4DO0A

Crystal structure of human phf8 in complex with daminozide
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
363
structure length
363
Chain Sequence
VKTGSPTFVRELRSRTFDSSDEVILKPTGNQLTVEFLEENSFSVPILVLKKDGLGMTLPSPSFTVRDVEHYVGSDKEIDVIDVTRQADCKMKLGDFVKYYYSGKREKVLNVISLEFSDTRLSNLVETPKIVRKLSWVENLWPEECVFERPNVQKYCLMSVRDSYTDFHIDFGGTSVWYHVLKGEKIFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVDKCYKCSVKQGQTLFIPTGWIHAVLTPVDCLAFGGNFLHSLNIEMQLKAYEIEKRLSTADLFRFPNFETICWYVGKHILDIFRGLRENRRHPASYLVHGGKALNLAFRAWTRKEALPDHEDEIPETVRTVQLIKDLAREIRLVED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Histone lysine demethylase PHF8
total genus 103
structure length 363
sequence length 363
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2012-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4do0A02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4do0A01
4QXCA 5A80A 3KV6A 4TN7A 4BU2A 2YU1A 5F32A 3K3NA 3N9LA 5FJKA 3NJYA 5FYIA 2YU2A 5FY9A 5FYUA 3N9NA 5ANQA 4EYUA 5FYVA 5FZEA 4D6RA 4BISA 2PXJA 4CSWA 5A7WB 2Q8DA 5F3GA 4UF0B 5FXWA 5FY5A 3AL6A 4EZHA 3PURA 5IVFA 2OQ6A 2W2IA 4HONA 5A3NA 3N9OA 2OS2A 3K3OA 5IVEA 2GP3A 5IWFA 5FY4A 2XXZA 3PUQA 4LIUA 5FZLA 5FWJA 5A7QA 5IVCA 5A7WA 4CCMA 2XDVA 5E6HA 4LXLA 5FY7A 5IVYA 4DO0A 5FP9A 4QXHA 4CCLA 4XDOA 5FPUA 5IVVA 5FZDA 3PU3A 4Y33A 3PDQA 3N9QA 4CCOA 4AI9A 2VD7A 4EZ4A 5FP3A 4QXBA 3ZLIA 4DIQA 2XMLA 5FZOB 2XUEA 4CUGA 3DXTA 3KV9A 5FY8A 3N9MA 3U78A 4BXFA 4C8DA 5A3TA 5FUNA 3N9PA 5FYZA 5A7PA 4HOOA 5FPVA 5FYBA 4IGQA 5A7SA 2WWJA 2Q8EA 5FY1A 5CEHA 5FWEA 2YBKA 5K4LA 5FZCA 5F3CA 4CCKA 5FYTA 5FXZA 5FZ8A 2OX0A 3KV5A 5F5AA 5ISLA 5FZ6A 3LDBA 5FZMA 4V2WA 5F5CA 4XDPA 4CCNA 5IVJA 4D6SA 5FZ3A 5LY2A 5A3PA 5KR7A 4GAZA 4LIVA 3RVHA 5FXXA 3AL5A 5FZ7A 3OPTA 4URAA 5FYSA 4D6QA 4ASKA 5FZ0A 5F2SA 3PU8A 5FJHA 3AVRA 5A7OA 5FZKA 2YPDA 5FYCA 5F39A 5FZBA 2OT7A 4IGPA 5F37A 4GD4A 5FZGA 5F2WA 4CCJA 4AAPA 4LITA 3UYJA 5A1FA 3KVAA 5IW0A 3K2OA 4QWNA 2WWUA 5FPAA 4NUBA 3AVSA 5F3EA 5FZIA 5FBJA 3LD8A 5FZHA 3PTRB 2YBPA 4QX8A 5FV3A 2GP5A 5FPBA 4Y4RA 3OPWA 5FPLA 5FP8A 5FYHA 5FY0A 2OQ7A 5FXVA 3PUSA 1VRBA 2YBSA 5FZOA 5LWBA 3KV4A 3ZPOA 4IGOA 4QX7A 5FYYA 5FZFA 5A3WA 4UF0A 5FYMA 4E4HA 4GJZA 5FP7A 5FZAA 5LY1A 5F5IA 4GJYA 5F3IA 5FZ9A 3KVBA 4QU1A 5FZ4A 4V2VA 4Y3OA 5A7NA 3DXUA 5FZ1A 2Q8CA 5A1LA 5IVBA 5FUPA 5LW9A 5FP4A 3PUAA 2P5BA 3U4SA
chains in the Genus database with same CATH superfamily
2ZGOA 1Z7S3 5KXDA 2JKBA 5GZEA 2R30A 5SV8A 3MBWA 4AVAA 4AEDB 4A7YA 4YW3A 2CXFA 3MKDA 4A98A 3CLPA 3N9NA 2NM1A 3J9SA 3H37A 2XLGA 3OOXA 4IW3A 5FLJA 1ZA7A 3J8F1 3Q5XA 2A3YA 1M62A 3AFGA 1MMAA 2LT3A 1WR0A 3OJBA 4D69A 2WNUC 3HIFA 3P7IA 4HN9A 4X1IE 5FVLA 5GLUA 1MIVA 2KXPB 1C3HA 2CTVA 1YQ5A 2D44A 3ECQA 1CESA 2VKOA 2WN3A 4S2FA 1YLLA 4RL7A 1SCRA 3FHIB 3AA1B 3POIA 4LO7A 5HPOA 2UU8A 4QAWA 4AQSA 5EK2A 2H7VC 2QRXA 1NCRA 3P1IA 4MXVA 1ZRDA 4GALA 1HIXA 5BXXA 3B7MA 4LE3A 1CAUA 4B7KA 2XAFB 3H1YA 4YTPA 3EAMA 1LGNA 5JR9C 2FCVA 2XOMA 4QXHA 4COWA 3WQ7A 4C1WA 1POV0 4CCOA 1SUMB 1UY1A 3J7NA 1BEV3 1UL9A 1G9AA 3NVOA 3AP6A 3OGSA 5FZOB 2CHOA 2I6HA 4D0QA 5IHRA 2JDAA 4JTOA 4G63A 4N7IA 2Y0IA 2VOTA 4AQ2A 4EWAA 2WL1A 3WG1A 3N9PA 5CB4E 1OLME 1REEA 5LA2A 2X9HA 4AGGA 1HTJF 2XWBB 1Z8UA 1LODA 2MEV2 1JOPA 1RUI3 1VPHA 4K7JA 3OGRA 3R4UA 3WNKA 4CDQB 2GNBA 3N4MA 3FC0A 4QPIB 5EK4A 3GWHA 4Y20A 1QHDA 4L9IA 3JBG3 2IFWA 3CF6E 3LZZA 1GP6A 3I3EA 1IS6A 1DQ5A 2WT2A 2XH6A 3FUQA 5JLVA 2MOZA 3UULA 4DINB 3NJVA 3OSDA 4XUOA 1WCDJ 2B9VA 3IZOA 1CAVB 1J3QA 2O8OA 1O8PA 2IZWA 1CAXA 1QU0A 4NPPA 5LY2A 1W9RA 5ABEA 2XB6C 5ACA1 5CGMA 2WDBA 4B7EA 3EQEA 5LBQB 5EYYA 3AE3A 1PO12 1COV2 2R043 1K5MC 4ASKA 2R1DA 2X29A 3VN4A 3I3MA 2DNXA 2HWE2 3KCCA 4NHKA 4PF1A 2O1QA 4QPGA 4ZONA 4Z1VA 1OQEA 1NY71 1Z78A 2C9KA 2HKXA 3O1JA 2MNGA 2JDMA 3HT2A 4OZOA 4PFOA 4YPJA 3V0BB 1IPJA 1JOJA 2BG9B 4M1PA 4TX5A 1Q5OA 4M01A 5FZGA 2ZM0A 4QX5A 4GKKT 4QH5A 2WSSV 3J9X1 5JDMA 4OMDA 1IS3A 1DIWA 3UQ7A 5GLWA 4NUBA 4CDUC 4AVBA 3MIEA 4BJ0A 2EHOA 5LA6E 5LJNA 3O14A 3ACGA 1Q3EA 4PIXA 3WCRA 3W58A 1Q8OA 2R063 2MPKA 3Q5DA 5JI7A 1HB3A 5AQKB 1NLQA 2H3RA 1XMOT 2D6MA 2D6PA 3ZT6A 2F4LA 2VCBA 3OPWA 5KBFA 3LFIA 1OI6A 3IWZA 3A8YC 2IMLA 4K20A 2ZKLA 1O3QA 2VL4A 2ZAHA 1AR61 4AXPA 2UXDT 4YGCA 2JG8B 4I2OA 3C7OA 3C51A 1UYXA 4UF0A 2RP4A 1US3A 1FPN3 2W67A 2XQYA 1G8WA 2GH2A 3D6EA 4DR7T 5FYMA 3LKJA 5E88A 2XHEB 3VHNA 2VZRA 2VCMA 2LEHA 1S0FA 3LF7A 2Y60A 4XQWA 1OPMA 2GU9A 4BB3A 1MR5A 5JOZA 1JZ3A 2HHHT 2BG9E 3CQCB 1UY0A 3OPZA 1Q8VA 4LNVA 3DP7A 1PMJX 2WQ8A 3VZMA 2C6SA 2BVMA 3JADA 5LEJA 4IDPA 4IL9A 3FFZA 1CAWA 3KT4A 1JN2P 2V72A 2A70A 5FJKA 1OKOA 1X9BA 2EHOD 1EUUA 2WZR2 2LHRA 3Q5EA 1RUG2 2XJSA 2IAKA 3VL8A 1OURA 3PUXF 1OXCA 4WZFA 2JG9A 1I1EA 1IZNB 1J83A 4DQAA 1D1AA 4MGIE 1M7KA 1V6OA 4CUCA 1ZBA2 4CZZB 5CJ5A 2HYXA 4RGGA 4GB33 1VIWB 2X5IA 3CNAA 3H50A 2FDJA 4GWMA 2ZA9A 1UOBA 3HT1A 3GBWA 1KNZA 1ZM1A 3C7GA 2IFRA 5KHGA 3E6DA 4XCAA 3DGTA 1FT9A 1AXYA 4AIUA 2ZMKA 4M0HA 5FWJA 3UTKA 4X66T 4DOUA 4ZU7A 5FRAA 1B35A 5KMGP 1NAEA 4KGGA 3WF0A 4Q0PA 1ZA4A 3N7MA 3AEAA 1RUC3 2X0LB 1YJKA 4XDOA 5LHGB 3PU3A 4QKNA 3FBMA 1I6XA 4O4JE 2HEWF 3PDQA 3M3ZB 2E53A 4L0RA 5LB7B 3FXDB 5K0UA 4OQ9A 1HNWT 5LG4A 1PHMA 4DIQA 4JRAA 4LK7A 2JG8A 4JI0T 1AZDA 1MZ5A 5JXIA 1QJU2 1NCRB 3RZKA 4DXTA 3MV01 2XSAA 4EV6A 5JWPA 4XUPA 1QDOA 4CU8A 5JREA 1RUI1 5EPAA 5A7SA 2IUWA 1OQDA 1N1VA 2CGNA 1UMIA 4BJNA 1CVNA 5FXZA 5FYTA 4E2QA 3PTYA 1OF4A 1X33A 3BOWA 4YSFA 3CX8B 1UYPA 1WMEA 1N3OA 5FUIA 1Y43B 1F15A 1W8FA 4WNKA 1TNRA 3JBG1 5FZMA 3P4SA 4XTMA 3POJA 2FBWA 4IV1A 3EDVA 3BODA 4W4ZA 5ACA2 2FD8A 3QD6A 3SQOA 1BQPA 3N5LA 4IE5A 2R0HA 3T1HT 3D0SA 3H8RA 2PG8A 3ZC0A 5DXDA 1ZRFA 1R093 4JGYA 3ZOIA 3LBXA 5FXXA 1VBD3 2NQYA 4NHLA 2GC0A 3OPTA 4CU9A 1A8DA 5I91A 4JI2T 4GKJT 1VBB3 5FK7A 3T0BA 4GOUA 1JYVA 3ZJ2A 5L3CB 2KD7A 4FI5A 1V9U1 3RJRA 4CDQC 2QVAA 3VU7H 1GQPA 5CFBA 4B1MA 1CAVA 5JI9A 1HB4A 2ZZQA 2ZEZA 2CRBA 4HEAA 3OTFA 2PTMA 4IEUA 4BXSV 2D3SA 2VO5A 3T0AA 1VBE2 5AQGB 1QQP1 2XL9A 3AYEA 3LD8A 2B76A 3ES1A 4RHV3 4KGQA 4LOTA 4ZS2A 3U14A 2RS51 5DMYA 3FHQA 3POGA 5T52A 3WINE 4MZUA 4LHKA 2YY1A 4E27A 5JOXA 5BMVE 5C3PA 4DR6T 4YZ3A 1YKEB 1NYWA 1MMNA 2EXJA 3OBAA 1J1LA 5T5OA 3U07A 2XQXA 4C0BA 1LVFA 2HWB3 2VMIA 2WINB 5KX5E 1ND3C 3CMGA 2QQMA 2VZVA 4OHFA 1ND3B 1SE7A 3V64A 4EN7B 2ODUA 3ES4A 3WR0A 4AQ6A 2QVSB 4AEKA 4DFSA 1YWKA 1AR82 2K48A 3MZKB 2ZGMA 2CE7A 1BMV1 3N3HA 2BV4A 4S2GA 5ABGA 5KXCA 2DTWA 2UUAT 2XLAA 5B4XA 1W09A 2Y64A 4IEYA 3ZR6A 3T1YT 1WLXA 2NTYA 5A1LA 5IYYA 4UEMA 3UJQA 3JQXA 4CU6A 3MK7C 4P08A 4QX2A 5LW9A 1O5UA 2CU5A 3CKDA 3CO2A 3KV6A 3J8F2 3K4DA 5C33A 2BPA2 2JRKA 3RX6A 3N9LA 3AZVA 4GXLA 2JX9A 4M3CF 5E89A 3WVJA 2NW8A 2V6XA 2XY8B 4AFCA 5FYIA 2YU2A 1POV1 2D43A 2GSYA 5FYUA 4H3WA 5BNOB 3RI8A 2WBKA 2AACA 2PXJA 1HQWA 1H2NA 2UWCA 4MGYE 5CZKA 5JDNA 2W1UA 2PJQA 2J1EA 4JI4T 1MPXA 5T5JA 3NO8A 1UZWA 5T55A 2VW1A 2JWPA 5IVFA 3BKZA 3ZC1A 1SBDA 1UN1A 1US2A 1W8UA 2HWF3 3FX3A 1SQ4A 3K3QC 3BALA 3O7OA 3ALQA 5LGUB 3POBA 4XBNA 3AE6A 4AISA 4U7YA 4N9HA 1W06A 4TNWA 2XQRA 4G3YC 1CGPA 4KX6A 1H7CA 1F5JA 2VG9A 3DEMA 4K6BA 4UOJA 4MLKA 4KL1A 5JIUA 4S2HA 1AR93 3UT5E 3MLKA 4HLTA 2YFZA 4KG8A 1HS7A 4V1Av 2LJLA 1DYKA 1H4GA 3E1F1 2BEOA 4WM8C 4O9GA 5E16A 3WG3A 4A44A 4CZSA 4DUWA 1RB8G 2W52A 2WY2A 5JIAA 5DZEA 2M6BA 4XTPA 3ZFGB 3UFEA 1OHFA 2VD7A 2AC1A 5FREA 3UUMA 4AI9A 3HAGA 4F83A 4NIAA 4FJOA 4Y4YA 4ZHNA 2LM2A 1N3QA 4P9WA 5KWRA 3LDKA 5LB6A 4FPLA 4I4TE 1YO8A 2V7KA 2F4VT 2TBVA 2W95A 2W63A 5FUNA 4XFCA 4DPNA 5F8PA 1UZVA 1WLCA 4FPOB 4IESA 4UXAA 3BTZA 2WWJA 4AZZA 1SCSA 4FOWA 4NPLA 1B7TA 2XAQB 3FB2A 1W2NA 1VE0A 2BP6A 4H9PC 4LULA 4Q4W2 4QD2A 3AKTA 4NJ4A 1W6PA 2FMYA 1V70A 3VKMA 2ZEXA 2JDZA 1QEXA 2IXKA 2XG3A 2D6LX 2ZTNA 1FAYA 1GNZA 2VL0A 3KMHA 3DJBA 3O0XA 3ZSTA 3ELNA 3V0BA 3DKQA 1JYXA 3H8XA 1GOFA 2IIUA 4KU7A 5IK4A 5SV5A 3W21A 3IPVA 2UUBT 4QWNB 4Q4Y1 3M3EA 3JB4C 3PIGA 4OMCA 4GMP1 4ES9A 5J2TE 1OLMA 4AKRB 3NSTA 3NMBA 4XBFB 2RDQA 2WT1A 3WG4A 5LHHB 1AUYA 2R041 1W6OB 4ZI3D 1FOD2 3WDTA 2JDYA 3O1HA 5AQOB 1DU2A 4Z8XA 1JU3A 1PZ9A 5FKBA 2VZ1A 1G8XA 3CZUA 4GD4A 3WP5A 3T4HB 1HG2A 4ILCA 3AC0A 3DL3A 3H3UA 1GQGA 2DFCA 3W9AA 2CLYC 4CXYA 2N2NA 4Z07A 2P9BA 4MHCA 4WYVA 1FNYA 4J1XA 3M2MA 4NOTA 4QWNA 4WBBA 1HNZT 2Y6LA 4JGZA 1RUF3 2Z42A 3C7HA 4MOAA 5F3EA 2ZMLA 1LECA 4HWFA 3DF0A 1BR1A 2RS53 1MMGA 5A3LA 2QQKA 5BUVA 2R072 2FHRA 4QKBA 5CA6A 2R16A 3PUIA 5FPZA 4JGYB 3VDCA 1UOGA 1CJDA 2OQ7A 4OVEA 1PO23 5J09A 2HWB1 2WRAA 3PUHA 4G4FA 1NCQC 1UZ0A 4YG3A 2XQ6A 4AQGA 2WNVC 2GN7A 2VR4A 2BJSA 3BPSA 1KQRA 4HPKB 2VUDA 5LP6E 4R9CA 5BPXA 3SISA 2E9QA 2AE9A 5L3EB 1JYIA 4BIFA 3VBOA 2OA5A 2EVXA 4TWTA 5J1XA 2P3KA 4IEOA 5DQ0A 1RUF1 3BK9A 1Y64B 5JDQA 4WM7A 5J2UE 4L11A 4MYEA 5FZ9A 2JIWA 2ACZA 1OOPB 4UW6A 3HKCE 1MIWA 2P3YA 5FQ0B 4B3ST 2LSGA 3I1AA 1W6QB 4I43B 1XRUA 3GZTB 4AKGA 3GZEA 2W5FA 3GHMA 1HR0T 1KDMA 3MUY1 4QQHA 4XXPA 4AI1A 2E33A 5LHIB 2CHHA 3APBA 5D1IA 5A1AA 2O0OA 1PGL2 4R4XA 2HN2A 2HEVF 3TWIA 2EAAA 2DLRA 1PK6B 4Q8LA 5AQSB 4YNIA 3KCYA 4J2CA 1CPNA 4AXOA 4BK5A 3RYRA 2LW8A 1OBNA 5DZGA 2XQ8A 2CNAA 5F3GA 2DV9A 1X7NA 2H0BA 3NVCA 3HOBA 2PFVA 1JU4A 4KWJA 4YGEA 4ZY9A 5LA9A 3ZDVA 5CFDC 4MGKE 4M00A 3PURA 4ZU5A 1OF3A 2EIEA 2H7OA 1HB2A 1YHFA 2BWCA 2CYFA 2EA7A 4HFHA 4GH4C 1IKPA 4HONA 2MHFA 3MIGA 2PN5A 4NPMA 1LB2A 3C50A 4PFPA 4PJNA 5EK3A 1RHI3 5DDJ3 3UETA 3KGZA 4XJZA 3VBSA 4XAXB 3RRWA 3LOIA 3ONXA 1F9KA 3HMYA 3OGGA 3U75A 5I93A 1ZZ7A 3K8PC 3I2KA 3IBPA 5DAWA 1JZ6A 3JCFA 5IVVA 3AA6B 1U5XA 2V6YA 2VCCA 1HRI1 3DN7A 3N9QA 4RN5A 5DQWA 3RMYA 2GMEA 3T2PA 5CFCB 4BK4A 4QXBA 1RC6A 3SWHA 1XU1A 3LE0A 3ZXEA 1QQP2 2A73B 2O8QA 3ILFA 4CUGA 2VL8A 4HFSA 2EICA 2HWD3 3P50A 2KA3A 5D8AC 5FMOL 4RGKA 3EYPA 2ZMAA 1N33T 5HXEA 1AYN3 5F6KA 4I02A 2PHFA 2VNOA 1MS0A 1DBNA 1LOCA 2JMKA 4UV8B 5A70A 2JIJA 3GN5B 2V5DA 2BGCA 2EF6A 5EJZB 5IAVA 4BQYA 5L7OA 1VALA 2VUJA 2PELA 3URFA 3M3IA 3IN9A 3VHLA 5DUUA 1I6ZA 1R082 4JQTA 4ASLA 3RIUC 2IXLA 3HWJA 3KT7A 2BFUL 3MHZA 1VBE1 2QZ3A 3W5NA 1RYYA 1ZYBA 2VK9A 5A3PA 5CA0E 1RVF2 3KHCA 1XNCA 2DVAA 1KFYA 4TV8E 3ONLC 4YJ2E 5LMUT 1PGSA 2XBO2 3FHNA 4GMP3 2YUEA 3QB5A 4Q4X2 3T3YA 1ENXA 3ZN4A 1C8M2 2MTQA 4AVCA 1CAWB 1QWRA 1ULPA 3VBUA 3ZN6A 4WM8A 4XUQA 1OPOA 3HD8B 4HXCA 1DGRA 2ZEYA 4FTBA 1BJQA 3B13A 1W6MB 2J1UA 3VR8A 2CBJA 5EFUA 2X9XA 1GANA 1L3JA 1W9WA 4DB5A 5K0UC 1O5LA 1K5MB 4Q4X3 3ZXAC 3V5SA 2WO7A 3P4PA 1VBA3 1ZBE2 4YFWA 5C3QA 2OV9A 2WFF2 3N2GE 1PNFA 4Z2AA 3VKNA 2D98A 5JRCB 1LKNA 2K0GA 1RXGA 4GIQA 4QPGC 5JUVA 3WNXA 2WKKA 3OUIA 3RYKA 4WM8B 1R083 1DCSA 4TWFA 3VBUC 1ZVFA 1SFPA 2A6XA 4UFMA 2XL7A 4JVAA 2RR11 3OYXA 2A1XA 4QPIC 4AWDA 3N7KA 3U11A 1BLZA 4TZ4C 4HFBA 4M4PA 1QH7A 2WC2A 3ZCIA 2X0HA 2WU5A 1AYN2 2YYOA 2VW0A 1EAH2 5CAZA 2NOXA 1ZNPA 2HWD2 1SFYA 2VTXJ 4Z82A 1A34A 4AVVA 3LOBA 3KGLA 4YXDA 5FZ4A 5L7OB 2VXRA 4WZXA 2CL2A 1GR3A 3SOLA 1NCQA 5CIRA 1GFF2 2V7JA 1H2MA 2ET1A 1Z7S1 2PFWA 3PJYA 3ZMSB 1S2EA 3TLWA 4JUYA 1GBGA 4CEYC 5HXVA 3POFA 5F32A 3K3NA 2E2AA 1KXGA 1UXXX 1Q43A 4DV5T 1GZ9A 1O6UA 2ZGQA 4RSUA 4XMIA 5AVAA 2ZX3A 3V0AA 1R1A3 2FJEA 2A6WA 2VVEA 3Q8BA 4CP9A 2X51A 2W0XA 3R4SA 3VRBA 4UWDA 5H9PA 1YUDA 2XQ5A 2G4IA 4PCRA 2X9WA 3USUA 2VGDA 2XTLA 2A7AA 2K2SA 1YFUA 2Y8KA 5FXWA 1NT0A 1TME3 4XJUA 5FMNA 3ZFEC 1LHUA 1N3PA 1WWYA 4H63H 3LWCA 5A3OA 3ZN6B 4YZ2A 5JXHA 1AR72 3UNPA 3AB0A 5F5WA 5LOVE 1QOTA 4MX3A 2V4AA 3ZYBA 1AX0A 1BK0A 1DQ4A 4MHUA 4XUTA 1QOOA 3VZLA 3AP5A 3LEMA 3S6PA 2JG9C 3PUQA 1CQ9A 3RGLA 3F95A 3RC8A 3J7HA 4P09A 2IDOB 5FR3A 2OUJA 4CI3B 3S7IA 2V7MA 2ZGSA 2W87A 1HDKA 3DPRA 5CKMA 5C5TA 4U2ZA 3UESA 3I2JA 1GOHA 1LOFC 4YWAA 2JPFA 5JDLA 3T30A 4D3WA 4LA3A 4XF9A 4SLIA 4Y1ZA 3TRSB 4RFT0 1X8MA 3ANWA 2DCZA 3NJXA 1KNRA 4GMP0 2CV6A 4YHJA 3D8CA 2J1TA 3DYMA 3AEGA 1BEV1 1OH3A 5C9AC 2C5DA 2GNDA 2XUEA 3PUVF 1Y9GA 3P6BA 3MYXA 3WW4A 2XJPA 4XHXA 1Y9MA 4FVVA 2JDNA 3ZFEB 3ZT5A 1MVQA 1S35A 4TN7B 1RXFA 1W3VA 4Z2WA 3ON7A 2GN3A 2OA2A 4Y24A 4JRLA 5KHHA 3LK42 2GALA 2K9ZA 4L92A 3VDAA 4YARA 5C70A 4MFRA 4CCKA 1X36A 1UXZA 1XSQA 1PO22 3MUZ1 4BA9A 3H0OA 3BTYA 4EEBA 2UWBA 3MPBA 4LKFA 1NA1C 3U10A 3VBRA 2AZ5A 4X8PA 3ETVA 3BQKA 2HH9A 3ZN1B 2QCSB 5L47A 2JXAA 2VNVA 4AHYA 2ZGUA 1DLLA 3G7DA 2P3JA 2WIIB 1YW0A 3VBHC 1ZBE1 4XF4A 4QKDA 2UXXB 3CQXC 4URAA 2XQ9A 4JI3T 4D6QA 5C8YE 1HKDA 3T1MA 4HWDA 4R9DA 4P0BA 3CIRA 3F31A 1UY3A 3UKNA 3UV9A 2LLYA 1VBC1 5FOBB 3SKVA 1JZ5A 3D0TA 3MW3A 3E0ZA 4EN8B 1E5IA 4AEDC 4XVHA 1KRIA 4CCJA 4IEWA 3I8TA 1E7PA 4OYKA 3KQRA 2AEZA 5EYXA 4P5YA 1PO11 2I2SA 2VZTA 3JD73 3ZXJA 4O4LE 3GBGA 1RVF1 4BQ4A 2LKGA 3IDCB 1HQNA 3MIDA 1JI6A 4XJWA 4XABA 1BZWA 3T2QA 4JV5T 3H7YA 4HFIA 4FOYA 2W46A 3I59A 5EWSA 1XQNA 4KBZA 1N36T 3ZSMA 3RKGA 3PTRB 3L2YA 2OZ6A 3RSJA 4FBFA 3WQBA 3ME2A 4LFCT 3CX6B 2A75A 2ZHNA 5A3MA 5AC92 5FY0A 1HF8A 4W6YA 4A3XA 2IXJA 5LWBA 2FZ2A 2XJUA 2ZAAA 4TWDA 4BQ3A 2OW4A 3AE9A 1D0HA 1XB9A 2UURA 2BGOA 4IGOA 5FFOC 4N53B 4Q4W3 5FO7B 3UJOA 4BQ1A 3FZLB 4OI0A 4O2BE 2BU9A 4D94A 4IEPA 2YC0A 4CA9A 5LZ6A 1OMIA 2EIGA 3OCPA 2X05A 3I3QA 2RMU2 2GC1A 4G9SB 1SLIA 4GYSA 4LO5B 4LKDA 3W59A 3GA8A 2D5HA 2VUCA 5FBZA 4LF5T 1DHKB 4N7UA 4YGBA 5A33A 4LF9T 5A7NA 3WP6A 1BHGA 3ZMTB 1GU3A 3U4SA 1PNGA 2P6HA 5A80A 4Q5OA 3CVRA 1QNWA 2YPJA 5JSRA 2VULA 4NIGA 1OFNA 3R0RA 2D0UA 3VD5A 4NIHA 2VURA 5FY9A 3OD4A 4LBJA 4H63V 1AR92 2BOIA 1W0AA 2WO2A 3R4DB 2WDRA 4GIWA 1BVP1 4PI2A 4RR3C 4RGAA 5T50A 4WW0A 2C24A 3VD3A 3OJAA 3WDXA 4JI8T 5AQLB 1MNEA 2W62A 4PDWC 2P1BA 1E5SA 3RH3A 3RYHE 3WDUA 3EXUA 4EJRA 4GWNA 5J3UA 2OQ6A 3BTXA 5T3NA 3LEKA 1OSGA 2VY0A 4TZDA 3NL1A 2ARBA 4CEYA 1VOMA 3JAEA 2RA1A 3WX5A 2XXZA 5FZ3A 4DXSA 4MBQA 3VD9A 3GN5A 2ZM2A 3GM8A 4FFHA 4MUVA 4HFCA 3H8UA 4DUYT 3MA9A 5CFDA 4XQDA 4URTA 4F3JA 1ASJ3 5A6YA 4LORA 1ZZ9A 5AC91 4N43A 1CD3G 3K48A 4JHZA 4ARYA 2E5LT 3HVDA 4C91A 1S2KA 1ULCA 4R4ZA 3RNSA 3SKJE 1UYYA 1JH5A 2ORXA 2CMRA 1Z0HA 3L39A 2AREA 2RVAA 3FZKB 5G05L 3O1VA 2KZ7B 3B9CA 3AMNA 2FJAA 3N9MA 4QQLA 1W8HA 2K46A 1NZCA 1VAVA 4XW3A 2C1FA 2RDRA 3MEPA 3ZFGC 4DBRA 1WUVA 1MQTC 1FMD2 3HQUA 3AE4A 4LF7T 1PX3A 2ADEA 1ZRIA 1FV3A 2YBKA 2HWB2 1B09A 4KI5M 3ZSSA 3KBUA 1VBC2 5J96B 3KV5A 2X9YA 2FJDA 4KBBA 1LENA 3WW1A 4DV2T 5FNVE 2P4EA 2EALA 2YDSA 2QQVA 5F37A 4TLFA 4PJJA 2QA7A 3SEPA 4YTMA 1MS3A 2P6CA 3K46A 3LA2A 4D6SA 4YGDA 2XQ3A 1GWKA 2LRLA 1SLLA 4OHXA 4RHV2 3ST7A 1IJ5A 1W2TA 4OHWA 5CISA 5K0UB 2VZ3A 4GAZA 3UGHA 3LSEA 1X79A 4LIVA 3BU0A 5LMNT 2D6KA 1LOGA 4U2YA 5JVVA 4EN6B 4ZS3A 1KDKA 4DV6T 4I3GA 3N2OA 4A42A 3MJXA 1JTZX 1PO21 2WA3A 2ETEA 3NV2A 4KMQA 4Y1UA 2YEVC 3IHRA 1RITA 2YC2A 4FPKA 4P9JA 5A6QA 5F2WA 3UUBA 4Y1YA 3ZSEA 5I0UA 2D5UA 1EYBA 3IKWA 4HE8A 3OBTA 4DV0T 2IW5B 5CFCA 2ES0A 2FCUA 3JD71 4Q4Y2 3JAFA 1J58A 1R092 4XQ4A 1JZ8A 3HBZA 4YSXA 3OKQA 4C1XA 1ULDA 4UV9B 1W6OA 4QDRA 4HWHA 4ISQA 2NW7A 1GICA 2NLRA 1O3TA 2BVVA 4LO6B 3H3MA 5C3JA 1DGWX 1TE1B 2J4GA 3RHWA 4RQPB 4LMJA 1WBFA 2E32A 4AQTA 5ABFA 1C8NA 4B1LA 5I8YA 3AXDA 2QQWA 3TEZA 3NRXA 1MVEA 2FMDA 3V0AB 5AQMB 4Y5SA 1ZKEA 2MEV1 1N34T 2VZQA 3CHXA 3VLBB 4COZA 2I0MA 5AQIB 4R9AA 3IAPA 4I0WB 2FDIA 3VBFB 1S0IA 4YYOA 1LCLA 2D2SA 1TNFA 3WQ1A 2C5JA 2LRKA 4QX8B 1EV11 1VBA1 4E4HA 4OHVA 5ABJC 5JVDE 1QJEA 5LASA 4CEWB 3U4XA 1BR2A 4MGZE 3KVBA 4JGZB 2ID4A 4J6GA 1W0BA 3C64A 1YYNA 3WD5A 3RIFA 1IGOA 2W39A 3BPZA 4BOWA 1SPPB 5LG3A 4XACA 3PUAA 1W6NA 3GF6A 1OVSA 5LBMA 4GZ9A 5C5UA 5IUXA 5KDMC 1XWMA 3QB5K 2PLV2 1APNA 3B02A 5C3SA 4W6WA 3S0MA 1MQTA 2L9LA 4HKOA 3VDDA 3VRAA 1D4M2 4OHZA 5K8SA 4WM7C 2IVIB 1GKBA 2JICA 4CSWA 1W9SA 4UYBA 3PE0A 1YRZA 2YGMA 4B3NA 5B4NA 2VVFA 3MF6A 4JEHB 1PM4A 3QCWA 4QGMA 3VD4A 2BG9A 2XASB 5IK7A 3WSOA 2R7EB 5IFPA 3E6CC 4IXLA 4GB32 4NAOA 4IIJE 3RYIE 2GP3A 2ZGKA 1NE6A 1PGW2 2VU9A 4MV2A 4UVCB 5ABJB 2DF7A 2KM2A 2WBLA 1SA0E 5AQHB 1K5MA 1W6PB 2QE3A 4YY3T 2ZZJA 3OY8B 4RS5B 3H7JA 3AJZA 2UXCT 2DTYA 1RUG3 4LXLA 2Q9QD 4E7SA 2D40A 1H9WA 1UY4A 2ILMA 2ZEWA 3A7MA 3GJAA 3RWKX 5BNNC 4U7IA 1JYWA 2DHRA 1AJOA 3M4FA 4Y33A 4X6RB 1F31A 1TEIA 1H0BA 2J42A 4QH4A 4EYYR 5HI0A 1ZHCA 4EZ4A 2N7GA 4A3ZA 2VOVA 3NAPA 3L09A 4TYSA 1PVC1 4M3CB 3AKSA 4JDNA 2K3WA 3T1LA 4ILBA 1F4HA 3U78A 4PW8A 1Y4WA 1W6NB 2VB6A 5DAVA 1G86A 1XE8A 4DNDA 2E7QA 2E9XA 2G19A 2JJ6A 3CKHA 3L2HA 1FPN2 4HN1A 5LK5A 3L3PA 1F2NA 4UFJA 1NUKA 4PJMA 3GBFA 2Y48B 5LGTB 2VM9A 2IWGB 2XPJA 4PK6A 1BK1A 2OUHA 2WUHA 1LEDA 3WNPA 5CKNA 4YT0A 1OEDA 1EUTA 3LIGA 3PL0A 4FT8A 3FZFB 1DGRN 2WQZC 1XU2A 4XUNA 3TN92 3LDBA 5IAXA 1FATA 2XBO1 3I7DA 2WCAA 4R9BA 1L7QA 2WABA 4PIYA 3POYA 4CP2A 5IATA 2R062 3FBYA 4MGTA 2E26A 2FBEA 3CQGB 1KFXL 2GMPA 5T5PA 2HWC1 4K0KT 1IHMA 2KMFA 1VRH2 4RYDA 5AQUB 1IAPA 2LS6A 5JPMB 2B45X 4DR3T 1W90A 3JUUA 5FYCA 2V73A 4I01A 5F6LB 1OA3A 1H30A 1GZTA 3N2KE 4O4IE 4DV1T 5A32A 3NZPA 1WLTA 2VECA 3CL1A 3UU6A 2BS4A 1QJY1 1IZ3A 2CA5A 3PIJA 1COV3 1SLBA 1OWAA 1URXA 4IEQA 4UW4A 3PLQA 1Y7BA 4YW5A 4E8CA 4OQ8A 1GWMA 2J62A 1U4QA 5FKYA 5LCYA 1ONAA 3H42B 4N53C 3CJIC 4TTGA 2R32A 3J4UH 4YW2A 3ESLA 4D7TA 1VMJA 3AMHA 2XONA 4FSJA 1YEWA 3ZR5A 4AEDA 4FPEA 4N43C 4IL7A 2UXBT 5HXHA 5FXVA 1PX4A 1MMDA 2DVFA 3QNUA 1GNYA 2VMGA 3B93A 3ZMZB 5FDBA 5A3UA 1RUI2 5FYYA 1MIYA 1DG6A 1BR0A 1JYCA 1UO9A 3FHAA 5GZCA 1OD3A 5FO9B 2JQKA 1PGW1 1US7B 3QH6A 1CZVA 1GYKA 4UR9A 2KXLA 2CAUA 2Z2SB 2GNMA 3LB9A 1ULEA 2BGPA 3KF5A 4XFAA 4ARXA 3WHTA 3NAPC 3J26N 3P3NA 4K1YA 4GJYA 5L3GB 1E1HB 3AE8A 4QU1A 2K24A 4H9NC 3H9AA 3VDDC 3HN1A 4BLJA 1G9FA 3ABZA 4Y3OA 5KHIA 3FLTA 3NRYA 1R8IA 4IE4A 3VR9A 2MBGA 3H1WA 4YM2A 2TNFA 1JBCA 2J7MA 3UL2A 2E9XD 3O1TA 2IVJA 4KHZF 4ZI3C 2Y0OA 5BR8T 1BR4A 4TN7A 2YU1A 1UUSA 3P3PA 4O9EA 4ZOLE 4NUUA 2NW9A 4LKSA 2EXIA 5GKAC 1XE0A 2WAUA 1HB1A 1H8TC 1SFNA 2PHWA 3CWZB 2D97A 1F4AA 4UFKA 4KWKA 3T0DA 2XVLA 3ZYMA 4Z92B 1CUNA 3C8XA 4L0PA 4LMFA 1UNBA 4ADZA 4KBMB 1B35C 3AL6A 1SHWB 3C98B 3CQOA 1A3KA 2W2IA 5CU1A 4GK5E 1N32T 1GLHA 2WFPA 1LHWA 2A3WA 4LBLA 3A22A 1WD3A 1YNAA 2NN8A 4HVQA 4WBNE 5FLIA 5LXTE 1G9BA 5FZLA 4P1NA 1E5HA 5HCAA 4YSYA 4CP1A 4FTEA 4DRRA 1RHI1 4CI1B 2OPKA 2XDVA 3H3AA 4XBQA 1WCKA 5CBLA 1YKHB 1CWPA 4AEMA 5FP9A 2JQHA 2ZMNA 1OC1A 5FPUA 1Z7S2 3AZZA 3NKZA 3PV0F 1LU1A 1ODNA 4CN6A 3RLFF 2JG9B 5I8TA 5HXMA 4LUKA 1V6MA 4B29A 1HRI3 3ZLIA 1KITA 2VQUA 3V65A 2FDKA 3ZT7A 2HLEA 1UAIA 1FV2A 4U3CA 2XMLA 4IV3C 3FXEB 4AE2A 5C8CC 1NG0A 5CYYA 1C57A 3AK0A 5JSOA 5AQQB 5AQJB 1AYN1 1OFSA 5FVKA 5D8AA 3SH4A 2VTXA 4YW4A 4IGQA 2RS13 2XPKA 1QMJA 3HNBM 3AMPA 2IUBA 3SFDA 5FMOS 5DQVA 3I2DA 4NRQA 1NCQB 1WBLA 4JTNA 4OUMA 1ND2B 3PMEA 4HANA 1L7RA 2LTNA 4CYDA 1VB2A 5AFUL 1VRH3 2E7AA 4XXAA 3NBXX 2HBTA 2WLPA 5EZWA 4QPYA 2A9UA 1WW7A 2E9XC 4LKEA 1W04A 1S94A 4EOZB 1WA4A 5HEHA 2D5FA 2VWAA 2Y6GA 4RHV1 1WMXA 1DFQA 1R091 5C4WB 1U0AA 1Y01A 2VNGA 2Q5TA 2RM21 3E5UA 3TN93 4DMIA 1UX4A 1IQAA 3PVOA 2YMZA 2LM9A 4FFFA 4ZEYA 2Q0AA 3HPNA 5A7OA 2ZABA 1AJKA 5FZKA 4CDWA 4COFA 4I0UA 3EJKA 3WI3A 4L9BA 5CNAA 2Q9QC 4W8JA 5LBEA 3RZJA 2CM0A 1MEC2 4EQVA 4YW7A 3TYJA 3MPPG 1R64A 3EABA 4X1KE 2OZJA 4XFGA 3UGFA 1KFUL 4JQRA 4ZU4A 2V5YA 1IBKT 1BKZA 4IEXA 3BYWA 1W05A 1P8JA 1CHUA 1WGPA 1W99A 2G9ZA 4LJHA 3L8RA 4XURA 3VBFA 5JZGC 5AQRB 1VJ2A 4K3UA 5E1RA 3WXPA 1T6GC 5FZHA 5CFDB 3S57A 2YINA 1SLAA 1CZSA 2YBPA 3NKTA 2H6CA 1JUIA 2RM23 3AM2A 2K5BB 3K77A 3TN91 4WZCA 2KWHA 2XQ4A 2RJKA 3I3BA 1RJ8A 2VJXA 3RKOA 4QPWA 5FPLA 2BYVE 1GSLA 5JMOA 1BVVA 4ZZCA 2OVUA 2WU2A 1TMF3 2E6VA 1HJGA 1O4TA 3DPRC 3AYAA 3KV4A 2ZHLA 3C7EA 1NCRC 3CZJA 3PMSA 4ATEA 4QM9A 4IE0A 4ERRA 2C9AA 3WEZA 3Q9DA 2CCQA 1J1TA 3LSVA 5I0RA 2V8SV 3AMQA 5I8SA 2CWMA 4XILA 4QH1A 1DGLA 4Y26A 1HRV1 3FBZA 1DYOA 4X6QB 3PHMA 3VBHB 4C0HA 5BNQA 4AFAA 2D6NA 3O1UA 1XNKA 2WNEA 4ES8A 4ILUA 4LBQA 2WWVA 3W15B 2WA4A 1T8BA 5FUPA 4A6SA 3B69A 4NN0A 4WVZA 3PJAJ 1D4M3 5ABJA 1DZTA 4XFIA 1EP0A 2Y6HA 5K9YA 1VCSA 4PF5A 3KLSA 4PQQA 1H1MA 2HPJA 4IDQA 5L2LA 1NQDA 2PLV3 3AE5A 1WLWA 3ZYHA 4EYUA 3ETQA 4GULA 4NHMA 1R1A1 5DAXA 2H0VA 2WNOA 3MW4A 1FYUA 2Q8DA 2WO1A 3HNYM 3LIHA 4GB31 2DCYA 1Q56A 3B5MA 3C4ZA 1A8MA 4LBQB 3B3QE 2D93A 2KINB 4QX0A 4F8HA 5D21A 5FLHA 3VZNA 1YIPA 1M06G 2B1EA 4QXKA 4A41A 1BXHA 4J1WA 3OGJA 1MZFA 3I2GA 3JU9A 1ZRCA 3ILRA 4LIUA 2PHTA 1ENRA 3P4QA 3AKRA 5IVCA 4AGRA 4YSZA 1IKQA 3O5SA 2QKDA 4LT5A 3O1IA 1RMU3 1LULA 2ARCA 2PQQA 2VAUA 1QNYA 2ZGRA 3MGUA 4MO3M 1WA6X 3NV3A 1S0DA 1ZOYA 1DYPA 1OQ1A 2BWAA 4GH4A 4R52A 4HT1T 4Q2FA 4QX1A 1DQ6A 1UK5A 2JDHA 5I0TA 4BQWA 2VKDA 1NOVA 2W4XA 5LK7B 4LBOA 4Q4Y3 1U5ZA 3PVEA 1MS1A 2YC4A 2BTVC 3AP7A 5DN2A 5JZGA 5JH7E 1GWLA 3OEAA 1JXNA 1LHOA 1KF6A 3UT0A 1AYM1 5IVEA 4P14A 2ZX2A 4TUYE 4ISSA 1HN1A 2ZX1A 3KHBA 3ZM8A 5L4EA 5EQUA 1W6MA 4CDUB 4CP0A 4AQFA 1PK6A 2BZDA 4N8MA 4BYYA 1V9U2 4HZFA 3RZGA 2BNMA 4XF0A 1LHVA 4NIDA 3NV1A 3MXZA 3MLJA 1HXS2 4LMKA 4MALA 1O3XA 3LFMA 3RWNA 5CG8A 2CAVA 1RUJ1 3VBRC 4LA2A 2YDRA 4P02B 4FOQA 5BY5A 1T7SA 3QLQA 1XE7A 3MLLA 4LF8T 3ZMOA 4CEWA 2FDHA 2ZGPA 1IJ6A 3FLRA 2UY9A 2DWRA 1KJLA 3NW4A 4J25A 2ZKNA 4CDUA 5I0DA 3THPA 2B5HA 1RUH2 2QYWA 1NE4A 4XJAA 1DDLA 2JB4A 1ND2A 2QNKA 4B4QA 1C5IA 4B3RT 1LAJA 1UY2A 1VBC3 2JENA 2LSKA 2HYKA 4FXKB 1B35B 2QJVA 2VCAA 4LHLA 4Y5Z0 3SCHA 2JQQA 3GXUA 3M3CA 3MDPA 1ODMA 1OEDE 1FOD1 3I9WA 1FMD3 3AAIA 1V00A 3GYDA 3MFAA 3OBZA 2C5IT 4I0AA 4LITA 1W2OA 2A6ZA 4IUGA 1YI7A 3EB7A 2FUPA 3CEWA 5IW0A 5LBFA 3RQ0A 2WWUA 5EIYB 1QXJA 5JDFA 2YROA 4QHBA 4A7ZA 1NXD1 5FBJA 3MIBA 2X5IB 1GQHA 1LOFA 2Y34A 4AHWA 1PVC2 2XAGB 4UVAB 2VNRA 1IPSA 1Q8QA 3WQ0A 5FV3A 3M65A 2ADDA 2HWC3 1FIOA 4XFBA 2CBIA 3ZYPA 1KK7A 1ASJ2 2VZSA 3NAPB 5FP8A 1CIYA 1TMF1 1V9DA 2QUOA 4FPHA 2ERFA 1VRBA 5FAXA 3CIHA 1W28A 2C0SA 2Y8DA 4X65T 2ARAA 3THCA 2CGPA 2PAMA 2DBIA 5HWYA 1J5WA 3QC9A 1UX6A 4UFIA 5FZFA 1K42A 5JCTA 5AVPA 4DR1T 2L8KA 5BYNA 4HTEA 1UIJA 4OLLA 3RDIA 1ZZ6A 4AHXA 4CDQA 5FP7A 1D2QA 4CP9B 3S4UA 4B4RA 2NWBA 3N36A 1HRV3 3AFKA 5LRSA 3E6BA 4CN4A 1G73A 1WCRA 4DR5T 5C9AB 2WB5A 2Y38A 1LGCA 1JNRA 4CXWA 3DXUA 1OEDC 3R05A 4Y22B 4BAYB 2YG0A 3AZXA 3OYWA 4U33A 3SH3A 3AYDA 4ITCA 1UMHA 2JDPA 4QXCA 4AYUA 1O3SA 4U36A 3RMXA 1D4M1 3AE1A 1H2KA 1U5IA 3NJYA 1UU5A 4Q0UA 4UBGA 3RZZA 3ZXDA 5AFBA 3GHNA 5ANQA 2BKPA 3A0KA 3HQRA 5FYVA 1HCIA 2N9DA 1D0GA 4Q27A 4AI2A 5JR2A 2BQPA 4KH9A 3I2IA 1MZ6A 1SMVA 2D6OX 4I55E 3UUNA 2LUWA 3NWIA 5LYJE 2W94A 1UX7A 1S55A 1NLRA 1W6QA 2LROA 5FY5A 3SEEA 3VBOB 3VBSC 1PZ8A 3ZXGA 3FBLA 3R84B 1PMIA 1W9FA 2G1MA 2RMU3 1AXKA 3ZFGA 3ZFFB 3N9OA 3ZYGA 4WM7B 2W68A 2XGXA 1EAH1 4HFVA 3RIAA 3I9YA 2VVNA 3HKEE 2HWF1 2Z4FA 4K9SA 4OZXA 5FTTC 5GLVA 3BN6A 1I3HA 3LA7A 4YVSB 5DDJ1 3LPGA 3S30A 4YVSC 2VBBA 1D0YA 2I07B 3K75B 3PUYF 5F7UA 2AYHA 1RUD3 1UKRA 1VB4A 3TB0A 3BQLA 2D7FA 3BIEA 2KSRA 3HR0A 3WAKA 5AC93 2A71A 3RG0A 3KQ4B 4TV9E 1ASJ1 4UBHA 4CCLA 2F4PA 1RIRA 4AI0A 3MICA 4YM1A 2W61A 5J0ZA 3ETPA 1QXRA 2VPVA 3KT1A 1BMV2 1DLCA 4ISTA 2WFF1 3DXTA 1OUXA 3JD72 4U31A 4DV7T 5AQNB 1MACA 3OBRA 1KJRA 3PUZF 2RHPA 5CG9A 2CWYA 2IHR1 5FWEA 1WCUA 3IIAA 3QUJA 2KT9A 3S5AA 1HG5A 1X82A 2VOWA 1YFYA 3RYCE 4MG2A 2XJVA 2CPTA 5FZ6A 2XVKA 1LOBA 3LSDA 5ISLA 4P9LA 1QOSA 3BI3A 2XJQA 5HCHA 3IDAA 1QKQA 3A0NA 1RUJ3 5AQFB 2BRTA 2DUQA 5GJ6A 2WS93 5CKQA 2XKOA 4XC9A 2QQJA 2XM1A 3RQUA 2E31A 2VZUA 3KM5A 4NWWA 3FE5A 4Z8BA 1JMUB 2UUCT 3EMRA 3WW2A 2SLIA 1O8SA 2QQLA 4LLFA 4MGQA 3ZIWA 4YVSA 4PI0A 4ZXLA 4HKLA 3IAQA 4YHHT 4HSJA 2FQPA 4U2AA 3CK6A 2K9AA 4HFDA 2Z79A 2DCTA 1XDOA 3F2EA 3U3IA 3ZFFA 3FZ3A 2KR2A 3WF4A 4ANJA 3GNEA 3IB3A 4Y5TA 1PVXA 2VVSA 1BCXA 4PLNA 3IIIA 5F3JA 1K3IA 4JI6T 5L9BA 1V6KA 4YTNA 3UKTA 2DBNA 4CUAA 2UU9T 1DZRA 1CPMA 3ONJA 4A4AA 5B2GB 1ST8A 2ZJCA 1W0OA 4DBQA 5JR7B 1WCSA 2YOEA 3ZN0B 5LBCA 1KNPA 3ATGA 1UOFA 2XAJB 1NXMA 5FO8B 5IFTA 1YFWA 1XNRT 1IS5A 4UFHA 3SLIA 4CE8A 5ADXL 4LPLA 4LFAT 4OYJA 3B57A 1E57A 5GM0A 4P5HA 3NNJA 1ULFA 3UGGA 5DZFA 2BBVA 1UZYA 4QX7A 3MIHA 3JZVA 2CSGA 2UXNB 4PAGA 2WR9A 4P9YA 5EV7A 4E4SA 2DU1A 3AJYA 1T6BX 1BBT1 1QGLA 2GH8A 2JDKA 5BNPB 2F6BA 2D3RA 2VQTA 3AZWA 4Q8KA 5M4YA 1AR73 3FMGA 4ONUA 3SHRA 5LY1A 4FQ4A 1S0JA 2WO3A 1J59A 3AEFA 2WZIA 1YQ3A 1TME2 5IVBA 4CTEA 3V5UA 3CBNA 2W66A 2RJ2A 2CDOA 1R1A2 1IG3A 4CN1A 3ZXFA 1DZQA 1FEWA 1U5PA 1LOAA 1S0GA 3ZMNA 4ZHQE 2QZ2A 4XAEA 3RS6A 1MS8A 4D6RA 1C1LA 2C5KT 2GC3A 3M8LA 5A7WB 2EHOC 2W9XA 2R6QA 2ZS6B 4QMAA 3ZSLA 2AEYA 1HX8A 5GONE 2WAAA 2WQYA 1OA2A 2Y6FA 2AH2A 1AL21 1C5HA 1GUIA 1SACA 3MO4A 3IPVB 4P9XA 5C3OA 3WUCA 1EAH3 2A5ZA 5A3NA 1IBLT 1DU3D 1V6LA 2XM2A 3UU4A 4QHZA 1ZBA1 5HXRA 2ZACA 4AF9A 2XJTA 4FPCA 1NWMX 3EHKA 5HEJA 2VOXA 4QQ2A 1J84A 4XPVA 3RPQA 3V56A 1RUG1 4F7ZA 1QJX1 3I4IA 4XHBA 4YG6A 3TNQA 1LOEA 5FY7A 4EAHA 2Q9QA 4DO0A 3O9XA 3ZPYA 1T98A 2WZEA 4CCDA 4NIQA 3SS1A 3RI5A 1RUOA 1A6CA 5HYAA 1XSRA 2NP0A 1O7FA 1TG7A 2VZPA 4L99A 3SMHA 3THDA 2I59A 5EZYE 2ZX0A 3KB5A 1LKXA 2RV9A 4GKYA 4KHPT 4HSLA 2WFF3 4BCUA 2ET7A 1ZBE3 1XDPA 1VBA2 3ACFA 3EHZA 2VQAA 4RFRB 4C8DA 4JDOA 3E22E 1OVPA 5L73A 2N1GA 4XDQA 4UVBB 1J3PA 1AYM3 5GZGA 4IDOA 4DIDB 1XBFA 3D0JA 3O0VA 1I94T 4N90A 4XJ8A 4H9OC 4YVWB 5GZFA 3O4XE 1H1AA 3ZO0B 2RR12 1C8M3 4ZZ8A 1CX1A 3PDYA 4FPYA 4HVOA 2YKSA 2XQ7A 3KFWX 2WSUA 4MLOA 2XBO3 3ITQA 1ND3A 3NNMA 3KD4A 1RVF3 1S0EA 2QFEA 2R071 4UI9L 4XCBA 5C6CA 3CJIA 4XDPA 4TSVA 2ES3A 4CCNA 4DRVA 5LBBA 4LHSA 4XZCA 3RPUA 1XNDA 2CWSA 1UW8A 1W0NA 2NMOA 1X50A 4ZZBA 5J37A 5JPNB 4AKHA 2DUOA 3AKQA 4I50E 4DV4T 2V7LA 3PUWF 2GDFA 2TEPA 5FZ7A 3PVNA 5FJHA 4NRMA 2AGSA 2ARXA 2BVBA 1NKGA 3AZYA 5L9RA 2YPDA 4DZGA 4YFZA 1VBB1 3VBSB 2OT7A 1REFA 2WWSA 4DXRA 1STMA 5HEOA 2PHRA 4I0BA 4ZI2C 1SEFA 4IE7A 4Q4W1 3B00A 3TNPB 1SHZC 4CCEA 2PYTA 3E97A 3O0WA 1UWWA 2RPAA 2WP9A 1QQP3 2Q1ZB 2Z5WA 3WNMA 4U72A 1SBEA 4LBNA 4CUBA 2RDSA 2B7YA 3LQCA 2JG8C 3J7MA 4YFSA 1V0AA 3QACA 3ETUA 4JC1A 3VZJA 1FXZA 3OYWB 2QGSA 1VMFA 1Y9QA 4Q1PA 3C7FA 4QX8A 2GP5A 1VR3A 2SPCA 5FL1A 1KD7A 2ORZA 2ZM8A 1HXS1 4DV3T 1JNZA 1YQ2A 4IDNA 2P17A 4ISRA 4KWUA 3I49A 4HVRA 1XJAA 1QJFA 4ZKTB 4BZ4A 2E5VA 4EXTA 1UPIA 2NP9A 2UY8A 1C1FA 1V6JA 5DDJ2 1RHI2 1ND2C 5IK5A 4A97A 1AX1A 1FMD1 2JE7A 5LJMA 2OLTA 4W65A 1WRDA 4XFHA 4Y1VA 1L0VA 2E9XB 4X62T 4WV8A 5KHJA 3RZHA 4TWHA 1HNXT 2RS32 1W8TA 2FDFA 4BLIA 1LU2A 4FOVA 3MV11 4QB1A 5LA0A 1D1BA 4P9GA 2VKHA 1DQ0A 3DUIA 5ETWA 1R1ZA 2P5BA 4CXXA 4HPKA 1YXRA 4FPFA 4CDXB 2DYCA 4KQ7A 4AKIA 1AR91 1POV3 5DPNA 1HW5A 1UD1A 1HV1A 3UKVA 3I54A 4OI4A 4FI9A 5BV6A 4KI0F 5ABHA 1CONA 1PIV3 1GOGA 2ZX4A 2VQFT 3GJBA 4QGNA 3HN3A 1D0ZA 1FI2A 2BERA 2X8KA 3N7LA 2LRPA 5EP9A 3QH7A 2B39A 4DEVA 1YCIA 5E0OA 1DP0A 2JKXA 4FP3A 3WDVA 4FAHA 3G6JB 1IS4A 1DF0A 2O14A 3ORJA 3ZXLA 3VZKA 4IEZA 3KDSE 2HWD1 2OIIA 2RMU1 5JR9A 2ZXQA 3L9JT 3TEYA 4ORFA 1NQJA 3DTOA 3Q5WA 1UIKA 2E7TA 4IQPA 2WZHA 1W8NA 3SCGA 4AVTA 1CX4A 1YIFA 1KS4A 2WSVA 3IDEA 5A7WA 3AP9A 4BHPA 3AE7A 3FUOA 4FAGA 2QQPA 4B6XA 5IHYA 1QJX3 1W0PA 1JS9A 2EXKA 3CJXA 5HCFA 3ZYRA 4CPBD 1RL3A 5J7MA 5A6XA 2VW2A 4QHOA 2R073 2FJBA 4IT4A 1QY4A 2WZ8A 3K51A 3ZX7A 5CFCC 2JECA 3A7QA 5EXOA 2PHDA 2RS52 5C4WA 2BKOA 3O1MA 2WYSA 4AFBA 2JMHA 2LKHA 2XQAA 1RUF2 3FFQA 4XOGA 3WDYA 4A6OA 4QB2A 3WNNA 3WV6A 3R6NA 4NROA 1FMVA 5H6QB 1AJ3A 1VAMA 1YD8G 2RE9A 1ALYA 3OUJA 5A7PA 4HOOA 3AA0B 1KEXA 1N47A 5LA1A 3QBQA 4PJLA 1LESA 3RGBA 4N43B 3AP4A 1FOD3 5CA1E 4EB6E 1SG3A 2OX0A 4WVVA 4PIZA 3AE2A 2IXHA 3EO6A 4M4RA 2BBJA 3S7EA 2BFUS 5HAXA 1RUC1 3BVCA 3P4RA 3OD0A 5KC6A 4LBMA 2QQOA 4Q4X1 4CCCA 4UW5A 4XEZA 3VBUB 1ULOA 4JKKA 1UKGA 2ZHKA 2A3DA 3WOGA 3ZIXA 2HJIA 2Y6XA 3RZMA 3C4XA 1LEMA 5HEGA 1OOPA 4P00B 3ROUA 4B8EA 1LRZA 1W3XA 5J36A 5HWXA 2WQ4A 2UYBA 4NR1A 3BOPA 5HCJA 2X10A 4PQ9A 4DNYA 1K5JA 4IGPA 5L9VA 3AEEA 3X1DA 3A21A 4YM0A 5JR9B 2Q1MA 2QQNA 4OFGA 4OUEA 2W92A 4YG0A 3HA4A 4NE9A 1O91A 1H8TB 4AAPA 4AVSA 1PM7A 2VH9A 4DVDA 3ZMVB 4PLMA 4IETA 3K2OA 4HFEA 4P9IA 2GMMA 4META 5TSWA 1VMHA 2GZWA 3U1XA 3WZ1A 2QQUA 3THTA 3ZKUA 5C8WA 4O2AE 5A33B 4JDMA 1E5RA 5FMCA 4IV1C 4LO8A 4QPGB 3HEIA 3CPZA 2BG9C 4IHJE 3IDBB 3E08A 2P37A 2XUMA 3MIFA 4R8HA 5HCBA 3VB9A 5BNPC 5TAOA 1GZCA 5L3DB 2F17A 5EJ3A 3F57A 5BNOA 2W2UA 4E7ZA 2QTWB 2JB8A 1D7PM 3WW3A 4CDWC 3I0QA 3RRDA 1O4YA 3IBMA 4AG4A 5C3RA 2BKNA 3PNAA 4Q0SA 4AI3A 5M0TA 2VOKA 4PDWA 2DL1A 1XC6A 3P5BA 3SITA 1MNDA 4HKAA 2HWF2 2P2KA 2X09A 1LGBA 4DMWA 5FIXA 2Q4SA 3VHPA 4F8AA 5JSPA 2MYSA 1N1TA 3A23A 4BJMA 3RJ2X 3WDWA 4B3TT 1OLQA 4BQ2A 1AR71 3OYZA 1LTEA 3FN9A 4BDVB 3USUB 4IV3B 2EHOB 2PTFA 2B8MA 5C8CB 4UELA 5FZ1A 5L19A 3LPFA 1YFXA 3OVUA 5I0SA 2W3JA 4AFDA 1Y3TA 3WLUA 1J3RA 3ZEFB 4L97A 4ATFA 1QJX2 4KP3C 2Y33A 3ZVXA 1AL0G 1PIV1 3ABVA 3ZYIB 3J8F3 1X9TA 2VC9A 4COUA 2XZEA 3EUHA 1HX1B 5GALA 1OEDB 3X29B 3DYPA 3KS7A 1PGL1 1SZBA 5DABA 3HKBE 4E4DX 2V7IA 3RF1A 3WAJA 4YW1A 4UF0B 2DWKA 2PQSA 2VMCA 2X5IC 4EE2A 1TVGA 2B4KA 2WMNA 1AR83 3VKHA 2ENRA 2RS31 3NNLA 1W8ZA 4NRPA 3ZYLA 3WCSA 2OS2A 3M1HA 4QM8A 1JZ7A 5DG1A 1RUNA 1H4HA 2Q1FA 3NV4A 3Q8AA 5FY4A 2D0TA 5JDHA 5IWFA 3RQWA 2XAHB 3ZJ1A 1KS5A 1NZIA 4JZRA 4CVUA 4EIWA 1ENQA 3NZQA 3RYFE 4X5TA 1SPPA 4OYUA 4TLGA 1PIV2 2LSYA 3ZCJA 3H3ZA 5F9TA 2LOPA 3NQHA 2PA7A 3JB8A 1K45A 4CPBA 3QOFA 3ZFEA 3LA3A 1M4WA 4DUXA 3FL7A 2MAWA 1Z0PA 4WVWA 3ZFFC 2WLQA 1XYPA 2B9UA 1YQ6A 4RD7A 4E9KA 1SLCA 4M0NA 1WMDA 3TEXA 4NHXA 3UFGA 2G9GA 3HNMA 2W0GA 5FP3A 2GC2A 4FPGA 4JCKA 5CVRA 1FMWA 1A78A 1H6YA 1VBE3 2WS91 1V6NA 4N78D 3GCXA 4SBVA 3UU8A 3T2TA 4YM3A 5JRCA 3CMLA 1AR81 1JUHA 2FCTA 3KV9A 1WKYA 2FZ1A 2PAEA 2RS33 4GWJA 4HK8A 4LTAA 4IREA 4QX3A 5KXBA 4JI1T 3VKLA 3LDRA 4AEJA 1Q8PA 5FPVA 4LR4A 1H8VA 2DVBA 3ZSJA 3W5MA 1C4RA 4K0UA 5FY1A 4DUVA 1O3RA 5K4LA 5F3CA 5FZCA 4Z90A 5FKCA 1W9TA 1O59A 3VBHA 4KU8A 1NY72 1VBB2 3WP3A 4FCAA 2X53S 1RUE1 2J1RA 3JQWA 4XAAA 4LMLA 4GWIA 1VBD2 3BU7A 5AQPB 4QGLA 1WYCA 1QLBA 5JQGE 1QXPA 3JCIA 3POWA 4S2DA 3LDQB 1WMFA 2VZOA 4V2WA 2WS3A 1QJZA 4XMAA 4YLZA 3RYPA 1MS4A 5EHDA 2X68A 2JIGA 3KF3A 1F35A 2CWOA 2A6YA 5DAPA 4E8DA 3ZYJB 2CLYB 4BMEA 4AQFC 1PK6C 5ACA3 3UU3A 5JDGA 4YJ3E 1QH6A 1R081 1UOJA 2LHNA 5FYSA 5H9RA 5FOJB 4CRQA 2YXSA 3B94A 1NAFA 3P4WA 4W50A 1D2SA 1RGSA 3HR9A 1C28A 1DQ1A 4XF1A 5CB7A 5C71A 4AKLA 3B5LB 2LSJA 1C8M1 4Q0VA 4EWDA 4BMBA 3O1PA 1FJGT 3RRCA 4UIGA 2ZCWA 1COV1 3OPCA 3CDZB 3UYJA 4YZ1A 3HJRA 5A1FA 3NKGA 1QJU3 2BUKA 2ZOEB 3D5OA 3IF8B 2IXCA 1WW6A 4LE4A 4NAMA 1QIQA 4OULA 2BBHA 4RS5C 5KXEA 2YHJA 4DR2T 1JZ4A 2WDQA 4JGZC 2YDQA 1IG0A 2P34A 4QDQA 3SXWA 5HV4A 1LR5A 4UAPA 4QB6A 1AXZA 2M6IA 3AAAB 1PMHX 4PHZA 3DECA 4Y4RA 3ZYKA 4ZI7E 1RUC2 4I30A 5T54A 4BH9A 5H6RB 4H14A 4LQRA 1G9DA 2WYFA 3SRZA 3OG2A 5FYHA 4D7YA 4RR3A 2ZPXA 1VAKA 3T4VA 1AX2A 2M67A 2DURA 5L3BB 1ULGA 3OBVE 2G9FA 2RR13 4DY5A 5L36A 2VXJA 1AYM2 4NXNT 1CIWA 2H89A 2RG4A 2BS2A 5E8AA 5LNKA 3OTOT 1QJU1 4X64T 4LLOA 2JEMA 4LUMA 2ACXA 1AHSA 4Q0QA 2CGOA 3PJQA 2BNOA 1JYTA 5FMBA 1WR6A 1ZBA3 3FJSA 3O1SA 4OCTA 5FP4A 4DY3A 3TLUA 2UYAA 5FCCA 1OD5A 4QX7B 1UF2C 3J7LA 3TOJA 4BU2A 2PBIA 3SC7X 5FPXA 5LEKA 2WZR3 4FXGB 5JXJA 1DGWA 3BCWA 5BNNB 4YVWA 4H55A 2FDGA 2YDEA 4FO9A 1LVKA 4MVTA 4BISA 5A6ZA 3WT3A 2LSIA 1SBFA 1JOBA 1TQ5A 3K1SA 1XNBA 3D3AA 3F2ZA 3QOPA 4WVMA 4COYA 1QUUA 2XHNA 3FWEA 3VBRB 4BIOA 4PDWB 5J48A 2W08A 2XHKA 4QQOA 4G2AA 3I2OA 4E2SA 1XOYA 3ZXKA 3Q8CA 3DCQA 1XMQT 2C4XA 1GQEA 5KXJA 4A45A 4EN9B 2L3LA 3UUXB 2OPWA 2RS11 2WT0A 3D82A 4HWIB 3LCPA 2R0FA 4H2AA 4COVA 2B42B 2WNVA 3POEA 4Q25A 4IERA 4PBOA 3ZKYA 4C90A 3AYCA 3H1MA 5H9SA 1SDDB 2C26A 4XZPA 2ZM6T 5IVYA 3RFRA 3T08A 4AR2A 2V09A 4HKWA 4AOCA 4BM8A 1W8OA 5FZDA 2BDRA 2AENA 4QDSA 1U12A 5FMDA 1CAXB 3UU5A 2IC6A 3MACA 1CZTA 2EXHA 4N53A 2IC9A 4XFFA 1I5PA 5FY8A 4AK3A 3EDUA 1FX5A 2HEYF 2XR4A 4M3CE 4MHRA 2HPLA 3T2OA 5FYBA 4JI7T 2DCJA 4NXMT 1MEC1 1L7LA 1EY2A 3LEIA 2QBXA 1XZYA 3SH5A 4DEQA 5BNOC 2KLQA 2J1DG 3VV1A 2E51A 2HWE3 3BGAA 1D1CA 4PK5A 1H6XA 2VMEA 4AGVA 3ASIA 1PO13 2R042 1S1AA 3CX7B 4K8RB 2XVGA 2CDPA 3T8OA 3AEBA 2EIBA 1UZZA 3IMNA 2OXBA 3I2FA 4MSVA 5IVJA 4NHYA 3ZSKA 2BW8A 4OI2A 1UPSA 2P3IA 2WJSA 3Q8EA 4HBNA 2TUNA 4OUSA 5ANNA 2BZBA 5EJ1B 5GLTA 4JV4A 2XWJB 3JBG2 1Q8SA 1OA4A 4GKXA 3ZYFA 4HMZA 4XIOA 4YW6A 3U0ZA 4IDZA 5IWAT 4UFLA 5F2SA 1GNHA 4DMVA 1TZOA 5FZBA 2W00A 4K21A 3LG7A 2MEV3 4PBPA 5DUXA 5DAQA 5IUQA 1WW5A 1D4VB 3SFEA 1IPKA 1QSDA 2X67A 4HWCA 4QXHB 4ZXKA 1WZXA 5C4WC 1OXZA 2V6YB 3ACIA 3ENRA 4OX9T 4IEVA 3AVSA 2JD9A 3GCWA 4LBKA 2EAKA 1IOAA 5IYZE 1POQA 5JMCA 1F5FA 1ZV4X 1UYZA 1GV9A 1UX5A 1WFDA 1BEV2 1CJPA 3J7Yq 3N35A 2WS92 2MPFA 1XYOA 1RUJ2 4L5GA 2B46X 2WNUA 2IC1A 3DV8A 4LBQD 3ZDSA 1UCUA 3AB3B 2H6BA 3KZ4C 4NO4A 2LOSA 1LNSA 1W2AX 2CXLA 2BS3A 4RS5A 5FZOA 5L3FB 3KCXA 3Q2MA 4Y22A 4EEDA 3TBDA 2I74A 3M3QA 1F8VA 3ZPOA 2OKXA 2DUPA 1UMZA 3C3VA 3IM0A 4AL9A 1WYBA 4FP2A 4LF4T 2ZBJA 1FNZA 1W2UA 4UXNB 4P0AA 3VL9A 2YK0A 1D0XA 4HGAA 4JLEA 3UQ4A 1BYHA 4WBOA 3R6SA 5FZAA 5F5IA 5ERLA 1ZP0A 4H9QC 5ABFB 4W6XA 4BQ5A 3KBTA 4V2VA 3ILNA 2NTXA 3GZUC 2JQ9A 3LK3B 3LGRA 1X8EA 5HBAA 3AXJA 3IT8A 1HN0A 2YFUA 4ZXEA 1GMMA 3RZLA 5C2TA 4O8SA 4NUVA 4H9SE 1NA1B 1SDWA 1T2XA 4X8NA 4BQXA 3FZMB 3AMMA 3ZMUB 3EVYA 5G04L 4RA0A 4YZ5A 1JW6A 1RUD2 4GK0E 3U37A 4XE9A 5IT6A 2VMFA 5FZEA 5KC5A 1HQLA 4QPIA 4RQPC 4UW3A 4Y20B 5DUWA 3TAYA 4GA9A 3NWKA 3OGVA 4I3PA 4EV0A 3OEBA 2DDUA 1I5ZA 3TEWA 2NR4A 1AL23 4CDXC 2H88A 3AXJB 3A4UA 3DYOA 4EZHA 4A5XA 1TME1 4IL4A 2RJLA 2XSBA 4BE3A 2Y26A 1ZREA 3K3OA 3ANWB 4QT6A 1AVBA 1G6NA 1XYNA 4NMIA 2Z6EA 1BBT2 1REDA 4PLOA 4XJ9A 1H8TA 1UU4A 3LAGA 5JOWA 2PHXA 2Q30A 4HETA 4KWLA 5A7QA 2GK9A 4LFBT 2D9DA 1RMU1 4AW7A 4OHYA 3JC6D 1S0BA 3N7JA 1AR62 2HBUA 2W1SA 5FK8A 4CDXA 2YB7A 5E6HA 3NNGA 2YZ4A 1YQCA 2XJRA 2YGLA 4NPRA 4XIKA 1ZZBA 3GALA 1W03A 1W39A 4JBWF 1UQXA 3I97A 4LO4B 2XLFA 4NVPA 4ET7A 1OLRA 5HEUA 1V6IA 4F6RC 2NYYA 5J1GA 1JODA 1ENSA 4WVMB 2A6VA 4N9IA 1OOPC 3M3OA 1XXNA 3TLSA 3PJAA 3RI9A 2VTFA 1HRV2 4Q4V2 1MZEA 1S4CA 5DUVA 2JE8A 2W91A 4HK9A 4BXFA 4X20E 5JTGA 2LALA 4A2UA 5KHKA 1QF3A 1NX9A 2ZLYA 3P8CD 3TLVA 4NWVA 4FTSA 4HN0A 3UK9A 5CEHA 5JXGA 4Q26A 4MH0E 1G7YA 3PUGA 5C9AA 1N1SA 2LE8A 1WCQA 2DCKA 3B01A 4QXCB 1H2LA 1NLSA 1VLNA 1WW4A 1UU6A 2SBAA 1EPWA 4B3MT 2XJ7A 3HI2A 1H9PA 2ZGLA 2HWC2 3ACLA 5F5CA 5JZGB 2PHLA 4MADA 5HXSA 1J1JA 5GLZA 2QQIA 4GH4B 2V5CA 2J47A 1RINA 1PVC3 2W1WA 3T09A 3O1RA 4FPJA 1EPZA 3ACHA 1W8WA 4IV3A 5C8CA 2PAKA 2J1SA 2CY6A 3AL5A 1QJY2 4RR3B 4AQYT 2AXDS 3WHUA 3PU8A 3O1OA 2X66A 2G0UA 1NEKA 4ILAA 3S5QA 3B9IA 4EN0A 1XNQT 1LRHA 1HJFA 1WD4A 3DPRB 3NJZA 4JKMA 4PJYA 4QU2A 2E63A 4Z91A 3HQXA 4ASMB 2R6GF 3VDDB 2CXDA 1XNTA 4LHNA 2CEAA 3WF1A 1FPN1 3KVAA 1LHNA 2ZHMA 3QK6A 4L2NA 1EV13 2BBAA 1RUH3 2VBPA 3TLTA 4JAAA 4O61A 4QKFA 5LGNB 3WF3A 4XF3A 1DQ2A 3IA3A 4JYAT 1VP6A 2NMNA 1ZX5A 3JC6C 2R061 2Y6KA 3CJIB 2HN1A 3E5XA 5DJQC 3WY6A 2IXIA 4LF6T 5H9QA 5BNPA 4YLHA 4O4HE 5HCMA 2C0ZA 2V4VA 1VBD1 4K40A 3SNMA 3VZOA 3VD7A 1I9RA 1RUE2 1S2BA 1HXS3 2J1VA 4A7KA 1KGYA 1E2AA 5AQTB 5F1RA 5JOYA 3PUSA 1QDCA 1V9U3 2YV8A 4JHTA 2VVDA 2DCFA 1GP5A 4ZPIA 3WNOA 4KUMB 4FFIA 3BUCA 5A3WA 2JE9A 4Q1RA 2R49A 2YN6A 3FZHB 1IBMT 3I2HA 2WZPP 1CR7A 1T72A 1UURA 3BTAA 1K12A 3KWVA 2V26A 2WDVA 3OF1A 3H8OA 4Q4V1 2WNUB 1EZ3A 2ODVA 5L4HA 3LEGA 4RQPA 2VQET 3WG2A 3H3LA 1HLCA 5F3IA 5AFEA 2WMOA 2NPIA 1MS9A 5T5LA 3WP4A 2Q8OA 5C7GA 5HV0A 2AR6A 3LK2B 2EIDA 2Q8CA 2KWIB 1OKQA 1YJLA 4NIIA 5AQVB 2XKPA 4OI1A 1YI9A 3IEEA 2W1QA 3AXEA 3CU7A 3FLPA 3IMMA 3RIUA 4D7SA 3AA7B 4IGUA 4YVWC 1UCXA 2WZR1 1RMU2 4DS0A 4EROA 2PLV1 4MXWB 4Q29A 2DVGA 3GGLA 4LEJA 3VKOA 5CADA 3WF2A 2QDNA 5FL0A 4A56A 4CEYB 4O65A 2A2FX 4IV1B 3I3DA 1MS5A 2DFBA 2UWAA 2OYZA 3DKWA 3ZKRA 3Q9OA 4X1YE 4JI5T 1YXWA 3VHOA 5JAXA 1X9PA 3VKFC 3AEDA 1JYNA 2WN2A 2A3XA 3POSA 2Z69A 4QQPA 3BIWE 3TKLB 2VQ0A 1RUD1 4U74A 2ZGTA 1LJ7A 4K1ZA 4TXWA 4O7XA 4YZ4A 4CDWB 4ZI2D 4CCMA 3HL6A 2CHNA 4L8QA 3GZAA 2PMWB 2W47A 4V1PA 1RUE3 5A32B 1GP4A 3AECA 4INDA 5K7PA 1WLDA 3ZN5A 1MQTB 4LK6A 3MZHA 1J5ET 1RJ7A 2RDNA 5IJRA 3LJCA 3M70A 3WUDA 4CU7A 3A5XA 4K8FA 4KG0A 3VKGA 4AAXA 2L9QA 5HXCA 3KSCA 1N1YA 3HBKA 3OUHA 1YC61 4BPZA 3K4AA 1ZZCA 1IQDC 5L7OC 4LOSA 1CN1A 3OB8A 1EV12 3VDBA 1JZ2A 4ZZ5A 4PT6A 1W9YA 5A3TA 5JDBA 3GDBA 4H7MA 1VCTA 5FYZA 4EWEA 3MF9A 2WAOA 3MW2A 2GNTA 4H9RC 2VUAA 3Q8FA 4JEUB 4I09A 2Q8EA 1KEYA 2BNNA 4JGYC 4XBLA 1PZ7A 3BQIA 4MGSA 4XYXA 2A72A 2BDEA 1TMF2 2JDUA 4MXWA 4HL0A 4AFMA 2J22A 5J98B 1QJY3 1JHJA 5F5AA 2KNDA 2ZGNA 1AF9A 4EGWA 1GZWA 3K4ZA 2VBDA 2RM22 3INAA 2Y6JA 2LM3A 1H1IA 5D2AA 4BA6A 3PVBB 5LCWL 3D4KA 3WNLA 4QXBB 4TNVA 1XPWA 5KR7A 2PHUA 2NZ9A 4D8MA 3NNFA 3RVHA 2X0YA 2JD4A 3MFCA 4M3CA 2WM9A 1RTVA 4DUZT 5FZ0A 3AVRA 3I0OA 4DR4T 2I45A 3MI8A 5APAA 3VUOA 4Y1XA 3AKPA 5F39A 5F5QA 2AUYA 4PNIA 1MEC3 1GZWB 1HV0A 1YQ8A 3NRUA 3AX4A 5BNNA 2Q9QB 5LATA 2VASA 2HWE1 5GZDA 3G06A 3KINB 4JKLA 4OK0A 1VRH1 5LRRA 3VHRA 5DG2A 3VBFC 1RUH1 2GAUA 4XETA 3O12A 2DVDA 5FPAA 2V1DB 4Q4V3 4DXZA 1UGOA 1G9CA 2VMDA 3RC3A 3LBXB 2BOJA 5FZIA 2D3PA 1SLTA 3E5QA 3SCFA 2WNVB 3EI0A 4FFGA 4E2GA 3HKDE 1ZEEA 4IE6A 4KMCA 1CAUB 5D8AB 1ZZ8A 5FPBA 1YQ4A 3C4WA 4FQZA 4GQ7A 2JJ9A 1U5YA 1JHNA 2QDRA 4JX0A 2VMHA 2J1AA 3JXSA 2E8IA 4KNCA 4CEWC 1ACCA 1XNAA 2VE1A 4HG6B 5FQ0A 2YBSA 2DWGA 1AR63 3M7AA 4AI8A 4BWOA 4GYRA 4CI2B 1NA1A 3USSA 4E4ZA 1O4ZA 2HH7A 1S0CA 2DI4A 2RS12 1BBT3 1OH4A 3W20A 2ATFA 4B4PA 4AHZA 4AI6A 3VBOC 4GJZA 1NENA 3VGIA 2R1BA 4UT5A 4H7LA 4XZUG 3AAEB 4CQIA 5IK8A 1HFAA 1ZRRA 3BB6A 4PK4A 1AL22 5FZ8A 2BVLA 2VKJA 1OT5A 3C2UA 4OFZA 1HRI2 1HX6A 3EBRA 1OUSA 3I59B 2DU0A 4YRDA 3GMIA 3OY8A
chains in the Genus database with same CATH topology
5F32A 3K3NA 3ZEFB 4KP3C 2HPJA 2CXFA 5L2LA 3MKDA 3N9NA 4EYUA 3H37A 3EUHA 2X51A 3Q5XA 5DABA 2X9WA 3HKBE 2Q8DA 1MMAA 2V7IA 2XTLA 3WAJA 4UF0B 5FXWA 2LT3A 3C4ZA 2DWKA 5FMNA 4H63H 2KINB 3P7IA 4HN9A 4X1IE 1MIVA 2KXPB 2WMNA 5LOVE 3VKHA 2B1EA 3ZYLA 2VKOA 2OS2A 5IWFA 3AA1B 5FY4A 2D0TA 5JDHA 2XAHB 3PUQA 3ZJ1A 4LIUA 3RC8A 4EIWA 4P09A 3NZQA 3RYFE 5IVCA 4CI3B 2LSYA 3ZCJA 5EK2A 2H7VC 2LOPA 2V7MA 3O1IA 1Z0PA 2JPFA 2XAFB 5JDLA 4QXHA 5JR9C 4CCOA 3ANWA 2W0GA 5FP3A 1FMWA 4YHJA 2VKDA 4N78D 5FZOB 2XUEA 5JRCA 3CMLA 3KV9A 4G63A 5JH7E 3N9PA 5CB4E 1S35A 4TN7B 5FPVA 2X9HA 1HTJF 4TUYE 4ISSA 3LK42 4K0UA 5FY1A 5K4LA 5F3CA 5FZCA 4MFRA 4AQFA 4CCKA 5EK4A 3GWHA 4BA9A 3MXZA 4L9IA 4MALA 1O3XA 1WYCA 3LFMA 5JQGE 4V2WA 2MOZA 3ETVA 3UULA 3BQKA 3ZN1B 2X68A 2CWOA 1IJ6A 1YW0A 2CLYB 4AQFC 5LY2A 5JDGA 4YJ3E 2UXXB 5LBQB 3CQXC 4URAA 2LHNA 5FYSA 4D6QA 4ASKA 5C8YE 2DNXA 1NAFA 2LSKA 3F31A 4P0BA 3O1JA 2JQQA 4AKLA 3D0TA 4PFOA 3E0ZA 5F37A 5FZGA 3I9WA 2LSJA 3AAIA 4M1PA 4TX5A 4CCJA 2C5IT 4OYKA 2ZM0A 4UIGA 3RRCA 4LITA 3UYJA 5A1FA 3J9X1 2WSSV 5IW0A 5JDMA 4O4LE 4C8DA 2WWUA 3IF8B 4NUBA 5JDFA 2EHOA 5LA6E 5LJNA 5FBJA 2XAGB 4UVAB 3PTRB 5FV3A 3M65A 3CX6B 3AAAB 1FIOA 4Y4RA 2H3RA 3ZYKA 4ZI7E 5H6RB 1KK7A 3OPWA 5FP8A 5FY0A 3SRZA 5FYHA 1HF8A 1V9DA 1VRBA 5LWBA 2M67A 2C0SA 2Y8DA 3OBVE 5L3BB 4AXPA 4IGOA 5HWYA 3C51A 3QC9A 4UF0A 5FZFA 2RP4A 4O2BE 2L8KA 2XQYA 5LNKA 4HTEA 5FYMA 2XHEB 2ACXA 2LEHA 5FP7A 3S4UA 2NWBA 4GYSA 1G73A 3GA8A 1WR6A 3CQCB 5A7NA 4CXWA 3DXUA 3DP7A 4BAYB 5FP4A 2BVMA 3ZMTB 3U4SA 4QXCA 5A80A 4QX7B 4BU2A 3CVRA 2PBIA 5FJKA 2EHOD 2D0UA 3NJYA 2LHRA 5FY9A 2IAKA 5ANQA 4H63V 5FYVA 1LVKA 1IZNB 4BISA 1HCIA 1D1AA 2LSIA 2N9DA 4GIWA 4WW0A 4CZZB 1QUUA 3OJAA 4I55E 3UUNA 1MNEA 2W62A 5LYJE 5FY5A 4G2AA 3RH3A 3RYHE 3FBLA 3R84B 1KNZA 2OQ6A 3N9OA 4HFVA 3I9YA 1VOMA 3HKEE 2L3LA 2RA1A 3UUXB 2XXZA 5FWJA 4MBQA 3GN5A 2ZM2A 3UTKA 1D0YA 3MA9A 5KMGP 3BQLA 3HR0A 3WAKA 4C90A 5IVYA 2X0LB 4TV9E 4CCLA 4XDOA 5LHGB 3PU3A 4QKNA 5FZDA 4O4JE 4C91A 3PDQA 2W61A 4L0RA 3FXDB 4DIQA 5LG4A 2IC6A 2CMRA 3MACA 2IC9A 4ISTA 3DXTA 2KZ7B 5FY8A 3N9MA 3EDUA 2HPLA 4DBRA 5FYBA 5JREA 5A7SA 2CWYA 5FWEA 2YBKA 4BJNA 3QUJA 2KT9A 2KLQA 2J1DG 3KBUA 5FXZA 5FYTA 3KV5A 1D1CA 4PK5A 1HG5A 2X9YA 3CX8B 3RYCE 5FNVE 5ISLA 5FZ6A 3CX7B 4WNKA 5FZMA 4PJJA 2QA7A 3T8OA 3EDVA 5IVJA 4D6SA 3N5LA 4IE5A 1IJ5A 5FZ3A 2PG8A 3ZC0A 4GAZA 4LIVA 1X79A 2BZBA 3LBXA 5FXXA 3OPTA 4IDZA 5F2SA 4ZS3A 4DMVA 2K9AA 4GOUA 3N2OA 3ZJ2A 3MJXA 5L3CB 5FZBA 3F2EA 4FI5A 2W00A 3LG7A 2YEVC 3IHRA 3U3IA 3VU7H 5F2WA 1QSDA 2X67A 2D5UA 4QXHB 4ANJA 4HE8A 1OXZA 2IW5B 2ES0A 5F3JA 4HEAA 3AVSA 5IYZE 1ZV4X 3LD8A 1UX5A 3OKQA 4DBQA 3J7Yq 4UV9B 4ZS2A 3ZN0B 2NW7A 4L5GA 2XAJB 1UCUA 3AB3B 5BMVE 2LOSA 5ADXL 1YKEB 3NRXA 1MMNA 2CXLA 4OYJA 3B57A 5L3FB 5FZOA 3Q2MA 1ZKEA 1LVFA 3ZPOA 4QX7A 1WYBA 5KX5E 4OHFA 2UXNB 4PAGA 4UXNB 4P0AA 2ODUA 2D2SA 2YK0A 1D0XA 2C5JA 4HGAA 4JLEA 4QX8B 2K48A 3MZKB 4WBOA 2CE7A 5M4YA 5JVDE 5FZAA 5LY1A 1BR2A 5F5IA 4H9QC 3KVBA 3KBTA 3C64A 4V2VA 2NTXA 3LK3B 1WLXA 2NTYA 5A1LA 5IVBA 4UEMA 5LW9A 3V5UA 3PUAA 3MK7C 4O8SA 3CKDA 4H9SE 3KV6A 4NUVA 5LBMA 5KDMC 2JRKA 3RX6A 3N9LA 1FEWA 3ZMUB 1U5PA 3EVYA 2NW8A 5FYIA 2YU2A 4ZHQE 5FYUA 4GK0E 5FZEA 4D6RA 2C5KT 2PXJA 4CSWA 5A7WB 2EHOC 3PE0A 5JDNA 1HX8A 2PJQA 5GONE 4JEHB 4EZHA 2XASB 5IVFA 3ZC1A 5A3NA 3K3OA 3ANWB 3K3QC 2Z6EA 4IIJE 5HXRA 3RYIE 5LGUB 2GP3A 1NWMX 4UVCB 1H7CA 2WBLA 1SA0E 2GK9A 5A7QA 3JC6D 4MLKA 3UT5E 5E6HA 4LXLA 2Q9QD 4V1Av 4E7SA 5FY7A 4EAHA 2Q9QA 2LJLA 4DO0A 3O9XA 1T98A 1HS7A 3SS1A 2DHRA 4Y33A 5HYAA 3UFEA 4AI9A 4EYYR 2VD7A 1ZHCA 3UUMA 4EZ4A 4F6RC 4FJOA 2I59A 5EZYE 5J1GA 3L09A 1LKXA 4I4TE 2V7KA 4PW8A 3U78A 4X20E 2VB6A 2W63A 5FUNA 4BXFA 3E22E 4DNDA 2E9XA 2ZLYA 5F8PA 2N1GA 3P8CD 3L3PA 4UVBB 2WWJA 5CEHA 4PJMA 1B7TA 2XAQB 2Y48B 3FB2A 5LGTB 4H9PC 4H9OC 3O4XE 4PK6A 3PUGA 3PDYA 2LE8A 3KFWX 3DJBA 4QXCB 3LDBA 3HI2A 5F5CA 4XDPA 4CCNA 5HXSA 4XZCA 3RPUA 4QWNB 3CQGB 5J2TE 2KMFA 4AKRB 3AL5A 4AKHA 5FZ7A 4I50E 2V7LA 4XBFB 1IAPA 3PU8A 5LHHB 5FJHA 4ZI3D 2X66A 2G0UA 2YPDA 5FYCA 3O1HA 2OT7A 4Z8XA 4GD4A 1G8XA 3N2KE 4O4IE 4ZI2C 1HG2A 4IE7A 3NZPA 2CXDA 1SHZC 2CEAA 2CLYC 4CXYA 3KVAA 2N2NA 3QK6A 2CA5A 2P9BA 4MHCA 4QWNA 1OWAA 5LGNB 5F3EA 4U72A 4E4HA 1U4QA 3JC6C 1BR1A 5LCYA 4YFSA 5DJQC 3ETUA 1MMGA 2QGSA 4YLHA 4QX8A 3ESLA 2GP5A 4O4HE 2SPCA 2ZM8A 2OQ7A 5HXHA 2Q8CA 5FXVA 4EXTA 3PUSA 1MMDA 2NP9A 3ZMZB 4AQGA 2DCFA 4KUMB 5FYYA 1MIYA 5LP6E 1BR0A 5A3WA 5LJMA 5L3EB 1WRDA 1US7B 2OA5A 2V26A 2E9XB 1EZ3A 2ODVA 3BK9A 1Y64B 5JDQA 5J2UE 4GJYA 5L3GB 1E1HB 2WMOA 4QU1A 2K24A 4H9NC 5F3IA 5FZ9A 1D1BA