4DO0A

Crystal structure of human phf8 in complex with daminozide
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
363
structure length
363
Chain Sequence
VKTGSPTFVRELRSRTFDSSDEVILKPTGNQLTVEFLEENSFSVPILVLKKDGLGMTLPSPSFTVRDVEHYVGSDKEIDVIDVTRQADCKMKLGDFVKYYYSGKREKVLNVISLEFSDTRLSNLVETPKIVRKLSWVENLWPEECVFERPNVQKYCLMSVRDSYTDFHIDFGGTSVWYHVLKGEKIFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVDKCYKCSVKQGQTLFIPTGWIHAVLTPVDCLAFGGNFLHSLNIEMQLKAYEIEKRLSTADLFRFPNFETICWYVGKHILDIFRGLRENRRHPASYLVHGGKALNLAFRAWTRKEALPDHEDEIPETVRTVQLIKDLAREIRLVED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Histone lysine demethylase PHF8
source organism Homo sapiens
total genus 103
structure length 363
sequence length 363
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2012-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4do0A02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4do0A01
3RVHA 3DXUA 4Y33A 5F3GA 3N9OA 5LWBA 3K3OA 4GD4A 4QX7A 5FY8A 5A7SA 2Q8DA 3PU8A 4EZHA 5F3EA 5FUPA 3KVAA 4E4HA 4CCOA 5FJKA 3AVRA 5LY2A 4GJZA 3PTRB 5IWFA 5LY1A 5K4LA 5FZAA 5CEHA 5FZ7A 5FP4A 2YBSA 4BXFA 3KVBA 3UYJA 3U78A 5FP9A 5FYCA 5FY5A 5IVBA 2YU2A 5FJHA 5FYBA 2OQ6A 5FZBA 5A1FA 4CSWA 5FP8A 4QXHA 5FP7A 2Q8EA 2PXJA 5A3PA 4V2WA 5A3WA 5FZDA 5FZ1A 4CCLA 2OX0A 5A3NA 4CCMA 4XDOA 5FZMA 5FP3A 5A1LA 3LD8A 3AL5A 5FPVA 4Y3OA 2W2IA 5FYSA 5FZ0A 5FYMA 3ZPOA 3OPWA 5A7WA 2YBPA 4QX8A 4LIVA 5F2WA 5FZOA 5FXVA 5FY7A 5FYYA 4QU1A 3PURA 5FPBA 5FZCA 4BISA 5F5CA 5FPLA 4NUBA 5FXWA 3AL6A 4LITA 3KV6A 4D6RA 3KV5A 5F2SA 4D6SA 5IVEA 5FPUA 3PUAA 5FY4A 5F3IA 2XMLA 2OS2A 3K2OA 4GJYA 5FZ8A 5A7OA 3N9PA 4IGPA 5FZIA 5A7NA 1VRBA 5FPAA 5IVJA 2P5BA 3NJYA 5IVCA 3K3NA 4V2VA 5F37A 4DO0A 5F5IA 2YBKA 3KV4A 3OPTA 3PDQA 5ANQA 5FYUA 4Y4RA 2XDVA 4UF0A 5IVFA 4EZ4A 5IVYA 4QXBA 4LIUA 5FZHA 5A3TA 5FWEA 2VD7A 4URAA 4QXCA 2WWUA 4LXLA 4CCNA 4D6QA 5FY9A 5A7WB 4ASKA 5KR7A 4QWNA 5FZOB 4IGOA 2WWJA 3PUQA 2GP3A 5FZEA 5FV3A 5FYHA 5F5AA 3N9QA 5E6HA 4TN7A 2YU1A 3DXTA 5F39A 4BU2A 4C8DA 4EYUA 3N9NA 5FZGA 4XDPA 3LDBA 4CUGA 5FZLA 3N9MA 5FYTA 2OT7A 5LW9A 5F32A 5FWJA 5FYIA 3U4SA 3PUSA 4AI9A 5FZKA 5IW0A 5FYZA 5FZ3A 3ZLIA 2XUEA 5FZFA 4HONA 4UF0B 4CCKA 4GAZA 5FXZA 3PU3A 5FY0A 5ISLA 5F3CA 5FY1A 2OQ7A 4IGQA 5FBJA 5IVVA 2Q8CA 4AAPA 4CCJA 5FZ6A 5A80A 3AVSA 5FXXA 5FZ4A 5A7QA 3KV9A 3N9LA 2GP5A 5FYVA 4DIQA 2YPDA 4HOOA 2XXZA 5FZ9A 5A7PA 5FUNA
chains in the Genus database with same CATH superfamily
3U0ZA 2QQWA 4AEDA 4X1YE 2ZHNA 1ZRFA 1CJPA 5F3JA 4Q4W2 2BEOA 4FT8A 5FY5A 4X8NA 3WQBA 4YNIA 3LIGA 1WUVA 4Q5OA 1O3TA 1G9CA 1ZBE1 1H6XA 4XAEA 1V6OA 4Q0PA 2NQYA 4LMLA 1CAUB 5FZ0A 1XMOT 4DMVA 2C5DA 1G9AA 5AFBA 5C3JA 4KWKA 1FYUA 5JAXA 3UUMA 1MZEA 1UU5A 4GK0E 1ND3C 4L97A 3NJVA 3C4ZA 4J6GA 5K7PA 3SMHA 4FTBA 4KG0A 4LO4B 4YW1A 2Q4SA 1PIV2 2NP0A 1FJGT 3THTA 2DLRA 4WYVA 2LTNA 3BIWE 1ZBA3 1SQ4A 3RMYA 3Q5XA 5JSOA 4CEYB 2ZM6T 1SCSA 2L9LA 4ITCA 2BG9C 2OQ7A 2RDSA 1LOFC 2Q8CA 5JLVA 4UEMA 2P3IA 2YPDA 3OUJA 3IDCB 4LF5T 5F3GA 4XFHA 2GC1A 1GQPA 1WLWA 4B4RA 3LEGA 4MHCA 1IG3A 4QH4A 3BPZA 3LFIA 3NJZA 2ES0A 2VNVA 4ZI2C 5FPVA 4HK8A 5FO9B 2YEVC 4LIVA 1O91A 1R083 5HWXA 5LJMA 5F2SA 3AP4A 4Q26A 4AGGA 4LBQA 2YPJA 2K9AA 4IDPA 5FO8B 2WO3A 1Q5OA 4LF7T 5E88A 3GBFA 5HCAA 1TVGA 5L3GB 4LBJA 3PUGA 3ZYLA 3I2DA 2AC1A 5F6KA 3FXEB 5EHDA 1OQDA 2GMPA 1O4ZA 3B5MA 3MPPG 2Y6KA 2WNEA 1PNFA 3FE5A 1W39A 3JZVA 2KT9A 1OLQA 2L8KA 2LS6A 3N5LA 5E0OA 3ZFEA 3Q5WA 2PJQA 3IWZA 3PIGA 1ASJ1 2YB7A 4CP1A 3SKVA 4CU7A 2W67A 3FBLA 2V4VA 1H9WA 3P3PA 4N7IA 5LA6E 3RFRA 3D5OA 4DR5T 3R4UA 2HYKA 1Q8PA 3RDIA 4H2AA 3VDAA 3O1UA 4S2FA 4NJ4A 1F35A 2X9WA 4G3YC 3CZUA 2LRKA 5ABJA 4TX5A 2YFZA 4MSVA 4QX3A 3B02A 3UU6A 1CJDA 3RYPA 1RITA 3JCIA 2JQQA 2ZX4A 4Y4RA 2VASA 2ZGOA 2B1EA 2WNVB 4XTPA 4IUGA 4XJ8A 4R52A 4LE4A 4PJJA 2VE1A 2W66A 1N3PA 4XFIA 3BOWA 1RVF2 4ZXEA 1VR3A 1G9DA 3WXPA 3QD6A 1H1IA 2ODVA 3SRZA 4A56A 3MDPA 4NPLA 1W0AA 4LMJA 4IEWA 2DUPA 4GKYA 1RUD3 2Z4FA 1QXPA 5GZFA 2X0HA 2GNMA 3AA0B 4IDZA 2PHWA 1UURA 3EI0A 3CF6E 2LUWA 3RIUA 3JC6D 3I4IA 1JYWA 3QH7A 4Q4Y2 1CX1A 2E9XD 2X9XA 2K9ZA 2VB6A 3K3QC 2XBO1 2BS4A 4KL1A 4E7SA 3ZXEA 4WNKA 1LEDA 1AJ3A 2E9QA 3NRXA 1VP6A 1HDKA 4LHNA 2RE9A 3PDQA 5C9AB 4J1XA 2WZPP 2BWAA 3P8CD 2JE7A 2D3SA 2X10A 1IKQA 2PLV1 1XWMA 1UN1A 1LRZA 3NNMA 2OUHA 3ZMZB 3VKGA 3C64A 1W0PA 4P9WA 2VOWA 4AQTA 1QH7A 3RI9A 4QXBB 4XPVA 4M3CA 1BQPA 3MUZ1 2FCTA 3HQUA 2VL0A 1PM7A 1MIYA 3S6PA 4P9LA 4DR3T 1G9BA 2AENA 2JEMA 2YC2A 5KHJA 5FZBA 4RGGA 3P7IA 3I2OA 4XUNA 1AX2A 5AQVB 1KFYA 4XHXA 2YY1A 5AFEA 4KWUA 2JJ9A 3E6BA 2YK0A 2Q9QA 1H9PA 5TAOA 3N2KE 1O5LA 3ZMVB 1DQ4A 3D3AA 4RGKA 3UJOA 3K51A 1VRBA 4M3CF 3WG3A 4O4HE 4FVVA 3UFGA 1ZRIA 1QJX3 3VBUB 2WA4A 1ZBA1 5KHGA 3KM5A 1AF9A 4F7ZA 3CX6B 2IXLA 2IVIB 4B3TT 2JDYA 2ZGMA 4LA2A 2JG8C 4EJRA 5AVPA 3SFEA 5FRAA 4UBGA 2VZQA 2BKOA 5J3UA 3ESLA 2HWC3 2VVEA 2DUQA 1US2A 3JAEA 5EYYA 3ZKYA 4DR2T 4YW2A 2ZEZA 2JICA 1DFQA 4U72A 4DBQA 5L47A 3RYRA 2GSYA 4A3ZA 1PVXA 3ZN6B 4NAOA 3VHOA 5CNAA 4FPCA 4DUZT 3GN5B 3D82A 3CKDA 2W39A 1WBLA 4AL9A 3SEEA 5A32A 5C8YE 1MZFA 1VBA2 1F9KA 3H1MA 2A2FX 1W28A 1OLMA 5DDJ3 3RMXA 3B00A 1AR93 4AEDB 4L9BA 3KV5A 5AQSB 2HEWF 2YDSA 2OS2A 5J96B 4D8MA 3P5BA 5KXBA 4JC1A 5H9RA 1AR73 4F6RC 4DUYT 5JCTA 3AYDA 3H8OA 1QQP3 5AQHB 4FPKA 2XAFB 5DQWA 3AEEA 2Y64A 1HG5A 1JNZA 2CLYC 4CXYA 3NSTA 4IESA 3E5UA 4J2CA 4IE5A 3WT3A 3RRCA 1AL22 1SBDA 1BMV1 4LKFA 5F1RA 3O1SA 1V70A 1ND2C 3N7KA 1H2LA 4JGZA 3S57A 4DB5A 1VBD2 3S4UA 4XIKA 4E2QA 4JI1T 2LSIA 4Z07A 1YRZA 1E5IA 1V9U1 3P1IA 1HS7A 2FJDA 3RNSA 3WSOA 2DUOA 4H14A 1WD3A 3M3QA 4QPGC 2NP9A 4D6RA 2ZXQA 4EWDA 1HB3A 1S0FA 4UVAB 3ETUA 3D0SA 2VJXA 3VD9A 1TMF1 5JH7E 4KHPT 3OPTA 1HQNA 4XFCA 3AKRA 1N34T 3J7HA 3RPQA 4YW4A 3PUIA 1VOMA 2WWUA 3AA1B 4Y1VA 3HOBA 2VQET 2WZR2 1MS0A 4TWTA 4ARXA 4ZZ5A 5JDGA 4LBQB 3OYWA 4TTGA 4R9AA 2A72A 1K45A 3RSJA 1VBE1 3CBNA 4EV6A 5FY0A 4HGAA 3AKTA 1GANA 3CK6A 3A7MA 1U5IA 1BR0A 2DCTA 2BFUS 2J4GA 1K5JA 5A7SA 5IAXA 5LGTB 2ZHMA 3UFEA 4U3CA 5M4YA 5LK5A 3ZFGC 1ZHCA 2E7TA 3LG7A 5FP7A 1XE0A 2PTFA 2X5IC 3ZFEB 3MLKA 4UBHA 3V0AA 4CCMA 2PA7A 2YC4A 2XSBA 2MAWA 2RG4A 1NLRA 5I0UA 3QBQA 3ETPA 3PJQA 2XQ9A 3I9YA 4GWNA 2WNUC 2K3WA 3IA3A 4ATEA 1FPN3 2C24A 3GDBA 5B4XA 5LCYA 1W09A 4BQ5A 2WUHA 1LENA 5D8AA 3ZR6A 4XQ4A 3ZYPA 4D6QA 2HWF1 2H6BA 2PAKA 1TME1 1BXHA 5ABJB 4A4AA 2AXDS 1NENA 1RUI3 3SKJE 3VZJA 3WD5A 1LU1A 5EV7A 4B4QA 3ZX7A 2CNAA 1IPSA 3IBMA 2NZ9A 3ANWA 1E5HA 3TLWA 1B09A 4HFHA 1SLCA 4JQRA 2B45X 1JXNA 1RUJ2 2WDQA 2MNGA 3GCXA 2CRBA 1QXRA 3NAPA 2WDRA 2VKOA 3WINE 4R9BA 4B1LA 2YOEA 2LM9A 1AR83 3ZSMA 3J8F3 5K0UC 2E2AA 3WHUA 5LBCA 4UFMA 5LYJE 2PBIA 2A3XA 4C0BA 4BJMA 2LM2A 3BPSA 4DXZA 3T4HB 5TSWA 4X66T 1WMFA 5ANNA 2BKNA 3VRBA 3AMHA 3ZC1A 1RUC1 4YRDA 2BUKA 2CL2A 4U36A 4CZSA 4ERRA 5FZ8A 1QJY3 4COZA 1UOFA 4BZ4A 1D4M1 3NNFA 1FX5A 2HPJA 2X09A 4MHUA 4IEVA 2W61A 3QNUA 1M4WA 2HWC1 4EN6B 3AFKA 2QQUA 2P1BA 1H8VA 5LGNB 2PAEA 5JR9A 3C7FA 1NKGA 4ISSA 1W2TA 1BZWA 2G19A 1YQ4A 2IXKA 1M06G 1KFUL 1ZM1A 2WFF2 5CG8A 3P50A 4QDSA 3U11A 3ZFFA 1POQA 2K46A 2NM1A 4N7UA 2XJUA 5HAXA 2CA5A 3ES4A 1XNDA 2FDGA 3H1YA 1J1TA 2ZA9A 5FY8A 4HFDA 5BNPC 1AR91 5G05L 1CIWA 2DWGA 4M3CB 1PGL2 4Z90A 4Q4V3 2FBWA 4ZU7A 5LCWL 2Q0AA 5H6RB 3W5NA 4PDWA 1QQP1 2LOSA 2N9DA 2WABA 4PT6A 4XHBA 1LGNA 1GNZA 2G9ZA 4NRQA 2CBJA 5D1IA 1YKHB 1NOVA 1GP4A 1YHFA 1Z0HA 2VY0A 2FJAA 2E9XA 2MPFA 2Q9QB 2ZHKA 2P3JA 2KWHA 1AYN3 4YZ1A 3RJ2X 3WP5A 1WWYA 2WU2A 4PQ9A 4NHXA 2HWB2 1PO13 2OV9A 1TZOA 4LOTA 1JBCA 4ZI3D 4DR1T 1OEDE 1DQ5A 2FDHA 4Y1YA 3UT5E 5L2LA 4YJ2E 1BJQA 1YIPA 5CADA 3UL2A 4CDUA 3NWIA 1NY72 3WX5A 3FHAA 1W9SA 4LTAA 4YJ3E 5A6ZA 1COV3 1OPOA 3VDDB 1MS9A 4GXLA 1YQCA 3LEIA 2LW8A 3KCYA 1D7PM 5C2TA 3J7LA 2P6CA 2GMEA 3G06A 1BVP1 3OJBA 5DAPA 5A32B 5J1XA 1UZYA 1UZ0A 3USUA 2QDNA 2IZWA 3LE0A 4MUVA 1FOD3 1WCQA 4P5HA 3LK42 4A6OA 1SLAA 3E0ZA 3F2EA 5EZYE 1LB2A 3HIFA 3HA4A 2EA7A 4LEJA 4J25A 4AK3A 4K40A 1KGYA 2UUBT 1O3RA 5JOXA 2JKXA 1J58A 2RVAA 1RIRA 3GALA 2JDNA 3DP7A 1KNZA 1JS9A 3CJIA 1SDWA 3ZSJA 3LOIA 4GH4A 4N78D 4Y20A 3IDEA 2YG0A 2D6LX 2VUDA 5A7QA 4YTNA 2Y60A 4I0AA 3AEDA 2PQQA 1MEC1 1XYNA 4O2BE 1LKNA 4XAAA 1LOGA 4WM7A 4AI8A 4YW7A 3OGGA 1D0XA 4CN6A 4FPGA 3FHQA 1U5PA 4TWDA 1UYPA 1WMEA 4U2YA 2V5CA 2BVMA 2V4AA 3HVDA 3HPNA 2QYWA 4XURA 3HT1A 4ZU4A 3CO2A 4JGZB 1E7PA 1D0ZA 1CPNA 5HXSA 1GLHA 3DYOA 1R082 2XTLA 5JDQA 1RUI1 5LBBA 1DLLA 5EJ3A 1JOPA 4IE6A 4I3GA 3FBYA 1ZREA 1X9TA 2IWGB 2Y8KA 3MIDA 3LDQB 1NAFA 2B42B 4Y22A 3WCSA 4YFZA 3OGVA 4LE3A 2WU5A 3W58A 5IW0A 3C98B 5C3RA 5DABA 1GWKA 1AR81 3PUYF 1GU3A 3V5SA 3QACA 2CTVA 3TN93 5CFDC 3OYWB 3I3MA 4ISTA 1YKEB 4MGYE 2BW8A 1YI9A 1VMFA 1OSGA 1S0EA 2UUAT 4UXAA 2RM22 3U10A 3C7EA 4AWDA 4XUPA 3P4QA 1JYIA 3TNQA 1QJY1 2JE8A 4HWFA 4NVPA 1PZ8A 5GJ6A 3VHLA 4CEYC 1EV12 5IVEA 2N7GA 2F4PA 2CXLA 4NRPA 4CRQA 2JB8A 3IDAA 2I74A 3ZMUB 5CBLA 5JIAA 3AM2A 1DQ1A 3PVEA 3V0AB 3O14A 4IL7A 3O1HA 5FQ0A 4BYYA 2JJ6A 4FJOA 5LXTE 1NG0A 2R49A 2P3YA 2JDPA 4X1IE 4N90A 4GB33 1G8WA 2VZ3A 1ZZ8A 2WWVA 5D8AB 2ZKLA 5FBZA 2W2UA 2LKGA 3RRDA 2ZS6B 3WP4A 4NXNT 1TNFA 3O0VA 4YY3T 4OI0A 4Z1VA 2YN6A 4X6RB 1RUE3 4EZHA 4CA9A 5EXOA 4Q4V1 3ANWB 2NTYA 1RUD2 4LF4T 4JYAT 3GWHA 2JECA 2C9AA 3RKOA 1ZYBA 4CDWA 1N36T 3A21A 2WDBA 4K1ZA 3NAPB 2IVJA 2UXDT 1ZZ9A 1C8M1 3AL5A 2R043 5JWPA 1CAVA 4ZI7E 5JR2A 3EVYA 4XFBA 3G6JB 2GU9A 2CU5A 1XNCA 2BS3A 2W47A 2V7MA 1XMQT 1VAKA 3MIGA 5EZWA 4DR6T 2WS3A 1KQRA 4HKAA 4ASKA 3SLIA 2YC0A 5HCFA 1QIQA 1ZA7A 3VKNA 1D1CA 4GMP3 3CL1A 1UXZA 2OA2A 5FMOS 2VNOA 3B5LB 3EJKA 2R1BA 4Z8XA 4SLIA 5C7GA 3JBG1 3I3QA 2VWAA 2YFUA 4LBNA 4BIFA 3GMIA 1W04A 1POV1 5JR9B 3Q8FA 3ZDVA 1PZ9A 4YM0A 2SPCA 5DQ0A 4M00A 1REEA 3ZFFB 2ID4A 4ES8A 1A8MA 3VB9A 5BNOC 2KR2A 3OD4A 1YQ5A 4MGQA 4A97A 4LPLA 4BISA 4XFFA 1PO22 1WA4A 4EEDA 4D6SA 4KU7A 5DZEA 4QKDA 1FOD1 5CJ5A 2BFUL 4WBOA 4OK0A 5IVJA 2EXHA 5JVVA 3H3MA 1E1HB 2JDUA 4XDQA 3MFAA 1ULCA 4H55A 3SISA 3KD4A 2VC9A 4H63V 1CR7A 3PUWF 4OULA 2ZTNA 1Z0PA 4PDWB 3RI5A 2IC6A 3QUJA 2BVVA 3MLLA 1HF8A 1OOPA 2D6KA 3RIFA 3B93A 3THDA 2E9XB 3KMHA 2XJ7A 3KHBA 2LRPA 3LF7A 4UELA 3OYXA 4DUWA 2VQFT 4Y5Z0 1SFYA 2XXZA 5I8TA 1FI2A 4QKNA 5LA2A 5CB4E 3MV01 4YZ5A 4K0UA 3UGGA 4O7XA 1RC6A 2BG9E 2QCSB 1OD3A 3JADA 2UXXB 5FUIA 4AVCA 4DV3T 1I6XA 4XZUG 3BTYA 4UR9A 4YVSC 2QJVA 4CDUB 3PJYA 5DDJ2 1FAYA 4UWDA 4AQGA 3KINB 4AVAA 1U5YA 4FPYA 4EAHA 5GALA 2X8KA 5AQUB 3OVUA 1HN1A 5AQJB 5ACA2 2WCAA 3AE4A 1Q8OA 1KD7A 4QPIB 4P0BA 1AR72 4GMP0 5FV3A 4YVWA 2BVLA 3UTKA 4YGCA 5A6QA 1W8TA 1KK7A 3LZZA 3USUB 1HXS1 1UCXA 1OXZA 4MXWA 3KWVA 4PQQA 5C4WC 5C3SA 3WDYA 4F3JA 4JVAA 1S2EA 5A80A 5A70A 4LO6B 4KI0F 3QOFA 1Y64B 5DUXA 1SACA 3M3EA 1W05A 3J7Yq 2CDOA 1OEDA 1JTZX 4A3XA 3VBUC 4DY3A 4FPHA 2BYVE 3RZZA 3BCWA 3CJIB 4GH4B 2XY8B 4Y20B 3BN6A 4ZONA 1DCSA 2K24A 2IDOB 3MJXA 4GOUA 2B5HA 4QM8A 5LHIB 3V65A 1VRH1 2FUPA 3BODA 2VVSA 2CY6A 4XF3A 2YDEA 2WT2A 2GAUA 4WM7B 1R092 4R8HA 2DBNA 4N8MA 4RS5A 5DUWA 2LT3A 2BZBA 4XYXA 2JIWA 3MIHA 5GM0A 4EROA 4S2HA 3LB9A 1QJU2 3ILRA 2VD7A 2GN3A 1RB8G 1ENRA 4I0UA 5IYZE 5LG3A 4R4ZA 2GH2A 5LB7B 1UMIA 3KS7A 1S1AA 3ZYFA 3I97A 2J22A 2TNFA 1YI7A 3N35A 3SOLA 1LOBA 3DPRA 5FNVE 5ADXL 3ZYBA 2ARXA 4MGSA 2KXLA 4Y1ZA 4RHV1 3FB2A 3KQRA 2QQKA 1SFNA 4EEBA 1VLNA 4OZXA 4HOOA 4Y22B 2HJIA 2AYHA 1W8OA 3PL0A 2WR9A 4IW3A 3GZEA 5C70A 5EJZB 5BY5A 4I55E 1HQWA 1WCRA 1LHOA 3H9AA 2R041 3ZSLA 3IBPA 2CHOA 2MEV3 2YYOA 5HI0A 1R64A 2IXCA 3TEZA 2OUJA 2VUCA 5DXDA 5JXJA 3QLQA 2GNTA 1UXXX 1GP5A 4DV2T 3WNMA 3L9JT 4OVEA 1I94T 4H3WA 5LRSA 3ZYJB 5LP6E 3BI3A 2BNNA 4CI3B 2OVUA 1FPN2 2VUJA 3ATGA 4ZU5A 2BQPA 1RUH2 1IBLT 3T0BA 2UXBT 4CQIA 1OA3A 4GKXA 2QGSA 2JPFA 4FPOB 4LHKA 1LVFA 3RRWA 5FYTA 5FO7B 5C5TA 4L5GA 4I4TE 2ARBA 2JMHA 4FFIA 5LB6A 4QDQA 5IVVA 4Z2WA 3POBA 5FQ0B 4CI2B 1HB2A 3L2HA 1H6YA 3MKDA 1YC61 2CXDA 4QHOA 5C5UA 5JZGA 2WJSA 1JN2P 3F2ZA 2A5ZA 3QH6A 5HCHA 2WZHA 5FK8A 2Q8EA 3OKQA 3DKQA 3WW3A 4HTEA 1VMHA 1D0YA 1FNZA 2DVGA 4A7KA 5FL1A 3J8F2 3LSEA 1IS6A 3S5QA 3AK0A 4E4ZA 1X8EA 4MBQA 1APNA 2NLRA 5E16A 4CDWB 4PJMA 2BGOA 2RS32 4WVVA 2JB4A 2BOIA 3FLPA 4WVZA 2XR4A 2WT0A 2VNRA 4LMFA 1CAVB 4UV8B 2IC1A 1NCQA 3P3NA 3S7IA 3BALA 4LBMA 4LT5A 3ZFEC 3ZMNA 1SPPB 3JU9A 4LORA 3WZ1A 5LBQB 5LATA 2HWE3 4KNCA 4K8FA 2UU8A 2XQ6A 3VN4A 1K3IA 2IUBA 3ONJA 3NQHA 3H1WA 4Y26A 3T09A 1PGW2 4GD4A 2PHTA 4XUQA 1RMU2 3ZN5A 2DF7A 1N1VA 3ZIXA 3O9XA 3FZHB 4AKRB 5ABJC 5T5LA 2JG9A 3ZMSB 4HLTA 4CVUA 4GK5E 3HQRA 2WBKA 4H9RC 1YXRA 5IFPA 2RR13 4OUSA 3VZOA 5F7UA 1OMIA 1GQHA 4MHRA 2QUOA 4Z92B 5GZCA 3UT0A 3RG0A 3IT8A 4DINB 4ARYA 1MS8A 4MGKE 1T6GC 1WCDJ 4NIHA 4MVTA 3ZT5A 2CSGA 3IF8B 2XQRA 1LODA 1V6LA 1QU0A 3VKMA 5L7OB 3O7OA 1V6JA 2CWOA 4CEWA 1J1LA 1AYN2 4COYA 5A3UA 2MPKA 1KXGA 4DV1T 3WDTA 4A2UA 4IETA 2HWD3 3T3YA 4AW7A 2CPTA 2ZM0A 4CPBD 1PO12 4X62T 5F3EA 1OOPB 3MHZA 1G7YA 3AVRA 4RQPC 3AXJA 3AECA 2GC2A 2ZMAA 5FZ7A 1XPWA 2E32A 4LNVA 5M0TA 4IL9A 2VMEA 5LG4A 4HKWA 2WQ8A 4UIGA 3AA6B 3NNJA 1OC1A 1AZDA 2YBPA 1GSLA 2ZGPA 3LFMA 2W68A 1COV2 2WSSV 4BH9A 5GLVA 2RJ2A 2XMLA 4PLOA 2V72A 3FXDB 1ST8A 5T5JA 1ZRDA 5FYUA 4E4SA 3T1HT 5L3EB 3M3CA 5C3QA 2Z2SB 3O1VA 2WO1A 1QWRA 5C8CC 5FCCA 3I49A 2TEPA 2ACZA 5FDBA 4IE0A 2WNOA 4O8SA 1RHI1 4WZXA 5JOWA 1Q8SA 3VKOA 5HV0A 5FR3A 2ORZA 5A3OA 1OF4A 4YVWB 4BLJA 2C9KA 1JYTA 5JPMB 4FAHA 3KF3A 2XG3A 5K4LA 2FBEA 4MXWB 2W00A 4DUXA 4Y4YA 5KC6A 2WB5A 2WP9A 2RS12 3H42B 4ES9A 3T1MA 2ZPXA 4OLLA 4X64T 3RIAA 1LECA 4TV8E 2ZAHA 1NXMA 3ZM8A 4XF9A 2W2IA 5FMOL 2BG9A 4PJLA 1LOFA 1ULOA 4U31A 2ZBJA 3ON7A 5F5CA 3POYA 3I54A 2LSKA 3N3HA 1OEDB 2CEAA 2KLQA 3LDKA 3AE3A 1DZQA 1UX4A 3OUHA 4HMZA 3VBRC 3PUHA 2CCQA 3OUIA 5LEJA 3POEA 1PVC3 5FZHA 4URAA 3OPZA 1UMZA 5JPNB 3T0AA 5T5OA 1BCXA 2Y6HA 3VDDC 4DR7T 2F17A 2A1XA 3IHRA 4RS5B 5LBEA 4FCAA 4N53C 4LBQD 4QQHA 1EAH1 1OKQA 1RUNA 1AYM2 1UNBA 3WV6A 4IDQA 3FJSA 4JBWF 3EHKA 1H4HA 1PMHX 4O2AE 3ZKRA 2FJBA 4CDXA 3NVCA 3SS1A 3DPRB 5EIYB 3ZO0B 5J2UE 2ZX3A 2QQIA 1SEFA 3AP6A 3M1HA 1HFAA 3TN92 3VZKA 1XNBA 1O8SA 1IOAA 1IJ5A 1I5PA 3QB5A 2ZGTA 3N36A 1ZX5A 5FP3A 1AXYA 1CN1A 5FXWA 2RA1A 2G9GA 3UU8A 3U75A 3C7GA 3AKQA 5LASA 1VIWB 3C8XA 1ENSA 4LIUA 1KF6A 4QKBA 3CQCB 4AR2A 3K46A 4IGOA 5KBFA 4OFGA 1V6MA 2PAMA 4TLFA 4DZGA 4F8AA 1UX6A 2J7MA 5FVKA 2VMHA 3AMQA 4CI1B 1ZKEA 3WNOA 5JDLA 2PFVA 1H1AA 4PI0A 3PU3A 4UFLA 4PBPA 2XHEB 4JGZC 1HLCA 4GB32 4LQRA 3V5UA 1WLTA 4B8EA 4FFFA 5IWAT 1U12A 5ABFA 4JHTA 2EIBA 3POSA 5IWFA 1VJ2A 4QB6A 4OHZA 4QX5A 5CGMA 4DV6T 2RR11 1RUE2 1VBC1 5ABHA 1GYKA 4XABA 3R0RA 5IHYA 2P37A 2K48A 2B76A 3RHWA 2D6NA 5JZGB 1FMD1 3K4ZA 2RHPA 2E53A 4I43B 1JU4A 3SH5A 1U4QA 5BUVA 5DUUA 3T0DA 1BBT1 5FPAA 4COVA 3WCRA 2B4KA 3R84B 5F37A 2J1RA 1BEV3 2ZACA 1DZTA 4NR1A 5I0DA 2BS2A 2ODUA 5DG1A 3DXTA 2ZCWA 1OBNA 2HWD1 5FZKA 2ZJCA 3ZR5A 2HLEA 4RR3C 1NX9A 3OB8A 2IC9A 2RV9A 2AZ5A 2W3JA 3AEAA 3N9LA 3O1MA 1NCQB 2XOMA 3AXEA 3H37A 3WNNA 3ZSSA 4D7SA 5L19A 1UCUA 4ZOLE 1NXD1 1BK0A 5DG2A 2XQ8A 4MO3M 4QMAA 1YQ2A 1H8TA 2W52A 3SNMA 4CP0A 1OH3A 1X9PA 2W9XA 2D7FA 4HN9A 2IUWA 4H9NC 3KQ4B 1GBGA 2WL1A 3PLQA 2FDKA 5D8AC 3SFDA 1DQ2A 4K7JA 1MMAA 3A5XA 4A42A 3TNPB 4CU8A 1I6ZA 4MOAA 4OCTA 3EB7A 1RUG1 1KJRA 2LSGA 1DHKB 2JG9B 3PVBB 2VVNA 4KX6A 2WN2A 4CCDA 1S0DA 2XPKA 2P2KA 2JDZA 3OTFA 2Q9QD 3MACA 2PHDA 2HHHT 3I3DA 2ZAAA 3HEIA 1UY0A 2QZ3A 3T08A 4P09A 2A3WA 2RS53 5KX5E 2VZVA 1Y7BA 2QQNA 5FXXA 3VL9A 4DIQA 2QQPA 4OYJA 1MPXA 2V8SV 5FKCA 4KHZF 4CEWB 1XDPA 2WYSA 3VDCA 2A6WA 1WKYA 4A7ZA 3LOBA 4QGMA 3K77A 5A3NA 2W62A 3OF1A 1CZSA 2WAOA 3ZPOA 1SUMB 2J1EA 5JDFA 4XC9A 2EXJA 3JB4C 3W59A 5L73A 3WG4A 3NV2A 3E1F1 2PTMA 4LFBT 3AXJB 1WFDA 2R0FA 1PGSA 3FZFB 1REDA 3EMRA 1L7QA 4W8JA 1GOFA 3IB3A 3UV9A 5E1RA 3A8YC 1NAEA 2CE7A 3NO8A 1N1YA 5JR9C 1WCSA 4KGQA 3JQWA 1VMJA 2A3DA 3H3ZA 4DRRA 2ZGUA 2PYTA 3AE9A 2DURA 3RQWA 2JE9A 4XMAA 3J9SA 2R061 2WS92 1GWMA 4HVQA 5F32A 2YKSA 4QX2A 1C1FA 1K12A 2WZ8A 4H9OC 1V0AA 1YCIA 2W63A 2PELA 1NZIA 3MZHA 5H9QA 4D7TA 4QKFA 2DYCA 1G86A 4AVBA 4CYDA 4QQOA 5DJQC 4KMQA 1R1A2 3KCXA 2VMFA 2L3LA 1W9WA 2WT1A 2ZX1A 1HX8A 4KGGA 2RMU2 1EPWA 1BR2A 4AHXA 3RYHE 2OYZA 1JOJA 4AFCA 2UUCT 1LJ7A 1PHMA 4B3ST 5FZMA 5I93A 3PURA 5FPBA 4CUAA 1VBB2 5JMCA 2XM2A 3JC6C 1ND2A 1UQXA 2JDHA 1O6UA 3WI3A 1K5MB 2VO5A 3LIHA 1WYCA 2XDVA 4QAWA 1PM4A 2JIJA 3O1PA 4QXCA 3BOPA 2BG9B 4OMDA 2VMGA 3ETVA 4QWNA 5FKYA 2BERA 2WWJA 2HBTA 2UURA 5KXDA 4JAAA 2XJPA 2V1DB 3VR9A 3MO4A 3DECA 4I30A 4QPGA 2R7EB 1XB9A 4XBNA 4TLGA 2ENRA 1WR0A 1NA1C 2Q1ZB 4AAPA 4XXPA 2GNDA 4QH1A 4CDUC 1WW4A 3KB5A 4CP2A 4ISRA 1MQTC 3C2UA 2YGMA 5ABGA 1OURA 5IAVA 4NHYA 2DTYA 1UPIA 5IFTA 2PHUA 3ZXDA 4Q27A 4CCEA 5GKAC 3BTAA 3O0WA 2ET7A 5H9PA 4QPIC 2D97A 4XQWA 3BB6A 4Q4W3 3P4SA 5FZ1A 3RWKX 5DUVA 4OI1A 3ONXA 4CDXB 1RJ8A 1BEV1 4N9IA 1QJZA 1QLBA 2MEV2 3PV0F 2ACXA 2JX9A 4DV7T 1RUF1 3KV4A 4JEUB 2ZM2A 1L0VA 3EYPA 2R6GF 5H9SA 3ZFGA 1CAWA 1F4HA 2VW0A 3EABA 4A41A 3UU5A 1H2KA 1HRI1 1UZVA 4Q4X1 4TN7A 2X68A 5LMNT 1PIV3 5T3NA 4AIUA 2XGXA 2QQOA 4GWIA 3D0TA 3VHNA 1F15A 3MF9A 4YGDA 3WP6A 5FZ3A 1W0NA 4LOSA 5FL0A 4PLNA 3KT7A 3LJCA 5AC91 4BQ2A 2J47A 5BPXA 4KBBA 1B35C 5HXMA 2ZEWA 2V5DA 4WM7C 3L3PA 5FUNA 3M3ZB 1SHWB 2BTVC 4BJNA 2WYFA 3NRYA 5A1FA 5KWRA 3FMGA 4CUCA 1AHSA 3D8CA 4DQAA 4CN1A 3LD8A 1HRV2 3OPWA 4QX8A 2A71A 4XW3A 3U14A 5ABFB 4UFHA 4WV8A 2J1VA 4WZCA 4XILA 4AXOA 2LROA 3ILNA 4GA9A 3GBGA 1CAXA 5A6YA 4XFAA 2MOZA 4I02A 2V7KA 3JAFA 4DO0A 1XJAA 4UFJA 1WMXA 5HXCA 3HN1A 5K0UA 4NROA 1M62A 2BNMA 3IEEA 4EV0A 3NW4A 1HNZT 4HSJA 3T8OA 1EPZA 5FFOC 4SBVA 1LHWA 5HXEA 2RS51 5LOVE 4YTPA 2SLIA 5DAVA 4AI9A 4XF0A 1UX5A 4ONUA 1M7KA 2ATFA 1QOTA 3ETQA 2QE3A 2E7AA 3D0JA 4KP3C 1AR61 4ZKTB 2LSJA 2BWCA 1QJEA 2VOVA 4HKOA 2WRAA 2C5KT 5LWBA 2XQXA 4KMCA 2HWE2 1DIWA 3PU8A 3KF5A 3PUZF 1H1MA 3WDXA 1V9U3 1DGLA 3NZQA 4GIQA 1Z7S1 4XJZA 2XH6A 3JQXA 3HWJA 1WLCA 3DUIA 3AA7B 4PJNA 1TMF3 2C6SA 1TNRA 4LLFA 4O4JE 4YT0A 1H8TB 4LKDA 1UK5A 5BNPA 2VGDA 3RYIE 5EJ1B 4WVWA 1L7RA 4TSVA 1VBE3 1MS5A 3SCFA 1W3XA 4MZUA 1F4AA 1ZV4X 5IK5A 4LLOA 3UKVA 3HD8B 4LO5B 3ZSKA 5LNKA 2FMDA 4ADZA 4HETA 4JRAA 3O1RA 4E9KA 2YUEA 4BPZA 1W0OA 5HEJA 4CDWC 1W6PA 4CN4A 1SBFA 2IIUA 3VLBB 1N3QA 4BA6A 3CWZB 3P4PA 1NE6A 2AUYA 3EQEA 3WG2A 1S0IA 2VQUA 4ILBA 5JDMA 1FMWA 4P14A 2K5BB 2W94A 1YIFA 3JD72 1MIWA 2QA7A 1GWLA 1XBFA 3NV1A 1EY2A 1JOBA 1SLTA 4TV9E 3I1AA 4BQYA 4Y1UA 1SG3A 2HWF3 2ZGKA 3OYZA 1YLLA 1TME3 5K8SA 4KBMB 4YZ3A 3THPA 3ZT7A 1A3KA 4DEQA 4ET7A 1DQ6A 4UW5A 4DV0T 1MNEA 3NRUA 1JHJA 4LBKA 3CQXC 3WNPA 4KUMB 4GAZA 3E6CC 1WGPA 1IG0A 4UW6A 1WA6X 5CKQA 4AQSA 5JOYA 2AGSA 5A7PA 1CVNA 3GF6A 3VRAA 2H0VA 4Q4W1 1QMJA 3VKFC 4IV3C 5AQOB 2WM9A 2YHJA 2LEHA 1W2NA 3OBAA 3PTYA 4GALA 4W65A 4XEZA 3GJBA 1BVVA 2PXJA 1RXFA 1RUC3 5L7OC 2LJLA 2IXJA 5FZCA 5J48A 3PUXF 1W9RA 2VCBA 4YFWA 2W1QA 3R05A 1GOHA 4QGNA 1D4M3 1UZWA 1QY4A 2CLYB 1W2AX 2Z42A 4XCBA 5LA9A 3NMBA 3MIFA 2VK9A 1XNAA 2DCKA 3NV3A 3VU7H 2DWRA 3GJAA 3H7JA 5CAZA 1PIV1 1L7LA 1YO8A 1DYKA 3I2FA 4HEAA 1F31A 3I9WA 2HYXA 2A75A 5GLUA 1ND2B 1OPMA 3HKDE 3WF3A 1J5ET 4TYSA 5LW9A 1IJ6A 4NWVA 3TEXA 3Q8BA 1N3OA 4QXCB 4QWNB 1XC6A 1HB4A 2KINB 4C1XA 4Y5TA 1T72A 5FLHA 4BXSV 3FZLB 4E4HA 4QPGB 5DPNA 3DCQA 4GKKT 4TNWA 4IEOA 3LSVA 5IJRA 4NIDA 4HN0A 5JREA 4CCLA 4CDQC 4QQ2A 3SCGA 4QM9A 1VBA3 2VKJA 3AE1A 1GP6A 3DYMA 5JMOA 4U2ZA 3WDVA 3Q8AA 4AG4A 1TQ5A 2LHRA 4RD7A 2H6CA 4HVOA 1QDOA 1W6OA 3ZDSA 5CFDA 2OW4A 1IGOA 1HR0T 2VMIA 3MXZA 2Y0IA 1RJ7A 5L4EA 4JTOA 4YVWC 5FPXA 1YJLA 3R4DB 2O0OA 2EHOD 4EQVA 3I2JA 1VCSA 5FY9A 5ERLA 2DDUA 3U1XA 4QXKA 4MG2A 3ZCIA 3ABVA 4NPRA 2QQVA 4FXGB 4I0BA 2R072 2XQ5A 1NLSA 5KHIA 1HX6A 1W03A 3ENRA 4GYRA 3E22E 3PJAA 1W8WA 1V6IA 3ZFGB 5FY1A 1CAWB 5HWYA 1UKGA 4KU8A 4HFCA 3LQCA 4LFAT 3R4SA 2X9HA 3LA3A 3T2TA 4TN7B 5I0SA 3A22A 1AL23 2AREA 5JI7A 1UOJA 4NAMA 2CBIA 2P34A 3URFA 4TZDA 4ZI3C 1VALA 5J98B 2EXKA 3OEBA 4YM2A 1D2QA 1ZBE2 4NPPA 2DFCA 4HVRA 4RS5C 4XVHA 3AL6A 5H6QB 5FPUA 3ZXFA 1V9DA 4WZFA 4LO7A 2C1FA 1T2XA 5AVAA 1SLBA 3IM0A 2WZEA 3Q9OA 2D2SA 3SQOA 2N1GA 4YZ4A 1ACCA 2ORXA 1UIKA 4QX8B 2KA3A 1D1BA 3KBUA 1DBNA 2H88A 3N2GE 1WD4A 1KDKA 2DVDA 4ATFA 5FMCA 5IT6A 5J09A 4UV9B 4AI0A 1CAXB 4YM3A 5JOZA 1RVF1 3O1TA 2UYBA 5K0UB 4PF5A 5ISLA 4E2GA 3SITA 1GQEA 3RQ0A 4U7YA 4FI5A 2JKBA 2P9BA 2XVGA 1MEC3 3VBSA 1H2MA 4XUTA 4L0RA 1GMMA 1V6NA 2IAKA 4YSYA 1UYXA 2V5YA 2XJTA 4M1PA 4AXPA 3M3IA 2BP6A 5SV8A 4AI1A 4L2NA 2YBSA 4Q4Y1 4I2OA 2D3RA 1C5IA 2GMMA 1KNRA 1AVBA 3RQUA 1BYHA 3VD4A 4OI2A 5KC5A 3LCPA 5IUQA 4P0AA 3FL7A 3FX3A 1GICA 2LOPA 4XJ9A 2DI4A 2KZ7B 5FY4A 2BVBA 4W50A 3GHNA 2XJVA 1FEWA 1NCRC 3ASIA 3THCA 5AQFB 3LWCA 3VBOC 3KCCA 5GLTA 4XIOA 4IREA 1O7FA 2W92A 5AQRB 2KSRA 4C90A 3LA2A 3ZXKA 5FZEA 1PK6C 4P9GA 5BNOA 4NWWA 1AJOA 3ZYGA 4C8DA 3C7OA 2VXJA 1OFSA 3G7DA 4NIIA 3ZJ2A 2XAHB 4LK7A 4BK4A 5BNPB 1UKRA 4CCJA 3AVSA 1OI6A 3WOGA 3I8TA 4LJHA 5FZ4A 2Q8OA 1RUJ3 3RVHA 1F2NA 2HH7A 4QX7A 1ASJ2 4V1Av 3POIA 3KVAA 1REFA 2R32A 4JTNA 1DP0A 2RJKA 4HG6B 4QX0A 3KLSA 1LTEA 1U5ZA 2D0UA 4YGEA 3POWA 5HXHA 3TEYA 3WY6A 3IIIA 5FYSA 1Q56A 1J5WA 4IV1C 3SC7X 3OGSA 5FZOA 2XWJB 1W6PB 3FZ3A 4NUBA 3WR0A 4JV4A 2E5LT 2QRXA 2R1DA 5SV5A 3K75B 4L11A 2JD4A 2XSAA 2MBGA 1LOEA 1NCQC 4ZEYA 2UWAA 3LBXA 4IIJE 2XUMA 4KG8A 3I2HA 4AQFC 4Q8LA 3O1JA 3DTOA 3MIBA 2HEVF 1E5SA 5CA0E 4HT1T 4FOWA 3RI8A 1HJGA 3I0QA 1N1TA 1DLCA 4NOTA 3HNYM 4YVSA 4CZZB 2BJSA 2Y34A 3GYDA 3M2MA 1W8FA 4LKEA 1KS5A 1Z78A 2NR4A 4NUUA 3WF1A 1NEKA 1I5ZA 3C50A 3OGJA 2WFF3 1YFXA 3TEWA 1DYPA 2A7AA 2BZDA 1XE7A 5JXGA 4HBNA 5HEHA 1VBA1 4HE8A 1C8M3 1Y01A 4Y24A 2YV8A 2NW8A 2CMRA 5FTTC 5C4WA 4LHLA 2VZ1A 1OLME 2UY8A 4GULA 3KBTA 2XBO2 3AAEB 3E6DA 5F3IA 4W6XA 4BQ4A 3RKGA 3CHXA 4UW4A 2P5BA 5J7MA 3K3NA 2XQ3A 3LSDA 1YQ3A 4PBOA 4PJYA 1HCIA 5D2AA 3VBUA 2D93A 2VG9A 1S2KA 1H7CA 2VL4A 3HBZA 1XSQA 5KHHA 3KT1A 4UVBB 2PLV2 3IKWA 4PCRA 1FT9A 5A3MA 1GQGA 2GDFA 2VTFA 4D3WA 2VCAA 3AZYA 2ARCA 1G8XA 3DYPA 3JBG3 3NBXX 3Q9DA 1AL21 3B9IA 3RPUA 5EK2A 4DV4T 2A73B 4XAXB 3TOJA 1KEXA 1POV3 4FPEA 5HV4A 2HWB3 2E31A 2OPKA 2CHNA 3K3OA 3RC8A 1VBD1 5LZ6A 1H0BA 1XNTA 2Q1FA 3ZC0A 2WC2A 2WLPA 3OBZA 5L9VA 2NMNA 4QXHA 2PFWA 3VBFA 3AB3B 4RL7A 1VAVA 1C5HA 5L3DB 2WQYA 3CX7B 1W9FA 4LBLA 3KFWX 5FMNA 1WW6A 2BBHA 3RZGA 3RGLA 3BQLA 3IMMA 4BDVB 2JQKA 4KI5M 1WR6A 4RFRB 5AQPB 2Z79A 3WW4A 3MK7C 2VOTA 3GZAA 4KH9A 2WZR1 4P02B 4OHXA 1S0GA 3ZCJA 1AXZA 1WCUA 1W6OB 1ZBA2 3OSDA 4GZ9A 3MFCA 2DHRA 1QNWA 1RTVA 1WZXA 5CFDB 1S4CA 3A0KA 4AF9A 2Y6FA 2QTWB 5CG9A 1Q43A 4UI9L 4OQ8A 2W87A 2Y6JA 4FSJA 3WAJA 2WSUA 3ACHA 3N2OA 3ZIWA 1H30A 1K5MC 5LY2A 4B29A 2VW2A 3VBHC 2FCUA 1XU1A 2PHRA 2A70A 3O0XA 3Q2MA 4JKKA 5A1AA 3MIEA 1X33A 1DGWA 5A1LA 1A34A 3ST7A 2J1AA 4QU1A 3OPCA 5KXEA 3AAAB 4JI7T 4H63H 4QGLA 4CXXA 2QBXA 4ZXKA 2V6YA 3NNLA 4ZPIA 3I2KA 3MV11 1HIXA 1BLZA 3LPGA 1ZZBA 5DAQA 2FDJA 1OWAA 4PI2A 3LA7A 2AE9A 3F57A 1ZZ6A 3BU7A 1HXS3 2E7QA 5FZGA 3JB8A 1QF3A 3UK9A 1MMDA 3O5SA 4AKLA 3ZXGA 2VBBA 2VTXA 3TWIA 2VQ0A 1RUJ1 1XNRT 1X50A 5AQGB 1RINA 4CDXC 1POV0 3EBRA 5F5QA 2VL8A 4PIYA 1DU3D 4HFSA 2EHOA 4KWLA 3O4XE 2GALA 1QNYA 1BMV2 1OUSA 3S30A 3UUNA 3UETA 4YSZA 1W6QA 4MXVA 2QVAA 1GV9A 1S35A 1UL9A 5I0TA 4F8HA 4BOWA 2RPAA 1IS3A 1YWKA 1MS1A 1OVPA 1VRH3 3RZLA 1LCLA 2EAKA 3VBSB 5A7WA 2RM23 4AEMA 1V9U2 2ZLYA 3HN3A 1C57A 4BE3A 3RZKA 4G4FA 3B3QE 4HFEA 4GKJT 1EV13 5JVDE 3B94A 2ZGLA 1OVSA 4D7YA 4OYKA 2D43A 3HQXA 4UFIA 1TMF2 1JYVA 3PUQA 3B7MA 3CIHA 1VAMA 3NV4A 4IERA 2XVKA 4RHV3 2VNGA 1HNWT 2WFF1 2VULA 5C33A 2XUEA 1VBE2 5AQIB 2EXIA 1D1AA 2D5HA 4ZY9A 4LF8T 3OEAA 4Q0VA 4I3PA 2B8MA 2G9FA 3BYWA 4RN5A 5BNOB 1FIOA 3T2QA 2XLFA 1X7NA 2WINB 1SHZC 2WMOA 3S7EA 1OXCA 3TB0A 5FK7A 1KFXL 1PGL1 2IHR1 2P17A 5GZEA 2CGNA 3A7QA 5A3PA 3WDUA 1G73A 2OX0A 1CIYA 3AMPA 4XDOA 1ODNA 1PMJX 4YW3A 1PMIA 1B7TA 1ALYA 4QX7B 5LGUB 1J3RA 1UW8A 4FFHA 4QDRA 4DEVA 4GIWA 2VR4A 3WF4A 4RQPA 4NIAA 3FLTA 3J26N 3NWKA 3WNLA 3HAGA 2D9DA 3W21A 4LK6A 4PHZA 5FZOB 1JYCA 3AMNA 4HN1A 4ILAA 2DCZA 2IW5B 5AFUL 1BHGA 1JHNA 2HWF2 1RYYA 1MMGA 3VDBA 1TME2 2F6BA 5FOBB 1GR3A 2QZ2A 4IEYA 4HFBA 2HWB1 1YUDA 1Y9MA 4ZXLA 3LBXB 3K4DA 4FTEA 4HWCA 2WNVC 1K42A 3ZN1B 4Y1XA 2DU1A 3K48A 4R9CA 3AE5A 2B9VA 4Y33A 1H8TC 5JRCA 1NY71 2W08A 3IN9A 2W1SA 2IXIA 1UY3A 4YVSB 3HL6A 5FZAA 5C8CA 3KVBA 2D40A 5FP9A 3B13A 2C4XA 1MS3A 2M67A 1OA2A 2FHRA 3ME2A 3K4AA 2ZZJA 1US7B 1YD8G 2DFBA 5B4NA 3ZXLA 1ZEEA 3T1YT 1CUNA 2XVLA 3VD5A 4DXSA 1RUC2 4B7EA 1JI6A 1PO23 1OUXA 1QJX2 4ILCA 2WO2A 4YWAA 3PUVF 1BKZA 2VVDA 1CZVA 1UWWA 3WDWA 4TUYE 4LKSA 1D4M2 5C4WB 1JYNA 3CIRA 1Y9GA 2FZ2A 4QHBA 1IZNB 1MVQA 2HWC2 4A5XA 3FC0A 4BQ3A 1IBMT 2JENA 5HYAA 5EK3A 1UOBA 5FLIA 3ELNA 5C9AC 1OD5A 1MR5A 3PJAJ 2P4EA 3SXWA 3VBRA 2B39A 2VMCA 4HZFA 2I0MA 2HH9A 5J37A 2AACA 1IPJA 4FP3A 3W5MA 3F31A 5FLJA 2YZ4A 4ZI2D 3VZNA 3OBTA 4KQ7A 3UGHA 3VDDA 2OLTA 2D5FA 4N53A 1AR92 2W5FA 2ZGSA 4BQWA 1SCRA 4D94A 3HR9A 2XPJA 3MEPA 2X51A 3WHTA 4L0PA 1LKXA 2VPVA 1R081 4LR4A 2C26A 1QQP2 3WUCA 3CVRA 2F4LA 1N47A 4QXHB 4AFDA 3U07A 4Q0UA 3VBFB 5F5IA 3MICA 2MHFA 2Y33A 5IVFA 1C8NA 5A33A 1C28A 3HI2A 2DV9A 2YXSA 3CKHA 5ACA3 1S55A 2WKKA 5JSPA 3CMLA 1J3PA 3S5AA 2DWKA 2Y38A 3AYAA 3KGZA 3E97A 1CONA 4EN8B 4CU9A 5CA6A 3V0BA 4JGYA 3WW2A 3X29B 2HPLA 3BTZA 5BNNA 3DXUA 5F9TA 4FQ4A 4P5YA 3AZXA 2OZ6A 2BPA2 3PTRB 1LU2A 3POGA 5CEHA 2RM21 1PNGA 5BR8T 2BKPA 4U33A 3VZLA 3C4WA 5L36A 2Q5TA 1WLDA 4HKLA 4XACA 1VB4A 1V6KA 1EV11 4I0WB 2VCMA 1C1LA 1HX1B 3GCWA 4IXLA 4LITA 4A6SA 2EALA 1G6NA 5FMBA 4NHMA 1FATA 3BKZA 1GUIA 4Z82A 4P9XA 2QFEA 3MBWA 4D69A 2W4XA 2CGPA 5AQKB 1CZTA 1R093 5CYYA 4ZHQE 2GNBA 5IHRA 4AKGA 4AEDC 4YLHA 4YARA 1QJU3 5AQQB 5L9RA 1GNYA 2V6YB 2ZZQA 3AX4A 3AZVA 3JCFA 3P6BA 2UU9T 3J4UH 1RHI3 4OHYA 1J59A 1LHUA 4XTMA 5C6CA 1JMUB 5EYXA 2JIGA 4A7YA 2JDMA 3NKGA 3UQ4A 5HCJA 5GLZA 4UVCB 4OMCA 2XASB 5FYVA 4COFA 2FCVA 1BR4A 1RUD1 1MEC2 4AFMA 4EE2A 5FJHA 2EHOB 2QQMA 3FWEA 2VMDA 4RR3A 3UQ7A 2WWSA 2V73A 2XJSA 3WQ0A 4UFKA 2B9UA 4MLOA 1W6QB 4EN9B 4LUKA 2VZRA 1NZCA 4LF6T 2Y6GA 1HG2A 4H9PC 3ZMOA 2D6OX 5AQLB 3K2OA 4PK6A 3H3AA 4FQZA 3HKEE 1YEWA 4CCCA 1UY2A 2QDRA 4UF0A 5A7WB 2Y48B 1RUI2 2NYYA 3Q8EA 4X65T 4OHWA 1RUH3 5E6HA 1HJFA 1SBEA 4I50E 3D6EA 1EAH3 3NVOA 3ECQA 4CTEA 5F3CA 1JZ4A 2J1DG 4C0HA 4YZ2A 4CE8A 3HKCE 1DGRN 1AR82 3C3VA 1GZWA 4UYBA 5FREA 2ZEYA 5KMGP 3MGUA 1QEXA 1JZ7A 3NKZA 2Q8DA 1IPKA 4JUYA 5EK4A 3RZJA 2VZSA 3ZN0B 4AGVA 5FYCA 3UU3A 5JDBA 2GK9A 4NN0A 5LEKA 1UYZA 2CGOA 1WBFA 3ZN4A 1PO21 2ZEXA 1W8UA 4DNDA 1IHMA 4FO9A 1HN0A 5FPLA 1QJY2 1U0AA 4AI3A 3WG1A 4WM8A 1UU6A 5CZKA 4I01A 3PE0A 1AJKA 4IGPA 2EAAA 3L2YA 3WQ1A 4W4ZA 2NW7A 3CNAA 3WW1A 1CQ9A 1QH6A 3MW4A 4Q25A 2EIDA 2RS33 4AHWA 3T2PA 2NPIA 1QJX1 4HWHA 1NQJA 1EZ3A 5CIRA 2ZGQA 4QT6A 4RQPB 2NN8A 3GZUC 4CCKA 3K8PC 1F8VA 5D21A 3AKPA 5C3PA 4IT4A 5LJNA 5CISA 4X20E 2DU0A 2GP5A 1OFNA 4K6BA 4L8QA 3HNBM 3BU0A 3TYJA 3ZXJA 3ZEFB 2NTXA 2X05A 1LULA 1DYOA 3EAMA 3L09A 5LY1A 4ANJA 1X8MA 1VBC3 4XMIA 2PG8A 1Y9QA 3O1IA 1RMU3 1LHNA 3WF0A 2JWPA 2YU2A 3INAA 4Q4V2 4BA9A 3MYXA 5J0ZA 1UZZA 4NMIA 1FMD3 1J83A 5FYMA 2UWBA 1W6MA 2XZEA 2BRTA 5JRCB 4QHZA 5DDJ1 1C8M2 2E63A 1BBT3 2J1UA 1DZRA 3H3UA 2WY2A 5C8CB 1C3HA 3H8RA 3VV1A 3LK3B 1QJFA 3J9X1 3HNMA 2QQLA 2K2SA 4EIWA 1FNYA 1LESA 4NHLA 4W6YA 2XAJB 1CD3G 5ACA1 5ANQA 2TBVA 4DMIA 2VZPA 3SEPA 4JRLA 1AR71 4XF1A 3WQ7A 2VCCA 4ASMB 4BAYB 4N43A 4O4LE 1UPSA 1A6CA 3DF0A 2W0XA 2GP3A 1XYPA 4L9IA 1O3SA 5FYHA 4OHFA 4XJAA 3AJYA 4PLMA 2C5JA 3RIUC 5CFCA 3WF2A 1GOGA 1W8ZA 2XONA 4DY5A 2WSVA 4IEXA 1S94A 4K0KT 5LK7B 4XFGA 4Q2FA 3JBG2 3C7HA 4Q0SA 1AX0A 2JD9A 4ZHNA 2O8QA 3UULA 4FTSA 2JQ9A 2VOXA 3U78A 2XB6C 1U5XA 2ZABA 3HMYA 3A0NA 1Q8QA 3VBRB 4GWMA 3AP9A 4DV5T 1WW5A 2D44A 1XYOA 1NA1A 4V1PA 1D2SA 4IEUA 5DQVA 3CMGA 3X1DA 3CLPA 2I6HA 3AMMA 3KV6A 1R091 1RUG3 3PUAA 2EF6A 4ASLA 1MQTA 4JCKA 2LHNA 4WBNE 4EB6E 1XDOA 1FOD2 1QJU1 4N53B 2OXBA 2ZHLA 4NUVA 3IMNA 4QPIA 4OQ9A 1ND3A 2N2NA 3ZVXA 1SA0E 2FZ1A 5F39A 4K1YA 4EYUA 2M6IA 3N9NA 3UGFA 3N9MA 3AEGA 5L3CB 3C51A 4J1WA 2XAGB 4N9HA 5CFBA 2VTXJ 3J7MA 2BU9A 2IFWA 5A33B 2Q9QC 4QQLA 1ZOYA 2PHLA 4XCAA 3OGRA 1T6BX 3UJQA 1N33T 3LEMA 4ZS3A 1O5UA 4Q8KA 2LALA 2XAQB 2ZMNA 3IZOA 1UYYA 2IFRA 4YYOA 3ZSEA 4TWFA 3JUUA 3RX6A 3NZPA 5ABEA 4DBRA 4P9JA 3V0BB 3ACIA 4JGYB 1W2OA 3TLUA 1YQ6A 2RS13 3POJA 1XSRA 5BNNB 3H8UA 3IPVA 4QB1A 1B35A 1ENXA 1BK1A 4DIDB 3UUXB 2NW9A 4MGIE 3AP7A 1X36A 2DBIA 4CXWA 2BBJA 5IVCA 1FPN1 3ZT6A 2ARAA 1RUH1 1WRDA 3LPFA 1HW5A 5FWEA 4FI9A 1YYNA 1XU2A 4PAGA 2FQPA 2R063 2DCJA 4K3UA 2YU1A 5I8YA 4MLKA 3QCWA 2P3KA 4G9SB 4YHJA 4IHJE 2ET1A 5CU1A 3MW2A 4DOUA 3FFZA 1HXS2 2VXRA 3ZSTA 1QUUA 1MACA 2FD8A 2R0HA 4AKHA 3O1OA 5FVLA 1UGOA 3HJRA 5K9YA 5HPOA 1QHDA 4FOQA 1W8HA 4FPLA 5GLWA 4Q1PA 1HKDA 1AYM3 3CX8B 3BVCA 3N9OA 4E4DX 1CX4A 3I59A 4W6WA 4AEKA 5G04L 2YDQA 3FBMA 1O3XA 3H50A 2Q1MA 1OQEA 3J8F1 2X53S 5AQMB 5FZDA 2V6XA 3APBA 3LKJA 4U74A 1YXWA 5F2WA 4A98A 2Y6LA 1XNQT 4MFRA 5HBAA 5EWSA 1VRH2 2RS31 4QQPA 2L9QA 3BQIA 4ILUA 3IAQA 4S2GA 2W1WA 2WDVA 1F5JA 1TEIA 2Z6EA 5C71A 5F5WA 4RR3B 3POFA 2LLYA 1ZNPA 2A6ZA 3AE8A 2WAUA 3AE2A 1PZ7A 1ZRCA 3ACFA 1UY1A 2BV4A 4NHKA 2CAUA 4CUGA 1V00A 1Y43B 4QD2A 4PK4A 3ZLIA 4UF0B 1O3QA 3L8RA 3FN9A 1W0BA 1NT0A 4AEJA 3Q8CA 4RHV2 4JI6T 2CWYA 4BK5A 1PGW1 1ULPA 1D0GA 3KV9A 1RMU1 2XHNA 4G2AA 3I2GA 2OZJA 2ZM8A 1ZA4A 4RYDA 3VKLA 3U3IA 5FP4A 3SWHA 1QOSA 4HPKA 2WQ4A 2HN1A 3LEKA 1I3HA 2R042 2VU9A 1P8JA 4PIXA 2MYSA 4JQTA 1NE4A 2VQAA 1GZWB 3N7LA 4MH0E 2XKPA 5FYYA 3MZKB 4TWHA 3RZHA 4INDA 2D0TA 1RUF3 2XM1A 2CWSA 3TLTA 1XRUA 4I09A 3TBDA 1ULGA 3PMEA 5DZGA 3AP5A 1XNKA 1CHUA 1ULDA 2VKDA 2XL9A 1HRI3 4OZOA 4P08A 2UWCA 2XJQA 4Q4X3 1J1JA 4DR4T 4WM8B 1AYN1 4PNIA 4ZZCA 5HEOA 1SPPA 1W9TA 2Y0OA 5AC93 2X0LB 4O9EA 3VBSC 5FZFA 4B3NA 4BQ1A 4P1NA 4JV5T 2GZWA 1IQDC 1KRIA 1PO11 4EN0A 4XBQA 5HXVA 4AI6A 1F5FA 3ZMTB 1MZ6A 4HFVA 1FV3A 4GJZA 3VGIA 4BWOA 2VUAA 5IVBA 4Q1RA 3VD3A 3QC9A 2VURA 1ZZ7A 4FBFA 1XE8A 2DL1A 1UUSA 4YHHT 2VOKA 3VZMA 1COV1 4Y3OA 3I3EA 4MADA 1VB2A 2PHXA 1ULFA 4M01A 4B3RT 3KZ4C 1OLRA 2UYAA 2A6YA 1YQ8A 2ZX2A 4OX9T 4E27A 1S2BA 4IV3A 4COWA 2X9YA 3ZOIA 1O59A 2YBKA 3NAPC 2ILMA 5IVYA 5FOJB 1Z8UA 2E8IA 1W6MB 5EQUA 1GNHA 3S0MA 5L7OA 1UOGA 3FUQA 4U7IA 4LBOA 1XQNA 3ZYRA 2DTWA 1A78A 1E2AA 4BMBA 2OKXA 1AR63 5FMDA 1ONAA 4Y5SA 3BK9A 2JG8A 4HANA 4N43B 2DVFA 3OG2A 5JXIA 2BOJA 4AGRA 3OOXA 1KJLA 5T52A 4B6XA 3EXUA 2XHKA 2LKHA 2BGPA 3U37A 5A6XA 4E2SA 2RS11 5AQTB 1Z7S3 4RA0A 4IEZA 5CFCB 4AYUA 2ZMLA 3AYCA 3W9AA 3CQOA 3NL1A 2O14A 5A3WA 2BDRA 3ORJA 2VAUA 1LAJA 4JDOA 2VQTA 4S2DA 1N32T 2CXFA 1QKQA 1W90A 4FXKB 4HWDA 1DGWX 3RYCE 4PFOA 4K21A 4R4XA 5C3OA 3ZFFC 4L99A 4Z8BA 5FAXA 2GH8A 2YMZA 3IAPA 1UX7A 5IK8A 3HBKA 5KXCA 3IIAA 1NA1B 3NNGA 2DCYA 1HQLA 4JEHB 3AE6A 2ZMKA 3H3LA 4CDQA 5DAWA 2B7YA 3VL8A 5A3LA 1MQTB 4YLZA 2RP4A 2BBAA 4XDPA 2G4IA 4AI2A 5T50A 2I59A 1AYM1 3CPZA 2ES3A 2WS93 1KEYA 5L3FB 4PDWC 1ND3B 3D4KA 4DPNA 2QKDA 1KITA 4DMWA 4AFAA 3TN91 5EFUA 4META 2C0ZA 4AZZA 5BNQA 4BXFA 3UYJA 4M4RA 2E9XC 4AHZA 4CSWA 1R1A3 1WMDA 5L4HA 4YG0A 4WBBA 2RMU3 1YFWA 3K1SA 4Q0QA 3M7AA 5T5PA 4EOZB 1TG7A 1US3A 4DXTA 3QB5K 3Q5EA 3QOPA 2AH2A 2I45A 3UU4A 3ES1A 3RH3A 5FKBA 5A7NA 1LRHA 1VBB3 3M8LA 3ACLA 2C5IT 4B1MA 5J1GA 2AEZA 3RZMA 5LMUT 2WLQA 1TE1B 4ZZBA 2UY9A 3IPVB 1X9BA 1B35B 3WUDA 2AEYA 1NWMX 2BNOA 1W6NA 2V09A 1O4YA 2H3RA 5EPAA 3M65A 2JQHA 2OPWA 4UOJA 2CM0A 5IK7A 4MV2A 1O4TA 4LULA 1LGCA 3M3OA 1OH4A 1GKBA 4YW5A 4QPWA 4PFPA 4GB31 2NMOA 3N7JA 1AUYA 4IGQA 4LF9T 5HCMA 2M6BA 1UO9A 1RHI2 4HXCA 1JODA 2KWIB 4M0NA 1EP0A 2H89A 1MVEA 4OYUA 3VBFC 2QVSB 1SFPA 2KMFA 5EP9A 2HBUA 2XQYA 4JI4T 1RUE1 1BR1A 4WVMA 1HB1A 3M4FA 4FOYA 5CB7A 4CP9A 1JNRA 5J36A 5IK4A 2IXHA 2XLGA 2WZIA 3BGAA 1UF2C 3DL3A 3I59B 2X5IA 3AJZA 4C91A 1YJKA 1H2NA 2ZGNA 1IQAA 4GJYA 2X29A 3CJIC 3DV8A 4GH4C 1XXNA 1JU3A 3R6NA 3UUBA 2ETEA 2WNUA 4NIQA 2VECA 3FHIB 2WO7A 5KR7A 4K9SA 2R30A 1IAPA 2RDNA 4XOGA 1JYXA 4AOCA 2CDPA 2KD7A 2WAAA 3PNAA 4L92A 3FBZA 3E5QA 4MALA 3U4XA 4XF4A 3ITQA 4GMP1 4NRMA 3RJRA 2XQ4A 5DN2A 1OKOA 4A44A 2KM2A 3RF1A 4FOVA 1NCRA 4LFCT 1EAH2 4DFSA 3VBOA 3KSCA 2DCFA 2QNKA 1EUUA 2VW1A 4AQYT 4C1WA 1HV0A 3OBVE 1ENQA 2FJEA 4BB3A 1CESA 2UXCT 5BMVE 1PK6A 3WNXA 4YW6A 4BJ0A 2ERFA 5GZGA 4HWIB 1RGSA 1URXA 1W3VA 4IEPA 4AVSA 4UXNB 1SDDB 1FMVA 5HXRA 3UKTA 4EXTA 4X6QB 3WVJA 3T1LA 4H9SE 3UNPA 3FLRA 4BLIA 5T55A 1S0BA 1E57A 1HRV3 3VHRA 3F95A 4NIGA 3OBRA 4HPKB 2J62A 3DKWA 3MUY1 3UESA 4AQ2A 4AE2A 4EWAA 1UAIA 1D4VB 2TUNA 2W46A 3AXDA 4PIZA 1W2UA 2CHHA 3EDUA 2WN3A 2EVXA 1KNPA 4UT5A 2XL7A 3FZMB 5I8SA 3JXSA 4DRVA 2G0UA 4BU2A 4IV1A 2EHOC 5FZLA 2ZOEB 2JDAA 4OUMA 3KDSE 4K8RB 4H7LA 4NXMT 1LOAA 3H8XA 3AEBA 3A23A 2Y6XA 4TNVA 1MIVA 3I3BA 2QQJA 2ADDA 2XJRA 3FZKB 4AQFA 4IGUA 3AEFA 1YNAA 1X79A 2IMLA 5E89A 3VD7A 3HKBE 2W95A 1S0CA 4GWJA 3N7MA 1DG6A 5FP8A 4JI2T 4QX1A 2EIEA 4V2WA 2YROA 4KWJA 3V56A 4RFT0 2RR12 2R16A 4JZRA 3GXUA 1VBC2 4EYYR 4DUVA 2VKHA 4YG3A 3EUHA 3P4WA 5T54A 3MA9A 5IATA 3ACGA 4BHPA 1FMD2 1OT5A 5A7OA 4AHYA 5CKNA 4TXWA 4YSFA 4XBLA 4O9GA 4COUA 4WW0A 1CWPA 1BBT2 4EZ4A 4ORFA 4IL4A 4EGWA 3ILFA 2W91A 4O61A 3EO6A 3RYKA 2HN2A 3FUOA 1RVF3 5LA1A 2WS91 2G1MA 2JDKA 3DN7A 1AX1A 3WNKA 2H7VC 1I1EA 4XXAA 3LDBA 2OT7A 4IV3B 2GC0A 2CYFA 3ABZA 3PIJA 4X8PA 4X5TA 1LGBA 4O4IE 1HNXT 4JI0T 4YFSA 1IBKT 2HWD2 5IUXA 1JUIA 4FFGA 1W06A 1HV1A 4OFZA 1H4GA 5JI9A 1R1A1 1LNSA 1YFYA 3RGBA 2YDRA 2RMU1 4Q4Y3 3OY8A 1NYWA 1UIJA 1NLQA 4E8CA 4EWEA 3E08A 5FYBA 4RGAA 3FHNA 2CAVA 2RDRA 2E5VA 2JG8B 5APAA 2Z5WA 5JR7B 4MGZE 4NO4A 2XWBB 2VZUA 3L39A 3AAIA 3I7DA 1VBB1 5BYNA 4JDMA 1LR5A 1XOYA 1JUHA 1O8PA 1DU2A 4XUOA 3JD73 2CWMA 3SH3A 3B69A 2XQAA 2W1UA 1VCTA 4BM8A 1MZ5A 4YSXA 1QGLA 2PQSA 3T4VA 2JXAA 1RUG2 2DNXA 2DVAA 5LBMA 2J1TA 4CCNA 4JKLA 1ZZCA 5LHHB 1RL3A 4UAPA 2P6HA 4LMKA 4G63A 3RC3A 1OA4A 3OJAA 3GBWA 4XE9A 4A45A 4MGTA 3KHCA 2VZOA 2I07B 1JH5A 3AZWA 4ISQA 3ZYIB 1CGPA 3J7NA 3QK6A 4CDQB 1DGRA 1R1ZA 4E7ZA 2FMYA 2A3YA 3MPBA 1EUTA 1LEMA 3KGLA 3BUCA 3MW3A 1Q8VA 1SE7A 3MLJA 3DJBA 4PK5A 5JQGE 1W99A 2Y8DA 4YG6A 4HSLA 3GNEA 3DGTA 1LVKA 5FY7A 2MEV1 3T30A 1OOPC 3FFQA 3SHRA 4HFIA 3ZJ1A 1PVC2 3NJYA 1QSDA 1K5MA 1W8NA 4JI5T 4XQDA 3IDBB 3AE7A 4MX3A 2F4VT 3RS6A 3ZKUA 3VBHA 4OI4A 4P9IA 3N4MA 3AYEA 3ROUA 1YW0A 3CQGB 1NUKA 1IS5A 5F5AA 3N9QA 5JXHA 4NPMA 3LAGA 1JZ6A 1E5RA 1Q3EA 5KHKA 2R062 1FXZA 4M4PA 1T7SA 4JHZA 5LHGB 3HR0A 1SZBA 1QXJA 2D6MA 4ZZ8A 2R6QA 1CAUA 2E51A 4RSUA 2WFPA 3LGRA 1W6NB 3ZPYA 4JKMA 2A6XA 2ADEA 4KBZA 4HL0A 2HEYF 1T98A 1EYBA 4AFBA 2LM3A 2JMKA 2SBAA 2RJLA 2GC3A 4HK9A 2VVFA 2V7JA 1SMVA 1HRV1 5JIUA 3BIEA 3C4XA 4JX0A 3V64A 4JI3T 1ODMA 5FXVA 4B3MT 2VM9A 4Q29A 4IE7A 2PHFA 4QPYA 1I9RA 4WVMB 5FZIA 4CP9B 2OA5A 1ZRRA 4CEYA 4DVDA 1DF0A 3BTXA 5DAXA 4P9YA 3VKHA 5A3TA 3B01A 3RYFE 5BXXA 3GM8A 3WEZA 1J84A 3AC0A 2X5IB 1OEDC 3GHMA 4R9DA 2A9UA 1WLXA 4LO8A 2XLAA 1N1SA 4IDOA 2ZGRA 4JGYC 5FWJA 2O8OA 1SLIA 2O1QA 5FYIA 4AAXA 2FDFA 4YGBA 1PX4A 1GZTA 2WBLA 2WNUB 1J3QA 5BNNC 2R073 4DS0A 4GQ7A 5LBFA 3VR8A 2K0GA 5F8PA 3CJXA 4XJWA 1VBD3 3WP3A 2HWE1 1IZ3A 2VZTA 2E6VA 2Y26A 2YINA 2XKOA 3HT2A 4IE4A 4NE9A 3UKNA 2Q30A 5FJKA 1UD1A 3AB0A 2WA3A 4K20A 3CZJA 1NCRB 1ULEA 5IYYA 5F6LB 3VBOB 2D98A 3O12A 2Z69A 3ZXAC 1ZBE3 2VBDA 3DPRC 1GFF2 3P4RA 1L3JA 2V26A 1C4RA 5L3BB 4FPJA 1BEV2 4XZCA 1PK6B 4F83A 1KS4A 4JI8T 2J42A 2WZR3 5GZDA 2NOXA 4XJUA 3EHZA 1RUF2 5JDNA 3GGLA 2D3PA 4LXLA 4AQ6A 4QB2A 2B46X 3R6SA 4FAGA 3LK2B 1T8BA 4M0HA 4TZ4C 4YPJA 5KXJA 5I0RA 4IDNA 3SH4A 4URTA 1JZ3A 2PN5A 3CDZB 1HRI2 1JZ5A 4Q4X2 3PUSA 1WW7A 4P00B 3OTOT 5DMYA 1DDLA 4Z91A 5LA0A 2I2SA 5FZ6A 3I2IA 4CU6A 2W0GA 4E8DA 2H7OA 4AISA 5AC92 3RWNA 1WCKA 4LUMA 3OD0A 4AKIA 4QU2A 3TLVA 4IV1B 2H0BA 2ZX0A 1YFUA 1ZP0A 3CU7A 1RUOA 3PHMA 5FPZA 3CEWA 3W15B 4H7MA 5HCBA 3JD71 1JZ2A 3H0OA 5HEUA 5JTGA 1UMHA 2NWBA 5HEGA 1AXKA 1IS4A 1UU4A 2V7IA 1NQDA 2WMNA 5KDMC 2WNVA 1MNDA 5LRRA 5GONE 4DXRA 2X67A 4FP2A 1S0JA 3N9PA 2WIIB 4V2VA 3KT4A 3ONLC 2KXPB 2XQ7A 2LE8A 1QDCA 3AZZA 5BV6A 3EDVA 5JZGC 2D6PA 3M70A 3AKSA 5J2TE 1OQ1A 3BQKA 3ZYHA 4M3CE 5DZFA 2RS52 3TLSA 2VBPA 5FYZA 3GZTB 3E5XA 1AL0G 3TKLB 3NKTA 2LSYA 2LRLA 2AR6A 2PMWB 2OIIA 1VE0A 4IEQA 3OCPA 2DVBA 2X0YA 4FPFA 1G9FA 3LDRA 1R8IA 2X66A 2BGCA 1AR62 1QOOA 1UY4A 2C0SA 4CCOA 4LHSA 4IQPA 2VH9A 4PW8A 5I91A 1ASJ3 5CVRA 1LHVA 1ZVFA 2OQ6A 4JDNA 3ZYMA 4O65A 5C9AA 5C8WA 4WM8C 4YTMA 1Z7S2 3VUOA 1VPHA 1FV2A 4XBFB 2A6VA 5FIXA 3VHPA 1GZ9A 3OY8B 2E33A 2WQZC 4LA3A 4XETA 3WAKA 4QH5A 4YXDA 3PMSA 2EIGA 4QXBA 1A8DA 1RXGA 1STMA 5L9BA 1PVC1 3DEMA 2KNDA 4CUBA 3T2OA 4U2AA 3NJXA 2RDQA 4PF1A 4BMEA 4Z2AA 4HONA 2JG9C 5CKMA 4AVVA 2D5UA 2UXNB 5E8AA 2YGLA 4ZS2A 3B9CA 2JRKA 4DNYA 2HKXA 3USSA 4JLEA 5FZ9A 1KDMA 5JDHA 4X1KE 4B7KA 1JZ8A 4B4PA 1X82A 2BDEA 3AFGA 5FUPA 1MMNA 3B57A 3Q5DA 2ZKNA 1OF3A 1Y3TA 1IKPA 1GZCA 2E26A 1OHFA 1WYBA 4BCUA 3ALQA 3GA8A 1XZYA 1Y4WA 4GYSA 3MF6A 3H7YA 5ETWA 1CPMA 4CEWC 4YM1A 4OUEA 5JUVA 3WLUA 3ZYKA 3PVNA 4XZPA 2J1SA 4H9QC 4UW3A 4N43C 2FDIA 2GN7A 4AVTA 2XBO3 1JW6A 3A4UA 4BIOA 3TRSB 3MI8A 4MYEA 4CPBA 3PDYA 1PX3A 2BBVA 1D0HA 2MTQA 5CFCC 4EN7B 2R071 3ZN6A 1LOCA 3I0OA 5B2GB 3W20A 1SLLA 3U4SA 3GN5A 2PLV3 3PVOA 1W9YA 2EICA 5CA1E 5JSRA 5FXZA 3RLFF 3VBHB 5FBJA 2CV6A 3SCHA 4D0QA 4OHVA 3TAYA 5AQNB 2V7LA 1HTJF 4BQXA 1MS4A 1DQ0A
chains in the Genus database with same CATH topology
2ZM0A 2VKOA 4AQFA 2YINA 4B6XA 1MIYA 1FIOA 3H37A 4IGUA 2LM9A 1BR4A 1UCUA 2XAQB 4IE4A 4X1YE 1X79A 4ISTA 4ZOLE 3J7Yq 5F3EA 3AVRA 5FJKA 4E4HA 1SHZC 2WMOA 4BJNA 5F3JA 1YKEB 2ZMAA 5FZ7A 4HE8A 3HKBE 3RX6A 5FY5A 3NRYA 3NZPA 5FJHA 4DBRA 5FZBA 5A1FA 3P7IA 5FP8A 5LG4A 2EHOB 5LYJE 2NW8A 5A3PA 4V2WA 5A3WA 4UIGA 2PBIA 1G73A 2CMRA 5JREA 4HN9A 4CCLA 3AA6B 2OX0A 4BJMA 4XDOA 2K24A 4H9NC 3LD8A 5FZ0A 3MJXA 2JJ9A 4GOUA 2VKJA 2YK0A 2Q9QA 4DMVA 2YBPA 3OPWA 1B7TA 4QX8A 5TAOA 5LHIB 4QX7B 3VHLA 3N2KE 3LFMA 3ZC1A 4EYYR 2LHRA 2VKHA 2CXFA 5LGUB 1MMAA 3A5XA 3ZMVB 5IVEA 2WSSV 2V26A 3EUHA 3MA9A 5L3BB 4XZCA 2NW9A 3UUXB 3KBTA 1HG2A 2CXLA 4GIWA 4H9PC 3UUMA 3AAEB 5F3IA 2XMLA 3RYCE 4ERRA 4PFOA 3K2OA 4PK6A 5FZ8A 2MOZA 5A7OA 4GK0E 3H3AA 1VRBA 3MXZA 2P5BA 3HKEE 4CXWA 5IVCA 3K3NA 2LT3A 2BZBA 2V7KA 3FXDB 4O4HE 2NOXA 4WW0A 3ZMUB 4DO0A 3C4ZA 5FYUA 5HXCA 1HCIA 1WRDA 2LSGA 4UF0A 4EZ4A 2HPJA 2EHOD 5JDNA 5L3EB 5FWEA 2VD7A 3O1HA 2W61A 4LXLA 3IEEA 1H7CA 2Y48B 5FY9A 5IYZE 5A7WB 5FZOB 4JEHB 4PAGA 3LK2B 2IW5B 3ZCIA 5AFUL 3T8OA 4FJOA 4TZ4C 2DLRA 5LXTE 4UVBB 2Q9QD 5HXEA 3MACA 5LGNB 5E6HA 2YU1A 3CX6B 5LOVE 1MMGA 2H7VC 2RP4A 4I50E 4MLKA 5JR9A 3SOLA 4X1IE 3LDBA 4XDPA 4ISSA 4YHJA 4IHJE 2OT7A 5FNVE 5ADXL 3PUSA 4IE0A 2I59A 4AI9A 3ESLA 1G8XA 3Q5XA 1UX5A 4GYRA 3CPZA 3NBXX 4O8SA 3E22E 4P09A 4O4IE 3LBXB 3Q9DA 4YFSA 3FB2A 3RPUA 5KX5E 5EK2A 5FY1A 5F3CA 2OQ7A 5HWYA 2J1DG 4XAXB 5L3FB 2Q8CA 5FZ6A 1QUUA 5FXXA 2W0GA 4AKHA 5HAXA 2CA5A 2H7OA 3HKCE 4KP3C 2LSJA 3ZN1B 4OFZA 4UEMA 4DIQA 2YPDA 4HOOA 4U72A 4DBQA 2X9HA 3CX8B 4AKIA 4Y33A 2C5KT 5F3GA 3N9OA 5LWBA 4TN7B 3K3OA 4DMWA 5KMGP 4KMCA 4OYJA 5JRCA 3RC8A 5FY8A 2Q8DA 3PU8A 4EZHA 4JUYA 3GN5B 4I55E 3HL6A 5EK4A 3ZC0A 5K4LA 5FZAA 4ZI3C 3ANWB 2W00A 2NTYA 3CKDA 1O3XA 3ZN0B 5C8YE 3KVBA 3GWHA 3UYJA 5FP9A 3IBPA 3E08A 3B13A 5FYCA 4BXFA 4MHCA 5FYBA 2E9XC 3FHNA 3RKOA 4CSWA 2DWGA 4QXHA 3NZQA 2M67A 2GK9A 3W15B 2A2FX 5FZDA 1US7B 5A3NA 3AB3B 2W62A 4TV8E 1YD8G 2ES0A 2NWBA 4ZI2C 3ZPOA 4U74A 5L3DB 2W2IA 3AL5A 5FPVA 3AAIA 1ZEEA 2YEVC 4DNDA 4PJLA 4EOZB 4LIVA 2V7IA 5JDFA 5F2WA 2WMNA 3CX7B 5KDMC 5H6RB 1CUNA 1MNDA 4ZI7E 5HWXA 5F5CA 4MFRA 5FPLA 5LJMA 5H6QB 3AL6A 3KFWX 5FMNA 3KV5A 5F2SA 2LOSA 2N9DA 5FPUA 2LSKA 1V9DA 3EVYA 3AA7B 5GONE 4PJNA 3BQLA 2X67A 3RH3A 2CEAA 2OS2A 2KLQA 1WR6A 2K9AA 3PE0A 2L9QA 3N9PA 4O4JE 4IGPA 5A7NA 1UX4A 3BQIA 2V7MA 4ILUA 4V2VA 4F6RC 3MK7C 5LP6E 2C5IT 2CCQA 2NW7A 2CE7A 1YKHB 4CI3B 2D2SA 5J1GA 2KXPB 4TUYE 2Z6EA 2N1GA 2DNXA 4HKAA 2LE8A 5FZHA 5LBMA 4URAA 5L3GB 5JR9C 2E9XA 3PUGA 4CCNA 3RYIE 3ZYLA 2Q9QB 4ASKA 4QX8B 3ZCJA 5LHHB 1D1BA 3KBUA 3N2GE 4CQIA 3EDVA 2A3DA 2WAUA 2KWHA 2QGSA 2XAFB 3FXEB 4G63A 5DQWA 3RC3A 1NWMX 1HG5A 1IZNB 2JPFA 5J2TE 2CLYC 2DHRA 4UV9B 1D1CA 3BQKA 4CXYA 2H3RA 1ZV4X 4CUGA 1EZ3A 3M65A 3OJAA 5HYAA 1LVFA 3RRWA 5FYTA 5EK3A 2CM0A 5F32A 3IHRA 4L5GA 4I4TE 5FYZA 4PK4A 4J2CA 2JMHA 3ZLIA 4CCKA 5LNKA 3K8PC 4UF0B 4PFPA 4IE5A 2KT9A 4ADZA 5ISLA 4H9OC 4Z8XA 2W63A 2L8KA 4IGQA 5IVVA 4FI5A 3N5LA 3RRCA 3TKLB 2LSYA 5E0OA 2VWAA 4ZI3D 5LJNA 2CWYA 4X20E 3Q5WA 2PJQA 2P9BA 3KV9A 3QK6A 2GP5A 2KWIB 3UT5E 5L2LA 2X66A 4YJ2E 4O2AE 4CI2B 4E7ZA 3WAJA 4G2AA 4L0RA 3FBLA 3GMIA 3F31A 2IAKA 3MKDA 3N2OA 2ZM8A 2CXDA 3SS1A 3ZEFB 2NTXA 5JR9B 4QHOA 5DJQC 2C0SA 4CCOA 5LY2A 4M1PA 4AXPA 4ZI2D 5J2UE 5LA6E 2KMFA 2L3LA 3L09A 4PW8A 4ANJA 5LY1A 3S4UA 2XQYA 1HX8A 3U3IA 5FP4A 3SWHA 2PG8A 1BR1A 1HFAA 2SPCA 2YBSA 3O1IA 3CWZB 3DJBA 4PK5A 1BR2A 2YU2A 2OQ6A 4YJ3E 3RYHE 2LSIA 3Q2MA 5JQGE 4BA9A 2Q8EA 3OKQA 3ZYMA 1IJ5A 4HTEA 1D0YA 2Y8DA 5JDMA 2MYSA 1FMWA 5FZMA 5FP3A 2K5BB 5A1LA 5FYMA 1HS7A 1LVKA 1MIWA 5FY7A 4XBFB 5JRCB 2X9WA 4QU1A 5FYYA 2X51A 3MZKB 3PURA 5FPBA 4BISA 2QA7A 5FXWA 3AAAB 2RA1A 4H63H 2NP9A 4P0AA 4D6RA 2D0TA 1LKXA 4CXXA 4D6SA 4TX5A 4C91A 2LOPA 3JC6C 3ZJ1A 2DI4A 2KZ7B 5FY4A 4MBQA 3LK3B 4WBOA 4GJYA 3CVRA 4TV9E 4UVAB 3J9X1 3WAKA 3ETUA 3I1AA 4OK0A 5IVJA 1FEWA 3NJYA 1QSDA 4QXHB 4EIWA 4PJMA 5JH7E 3WI3A 5F5IA 3OPTA 1E1HB 3R6NA 2XAJB 2JQQA 5ANQA 1WYCA 2XDVA 2VASA 4Y4RA 5IVFA 3OYZA 2VKDA 4QXBA 4LIUA 4QXCA 1VOMA 1YW0A 2WWUA 3AA1B 4KBMB 3CQGB 3CQCB 5KR7A 4H63V 3ETVA 2B1EA 4BAYB 3HI2A 4QWNA 1OWAA 3LK42 4O4LE 4C90A 4IGOA 1IAPA 2WWJA 1Z0PA 2IC6A 3E0ZA 3F57A 4UV8B 2GP3A 5FZEA 3F2EA 3QUJA 5EZYE 4L9IA 5FYHA 2KNDA 4OHFA 3HA4A 5F5AA 3N9QA 5JDGA 3CMLA 4C8DA 2V1DB 4PJJA 1HF8A 5FZGA 2C5JA 4PNIA 3FBZA 2A72A 4CI1B 1MMDA 1ZKEA 4AKLA 2DWKA 4MALA 3ZJ2A 2XAHB 2X0LB 1MNEA 5JDLA 2PFVA 3CQXC 3DP7A 4HONA 5LBQB 5FZFA 4KUMB 4GAZA 2VL8A 3PU3A 1KNZA 5LHGB 5FY0A 3HR0A 2ODVA 2D5UA 2UXNB 4HGAA 2E9XB 2EHOA 4AAPA 4CCJA 3SRZA 2XHEB