4DO0A

Crystal structure of human phf8 in complex with daminozide
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
363
structure length
363
Chain Sequence
b'VKTGSPTFVRELRSRTFDSSDEVILKPTGNQLTVEFLEENSFSVPILVLKKDGLGMTLPSPSFTVRDVEHYVGSDKEIDVIDVTRQADCKMKLGDFVKYYYSGKREKVLNVISLEFSDTRLSNLVETPKIVRKLSWVENLWPEECVFERPNVQKYCLMSVRDSYTDFHIDFGGTSVWYHVLKGEKIFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVDKCYKCSVKQGQTLFIPTGWIHAVLTPVDCLAFGGNFLHSLNIEMQLKAYEIEKRLSTADLFRFPNFETICWYVGKHILDIFRGLRENRRHPASYLVHGGKALNLAFRAWTRKEALPDHEDEIPETVRTVQLIKDLAREIRLVED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone lysine demethylase PHF8
source organism Homo sapiens
molecule tags Metal binding protein
total genus 103
structure length 363
sequence length 363
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2012-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4do0A02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4do0A01
2XMLA 5IVYA 5FUPA 4IGQA 2W2IA 4IGPA 5F2SA 5FZBA 3PUQA 5FZ9A 4EZ4A 5F5CA 4CCJA 5FY5A 5FZHA 5FY8A 5F3CA 2Q8DA 5FY9A 3KV4A 4QXHA 5F3IA 5IWFA 2WWUA 5FY7A 4E4HA 2GP5A 3KV6A 5E6HA 5F39A 3AVSA 5FP4A 4V2WA 3ZLIA 5FZLA 5KR7A 5FY0A 3PUAA 2P5BA 5ISLA 4LXLA 5FJHA 4EZHA 5F2WA 4CSWA 3U78A 3AL6A 5FPLA 3LDBA 5FYSA 5IW0A 4CUGA 5FZ7A 3K3OA 4QX7A 5FJKA 4D6QA 3PU3A 5FP9A 5FZ8A 3KVAA 2OT7A 5FYBA 5IVBA 5IVVA 2XXZA 4QX8A 5F37A 5A7WA 4D6SA 3AL5A 2OQ7A 4Y33A 5FBJA 5FPBA 5A7WB 5F3EA 4D6RA 5FZGA 4HONA 3LD8A 5ANQA 2XUEA 5A1LA 3PDQA 2YU2A 5FYIA 3PUSA 5A80A 5IVJA 5A7QA 5FZIA 5LY1A 4QXBA 4ASKA 4DIQA 5K4LA 4TN7A 5FWEA 5A7PA 5FP3A 4GAZA 4IGOA 3UYJA 3OPWA 5FYZA 4GJZA 4LIVA 2YU1A 5FZAA 3K3NA 3RVHA 3NJYA 5FWJA 4Y3OA 5FP8A 3ZPOA 4AAPA 4BISA 2YBPA 2XDVA 5CEHA 2YBSA 4UF0A 5IVCA 5FYTA 4QXCA 4GD4A 5A3WA 4UF0B 3OPTA 4CCKA 5FZ1A 4LIUA 5FZOA 4GJYA 5A3NA 5FPAA 5FZ0A 3PTRB 3N9OA 5LWBA 5FZ3A 2OX0A 4C8DA 4QWNA 5FZOB 2OS2A 4CCLA 5FZ4A 3N9LA 5FZEA 2Q8EA 3DXUA 4XDPA 5FY4A 5A7SA 5A3PA 5LW9A 5LY2A 5FZMA 2PXJA 2WWJA 4CCMA 2YPDA 5IVFA 4BXFA 3PURA 3AVRA 5FYCA 2VD7A 3KV9A 5FZKA 5A7OA 5F5IA 5FUNA 5FXZA 5FV3A 3DXTA 5FYUA 4HOOA 4XDOA 3N9MA 4Y4RA 5FY1A 5FXWA 5A7NA 4CCNA 5F3GA 4DO0A 2YBKA 3K2OA 5FYVA 4V2VA 4EYUA 4URAA 3KV5A 4AI9A 5FZ6A 5F32A 4BU2A 3KVBA 3PU8A 5FYHA 5FZDA 3N9NA 4NUBA 5FYYA 2Q8CA 5FZFA 4LITA 4QU1A 5FYMA 3N9QA 5FXVA 5A3TA 5IVEA 1VRBA 5FPVA 5F5AA 5A1FA 3U4SA 2OQ6A 4CCOA 5FPUA 5FXXA 5FZCA 5FP7A 3N9PA 2GP3A
chains in the Genus database with same CATH superfamily
2WU2A 1YQ3A 1UPSA 3AE1A 4RN5A 3HOBA 3O5SA 3EQEA 5KXDA 2BDRA 3VKFC 3HN3A 5KXEA 1NCRA 3Q9OA 1UY4A 2LM9A 5KXBA 5CYYA 2VL4A 1WFDA 4U2YA 3N7LA 1NA1C 5A7QA 3ZYFA 3OJBA 1DBNA 5AQJB 2W00A 4DV1T 3JD71 1DGWA 3LA2A 3NWKA 1ULEA 3ZX7A 4HPKA 3MW3A 4XURA 4UFIA 3ZYMA 2J1DG 1OMIA 3ORJA 4N53B 2LRPA 2PFVA 4LHKA 2XQ8A 2B8MA 1IBLT 5CADA 3NRYA 1E5IA 2XSBA 3VKHA 1FPN3 2XQ7A 2Y6LA 1KITA 1FX5A 3P4RA 1MS4A 2W08A 3AXEA 4TTGA 5HXRA 3OD0A 3E5QA 1QNYA 2XLGA 4Q0PA 1U4QA 1F31A 4R9DA 4XUQA 5FREA 4LBQA 3N2OA 2ES0A 2C5JA 3WX5A 3BQIA 1UXXX 1LKXA 1R092 1CAVB 3O9XA 3J7MA 2WO2A 4HSJA 3I59B 1RUH3 2X53S 5EP9A 3B5LB 5LA9A 2XM2A 3WNMA 1YQCA 5ANQA 3FHIB 4LLFA 4XFFA 2ZLYA 2XJQA 1VMJA 3F2EA 1RUG3 3MK7C 1PO12 3NSTA 1UY1A 3ZXLA 4PI0A 2OW4A 4IT4A 2K9AA 2VQFT 5HPOA 4JLEA 3LQCA 3RRDA 1ZA4A 4RGAA 1H4HA 3FXDB 1JZ3A 1HJFA 3AK0A 4YJ3E 3J8F3 3V0AB 5FOBB 1QIQA 1BJQA 2OYZA 1LHNA 5T5JA 2FD8A 2OIIA 2R1DA 1OKQA 4Q0QA 3EHZA 1EZ3A 4S2HA 5IK4A 4FPYA 2EXHA 2IXKA 3E1F1 3MUY1 3HBKA 3LE0A 1JH5A 4YVWC 3H3AA 1D4VB 1S0FA 5DJQC 2X66A 4E4ZA 4HFIA 2D40A 4XF1A 1UIKA 3S4UA 1C8NA 5JTGA 1SPPA 3VD4A 3WOGA 4ZU7A 5JDMA 3AB0A 4R9BA 1FEWA 1E2AA 1F35A 4HANA 3ST7A 3M3OA 2Y6FA 4AKRB 3KVAA 5AQQB 2OT7A 1WD3A 4N90A 2C9KA 3AKSA 3P6BA 3GCWA 4GWJA 3AZVA 4JKKA 2LHRA 1VPHA 2D6KA 5LYJE 4NVPA 1PGW2 5DAXA 2XDVA 2YPJA 3I2JA 3DL3A 2WZHA 3ACLA 2R073 3WHTA 3PTRB 3TNQA 5C5TA 2FMYA 3LK3B 3JQXA 3AE7A 2ENRA 2JG8A 1QQP1 1VCTA 1W2UA 2VBBA 3RNSA 2AENA 1RUE2 3RF1A 2P6CA 4WBNE 4M01A 4CP2A 2YUEA 1KFYA 3RS6A 4FFGA 1GNZA 4CCOA 2L3LA 4RS5C 1B7TA 4FI9A 4N43A 1J3RA 4F3JA 4WW0A 3H7YA 1AXYA 2A5ZA 3ZC0A 2XWBB 4BDVB 4GYRA 2DURA 3MV11 3LDKA 2WAUA 2I45A 5T50A 5ISLA 4LTAA 1GOHA 1LHWA 1NY71 1RUI2 3LBXB 3I2HA 3QUJA 3N7KA 3I2OA 5FPBA 1T6BX 1LU1A 1HS7A 3TAYA 4TN7A 4DPNA 5JREA 4QDQA 2MTQA 5F8PA 3LK2B 2QYWA 2XONA 3JC6D 4SLIA 3N9OA 2AYHA 1LEDA 1OLMA 4FP2A 5GLVA 4CDUB 3ABVA 2W62A 3D8CA 3INAA 2X0YA 3H8XA 5JR2A 5K8SA 1Y9QA 1UMIA 4B3NA 1N1SA 1PMIA 3OF1A 1STMA 4ZI2D 4A7YA 1UL9A 4IV1A 3WDTA 3ANWB 1RINA 5FV3A 2DTWA 3IBMA 2V73A 3KF3A 4JDMA 3FN9A 3HQRA 2PQQA 4XF9A 4U36A 5M0TA 3ZDVA 1GSLA 5CA6A 1H1AA 4NWWA 1X50A 3ESLA 4BXSV 1CAWA 4O9GA 3FLTA 3R6NA 4X8NA 1I6XA 2A3YA 3A4UA 4PW8A 2J42A 1K5MA 3ETQA 2BNOA 1SG3A 1W9YA 2P34A 2I6HA 2ODUA 2DCFA 1NXD1 4HONA 2Z42A 1W0NA 2LROA 4JYAT 5FYIA 3ZFEB 4TX5A 5CB7A 5IK7A 2XOMA 2QCSB 3U10A 3AZWA 2Y34A 5J0ZA 2FJAA 5KC6A 3PIJA 4BISA 3PVNA 4NHXA 2HHHT 5JPMB 4LO8A 1GZCA 5A6XA 2BOJA 3LKJA 3AB3B 1U5XA 5HEOA 3AMPA 1QWRA 1S0CA 5I8TA 3NL1A 2DU1A 4YSYA 3KDSE 4WVVA 5FUNA 2EIBA 2PG8A 1O91A 3UESA 3UQ4A 1H8TA 3VHNA 1BLZA 5AC92 3N9PA 5HCBA 1PX3A 4IGQA 1FOD3 1J1TA 3DUIA 3ON7A 2HLEA 5FY5A 1PO21 1O4TA 3CIRA 1RUF2 1TNRA 4W6XA 1OQ1A 1D4M1 3I0QA 4QPGC 4KI5M 2WDQA 1VRH3 1WCDJ 1FJGT 4JI1T 4E9KA 3AL6A 5LRSA 4KBBA 1ZBE2 4CEWA 1N36T 3TEWA 2ZMLA 2M67A 2BKNA 2IAKA 1MACA 5CU1A 3ZFGB 2CMRA 1HRV1 2JPFA 2W0GA 5JDBA 4RR3B 3ZR5A 2FDIA 3ZPOA 2C9AA 1CX1A 2QQLA 3SKJE 3UFGA 3CO2A 4LFBT 5D8AB 1ZRFA 2A72A 4LK6A 4XFCA 2YDQA 3RPUA 2X0HA 2WMNA 2RS52 1POV0 2XAGB 1BQPA 4N9IA 3Q8AA 4R4XA 2VTXJ 3I54A 3K2OA 5C8CB 4A7ZA 4AI9A 5LK7B 2VU9A 5C3QA 3ZFFB 1A6CA 2IXJA 1Y4WA 2HH7A 4UIGA 3USUA 3RYRA 2I0MA 5EFUA 1ZYBA 4QX0A 2PLV1 3AE2A 5LOVE 4XILA 3OYWA 3ZYKA 3GCXA 4GQ7A 1BR4A 3CVRA 5KR7A 3GHMA 4NMIA 3F2ZA 4GXLA 1WLTA 3DKWA 1BMV2 2JIGA 3SCHA 2DBIA 2WU5A 4NHYA 1GNYA 2DVDA 4P1NA 4JI0T 2ES3A 1O3RA 3DJBA 3AAAB 2PQSA 2B9VA 4HEAA 1DQ6A 2ZHMA 3UUMA 3A22A 3V0BA 5LMNT 2XPJA 3P5BA 5A32B 3FZLB 1MS5A 2VMCA 2UUBT 4MUVA 4Y4RA 2WAAA 4AFMA 2VUJA 2YKSA 1OHFA 3B01A 4IGUA 1W2NA 2RMU1 2FCUA 2VB6A 2UU9T 2CYFA 4R9CA 1IPSA 1SBFA 2XLFA 3LOBA 3QBQA 2JDZA 3NJZA 3WD5A 1F15A 2ZGMA 3BK9A 2N2NA 1C5HA 1AF9A 1QH6A 4CVUA 2KLQA 4K20A 4DNDA 1FXZA 1DIWA 2L9LA 4AEJA 5LCYA 4F7ZA 5LA1A 3NNJA 4META 4LQRA 3KHCA 3P4PA 4R9AA 2BBVA 5FJKA 1WCQA 5L7OA 4DR2T 4QAWA 2FCTA 4QM8A 4AQSA 1RJ8A 5L9BA 4W6YA 1W9TA 3NBXX 2A70A 3ZJ1A 2HWF3 2XVGA 4Q4W2 5EK3A 1WCUA 4GWNA 5CFCC 4BQYA 1QDCA 1QJFA 3I9YA 1PZ8A 2XBO1 4P0AA 2V26A 1VBB3 3LA7A 4Y20B 2WDRA 1UX7A 2JB8A 3WDYA 3IN9A 4YM3A 5IATA 3I3MA 4ES8A 3PUVF 1F4AA 4LHLA 2RR11 4Q4X1 2OZJA 1AR83 5JOWA 3M70A 3CJIC 2V4VA 3T1MA 4RL7A 4AW7A 4DRVA 3IAQA 3M2MA 4BOWA 1QJX1 5C8WA 5AQOB 4OHFA 1GZWB 2QQKA 4DXTA 1IBMT 1LGBA 1X36A 3C8XA 5F39A 2NR4A 4V2WA 3THTA 2P5BA 5IFPA 1OSGA 5L19A 4YW1A 1AXKA 4CUGA 4KMCA 2ZGOA 4XIOA 3WR0A 3VKMA 5GZGA 4HFVA 4QX7B 4QH1A 3WLUA 1SZBA 2V7JA 1UOBA 2VUAA 3B7MA 4HN0A 2BBHA 5J2TE 1QLBA 3WQBA 3OPWA 1VB4A 1DQ0A 1G9AA 4QQOA 5IVCA 4MLOA 1U5ZA 1XB9A 2VGDA 4HN9A 4U7IA 3E97A 1D0ZA 4QKNA 3D3AA 5FPAA 4N53A 5IHRA 4AI0A 1MQTB 4NUUA 4X66T 2VCAA 1KJRA 2ET7A 4I3GA 5FKBA 2W63A 1C8M3 4MHRA 3RZJA 4DO0A 4LUKA 1OLRA 5JXGA 4WM8C 2WSSV 1V6OA 4XYXA 2RHPA 4BK4A 3SWHA 1XNKA 2AXDS 1AYM1 5HBAA 4O4JE 5BV6A 3J26N 3LFIA 2KSRA 5FY7A 1OQDA 4PDWC 1CAVA 4CU8A 3AE3A 5EXOA 4AHYA 4QDRA 2IUBA 3H3ZA 4YM0A 4XJWA 3I59A 4BWOA 2WZEA 3JADA 2H89A 5JR9C 4W6WA 3FBLA 5GM0A 4AF9A 5FUIA 3RKGA 4ISQA 1W0AA 3AEDA 3BTAA 2YU2A 1IPKA 3N7MA 1H6XA 3AXJB 5DUUA 2VZPA 1U5PA 4Q4Y2 3OPZA 4M0NA 1TNFA 4YFSA 3M7AA 5JIAA 1LOEA 1X9BA 2W9XA 3V0AA 1ZBA1 5LJMA 2HYXA 3NJXA 3NAPC 4L5GA 1GU3A 2IXHA 2CLYB 3J7NA 4IL7A 3WCRA 3PURA 2QZ3A 3I8TA 5FXZA 2IZWA 4FPGA 4YW7A 3RYKA 5LK5A 1GANA 1XE7A 5DAVA 4ET7A 5BNOC 1U12A 4BM8A 5C3SA 3PJQA 2WQ8A 5EJZB 1W05A 2WWSA 2XQYA 5A1AA 5HAXA 2KINB 4CCJA 3BUCA 5DQ0A 3AC0A 4L8QA 3EDVA 5L36A 4BCUA 3Q5WA 1PIV1 4M0HA 3LDBA 1QXRA 3AA0B 4DR5T 3B9CA 1NA1B 1V6IA 2IFRA 1NWMX 2XQ9A 2O8QA 3WW4A 4ZXKA 4OI1A 1J59A 2J47A 1KNZA 5FMOL 2W87A 5AQIB 4Y1VA 3RH3A 2NPIA 2WN2A 5KHIA 3UU3A 2K2SA 4YTPA 4CCKA 4D7YA 5A3NA 3JU9A 3BU0A 3ETVA 3RLFF 2AR6A 4MLKA 4PK5A 4UXAA 5JXJA 2BWCA 2WFF1 3ZYIB 1KK7A 2BZDA 5DUVA 5CB4E 1W90A 2IFWA 2XM1A 2XWJB 5A1LA 3BQKA 1B35B 4DVDA 1JYTA 3CJXA 4YG3A 5KHKA 4MADA 1W9WA 1QNWA 3AA7B 5FMNA 2EXKA 4XTPA 4Q4V2 1WW4A 5SV5A 3PUYF 1XE0A 4PI2A 5ANNA 4LFAT 1CX4A 2WB5A 3JBG2 3FFZA 4CDXC 3OGJA 1UZYA 2Y64A 3ZR6A 1F2NA 2UY9A 3O12A 3KB5A 2XQ3A 3LBXA 2FDKA 1DU3D 4XF4A 1LVKA 4FI5A 4HVRA 5FZGA 4KGGA 2EAKA 3WG3A 3CU7A 3V5UA 1OI6A 3WW2A 1NZCA 1R093 1UK5A 5FYTA 5ABEA 2CTVA 4WZXA 2RJ2A 4W4ZA 4G63A 4A45A 2XVKA 3CK6A 4X1KE 4CDUA 4LFCT 1KEXA 1H1MA 4XABA 5GJ6A 4H9QC 4CCMA 2XASB 3ANWA 2D3PA 4BXFA 2VO5A 2RDNA 5D21A 1W6MB 2A73B 4U7YA 5DAPA 2XQ5A 1K5JA 1PO13 3KT1A 2V6XA 4P9YA 4BU2A 4YVWB 1Q5OA 4YRDA 5FMBA 1W6NB 1AYN2 1NKGA 2WM9A 5FYMA 2A1XA 1CGPA 1AJKA 4DINB 2PHLA 5AVAA 4GOUA 1ZNPA 5CBLA 3POJA 3VZLA 1GNHA 4LMKA 4UBHA 5KXJA 1OOPC 1Z7S2 5AQUB 3QCWA 1LOGA 2RDQA 1KF6A 2GDFA 1V9U2 2WQYA 4E2GA 1XNAA 3AZYA 5FP9A 4XE9A 3VZOA 4XXPA 4GMP3 3ZFEA 5D1IA 1SHWB 2X68A 3OY8B 3ES4A 3N35A 1OEDE 2UYBA 2G4IA 1S1AA 1MEC1 1UO9A 3CIHA 1EUTA 3ZEFB 1IS5A 4O7XA 3RZHA 3H1WA 3AAEB 3OBAA 2JDPA 4MXVA 4ERRA 4ZZCA 1H4GA 3HN1A 2HPJA 3J4UH 5LY2A 1SLCA 3CBNA 3O7OA 4IL4A 3GM8A 4AQFA 1S55A 5A3OA 4AI2A 2UXBT 4PIXA 3HQXA 4YGBA 3ALQA 5FVLA 4LUMA 3A0KA 4QT6A 4WBBA 3PJAJ 4RS5B 3ZMOA 3ZYHA 4QKBA 2CGNA 5DZEA 3BOWA 3AE6A 1R64A 1CJPA 1XYNA 4JDOA 2E9XD 1NAEA 2QDNA 2WRAA 2X10A 1MIWA 3LEKA 1CIYA 1WMDA 1RUE3 2XTLA 1U5YA 2B76A 4HK8A 4MGKE 4UV8B 3BPZA 5FBJA 3ZFGA 4QPYA 2D43A 4LMLA 3VBSC 3ES1A 1UURA 5AQVB 4RR3A 2DWKA 2VMGA 5LASA 2ZCWA 2YBSA 3FJSA 1XYPA 5D8AA 4CXXA 2YDEA 4GB31 1RUI3 2FDHA 5I91A 5LA2A 2XAQB 4TV8E 5C8CA 2PBIA 3ZMUB 1HQLA 4DBQA 4JI6T 3MIHA 3ZFFA 2YC2A 4LBOA 2Q8CA 3I2KA 2BJSA 5KC5A 1J5ET 5FXXA 4UW4A 4I30A 2PELA 4BLJA 3FB2A 1JW6A 4E2QA 3R05A 4BB3A 2JMKA 2ZS6B 1PM4A 1ACCA 1QOOA 3OKQA 1ZV4X 5E89A 1L3JA 3F31A 2VMHA 2WT1A 2FZ2A 1HB2A 5LEJA 5J2UE 5A80A 5IYYA 3OGVA 1XRUA 1NX9A 1CESA 3E22E 4D7TA 4EQVA 1VBD1 4GJZA 4LIVA 1SACA 5FZAA 4E8CA 3ABZA 1JNZA 2Y48B 2JXAA 5F1RA 2ZBJA 3MBWA 2CXFA 1EV11 4S2DA 1UYZA 3Q2MA 3HPNA 1ZEEA 5A32A 4Z90A 2D97A 4NJ4A 1ZHCA 1KJLA 2PTFA 2DFBA 2QQJA 2UWCA 4ZONA 3UUNA 4YHHT 5A33B 4HFHA 1W0BA 5FXWA 2RVAA 1REFA 5EV7A 3KFWX 2CM0A 3L9JT 4UVCB 1LENA 2XR4A 4GIWA 5GLWA 1Q43A 2VZSA 5J96B 5HEGA 4XPVA 4CU7A 3LB9A 5FUPA 5LRRA 5FLIA 2LHNA 4QPGB 4FPCA 1PNGA 3U0ZA 4R8HA 3MPBA 2TNFA 2WN3A 4UBGA 1N3QA 3K3QC 4EWAA 3ZN4A 1G8WA 5FR3A 3ZSLA 1JUHA 1X7NA 3FMGA 1W04A 4XAEA 1PZ9A 4AQTA 1RHI1 3AL5A 5SV8A 3ONLC 2AEYA 2D9DA 5AC93 4MYEA 3HR9A 3JD72 5JCTA 1RUD1 3MIBA 4KH9A 5F9TA 1RUF3 1YWKA 4UW6A 1OXCA 3IPVB 4BMEA 3SC7X 1JNRA 4X62T 4GULA 1AR91 4Y20A 5J36A 3AP7A 1UF2C 2E26A 4OI4A 3M1HA 2VQUA 1X8MA 4AAXA 1ZBE3 3OUIA 5C3OA 2WDBA 2CY6A 2ZXQA 3QLQA 4UFHA 2VXJA 3T4HB 1VBC1 2ZGQA 3JCFA 5LA6E 3MZKB 2P6HA 4TZ4C 1CPNA 2ADDA 1E5SA 1GZWA 2KWHA 5GLZA 2LKHA 4COUA 5C2TA 4XJAA 3LIGA 1WW7A 2D5UA 4EZ4A 4UI9L 2RS53 2X9WA 3KCXA 2BVVA 3FFQA 5GLUA 4XACA 3PE0A 3AMHA 4QX7A 3FBYA 2B5HA 2C5KT 3C4ZA 5IJRA 2BV4A 1JYWA 3OOXA 3H50A 2W5FA 4Q0VA 4HT1T 4Q2FA 2MEV1 2WQZC 5G04L 4JV5T 4DUVA 2VCCA 2FQPA 2YOEA 4Q27A 4P9IA 4QHOA 2ZX4A 5LATA 2C0ZA 5EPAA 1IOAA 3OD4A 2WZPP 2W68A 5HV4A 4COFA 2VOWA 1MQTA 2UXCT 3QH6A 3RYHE 5HXCA 4ZS3A 3AEGA 2M6IA 2W0XA 3CF6E 5IUXA 2P37A 5JSRA 3WF3A 1SLLA 3K4ZA 2XKPA 4EN7B 4A98A 3VHLA 5F3GA 2ZX0A 1PVXA 2FDGA 3WHUA 1RC6A 3ACHA 4WV8A 2XHNA 1RVF1 2FMDA 3EB7A 3ASIA 5K0UC 3I3QA 4EB6E 1S94A 1KNPA 1JN2P 5F3CA 5FY9A 1JYNA 5DXDA 2YDSA 4MOAA 3BI3A 3WINE 2VQTA 2Z4FA 3VD9A 3ELNA 3U4XA 1OPMA 3USSA 1JOJA 2ZX2A 4NHKA 5T3NA 3ITQA 4OX9T 3MLKA 2Q0AA 4CN6A 3LSDA 4F8HA 5KWRA 2EHOC 4LOTA 3AXJA 4AVBA 1ENXA 5CFCB 3VL9A 3LFMA 5K9YA 4QXBB 2Z6EA 2EXJA 3HKBE 4CI3B 1W8FA 4ZPIA 4ZI3C 3TYJA 2D3SA 4XBQA 1OUSA 3CQCB 3HA4A 5FZOB 3AYEA 3G06A 3GJAA 5J1XA 4LO6B 3PLQA 2KXLA 1HXS1 2JIWA 2GNTA 3HJRA 3CJIB 3MZHA 2QDRA 3D4KA 2CWOA 4P02B 4Q4W3 4EV0A 2CAUA 4NXNT 2VK9A 3LSEA 4URAA 1W8WA 4BMBA 5C70A 2JEMA 2UUCT 2PHXA 1M7KA 1D0GA 2BU9A 2X5IC 2CPTA 2BG9B 1FMVA 3RQUA 3VLBB 2Y6KA 1LU2A 1R1ZA 1BBT1 1RXGA 3NKZA 2XQXA 2VMDA 3MYXA 4DMIA 4L11A 1RMU1 1ZRCA 1US2A 1Z78A 5AFBA 1GUIA 1D0XA 4I0UA 4YYOA 1NY72 4HGAA 4UWDA 4PJJA 1CR7A 2P3YA 3M3IA 3Q9DA 1NA1A 2PHTA 3B69A 4N9HA 4N7UA 1LVFA 3VDDC 5EJ3A 3PUSA 4CN1A 1YI9A 2ZZQA 5JZGC 2Y6JA 1WWYA 4GKJT 4X20E 3DGTA 5BMVE 3HAGA 1ULDA 5DUWA 3WF4A 3NZQA 2Y6GA 5FZ0A 1UZWA 2JE8A 1FATA 1YO8A 4Z07A 1RIRA 5LBMA 2E7QA 4YZ3A 5J98B 4FTEA 4MV2A 1B35A 1H2MA 4ASLA 4P9WA 4WM8B 4Q0UA 4HVQA 4HKAA 1MMAA 2QQVA 3KVBA 4XQWA 1AR71 5K7PA 2WWVA 4L92A 4H55A 1LOAA 2V72A 4QKDA 4PDWB 3WNNA 3NO8A 3ZXEA 1FMWA 3VHPA 2RS31 4DY5A 3UNPA 5JR9B 4L99A 3TEYA 1T98A 5FYBA 2HH9A 3TB0A 5JDLA 4PJMA 4G2AA 2DDUA 2K46A 1UUSA 4C1XA 1Q3EA 3A5XA 3UYJA 4RQPC 1UYPA 1UIJA 3N2KE 4IDOA 4JEUB 2WS91 2EICA 3NAPB 2E9QA 4LKSA 3GWHA 1CVNA 3RPQA 4XCAA 3WF2A 4PQ9A 2AGSA 2CEAA 3THPA 2QBXA 1JUIA 2R041 1W6MA 4KU7A 5BNOB 3WZ1A 1VOMA 3NV3A 4HOOA 1O8SA 4AGVA 2D6OX 4YVWA 4XETA 1W6NA 5GALA 3E6DA 1OPOA 3TRSB 4V1Av 5FPUA 5FZCA 1PO22 5T5OA 2XMLA 1JTZX 2D7FA 1D4M2 4N78D 3T08A 4PCRA 3AEBA 1TME1 4WBOA 1YQ8A 3LDRA 2CHHA 2XJUA 5FZLA 1W8TA 4XC9A 1XNCA 4NRPA 4QDSA 4PJNA 2XLAA 2OA5A 2WSVA 2V6YB 1TVGA 4QHZA 3BB6A 2LLYA 4K3UA 4K0KT 3OPCA 1HRV2 3N36A 2VQ0A 3LF7A 3OY8A 2QVSB 1HCIA 4BJ0A 3C2UA 1WRDA 2QQNA 2HWD1 2W95A 3VR8A 4R52A 2CE7A 2BDEA 4ES9A 5A6QA 1XMQT 1WLWA 4LA2A 4ATEA 2TEPA 4HTEA 2W92A 3OSDA 2GC1A 4I2OA 2CSGA 2IWGB 4WVWA 1WLCA 4A41A 1U5IA 4V1PA 5JXHA 3ZO0B 3O1TA 4BZ4A 3T30A 2WT2A 4XZUG 3P8CD 3MICA 3VZKA 5HXSA 2HEYF 5A6ZA 1YJLA 3ZT5A 4AIUA 4RS5A 5FO8B 4BA6A 4LK7A 4BYYA 4HWDA 2FJBA 2JICA 1WLDA 4AI8A 2PLV2 2B7YA 1UX4A 4WVZA 1HRI1 2DNXA 1VLNA 1JZ6A 2DCZA 1W99A 3RKOA 3RZKA 4JKLA 3B9IA 3PUAA 5HCAA 1OC1A 3ZMNA 3AYCA 4UVAB 4AI3A 5DPNA 2MPFA 3C7OA 3GBWA 3K77A 4BH9A 4I55E 1EAH1 4D6SA 1LNSA 2JECA 5EQUA 2XUEA 4A7KA 3QB5A 1IAPA 5CKMA 5ACA1 4Q4V3 1GWKA 3ZIXA 4NHMA 3KGLA 5FYZA 1G9BA 4I3PA 1F4HA 1MS1A 4HLTA 2DL1A 3K3NA 4ORFA 1GQHA 3T2TA 3JBG3 4DEVA 4TWDA 1D1AA 5ERLA 3UK9A 2G9ZA 3UJQA 1IZNB 1WYCA 4TWTA 1ENSA 2X8KA 1NOVA 3T2PA 1R1A1 1RUJ1 2NQYA 4LMFA 1PHMA 5E88A 4ASMB 4WVMB 4MXWB 2RMU2 2RJKA 3IBPA 3LJCA 1ZX5A 5HYAA 4JKMA 1UX5A 2PHWA 3Q8BA 3PMSA 3LG7A 3HL6A 3A0NA 1YFUA 4QB6A 5TAOA 5A3TA 2VMEA 4UYBA 3U4SA 5IVYA 2E32A 1HX6A 4CP9B 3HNBM 4D0QA 2I59A 4MZUA 5FP4A 1AXZA 1WW5A 5LBEA 3AP6A 2V8SV 1UPIA 4CPBD 3MF9A 1LHOA 4TNWA 4ISRA 5F37A 4TLGA 4KWLA 3AMNA 2KMFA 1AYN3 2W91A 1YXRA 2J4GA 2WT0A 2Y6HA 2J7MA 2CCQA 1ZP0A 3GXUA 3M3EA 3N7JA 2HWE1 5J48A 1UQXA 3WNPA 2D0UA 2NP9A 4XXAA 2XBO2 3IT8A 4OK0A 4MHUA 4HKLA 2JQKA 1Z7S3 2D44A 5LGUB 1Q8QA 2R6GF 1V9U3 4GJYA 2X9HA 5CGMA 4I09A 4AQ6A 4DOUA 3SFDA 3RI9A 1JYIA 5FZMA 3RQWA 2RR12 4Q4X2 4GH4C 1W8UA 3FZHB 1Q56A 4D69A 3A23A 5A33A 1US3A 5FPXA 4RD7A 4YSXA 4DY3A 4OZOA 3GBGA 4JDNA 3PL0A 2K24A 5L3FB 1QJX2 2W52A 1NXMA 3PTYA 5EIYB 3MUZ1 2SPCA 4OFZA 2VJXA 4QPGA 2JKXA 4CUAA 4UFLA 1RUOA 4L0RA 4ZZ8A 3OBVE 2JDKA 5ABJC 1LESA 5AFUL 5EK2A 4JQTA 4GK5E 1RUNA 1I5PA 4PNIA 2VW0A 2I07B 2KNDA 5A7WB 4QMAA 4NWVA 4GAZA 1ND3C 4X1IE 1RUC1 3P50A 2YBPA 1LODA 4OI2A 3VD3A 1QHDA 2G19A 2OX0A 2XSAA 2HWB1 1N3OA 2D6MA 3RJ2X 4XAXB 3C4WA 2VMFA 5LXTE 2PXJA 1RL3A 1ULGA 5AQFB 1DCSA 4P5YA 1WMEA 3ZXDA 5HI0A 4CCNA 2QNKA 1POV1 4P9XA 3AAIA 2WFPA 1L7RA 3SS1A 3GA8A 1BEV1 5L4HA 2AH2A 4CQIA 1AYM2 5LNKA 2PA7A 1CUNA 1HX8A 2BG9E 4IREA 2H0BA 1BHGA 4EAHA 4DR4T 1VE0A 5LHIB 4FOYA 5JOZA 5L4EA 1XOYA 2HPLA 1X79A 2GP5A 3VRAA 2C26A 2EIGA 3UKTA 2E2AA 3P1IA 5FVKA 4TXWA 4X1YE 2MYSA 3GF6A 4MGSA 4ITCA 1US7B 3ACGA 2DCKA 4LOSA 3LEGA 5T54A 4YSZA 3D0SA 2KXPB 2YMZA 4LF7T 3AM2A 5CVRA 1NE4A 2BYVE 2NTYA 1AR61 2DLRA 1ZBA2 1JS9A 2E53A 4PIYA 4EE2A 1AJ3A 3HWJA 1HNZT 3UULA 2B45X 2VKOA 4FP3A 5FLHA 2E31A 1CQ9A 1CN1A 2ZM6T 2PAMA 2BBJA 2Y33A 3I3BA 5AQPB 1LKNA 3THDA 2QA7A 1BR0A 2G9GA 1XYOA 4TNVA 2ZMNA 2MPKA 2DV9A 3ZMZB 3SLIA 3HBZA 4YSFA 3GZUC 3SISA 3K4AA 3DPRB 3FHAA 3U1XA 4Z2AA 4TUYE 3LPGA 1SUMB 2A75A 1ZREA 5BYNA 1PIV2 3FXEB 2N7GA 2OZ6A 3RZLA 3T2OA 2F4LA 3IZOA 5IK8A 4QPIC 3URFA 2Y60A 5CFCA 3IEEA 1ZZ6A 5LY1A 4QXBA 3MDPA 4QHBA 1CAXB 1QJY3 2ZMAA 3MJXA 2V7MA 4E2SA 3H8OA 3E6BA 2VNGA 2B9UA 1UKRA 2X05A 1IBKT 1XDPA 1REEA 4HBNA 2X9YA 4HFDA 4UOJA 5FZOA 3GZTB 5L3GB 2WFF2 4AKIA 2OV9A 1QJU1 1W2AX 4FXKB 3K75B 1EYBA 5LA0A 5CG8A 5FY4A 1WR0A 2UWBA 4A42A 3JB8A 3CJIA 3MLLA 3JD73 3I0OA 3VD5A 2W46A 4FOVA 2BG9A 2WO3A 2CWYA 3POIA 4GKKT 4NR1A 5LBFA 3JCIA 5KMGP 1JI6A 5EYXA 4JQRA 3HKEE 2GNBA 3HKCE 4TWHA 4JI4T 4YPJA 4YLZA 2BOIA 1COV1 3TEZA 2DVAA 1ULFA 1BK0A 4YZ4A 1D1BA 2GALA 3ZYRA 1H8VA 2QVAA 3LEIA 3W5MA 2UWAA 2Q1FA 2V1DB 4FQ4A 4FPEA 4OYUA 1N47A 4NN0A 1NQJA 4KX6A 4LE4A 5JDHA 3W58A 4BIFA 1WUVA 4BQ5A 5L2LA 2ID4A 5DZFA 4ZOLE 4O2AE 1ENRA 5CFDC 5C4WC 4IEXA 3CQXC 1OURA 2IDOB 1DF0A 5L7OC 4XAAA 4BK5A 3D0TA 3HR0A 3VBRC 2WAOA 4QB2A 1FMD1 3NNGA 2W1UA 2YPDA 2BERA 3WDUA 4WM8A 1DZQA 4XDOA 4YHJA 1QJY1 3OJAA 1JOBA 3WP5A 4ARXA 1PMHX 2BWAA 4XFAA 2YK0A 3ZCJA 2QZ2A 1QXJA 2IMLA 4PQQA 4K1ZA 2Y8DA 1MMDA 4PDWA 4DFSA 2VNOA 3U07A 4JRLA 4EEBA 1JOPA 1D7PM 3KSCA 1F5JA 5JR9A 2Q30A 4CI2B 2AEZA 4FJOA 3DCQA 1QSDA 5IVVA 2C0SA 2EHOB 2ZM0A 5AQNB 2X9XA 2ARXA 4W50A 4O4IE 1OBNA 2XKOA 1NAFA 3O0XA 4E4SA 1MEC2 1C28A 3WP6A 1GQEA 2YU1A 1HN0A 3CQGB 3NAPA 3ZYLA 1WBFA 3MKDA 5DABA 3Q5XA 1LJ7A 2ZX1A 1O59A 5LBCA 3S5AA 4XDPA 3VZNA 5KHGA 5ADXL 1NE6A 5BNOA 3KBTA 4XFHA 4L9BA 4U3CA 1TG7A 4GA9A 1NCQC 2X5IB 4EOZB 1OA3A 4IEWA 3NNFA 1EPWA 1PVC1 4NUBA 2C6SA 3HT2A 3PMEA 4G9SB 4BQ3A 2OQ6A 3WY6A 1VMFA 4CP1A 5JLVA 3OG2A 1QQP3 2VZOA 1AL21 2ZOEB 1MZEA 3C64A 3O1OA 4M3CB 5IUQA 2E9XC 1YQ6A 3LIHA 2V6YA 4O4LE 2JDNA 4CDQC 5HEJA 1Y43B 4P09A 2OUJA 3VDDB 5F6LB 2EALA 3GHNA 1JHNA 1DQ5A 3I2GA 4I0BA 4Y1XA 4HL0A 1MPXA 5KX5E 1YUDA 5FK7A 1NT0A 2W39A 4XEZA 1OLME 3RMYA 2Q9QC 4CRQA 3FX3A 5HWYA 4LBNA 1YEWA 4CPBA 2CU5A 2VOVA 3AJYA 4GB32 1G9DA 2VZVA 3S30A 2V5YA 5E8AA 4XZCA 4HN1A 2BRTA 1ZOYA 1G6NA 1WR6A 4CDWC 2A3WA 4XW3A 1N1VA 3SNMA 5JOXA 3RWKX 1HB3A 5FBZA 2Q1ZB 1I9RA 2XL7A 3HEIA 4CEYC 3KQRA 3ZVXA 2KD7A 1O3TA 3VKNA 2EHOD 3UETA 4J2CA 2NMOA 1HFAA 2JQQA 2J1TA 1W3XA 4LT5A 4ZI3D 5C33A 5JI9A 4LHSA 4YG0A 2ZEWA 4C90A 4M4PA 3AEFA 1Z8UA 4KBZA 1LEMA 5H6RB 4AISA 2VQET 2RS11 3I49A 4JTOA 5T5LA 4FVVA 2ILMA 5KBFA 1VBD2 4RQPB 2VVSA 2X29A 3VD7A 2R16A 1HR0T 1W8OA 1PK6C 4NPLA 1EV12 1TMF1 1J5WA 1W2TA 3KCYA 2ZEYA 3DN7A 3OEAA 1XPWA 4JVAA 3CDZB 4WZFA 3LEMA 3IWZA 2MBGA 1V9DA 3AVRA 1XWMA 4WVMA 4MXWA 1YJKA 3DXTA 3M65A 3UU4A 4YJ2E 1GOGA 5FXVA 3MW2A 3OB8A 4D7SA 5LHGB 4KUMB 4KU8A 4CXWA 1SLTA 5FPZA 4CP9A 4MHCA 3FHNA 3O1VA 4UELA 3SKVA 4DB5A 3ROUA 2JJ6A 1IQAA 2Q8DA 2K48A 3WDVA 2ETEA 3AVSA 2JWPA 3ZLIA 4UFMA 1ZZ8A 3IIAA 3EUHA 1X8EA 1RHI2 3LWCA 1J3PA 4UW3A 4AQGA 3G7DA 5F6KA 1UZZA 2NTXA 1C4RA 4AR2A 1X9PA 1RUD2 3VBUC 2ARBA 4YW6A 2E7AA 4IIJE 1PO23 1MIYA 1UXZA 4AVAA 5JVDE 1NQDA 1D4M3 5BY5A 4X5TA 1AR92 3SFEA 4LF6T 4FPOB 4QM9A 2R061 1UMZA 4IERA 3O1UA 5JRCB 2NM1A 1YLLA 2RJLA 4ONUA 2JKBA 3QACA 5AFEA 1UZVA 4NIDA 1HRV3 2B42B 1GP5A 1VBC2 5F5WA 5A7NA 5DDJ1 4AVVA 1RITA 3L09A 2CRBA 3H3LA 4LBMA 1N33T 2CXLA 4NIGA 2BFUL 2ZJCA 3MIGA 5F3IA 3GYDA 3FL7A 3UL2A 4H63V 4YARA 2JRKA 3KMHA 4EROA 3U14A 2GH2A 4HE8A 5IW0A 4P0BA 3ZKRA 4NAMA 3D82A 5A7WA 1HLCA 3RIUC 1AZDA 4FOQA 4AFBA 2MEV2 3PDQA 4WM7C 2PLV3 1N34T 2XJRA 3WNOA 2FDFA 4KI0F 2BPA2 2FCVA 2EA7A 3R4DB 3MIEA 4BLIA 4E7ZA 2W3JA 3TLVA 4AHZA 2WS3A 1YD8G 1VBA1 2ADEA 2VW1A 2BKOA 3Q8EA 2C5DA 2J1EA 4J6GA 2IVJA 1PMJX 1SLBA 4Q4Y1 4QQPA 4JX0A 5L73A 4DV4T 5C71A 1RVF2 4RYDA 1DFQA 1XSQA 4LKFA 1RGSA 3WT3A 4AKLA 2QQWA 5L9VA 1O8PA 2Y6XA 4ZU5A 1DP0A 2XUMA 2YDRA 2W61A 5AQSB 3H3MA 3GNEA 2PYTA 3ZSEA 4HWFA 1ASJ1 2WZR1 4NE9A 1VP6A 2RMU3 2ZGLA 5CFBA 2ZMKA 3C51A 4B3TT 3T1HT 2ZAAA 5FQ0B 1PGL1 1FAYA 2WJSA 5LG3A 3DKQA 3VDCA 4P9LA 5FZIA 4O2BE 2WP9A 5ETWA 3V5SA 3K4DA 2QJVA 3NQHA 4IEVA 1ZZCA 4DXRA 5CEHA 2W1SA 5FO7B 2VCBA 4FTSA 2UXDT 2VVNA 3SH5A 2XZEA 4FPJA 4GH4B 2VVEA 3J9X1 5LCWL 1SBDA 4IV3C 4XMIA 2RV9A 2P3KA 2NOXA 3MA9A 4GMP0 1JZ4A 3H7JA 2XBO3 3ZSTA 4H7LA 4B4PA 2EAAA 1BBT2 3PHMA 5GZDA 2LOPA 5D8AC 3DPRA 5FP7A 1RMU2 1WD4A 3A7MA 2B39A 2AACA 5I0TA 1N32T 5ABJB 2CGPA 5EYYA 2RR13 4Q4X3 5JQGE 3ZN6B 1VMHA 1MS8A 3V65A 1E57A 5EK4A 1ZRIA 5FYSA 3ETUA 4RHV1 1QJX3 4MG2A 4PHZA 2DF7A 1QOSA 1XNDA 3WP3A 2AREA 2LOSA 1CAXA 1ND3B 5A3MA 2YXSA 4YT0A 1U0AA 1V70A 2ATFA 4YGDA 3WW3A 1IS4A 4IEPA 1XDOA 3POSA 4MGIE 4Y5Z0 4D3WA 1A8MA 1SBEA 1BR2A 3N9LA 3PUIA 5GONE 4HFCA 2XJSA 2JE9A 1YFWA 2H7VC 2X51A 1LGCA 4DXSA 2CV6A 3UUXB 4IETA 1OEDC 4NIAA 4PK6A 1OVSA 5FK8A 4Q8LA 3ZXFA 1J3QA 4HMZA 1WMXA 1GFF2 3GGLA 4H2AA 4Y22B 2GZWA 2H88A 5LEKA 1FIOA 4H9OC 4F8AA 3R6SA 4QH5A 2W66A 2RS32 1CD3G 4K0UA 4PAGA 4M3CE 5FLJA 3TN91 2WUHA 3L2HA 2BS3A 1W28A 1AYM3 2BKPA 1E5HA 3VBOC 3OGRA 1GQGA 4FSJA 4YW3A 5JMOA 4E27A 5JDNA 4AZZA 3NJYA 2WS92 3WNLA 2WO7A 2V7KA 3W59A 4GKXA 3SRZA 2A7AA 4EV6A 2R042 4JGYC 5JUVA 5LW9A 2V7LA 3NV4A 2E8IA 1CIWA 2DVGA 2V7IA 2A6WA 4DIDB 2CA5A 2JQHA 3WUCA 2OUHA 4A4AA 4JHTA 3VHRA 4EYUA 3VRBA 3KZ4C 2VR4A 2VOXA 1ZBA3 4A44A 5LBQB 1QF3A 2ZKNA 2GP3A 1TME2 3RZZA 2DTYA 2P3IA 1E5RA 3X29B 3HKDE 3AYAA 1ULCA 1JZ7A 3TKLB 4YY3T 3TBDA 3KT4A 5EWSA 5LMUT 3IA3A 1KFXL 1Q8PA 4QPIB 3ZYGA 2EHOA 1BKZA 5T5PA 1SCRA 4JEHB 3SCGA 2HWC1 3RZMA 2DVBA 3NV2A 4UT5A 2HWD2 4AL9A 1KD7A 4OYKA 4Y1UA 1XU2A 3AKTA 3U3IA 1PIV3 3K51A 2LUWA 2QFEA 3H37A 3T4VA 4KWUA 3ZM8A 3C98B 2JIJA 4HWIB 3DYPA 3CMGA 3EI0A 1AHSA 2EVXA 2H6BA 4HG6B 3ZN5A 1ZZBA 3CKDA 4NIQA 2IHR1 1EPZA 2X5IA 1SA0E 2WQ4A 4LBLA 1R081 2BUKA 3E0ZA 5L9RA 4EGWA 5FZFA 4H7MA 1G9CA 1R8IA 4O9EA 2MAWA 5LJNA 1DYOA 2CHNA 3NW4A 2WFF3 2BEOA 3WV6A 1LTEA 2LKGA 4AHXA 2VY0A 1NUKA 4M3CA 4NRMA 1UNBA 3UV9A 3DEMA 4BHPA 4IEYA 2ZEXA 5CA1E 3ZSMA 2F17A 2WNEA 3VBFC 5CNAA 5BNPC 3VBHB 3VDDA 4H9SE 2ZGTA 2JD4A 3I7DA 2NW8A 5ACA2 4NPPA 1YRZA 3Q5EA 4IEQA 3AZZA 4JGZC 1ND2C 4B4RA 1VBE1 3TLWA 5APAA 2OPKA 2WLPA 5CFDB 5C4WB 3JZVA 1K3IA 4URTA 4QXKA 2CAVA 4XQDA 5TSWA 3AX4A 3DYOA 5C6CA 4J1XA 4ZZBA 3PUZF 1R1A2 1RUJ2 2LSGA 4YW5A 2VWAA 3VBRB 4DV7T 1UWWA 4MGQA 2BS4A 2WWJA 3RG0A 1MZFA 1GP6A 3I3EA 3OBRA 5T52A 4Y1ZA 2VNRA 3VKLA 5DAQA 1EUUA 4XF3A 4B1MA 2GMPA 3HVDA 1QKQA 3PUWF 1HTJF 3PU8A 3EHKA 5JI7A 3GZAA 3I2FA 1CAUB 3UT0A 1Z0PA 3EXUA 3ECQA 3FBMA 3O1JA 2D3RA 4MGZE 2MNGA 4PFPA 1N1YA 1IJ5A 3SHRA 1H7CA 1Y7BA 3ILNA 2RM21 3WVJA 5DQVA 3SXWA 1BCXA 4KG0A 5DUXA 5FZ8A 2VVFA 4OI0A 1IQDC 3J9SA 4DUWA 4JHZA 4YTMA 5F5QA 4B1LA 1APNA 4MFRA 4RQPA 2B1EA 4NUVA 4DR1T 2HWE2 1O5LA 5A7PA 2J22A 3NVOA 2VCMA 4AI1A 1HIXA 3LA3A 3CKHA 2CWMA 4I4TE 4PBPA 3T3YA 3RHWA 2DFCA 4P9GA 3BQLA 4EN8B 5C9AC 1MMGA 1BR1A 1S0BA 3BYWA 3GJBA 2ZAHA 2K3WA 1NCQB 4XJZA 4EJRA 1I3HA 1MEC3 4M1PA 4I50E 2F6BA 5E1RA 4GK0E 5FYHA 5FZDA 2PJQA 4NPMA 1DGWX 3PJYA 1XBFA 3SITA 4OMDA 5JSPA 1VAKA 4M3CF 4YGCA 4LF4T 5F7UA 2E9XB 1AX0A 4K8RB 4X6RB 1FV3A 5C7GA 3RQ0A 4CDQB 1QJZA 1T6GC 4AVTA 1B35C 3BCWA 3UKNA 5HEHA 5DZGA 3ZJ2A 2PHUA 4F83A 1FNYA 2GU9A 4FXGB 5HXHA 4CTEA 3IKWA 2Q9QB 3ILFA 1RUC2 2VZRA 2C1FA 4XJ9A 1YQ5A 1IKQA 2ACZA 2CNAA 2R32A 4AAPA 5H6QB 2GAUA 4EN9B 5H9RA 1UY3A 5JRCA 2L8KA 4XHBA 4EEDA 2HWB2 2J1AA 5LWBA 4IE4A 3QOFA 3ACIA 4CDWB 1GQPA 4YNIA 3AFGA 4P00B 5B2GB 1IJ6A 1GWMA 1YCIA 1I94T 4P9JA 4CEYB 4SBVA 1BEV2 1YI7A 3B93A 3NNLA 4AXOA 2ZM8A 1MNDA 2ZHKA 2W47A 4LR4A 4Q1PA 4GB33 3KCCA 1CHUA 1H1IA 2Y38A 1QGLA 2BFUS 3HT1A 1J58A 3I2DA 4FT8A 4E4HA 4FAHA 3KINB 5BR8T 3B3QE 2DHRA 4IDNA 4I0AA 1OWAA 1VIWB 2YEVC 1BVP1 1H2NA 2JENA 5LGNB 2XXZA 4DUXA 4XCBA 1LECA 2WNVC 1N3PA 2A3DA 4RGKA 1G9FA 1UKGA 3MIDA 3PNAA 4NRQA 4Y5TA 1AR62 1M4WA 1PK6B 4PLNA 3R4SA 5FWJA 1FPN1 2SBAA 3BIWE 3W20A 4YZ2A 5GZEA 4YM2A 4DV6T 2D0TA 2GN3A 4U33A 1WCSA 4IDZA 3WG2A 5BXXA 3WW1A 1VBD3 3VDBA 4MO3M 2A3XA 1WMFA 3APBA 3O1HA 2HEVF 3HNYM 3N3HA 2L9QA 1HDKA 1CZTA 1NG0A 1RUH1 4IW3A 3AE5A 5HXMA 1EV13 2H0VA 1ZA7A 1RYYA 3IDBB 4FFHA 3BTYA 4CA9A 4CU9A 2Q9QD 5FZHA 4AEDC 2J62A 4PJLA 2WL1A 1VAMA 1RUG1 2YROA 1WLXA 4BJNA 5AQTB 2IUWA 1UU6A 3ZOIA 5FQ0A 4Y1YA 3VBUB 3J8F1 4PT6A 4RGGA 4A6SA 1WA6X 3PIGA 2J1SA 2P2KA 1X33A 3MACA 1ZM1A 5G05L 1FYUA 2W94A 2VBPA 3R0RA 3ZXAC 3RZGA 5BNQA 1QJU2 4GH4A 1RHI3 2YB7A 4H9RC 5IWAT 2D2SA 4OUSA 2ACXA 2YHJA 5FZEA 3NKGA 1YXWA 2ORZA 1RUD3 1UZ0A 2ZHNA 1B09A 3MIFA 5FY1A 3WDWA 4CUBA 2ET1A 4XIKA 2AZ5A 1AR93 1JBCA 1GV9A 5AQRB 1VR3A 5I0RA 4CYDA 3D0JA 2YC4A 1COV2 4IE0A 4TZDA 2IIUA 5ABJA 1DHKB 2OA2A 3ZN6A 2XGXA 2JDUA 1W39A 1LOFA 1VBC3 4YM1A 2VECA 4EZHA 1MZ5A 4EYYR 1O3SA 4D6QA 1K42A 2R071 2VTXA 3O4XE 4WM7B 2D5FA 4GWMA 3BPSA 1ND3A 1PZ7A 2VC9A 4JI2T 3GMIA 1UMHA 4CE8A 4DBRA 2VQAA 3AZXA 2UURA 1SDDB 4CUCA 2Q1MA 4WYVA 5LZ6A 4OHVA 1CWPA 3ME2A 4A97A 3FWEA 1MS0A 3MO4A 1FMD2 3BTZA 4AKHA 1HW5A 3OTOT 1VAVA 3EABA 1UD1A 2MEV3 4AKGA 5FCCA 1QJY2 2FJDA 3UGHA 2LJLA 1K45A 3N5LA 4LHNA 5JMCA 4V2VA 4AGRA 3IMMA 4IE7A 4Y22A 3NRUA 1SMVA 3SCFA 4LITA 5AQKB 1A8DA 1DYKA 4KP3C 5FNVE 1DQ1A 1DLLA 2UU8A 3T8OA 4LO5B 5IWFA 3MFCA 2VTFA 3KV6A 3TLSA 1DGLA 1ZKEA 2XPKA 3W15B 3TNPB 4QX3A 2GMMA 1A78A 3C7HA 1S35A 1RVF3 1YW0A 3P4QA 4E4DX 4LPLA 4U74A 4Z82A 3LD8A 1YQ2A 4HZFA 2PHFA 4L2NA 3B00A 5FWEA 3I9WA 5JVVA 4JCKA 2XG3A 4QX2A 5BNNC 2Z2SB 2ZX3A 4ZXEA 3J7HA 1W8NA 3KF5A 2ZGKA 1L0VA 4XBNA 2O0OA 4BAYB 4YVSC 4IV3B 3WAJA 4LULA 1LOBA 4IHJE 2YYOA 1DDLA 5FMDA 1PVC2 4EWDA 1KRIA 3OUJA 5FZ6A 4UW5A 5JAXA 3W5NA 3CX8B 4OHXA 2XB6C 5FPVA 2VUCA 1LHVA 2WA4A 1AL22 2QTWB 5FZ9A 5CAZA 3BOPA 1HXS3 4XBFB 1NLRA 1W9FA 3POYA 3RI8A 4QPIA 3AJZA 2PAKA 5HCJA 3VZJA 4M4RA 4QH4A 1GR3A 1BBT3 4ZU4A 2NZ9A 1RMU3 4ZS2A 2LTNA 1YIPA 4ILCA 3RVHA 5FP8A 2E63A 1SFPA 3PUHA 3HNMA 1ULOA 3WF1A 1DYPA 1SE7A 3ZCIA 3AFKA 1IS6A 2ZABA 1C57A 3ACFA 2PFWA 1FOD1 1OEDB 5A3LA 4LKDA 4I01A 2QQPA 2WDVA 4KL1A 3CLPA 1VRH1 2NN8A 5JIUA 1JZ8A 3AMMA 2ZZJA 3GZEA 4ZEYA 1V6KA 2D5HA 4PJYA 4AK3A 2JD9A 5HCMA 2X67A 1HB4A 2JX9A 3L2YA 1G7YA 2JG9C 1H9PA 1W6PB 4PF5A 3WCSA 5FRAA 2WZ8A 3VU7H 2WA3A 5CKNA 1RJ7A 2LM2A 3NWIA 2XQRA 2EXIA 3VBHA 2KZ7B 2YGLA 2RS12 1AR73 3VBOB 4TSVA 2QRXA 1CONA 4L9IA 3CX6B 4D94A 2KA3A 2N1GA 3POFA 1YC61 3T0AA 3FBZA 3ONXA 1QQP2 5CFDA 5C4WA 3HQUA 4CCDA 3MXZA 2HBUA 5KHHA 1OD3A 2RS33 3VN4A 1TMF2 4YW2A 3ZN0B 2YY1A 2YN6A 1XU1A 1IZ3A 4JAAA 3VBRA 4JGYB 3R84B 4NO4A 4B7EA 4AVSA 4EWEA 1OXZA 4QKFA 1HB1A 4MX3A 5LB7B 4J25A 4OQ9A 2QKDA 5CISA 4HKWA 4LBKA 3FZMB 1N1TA 4IXLA 5I8SA 5I8YA 2H6CA 5FOJB 1HV0A 3CWZB 2M6BA 2SLIA 4LMJA 1PM7A 1RB8G 2YBKA 1XJAA 2XJVA 2WS93 4AGGA 3H1MA 4EXTA 3UT5E 4G4FA 1Y9MA 1CAUA 4FFFA 1T8BA 3AEAA 3N9QA 2LM3A 4C0HA 2DCYA 2WNUC 5FZBA 2R043 3NRXA 1OKOA 5JWPA 4XFGA 4QXHB 2KWIB 5DG2A 3WNXA 1AX1A 5ABHA 1W0OA 3I2IA 4C91A 5FPLA 2PAEA 3E5XA 5B4NA 1SHZC 2CBJA 1S2EA 3C7EA 2QUOA 5ABFB 2BG9C 4JC1A 2VXRA 5JDQA 4KWJA 5LB6A 3ZT6A 4D8MA 5L3BB 1I1EA 1BVVA 1TME3 5BPXA 4EN6B 3WP4A 2R0HA 2XJTA 1D1CA 2R062 4AXPA 3CEWA 3LSVA 1SLAA 1XNBA 2CBIA 2QQMA 3UGGA 2VURA 4ZI7E 2A6YA 2BNNA 3RFRA 1KDKA 3V64A 2I74A 4B8EA 3DXUA 4B3ST 1NCQA 5DDJ2 2F4PA 2VD7A 3KV9A 2HWD3 2LSYA 1C1LA 3N2GE 1OUXA 2K5BB 3WG4A 3E08A 1J84A 3WSOA 1PX4A 5BUVA 2DUQA 2QQIA 3KBUA 3H1YA 3FUOA 2GH8A 4XUPA 4DEQA 2ZHLA 1C5IA 1S0GA 2BP6A 2E9XA 5J09A 2HWF1 3AECA 4CDQA 3JAFA 4NAOA 4MGYE 5LG4A 3UQ7A 3VBFB 5BNPB 1SDWA 2AE9A 1FI2A 5F3JA 3PU3A 1VBB1 5HCHA 3KLSA 4ATFA 1M06G 1KQRA 2OVUA 5A70A 4JGZB 1ND2B 2Q9QA 4OHYA 3AP9A 1VJ2A 1NCRC 3EMRA 3TEXA 1HRI3 2XVLA 1L7QA 1FNZA 3RIFA 4QPWA 1EP0A 3MHZA 1AR81 2OPWA 2WCAA 4DR6T 3IDEA 3JXSA 3TLUA 3OPTA 4CDWA 5J3UA 1Y9GA 1DU2A 1EAH3 1VBA2 2X09A 4XTMA 2OS2A 2DBNA 4JI5T 2HN2A 5ACA3 3EO6A 3ONJA 4CEYA 1E7PA 3OUHA 5CA0E 2VE1A 2IC9A 1GOFA 4ZY9A 3VUOA 4DUYT 1S2KA 1IGOA 1QH7A 4FQZA 4U31A 4X6QB 1SEFA 1H9WA 1HG5A 4KG8A 4JBWF 4LBJA 4Q5OA 1C1FA 2Q8OA 3QK6A 4ISTA 1R1A3 1RUJ3 1NEKA 2PHRA 5I0UA 4H14A 4YG6A 1ASJ2 4HK9A 2RDRA 2WZR2 5FY0A 2Y0IA 2N9DA 4WZCA 4LXLA 4AEMA 3B57A 4U2ZA 1LB2A 1M62A 2JDYA 5FKYA 2ARCA 3RYPA 1PGL2 4IEOA 5FTTC 3NNMA 3K8PC 2KM2A 1W9SA 2XL9A 4B29A 3ZMTB 4QQ2A 1T7SA 4Y5SA 4AYUA 2YGMA 2PTMA 3UJOA 5L3CB 5ABGA 2VZ1A 1PK6A 2GK9A 2W4XA 1F9KA 1YFXA 5J37A 1C8M1 2OXBA 1SLIA 3ZSKA 4B4QA 4GD4A 5FDBA 5C9AB 1W6OB 1QEXA 1ONAA 1VALA 1H0BA 3JB4C 1W9RA 3POBA 3BGAA 4CCCA 5HEUA 1XE8A 4ZXLA 4Q8KA 1W03A 1LRZA 2CDOA 4MBQA 2HWE3 3ZIWA 4CDXB 3ZYJB 1HX1B 3NZPA 3NJVA 5L3DB 3U37A 3V56A 2DI4A 2P1BA 1WZXA 3FZKB 2XQ6A 4AFDA 2IC1A 1OVPA 2P3JA 3X1DA 2R7EB 4Q25A 1W6QB 2WZIA 4RHV2 2ZGPA 2O1QA 1SFYA 4H9NC 2WO1A 4CSWA 1OD5A 3IIIA 4I02A 3VBUA 1T2XA 2C5IT 5JXIA 2W2UA 1V00A 4PF1A 2Q5TA 3PJAA 4OQ8A 4B7KA 4FOWA 2NYYA 3PUGA 3H8UA 5T55A 2VZUA 3ETPA 3HI2A 1PNFA 4LORA 2FBEA 1L7LA 4UF0B 3RGLA 1UX6A 5GKAC 2CGOA 1HV1A 1P8JA 4Z1VA 2GC2A 2BBAA 4XQ4A 1RUC3 1OOPB 5C3PA 2D6LX 1DGRN 2DVFA 5H9SA 4Y26A 2JG8C 3WXPA 1NLSA 4FFIA 2LALA 3PVEA 4IQPA 4Q1RA 4LKEA 5F5AA 2HWB3 1H6YA 3VR9A 2VZTA 3ZT7A 3KS7A 2A9UA 1W8ZA 4CXYA 5AQGB 1WBLA 4N43C 4AVCA 3TN92 3BALA 4HFEA 1POV3 3BVCA 3RIUA 1GZTA 1BEV3 3S6PA 1BXHA 2WNVB 3RRWA 5JH7E 1YIFA 4WM7A 5FKCA 3GN5B 1KEYA 4HVOA 2ZEZA 4QX8B 1QDOA 3JUUA 1HQNA 1NZIA 1AX2A 4EN0A 4AFAA 3OVUA 3FZ3A 3HIFA 4Y3OA 3MW4A 1DLCA 4QX1A 3L8RA 3U75A 1JU3A 1HNWT 4OYJA 2C24A 1S0JA 1ODNA 2H3RA 5LBBA 4XFBA 5A7SA 2QQOA 3BKZA 3SH4A 5HXEA 2O8OA 3BU7A 3RYFE 5FZKA 4NXMT 1AR63 1TZOA 4KNCA 4A5XA 1JODA 3KV5A 1WGPA 3AE4A 4IV1C 4KGQA 3P4SA 1BK1A 3QH7A 3A8YC 4AEDB 3IDAA 4IUGA 1Q8SA 1OH3A 1UY2A 3W21A 2VM9A 4S2FA 3VBSB 4M00A 3PVOA 4X64T 2YZ4A 5M4YA 3ZXKA 5HCFA 2XAHB 1R091 4UAPA 5DMYA 1O3QA 3WF0A 1F5FA 2D93A 5EHDA 2HWC2 1F8VA 1XNTA 1K5MC 4GKYA 4RFRB 3KWVA 3C50A 5FP3A 4IGOA 4Y24A 2QQUA 2XHKA 1QMJA 4YGEA 4IESA 1PO11 3ZYPA 1KS4A 5FAXA 4N7IA 1LAJA 4IV3A 3SEPA 4H9PC 3UU6A 4QX5A 4QWNB 4QGMA 4DRRA 1POQA 1QY4A 4K9SA 2NMNA 1R082 2YC0A 1H2KA 2WABA 1MMNA 2B4KA 2MOZA 1GZ9A 5FFOC 3RX6A 1QJU3 4GMP1 5I0DA 2VVDA 2G0UA 2GNDA 2WBKA 5I93A 3MI8A 1H8TC 2VASA 3Q5DA 2WSUA 3ZC1A 2WYSA 3RDIA 4A3XA 5H9PA 3SEEA 2ORXA 3C3VA 5IAVA 4DV5T 3NMBA 3FUQA 2CWSA 3ZMSB 2RG4A 3CL1A 5GLTA 4HXCA 5FZ7A 2BTVC 3EBRA 2LS6A 3HMYA 3PDYA 2HN1A 1JZ2A 4AI6A 2V5CA 4DV2T 1OFNA 1VBE2 5CKQA 2GSYA 1COV3 4CEWC 2G9FA 4DIQA 2NWBA 1KXGA 4N8MA 2LSKA 4ILAA 3VB9A 5C3JA 3JQWA 1PGW1 1LHUA 3IMNA 4BQ2A 5LGTB 2J1UA 1Z0HA 5JDGA 3WQ1A 1OEDA 2NW7A 4DMWA 4BJMA 1AUYA 2VULA 4MALA 3OYZA 3I97A 2V5DA 3S5QA 4DXZA 2Z79A 3ZPYA 4OULA 1QU0A 2LT3A 4ANJA 1LOCA 1RUE1 2VAUA 2WINB 3DTOA 4AEKA 1ENQA 2BQPA 2W2IA 1W6PA 1FMD3 3RC3A 3DECA 1XNRT 2RM22 2HJIA 2JDMA 3AXDA 4IEZA 2XQAA 3SQOA 3VBOA 4CZZB 4BE3A 1IG3A 1VCSA 5GZFA 5IAXA 2ARAA 1Q8OA 4CZSA 4ILBA 1RUI1 3DPRC 4OFGA 2ERFA 5BNNB 1IKPA 5B4XA 2R30A 4FPKA 4IDPA 4XJUA 4LF9T 1G73A 3BODA 4INDA 4JGYA 4J1WA 1ULPA 4YTNA 4AWDA 5FIXA 1HKDA 4YVSB 1LULA 4Z2WA 3O0WA 4DQAA 2J1VA 1RTVA 4JRAA 3PV0F 3RRCA 1YKHB 3QB5K 1UOFA 3O1SA 3OBTA 1XNQT 1Y64B 3GBFA 3K1SA 3ZMVB 2E7TA 4UFKA 1HNXT 2GMEA 5JOYA 4XUOA 3N9NA 4QGNA 2IXIA 2CL2A 1VRBA 4OLLA 2Z5WA 4TYSA 5FL1A 5F2SA 4QXHA 5CG9A 3FHQA 1ZRDA 2XAJB 1MVQA 3H9AA 2PMWB 2NP0A 4NPRA 1WCRA 5ABFA 1DG6A 2VG9A 3AE8A 1PVC3 4OZXA 3MFAA 4K21A 4COVA 4DV0T 1AL23 3B13A 2VH9A 4CN4A 2WYFA 3QNUA 2ZGSA 4P14A 3B5MA 4GYSA 3IAPA 4W8JA 1XMOT 1G86A 3J7LA 2VKDA 3LZZA 3P4WA 3H0OA 2VMIA 1SFNA 5HV0A 5K0UB 2F4VT 3EYPA 5IVFA 4L97A 2CDPA 5I0SA 5C3RA 4LE3A 1NYWA 1FT9A 2RPAA 4KQ7A 3AA1B 1XSRA 5IVEA 2JG9B 2GN7A 4GWIA 3O1MA 3VHOA 1MS3A 2BGCA 2EIEA 2RE9A 5AC91 3IDCB 4NIIA 1LGNA 2FJEA 3EAMA 4BQ4A 2WNOA 5E6HA 3VBFA 5BNPA 2BZBA 2FHRA 4CI1B 1RUF1 5DN2A 1YKEB 2BVLA 1UY0A 3ZSSA 3H3UA 3L3PA 4OUEA 4JGZA 1ND2A 4FTBA 4OVEA 3C7FA 1HN1A 4WNKA 1ZBE1 1A34A 4GZ9A 2E5LT 1EY2A 4COWA 3Q8CA 3QD6A 2D6PA 4Q26A 1FPN2 3R4UA 4P08A 1C3HA 3ZKYA 2ZGNA 3WG1A 2FDJA 1OF3A 1OH4A 1MZ6A 2JB4A 1QXPA 5FZ1A 4LIUA 4QXCB 2RS13 4A3ZA 4G3YC 4O4HE 2JMHA 4AFCA 4ZZ5A 1JYVA 1H2LA 2LEHA 4N53C 3WEZA 2RS51 2RA1A 4QD2A 2VBDA 4FO9A 5F5IA 3N9MA 4LJHA 2PN5A 1RUH2 1TMF3 2WNUB 2WIIB 4QU1A 1CJDA 2W67A 4YZ5A 3T2QA 1QJEA 3LGRA 2XJ7A 4IGPA 3PUQA 1RUG2 5JZGB 3ZXJA 2ZPXA 2C4XA 3RMXA 3AKRA 2A71A 2VKJA 2LRKA 4XVHA 1D2QA 2VZQA 1DZRA 3J8F2 5J1GA 1GP4A 5IVBA 5JSOA 4W65A 4COYA 3OBZA 2A6XA 2LRLA 2Z69A 2FZ1A 4KHZF 5F3EA 2HEWF 3IHRA 3TWIA 2JQ9A 1BMV1 2W1WA 4YFZA 3EJKA 4X65T 5AQMB 3PVBB 4XMAA 2QE3A 4KHPT 5C9AA 1TEIA 1W6OA 1CPMA 5A3WA 2YINA 2EIDA 4DS0A 3WQ7A 4BIOA 3RGBA 1UW8A 2UXXB 4U72A 3EVYA 5IHYA 1V6NA 3KHBA 5FMOS 1K12A 4CDXA 4XDQA 2DWGA 1SQ4A 3SOLA 2LSIA 2UXNB 2WY2A 2R063 3UU5A 4HETA 5LP6E 3JC6C 1W8HA 3RYCE 5C8YE 2AUYA 2P9BA 5CZKA 4NHLA 2DUPA 3E5UA 2DU0A 3N4MA 5IFTA 1W6QA 5AQLB 5DDJ3 1I5ZA 2HBTA 2JDAA 4ZI2C 4IL9A 3T0DA 3LAGA 1H30A 4DR3T 2R072 1BZWA 1GBGA 2ZKLA 3K3OA 2K0GA 3PUXF 1LCLA 1NCRB 3AEEA 4Z8BA 3CPZA 2P4EA 3FLPA 4XOGA 1A3KA 4ILUA 3WUDA 4R4ZA 5K4LA 4JI7T 4JZRA 3M3CA 4NOTA 4Q4W1 2ZM2A 2RDSA 4UF0A 1V6MA 4Z8XA 4HPKB 3WI3A 1UOJA 1UU4A 2GC0A 4HWCA 4X8PA 5EZWA 3BTXA 1UYXA 1GLHA 3QC9A 2WMOA 4K40A 1OOPA 2VNVA 1ALYA 1OA4A 4BQWA 4YZ1A 3TOJA 4XUTA 3FE5A 4HFBA 1E1HB 3CZJA 1UGOA 5E16A 4IE6A 2Y26A 4UVBB 4QU2A 1VBA3 1MS9A 4DUZT 5FO9B 3KV4A 4LBQB 4YFWA 4K1YA 4Q4Y3 4FPFA 1UYYA 4HSLA 3Q8FA 3KQ4B 2WNVA 4FCAA 4COZA 5HXVA 5FL0A 1G8XA 1WA4A 3GN5A 1MVEA 1S0DA 3VGIA 4QX8A 4LEJA 2XJPA 4GIQA 2ZACA 3OTFA 4Y4YA 2IW5B 4XF0A 5IVJA 1Y3TA 2DWRA 1W2OA 4NIHA 2DUOA 2TBVA 2BS2A 3MF6A 1ASJ3 3POWA 3RJRA 1W09A 2WZR3 4TLFA 1HJGA 2WLQA 4XZPA 2TUNA 3MLJA 2H7OA 1YYNA 1D2SA 1GICA 1X9TA 4I43B 3K46A 1J1LA 2E6VA 3ATGA 3LOIA 4CDUC 4YLHA 2VW2A 5KXCA 1GYKA 2YG0A 1CZVA 1QUUA 4P5HA 1Y01A 3DV8A 3VKOA 4QGLA 4AEDA 4MGTA 3WNKA 4PIZA 3P7IA 4XHXA 4BQ1A 3RSJA 1UCXA 3S7IA 3NV1A 3VBSA 1YHFA 4Q0SA 4CCEA 4OHZA 2E33A 2ZGUA 1WKYA 1V6LA 1TE1B 3FZFB 4C0BA 1SPPB 2JJ9A 5FJHA 3LDQB 1BYHA 4JV4A 4QB1A 3I1AA 4LA3A 1D0YA 2HKXA 2ZTNA 4S2GA 3WDXA 4XFIA 1ST8A 4D6RA 3UU8A 5A6YA 2WKKA 4UXNB 3ZDSA 4ISSA 3A7QA 4LF8T 2YFZA 3AMQA 3ZFEC 3OCPA 1S2BA 2BNMA 2D6NA 4RHV3 5LHHB 2E51A 1KS5A 1J1JA 5FZ3A 4QWNA 1FOD2 2OKXA 1W3VA 5FZ4A 1UOGA 3IF8B 5IK5A 4BPZA 3AA6B 2D98A 1OT5A 2JG8B 1VRH2 4LBQD 2A2FX 3OEBA 2V09A 4PK4A 3E6CC 2XY8B 3VKGA 2GNMA 5FYVA 2KR2A 2VKHA 5C5UA 4FPLA 5F32A 5IYZE 3C7GA 1AL0G 4AQFC 3POEA 5DQWA 3FLRA 3RWNA 2DYCA 5DG1A 4N43B 4KMQA 1OFSA 1V6JA 3F95A 3J7Yq 4KWKA 4DR7T 4JI8T 4U2AA 4I0WB 5J7MA 4XJ8A 3U78A 3O0VA 3TLTA 3VZMA 4XBLA 2W1QA 4O61A 1S0EA 4PLMA 4IE5A 2G1MA 3AP5A 3MPPG 2RP4A 1HXS2 1I6ZA 3OGSA 3T09A 1OF4A 1PGSA 4LLOA 3A21A 3ZFGC 4TN7B 4Z92B 1O4YA 3D6EA 1REDA 4RFT0 1JYCA 4EIWA 2AC1A 1LR5A 5DAWA 4RR3C 3TN93 2BW8A 3D5OA 4B3MT 2V4AA 4ZKTB 1LRHA 4YW4A 2YV8A 3CQOA 3CZUA 1WCKA 3AP4A 2XAFB 4AE2A 3RC8A 4LF5T 3L39A 4PLOA 2QGSA 4IDQA 5FYUA 3CMLA 4JUYA 2NLRA 4IV1B 1O7FA 2O14A 1KDMA 4LO4B 4MVTA 1XQNA 2R1BA 3K48A 4LNVA 5FYYA 3IB3A 4AQYT 1ODMA 5C8CC 1OA2A 5GZCA 4C1WA 5CJ5A 3ZFFC 4JTNA 1AJOA 3NVCA 1CAWB 2WWUA 4Q4V1 2IXLA 3MV01 1DQ2A 1HG2A 2XH6A 3JBG1 2XQ4A 4AOCA 2Y8KA 5JPNB 1WYBA 4OCTA 2FBWA 1X82A 2VL0A 1JZ5A 1K5MB 4UV9B 2I2SA 1IG0A 2VZ3A 4E8DA 2YFUA 2CHOA 5BNNA 2HYKA 1JHJA 5AQHB 4ASKA 1MIVA 3T1LA 3QOPA 3AYDA 4AG4A 1S4CA 1W0PA 4ZHQE 2X0LB 3ZYBA 4NROA 3RIAA 1JU4A 5E0OA 2VOTA 3JAEA 4YXDA 1LOFC 1W06A 4YVSA 1Q8VA 1AR72 2IVIB 3LPFA 3KM5A 4CCLA 5JR7B 1D0HA 4QQLA 2HWC3 1QOTA 3IPVA 3GDBA 3H42B 5FYCA 1YNAA 2FUPA 3MGUA 2JE7A 5FMCA 4K6BA 5H9QA 1OLQA 3M3ZB 2CXDA 1GKBA 1O4ZA 2VOKA 3T0BA 2ZA9A 2K9ZA 3ENRA 3P3PA 3CHXA 3VDAA 1XZYA 3THCA 2B46X 2P17A 3VV1A 1AYN1 2E5VA 4H63H 1H8TB 2HWF2 1S0IA 3WAKA 3UUBA 3CNAA 3CX7B 4O8SA 1JMUB 4F6RC 3M8LA 5EJ1B 3SMHA 1DQ4A 2WR9A 4ARYA 1VBB2 1R083 1Z7S1 1O3XA 4ADZA 4A6OA 1V9U1 1KFUL 4RA0A 5A3UA 3HD8B 4CEWB 3M4FA 3I3DA 3DF0A 3IM0A 4HFSA 1WW6A 5EZYE 1UCUA 4DZGA 4BA9A 1AR82 5CIRA 3NKTA 3F57A 2LW8A 2BVMA 4MSVA 4IEUA 3O1IA 3RI5A 1ZZ9A 4C8DA 3GALA 5K0UA 4L0PA 2JDHA 5A3PA 1IPJA 2DCJA 2UUAT 2UY8A 1VBE3 3DYMA 3AKPA 1IS3A 3AKQA 2EF6A 3ILRA 3DP7A 5A7OA 2IXCA 3WQ0A 4QQHA 1ZZ7A 3T1YT 1OQEA 1GWLA 2JG9A 3POGA 3S7EA 3S57A 1NLQA 4RSUA 4HWHA 1FV2A 1J83A 2WBLA 3C4XA 4XUNA 4A2UA 5F5CA 1UAIA 3G6JB 1CZSA 3KGZA 3USUB 4K7JA 4O65A 2J1RA 1HF8A 1T72A 1MNEA 3OYWB 1XXNA 4LO7A 2A6ZA 5F2WA 1UU5A 2VUDA 4CP0A 3FC0A 3U11A 4MH0E 3W9AA 5KDMC 1MR5A 3H8RA 2OLTA 3BN6A 4FAGA 1C8M2 1JXNA 2IC6A 1DGRA 5AVPA 1XC6A 2RM23 5IT6A 5KHJA 1O5UA 1NENA 1ZRRA 2Y0OA 4QXCA 3UGFA 4B6XA 1V0AA 2Q4SA 3VL8A 3S0MA 3B94A 4A56A 2LSJA 4B3RT 1URXA 1HRI2 2R0FA 4ZHNA 1JYXA 3ZXGA 1MQTC 3V0BB 1UN1A 4BQXA 3UKVA 4KBMB 4TV9E 1AVBA 1YQ4A 1SCSA 5HWXA 4AHWA 2WNUA 2UYAA 4DNYA 3KD4A 5L3EB 3O14A 2DCTA 5A1FA 1EAH2 4FBFA 3SH3A 1TQ5A 2VL8A 1KGYA 5JZGA 4OMCA 3UFEA 2BGPA 4E7SA 4UFJA 5FY8A 3ZSJA 2WC2A 2R6QA 4AQ2A 1ZVFA 2VPVA 2GC3A 4Q29A 4OUMA 2LE8A 3I4IA 1KNRA 3OGGA 2ODVA 2XHEB 4K8FA 5L7OB 3UTKA 2OQ7A 2R49A 4Y33A 4OHWA 3EDUA 3LCPA 4H3WA 4UEMA 1GMMA 2MHFA 2BVBA 5D2AA 1IHMA 3M3QA 3B02A 4GALA 1RXFA 3MEPA 4DV3T 5L47A 3O1RA 3OYXA 4Z91A 4TWFA 3VBHC 1O6UA 4UR9A 1DZTA 1VB2A 2NW9A 3BIEA 2ZGRA 3ZKUA 1YFYA 2Q8EA 4HKOA 4PFOA 2KT9A 2CLYC 2BGOA 3P3NA 5JDFA 4CU6A 3RYIE 4FPHA 4JI3T 2PHDA 3KT7A 3LK42 4PBOA 2A6VA 1HQWA 3O1PA 3AE9A 4DMVA 4YWAA 3ZN1B
chains in the Genus database with same CATH topology
2D5UA 4GOUA 2Y6XA 2XMLA 3ESLA 5LHIB 2W2IA 2P9BA 4EZ4A 3R6NA 2Q9QD 5FZHA 4N78D 2W61A 4PJLA 3RC3A 2HPLA 1X79A 2WWUA 4WBOA 2GP5A 2X9WA 5F39A 3C64A 4V2WA 1WLXA 3VU7H 5FZLA 1HG2A 4ZI2C 2E9XC 2P5BA 4BJNA 4PW8A 4H9NC 4O4LE 5CA1E 4CSWA 1WYBA 4PJNA 2KZ7B 4KMCA 4CZZB 4CUGA 3PE0A 2OA5A 3K3OA 4QX7A 4H9SE 4X1YE 2C5IT 5FP9A 3C51A 4P09A 2C5KT 3C4ZA 4UV9B 4HFVA 2LM9A 2MYSA 4L9IA 3CX6B 4QX7B 2ODUA 2DCFA 3CPZA 1US7B 2NW8A 4HONA 2V7JA 2N1GA 4ILUA 5FYIA 5A7QA 5FZIA 1HCIA 4O2BE 5KX5E 4ASKA 3FBZA 1MIVA 2X68A 3ONXA 5J2TE 5K4LA 2KXPB 4TX5A 3MACA 3MXZA 2W00A 5ETWA 2Q9QC 4ZHQE 3PUGA 2X0LB 3OPWA 1WRDA 3V5SA 5HWYA 2CE7A 2BDEA 2NTYA 1G73A 4QHOA 5E0OA 3HI2A 3ZEFB 2DLRA 4BISA 2ZM2A 5CEHA 4UF0A 5IVCA 3ZN0B 4Z8XA 3AAEB 4HN9A 3WI3A 4UF0B 4HTEA 1D0ZA 4QKNA 3R84B 1AJ3A 3ZYMA 2LSGA 4XZCA 5FPAA 3UULA 2VWAA 2J1DG 3AB3B 1OXZA 4H9RC 2D2SA 2ACXA 4CCLA 2VKOA 4ERRA 5FZEA 3RYHE 3RRCA 5HXCA 2HPJA 2PFVA 4ZS3A 1WR6A 4NUUA 5LY2A 1YKHB 3J9X1 3QC9A 2WMOA 2WWJA 3KDSE 3NRYA 5FYCA 3P8CD 4AQFA 2QA7A 5FUNA 1BR0A 3VKHA 5FY1A 1Y64B 5HXSA 2NOXA 2W63A 3CWZB 3ZMVB 3MA9A 3VHLA 5F3GA 2PG8A 4DO0A 2CXDA 2YBKA 3ZMZB 1HTJF 4EXTA 3PU8A 5HXRA 2WSSV 3N9NA 3UT5E 2LOPA 3N9QA 1E1HB 1VRBA 5F5AA 2EHOD 3SWHA 4IE6A 3N9PA 4H63H 4IE0A 5FP7A 4UVBB 1U4QA 1Z0PA 4J2CA 4O4JE 4IGQA 5F2SA 5FZBA 1UX4A 4EB6E 2E9XD 3NRXA 4TUYE 1S94A 5FY5A 3N2OA 5F3CA 3WAKA 2ES0A 2C5JA 3KV4A 4QXHA 5FY9A 1HFAA 2DNXA 3O1JA 2JQQA 5FY7A 3CX7B 4O8SA 3BQIA 4PFPA 3RKOA 3I0QA 4QXHB 5JQGE 2KWIB 4CXYA 1MIWA 3FXEB 1IJ5A 2XAJB 1LKXA 4F6RC 1H7CA 3PUAA 4ZI3D 4C91A 4UVAB 4C90A 2XTLA 4EZHA 5EK4A 3AL6A 5FPLA 5FYSA 5DQVA 4EYYR 3O9XA 3ETUA 1SHZC 1O3XA 1G8XA 3RRWA 3GN5A 4ADZA 5JH7E 4D6QA 5FZ8A 5H6RB 4QX8A 3GN5B 2M67A 4I55E 3O4XE 5JR9C 4D6SA 4UV8B 5JDQA 2IAKA 4QX8B 4MFRA 5FBJA 3FBLA 2B1EA 2IW5B 5ANQA 2EHOC 2LOSA 2XUEA 3IEEA 4NUVA 2YU2A 5IVJA 5LY1A 1IAPA 2ZLYA 2CMRA 5L3BB 3B13A 4QXBA 2JPFA 5EZYE 2ZMAA 3F2EA 3MJXA 3GMIA 5A7PA 1UCUA 2DWKA 3LFMA 2V7MA 4QXBB 3MK7C 5FYZA 2W0GA 4DBRA 4BA9A 1U5PA 1D1CA 2Z6EA 3K3NA 3F57A 3ZPOA 4AXPA 4Y3OA 3HKBE 2BVMA 4CI3B 4I4TE 2YBSA 4GYSA 2K9AA 1D1AA 4ZI7E 4JLEA 4YFSA 4ZI3C 1IZNB 4CXXA 2X9YA 3O1IA 3FXDB 2VKDA 5FZOA 1WYCA 2A72A 4YJ3E 3CQCB 5LJMA 3BQLA 5L3GB 3HA4A 4C8DA 4OYJA 5FZOB 4AKIA 1MMGA 1BR2A 4L5GA 3RPUA 3N9LA 4AKHA 5GONE 2WMNA 1BR1A 2H3RA 2CLYB 3DXUA 5FY4A 2H7OA 5A7SA 5A3PA 2MBGA 4I43B 2XAGB 2XAQB 1V9DA 2H7VC 2X51A 5HXEA 5IVFA 4AKGA 3AVRA 3PURA 2VD7A 3UUXB 3KV9A 3RYFE 3DP7A 5FZKA 5A7OA 4PK6A 5FXZA 2CWOA 2LJLA 3I0OA 1EZ3A 4YLHA 3DXTA 3M65A 2LSYA 3N5LA 4TV8E 2PBIA 3N2GE 3ZMUB 4DBQA 2VK9A 2K5BB 1QUUA 4I50E 3IBPA 4M1PA 3K2OA 3LJCA 4V2VA 4URAA 3E08A 3KV5A 4AI9A 5HYAA 4IE7A 4GK0E 4YJ2E 1UX5A 5FYHA 5FZDA 2CWYA 3AA1B 3LG7A 3HL6A 2Q8CA 4LITA 5TAOA 1FMVA 3KBUA 5FXVA 5A3TA 5IVEA 2PJQA 5LHGB 4KUMB 3U4SA 2XQYA 5KMGP 3P7IA 5FXXA 2HH7A 3H3AA 1FIOA 4UIGA 4CXWA 2WBLA 3C4XA 4H9OC 4KP3C 3FB2A 3HKEE 5FNVE 5HAXA 5IVYA 2KINB 4MHCA 3HKCE 3FHNA 4UELA 5F5CA 2E9XA 4CCJA 5DJQC 2JMKA 2X66A 3T8OA 2Q8DA 5IWFA 2E9XB 5LOVE 2K48A 3KV6A 5E6HA 2I59A 3S4UA 2BZBA 3AVSA 3OKQA 4K0UA 3ZYKA 1D1BA 1ZV4X 5FP4A 3EDVA 3ZLIA 1BR4A 5JDMA 3CVRA 4CI1B 1D0XA 5LG4A 1ZKEA 1FEWA 1HF8A 3F31A 1MNEA 4PAGA 1YKEB 5M4YA 5KR7A 2JJ9A 3W15B 3Q5WA 2BVLA 5FJHA 4HGAA 5F2WA 4PJJA 3L3PA 2XAHB 3LDBA 3EUHA 3I1AA 1D0YA 2V1DB 3Q9DA 4AKRB 5F3JA 3ZJ2A 3PU3A 3KVAA 2OT7A 1S35A 1YW0A 3AA0B 5F37A 4AQGA 5HXHA 2NTXA 4WNKA 2KMFA 2Q9QA 5KDMC 4U74A 1NWMX 4D6RA 1LVFA 5JDHA 3LD8A 2Q9QB 5J2UE 3PUSA 5A80A 4UXNB 4ISSA 4IIJE 1MIYA 5JVDE 3E22E 5FWEA 3C50A 5FP3A 2CCQA 2LHRA 3I9WA 4X20E 4IGOA 5L2LA 4GJZA 5BMVE 1KNZA 4LIVA 2IC6A 5JDNA 5FZAA 5LYJE 2D0UA 3NJYA 2NP9A 4AAPA 4ZOLE 5H6QB 3DJBA 3RH3A 4OK0A 2XDVA 3AAAB 4O2AE 5JRCA 2Y48B 2V7KA 3NZQA 2L8KA 5LGUB 4QXCA 4B6XA 5LHHB 3CQXC 4HEAA 3OPTA 4CCKA 5JRCB 4LIUA 5FZ1A 4QXCB 2X9HA 4GJYA 5A3NA 5FZ0A 3PTRB 5LWBA 4IE4A 2CXFA 3SRZA 3UUMA 5FZ3A 3ETVA 4QWNA 4O4HE 2JMHA 2OS2A 4BAYB 3Q2MA 5FZ4A 4H9PC 4A56A 4MLKA 4QWNB 2LSJA 4PK5A 3D0TA 1ZEEA 3HR0A 3LK3B 5LW9A 3WAJA 3IF8B 2V7LA 1IJ6A 2LEHA 1KK7A 3AA6B 5FZMA 5LBMA 5CB4E 1ZHCA 2E8IA 2YPDA 2RA1A 4IHJE 5F5IA 2A2FX 2V7IA 3UUNA 5CA0E 4KBMB 5A1LA 4PK4A 5A7NA 2CA5A 2IC9A 3N9MA 5FXWA 3BQKA 4YHJA 4TV9E 3OJAA 3VKGA 4XDOA 4Y4RA 3L09A 4HKAA 4DVDA 2K24A 3KFWX 1MMNA 2CM0A 4EYUA 5HWXA 5L3FB 5FYVA 4UVCB 2ZM8A 4WBNE 2VKHA 5FZ6A 1MMAA 5F32A 5IYZE 3KVBA 2YK0A 3CX8B 4GIWA 1MNDA 4IGUA 3ZCJA 1HG5A 4AQFC 2MOZA 5L3EB 2VB6A 2CXLA 5DQWA 4QU1A 3AA7B 5FPVA 3RX6A 5A1FA 5LBQB 4CCOA 2Y8DA 2SPCA 3QK6A 4ISTA 1MMDA 4OFZA 5FMNA 2VL8A 2GP3A 2L3LA 5FUPA 1B7TA 3BK9A