4DO0A

Crystal structure of human phf8 in complex with daminozide
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
363
structure length
363
Chain Sequence
VKTGSPTFVRELRSRTFDSSDEVILKPTGNQLTVEFLEENSFSVPILVLKKDGLGMTLPSPSFTVRDVEHYVGSDKEIDVIDVTRQADCKMKLGDFVKYYYSGKREKVLNVISLEFSDTRLSNLVETPKIVRKLSWVENLWPEECVFERPNVQKYCLMSVRDSYTDFHIDFGGTSVWYHVLKGEKIFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVDKCYKCSVKQGQTLFIPTGWIHAVLTPVDCLAFGGNFLHSLNIEMQLKAYEIEKRLSTADLFRFPNFETICWYVGKHILDIFRGLRENRRHPASYLVHGGKALNLAFRAWTRKEALPDHEDEIPETVRTVQLIKDLAREIRLVED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Histone lysine demethylase PHF8
total genus 103
structure length 363
sequence length 363
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2012-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4do0A02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4do0A01
5A3TA 3PUAA 2P5BA 4LXLA 2XDVA 5FZ1A 5F3IA 5FZBA 5E6HA 5A7OA 2OS2A 5IVJA 5FY9A 3K3OA 5FPAA 5A1FA 3PUQA 4GJZA 4IGOA 5F32A 5FZLA 5FV3A 5FZ4A 4UF0B 3N9OA 5LY1A 5FZOA 3K3NA 4QXBA 5F3CA 5A7PA 2Q8CA 5FZDA 4CCOA 5FPUA 3N9MA 2YBKA 5FY5A 2OX0A 2OQ7A 3KVBA 2YPDA 4AAPA 5FZMA 5FJHA 5FZGA 5KR7A 4CCMA 2GP5A 5IVFA 5A3NA 4D6RA 5LY2A 3U4SA 5FY8A 4QX8A 3PURA 5FY4A 3PU3A 5FZ8A 2XUEA 4Y3OA 5F5IA 5FZAA 4D6QA 5IVVA 5F2WA 3PTRB 5F39A 5FP7A 4EZHA 5FZ7A 5FYIA 4DO0A 2Q8DA 5FY0A 5FZ9A 2VD7A 3DXUA 4QX7A 4HOOA 4Y4RA 5FZ6A 2Q8EA 5FJKA 4LIVA 4QXCA 5FP8A 5FPBA 3AL6A 4GJYA 4QU1A 5FWJA 3KV6A 5FPLA 5FYBA 4C8DA 5FPVA 3AL5A 5A1LA 5FZOB 3PU8A 5CEHA 4EYUA 5FZFA 4Y33A 4HONA 2WWUA 3N9NA 3NJYA 3N9PA 5FZ0A 5FXXA 2YU1A 2XMLA 4E4HA 4V2WA 4QWNA 2YBPA 5IVBA 5F3GA 5FP9A 3RVHA 5FWEA 1VRBA 4LIUA 5FYVA 3KVAA 3DXTA 4UF0A 2XXZA 4CCJA 2YU2A 3PDQA 5IWFA 4QXHA 3N9QA 3ZPOA 4TN7A 5A7QA 3LD8A 5FP4A 4EZ4A 5IW0A 4GAZA 2OT7A 5A7WA 5A7WB 3U78A 4AI9A 4LITA 5FYUA 5F5CA 5ANQA 5FZEA 4NUBA 4V2VA 4CCKA 3KV5A 4CCLA 5FXVA 2GP3A 5A3WA 5FYHA 5FXZA 5FUNA 5IVEA 5IVYA 5F2SA 5K4LA 3PUSA 4IGPA 4GD4A 4BXFA 3OPWA 2YBSA 5LWBA 3KV4A 5ISLA 4CSWA 5A80A 4URAA 5FZKA 4DIQA 2WWJA 5FYSA 5F3EA 5IVCA 4IGQA 4XDOA 4CCNA 3AVSA 3LDBA 2W2IA 5F37A 2PXJA 5FZHA 4D6SA 5FUPA 3OPTA 3AVRA 5F5AA 4BU2A 5FYTA 3K2OA 5A7SA 3UYJA 5FY1A 5LW9A 5A7NA 5FYZA 4BISA 5FY7A 4CUGA 5FP3A 4XDPA 5FZ3A 5FZCA 5FXWA 2OQ6A 5FZIA 4ASKA 5FYCA 5A3PA 5FYMA 5FYYA 3N9LA 5FBJA 3KV9A 3ZLIA
chains in the Genus database with same CATH superfamily
5A6ZA 5HEOA 3VDCA 1NY72 2ZACA 4DR2T 2B46X 4B6XA 1XE8A 2ZGNA 4WM7B 3QCWA 3RZKA 2NW7A 2FBEA 1OKOA 3BPZA 5HV4A 5A1FA 2CRBA 1XNCA 1NA1B 2HWE1 5FZ4A 2BVBA 2PAMA 3KCYA 5EZWA 1F8VA 5LGUB 2YROA 4NXMT 3B9CA 4K9SA 4KU8A 3RYHE 1PGL1 1K5MC 1QY4A 4XFHA 5FPUA 5IJRA 3KCCA 1R093 1BMV1 3AE5A 4ZI3C 1WW6A 1M7KA 2O0OA 2YPDA 2V1DB 3H0OA 1X9PA 3LEKA 2NOXA 3BK9A 5AQJB 1EV13 2VZ1A 1FMD1 5A3NA 1HG5A 2Q9QC 1UZVA 3UUXB 4QKBA 2LRLA 3AP9A 3JBG3 5G05L 3ZMTB 4ASMB 4OK0A 2Z69A 2X53S 4UFMA 4N8MA 1DQ5A 1JUHA 1VALA 2VXRA 3I3DA 4XW3A 2YGLA 3AKTA 4W50A 3NNLA 1JU4A 3OGGA 4QT6A 4ZXKA 3SQOA 4BXSV 3PUHA 4CQIA 1J58A 4FFFA 1UIJA 4P0AA 2JE8A 3R0RA 1K12A 1GLHA 4NE9A 2CPTA 3CWZB 1QUUA 4YTNA 2SPCA 4GB32 4N78D 1VBE2 2CEAA 3KZ4C 1BR1A 4Z8XA 2EXKA 1OPMA 4QX7A 1V6LA 4HFDA 2HWD2 5DPNA 2QQPA 1W6PA 4CXWA 1YJKA 3R4UA 2JRKA 1C8M3 1I6XA 2D7FA 5FZDA 4XAXB 1WCUA 4Q0UA 3P6BA 3RG0A 5BNPB 3LBXA 1NLSA 5EZYE 4YYOA 3FBMA 3ZJ1A 1A6CA 3VBHC 2WFPA 4PI2A 3IF8B 2DVBA 2HBUA 3RI8A 2EVXA 2IHR1 3VRAA 5LJNA 1Y9GA 2RVAA 2IUBA 1ULPA 3RPQA 2W47A 5FKBA 2CGNA 3ACHA 1AR91 1H9PA 3B00A 3HQUA 2X9YA 4CDUC 3RVHA 1JBCA 1N47A 2CY6A 2XTLA 5D8AB 4E4DX 5J48A 2XL7A 4MHRA 4YZ4A 5DAVA 3L3PA 3RHWA 2WB5A 5JR9B 1NE6A 2Q1FA 3D8CA 1KF6A 3JD73 5LHGB 4XTPA 3SH3A 2XGXA 1ZEEA 3CX6B 5L2LA 5LG3A 4PFOA 4H63H 1VBE3 5AQFB 1WMDA 5FP4A 4X64T 2HHHT 2HBTA 3MICA 4HEAA 3WUDA 2VBDA 4AEKA 5IW0A 3DUIA 4GAZA 3KLSA 4RFT0 3J7Yq 2CDPA 2WNVA 1LECA 1O4YA 4QGMA 2VOKA 4QPIC 1LHNA 4UELA 2ZMNA 3NL1A 3E5UA 4JKKA 2HH7A 2ZGKA 4NUBA 3H1WA 3B13A 1UYYA 2EHOD 1WLCA 3RIFA 4SLIA 1JW6A 3SKVA 5F9TA 1RJ7A 2VVSA 2BRTA 1F2NA 2X05A 4IQPA 4G4FA 1EZ3A 4JTOA 2FDHA 3OBVE 3WY6A 5CFDA 2QQNA 1UMHA 1BCXA 3H1YA 1K5MB 4JGYB 5HCJA 4LF7T 1VCTA 2J1TA 2LW8A 1MIVA 2KXPB 1DF0A 3LDKA 4P0BA 3E6CC 3AP6A 3ZCJA 4PF5A 4XBQA 4YVSC 4Q4W3 4DEVA 2DU0A 4IGUA 2QVSB 2IXHA 3FZ3A 1AHSA 5FOJB 1UX7A 3CKDA 3FLTA 5LK7B 4Y5SA 1ZOYA 2ERFA 3SCFA 3T0AA 1XDOA 1Z8UA 5FUPA 1IBKT 1CAXA 3VKFC 3TNPB 3B94A 1VCSA 1D0HA 5GJ6A 3SEEA 4KX6A 2Y64A 2CA5A 2R7EB 5FYZA 4CDXC 5FY7A 4DUYT 3FB2A 4QXHB 4EN6B 2GN3A 2OQ6A 5KHJA 1GYKA 1DQ2A 1NEKA 3FN9A 4ATEA 1D1BA 3ZSEA 5JSOA 4PI0A 3ETUA 1VOMA 1LU1A 1GP6A 3DCQA 3MF9A 2YV8A 4M0HA 1HXS3 1UOFA 4BWOA 5HBAA 2WNUA 5CADA 4PK4A 1W8TA 2JDMA 3PUAA 2RS13 1FAYA 3ZN4A 3ES1A 3FBZA 2RDQA 2E51A 4CU8A 5CISA 2RS31 1MS5A 2QQWA 1V6KA 5D2AA 4GKJT 2RS32 3T0BA 2OKXA 3ZT6A 3WW3A 3NVOA 1W6OB 2W92A 4KGGA 5KXEA 1TE1B 2VKDA 3D82A 3H7YA 4GH4B 3AMMA 4R4ZA 1XNRT 3W58A 2V5CA 4PAGA 1PK6A 3VRBA 2EAKA 3MIDA 1PMJX 2WA3A 5FIXA 3N9MA 4FCAA 2D6OX 2Q8CA 2BBJA 5IUXA 4CCOA 3MUZ1 5BNOA 1O3QA 1HV0A 3NNJA 2GMEA 4CEWA 4M4PA 1T8BA 1W39A 3FZFB 3UU5A 2W1UA 4QPYA 1O3XA 3WF1A 1PVXA 1GBGA 4CP0A 4DS0A 4ZI2D 2LROA 1QJZA 2PHUA 3RF1A 3C7OA 4NWVA 4X8NA 2WYSA 5FY8A 2VZUA 2DCTA 3AA1B 1N3OA 1XWMA 2CU5A 4Y3OA 3AECA 3QOPA 4FFGA 4UXAA 4B7EA 2NTYA 4JI2T 4AYUA 5CFCB 1MZFA 2C4XA 4I01A 4W6YA 3P3PA 2D9DA 4H63V 3CIRA 1R1A2 3HBZA 1CZTA 4GA9A 3WDVA 4JBWF 1AL23 4IV3C 5JVDE 3RYKA 3S5AA 2BJSA 5M0TA 5AQIB 2Y60A 3OEBA 2VCCA 3POFA 1K3IA 5EJ3A 5LZ6A 4PK5A 1HR0T 2X29A 1Q56A 4MZUA 4N7UA 4Z1VA 2G0UA 4XFIA 1MQTB 3AX4A 3MLKA 5CZKA 3USUA 2HWB2 3KV6A 3JQWA 2BGOA 5A1LA 3C98B 4DUVA 2DVDA 1VR3A 2MYSA 3HI2A 4QKNA 4DVDA 4KH9A 2BGCA 2CHNA 2KLQA 2R061 3ME2A 1VJ2A 4G3YC 1AXKA 3RZJA 3TLTA 3TNQA 3ONLC 2YXSA 2ZGOA 4I09A 1R1ZA 3OGVA 1ULCA 2V26A 1SFNA 3KT7A 2VOWA 3DYOA 1YQ4A 2VH9A 3GN5B 5CGMA 1DQ1A 1HKDA 4EGWA 1W8UA 1O5UA 2KXLA 3GN5A 1EYBA 1RUG3 3IB3A 3ZSLA 2IXJA 5C6CA 1C1FA 4CEWC 2XJPA 4JI6T 2Y6HA 4WV8A 5I0DA 2VW1A 4N90A 5H9QA 3RZLA 2K0GA 1AR92 4RHV1 3JADA 2KMFA 2VB6A 3CIHA 5T5OA 3MIHA 3EXUA 2IXLA 1C8M2 4D0QA 4UEMA 3RQ0A 3THPA 3HWJA 5GZEA 1NCQC 3O1PA 5HCMA 2K24A 2D6PA 4IEZA 2CXFA 5F3JA 1S2EA 4PJMA 2JDYA 5D21A 1W04A 2A2FX 3WDYA 1YFXA 4XUQA 2A3DA 2KSRA 1XSQA 1H8TA 4TZDA 3MLJA 3CBNA 4Q2FA 1XNTA 2MEV3 4K40A 2KA3A 3O1IA 1AXZA 3GZUC 4LBQD 4LE3A 3VZMA 3SNMA 1GOFA 4ZZ8A 1JMUB 3FUOA 2DFCA 4AWDA 3TWIA 2VOVA 3UJQA 2A7AA 1W03A 2YC4A 3UESA 1YWKA 2ARXA 3PMEA 4O2AE 1AR63 4JGZB 2RDNA 2RR12 2VY0A 2YMZA 2A9UA 4X6QB 2N9DA 1UXZA 3OPTA 3ZYPA 5IAXA 1NUKA 1T98A 1XYPA 3E1F1 1WCKA 3GXUA 4K1YA 4BQYA 3O1MA 2C9KA 5FY1A 5AC93 4I0BA 2WAOA 5C7GA 3AJZA 3BYWA 3BTYA 1J5ET 3JQXA 4GWIA 1UURA 3ZC0A 2CAVA 3ZFFA 5J96B 1KGYA 5GALA 2BG9C 2CXDA 1ZNPA 2YB7A 2WP9A 3SISA 3VBRA 4BK4A 3B57A 2OPWA 1A8DA 3KT1A 3BQIA 4FT8A 2XASB 1GU3A 3APBA 4CPBD 3ZN0B 1OEDC 1U5YA 5CA6A 2JWPA 1ULOA 1RHI3 4LXLA 3SOLA 2P5BA 2AR6A 4OMCA 4OYUA 4QXCB 1OOPA 5LATA 3O4XE 5LHHB 3MA9A 1VAVA 2ZM8A 5C8CA 4L9IA 5D1IA 5IUQA 1SLAA 4ONUA 1OKQA 2WRAA 5FREA 2ODUA 5JR9A 5A3UA 5JMOA 2E9XB 1AR62 5FVLA 5CG9A 1RXFA 4YZ3A 2Z4FA 4JCKA 4GJZA 5LEJA 5JOYA 1BBT2 2VVNA 2ZHLA 2D98A 3PUYF 1JYNA 2JMKA 2DUQA 3LZZA 4XJAA 3PUXF 2V5YA 1NT0A 4E2GA 3ZFEB 4CU6A 1DHKB 4Z8BA 4ZHNA 2QDRA 3DP7A 1OA2A 3GWHA 4QX1A 5CJ5A 1JUIA 4YM1A 5I0UA 3A7QA 4HGAA 1YQCA 3W59A 3K48A 3HEIA 4H7MA 3N5LA 1T6BX 1W8NA 1HRI3 2ARCA 2SLIA 1DFQA 3I2KA 5FZ8A 4COVA 4IL9A 4E8CA 3AP5A 4DXZA 4PDWB 2ET1A 1YW0A 3PMSA 1F9KA 1H2KA 5HCHA 3I8TA 5FQ0A 1DZRA 4QQOA 3WZ1A 1H6XA 4XABA 1XNAA 3OPZA 3VBFB 5JIUA 3Q8AA 1HG2A 4QPIB 2WQ4A 1F4AA 4LHLA 1LEMA 2XZEA 1YD8G 3MIGA 5FPZA 1ZZ8A 1QXPA 1EV12 2CLYB 2GAUA 4YJ2E 1ASJ2 1YQ8A 5LA9A 3WG3A 4EEBA 2I07B 3L39A 4V1Av 2JXAA 2LRPA 3VR8A 3A8YC 1L3JA 4AKGA 1LULA 1O7FA 5LBMA 2DHRA 2WZHA 1B7TA 1HXS2 2VZSA 5A70A 3QK6A 4EYUA 5KC5A 4OYJA 5DQVA 2JG9B 1RXGA 5FXXA 3QNUA 3JCIA 4PNIA 3NJYA 3E22E 1O8PA 3AE2A 4XQDA 3WP6A 2V7MA 2YDRA 1YUDA 4BPZA 2CWSA 3WDXA 1D2SA 3GBGA 1OOPC 4PF1A 2WMOA 4Z07A 2J22A 4XFFA 2XL9A 1UIKA 4TWHA 1APNA 1V9U3 2DBIA 2RS11 3F31A 1UN1A 5ANNA 1VIWB 1VMFA 2JQKA 3KBTA 2X9XA 3SCGA 3VBUA 2WINB 3OUIA 5LMNT 5CA1E 2NM1A 3AK0A 4XE9A 5GLUA 2YC2A 1OXZA 3CKHA 5LGTB 2WAAA 4P9XA 3QUJA 3HR9A 4JC1A 1UU5A 4HVOA 1MEC1 5LRSA 3HKBE 4GB33 1CPNA 3OY8A 5C3PA 3AXJA 1UO9A 1W3XA 5F5CA 3JC6D 4C90A 1W8HA 1E1HB 1N32T 1W9TA 3VZJA 1LVKA 3KV5A 1OFNA 1SPPA 1LODA 4NIGA 1WW4A 1JZ2A 3MZHA 3OOXA 4UV9B 4XQ4A 1EPZA 1OFSA 4COFA 1WR6A 1YC61 2AGSA 4GULA 4K20A 5FYHA 1H30A 1PX3A 3WQ0A 5JCTA 2E7QA 4AQSA 3VV1A 1YHFA 4Z91A 3ACLA 5IK8A 2QTWB 4JX0A 1YYNA 5TSWA 3NKTA 2PHDA 4TSVA 4HXCA 3UFEA 5ABGA 2GNMA 2C6SA 2I45A 3OPWA 3RQWA 4QPGA 1URXA 5BY5A 4YG0A 1IBMT 1D4M1 1UOGA 1I3HA 4WZFA 3HNBM 1HV1A 1QDCA 3VKGA 4GMP0 3AE9A 3EMRA 4GZ9A 4AFAA 3JD72 3LF7A 3WINE 1CHUA 1LOAA 1H4HA 3KQ4B 4Q4X2 1X36A 3PL0A 2V7KA 4DV4T 1IKPA 4CXXA 1ZBE1 5A7NA 1G9BA 3DKWA 5F5QA 2VZQA 2W1QA 4Y24A 2VTXA 3DGTA 2B9UA 4LMFA 1VBE1 2CWYA 1DGWA 2OUHA 4FI5A 1OC1A 4O9EA 4LKFA 4BB3A 1QJEA 2B45X 1NG0A 3DF0A 1D0ZA 2H88A 1AYN3 5JR7B 3JD71 3BB6A 5DDJ1 2LM2A 4UFJA 1VRH1 2WWVA 3MIEA 2XDVA 5BYNA 2YHJA 1H4GA 2XQ4A 4Q0QA 4TUYE 3ZMOA 1MS3A 2W2UA 4YLHA 4DR7T 3AB0A 2KINB 4M3CA 2Y6GA 1FMVA 1IHMA 3QD6A 4OHFA 5FV3A 2H3RA 3RI9A 3AEAA 3JAEA 3OTOT 1J3PA 1O4TA 1PZ9A 1SUMB 1MQTC 1QJY1 1TME1 1VE0A 2W0GA 2P3IA 1SEFA 5LBFA 4EJRA 5J09A 4XIOA 3ILRA 3K8PC 5JDQA 2A6YA 3MZKB 4Q4W2 1PO11 5A7PA 1VBC3 4ZI7E 4DUZT 1YNAA 4HK8A 4J25A 4A4AA 2JECA 2XAFB 3VD9A 2HN1A 3V5SA 2R6GF 2G9FA 2GNBA 2E26A 1MACA 4FBFA 5KR7A 4X1YE 4NPRA 3LK2B 1VBC2 3C7GA 3RYIE 3T2PA 4AFDA 4QDQA 1JTZX 4I2OA 4P1NA 4OVEA 4LMJA 4BMBA 1DZQA 3PURA 1WD3A 3LA3A 2FZ2A 3PU3A 2JX9A 5FMOS 2ACZA 2D5FA 3AM2A 4RA0A 1VRH2 2D40A 4IEVA 4Y1ZA 3HR0A 2X9HA 2RS12 3ATGA 5H9PA 2UXNB 1KDKA 4KWLA 4WM8A 1KD7A 5GZGA 1WLXA 2XM2A 1RVF1 1TME2 4A97A 2VD7A 3ZR6A 5FZ6A 1OI6A 3WF4A 3K3QC 3MK7C 2XY8B 3PUWF 4XMAA 4XZUG 3HL6A 3VBHB 3VBOC 1LR5A 3WG1A 2R041 3LEMA 3VDBA 2XHKA 4QPWA 2WZIA 2R071 4I43B 4JKMA 4RHV3 3MIFA 1Z7S1 3QACA 2XKOA 1J3QA 2DLRA 4GXLA 5FUIA 2BNNA 3GDBA 2ZGRA 3TYJA 1W8ZA 2XLGA 1YLLA 1RUG1 2DU1A 3HT1A 2HWC1 1AX0A 1KEXA 4EAHA 3I3EA 2L9LA 1ZZBA 3POIA 4K8RB 4YARA 3TEYA 4AIUA 3WG2A 1F35A 2KZ7B 3TKLB 2ENRA 1H2MA 2ZJCA 4TWTA 4FPEA 4XOGA 2OA5A 5FK7A 3LSDA 1Y43B 4JKLA 3UQ7A 4JI1T 1SLTA 1PVC2 3B93A 4NXNT 1KFUL 2DURA 2IZWA 3M3QA 4OULA 5J7MA 4A7YA 2XLAA 3LD8A 5L3EB 1LKNA 1QLBA 3ACIA 3WW1A 4CA9A 3AEDA 4D7SA 5J37A 3IIAA 3VDDA 5ACA1 2X10A 3WW2A 2EICA 1D2QA 4HK9A 1RITA 2AREA 5E1RA 5FZEA 1AX1A 2VJXA 4MV2A 3ZMSB 4YVSB 2JKXA 4YM2A 2K2SA 4BJNA 2M6IA 4L99A 3M2MA 2VUCA 1OF4A 5B4XA 3RWKX 3W21A 4Z2WA 1MS9A 2XQ3A 4QB6A 4DXTA 1OEDA 1S0EA 4H9QC 2X8KA 1IZ3A 2CGOA 2LE8A 5F2SA 3WP4A 1HCIA 1OUSA 3WG4A 3J8F1 2TBVA 3NRUA 3H7JA 2HYXA 1UOJA 3ROUA 3AFKA 3P4SA 2CCQA 1XE0A 3BQLA 5E88A 4C8DA 4EV0A 4URAA 4MX3A 4L0PA 3RYCE 4RQPB 2P6HA 3E08A 3WQBA 4AZZA 2IW5B 2W2IA 5FQ0B 4NRPA 4K8FA 2RR11 4AAXA 1FJGT 1QIQA 2W08A 3CJIC 1E5HA 3ZM8A 3IKWA 5FPXA 5JI9A 4AKLA 4Q4Y3 1CVNA 4YFSA 1DU2A 2A3XA 2JE9A 2ARAA 2QGSA 2LS6A 1DLCA 2IMLA 1OQDA 2ZMLA 4Y22A 2MHFA 1QQP2 1E5SA 1JYWA 2VZTA 1O8SA 4ARXA 1NAFA 4ASKA 3E0ZA 3VZKA 4F3JA 2VK9A 2VTFA 3VL9A 2PELA 3WNOA 2QQKA 3I1AA 1O59A 2YZ4A 5L4EA 4ZKTB 2H7OA 5LA6E 3TOJA 5JMCA 5E6HA 4BQ3A 3D0SA 4YSFA 2PN5A 2L8KA 5JDHA 3EHZA 3WAJA 1OVSA 3RQUA 2WT2A 4LK7A 2P1BA 4MVTA 3KMHA 4ZONA 5LA2A 3WNPA 2K3WA 4HVQA 2QZ3A 1PIV3 2JDHA 3DPRA 5LG4A 3AFGA 2H89A 3AP7A 3R6NA 1SLBA 1JHJA 4IREA 1COV1 3JBG2 4AI2A 4OQ8A 2XWJB 2GNTA 4CDWA 1AR83 2GMPA 2CXLA 1N34T 1BBT1 3AEBA 2BW8A 4MO3M 1CWPA 3KF3A 3IDCB 4IXLA 3LIHA 3AKRA 4JGZC 4RSUA 3AZXA 3W9AA 2LM3A 4LLOA 3WF0A 4J1XA 1NZIA 1C5HA 1UYXA 2YY1A 4DY3A 2B7YA 2WU5A 2D3PA 1W8WA 2FCVA 2R0FA 4AXOA 3R6SA 2XQ6A 1O3RA 3FMGA 3O1SA 5LASA 5ABFB 2XBO3 4MGTA 1SMVA 3ST7A 4CCDA 3RGLA 2JD9A 3N2KE 3ZIWA 5B4NA 4JDOA 3W15B 3ZYJB 2PA7A 4RL7A 3FE5A 4BIOA 2ZX0A 4NIHA 2XUEA 3AXDA 1VBA3 1U5PA 4FPYA 4D6QA 1UK5A 1JODA 3WHTA 3GMIA 2ES0A 4WM8C 1J3RA 2WNVB 1CJDA 2UWBA 2QNKA 2RDRA 3EAMA 4AVVA 3I3MA 2IXKA 2K48A 1OLMA 1BEV2 3K4DA 4B7KA 3ZEFB 3VD7A 2YK0A 2W5FA 4OI2A 5EYXA 1BEV1 2ZM2A 1KS5A 2YDEA 2AZ5A 4FPCA 1O5LA 3TB0A 1D7PM 2XJVA 1XSRA 3OGSA 1K5MA 2BUKA 5JZGB 1DQ6A 2Y8KA 3AP4A 5CEHA 4IV3B 2IXIA 3RC3A 1HRI2 1W2OA 3GZAA 1BK1A 1RUC3 5EIYB 3Q5XA 1LHOA 2A6ZA 1JS9A 2VL4A 2K9ZA 3LEGA 4ZXEA 3ZYHA 5GONE 4DXRA 5F6LB 5FP9A 3PVNA 1VRBA 4COZA 4PW8A 1SDDB 5GLZA 2RJKA 3H42B 2XXZA 2WLQA 1YQ3A 1NWMX 2RP4A 2O8OA 3JUUA 3CK6A 1UY1A 4PLOA 5DUVA 2X0LB 4Y26A 3IA3A 4DR6T 2D6KA 1PO23 4XBFB 1OLQA 1UF2C 4R9CA 2FQPA 2GN7A 4QB1A 4YVWC 5DMYA 1BLZA 4MXWB 2QQVA 1FPN3 4AI9A 3FBYA 2ODVA 2A6WA 2F4PA 2R043 4LF9T 1VAKA 2C5IT 4V2VA 3PJAJ 2FMYA 3ECQA 1ENXA 3T2TA 1F31A 1UZZA 3U75A 5A3WA 3WQ7A 5A6QA 4YSZA 4S2HA 1MS8A 3C7FA 3H3ZA 3C4ZA 5FXZA 1GQPA 1RUC2 5LBCA 5C4WA 2WNUC 3ORJA 4LNVA 3O1VA 2RHPA 4YW3A 4PCRA 5B2GB 4XUOA 2XSAA 4LHKA 4ZY9A 4BXFA 3IN9A 4EOZB 3BTZA 3UQ4A 2BVMA 3OGRA 3SH5A 3O1HA 1W90A 4CSWA 2PMWB 2VCBA 2NN8A 2J1DG 5JDMA 3OYZA 1RUF3 1C28A 2TUNA 4RD7A 4XDOA 3I97A 1GICA 5FMDA 3O0WA 3SLIA 4FXKB 5FZHA 2J1SA 4QH4A 2LJLA 5HEHA 2FDKA 3T30A 2LM9A 2ZS6B 5JDLA 1RUD1 2RM21 3WEZA 4BISA 5HEUA 1BVP1 1C1LA 4MYEA 1YQ6A 2CE7A 1PO13 4HSJA 2V7JA 3CVRA 1D1CA 1X9TA 2RA1A 4YW6A 1AJKA 4NHMA 2DYCA 2VAUA 4QDSA 4WVMA 2DNXA 4DR3T 5L4HA 3IDEA 3P4WA 4H3WA 4TNWA 2RMU1 4BQWA 1QXRA 2JDZA 1WGPA 3CJIB 3Q5EA 4GYSA 5C70A 1W0NA 1HTJF 4MHCA 1LOEA 2C5KT 1BJQA 4JV5T 5FKCA 3CNAA 2D6NA 2R0HA 3OD0A 1PMIA 3UUMA 2J1VA 2C0SA 1LNSA 3IPVA 3I9YA 3UTKA 3ZC1A 3NAPB 4IEQA 4XCAA 2KWHA 3VZLA 3ABVA 1ND2B 5K0UC 3HKCE 4KUMB 1Y64B 1CX4A 4AKHA 3I0OA 2ZBJA 4WVVA 1EAH3 2JENA 2R063 4LJHA 2UXXB 5AQQB 3HVDA 3D5OA 4N7IA 1X9BA 4AI8A 3FBLA 3ZMVB 1ULEA 4FQZA 4EV6A 5EXOA 3SITA 5I8YA 1WD4A 1RUJ2 2AACA 1IAPA 1RUD2 4ES9A 4QQLA 3ZMZB 4N9IA 5FZMA 2QQOA 2JE7A 3IM0A 2I2SA 3BN6A 3A0NA 5ACA3 1JZ4A 2EALA 2QUOA 1OBNA 2K9AA 1HN0A 4GIQA 4N43A 4AHYA 4FPHA 4DMVA 1OQEA 5F8PA 1S2KA 5JI7A 2IAKA 1XB9A 1XNDA 1MPXA 1W2TA 1EP0A 1VBB1 1CESA 1R082 1QOSA 1S0FA 4DV5T 2A5ZA 3PTYA 4BLJA 2F4VT 3IZOA 1XMOT 2DWKA 1W9FA 2NPIA 3QH7A 4G63A 2D43A 3M4FA 3DV8A 4DO0A 2YDSA 3POJA 1D1AA 2DWGA 1ODMA 3ZN1B 1NX9A 1Q43A 3PNAA 2I59A 3FWEA 3ZFGB 4AGVA 1STMA 1ZRFA 3ZSMA 1QJX3 1MMDA 1PZ8A 1RUI1 4TV9E 2CBIA 3X1DA 1ND3C 3A0KA 2PG8A 1DYPA 1MS4A 5BNOB 4BAYB 3BGAA 4GJYA 5CNAA 1UZYA 2NWBA 2UU8A 3BOWA 4HLTA 4TLFA 5DUXA 4TX5A 1XMQT 1L7QA 4UFKA 4YG3A 4LO7A 2F6BA 1F4HA 3ZOIA 3ZYRA 5LCWL 1MEC3 5IK7A 3D0TA 3KHBA 4CCEA 3U14A 1JU3A 3P50A 1G6NA 2DVFA 4Y33A 4Z2AA 4B3TT 3N9PA 4X62T 3CDZB 4AQGA 5ADXL 1JOJA 2ZZQA 3GCXA 4QWNA 2XJQA 4QQ2A 3HIFA 2IC1A 4AHWA 4N43C 2XHEB 4C0BA 4JHTA 1LHVA 1V00A 3BU0A 2DI4A 2QQJA 4C1XA 4NIQA 1MZEA 1WKYA 4QU2A 5IFTA 3AEFA 1ZX5A 4P02B 4QXHA 3FZHB 1TQ5A 3C8XA 3H9AA 4CTEA 1DLLA 1QF3A 3E6DA 4CDUB 1DG6A 2XM1A 2CYFA 2WS93 1NKGA 4XJ9A 1QJU1 3P1IA 4A3XA 2Q9QA 1IPKA 2IWGB 2JMHA 4A44A 2ZGLA 1NXMA 2WNUB 4KWKA 3ZFGC 1SG3A 2W95A 2WS92 5K0UA 2QBXA 1VBC1 4S2GA 3LOIA 4PHZA 3VBRC 2VU9A 1AR72 1RHI2 3I2GA 5CU1A 1MZ6A 2VKJA 4Q4W1 2QCSB 4AQFC 1AUYA 4N53B 3WHUA 1YI9A 4S2FA 5A33B 4GH4A 1LVFA 1G9CA 2FBWA 4HFVA 5K4LA 2JPFA 1QDOA 2Y38A 4PJYA 4GD4A 5F5WA 3JB8A 4QGLA 2E9XC 3O1RA 2WZ8A 3UU3A 2VZRA 4MOAA 3WNKA 2V6YB 2Y8DA 3VKNA 2E53A 1WW5A 2VOXA 4Z90A 4U2YA 3MV11 4KMQA 1WLWA 3BTXA 3UU6A 2RG4A 4UVBB 3CQOA 5LRRA 3WVJA 3K75B 4FJOA 3LWCA 3M3IA 1QMJA 2NP9A 3PVEA 1HX8A 1W0PA 3LK3B 2NMNA 4Y20B 5FZCA 2IC6A 2WA4A 3ZKUA 1UX5A 4DV6T 4KP3C 2X66A 4LFCT 3MDPA 3NAPC 3TLUA 4Y20A 3VDAA 4AVCA 2X51A 4YGEA 1CAVA 1UYZA 5FBJA 2HWF3 2WO1A 3FHIB 5J98B 1RC6A 2ZGPA 2WS3A 4HANA 4NROA 1GZ9A 1POQA 3LE0A 3LK42 4B3ST 1OEDE 4QPGC 2R072 4LBMA 4HFEA 1S4CA 2H0BA 3IDAA 1FIOA 2TEPA 1MVQA 2GH8A 2G9GA 4BQ1A 4QGNA 5FVKA 1UW8A 2N7GA 2XG3A 2XAGB 3S5QA 2ZGSA 5F1RA 1GWLA 5LY1A 2VTXJ 1G9AA 5A3LA 4OUEA 5EPAA 2VQAA 4YGBA 2WBKA 5C71A 3KVBA 2W00A 5AC91 4OZXA 5DABA 4K6BA 3JU9A 3D3AA 4BA9A 2BKPA 5HXRA 1REDA 2R6QA 4OFZA 1AR81 5IK4A 1MIWA 2BQPA 4PIYA 4AVAA 4BM8A 4I02A 2EIEA 1DGRN 2HJIA 1Y01A 4CP9B 1QQP3 1PIV1 1TMF1 1US2A 4PBPA 4WM7A 3A22A 3ZPYA 1R092 2Q1MA 1PIV2 3ESLA 2JEMA 3GZEA 3HN1A 3KD4A 3RWNA 4A6SA 3PTRB 4CP9A 3P4QA 3RRWA 3MV01 4YRDA 5FK8A 3WSOA 3J9X1 4BCUA 2O8QA 4O4LE 1C5IA 2K5BB 2OIIA 5LA0A 2PQQA 1SDWA 2PQSA 1UU6A 1KK7A 1HX1B 2E7TA 3O1TA 1KFXL 1PO12 2OZJA 3M3CA 4C91A 1EV11 3LGRA 3NVCA 4HOOA 5A3OA 3ZXKA 1UX4A 4Q0SA 1TMF2 5KBFA 5LMUT 2PHWA 2FD8A 4IEWA 3WI3A 3O0VA 4HTEA 3SEPA 3DTOA 2VE1A 2UXCT 4UVCB 2VW0A 3T3YA 3CJXA 4NPMA 4Q1RA 2XONA 3RYPA 5CFCA 1GQGA 4CDXB 4QPGB 4XTMA 4COYA 1UWWA 2YU1A 5KWRA 3G06A 4HPKA 1GSLA 3LJCA 2P34A 4Y1UA 3BU7A 1KNRA 3P8CD 3I4IA 3VLBB 3CZJA 3ITQA 3VHPA 4NIAA 2YKSA 1X82A 2V4VA 3KVAA 4F6RC 3DXTA 2FDFA 2YU2A 1V6OA 3L9JT 3I3QA 3O1OA 3U1XA 1HNWT 3ZR5A 5L7OA 1Q8OA 4QX7B 2GC1A 3H8RA 3RZHA 3VHLA 2W39A 4CDWC 3V0BB 1C57A 4IL4A 3AA6B 4NPPA 2DTYA 2EHOA 2A1XA 2BBHA 4CZSA 3T1HT 1BEV3 4K0UA 4QH1A 3HA4A 1ST8A 2VMIA 4CEYB 5BNPA 1XYOA 1W6NB 2LSYA 2R1DA 3N4MA 3VDDB 2EAAA 3THTA 3BIEA 5DZEA 2BOIA 4BH9A 5ETWA 4IV1B 4XZCA 1WR0A 1XPWA 2E63A 1N33T 4LTAA 2QVAA 2E9XA 1QWRA 1UKRA 3HAGA 3LPFA 5D8AA 5T55A 1SHZC 3I49A 2D6MA 3ZXJA 2YEVC 1HRV1 4IGPA 2E9QA 3ZN6B 4NJ4A 3P5BA 3QOFA 3T09A 2SBAA 4OLLA 1PO22 3TN91 4TTGA 4NPLA 1KITA 1RHI1 4MADA 4BQ4A 3UUNA 2KM2A 5FYSA 3WQ1A 2OV9A 5AQTB 1GZWA 2HWC3 2VECA 4W8JA 4ZHQE 1D4VB 1Q5OA 4L8QA 1O4ZA 2VO5A 5EP9A 5JPMB 2DL1A 4JYAT 3UYJA 3F2ZA 1Z7S3 2NMOA 2QQIA 4IEUA 4ZU7A 5CFDC 4XFGA 2WC2A 5FP3A 1SHWB 3RI5A 4HSLA 4D7TA 4XEZA 5GZDA 3RJRA 1AR71 3UV9A 2ORXA 4A6OA 2WM9A 1KJRA 1GOGA 1COV3 2Y6LA 4DXSA 2WNEA 3RC8A 4Q29A 3OKQA 4LUMA 1Q8QA 1OA3A 3OBAA 4QHOA 2YINA 4I0WB 5A7WA 3X29B 2G19A 2DV9A 2WU2A 1SCRA 3SMHA 1BR2A 1FOD2 2JIWA 5IYZE 1TNFA 2B39A 4I50E 2X5IA 2WZEA 3FC0A 2RM22 4ZS2A 4LFBT 2JIGA 2ZHKA 5A7OA 5BV6A 5JREA 2HEVF 4DY5A 3PUQA 1HXS1 4JI5T 3DYPA 4IGOA 5BNPC 3CO2A 5J2TE 5A32B 4DR4T 2PHTA 1HF8A 2P9BA 2AEZA 3VDDC 1LAJA 1ZZ6A 3H50A 4GWMA 4DEQA 5AFEA 2XQRA 4CDUA 3BKZA 5C5UA 2X9WA 2OQ7A 4CCCA 2J4GA 4L5GA 1ZRRA 1H6YA 2XKPA 3CEWA 3ENRA 4Q4Y1 3SHRA 1Z78A 4UW4A 2OZ6A 3T1MA 4PIZA 1V6NA 4YM0A 5FJHA 1GOHA 4OUMA 5I91A 5CKQA 4L97A 1LU2A 3M3EA 4GKKT 3MF6A 3VHOA 4D6RA 3VBSB 4LF8T 4K3UA 3OBZA 1YEWA 3MW2A 4YVWB 4XXPA 1I1EA 5KXJA 1AVBA 5FZAA 2RJ2A 4KL1A 4UW6A 4MLKA 3BOPA 5JLVA 4DR5T 1AJ3A 5ERLA 3SFDA 4Y5Z0 3L8RA 4DV7T 4RR3A 3UETA 5A3MA 1UCUA 5LGNB 3VD5A 2ZM0A 4AQTA 3RS6A 1RL3A 3LDRA 3VBOA 2VZOA 4IV1C 1CZVA 2Q8EA 2DCYA 2ZKLA 2ZOEB 5FPBA 1LOFC 3G7DA 4A5XA 3KWVA 4WBBA 1OSGA 3HNMA 3CQGB 4LBLA 5FL0A 4YW7A 5DQWA 5FPVA 5LK5A 4AEMA 5DAWA 4AHZA 3WCRA 4HWHA 2WUHA 5C3OA 1MMNA 4YTPA 4QQPA 2XQ9A 1S0DA 2D93A 4AI1A 1S0JA 4G2AA 4X65T 3ZYFA 2ZABA 5FWJA 5DXDA 5BR8T 5JR2A 2HWB3 5FL1A 1W8FA 5DZGA 2ZGMA 5FTTC 2P37A 2W68A 3C7EA 1MQTA 5L36A 1V9DA 2UU9T 2JB8A 1YFWA 4U74A 4DZGA 3N9QA 2VNVA 1R1A1 4K1ZA 4Y22B 3D6EA 1MMGA 3N35A 5K8SA 2QA7A 4B3NA 4B4PA 1RTVA 3EUHA 3W20A 1F15A 1BQPA 1PMHX 3B3QE 3WF2A 3ZYIB 2V5DA 4AEJA 5JDGA 1SFYA 4FXGB 2MEV2 2V6XA 1ZA4A 2WZR3 3IAPA 1QH7A 3RIAA 1QJU3 1W9WA 2BGPA 4AI0A 1B35A 1Y7BA 3WLUA 3A4UA 4EEDA 2UXDT 2JDPA 2I74A 2OA2A 1FXZA 1OD3A 4Q0VA 5C8WA 4MG2A 3PUSA 3FHAA 1FNZA 4MGQA 1DDLA 3A23A 4LUKA 4XUTA 5H6RB 5EJ1B 4FPFA 1JZ8A 4ILUA 2C9AA 2NW9A 4M00A 4BZ4A 5IVVA 3AAAB 4W65A 3ZYKA 4BHPA 3N7KA 3KGLA 3CU7A 3JBG1 3U37A 5FBZA 3V0AB 2WNOA 5JAXA 5KC6A 3S4UA 2BNOA 2PXJA 3NNFA 1JYIA 3B9IA 2LKHA 2W91A 1M62A 4GK5E 1LHWA 2ADDA 5KMGP 2IUWA 4RS5C 3VD4A 4YNIA 4WW0A 4IE6A 2P3KA 2I6HA 1FPN1 3AMQA 3NZQA 1K45A 4DFSA 3K1SA 3AAEB 2E5VA 3SRZA 3NSTA 3P3NA 4RGAA 3TLSA 5C2TA 5JWPA 2VKHA 1SBFA 4CN1A 1TVGA 2OW4A 2RR13 4CUBA 5AQOB 2XQ7A 1HB2A 2G4IA 5DG1A 5FCCA 5JOZA 5FYYA 2Y6XA 4ZZBA 3KV9A 2YFZA 2NR4A 2E2AA 4QX8B 2XPKA 1TZOA 2HEYF 3LPGA 2OS2A 3M8LA 4TNVA 4GMP1 1VRH3 5DN2A 3K3OA 4P9JA 1PX4A 3ZVXA 4BQ2A 1RUOA 5HXHA 4QX5A 3VBUC 2LOPA 1JZ3A 4WZCA 3B69A 1UY4A 2RMU2 1KXGA 5E0OA 1OMIA 3KT4A 1Z0HA 3EDUA 3VR9A 1GANA 1JNZA 3HNYM 3HT2A 5F3CA 3OF1A 4E7ZA 2Y33A 1WMFA 2P17A 4ILCA 1GWMA 3H3UA 3KF5A 2OX0A 4MGZE 1HRV2 4OHZA 5E8AA 3VBSC 1OLME 3AE6A 4ZI3D 4XBNA 3J7MA 3Q8FA 4O4HE 1YRZA 2Y6KA 5CAZA 3UULA 2WNVC 2CHOA 5I0TA 5A1AA 4CZZB 1LKXA 3V64A 1C3HA 4CVUA 2IFRA 5JPNB 1IS3A 3ZMUB 2VZPA 4UT5A 1CAWA 2DUOA 3CPZA 2WDRA 1XNBA 2QQUA 1GUIA 1HB4A 2VASA 1N3PA 2WIIB 1XOYA 3AXEA 4X8PA 5FZ7A 3SWHA 5HCFA 4ZU5A 4YZ2A 2B5HA 2B8MA 2XBO1 2WL1A 2ZPXA 1PVC1 4JI3T 4TWDA 3T1LA 2RMU3 1NA1A 1OVPA 3RZZA 4NUUA 4PFPA 4ZOLE 2HWF2 1MR5A 2A6VA 1BHGA 2XVGA 1COV2 3POEA 4JDNA 3RKGA 4N53C 3WOGA 3ZMNA 1AJOA 4XETA 3UKNA 3ZKYA 4AVBA 4BLIA 5C4WB 3RZMA 1J59A 3FFQA 4KWJA 1BBT3 3ZJ2A 1C8M1 2HPLA 2PLV2 5FYBA 3RH3A 1G8WA 4FFHA 3GHMA 4IEPA 3LA2A 4IESA 1UQXA 5T5JA 4PDWA 4HWDA 3ZO0B 1QOTA 1ZREA 1NCRC 1DZTA 4BQXA 4CPBA 4D69A 1UAIA 3NQHA 1WBFA 1Y9MA 3OCPA 2Q9QD 5FNVE 1L7LA 2ET7A 1B09A 1WWYA 4ITCA 5K9YA 5IVBA 2VVFA 4D8MA 2FCTA 3WNNA 4OCTA 3IEEA 2NLRA 3AB3B 5F6KA 4LIUA 5L73A 4UF0A 5AQNB 3ZXAC 3JCFA 3PDQA 4YW5A 5GLVA 3I2HA 3RYRA 2WDQA 2MEV1 2WKKA 3CX8B 4TWFA 1QQP1 1TMF3 1RVF2 1UMZA 4UFLA 4XYXA 5DAQA 1ULFA 2LUWA 3V65A 2CV6A 5DJQC 3I2IA 3S30A 5LA1A 1LENA 4A41A 4QH5A 2VMDA 4FP2A 2VWAA 1MVEA 4CDQB 1G9DA 4NIDA 2F17A 3RDIA 3HBKA 2WQ8A 2Y0OA 1SE7A 5CB4E 4R9BA 3VBFC 4CP2A 5GZCA 5J36A 2W62A 1LRHA 4DNYA 3SC7X 4CCLA 4JUYA 2XJUA 4BIFA 5JDBA 2BDRA 5CVRA 2BYVE 4L2NA 4M4RA 1QJY3 2GZWA 2H7VC 4ERRA 1AYM1 1R1A3 4IIJE 2VUAA 4DBRA 5JDFA 5L9BA 5HXMA 4AFBA 3K4ZA 4PJLA 5L3DB 1AL22 1T6GC 1V0AA 3MUY1 4CDQC 3JC6C 3J8F3 3T2OA 2WO7A 3FXDB 4KBBA 3WNLA 4WVZA 5JSPA 4XFAA 2V7IA 2XAJB 1MIYA 3KV4A 1X50A 1LOGA 2UY9A 2X68A 1QOOA 2YBSA 1OA4A 4IEYA 1DP0A 5DDJ3 4KMCA 3TN92 1BXHA 2QJVA 1PK6B 3P4PA 3N2OA 5CKMA 3INAA 4RR3B 4L0RA 2ZZJA 5F5AA 3V56A 4DQAA 5T52A 5FO8B 4N43B 4IE4A 4CI2B 2VMCA 1OEDB 4PBOA 1YFYA 2PHFA 1PZ7A 1DGRA 5FZIA 4E2QA 4XXAA 5CA0E 1WCSA 1HB1A 3FL7A 3D4KA 2WLPA 4QD2A 1DQ0A 4XVHA 5DZFA 5EJZB 4J1WA 1S2BA 1CAUB 4X1IE 5FMOL 1RUG2 1ZBA3 5ACA2 4INDA 4XF1A 5C4WC 3V5UA 4QHZA 4XJ8A 4WNKA 5FR3A 1POV0 1ZBE2 5FLJA 2D0TA 3DEMA 3ACGA 4A7ZA 2BG9B 1AR93 2CHHA 2W87A 2WWSA 2BWAA 3TLVA 5JH7E 3VB9A 4CYDA 5IHRA 5JOWA 5JZGA 1E7PA 2AH2A 4U33A 3I2FA 3DJBA 4M3CF 5FMNA 1NXD1 1H7CA 1X33A 1VAMA 2BTVC 3PIGA 4QXBA 3LG7A 1YXRA 2R32A 4K21A 4YG6A 1ZZ9A 1FX5A 1W6MB 2J1RA 1ZP0A 3KB5A 3POBA 1Y3TA 1R083 3ZYBA 2UXBT 3UKTA 1J1TA 3POYA 4MGYE 3QLQA 3ETVA 2XPJA 2L3LA 3THCA 3OUJA 2BNMA 2YC0A 3AKSA 4PIXA 1R8IA 1AR61 1RUE1 4H9SE 2GDFA 3GZTB 3IBMA 3IDBB 4OI1A 3O5SA 2YYOA 1QHDA 4XACA 5C8YE 4LT5A 2AEYA 5FY4A 4AISA 4UXNB 4HFIA 2K46A 4UAPA 4IDZA 2GMMA 3CZUA 2B9VA 1T7SA 4EZHA 4LF5T 4DMWA 1E57A 2ID4A 2W3JA 2ORZA 2XQXA 3CQXC 1I9RA 3AMPA 3B5LB 3WUCA 1W0AA 5FY0A 1IS6A 5HXCA 1RJ8A 3O1UA 5ABJC 1PGL2 3I59A 3V0AA 4U2AA 3ZYLA 2DCZA 3ZSKA 1AYM2 2NP0A 5ABJA 1HX6A 3AL6A 1GZCA 1AR73 2CWMA 2VL8A 5DUUA 3M7AA 5DUWA 2YPJA 4H9RC 4HKAA 5FZOB 5KHHA 5I8TA 4PJNA 1O6UA 3CLPA 2WT1A 3KGZA 1IQAA 2QE3A 1REFA 2WWUA 3S6PA 4JI8T 4MBQA 2XMLA 3VHNA 4X6RB 3GJBA 1PVC3 3NKGA 4UFIA 2VQUA 1UZWA 1FV2A 1OT5A 5FWEA 5AC92 1XYNA 5FFOC 4QMAA 4J2CA 4GIWA 2LALA 4NVPA 3R05A 1AYN1 5IWFA 4F83A 2LKGA 4X20E 4CI1B 3S7IA 1VMHA 3RKOA 5T54A 4HKLA 3IBPA 3NRYA 4ZEYA 2ES3A 3M1HA 4QHBA 4UOJA 2CTVA 1FATA 2VVDA 3IIIA 4JV4A 4NHXA 4BMEA 4S2DA 5L3BB 2A75A 3A21A 3AEGA 2XWBB 4M01A 4P9WA 1OURA 4XMIA 2WYFA 3HMYA 3MPBA 3C2UA 4P08A 4QX0A 4XC9A 3IMMA 3NKZA 4OZOA 1BZWA 4XFCA 3WT3A 1W0OA 3IPVB 3NAPA 3OG2A 4HL0A 2VOTA 4Q4V3 4BDVB 4LO6B 3Q8BA 2XUMA 1S0CA 1I94T 1XNKA 3FUQA 3OBTA 4EE2A 5IVEA 2ZAAA 1CGPA 1UX6A 1GV9A 2ZTNA 2Y0IA 3TBDA 3PJYA 2DCKA 1JI6A 2DUPA 5LBQB 1HNXT 3DL3A 1LTEA 4UR9A 3T2QA 2H6BA 4BJ0A 4RFRB 1A8MA 3CX7B 4QXKA 3Q2MA 2V72A 1POV3 3N7JA 2XAHB 4IGQA 1WFDA 1NQJA 3LDBA 3AE8A 3HKEE 1ONAA 2XVLA 1MMAA 1UY2A 3HOBA 2P2KA 3K2OA 4MFRA 1HNZT 2VQET 2XQYA 3ZSSA 1IS4A 3GBWA 1IQDC 2E7AA 4P9GA 2PJQA 4EYYR 4MSVA 5E16A 2XQ5A 1RUD3 4YVSA 3F95A 3PDYA 3NWIA 4TXWA 4AFCA 4HWCA 4Z92B 4RQPC 3DKQA 2R49A 3GALA 5A3PA 1H1MA 2A72A 1QJY2 2NYYA 3LQCA 3OYWB 4UWDA 5BXXA 2XJSA 1SLLA 5JRCA 3SFEA 3I2OA 4ES8A 4H55A 1V9U1 5AFUL 4MUVA 5HAXA 5SV8A 4AFMA 1RUH1 5FZ1A 5EWSA 4LA3A 1TG7A 3SKJE 2XLFA 3R4SA 2ZHNA 5EK4A 1QH6A 4XDQA 3HKDE 4ILBA 1AR82 4Q0PA 4O65A 3L09A 5F32A 4CRQA 4QPIA 2YDQA 2WQZC 5D8AC 4UF0B 5LB7B 3ZFEC 3ETQA 4LFAT 4UBHA 1L7RA 4JDMA 3AMNA 3FLRA 5LP6E 1QKQA 2Q4SA 3ETPA 3MFCA 2BWCA 5LJMA 4XILA 2IXCA 5CB7A 4HPKB 1A3KA 1TEIA 1SACA 4NRQA 1YKEB 1ACCA 2M6BA 1DGWX 4HE8A 2Z42A 4LBQA 1YI7A 2DDUA 4XIKA 4LEJA 1HFAA 1W2AX 4O8SA 1ZKEA 4LBQB 5IATA 2A73B 2WSVA 4IDPA 1JZ6A 3EVYA 2HWE3 3Q8EA 3ILNA 4HKWA 3GBFA 4LHNA 3WDTA 4LLFA 4WZXA 2VPVA 4CDWB 1GP4A 2FHRA 2PLV1 3VBHA 4RYDA 3ZFEA 3IWZA 2CGPA 5KX5E 2FJAA 3VGIA 4JEHB 5FYIA 4TV8E 1ZV4X 3CMGA 2MAWA 4JEUB 3RLFF 2GALA 3AC0A 4YXDA 3B02A 3CHXA 4Q1PA 5DAPA 1W6QA 3OPCA 2HWF1 2XBO2 1RMU1 2UYBA 4NAMA 5FLHA 3SCHA 1J1JA 3ZDSA 4KBMB 1UNBA 5HYAA 1W6QB 2J1EA 3M65A 3BIWE 5LCYA 4D94A 5J1XA 1S94A 3POSA 3AKQA 4GQ7A 4DUXA 5IFPA 1FYUA 1Q3EA 1U5ZA 2HWD3 4EROA 4OHXA 3E97A 2V8SV 4FPLA 1K5JA 5IT6A 4DRVA 4AEDC 5AQVB 1RYYA 3GCWA 5K7PA 5H9RA 1AL21 3CQCB 4E4ZA 4B3MT 2WQYA 3GJAA 1WLTA 5L47A 1SA0E 1JOBA 4HN1A 4N9HA 4LBOA 5HPOA 2HWB1 1RUJ1 2ZEWA 4I0AA 4META 2IVJA 1HJFA 2W0XA 3ACFA 3EQEA 5FYVA 5HXVA 3UJOA 1GZTA 4YHHT 2VVEA 3LSEA 1UCXA 1W0BA 2RS52 1UUSA 4OHYA 2D97A 2W67A 1XU2A 2ZGUA 1HJGA 2VZ3A 1SQ4A 1CJPA 2ACXA 2VMFA 4H7LA 3J7LA 4EZ4A 4Y4YA 4ZU4A 5EHDA 5IK5A 1WYCA 5FYUA 1CAXB 1U5XA 1YIFA 4XF9A 5EYYA 4U72A 1JYVA 4I30A 5I93A 5LBBA 5HWXA 4DUWA 1GNZA 4GWNA 1D0XA 5GLWA 3ZN5A 3H3LA 1UD1A 3S0MA 1JHNA 5E89A 4ZI2C 4FPGA 5FLIA 5T5LA 3RYFE 1Q8PA 1FNYA 1BR4A 1RUF2 1HQNA 4XJWA 1WA6X 4HVRA 3UGHA 1NENA 2LTNA 3VKHA 5C3QA 2VG9A 2PYTA 4I3GA 2VNRA 3J26N 1XZYA 1PM4A 5KHGA 3N7LA 2WY2A 1AYM3 2X09A 3VL8A 5AQSB 1SBEA 4XHXA 3WDWA 4EN9B 2WWJA 1N1TA 1V6JA 4MLOA 2D3RA 3AYEA 4XBLA 3VU7H 4LMKA 3LSVA 3AVSA 5HXSA 1W3VA 2BZDA 1GP5A 2V73A 1ENSA 4RHV2 3WX5A 3OD4A 4D6SA 5FOBB 3PV0F 5FYTA 5A7SA 4P5HA 4PLNA 4O7XA 3F57A 3UU8A 3RIUA 2PAEA 5A33A 5LW9A 2ZMKA 3NV4A 5BNNC 3PJQA 5BNNA 4YVWA 4XF3A 3AAIA 2ZX2A 5C9AA 4CEWB 5FO7B 2W1WA 5C5TA 1SPPB 2HLEA 4A42A 5HEGA 4DIDB 5FYMA 1DYOA 1VBB2 5AVAA 3VD3A 3EHKA 3VZNA 4PQ9A 1RGSA 2HPJA 4JI7T 3C4WA 4OX9T 1RINA 4OQ9A 3FZLB 2IFWA 4B1LA 2RDSA 5FPAA 4DINB 2XQAA 3AJYA 5KXCA 1HQLA 1VBB3 3AE3A 1UPIA 1HRI1 2E6VA 2ZX4A 3FX3A 4IDNA 4GK0E 1GNYA 1WMEA 2H0VA 3J7HA 4Y1YA 5GLTA 3T4HB 3P7IA 2G1MA 4P9IA 4NRMA 2XR4A 1S0BA 3VN4A 1V9U2 2UUBT 2XVKA 3I2JA 4MHUA 4R4XA 2OYZA 3WW4A 2ZLYA 4BOWA 3UNPA 4LF6T 3ZXDA 1C4RA 2PTMA 3J8F2 4AVSA 4NHYA 4AAPA 2GC3A 2DVGA 4AHXA 2F4LA 2Y26A 3BCWA 5G04L 3RJ2X 4CUAA 5IYYA 3T0DA 1SFPA 4ISRA 4YW1A 4XZPA 1KNZA 1VB2A 2EXIA 4FO9A 3KM5A 1SCSA 5AQLB 4QB2A 4COUA 3NJVA 2HKXA 4FAHA 2YN6A 2RV9A 4W6WA 1S35A 3T4VA 3ANWB 5JXHA 1KFYA 1WRDA 4LO4B 3Q5WA 3USUB 4OFGA 5JXIA 2B42B 3ANWA 3LBXB 1IS5A 2C26A 3HD8B 3NNMA 3UKVA 2XJTA 3GF6A 4GMP3 1LB2A 2EHOB 2GNDA 3I2DA 4ISTA 1HW5A 1PM7A 2Q8DA 3WD5A 1VLNA 2MPFA 4AK3A 2WFF3 3ONXA 4I55E 1UY0A 5GM0A 3ZXGA 4HBNA 3IHRA 1S0IA 2JQQA 4Q4V1 4Z82A 4AEDA 4E2SA 4U2ZA 4EIWA 1ZZ7A 1OF3A 1OPOA 2XHNA 1B35B 3E5QA 4UIGA 4FPKA 2VBBA 5AQPB 1UPSA 3CF6E 4QU1A 4AEDB 2EF6A 1ZRDA 5L9RA 1LOBA 4ORFA 5JUVA 3HQXA 2WCAA 4I4TE 2BBAA 2QDNA 2VKOA 2WSSV 5FZFA 3ES4A 3ZKRA 2KT9A 4Q4X3 4UYBA 5FZ0A 3RPUA 1IBLT 4MALA 1H2LA 1ND3A 1ZM1A 2BVVA 3NV1A 4AF9A 5KXDA 3LIGA 2D5UA 2X67A 3NBXX 1H8TB 3EJKA 3Q9OA 1XU1A 1ND3B 3J7NA 5F3GA 4XUPA 4E9KA 5BNQA 3BODA 4FI9A 2Q8OA 1XDPA 5JRCB 2CDOA 2AENA 2JG9C 3FFZA 4YFWA 1XBFA 2VMHA 4YPJA 1O3SA 4EXTA 2UY8A 5BMVE 5HEJA 1J1LA 3ZXEA 4CU9A 2JICA 3ZYMA 3AZVA 3S7EA 3OBRA 3UU4A 4CU7A 4FOQA 4YGCA 2J42A 3GHNA 5A7WB 4QM8A 4LITA 3HPNA 1FOD1 4TYSA 2A3WA 5ANQA 3AZWA 3ON7A 1S1AA 4NIIA 1VP6A 4YFZA 1TNRA 2Q0AA 5FXVA 1S0GA 4KI5M 1NE4A 2JG8B 5ABEA 1EUTA 4UFHA 5EV7A 4EN7B 1JYXA 1W6PB 4G9SB 4XHBA 1HDKA 2NW8A 1TME3 5FUNA 5GKAC 2EIBA 2W1SA 4F8AA 1ULDA 2DWRA 3J4UH 3K51A 5J1GA 5IHYA 1LESA 5J3UA 2VCMA 3MI8A 4FTBA 3GYDA 4F7ZA 1LEDA 2Y6FA 2FCUA 4P00B 4FPJA 5F3EA 4FOVA 4GKYA 4AG4A 1RB8G 4CEYA 4GWJA 1HN1A 3E6BA 4MH0E 4P9YA 1OQ1A 2XQ8A 4XAEA 4DMIA 1J5WA 3AVRA 4OMDA 3HJRA 2QKDA 2BPA2 1LGCA 1NY71 2A71A 3BI3A 3H8XA 3UL2A 5LEKA 2AC1A 4LORA 2JDNA 3WP5A 2ILMA 3RMYA 4CUGA 3AE1A 4ZZ5A 5C8CB 5LNKA 4NOTA 2I0MA 4IDQA 1LCLA 4LBKA 1SBDA 5ABFA 5C3RA 1CX1A 1QU0A 2L9QA 1EY2A 4JRAA 2JKBA 4JHZA 1GQEA 1AZDA 3BUCA 3ABZA 5AQRB 3AZZA 4DOUA 2ZM6T 1D4M3 5JSRA 1U12A 2ZA9A 1DBNA 5L3GB 3MXZA 4H9OC 1W2UA 3H8UA 3PHMA 2CL2A 1ODNA 4DPNA 4LOTA 1HIXA 4YW2A 5FZLA 4PLMA 1XNQT 3OYXA 1NCQA 3MIBA 4XF0A 3N9OA 5JTGA 3DYMA 5EK2A 3FXEB 4JGYA 1NCQB 2Z6EA 4HFBA 1C8NA 1BVVA 1H8TC 4KNCA 4NO4A 1BKZA 1KRIA 4YSYA 2HN2A 1CUNA 4EWEA 4XCBA 1KEYA 4FOWA 4XJUA 2WJSA 3VUOA 5FO9B 2FDGA 4IT4A 4E4SA 5BUVA 2X5IB 4V1PA 4GB31 3VKMA 4JLEA 1NA1C 3I0QA 5CFCC 4EWAA 1IG0A 2Q1ZB 5IVFA 4YZ5A 1BR0A 1PHMA 2Y48B 4KGQA 3BALA 2FJBA 3WR0A 2PBIA 3KINB 2O14A 2ATFA 3NWKA 4LHSA 1SLIA 1ASJ3 4LF4T 2R042 1N3QA 3OJBA 4YWAA 1T2XA 5F2WA 3RRDA 3UT0A 2A70A 2RS33 2VNGA 4YHJA 2DFBA 4JAAA 2X0YA 3POWA 4XJZA 4LMLA 2LSJA 4P5YA 2NQYA 1FMD2 2XJ7A 2RJLA 4IUGA 4EB6E 5ABHA 3DPRB 1I6ZA 3N2GE 1N1SA 3DXUA 4D3WA 4HN9A 1D0GA 5FJKA 3MGUA 4LIVA 4PK6A 3I3BA 4M1PA 5JIAA 5AQKB 1R091 3G6JB 3M3OA 3JAFA 4IEXA 3VKLA 2BDEA 2XH6A 3U11A 1OD5A 2C24A 3Q9DA 2FUPA 1A78A 1W6OA 3WV6A 3TEZA 2WS91 2QFEA 4AW7A 1DGLA 4EN0A 1RUI3 4W4ZA 3AE7A 1N1VA 1O3TA 2LSKA 2VXJA 5CKNA 1UYPA 1PGSA 3MKDA 1WZXA 2FMDA 2ETEA 1WLDA 1L0VA 4FFIA 5DDJ2 3TN93 1PGW2 3QB5K 1NAEA 1OXCA 3H1MA 3I54A 2BU9A 4IETA 3RFRA 2WO2A 2Y34A 4CCJA 2HWE2 1T72A 4WYVA 1YQ5A 5AVPA 3RNSA 4ISSA 1Q8VA 4AOCA 3ZPOA 4TN7A 4XQWA 2VR4A 3JB4C 3ZX7A 3MPPG 4YY3T 1W9SA 4CN6A 1W9RA 4TN7B 1K42A 4UV8B 4ATFA 2OT7A 2BZBA 4DV1T 2R1BA 3FZMB 3PUZF 3OEAA 2LHNA 2VL0A 4Q25A 3RIUC 1VBA2 3K4AA 4YLZA 2GH2A 1XC6A 4BYYA 4B1MA 4JGZA 2HH9A 2JIJA 2Z5WA 5BNOC 4FSJA 2Z79A 2LSIA 2D6LX 2YFUA 1EAH2 2CNAA 2OVUA 2DCJA 1G8XA 3MLLA 4FQ4A 1RUI2 5T3NA 1IJ6A 1VBD1 1CIWA 1EAH1 2VW2A 2ZEYA 1LRZA 1WA4A 4AVTA 2LHRA 3EB7A 5IVYA 1M4WA 4QXBB 2C1FA 1J84A 4H9NC 1VB4A 2RS53 3RZGA 3KQRA 5LB6A 2ZX1A 4HMZA 3VBRB 5ISLA 5LWBA 3LKJA 4HZFA 4YW4A 5A80A 4M3CB 2DBNA 1Z7S2 4MGSA 1VBD3 2OUJA 2VULA 1QNYA 4DIQA 4AI3A 3LB9A 3TLWA 1IGOA 2VMEA 1UY3A 4AQ6A 5C33A 2QZ2A 5F37A 3OVUA 3N7MA 4LA2A 3VKOA 2BG9E 5JQGE 5LHIB 1HQWA 3POGA 3RGBA 3ZDVA 1RUNA 3R84B 1HB3A 3WP3A 2CBJA 1BMV2 1W6NA 5FZ3A 2LRKA 3ZN6A 1GMMA 3KDSE 5AFBA 3UGGA 1CD3G 3WNXA 2Z2SB 1X8EA 1DIWA 4ET7A 5HCAA 1O91A 5L19A 3AA7B 2PTFA 1LOCA 4AQFA 3GA8A 1P8JA 3NZPA 2PHRA 4L11A 3ZIXA 4CCNA 4Q8KA 1M06G 1JZ5A 1LHUA 1I5PA 2JJ6A 5FZBA 1JN2P 4K7JA 4A2UA 2WZPP 4O2BE 5GZFA 3TEXA 1UMIA 5ABJB 1AX2A 4QX2A 4GKXA 2WN2A 3ZFGA 1H9WA 1RUE2 1IJ5A 3FJSA 3NMBA 5FZOA 4WBNE 3A5XA 3K3NA 2J62A 3T1YT 1XQNA 3UGFA 2IIUA 2BKOA 2BVLA 2M67A 4WBOA 4DV2T 1XXNA 2RM23 3I7DA 4XFBA 5FY5A 3ZXLA 2J1UA 4NWWA 4E8DA 3VBFA 3B7MA 4QAWA 2VNOA 3MACA 2VZVA 2WR9A 1ULGA 3C3VA 4LO5B 2GP5A 2E31A 1AF9A 3M3ZB 4X66T 4J6GA 4DR1T 4WVWA 1RIRA 2R16A 2A3YA 1DU3D 4KU7A 4QDRA 3S57A 2JG8A 3PUGA 1IZNB 2FJDA 3UK9A 1U4QA 1W9YA 3K77A 1ASJ1 1NLQA 2JDKA 1UZ0A 4Q26A 2XAQB 3AYCA 5F39A 2JG9A 5F5IA 5FP7A 3RMXA 3BPSA 2N1GA 4OYKA 2EIGA 4R9AA 1EPWA 2ZKNA 5A32A 3H8OA 2KR2A 2AYHA 1RUE3 2W9XA 2WZR1 2XSBA 5FZ9A 1KNPA 4MGIE 2DTWA 1RUC1 2B1EA 2E8IA 3LCPA 4Q4X1 4Y4RA 1E5IA 5FP8A 4QXCA 2BFUS 5JOXA 1V6IA 2IVIB 3GGLA 3Q8CA 3MJXA 4P9LA 2JG8C 4KHZF 1R081 4CN4A 1HS7A 5C3JA 3QBQA 1V70A 3NV3A 4U7YA 3FLPA 4AGRA 4HKOA 2ARBA 4KG0A 1G86A 3PU8A 1D4M2 3ZSTA 2FZ1A 5DQ0A 3RSJA 2BOJA 5JR9C 2V09A 2VQFT 3USSA 3N9NA 1YKHB 4N53A 3WF3A 5HWYA 3PUVF 2BV4A 2R062 4PJJA 2B4KA 1IKQA 1ENQA 2WFF1 2WSUA 3KS7A 2CM0A 5FRAA 2E9XD 5IAVA 3VBOB 1MNEA 1UGOA 3WDUA 1GFF2 1RUJ3 3F2EA 3KCXA 4EWDA 4Y5TA 4AL9A 4LQRA 4O4IE 1NCRB 1WMXA 1ZBA1 4YM3A 1EUUA 1N1YA 3ZXFA 4O61A 3U07A 4RN5A 4U31A 1GWKA 2FJEA 4TLGA 5C8CC 4RGGA 5A6YA 4RQPA 2N2NA 1OLRA 2KNDA 4NN0A 2V7LA 2YUEA 3ZFFC 3N3HA 1QJU2 1CAUA 3LAGA 3NW4A 4NAOA 4M0NA 1CQ9A 2W4XA 3QH6A 4L9BA 2EXJA 3PIJA 4AQ2A 3PVBB 1QSDA 1FMWA 4ZS3A 4XPVA 4BA6A 2WMNA 3U0ZA 2BG9A 2GP3A 4CP1A 3O0XA 4AR2A 5CYYA 1OWAA 3UT5E 5I0SA 4B8EA 3ASIA 2C0ZA 3U4XA 4FP3A 3E5XA 1W05A 4XUNA 1CIYA 1QXJA 4QWNB 1JYTA 2DCFA 2KD7A 2PHLA 4GYRA 1U5IA 3KFWX 1JNRA 4HG6B 4KI0F 3B5MA 1BYHA 3C51A 1XRUA 5HCBA 2O1QA 5LBEA 4IE7A 3NRXA 2X0HA 2AUYA 1MNDA 3TAYA 2D0UA 2HEWF 3R4DB 1MZ5A 4YGDA 5C9AC 4CI3B 2Q9QB 2WAUA 1OH3A 2BS3A 1QEXA 5J2UE 1VPHA 2JDAA 5EFUA 3W5NA 4XDPA 3PVOA 3VBUB 5FMCA 1PNGA 4AGGA 4A56A 1US7B 1JH5A 4ASLA 1ENRA 1JOPA 2PHXA 2ZX3A 5F7UA 5K0UB 2WZR2 3B01A 1QJX1 2VQTA 3MBWA 3OSDA 3OY8B 2D5HA 4HWIB 5JXGA 5HXEA 1WYBA 3ZLIA 2JQHA 2KWIB 1B35C 5A3TA 4BJMA 3MW4A 4OUSA 5KHKA 1RUH3 5L9VA 4AKRB 3QC9A 2AXDS 1JZ7A 4ISQA 2MPKA 1U0AA 5H9SA 1E2AA 1G73A 3C50A 2XJRA 4QQHA 4D7YA 1IG3A 3H3AA 3IAQA 4URTA 2MBGA 3ZT7A 2CWOA 5CBLA 4BK5A 3RX6A 5DG2A 5AQUB 1G9FA 2JB4A 2YOEA 4R52A 4BQ5A 5C3SA 3L2HA 4YSXA 5KHIA 5SV5A 2GU9A 2ZEXA 4KQ7A 2ADEA 4ARYA 4R8HA 2MNGA 1UL9A 4WM8B 5FZGA 3AZYA 4MGKE 3O1JA 2P3JA 2DF7A 2P4EA 3MYXA 4JRLA 1WCQA 2OLTA 4CCMA 3OB8A 4IV3A 4RS5B 1POV1 2ZGQA 3WXPA 3U4SA 2JJ9A 4JI0T 3FHNA 5L3CB 4QX8A 1FT9A 2CSGA 4YJ3E 5DAXA 2NZ9A 2W63A 3ZFFB 3ZCIA 1HRV3 3KSCA 1YIPA 3EBRA 4ZPIA 3SH4A 4U7IA 4IDOA 5H6QB 1RUH2 2RS51 2W61A 1WW7A 4ZZCA 2Y6JA 1LJ7A 1US3A 2BERA 3KBUA 1GQHA 2E33A 4PT6A 3V0BA 4IEOA 1LOFA 1UOBA 1JXNA 1ZA7A 3DN7A 2ZXQA 2D44A 3JZVA 1OOPB 3FHQA 4U36A 4TZ4C 1FPN2 4NR1A 2B76A 5KDMC 1CONA 2WDBA 2ZCWA 4HT1T 3A7MA 5M4YA 4LPLA 2CMRA 4OI0A 2R073 3ELNA 4RR3C 2W52A 3J9SA 4QM9A 4Q5OA 3AL5A 5FPLA 2BP6A 4JVAA 3P4RA 2QRXA 3NV2A 3VZOA 2GK9A 2HYKA 4NHLA 3LOBA 4HONA 4BE3A 4IV1A 4HWFA 3BQKA 1CAWB 1RMU3 5EQUA 3EDVA 2UWCA 2LEHA 1KS4A 1KQRA 3H3MA 4FOYA 4LO8A 5L7OC 4L92A 4NHKA 3AEEA 1PK6C 2G9ZA 3HQRA 4QX3A 2PLV3 3THDA 2UUCT 3EABA 1X7NA 4UVAB 3ZYGA 4K0KT 4UBGA 2VUJA 5JZGC 3WAKA 1Y4WA 4I0UA 5BNNB 2BS2A 4I3PA 4LBJA 2VMGA 4UI9L 1OUXA 4HFHA 4FPOB 2MTQA 3QB5A 4JQTA 3AYDA 1NLRA 4Q27A 2FDJA 1FMD3 4JGYC 4Y1VA 2BBVA 3MHZA 3U78A 3LDQB 4H9PC 5J0ZA 5I0RA 3DPRC 5KXBA 1UU4A 1LGBA 2P3YA 3AMHA 2W66A 3MFAA 1Y9QA 1N36T 3K46A 4CCKA 2FDIA 4DV3T 4AKIA 1AL0G 1ZHCA 3AA0B 1RVF3 2OXBA 5FAXA 2CLYC 3LEIA 4SBVA 3C4XA 4O4JE 4ADZA 1RUF1 1DQ4A 1UXXX 1ZRIA 3IT8A 4CDXA 2BFUL 3T8OA 2WABA 3ZSJA 1ZYBA 5LXTE 1ZVFA 4XAAA 3BTAA 3CJIA 3HN3A 4A3ZA 1W2NA 3VHRA 4CDQA 3NJZA 3ZT5A 4E7SA 2XOMA 4GH4C 4LKEA 4LOSA 1H1IA 2QQLA 4C1WA 1I5ZA 2X5IC 1QJFA 4CEYC 5AQMB 2LLYA 5IVCA 5T5PA 3O14A 2BS4A 1KDMA 5L7OB 1IPJA 1OH4A 3PLQA 1X8MA 2WT0A 2QYWA 2VQ0A 4IW3A 4BU2A 1X79A 2JD4A 5CFBA 2WDVA 4ZXLA 2PFVA 4JTNA 4E27A 1HLCA 3UFGA 1ND2A 1ND2C 2R30A 2WN3A 4JQRA 3U10A 2NTXA 1ZBA2 1BK0A 1PO21 1Z0PA 2BEOA 4B4RA 3OTFA 5FYCA 1F5FA 4X5TA 1JYCA 1SZBA 2H6CA 3AXJB 2W94A 3MO4A 4KWUA 4OHWA 1REEA 3WCSA 5T50A 1YJLA 4OI4A 4A98A 3WNMA 5HI0A 2WFF2 4FTSA 5IVJA 4JZRA 1IOAA 4IL7A 5FY9A 1G7YA 3RRCA 5AQGB 2CAUA 4MXVA 1XE7A 2V4AA 2ZGTA 1MS1A 4KG8A 5TAOA 4U3CA 1CZSA 1W06A 4B3RT 2J47A 5LYJE 1DYKA 1GNHA 1NCRA 1QJX2 3ILFA 3EI0A 3LFMA 5HV0A 2LOSA 1GZWB 1NOVA 1YXWA 4NMIA 4XF4A 3CL1A 2DVAA 4LKSA 3OYWA 4Q4Y2 2YBKA 3T08A 1V6MA 3OGJA 1ZBE3 4C0HA 3AKPA 3ONJA 2RE9A 2JQ9A 4A45A 2EHOC 4W6XA 4DRRA 1S55A 5EK3A 4PDWC 1NQDA 4IERA 1VBD2 4Y1XA 3C64A 5CFDB 1NZCA 2LSGA 2HWC2 5LY2A 5JDNA 5BPXA 4XURA 1IPSA 4LR4A 4GOUA 1FI2A 5CG8A 1DCSA 3W5MA 3ALQA 1PNFA 1GR3A 1WUVA 1AXYA 3GM8A 1OHFA 1VBA1 4LE4A 5I8SA 3AE4A 3DECA 4JI4T 1AYN2 1W8OA 2ZHMA 2AE9A 4ANJA 4DV0T 1Q8SA 2PAKA 1F5JA 4DNDA 3AYAA 2WO3A 5JVVA 4ILAA 3JXSA 4NUVA 2JDUA 2VGDA 2J1AA 1W28A 5F3IA 3URFA 2IDOB 1W6MA 1KJLA 1W99A 3OUHA 2UYAA 3GNEA 2VM9A 5FKYA 4OHVA 1A34A 3EO6A 2TNFA 1D0YA 1FOD3 1FV3A 1YO8A 3PUIA 3PE0A 4YT0A 1PGW1 1UKGA 3D0JA 3NJXA 4FVVA 4YTMA 4Q8LA 4QKFA 1R64A 4CE8A 1CN1A 3SXWA 4EN8B 5JXJA 2YGMA 3NO8A 4AXPA 4MXWA 1QGLA 4A7KA 4M3CE 5L3FB 2D3SA 2IC9A 4E4HA 3Q5DA 4V2WA 2YBPA 3VBSA 1MEC2 4YZ1A 2UURA 3I59B 2GC0A 3UUBA 1E5RA 3H37A 2GC2A 2GSYA 3TRSB 2VUDA 1GKBA 3CMLA 2OPKA 1H8VA 1MS0A 4LBNA 3FZKB 4P14A 5A6XA 3M70A 4QKDA 4WM7C 5A7QA 5C9AB 4IHJE 2RPAA 2V6YA 2Q30A 4R9DA 2E32A 1YCIA 2MOZA 3U3IA 3L2YA 2LT3A 4CXYA 4UW5A 4HETA 1J83A 1VMJA 4B29A 4COWA 3O9XA 1YFUA 4UW3A 2XB6C 3IMNA 4P09A 4IE5A 2Q5TA 2VBPA 5CIRA 4KHPT 4B4QA 3PJAA 3LA7A 1WBLA 1W09A 1WCDJ 1SLCA 1ALYA 2UUAT 2A6XA 3O7OA 4AE2A 3TEWA 1RMU2 4KBZA 2D2SA 4IE0A 2ZMAA 4H2AA 3LFIA 1CAVB 1H1AA 4HN0A 4LKDA 4RS5A 3I9WA 2VC9A 3MEPA 4PQQA 2C5JA 1FEWA 2C5DA 3C7HA 1H2NA 4RGKA 4WVMB 5APAA 5LOVE 1LGNA 4LULA 4O9GA 3KHCA 5FZKA 5FMBA 1ZRCA 1H0BA 2UWAA 4EQVA 5AQHB 2E5LT 3O12A 2PFWA 3EYPA 2YG0A 2EXHA 1CR7A 2EA7A 4LK6A 1XJAA 1QNWA 4GALA 4HFSA 2WBLA 4X1KE 2HWD1 2VCAA 4F8HA 1WCRA 5FDBA 3BVCA 5IWAT 3N36A 4AQYT 3MW3A 1CPMA 2QQMA 2EIDA 2BKNA 4CUCA 5FXWA 4FTEA 4DBQA 2W46A 3NNGA 2J7MA 4H14A 2P6CA 2ZEZA 1ZZCA 4Q4V2 1YQ2A 4AI6A 1NYWA 4HFCA 2VURA 4DB5A 4FAGA 3N9LA 3SS1A 2ZAHA 3OJAA
chains in the Genus database with same CATH topology
2H7OA 5LA6E 4QX8B 4B6XA 3MXZA 4H9OC 5L3GB 2OS2A 5E6HA 2NW7A 5F3IA 2L8KA 3K3OA 5JDHA 3WAJA 5A1FA 5HXHA 5FZLA 3OYXA 2LOPA 5FZ4A 5LG4A 3N9OA 3R6NA 5E0OA 5EK2A 3FXEB 5LGUB 3EDUA 2Z6EA 5F3CA 3RYHE 4E7ZA 5FPUA 2CXLA 2OX0A 1CUNA 4ZI3C 2YPDA 4ZI3D 2V1DB 4O4HE 2NOXA 3BK9A 3UULA 4JLEA 3I0QA 4CZZB 1HG5A 1LKXA 2Q9QC 3UUXB 5A3NA 5IVFA 1BR0A 3ZMTB 4OK0A 2Y48B 3ZMUB 3N2KE 2PBIA 3KINB 3CPZA 3W15B 2XUEA 2VASA 1U5PA 4CQIA 4D6QA 5F2WA 4P0AA 3GMIA 2ES0A 4YHJA 5FZ7A 3SWHA 3CWZB 2LSJA 1QUUA 2SPCA 4N78D 2CEAA 4EB6E 2K48A 1BR1A 3N2GE 4Z8XA 4NUUA 4PFPA 4HN9A 4ZOLE 3DXUA 4QX7A 3ZEFB 4LIVA 2YK0A 4PK6A 5FJKA 4CXWA 2ZM2A 4M1PA 2JRKA 2BDEA 3ZJ2A 5FYBA 2HPLA 4XAXB 3Q9DA 3RH3A 5CEHA 3LBXA 3RC3A 5EZYE 3ZJ1A 3IF8B 2LSKA 5LJNA 3Q5XA 3OJAA 2Q9QD 5FNVE 3MKDA 5GONE 5IVBA 5FP9A 2X9YA 3RVHA 1VRBA 2XTLA 3IEEA 4PW8A 3AB3B 4LIUA 4UF0A 4CCJA 3L3PA 2XXZA 1NWMX 2RP4A 5JR9B 3PDQA 4ISSA 5LHGB 3CX8B 1ZEEA 3ZPOA 3CX6B 5L2LA 4TN7A 2X0LB 4PFOA 4H63H 5FP4A 5DJQC 4XBFB 4HEAA 4TN7B 4UV8B 5IW0A 4GAZA 2OT7A 2BZBA 2VWAA 3J7Yq 4AI9A 2LHNA 2ODVA 5CB4E 4UELA 2C5IT 2HH7A 2W62A 4NUBA 4V2VA 3B13A 2EHOD 4CCLA 2LSIA 4JUYA 5A3WA 1EZ3A 1G8XA 3C4ZA 3OBVE 5FXZA 1IJ6A 1LRZA 2H7VC 4ERRA 2LHRA 4IIJE 4DBRA 5JDFA 5IVYA 4QXBB 4PJLA 4H9NC 5L3DB 3JC6C 3FXDB 4BXFA 1MIVA 2KXPB 2V7IA 2BVMA 1MIYA 2XAJB 3KV4A 3O1HA 4P0BA 2X68A 3ZCJA 2YBSA 5A80A 2J1DG 5JDMA 3OYZA 4IGUA 4DIQA 4KMCA 3CKDA 4XDOA 5F37A 3N2OA 5FZHA 5FUPA 4L0RA 2LJLA 5F5AA 2LM9A 5LHIB 5JQGE 4IE4A 5JDLA 4CI2B 2CA5A 3R84B 4BISA 5FYZA 5FY7A 3FB2A 4QXHB 2CE7A 5FZ3A 3CVRA 2V7JA 1D1CA 2RA1A 2OQ6A 3KDSE 5FZIA 2DNXA 5CA0E 1D1BA 3ETUA 1VOMA 3AA7B 4GYSA 4CCNA 4AQFA 3GA8A 4X1IE 1HTJF 3NZPA 4PK4A 4MHCA 3PUAA 2C5KT 3FBZA 3V5UA 5FZBA 4WNKA 3UUMA 4O2BE 2C0SA 2D0TA 3I9YA 3UTKA 3ZC1A 2KWHA 5JH7E 3HKCE 4KUMB 1Y64B 1IJ5A 4AKHA 3I0OA 5FZOA 3DJBA 3A5XA 2VKDA 3K3NA 1H7CA 5FMNA 4WBNE 2UXXB 4QXBA 3LG7A 3FBLA 4PAGA 3ZMVB 2Q8CA 5FZDA 4CCOA 3N9MA 2BVLA 2M67A 4WBOA 5FY5A 1IAPA 5FZMA 3ZMZB 3ETVA 3MACA 2L3LA 1O3XA 2GP5A 2K9AA 4H9SE 4ZI2D 4DMVA 5C8YE 5F8PA 3PUGA 5FY8A 1IZNB 5FY4A 2IAKA 4UXNB 3AA1B 4IDZA 1U4QA 4Y3OA 5F5IA 5IVVA 2NTYA 2XAQB 4EZHA 5F39A 4DMWA 2DWKA 5FP7A 2N1GA 4G63A 3CQXC 4H63V 4OYKA 4DO0A 1D1AA 2DWGA 3ZN1B 5FY0A 2I59A 5HXCA 5JVDE 5FZ9A 1MMDA 2B1EA 4TV9E 2E8IA 4Y4RA 2PG8A 3ZYLA 4QXCA 5FP8A 4BAYB 4PK5A 3AL6A 2NWBA 2G0UA 3MJXA 4GJYA 2VL8A 1HS7A 4TX5A 3KV6A 4H9RC 5A1LA 3C98B 4HKAA 3PU8A 5FZOB 4PJNA 2MYSA 3D0TA 3HI2A 4QKNA 4DVDA 5JR9C 2KLQA 4Y33A 2WWUA 3N9NA 1YKHB 3N9PA 4AQGA 5HWYA 5ADXL 4MBQA 2XMLA 4PJJA 4QWNA 2CM0A 2E9XD 2V26A 1MNEA 2XHEB 5FWEA 3F2EA 3GN5B 2DI4A 4J2CA 4GIWA 4O4IE 5IWFA 4X20E 3GN5A 4CI1B 4QXHA 3RKOA 3IBPA 3NRYA 2N2NA 2KNDA 2V7LA 2Q9QA 5L3BB 2KMFA 2VB6A 2JMHA 4UEMA 2K24A 1QSDA 1FMWA 4ZS3A 2CXFA 2WMNA 5F3JA 4PJMA 2A2FX 2GP3A 2A3DA 1OWAA 3UT5E 2VKJA 4AQFC 5IVEA 1LVFA 3O1IA 4HFVA 5K4LA 2JPFA 4QWNB 2DCFA 5LBQB 4GD4A 2E9XC 4GYRA 3KFWX 3CX7B 3Q2MA 2Y8DA 4O2AE 2XAHB 4IGQA 3C51A 3LDBA 3HKEE 2N9DA 4IE7A 3NRXA 4UVBB 1MMAA 3OPTA 1MNDA 4FJOA 1T98A 2D0UA 4MFRA 3K2OA 2NP9A 4CI3B 2Q9QB 2WAUA 5FY1A 2XQYA 1HX8A 5J2UE 4XDPA 2PJQA 3LK3B 4EYYR 3ZC0A 5FZCA 4A56A 1US7B 3PDYA 2IC6A 2CXDA 1UX5A 4KP3C 2X66A 3B57A 5A3PA 2X51A 3BQIA 2A72A 2XASB 3ZN0B 5JRCA 5HXEA 1WYBA 3ZLIA 5HAXA 2KWIB 3SOLA 5AFUL 3LK42 2P5BA 4LXLA 5FZ1A 4BJMA 4QXCB 3O4XE 4AKRB 3MA9A 3QC9A 5EK4A 2ZM8A 5LHHB 1FIOA 3HKDE 4L9IA 5F32A 3L09A 1G73A 3C50A 4UF0B 5LY1A 2XAGB 2ODUA 3H3AA 5JR9A 2E9XB 2MBGA 2CWOA 3RX6A 5LP6E 5LJMA 3KVBA 2W00A 5DABA 1YKEB 4BA9A 2JMKA 4HE8A 5HXRA 5FZGA 3O1JA 4OFZA 4CCMA 1MIWA 3DP7A 1HFAA 3GWHA 4O8SA 1ZKEA 4HGAA 3U4SA 2JJ9A 3FHNA 3N5LA 3EVYA 5L3CB 4QX8A 4YJ3E 5FZ8A 2W63A 3ZCIA 3ESLA 3PTRB 5H6QB 2W61A 3RRWA 5KX5E 1YW0A 4JEHB 3J9X1 5FYIA 4TV8E 4O4LE 1ZV4X 2K5BB 4JEUB 3KBUA 1KK7A 1HG2A 4C91A 4KBMB 4HOOA 5HYAA 1YD8G 5LWBA 1UX4A 4TZ4C 2CLYB 4YJ2E 5KDMC 3M65A 5M4YA 4V1Av 2CMRA 5LCYA 3WI3A 4HTEA 1S94A 4AKGA 5FPLA 5LBMA 2DHRA 3DTOA 1B7TA 3AL5A 4UVCB 3QK6A 4EYUA 2GK9A 4OYJA 5DQVA 5FXXA 4HONA 3NJYA 4PNIA 3E22E 3BQKA 2YU1A 3EDVA 2LEHA 2V7MA 3CQCB 3LJCA 3P8CD 1SA0E 2WMOA 5FYVA 3KVAA 4F6RC 3DXTA 3F31A 4UVAB 2YU2A 3KBTA 2X9XA 3WAKA 5CA1E 4QX7B 3VHLA 1OXZA 5LGTB 2ACXA 3QUJA 2MTQA 4EZ4A 3HKBE 3AA6B 1WYCA 3U78A 5FYUA 2EHOA 5F5CA 3JC6D 4H9PC 4C90A 1E1HB 4K0UA 4U72A 3HA4A 5HWXA 4CCKA 1LVKA 3KV5A 1D0XA 4AKIA 1ZHCA 3AA0B 4UV9B 2LSYA 5FYHA 1WR6A 2CLYC 3C4XA 4O4JE 4ADZA 4ZI2C 5ETWA 4XZCA 3RYFE 3T8OA 1BR4A 2E9XA 5LXTE 1SHZC 3VKHA 2YEVC 4IGPA 3UFEA 4E7SA 3OPWA 3UUNA 2WWJA 5FYSA 5IVCA 3VU7H 5HXSA 3VKGA 3AVSA 5ISLA 4D6SA