4LF9T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4lf9T00
4JYAT 4DUYT 1N36T 4DR2T 4DUZT 4OX9T 4YHHT 4LFAT 4LF4T 4DR6T 4B3MT 2HHHT 4DV5T 2UU9T 3OTOT 1J5ET 4GKJT 5LMNT 1IBMT 2ZM6T 4K0KT 4X65T 4LF8T 4DR5T 4LF6T 3T1HT 1XNRT 4JV5T 1IBKT 4JI8T 5LMUT 1N32T 2VQET 4JI7T 4X62T 4DV7T 2UUCT 4LF7T 3T1YT 4DR4T 2E5LT 4DV3T 4DR7T 4LFBT 4DV1T 4B3ST 1XMQT 4B3TT 5IWAT 1XMOT 4JI3T 1N34T 1HR0T 2UXBT 4DV0T 4NXNT 4B3RT 4LF5T 4LF9T 4DR1T 4KHPT 4X66T 2F4VT 4X64T 4JI6T 4JI4T 4DR3T 1HNWT 2UUAT 1XNQT 4LFCT 2UXDT 5BR8T 2UUBT 1FJGT 2VQFT 4JI1T 1IBLT 2UXCT 4NXMT 4DV4T 4AQYT 1HNXT 4DV6T 1N33T 4JI5T 4JI2T 1HNZT 1I94T 4GKKT 4DV2T 4JI0T 4YY3T
chains in the Genus database with same CATH superfamily
4DIDB 3F31A 2WB5A 2V5CA 5JH7E 3UTKA 3AAEB 2VWAA 1MMDA 3N5LA 4NPPA 4EXTA 4LF4T 3T8OA 2BKOA 2LSIA 3RIFA 4K0UA 2WU2A 5HXRA 4A98A 2UU9T 3OTOT 2MTQA 4Z91A 2D9DA 4LF8T 3NVOA 1HX8A 4IE5A 5FXVA 3LK3B 2E9XD 1XNRT 1JNZA 4IDZA 4CN4A 2AXDS 3BQKA 4MHCA 2YN6A 4O4LE 2VKOA 3PDYA 4O2AE 3RPUA 1WYCA 3A5XA 4U2ZA 5F5WA 3TKLB 4ANJA 2D2SA 4WBNE 2EHOD 2C5JA 3RYIE 2WAUA 1FEWA 1HX1B 3I9YA 2UXNB 3ZMUB 3Q5XA 1XNQT 2ZM2A 3HKDE 1E2AA 4DNDA 2HN1A 3VU7H 3PTRB 3Q5EA 2EHOA 2IC6A 2XQAA 3L09A 3PUVF 2BS2A 2UXCT 1WLXA 3RIAA 5M4YA 4JI2T 2NOXA 2NWBA 4U31A 4GKKT 4DVDA 4JI0T 2FJDA 2FJAA 3M3ZB 1G73A 3LBXB 4H9NC 3P4PA 3TLVA 3U78A 1WRDA 2B1EA 2W66A 5CJ5A 2X66A 4OX9T 2DL1A 1MIWA 4AKIA 2CEAA 2JMHA 2JPFA 2OV9A 1Z0PA 2XAHB 4QH1A 4YSZA 4L0RA 5LB7B 3PURA 1KEYA 1IBMT 3AE9A 3MZKB 3QK6A 4IDPA 1FMVA 2RPAA 3UU3A 4ZEYA 3T1HT 3PUSA 4X1IE 4EEBA 5KMGP 3DP7A 4WW0A 2XM1A 3I9WA 4XZCA 4UVAB 3SS1A 5AQKB 2KINB 4IHJE 2HPLA 3TLUA 2AE9A 4JI3T 4PJLA 3GWHA 1GQEA 2JJ9A 2ACXA 2LSGA 5C3JA 5AQRB 3ZMTB 4X64T 3C4XA 5IHYA 5ETWA 3PJAA 3FB2A 2ODUA 3J9X1 2BBJA 2H88A 3LK42 3AE8A 1I94T 4TWFA 4YTMA 2CLYB 4JYAT 4HEAA 4DUZT 5LGNB 4X1KE 3N9QA 4LFAT 2J1DG 3IA3A 4UEMA 2KNDA 3RRWA 2W61A 2GK9A 2VL8A 3LG7A 5F8PA 2YEVC 2K9AA 4XBFB 4K0KT 3AA6B 4DO0A 5L3DB 1ZKEA 5L4HA 2OLTA 1LVFA 4EEDA 2LRLA 1OEDE 5LMUT 2M67A 4P09A 2JQ9A 2UXXB 2YU1A 4U33A 4U7YA 3AAIA 2OA5A 4EYUA 4NIQA 4TV8E 4ZI3C 4YXDA 3LDQB 4ZOLE 1V9DA 3LJCA 4DMWA 4ERRA 2IC9A 2IUBA 4IE0A 5FKYA 3WAKA 2WMOA 5HXEA 3RHWA 2V7LA 5JR9A 5GONE 4G2AA 3RQWA 5EK4A 4EZHA 2IW5B 2KZ7B 3H3AA 4UIGA 4O8SA 2NTYA 4AQFC 3IF8B 1SE7A 2UUBT 5LJNA 1HS7A 2XUEA 5CFBA 4AKGA 2BDEA 1OEDA 2L8KA 1S35A 5J1GA 5AFUL 2LT3A 5AQVB 3ZCJA 2IDOB 3UUNA 4PFOA 3IHRA 4ZZBA 5L47A 1IZNB 3VRBA 5JRCA 3MXZA 2MPKA 3O1HA 2V7IA 4YHHT 4O4HE 5LXTE 3KV5A 2W00A 3CX6B 1ZHCA 2X67A 3GA8A 3PUZF 2V6YA 4DV5T 2WBLA 2ZM8A 3KDSE 3ANWB 4I4TE 2JQQA 3ETVA 3UU8A 5FL1A 1KNRA 4GYSA 4PJJA 2LKHA 3F2EA 4PW8A 5LG4A 2I6HA 3AA1B 4C90A 5AQTB 2W2UA 3NWIA 5FVLA 3UFEA 3HKEE 3AA7B 2E5LT 4V1Av 1OEDB 2G0UA 2BZBA 4TZ4C 4LFBT 3MA9A 3SFDA 3ZPOA 4U3CA 3C98B 5FY7A 4IE7A 4NXNT 4QX8B 2Q9QB 4PK6A 5JRCB 4HGAA 3G06A 2V8SV 1QUUA 1LKXA 4AKRB 3KV4A 4YSXA 3GMIA 4G63A 2V6YB 1T8BA 2HH7A 1UUSA 4AQYT 3PU3A 3J7Yq 4JI5T 3FZKB 1CUNA 4ISTA 3L3PA 2YDQA 4AKHA 2FJBA 3ZJ1A 1XDOA 4JBWF 2WWUA 5HEJA 3EABA 2WQYA 3C4ZA 4HWDA 4DR6T 4TWHA 5DQWA 5JDNA 3N2KE 5AQUB 3ZKRA 3RQUA 4PK4A 4IT4A 1KFYA 1G8XA 3AE3A 2KWHA 4X1YE 1MNDA 2WM9A 5AQMB 5FYMA 4LF7T 4PK5A 3RKOA 3HR0A 3ZMSB 5DQVA 2QGSA 2XQ3A 2LOSA 3N9PA 5L3CB 1HR0T 3PUGA 5ABGA 1U4QA 4L9IA 3V5UA 1T72A 1NAFA 2DCFA 1LVKA 2CLYC 1J5WA 3AE2A 4GOUA 2JQKA 3MJXA 1I6ZA 2BG9E 2LOPA 2QYWA 1HNXT 3RLFF 3UQ7A 3CQXC 2N9DA 1UX4A 2J47A 4ZZCA 4UXNB 5LHIB 2NW8A 1D0ZA 3B5MA 3OBVE 4PAGA 4LMJA 3ZSTA 3P8CD 4B3MT 2LEHA 5ABFA 4F8HA 3PE0A 3CMLA 1U5PA 2BG9A 2YOEA 4ISSA 3UT5E 5FVKA 4QH4A 1YQ3A 1MIYA 4MBQA 4X62T 2WU5A 3VR9A 2X9XA 5AQLB 3FZFB 4DR4T 1HF8A 4L5GA 2CHOA 4DR7T 2JRKA 3UFGA 3PUXF 4B3ST 3D0TA 4UF0A 3FBZA 2DI4A 3TLSA 2PG8A 5HWYA 4Q25A 3KVAA 3OKQA 3O4XE 4UR9A 2H89A 2XSAA 5F3JA 4JI4T 1VCTA 5ABFB 2QA7A 2MYSA 2E9XA 3QOFA 4JI1T 3UUXB 4IE6A 4P0AA 2J4GA 5LBQB 2CWOA 2XHEB 2LSYA 4BAYB 3MK7C 5KXJA 3FXEB 4COFA 5JDFA 4KP3C 1HFAA 4I0UA 2E5VA 2WZIA 2CBJA 2W63A 3C51A 3VRAA 5H6RB 3HL6A 3ONLC 5LMNT 1OEDC 3RYCE 4AIUA 2BVLA 4QWNB 4NUVA 1D1CA 3PJAJ 2Y48B 3RX6A 2XY8B 2XQ4A 3TLTA 2Q9QC 3RF1A 3O1IA 2N1GA 4HFCA 2CM0A 3N2GE 4CI2B 5HWXA 2E9XB 4UVBB 1L0VA 4H63V 4HFHA 3NZQA 3CK6A 2VK9A 1XMQT 3RIUA 3PUWF 3CIRA 4QX7B 5IWAT 4HWCA 2WZHA 1IJ6A 2IAKA 2UXBT 2K48A 5LBMA 4MALA 2X9WA 2ACZA 2EHOB 1YXRA 2X0YA 5LGTB 2NTXA 1HG2A 2LSKA 3L39A 3AA0B 4CXYA 1FMWA 2XASB 4JLEA 5JDMA 5AQHB 1HNZT 4HE8A 4DV2T 2KT9A 1R8IA 5FY1A 3KV6A 3AVSA 3AAAB 1HCIA 3P50A 5JTGA 2VKDA 5HEUA 4KI0F 3E08A 3UULA 4JEHB 1WCRA 4ZXLA 3UUBA 2XQ6A 4H9SE 5EZYE 2CRBA 2MAWA 3R6NA 1J5ET 2W67A 3JAFA 2XPKA 3RH3A 3B13A 3C64A 3ESLA 4LF6T 2KLQA 4IL4A 1FIOA 2WCAA 1S94A 2H7VC 3OPCA 3KVBA 4AKLA 4YHJA 1VOMA 3KFWX 2HPJA 3ZMZB 4CXWA 1W09A 5HEOA 1XMOT 4GIWA 1N34T 2KMFA 4ZS3A 4ZI2C 4X66T 5FNVE 3RYFE 2V1DB 4ILAA 1XDPA 3EHZA 5J0ZA 4ILUA 4PJMA 1FJGT 3JC6C 4EGWA 2K5BB 2D0TA 4WYVA 3JCFA 3K3OA 2DNXA 4CN1A 2FUPA 4DBQA 1HTJF 3RYHE 3ONXA 3MKDA 4I43B 3AE4A 4WNKA 2WDVA 2D0UA 5E0OA 4ZI7E 3SOLA 3OJAA 4YTNA 4IDQA 1XWMA 1YD8G 5TAOA 4X65T 4ASKA 2XQ7A 5LG3A 5HEGA 4TNVA 3KINB 5LP6E 2P9BA 4QXHB 4TN7B 2JIWA 4JUYA 5HCMA 2KWIB 3AEGA 2VB6A 3IEEA 1QLBA 2PJQA 1SUMB 5JR9B 4HWIB 4DV1T 3OYZA 3P4QA 1QSDA 4DV0T 2LHRA 1H7CA 1M7KA 2BG9C 2NW9A 4H9RC 2VL0A 4M1PA 2CA5A 2ZMAA 4KHZF 3N9MA 2BKNA 4LFCT 2E2AA 3FZHB 3GN5A 5ADXL 1UCUA 1D0YA 2PTFA 2XQYA 4CN6A 4IDNA 3SFEA 1BR2A 1IBLT 4YJ3E 2WS3A 3NZPA 4BA9A 5L3BB 4IL9A 3LSVA 4HFBA 2A3DA 3VKGA 3NRYA 1T98A 2RP4A 1EZ3A 4Z8XA 3UUMA 3BQLA 4ADZA 3ABVA 1D0XA 4MFRA 4IREA 5HEHA 2PFVA 2E9XC 3NRXA 3WAJA 4GKJT 1ZEEA 2L9QA 2ZM6T 2I59A 2DWKA 3ZLIA 1HG5A 4PNIA 3DJBA 3K1SA 2CBIA 2KXPB 4HFVA 2C5IT 1SHZC 3ZEFB 2XTLA 3VHLA 2EHOC 4H9OC 5FL0A 3IBPA 2Z6EA 5EK3A 3EDUA 5CA1E 3AE5A 4H63H 1M62A 4QHOA 3CQCB 4BJMA 3I0OA 1BR0A 5LGUB 4QH5A 1UGOA 1D1AA 4OYKA 4ZI3D 3FZLB 2Y8DA 4HFDA 3O1JA 3R84B 3EDVA 5AQOB 4YSYA 2V7KA 5JQGE 5BR8T 3I1AA 4UELA 3PU8A 1ZP0A 4KX6A 5FMNA 3I0QA 1MIVA 2IHR1 4CI1B 3RIUC 1N33T 2XQ5A 3AXJA 4WZXA 2VVNA 4QXCB 4UV8B 1OXZA 3DTOA 3FXDB 2A72A 5AQPB 3O9XA 4BJNA 4A5XA 3PV0F 3EVYA 2W62A 5JDLA 5AQFB 2SPCA 1VCSA 3VKHA 1IBKT 4TV9E 2XM2A 2LLYA 4JI7T 3AEBA 4NUUA 3T1YT 3E22E 4E7SA 5J2UE 4DV3T 3Q5WA 2V7MA 4ILCA 4EV6A 2BS3A 2X0LB 3LFMA 4U2YA 3P4RA 3FZMB 3Q2MA 3AEFA 2YKSA 4O4JE 4HWHA 4H9PC 2XQ8A 4I55E 2DHRA 5ABEA 2QVAA 2LM2A 1BR1A 4JI6T 5LHGB 2H7OA 2WMNA 5AQGB 3W15B 4FI5A 4KBMB 1KK7A 1MMNA 2LJLA 2DLRA 4EOZB 5C8YE 3AE1A 2LM9A 3AVRA 5AQNB 1J1JA 4HKAA 1NENA 3SRZA 3E0ZA 3M65A 5LJMA 3HI2A 3LBXA 2ZLYA 4X20E 4A56A 2BG9B 3AEAA 3HA4A 3ONJA 3X1DA 3ZT5A 2CCQA 2XJ7A 5JR9C 4P0BA 5IYZE 2YK0A 2C5KT 5KDMC 5FY0A 4AI6A 3CWZB 4IE4A 3CPZA 5AQJB 1UK5A 2B76A 4AISA 4IGUA 2VKHA 4UF0B 5LOVE 2V26A 5AQSB 3MACA 2YU2A 2KSRA 3AE6A 2I0MA 1Y01A 3TLWA 3CX7B 4PFPA 1KF6A 2CMRA 4B3RT 4LF5T 3NKZA 4DR1T 4YTPA 4TUYE 3KBTA 5FXXA 5J2TE 4LMKA 4YJ2E 3EAMA 5FXWA 2C0SA 3ZN0B 1KNZA 5LHHB 3ZT7A 2XSBA 2UXDT 1Y64B 4O2BE 5L3EB 2RA1A 2A2FX 2V6XA 1W9RA 2X9YA 3ZYMA 4YY3T 3AE7A 3UU5A 4DUYT 3CQGB 2K24A 5LYJE 2XAGB 4OK0A 4GK5E 4J2CA 2L3LA 4HFEA 4TWDA 3KBUA 3A7MA 1X79A 4OHFA 5BMVE 3Q5DA 1SA0E 5L3GB 3FBLA 3RC8A 2JQHA 3AEDA 2VASA 3PUYF 2IMLA 4DR5T 3A8YC 4JI8T 2A9UA 4H9QC 3C50A 2CXLA 2R6GF 2CE7A 1MMAA 3H37A 4EAHA 3K8PC 4IIJE 1CHUA 2D5UA 1ZOYA 3KV9A 4U7IA 4OYJA 5AQIB 3LK2B 1Z8UA 1E1HB 2NP9A 2WDQA 1W0BA 4KHPT 3P4WA 2X9HA 3PUAA 2ZM0A 4QKNA 4P1NA 4PJNA 1B7TA 4TX5A 3JADA 1W0AA 2J62A 3ZCIA 1YW0A 5IUXA 4DV4T 4DV6T 3ZT6A 5DJQC 5L3FB 3OVUA 2YDSA 5HAXA 4CXXA 2FBWA 3ZYLA 1JNRA 1N36T 2WWVA 1WR0A 2N2NA 3PUQA 4XAXB 4LMLA 2HN2A 2LKGA 5CA0E 4U72A 5HXHA 4EYYR 2HHHT 4YT0A 2LHNA 5FP3A 5C2TA 3F57A 4U74A 4X5TA 4Z90A 2MBGA 2ES0A 3ZSSA 3ANWA 3CKDA 3BQIA 1MNEA 2X68A 4ZHQE 2XZEA 4DMVA 1N32T 4CZZB 2M6BA 2YINA 2BS4A 2CWYA 4KUMB 3B57A 4HWFA 5ABHA 4KMCA 3S4UA 3QUJA 5LA6E 5L2LA 2Q9QD 3HKBE 2YDRA 5CB4E 1WYBA 5DABA 3K3NA 5JDQA 1MMGA 5JREA 5KX5E 1D1BA 1WFDA 1YKEB 2CHNA 4DR3T 1ZV4X 2Q9QA 3NBXX 4E7ZA 3AEEA 4EB6E 2V7JA 2VQFT 3RKGA 2VVSA 3QB5K 2VURA 4ZS2A 5EK2A 4A97A 4YFSA 4WBOA 1WR6A 3CX8B 5CGMA 5HXSA 2QRXA 2CXFA 4DBRA 4IDOA 3N9NA 4F6RC 2WSSV 5LNKA 4O4IE 4OFZA 3CVRA 2LRKA 4AQGA 1DU2A 2H3RA 4QXBB 2WY2A 1BR4A 4UV9B 4I50E 1XZYA 3N9LA 4HFIA 3VR8A 5JDGA 3C4WA 2NW7A 1X9BA 2VQET 2M6IA 4DV7T 5HYAA 2WDRA 3BK9A 1OWAA 3SWHA 2XAJB 5JVDE 1YQ4A 3QNUA 3HKCE 3V5SA 5HCJA 2IIUA 5LCYA 2BVMA 5AQQB 2X0HA 1VRBA 3U3IA 4AXPA 4LF9T 3GN5B 2W0GA 4CI3B 2UUAT 2WP9A 4TNWA 4ZI2D 5HXCA 4EZ4A 3AB3B 2XQ9A 3ZN1B 1UURA 4NXMT 3RGLA 3EUHA 1YKHB 1IJ5A 1IAPA 2LE8A 4JEUB 4HN9A 3QB5A 1KNPA 2VKJA 3JC6D 4MLKA 1NEKA 3ZMVB 4DR2T 2XAQB 3UU6A 1US7B 2JMKA 1E7PA 3P4SA 2V5DA 4CQIA 3QC9A 2K3WA 3L8RA 4GK0E 3Q9DA 2BKPA 3P7IA 2FJEA 3UU4A 5A1LA 3EI0A 4GYRA 5L4EA 4EIWA 5FXZA 3ZJ2A 3ETUA 2E8IA 2W4XA 5H6QB 3JAEA 4JV5T 2PBIA 1T7SA 3UQ4A 4AQFA 2UUCT 3H3MA 3K3QC 3OYXA 2X51A 2ODVA 4B3TT 2LSJA 2CPTA 3ZC0A 2Y6XA 4B6XA 1NWMX 4N78D 1O3XA 2F4VT 4UVCB 2CXDA 1AJ3A 3FHNA 3RC3A 2XAFB 3RI5A 3AECA 1HNWT 3RRCA 5JDHA 3AXJB 4ILBA 1LRZA 2NR4A 4FJOA 2DWGA 1UX5A 4HTEA 4C91A 4YLHA 3N9OA 2BBHA 3WI3A 3N2OA 2MOZA 3ZC1A 3ZYKA
chains in the Genus database with same CATH topology
4JYAT 4DUYT 1N36T 4DR2T 4DUZT 4OX9T 4YHHT 4LFAT 4LF4T 4DR6T 4B3MT 2HHHT 4DV5T 2UU9T 3OTOT 1J5ET 4GKJT 5LMNT 1IBMT 2ZM6T 4K0KT 4X65T 4LF8T 4DR5T 4LF6T 3T1HT 1XNRT 4JV5T 1IBKT 4JI8T 5LMUT 1N32T 2VQET 4JI7T 4X62T 4DV7T 2UUCT 4LF7T 3T1YT 4DR4T 2E5LT 4DV3T 4DR7T 4LFBT 4DV1T 4B3ST 1XMQT 4B3TT 5IWAT 1XMOT 4JI3T 1N34T 1HR0T 2UXBT 4DV0T 4NXNT 4B3RT 4LF5T 4LF9T 4DR1T 4KHPT 4X66T 2F4VT 4X64T 4JI6T 4JI4T 4DR3T 1HNWT 2UUAT 1XNQT 4LFCT 2UXDT 5BR8T 2UUBT 1FJGT 2VQFT 4JI1T 1IBLT 2UXCT 4NXMT 4DV4T 4AQYT 1HNXT 4DV6T 1N33T 4JI5T 4JI2T 1HNZT 1I94T 4GKKT 4DV2T 4JI0T 4YY3T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYA T;  4DUY T;  1N36 T;  4DR2 T;  4DUZ T;  4OX9 T;  4YHH T;  4LFA T;  4LF4 T;  4DR6 T;  4B3M T;  2HHH T;  4DV5 T;  2UU9 T;  3OTO T;  1J5E T;  4GKJ T;  5LMN T;  1IBM T;  2ZM6 T;  4K0K T;  4X65 T;  4LF8 T;  4DR5 T;  4LF6 T;  3T1H T;  1XNR T;  4JV5 T;  1IBK T;  4JI8 T;  5LMU T;  1N32 T;  2VQE T;  4JI7 T;  4X62 T;  4DV7 T;  2UUC T;  4LF7 T;  3T1Y T;  4DR4 T;  2E5L T;  4DV3 T;  4DR7 T;  4LFB T;  4DV1 T;  4B3S T;  1XMQ T;  4B3T T;  5IWA T;  1XMO T;  4JI3 T;  1N34 T;  1HR0 T;  2UXB T;  4DV0 T;  4NXN T;  4B3R T;  4LF5 T;  4LF9 T;  4DR1 T;  4KHP T;  4X66 T;  2F4V T;  4X64 T;  4JI6 T;  4JI4 T;  4DR3 T;  1HNW T;  2UUA T;  1XNQ T;  4LFC T;  2UXD T;  5BR8 T;  2UUB T;  1FJG T;  2VQF T;  4JI1 T;  1IBL T;  2UXC T;  4NXM T;  4DV4 T;  4AQY T;  1HNX T;  4DV6 T;  1N33 T;  4JI5 T;  4JI2 T;  1HNZ T;  1I94 T;  4GKK T;  4DV2 T;  4JI0 T;  4YY3 T; 
#chains in the Genus database with same CATH topology
 4DID B;  3F31 A;  2WB5 A;  2V5C A;  5JH7 E;  3UTK A;  3AAE B;  2VWA A;  1MMD A;  3N5L A;  4NPP A;  4EXT A;  4LF4 T;  3T8O A;  2BKO A;  2LSI A;  3RIF A;  4K0U A;  2WU2 A;  5HXR A;  4A98 A;  2UU9 T;  3OTO T;  2MTQ A;  4Z91 A;  2D9D A;  4LF8 T;  3NVO A;  1HX8 A;  4IE5 A;  5FXV A;  3LK3 B;  2E9X D;  1XNR T;  1JNZ A;  4IDZ A;  4CN4 A;  2AXD S;  3BQK A;  4MHC A;  2YN6 A;  4O4L E;  2VKO A;  3PDY A;  4O2A E;  3RPU A;  1WYC A;  3A5X A;  4U2Z A;  5F5W A;  3TKL B;  4ANJ A;  2D2S A;  4WBN E;  2EHO D;  2C5J A;  3RYI E;  2WAU A;  1FEW A;  1HX1 B;  3I9Y A;  2UXN B;  3ZMU B;  3Q5X A;  1XNQ T;  2ZM2 A;  3HKD E;  1E2A A;  4DND A;  2HN1 A;  3VU7 H;  3PTR B;  3Q5E A;  2EHO A;  2IC6 A;  2XQA A;  3L09 A;  3PUV F;  2BS2 A;  2UXC T;  1WLX A;  3RIA A;  5M4Y A;  4JI2 T;  2NOX A;  2NWB A;  4U31 A;  4GKK T;  4DVD A;  4JI0 T;  2FJD A;  2FJA A;  3M3Z B;  1G73 A;  3LBX B;  4H9N C;  3P4P A;  3TLV A;  3U78 A;  1WRD A;  2B1E A;  2W66 A;  5CJ5 A;  2X66 A;  4OX9 T;  2DL1 A;  1MIW A;  4AKI A;  2CEA A;  2JMH A;  2JPF A;  2OV9 A;  1Z0P A;  2XAH B;  4QH1 A;  4YSZ A;  4L0R A;  5LB7 B;  3PUR A;  1KEY A;  1IBM T;  3AE9 A;  3MZK B;  3QK6 A;  4IDP A;  1FMV A;  2RPA A;  3UU3 A;  4ZEY A;  3T1H T;  3PUS A;  4X1I E;  4EEB A;  5KMG P;  3DP7 A;  4WW0 A;  2XM1 A;  3I9W A;  4XZC A;  4UVA B;  3SS1 A;  5AQK B;  2KIN B;  4IHJ E;  2HPL A;  3TLU A;  2AE9 A;  4JI3 T;  4PJL A;  3GWH A;  1GQE A;  2JJ9 A;  2ACX A;  2LSG A;  5C3J A;  5AQR B;  3ZMT B;  4X64 T;  3C4X A;  5IHY A;  5ETW A;  3PJA A;  3FB2 A;  2ODU A;  3J9X 1;  2BBJ A;  2H88 A;  3LK4 2;  3AE8 A;  1I94 T;  4TWF A;  4YTM A;  2CLY B;  4JYA T;  4HEA A;  4DUZ T;  5LGN B;  4X1K E;  3N9Q A;  4LFA T;  2J1D G;  3IA3 A;  4UEM A;  2KND A;  3RRW A;  2W61 A;  2GK9 A;  2VL8 A;  3LG7 A;  5F8P A;  2YEV C;  2K9A A;  4XBF B;  4K0K T;  3AA6 B;  4DO0 A;  5L3D B;  1ZKE A;  5L4H A;  2OLT A;  1LVF A;  4EED A;  2LRL A;  1OED E;  5LMU T;  2M67 A;  4P09 A;  2JQ9 A;  2UXX B;  2YU1 A;  4U33 A;  4U7Y A;  3AAI A;  2OA5 A;  4EYU A;  4NIQ A;  4TV8 E;  4ZI3 C;  4YXD A;  3LDQ B;  4ZOL E;  1V9D A;  3LJC A;  4DMW A;  4ERR A;  2IC9 A;  2IUB A;  4IE0 A;  5FKY A;  3WAK A;  2WMO A;  5HXE A;  3RHW A;  2V7L A;  5JR9 A;  5GON E;  4G2A A;  3RQW A;  5EK4 A;  4EZH A;  2IW5 B;  2KZ7 B;  3H3A A;  4UIG A;  4O8S A;  2NTY A;  4AQF C;  3IF8 B;  1SE7 A;  2UUB T;  5LJN A;  1HS7 A;  2XUE A;  5CFB A;  4AKG A;  2BDE A;  1OED A;  2L8K A;  1S35 A;  5J1G A;  5AFU L;  2LT3 A;  5AQV B;  3ZCJ A;  2IDO B;  3UUN A;  4PFO A;  3IHR A;  4ZZB A;  5L47 A;  1IZN B;  3VRB A;  5JRC A;  3MXZ A;  2MPK A;  3O1H A;  2V7I A;  4YHH T;  4O4H E;  5LXT E;  3KV5 A;  2W00 A;  3CX6 B;  1ZHC A;  2X67 A;  3GA8 A;  3PUZ F;  2V6Y A;  4DV5 T;  2WBL A;  2ZM8 A;  3KDS E;  3ANW B;  4I4T E;  2JQQ A;  3ETV A;  3UU8 A;  5FL1 A;  1KNR A;  4GYS A;  4PJJ A;  2LKH A;  3F2E A;  4PW8 A;  5LG4 A;  2I6H A;  3AA1 B;  4C90 A;  5AQT B;  2W2U A;  3NWI A;  5FVL A;  3UFE A;  3HKE E;  3AA7 B;  2E5L T;  4V1A v;  1OED B;  2G0U A;  2BZB A;  4TZ4 C;  4LFB T;  3MA9 A;  3SFD A;  3ZPO A;  4U3C A;  3C98 B;  5FY7 A;  4IE7 A;  4NXN T;  4QX8 B;  2Q9Q B;  4PK6 A;  5JRC B;  4HGA A;  3G06 A;  2V8S V;  1QUU A;  1LKX A;  4AKR B;  3KV4 A;  4YSX A;  3GMI A;  4G63 A;  2V6Y B;  1T8B A;  2HH7 A;  1UUS A;  4AQY T;  3PU3 A;  3J7Y q;  4JI5 T;  3FZK B;  1CUN A;  4IST A;  3L3P A;  2YDQ A;  4AKH A;  2FJB A;  3ZJ1 A;  1XDO A;  4JBW F;  2WWU A;  5HEJ A;  3EAB A;  2WQY A;  3C4Z A;  4HWD A;  4DR6 T;  4TWH A;  5DQW A;  5JDN A;  3N2K E;  5AQU B;  3ZKR A;  3RQU A;  4PK4 A;  4IT4 A;  1KFY A;  1G8X A;  3AE3 A;  2KWH A;  4X1Y E;  1MND A;  2WM9 A;  5AQM B;  5FYM A;  4LF7 T;  4PK5 A;  3RKO A;  3HR0 A;  3ZMS B;  5DQV A;  2QGS A;  2XQ3 A;  2LOS A;  3N9P A;  5L3C B;  1HR0 T;  3PUG A;  5ABG A;  1U4Q A;  4L9I A;  3V5U A;  1T72 A;  1NAF A;  2DCF A;  1LVK A;  2CLY C;  1J5W A;  3AE2 A;  4GOU A;  2JQK A;  3MJX A;  1I6Z A;  2BG9 E;  2LOP A;  2QYW A;  1HNX T;  3RLF F;  3UQ7 A;  3CQX C;  2N9D A;  1UX4 A;  2J47 A;  4ZZC A;  4UXN B;  5LHI B;  2NW8 A;  1D0Z A;  3B5M A;  3OBV E;  4PAG A;  4LMJ A;  3ZST A;  3P8C D;  4B3M T;  2LEH A;  5ABF A;  4F8H A;  3PE0 A;  3CML A;  1U5P A;  2BG9 A;  2YOE A;  4ISS A;  3UT5 E;  5FVK A;  4QH4 A;  1YQ3 A;  1MIY A;  4MBQ A;  4X62 T;  2WU5 A;  3VR9 A;  2X9X A;  5AQL B;  3FZF B;  4DR4 T;  1HF8 A;  4L5G A;  2CHO A;  4DR7 T;  2JRK A;  3UFG A;  3PUX F;  4B3S T;  3D0T A;  4UF0 A;  3FBZ A;  2DI4 A;  3TLS A;  2PG8 A;  5HWY A;  4Q25 A;  3KVA A;  3OKQ A;  3O4X E;  4UR9 A;  2H89 A;  2XSA A;  5F3J A;  4JI4 T;  1VCT A;  5ABF B;  2QA7 A;  2MYS A;  2E9X A;  3QOF A;  4JI1 T;  3UUX B;  4IE6 A;  4P0A A;  2J4G A;  5LBQ B;  2CWO A;  2XHE B;  2LSY A;  4BAY B;  3MK7 C;  5KXJ A;  3FXE B;  4COF A;  5JDF A;  4KP3 C;  1HFA A;  4I0U A;  2E5V A;  2WZI A;  2CBJ A;  2W63 A;  3C51 A;  3VRA A;  5H6R B;  3HL6 A;  3ONL C;  5LMN T;  1OED C;  3RYC E;  4AIU A;  2BVL A;  4QWN B;  4NUV A;  1D1C A;  3PJA J;  2Y48 B;  3RX6 A;  2XY8 B;  2XQ4 A;  3TLT A;  2Q9Q C;  3RF1 A;  3O1I A;  2N1G A;  4HFC A;  2CM0 A;  3N2G E;  4CI2 B;  5HWX A;  2E9X B;  4UVB B;  1L0V A;  4H63 V;  4HFH A;  3NZQ A;  3CK6 A;  2VK9 A;  1XMQ T;  3RIU A;  3PUW F;  3CIR A;  4QX7 B;  5IWA T;  4HWC A;  2WZH A;  1IJ6 A;  2IAK A;  2UXB T;  2K48 A;  5LBM A;  4MAL A;  2X9W A;  2ACZ A;  2EHO B;  1YXR A;  2X0Y A;  5LGT B;  2NTX A;  1HG2 A;  2LSK A;  3L39 A;  3AA0 B;  4CXY A;  1FMW A;  2XAS B;  4JLE A;  5JDM A;  5AQH B;  1HNZ T;  4HE8 A;  4DV2 T;  2KT9 A;  1R8I A;  5FY1 A;  3KV6 A;  3AVS A;  3AAA B;  1HCI A;  3P50 A;  5JTG A;  2VKD A;  5HEU A;  4KI0 F;  3E08 A;  3UUL A;  4JEH B;  1WCR A;  4ZXL A;  3UUB A;  2XQ6 A;  4H9S E;  5EZY E;  2CRB A;  2MAW A;  3R6N A;  1J5E T;  2W67 A;  3JAF A;  2XPK A;  3RH3 A;  3B13 A;  3C64 A;  3ESL A;  4LF6 T;  2KLQ A;  4IL4 A;  1FIO A;  2WCA A;  1S94 A;  2H7V C;  3OPC A;  3KVB A;  4AKL A;  4YHJ A;  1VOM A;  3KFW X;  2HPJ A;  3ZMZ B;  4CXW A;  1W09 A;  5HEO A;  1XMO T;  4GIW A;  1N34 T;  2KMF A;  4ZS3 A;  4ZI2 C;  4X66 T;  5FNV E;  3RYF E;  2V1D B;  4ILA A;  1XDP A;  3EHZ A;  5J0Z A;  4ILU A;  4PJM A;  1FJG T;  3JC6 C;  4EGW A;  2K5B B;  2D0T A;  4WYV A;  3JCF A;  3K3O A;  2DNX A;  4CN1 A;  2FUP A;  4DBQ A;  1HTJ F;  3RYH E;  3ONX A;  3MKD A;  4I43 B;  3AE4 A;  4WNK A;  2WDV A;  2D0U A;  5E0O A;  4ZI7 E;  3SOL A;  3OJA A;  4YTN A;  4IDQ A;  1XWM A;  1YD8 G;  5TAO A;  4X65 T;  4ASK A;  2XQ7 A;  5LG3 A;  5HEG A;  4TNV A;  3KIN B;  5LP6 E;  2P9B A;  4QXH B;  4TN7 B;  2JIW A;  4JUY A;  5HCM A;  2KWI B;  3AEG A;  2VB6 A;  3IEE A;  1QLB A;  2PJQ A;  1SUM B;  5JR9 B;  4HWI B;  4DV1 T;  3OYZ A;  3P4Q A;  1QSD A;  4DV0 T;  2LHR A;  1H7C A;  1M7K A;  2BG9 C;  2NW9 A;  4H9R C;  2VL0 A;  4M1P A;  2CA5 A;  2ZMA A;  4KHZ F;  3N9M A;  2BKN A;  4LFC T;  2E2A A;  3FZH B;  3GN5 A;  5ADX L;  1UCU A;  1D0Y A;  2PTF A;  2XQY A;  4CN6 A;  4IDN A;  3SFE A;  1BR2 A;  1IBL T;  4YJ3 E;  2WS3 A;  3NZP A;  4BA9 A;  5L3B B;  4IL9 A;  3LSV A;  4HFB A;  2A3D A;  3VKG A;  3NRY A;  1T98 A;  2RP4 A;  1EZ3 A;  4Z8X A;  3UUM A;  3BQL A;  4ADZ A;  3ABV A;  1D0X A;  4MFR A;  4IRE A;  5HEH A;  2PFV A;  2E9X C;  3NRX A;  3WAJ A;  4GKJ T;  1ZEE A;  2L9Q A;  2ZM6 T;  2I59 A;  2DWK A;  3ZLI A;  1HG5 A;  4PNI A;  3DJB A;  3K1S A;  2CBI A;  2KXP B;  4HFV A;  2C5I T;  1SHZ C;  3ZEF B;  2XTL A;  3VHL A;  2EHO C;  4H9O C;  5FL0 A;  3IBP A;  2Z6E A;  5EK3 A;  3EDU A;  5CA1 E;  3AE5 A;  4H63 H;  1M62 A;  4QHO A;  3CQC B;  4BJM A;  3I0O A;  1BR0 A;  5LGU B;  4QH5 A;  1UGO A;  1D1A A;  4OYK A;  4ZI3 D;  3FZL B;  2Y8D A;  4HFD A;  3O1J A;  3R84 B;  3EDV A;  5AQO B;  4YSY A;  2V7K A;  5JQG E;  5BR8 T;  3I1A A;  4UEL A;  3PU8 A;  1ZP0 A;  4KX6 A;  5FMN A;  3I0Q A;  1MIV A;  2IHR 1;  4CI1 B;  3RIU C;  1N33 T;  2XQ5 A;  3AXJ A;  4WZX A;  2VVN A;  4QXC B;  4UV8 B;  1OXZ A;  3DTO A;  3FXD B;  2A72 A;  5AQP B;  3O9X A;  4BJN A;  4A5X A;  3PV0 F;  3EVY A;  2W62 A;  5JDL A;  5AQF B;  2SPC A;  1VCS A;  3VKH A;  1IBK T;  4TV9 E;  2XM2 A;  2LLY A;  4JI7 T;  3AEB A;  4NUU A;  3T1Y T;  3E22 E;  4E7S A;  5J2U E;  4DV3 T;  3Q5W A;  2V7M A;  4ILC A;  4EV6 A;  2BS3 A;  2X0L B;  3LFM A;  4U2Y A;  3P4R A;  3FZM B;  3Q2M A;  3AEF A;  2YKS A;  4O4J E;  4HWH A;  4H9P C;  2XQ8 A;  4I55 E;  2DHR A;  5ABE A;  2QVA A;  2LM2 A;  1BR1 A;  4JI6 T;  5LHG B;  2H7O A;  2WMN A;  5AQG B;  3W15 B;  4FI5 A;  4KBM B;  1KK7 A;  1MMN A;  2LJL A;  2DLR A;  4EOZ B;  5C8Y E;  3AE1 A;  2LM9 A;  3AVR A;  5AQN B;  1J1J A;  4HKA A;  1NEN A;  3SRZ A;  3E0Z A;  3M65 A;  5LJM A;  3HI2 A;  3LBX A;  2ZLY A;  4X20 E;  4A56 A;  2BG9 B;  3AEA A;  3HA4 A;  3ONJ A;  3X1D A;  3ZT5 A;  2CCQ A;  2XJ7 A;  5JR9 C;  4P0B A;  5IYZ E;  2YK0 A;  2C5K T;  5KDM C;  5FY0 A;  4AI6 A;  3CWZ B;  4IE4 A;  3CPZ A;  5AQJ B;  1UK5 A;  2B76 A;  4AIS A;  4IGU A;  2VKH A;  4UF0 B;  5LOV E;  2V26 A;  5AQS B;  3MAC A;  2YU2 A;  2KSR A;  3AE6 A;  2I0M A;  1Y01 A;  3TLW A;  3CX7 B;  4PFP A;  1KF6 A;  2CMR A;  4B3R T;  4LF5 T;  3NKZ A;  4DR1 T;  4YTP A;  4TUY E;  3KBT A;  5FXX A;  5J2T E;  4LMK A;  4YJ2 E;  3EAM A;  5FXW A;  2C0S A;  3ZN0 B;  1KNZ A;  5LHH B;  3ZT7 A;  2XSB A;  2UXD T;  1Y64 B;  4O2B E;  5L3E B;  2RA1 A;  2A2F X;  2V6X A;  1W9R A;  2X9Y A;  3ZYM A;  4YY3 T;  3AE7 A;  3UU5 A;  4DUY T;  3CQG B;  2K24 A;  5LYJ E;  2XAG B;  4OK0 A;  4GK5 E;  4J2C A;  2L3L A;  4HFE A;  4TWD A;  3KBU A;  3A7M A;  1X79 A;  4OHF A;  5BMV E;  3Q5D A;  1SA0 E;  5L3G B;  3FBL A;  3RC8 A;  2JQH A;  3AED A;  2VAS A;  3PUY F;  2IML A;  4DR5 T;  3A8Y C;  4JI8 T;  2A9U A;  4H9Q C;  3C50 A;  2CXL A;  2R6G F;  2CE7 A;  1MMA A;  3H37 A;  4EAH A;  3K8P C;  4IIJ E;  1CHU A;  2D5U A;  1ZOY A;  3KV9 A;  4U7I A;  4OYJ A;  5AQI B;  3LK2 B;  1Z8U A;  1E1H B;  2NP9 A;  2WDQ A;  1W0B A;  4KHP T;  3P4W A;  2X9H A;  3PUA A;  2ZM0 A;  4QKN A;  4P1N A;  4PJN A;  1B7T A;  4TX5 A;  3JAD A;  1W0A A;  2J62 A;  3ZCI A;  1YW0 A;  5IUX A;  4DV4 T;  4DV6 T;  3ZT6 A;  5DJQ C;  5L3F B;  3OVU A;  2YDS A;  5HAX A;  4CXX A;  2FBW A;  3ZYL A;  1JNR A;  1N36 T;  2WWV A;  1WR0 A;  2N2N A;  3PUQ A;  4XAX B;  4LML A;  2HN2 A;  2LKG A;  5CA0 E;  4U72 A;  5HXH A;  4EYY R;  2HHH T;  4YT0 A;  2LHN A;  5FP3 A;  5C2T A;  3F57 A;  4U74 A;  4X5T A;  4Z90 A;  2MBG A;  2ES0 A;  3ZSS A;  3ANW A;  3CKD A;  3BQI A;  1MNE A;  2X68 A;  4ZHQ E;  2XZE A;  4DMV A;  1N32 T;  4CZZ B;  2M6B A;  2YIN A;  2BS4 A;  2CWY A;  4KUM B;  3B57 A;  4HWF A;  5ABH A;  4KMC A;  3S4U A;  3QUJ A;  5LA6 E;  5L2L A;  2Q9Q D;  3HKB E;  2YDR A;  5CB4 E;  1WYB A;  5DAB A;  3K3N A;  5JDQ A;  1MMG A;  5JRE A;  5KX5 E;  1D1B A;  1WFD A;  1YKE B;  2CHN A;  4DR3 T;  1ZV4 X;  2Q9Q A;  3NBX X;  4E7Z A;  3AEE A;  4EB6 E;  2V7J A;  2VQF T;  3RKG A;  2VVS A;  3QB5 K;  2VUR A;  4ZS2 A;  5EK2 A;  4A97 A;  4YFS A;  4WBO A;  1WR6 A;  3CX8 B;  5CGM A;  5HXS A;  2QRX A;  2CXF A;  4DBR A;  4IDO A;  3N9N A;  4F6R C;  2WSS V;  5LNK A;  4O4I E;  4OFZ A;  3CVR A;  2LRK A;  4AQG A;  1DU2 A;  2H3R A;  4QXB B;  2WY2 A;  1BR4 A;  4UV9 B;  4I50 E;  1XZY A;  3N9L A;  4HFI A;  3VR8 A;  5JDG A;  3C4W A;  2NW7 A;  1X9B A;  2VQE T;  2M6I A;  4DV7 T;  5HYA A;  2WDR A;  3BK9 A;  1OWA A;  3SWH A;  2XAJ B;  5JVD E;  1YQ4 A;  3QNU A;  3HKC E;  3V5S A;  5HCJ A;  2IIU A;  5LCY A;  2BVM A;  5AQQ B;  2X0H A;  1VRB A;  3U3I A;  4AXP A;  4LF9 T;  3GN5 B;  2W0G A;  4CI3 B;  2UUA T;  2WP9 A;  4TNW A;  4ZI2 D;  5HXC A;  4EZ4 A;  3AB3 B;  2XQ9 A;  3ZN1 B;  1UUR A;  4NXM T;  3RGL A;  3EUH A;  1YKH B;  1IJ5 A;  1IAP A;  2LE8 A;  4JEU B;  4HN9 A;  3QB5 A;  1KNP A;  2VKJ A;  3JC6 D;  4MLK A;  1NEK A;  3ZMV B;  4DR2 T;  2XAQ B;  3UU6 A;  1US7 B;  2JMK A;  1E7P A;  3P4S A;  2V5D A;  4CQI A;  3QC9 A;  2K3W A;  3L8R A;  4GK0 E;  3Q9D A;  2BKP A;  3P7I A;  2FJE A;  3UU4 A;  5A1L A;  3EI0 A;  4GYR A;  5L4E A;  4EIW A;  5FXZ A;  3ZJ2 A;  3ETU A;  2E8I A;  2W4X A;  5H6Q B;  3JAE A;  4JV5 T;  2PBI A;  1T7S A;  3UQ4 A;  4AQF A;  2UUC T;  3H3M A;  3K3Q C;  3OYX A;  2X51 A;  2ODV A;  4B3T T;  2LSJ A;  2CPT A;  3ZC0 A;  2Y6X A;  4B6X A;  1NWM X;  4N78 D;  1O3X A;  2F4V T;  4UVC B;  2CXD A;  1AJ3 A;  3FHN A;  3RC3 A;  2XAF B;  3RI5 A;  3AEC A;  1HNW T;  3RRC A;  5JDH A;  3AXJ B;  4ILB A;  1LRZ A;  2NR4 A;  4FJO A;  2DWG A;  1UX5 A;  4HTE A;  4C91 A;  4YLH A;  3N9O A;  2BBH A;  3WI3 A;  3N2O A;  2MOZ A;  3ZC1 A;  3ZYK A; 
#chains in the Genus database with same CATH homology
 4JYA T;  4DUY T;  1N36 T;  4DR2 T;  4DUZ T;  4OX9 T;  4YHH T;  4LFA T;  4LF4 T;  4DR6 T;  4B3M T;  2HHH T;  4DV5 T;  2UU9 T;  3OTO T;  1J5E T;  4GKJ T;  5LMN T;  1IBM T;  2ZM6 T;  4K0K T;  4X65 T;  4LF8 T;  4DR5 T;  4LF6 T;  3T1H T;  1XNR T;  4JV5 T;  1IBK T;  4JI8 T;  5LMU T;  1N32 T;  2VQE T;  4JI7 T;  4X62 T;  4DV7 T;  2UUC T;  4LF7 T;  3T1Y T;  4DR4 T;  2E5L T;  4DV3 T;  4DR7 T;  4LFB T;  4DV1 T;  4B3S T;  1XMQ T;  4B3T T;  5IWA T;  1XMO T;  4JI3 T;  1N34 T;  1HR0 T;  2UXB T;  4DV0 T;  4NXN T;  4B3R T;  4LF5 T;  4LF9 T;  4DR1 T;  4KHP T;  4X66 T;  2F4V T;  4X64 T;  4JI6 T;  4JI4 T;  4DR3 T;  1HNW T;  2UUA T;  1XNQ T;  4LFC T;  2UXD T;  5BR8 T;  2UUB T;  1FJG T;  2VQF T;  4JI1 T;  1IBL T;  2UXC T;  4NXM T;  4DV4 T;  4AQY T;  1HNX T;  4DV6 T;  1N33 T;  4JI5 T;  4JI2 T;  1HNZ T;  1I94 T;  4GKK T;  4DV2 T;  4JI0 T;  4YY3 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...