5LHH B;  4DV2 T;  5JQG E;  4KP3 C;  3ABV A;  3O1H A;  4HN9 A;  4CXX A;  3AED A;  2M67 A;  4NUU A;  5A1L A;  4B3S T;  4X65 T;  3LK3 B;  4ZS2 A;  1HX1 B;  2LOP A;  5LYJ E;  4JBW F;  4AIS A;  2BS4 A;  4IL4 A;  4WZX A;  4I55 E;  3QB5 A;  4LF7 T;  3HI2 A;  3OYX A;  1FIO A;  3AE7 A;  3I0O A;  5EK4 A;  1YD8 G;  3P4W A;  2DI4 A;  1UCU A;  3J7Y q;  3ZYM A;  1N34 T;  2KIN B;  2YU2 A;  4AKH A;  1XNR T;  1EZ3 A;  4HWF A;  5AQT B;  3CVR A;  3AE4 A;  2AXD S;  3UFG A;  3G06 A;  2C5K T;  3NZP A;  3FXE B;  5BMV E;  3K8P C;  5JR9 B;  4DBR A;  2FJB A;  4HWH A;  4IT4 A;  4OFZ A;  1WR0 A;  5H6Q B;  1T72 A;  4PK5 A;  4JV5 T;  4YT0 A;  3LBX A;  2YOE A;  2E9X B;  1OED C;  1VCS A;  3B5M A;  4FI5 A;  5KMG P;  2ES0 A;  4EAH A;  3EHZ A;  2F4V T;  3VRB A;  2CWY A;  4EGW A;  1J5E T;  3ZEF B;  2Q9Q D;  4H9S E;  2CE7 A;  1MMA A;  2YEV C;  2V6X A;  5FY0 A;  3U3I A;  2W4X A;  5AQU B;  4YXD A;  4IIJ E;  4HFV A;  4ILA A;  1XZY A;  2NTX A;  3RLF F;  4GK5 E;  1OWA A;  3WI3 A;  2YDQ A;  5EK3 A;  1XNQ T;  1JNZ A;  5LB7 B;  2N2N A;  5LHG B;  4O4J E;  4QXC B;  3ZLI A;  1VOM A;  3NKZ A;  5LMU T;  3NRX A;  1DU2 A;  2M6I A;  2L8K A;  2WZI A;  2PJQ A;  2W61 A;  4HWD A;  4I50 E;  1GQE A;  3CX7 B;  3QC9 A;  4JYA T;  4L5G A;  3F57 A;  2X0Y A;  3P4R A;  5FMN A;  4KBM B;  2BG9 E;  3N2G E;  4LF4 T;  5FKY A;  1IJ6 A;  2WQY A;  3ETU A;  3ZCJ A;  4JI5 T;  4U3C A;  2E5V A;  3EAM A;  4NPP A;  5L4H A;  2R6G F;  4ZI2 C;  2LSJ A;  3B13 A;  1FMW A;  4H9O C;  4IDN A;  2B1E A;  5FXV A;  1OED B;  3TLU A;  4BA9 A;  3K3O A;  4ADZ A;  3JAF A;  1U4Q A;  2JQK A;  3UU6 A;  3Q5X A;  3C50 A;  2DL1 A;  2YKS A;  4ZXL A;  5LMN T;  4I0U A;  2KZ7 B;  4OYJ A;  5JH7 E;  4X20 E;  4PJL A;  2QGS A;  3KFW X;  4KHP T;  4YTM A;  1KNZ A;  4NXN T;  3TLS A;  5L3F B;  3AE6 A;  2J4G A;  4CN6 A;  5CB4 E;  2WY2 A;  3N9N A;  5AQR B;  3ONJ A;  3ZMU B;  1D0Z A;  1SUM B;  3N9O A;  4YY3 T;  2RPA A;  3ZT5 A;  2RA1 A;  5HCM A;  2UXN B;  3HR0 A;  2BS3 A;  2NW9 A;  4MHC A;  1KNR A;  1Y64 B;  2LEH A;  2HH7 A;  3ZST A;  2H7V C;  4X66 T;  4DV0 T;  3QOF A;  3UU3 A;  2ZLY A;  3P8C D;  2VVS A;  1UUR A;  4XAX B;  4B3T T;  3ZYL A;  4B6X A;  4NUV A;  3C4Z A;  1M7K A;  5HXR A;  4WW0 A;  1NEK A;  4Z91 A;  4PJJ A;  2W62 A;  1HCI A;  4X1K E;  2D0T A;  3T1H T;  2BVM A;  1AJ3 A;  3VKH A;  1KK7 A;  5HWX A;  3RIA A;  3KVB A;  2UUB T;  5EK2 A;  2HN2 A;  5L47 A;  3FZM B;  5F8P A;  2Y8D A;  4UIG A;  2W66 A;  3FZL B;  2X68 A;  5FXW A;  3AA0 B;  5LGN B;  2C0S A;  2LKG A;  1KNP A;  3DJB A;  1Y01 A;  1MIW A;  5E0O A;  3QNU A;  2LHR A;  3CIR A;  3O9X A;  2DNX A;  4ZI7 E;  4AQG A;  2H3R A;  4DBQ A;  4AKL A;  4EED A;  2PBI A;  3I0Q A;  3UUB A;  3CML A;  2YDR A;  4ILC A;  5L3E B;  3CK6 A;  1HG5 A;  5ABF A;  3R6N A;  1D1B A;  3O4X E;  3RYH E;  1IBK T;  1CUN A;  3ZJ1 A;  4HFD A;  3OYZ A;  2DWG A;  2VQE T;  5H6R B;  2Y48 B;  3ONX A;  2VWA A;  4EV6 A;  2KWH A;  4DR6 T;  5HAX A;  2OA5 A;  2XQ4 A;  3S4U A;  3NZQ A;  2V7L A;  3PUG A;  5ABF B;  2V7K A;  1T98 A;  3PJA A;  1NAF A;  5HXE A;  1UX5 A;  3Q9D A;  3C4W A;  5DQV A;  3JCF A;  3JAE A;  2NW8 A;  4OX9 T;  3ZJ2 A;  5AQJ B;  3RI5 A;  3FZF B;  1YKH B;  2H89 A;  3HKB E;  3WAK A;  5FL1 A;  3PUA A;  3AEG A;  2YK0 A;  4LFB T;  5JDM A;  4DMV A;  1E7P A;  5AFU L;  3ZKR A;  4QKN A;  3I9W A;  2LHN A;  4JLE A;  3AE5 A;  2X9H A;  3HKC E;  2XPK A;  3Q5W A;  4QH1 A;  4ZI3 C;  3E0Z A;  3UQ7 A;  4TWF A;  1HNZ T;  3HKD E;  3K3Q C;  3LDQ B;  5LBQ B;  4AKI A; 
#chains in the Genus database with same CATH homology
 4DV0 T;  4X66 T;  4JI0 T;  4DV1 T;  1IBK T;  1N36 T;  4JI5 T;  4DR4 T;  4JI3 T;  4LF6 T;  1XMO T;  4B3M T;  4B3T T;  4JV5 T;  2VQE T;  4JI4 T;  2UUA T;  4DR6 T;  4DV2 T;  2HHH T;  5BR8 T;  2F4V T;  5IWA T;  4GKK T;  4LF5 T;  4LF9 T;  4DR3 T;  1J5E T;  3T1H T;  1I94 T;  4LF8 T;  4DUY T;  4DUZ T;  4X62 T;  4LFC T;  2UUB T;  1IBL T;  5LMN T;  4DR7 T;  4B3S T;  4X65 T;  4DR2 T;  4OX9 T;  2UU9 T;  4DV3 T;  4JI6 T;  1FJG T;  2VQF T;  4KHP T;  4DV5 T;  1N32 T;  3T1Y T;  1HR0 T;  4JI8 T;  1IBM T;  1XNQ T;  4LF7 T;  4NXN T;  2UUC T;  4K0K T;  4DV7 T;  4LFB T;  4DV6 T;  5LMU T;  1N33 T;  2ZM6 T;  3OTO T;  4B3R T;  2E5L T;  4YHH T;  4DV4 T;  4NXM T;  1HNW T;  4JI2 T;  1HNX T;  2UXD T;  1N34 T;  4YY3 T;  4LFA T;  4JYA T;  4JI7 T;  1XNR T;  2UXC T;  4JI1 T;  1XMQ T;  4DR5 T;  1HNZ T;  2UXB T;  4DR1 T;  4LF4 T;  4X64 T;  4GKJ T;  4AQY T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...