4DO0A

Crystal structure of human phf8 in complex with daminozide
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
363
structure length
363
Chain Sequence
VKTGSPTFVRELRSRTFDSSDEVILKPTGNQLTVEFLEENSFSVPILVLKKDGLGMTLPSPSFTVRDVEHYVGSDKEIDVIDVTRQADCKMKLGDFVKYYYSGKREKVLNVISLEFSDTRLSNLVETPKIVRKLSWVENLWPEECVFERPNVQKYCLMSVRDSYTDFHIDFGGTSVWYHVLKGEKIFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVDKCYKCSVKQGQTLFIPTGWIHAVLTPVDCLAFGGNFLHSLNIEMQLKAYEIEKRLSTADLFRFPNFETICWYVGKHILDIFRGLRENRRHPASYLVHGGKALNLAFRAWTRKEALPDHEDEIPETVRTVQLIKDLAREIRLVED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone lysine demethylase PHF8
source organism Homo sapiens
molecule tags Metal binding protein
total genus 103
structure length 363
sequence length 363
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2012-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4do0A02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4do0A01
5FYCA 5F3EA 5FYVA 2Q8CA 4XDOA 5E6HA 5FPAA 5FYUA 5FZ9A 5FJKA 5LWBA 4LIUA 2YU2A 2XXZA 4QXBA 5FUNA 3PUSA 5FWEA 5ANQA 3PUAA 3PU3A 4LIVA 5FZCA 5FXXA 4QX8A 4UF0B 5FZOB 5FPVA 5F5CA 5FZKA 4QU1A 5FY4A 5FZHA 4IGPA 4AAPA 5F3CA 5A80A 2YU1A 4GJYA 5A7NA 4GJZA 3RVHA 5FP7A 5IVFA 5FP8A 3PU8A 3N9QA 5IVEA 5FY7A 3PUQA 5FYIA 5FZBA 4CUGA 4IGQA 5F3GA 3KV5A 5FZEA 4IGOA 5FYMA 5ISLA 5FJHA 4Y33A 5FBJA 5FY0A 3KVAA 2Q8EA 5LY1A 4LXLA 4XDPA 2XUEA 4QXCA 3N9MA 3AL6A 5A7OA 2P5BA 5FZAA 4CCMA 3LDBA 4QX7A 4V2WA 5FZIA 5FZ8A 4EZHA 4TN7A 4URAA 4LITA 5FZLA 5FZGA 4D6RA 5A7QA 3KV6A 5FZ0A 5FUPA 5A3WA 5LW9A 5FYBA 5FZMA 4EZ4A 3UYJA 1VRBA 4CCLA 5F2SA 5FP3A 3LD8A 5FXZA 5FP9A 5FZ1A 5KR7A 5FYSA 5FYHA 4D6QA 5FY8A 4Y4RA 4HONA 3OPTA 2XDVA 5FY9A 3PTRB 5FY1A 4EYUA 3DXTA 2YPDA 3N9OA 2GP5A 5FXWA 4CSWA 3K3NA 4Y3OA 5A7WA 4BU2A 5IW0A 5K4LA 4CCKA 5FWJA 2YBPA 3KVBA 2OQ6A 5IVYA 4HOOA 3AVRA 4CCNA 2YBSA 3ZLIA 5A1LA 4AI9A 5A7SA 2XMLA 5FZ6A 2PXJA 5FPBA 5FZDA 5FZ7A 3ZPOA 4CCJA 4NUBA 5F39A 2GP3A 5LY2A 4C8DA 3OPWA 3U4SA 3N9NA 2Q8DA 4GAZA 5F5AA 4DO0A 5FYTA 5F37A 4E4HA 5IVBA 5FZFA 4DIQA 5FZ3A 5FPLA 3AL5A 2W2IA 2YBKA 4BISA 3K3OA 3U78A 2OS2A 2OX0A 3PDQA 2WWUA 5IWFA 3N9PA 4D6SA 5F2WA 5F5IA 5FZ4A 5FP4A 5F32A 2OQ7A 3AVSA 3NJYA 3K2OA 5FYYA 4V2VA 5FPUA 3PURA 5FV3A 5FY5A 4UF0A 5A3PA 2OT7A 2VD7A 5FZOA 3DXUA 5A7WB 5FXVA 5IVCA 5IVJA 5F3IA 3KV4A 2WWJA 5FYZA 4CCOA 4QXHA 5CEHA 5A7PA 4QWNA 5IVVA 3N9LA 4ASKA 4GD4A 5A3NA 3KV9A 4BXFA 5A3TA 5A1FA
chains in the Genus database with same CATH superfamily
2ZZJA 1CZSA 4K3UA 5JDNA 4N53B 1VMJA 1HRI3 1ULCA 3NQHA 3ZN0B 1EY2A 4NWVA 4PJYA 2PTFA 2VQET 4K21A 2MEV1 4CZSA 2LSYA 2UWAA 3PUQA 4EV0A 4CQIA 2E9XC 5L7OC 1KDMA 4DR2T 1HS7A 2JKXA 2HWF1 3OJBA 2XBO3 3W21A 3N36A 3AE2A 3WF0A 1X8MA 1RTVA 5IT6A 1YFUA 3ANWB 4GKYA 4HN1A 2R0HA 3N9OA 3AE8A 2H7VC 4A6OA 2VUJA 2YBPA 4R9AA 2NPIA 1BR0A 2W67A 3ETVA 4ZHNA 2M6BA 1VRH2 2YPJA 2FJDA 2X09A 2OYZA 3OUHA 2BG9B 2Z2SB 4A44A 5F37A 2YC2A 3WVJA 2LOSA 4IEOA 3VBHC 5C4WA 3KS7A 3DCQA 3GF6A 4I2OA 1D1AA 1UCXA 4XFAA 1BMV1 1H9PA 3AAIA 2XJSA 4N43A 4UT5A 3J7MA 2RS31 1XNRT 3HN1A 5B4NA 2UYAA 3V0AB 2J47A 3TEZA 1NOVA 1D0GA 2CAVA 2F4LA 5L3EB 5EYYA 2WZEA 3AEFA 1OI6A 4YVWA 2ZGNA 5BNPC 1VRH3 2BEOA 2LKGA 2B5HA 4NUVA 1CJDA 1F8VA 2X0HA 2ID4A 4W6WA 5JRCB 2E9XD 2H6CA 4XCAA 3G7DA 3LOBA 1N3OA 3ZYPA 4C91A 3C64A 3WQ1A 4LF4T 4CSWA 5DDJ2 4HVQA 3ZLIA 4HKAA 1AL0G 3ZN5A 2KNDA 1CN1A 5CNAA 4RFT0 1OA2A 2VMGA 1O4YA 4IXLA 1JBCA 1J3QA 1VCSA 3R0RA 2N9DA 5KXEA 5L47A 4S2HA 2NZ9A 4CPBD 4ZS2A 2OW4A 3VDBA 2D97A 4FPOB 3IBPA 1H2NA 3SRZA 5FQ0A 4KQ7A 4FFFA 2BKOA 4QM9A 3MEPA 3CK6A 1UIJA 5C7GA 3D6EA 3UGGA 3LB9A 2RA1A 2V6XA 4ZHQE 1Z7S3 1RJ8A 2BVMA 3O1OA 5FK7A 1RMU1 1EUTA 5DDJ3 2WQYA 4IT4A 1AR92 1RUD2 1GOFA 4CU8A 4BAYB 2JQ9A 4Q25A 3POFA 1RJ7A 5FZAA 3AKQA 3WP6A 2VOXA 2ET7A 3RRCA 3WINE 4CZZB 5ABJA 1NCRA 2BKNA 4PBPA 2J1SA 1K45A 1HRV2 2YBSA 2VKHA 2QQJA 4RQPB 4L0RA 1UNBA 4UYBA 1RIRA 4JGZC 4YW4A 2BGPA 3FUQA 3VZMA 3AP6A 3LKJA 2W9XA 2R6QA 1FV2A 4QPIB 4CDUC 2ORZA 4YSFA 1AR93 2BZBA 1RUD3 3WI3A 2X5IA 4DR1T 3A7QA 2D3SA 3RYPA 2L3LA 1O8PA 1MZ5A 2IFWA 3ASIA 3KV9A 2QGSA 5A3TA 2VVFA 4NIAA 3MV01 4LIUA 3I3BA 3CU7A 2VTFA 1UYXA 1ENXA 5FZHA 4M01A 4XJUA 5CFDC 1CHUA 4IEXA 1MIYA 1IAPA 4BWOA 1HRV3 3ZXKA 2EA7A 3GN5B 4DFSA 2XQXA 4AVAA 4CI1B 2OZ6A 5JIAA 4W8JA 4TN7A 3T2OA 2QE3A 4PNIA 1ZZCA 1W3XA 3N7KA 3HA4A 2ATFA 4FXGB 4LBLA 1UN1A 3TEWA 1D2SA 1F35A 2KXPB 3CKHA 4TLFA 5A3UA 4ZXLA 2NMOA 1UU4A 5IFPA 4TWTA 3GZAA 3Q8AA 5KXJA 3RHWA 3ZFGB 2XWJB 5FZFA 2D5UA 2RJKA 1ZM1A 2ADDA 1WRDA 4NOTA 3QH6A 1OA3A 5F5IA 5BUVA 4ARXA 3NKZA 2Y38A 4A7YA 4LOSA 1ONAA 4DEVA 5IVJA 4M3CF 4YARA 3M3QA 3T2QA 4WYVA 2BOIA 2WBKA 4DBRA 1T72A 1OKQA 1IS5A 4LHSA 1H8TB 2DWKA 4AW7A 1MS1A 1YHFA 5K0UA 5JR9A 1RUH1 4HVRA 2WNUC 2RDSA 2ACXA 3MZHA 4X1KE 2GMPA 2RR11 2HWB1 3S5QA 3RS6A 3RWKX 4FI5A 2PN5A 4JBWF 1LULA 2GNMA 1HB4A 1MMGA 3TBDA 4IW3A 3I9WA 3QB5K 1GQGA 3WNMA 1TMF2 3MICA 1IHMA 4K8RB 5FO9B 4WM7C 2DU1A 3NV3A 3MYXA 4LKEA 1AR71 1OQEA 4GIQA 5HXEA 5FTTC 1GQHA 5JDMA 1DBNA 4PJJA 3M3IA 1LENA 3EYPA 2XAJB 2ZXQA 1OH3A 1WMDA 3WUCA 3BUCA 4OZXA 1PGL1 4CTEA 1WKYA 2E5VA 2F17A 3RX6A 1FPN3 1TVGA 2W2UA 3EDVA 5ACA1 4LF8T 1TMF3 4B3TT 3SH4A 5D21A 3IZOA 4GYRA 3LA2A 4Q4V1 2WIIB 5FYIA 1L0VA 2L8KA 2JMKA 2G4IA 2HJIA 1VBD1 2RVAA 2KR2A 4YFSA 2B9VA 2V8SV 4A5XA 3VR9A 3UKNA 2I74A 5LW9A 2XB6C 3B9IA 4ZKTB 2CEAA 3M8LA 4IDZA 2XJVA 5FXWA 1XXNA 4RL7A 3APBA 1UXZA 1CWPA 3OBVE 2XVGA 5IATA 5LBEA 4MX3A 5F1RA 3AE5A 4NUBA 2GN3A 5JAXA 1EZ3A 5F5AA 5FYTA 5L9BA 1PVC1 3WHUA 2XSBA 4K0UA 1AR82 2WZ8A 5L9RA 1I5PA 2V26A 1YFYA 4DUWA 5IAVA 4LMLA 1UW8A 5AQJB 4QD2A 4GH4B 2NR4A 4AEDB 1BZWA 2MYSA 1Y01A 4Z82A 2HH7A 4EEBA 4IV1A 1R1A2 1WA6X 3RIUA 4YW5A 5AQFB 2VTXA 3W9AA 1YIPA 2G9ZA 2Q9QB 3CQGB 4X62T 2OV9A 1GR3A 3W59A 4XACA 4YY3T 4U3CA 1GANA 4FPHA 3AEGA 4JX0A 1AR83 2XJUA 4K7JA 4XQWA 4UFHA 2C5DA 2CHHA 1W8OA 4EWAA 4DV0T 3Q9OA 4U31A 3I3EA 1GZTA 3OPTA 1XZYA 1RUC1 4JC1A 1LGNA 3OYWA 3LF7A 1FJGT 4YW3A 1E5RA 4DY5A 5EZWA 3UULA 1VB4A 1JTZX 5FPBA 2VQUA 3WP3A 3MJXA 1CAWB 1XNTA 4DO0A 5LBQB 1GWKA 3GYDA 1SBFA 1R082 4YJ2E 2K0GA 5DAWA 2BBAA 3KF5A 2WWSA 2R16A 4LBMA 5GLVA 1KGYA 3FZKB 3WOGA 5LK5A 4AXOA 1QIQA 2BBHA 5CBLA 1XWMA 5FMOS 1MIWA 1AXZA 2LKHA 2WAUA 3O1TA 3BTYA 3K3QC 5LA0A 4OHVA 2ZGQA 4QB2A 4A7ZA 2Z42A 1W0PA 2EHOC 2WDBA 4QT6A 4D94A 3ES1A 2OKXA 2FHRA 5LCWL 3POBA 1R083 2K2SA 4BJMA 3H7YA 1ULOA 1WLTA 5CISA 3ONLC 4Q4X3 4AK3A 1NA1C 3KBTA 2GMMA 4IEZA 5FY8A 2GP5A 3CX7B 2CLYC 2XKOA 4IEQA 4NHMA 1BQPA 2PXJA 4CP9B 1ND2A 1PM4A 4GAZA 3PV0F 3LK2B 4Y5Z0 1A8DA 2ZHLA 4DIDB 3VBRC 2BZDA 1RC6A 5KDMC 3K4ZA 4TLGA 3HNMA 2DNXA 2B8MA 1MMDA 2X10A 4GULA 5A3NA 5C8YE 1ZRRA 2ETEA 3KMHA 3RRWA 5FREA 1QJY1 5FPAA 2V6YB 4Q1RA 3ENRA 3WCSA 5HXMA 5LP6E 2DFBA 5ANQA 1PM7A 2W94A 4EJRA 3WSOA 2E2AA 4DQAA 1Z8UA 1SQ4A 3Q8FA 2ZHKA 5AQMB 2CA5A 3KV5A 4QX1A 2F6BA 3Q5EA 3RI8A 2R072 2H0VA 1X36A 3ZSKA 1ENRA 5JCTA 1X7NA 3S5AA 4HN0A 2WO3A 4XE9A 3OOXA 1CAUA 4HE8A 5J3UA 5K4LA 4FSJA 3ZMZB 1W2AX 1W6OA 3NJZA 4IETA 3HEIA 3IT8A 4AWDA 3RFRA 5L36A 1UOJA 2D7FA 2NN8A 1KNPA 3T4HB 3PUWF 4W6YA 2OX0A 3OYXA 5AFBA 5LA9A 4ZI7E 2B1EA 1OOPC 2XJ7A 4Q4Y1 3SEEA 1W9YA 1MS4A 2ZS6B 2K46A 1IBMT 1HLCA 4XF1A 3SKJE 3C4ZA 3GBGA 3J9X1 2XG3A 2VNGA 2CM0A 4WBNE 3P3PA 4YTMA 5FJKA 4FFGA 1UL9A 2CWYA 4QPGA 2K5BB 4FQ4A 5FZOB 5FPVA 3PVEA 2A70A 3MA9A 2Y6FA 4QU1A 1MMAA 2YKSA 4H63V 1VBB1 2Y8DA 3EI0A 4YTPA 1W09A 2PG8A 4ET7A 5LEJA 4MGYE 1IZ3A 1BBT1 2XQYA 1DQ2A 5FKYA 1R8IA 1JZ8A 4PIZA 3HL6A 2VOTA 4NR1A 3R4SA 4YFWA 3H0OA 2ZMKA 2BNMA 3I49A 5K9YA 1TME1 5D2AA 5HXVA 1DYPA 2E9XA 5L7OA 4WVZA 3ZYBA 4F8HA 5LB6A 5FMNA 2G9GA 2UXNB 1IGOA 1BK1A 4OI1A 1ASJ2 1XE0A 2NW9A 3O14A 1PX3A 3N3HA 3AB3B 4LULA 1JYCA 1KFXL 4O2BE 4X6QB 4YM1A 1D2QA 2Y6XA 3ZSJA 3GALA 4B1MA 3UKTA 1DG6A 4CPBA 2DHRA 3HNBM 2RJ2A 2VMEA 2VKJA 4XXPA 2FBEA 2HWD2 4X20E 1Z78A 1H1IA 4U33A 2WDVA 3ACHA 3LEIA 2WY2A 4XF0A 4BQXA 4AKLA 1JYIA 1VE0A 4YYOA 2DL1A 3SNMA 2WINB 2JRKA 1SG3A 4AI1A 4Q0QA 3QD6A 3D5OA 1W04A 1ASJ3 5BNNB 5EIYB 4LBQB 3IF8B 4A4AA 4HWHA 5AFUL 2P34A 1QGLA 4P0BA 4ATFA 2XAHB 1VB2A 5FZ7A 2NQYA 3LOIA 2MPFA 4LBJA 1PVXA 2PMWB 2HWD3 2OXBA 3IPVA 3J7LA 3SCGA 4YSYA 1XNQT 3OEAA 4J25A 4OHZA 3TNQA 2FJEA 3S30A 4HPKB 4UEMA 2SBAA 3OJAA 2YU2A 1NY71 2R6GF 4IE0A 3I59B 4EWEA 3NBXX 4Q8KA 2WSSV 2ZHMA 1O3QA 3ZXFA 1OD3A 3AAEB 1UUSA 3AC0A 2HWE2 4Z90A 3Q5WA 5C5UA 1UX6A 5IVEA 5IK4A 3AA7B 5F5WA 5JSRA 3F57A 2WT0A 3LCPA 3WDYA 4ZZBA 4Y1UA 1QDOA 2R043 4HFVA 4MLKA 1X9TA 2UXCT 2PLV1 2CY6A 5JZGB 4QU2A 3ZN1B 1A8MA 2E7TA 4UFKA 1DQ1A 3KD4A 1GQEA 3L39A 2XJPA 1DF0A 2VMHA 1W9WA 3O7OA 4UVBB 4JI1T 4W6XA 4UW3A 3A4UA 2PELA 2RM22 2Y6KA 3GM8A 4GWMA 2AYHA 5JR7B 2A3WA 3ACIA 2VCAA 3O1UA 3PUVF 2ERFA 4GB31 4P9GA 1HB3A 2HWE3 3AVSA 4D7YA 3PUGA 3MIDA 4EN6B 2YDSA 1CESA 2QDRA 4P9LA 1Y9GA 3EBRA 1PGSA 2ODUA 1BKZA 2KMFA 3GZUC 4URTA 2IW5B 2WLPA 4FT8A 5JREA 2XXZA 1R091 1UZ0A 2HEYF 4L2NA 4HFDA 3AX4A 1M62A 3USSA 1POV3 4O4LE 5A80A 2W95A 1W8ZA 3TEYA 2XKPA 5AQRB 1GZWA 1QLBA 2I0MA 4WVMA 4BPZA 1WCKA 3NAPB 4QX0A 4I02A 1O4TA 5HV0A 4NRPA 1YWKA 3I2IA 1VR3A 2YMZA 4AQFA 5SV5A 1OH4A 2CXLA 3VD5A 4AI2A 3WF2A 2O14A 3QOPA 5JDFA 1GNZA 4YVSC 1SE7A 1NENA 1RUJ1 2XQRA 2JG8B 3BALA 2D93A 3IKWA 5JXJA 3DL3A 4CEWB 1W2OA 4WM8A 3C7HA 1AYN1 2OUJA 2H0BA 1X9BA 1GP4A 2R0FA 1D4M3 2XH6A 4AEJA 4COUA 5FV3A 4YM3A 4P9WA 3Q5XA 3ECQA 1LVFA 5M4YA 3ROUA 3MIEA 3WV6A 3HIFA 1KDKA 5JOXA 3VZKA 4PFPA 1I9RA 4CCDA 3IBMA 4XUQA 1TQ5A 2RV9A 4DNDA 2A9UA 4CDWB 2LSGA 1ZBA2 1DU2A 4IV3A 5FO7B 2FDHA 3N35A 1QOSA 3CJIB 2XHNA 5A6YA 4AVTA 4CYDA 1AX2A 4B3ST 5H9RA 3FHAA 3AEDA 3JC6C 1ULPA 1XNKA 4NIDA 3CHXA 5A3WA 4OI0A 1WMEA 1UPSA 5CKQA 3AZWA 4KP3C 4BIFA 5I91A 3EHKA 1QOTA 3L9JT 3C50A 2MEV2 4HETA 3USUB 5T5OA 1Q8VA 5KHKA 4UW4A 3IIAA 3X29B 2WNUA 4QX7B 4OI2A 2DCKA 1AL22 1S1AA 4MGTA 1PIV2 3AL5A 2AC1A 2NWBA 3NNGA 2JDMA 1G6NA 1PGW2 1ZBA3 3NJYA 4FTEA 3ZSEA 5SV8A 4ARYA 5KBFA 4AQYT 4MALA 4A41A 3VBOB 3KV4A 1ENQA 2CGPA 2VULA 4NAMA 4XFGA 4DV4T 4K6BA 1DYOA 1F5JA 2VMDA 4DNYA 3LA7A 3KHBA 2ZX0A 1S0BA 4XZCA 4FOQA 1UYZA 2MEV3 3EJKA 5I0SA 2JB8A 3BYWA 4QWNB 2D6NA 2UWCA 2CV6A 1HIXA 3WDVA 1OMIA 3DTOA 4I0UA 3GCWA 4RQPC 4CDXB 1BMV2 3PIGA 4DUYT 4OI4A 3B02A 1PIV3 3LEMA 1S0EA 2CSGA 3SISA 1LGCA 4LF9T 4LBOA 4LO7A 2BJSA 1QKQA 2XLAA 2Y34A 4QPIC 4U2YA 2GDFA 5FYSA 4QM8A 4ZI3C 4GKJT 4NHXA 2WNOA 4XQ4A 3BU7A 4NHYA 2X0YA 3WW4A 3S0MA 1Z0PA 5FWJA 2OQ6A 5T54A 3TLVA 1OVSA 2WO7A 4Z2WA 4W65A 1BEV2 1XJAA 3VGIA 1WR0A 3VHLA 3TAYA 3QB5A 3ZMNA 2WDQA 5FKCA 1ZBE1 1I6ZA 2WM9A 5FMDA 3UUXB 1HXS1 4X1YE 2XQ3A 4LHLA 4BH9A 4YW7A 1VMFA 2B46X 4M4RA 4KBBA 1HB2A 4XTPA 1U5YA 1LOEA 2ET1A 1NYWA 3PUHA 4DV1T 5HEJA 3VZJA 4SLIA 5ABFB 1G8WA 4RD7A 1ZKEA 3K4DA 4IGOA 1BLZA 4BOWA 1BEV3 4E8DA 5EK2A 5C8CA 1CVNA 4QPWA 1D4VB 4LK7A 4DXRA 2D5HA 2DCZA 1ZEEA 4CA9A 1LHUA 2PFVA 4GK5E 2XDVA 1FIOA 4AE2A 1QNWA 2YROA 4XUTA 2WUHA 2UXBT 3W5NA 1LU2A 1OLMA 4BU2A 5EV7A 5KHJA 4JV5T 2VCBA 3ZFFA 5LYJE 2JDYA 2XL7A 2AREA 3BPZA 1H8TC 1Q3EA 3OPWA 3FLPA 2YEVC 1EP0A 4Z92B 1UOGA 2ARCA 3M4FA 2CWMA 2LLYA 2W08A 1Q5OA 2WR9A 1PMJX 2QQIA 2VE1A 4LKDA 3O5SA 1PZ9A 2JKBA 2Z4FA 3VD4A 5JPNB 4COYA 1WA4A 3R05A 3AB0A 3SEPA 1TNRA 3LAGA 4JTOA 3MUZ1 1YEWA 4FQZA 4EV6A 3QNUA 1RMU3 1NQDA 4X8PA 4R9CA 3VBUB 1BCXA 1LHNA 1MIVA 2XL9A 1WLCA 3G6JB 3VB9A 4AVBA 5DG1A 4OYKA 1W0NA 5E8AA 2W5FA 3O0VA 3ZXGA 2PQQA 3BTAA 3RC3A 1UOBA 5DAPA 4PF5A 4YGBA 3FZFB 3LD8A 1R64A 5KC5A 3NNLA 5FY9A 5C5TA 3NL1A 3P4PA 4G4FA 3QK6A 4NPPA 5A7SA 3NNJA 1VAVA 4DIQA 2UY9A 4FP2A 1NA1A 1VBE2 2ZEXA 3B13A 2BW8A 4LBKA 4Q4W2 4CCOA 2C5IT 3TN91 4OK0A 1W9RA 1H7CA 3WCRA 1E57A 3NV1A 1YFXA 1PNGA 1RUG1 5C4WB 2VXRA 5F8PA 4RR3C 3GBFA 3M1HA 3MK7C 4HL0A 1UKGA 2HYKA 5IVFA 1MPXA 3MI8A 2V73A 5GM0A 3PHMA 2DFCA 2PTMA 2Y33A 1GKBA 1Q56A 1O3XA 3MBWA 1Q43A 3MLKA 3O1VA 3JCIA 2A6VA 1VBE3 3EO6A 4Z91A 4YVWB 4J2CA 3IEEA 4XW3A 4Q4W3 4KL1A 4P00B 1RUH2 3M3EA 3HT1A 4AEDC 5FLIA 5EP9A 4UOJA 3CWZB 4P1NA 1J3PA 2WYFA 5EQUA 1GV9A 4MOAA 4JI2T 2Q9QC 2E7AA 4XEZA 2NYYA 3WQ7A 2J62A 4HVOA 2GSYA 5L4EA 2WRAA 3U14A 3L3PA 4C0BA 5J2TE 1N3PA 3MFAA 4LFAT 1VAKA 1OXCA 4KWJA 3HQXA 4AHZA 5BY5A 1OA4A 3RZJA 2QBXA 3NJXA 3RDIA 1XSQA 2P3JA 3MIHA 1AR72 1MNDA 2AGSA 2JE8A 1RUH3 3E22E 2WS3A 5FQ0B 2WFPA 5BXXA 2MOZA 3I7DA 4HFIA 5FKBA 3WDXA 1EYBA 1OUSA 5FZEA 2RR13 4AVCA 5GLZA 2HWB3 1V6NA 4XFBA 2ZOEB 4LUKA 5FK8A 1W0OA 4LITA 2VCCA 3ZO0B 3KGZA 3VD9A 2C4XA 5LHHB 5LG3A 1XMQT 1PMIA 4SBVA 3H8OA 3JD71 5LA1A 4NXNT 3V56A 3O1PA 3WQBA 1UY0A 4Y3OA 3VU7H 1KS5A 1PHMA 1IPSA 2QQUA 4RS5A 5F39A 4XFHA 4DR3T 1AR73 4JQRA 4L97A 4XFCA 5CYYA 4XBQA 3CIHA 2D6KA 1XRUA 5DN2A 5EZYE 5DQVA 3C7FA 3VKFC 5ABJB 4W50A 3PTYA 4UF0A 1NCRB 4HFHA 2JD9A 2BVLA 1DGLA 2UUBT 4HKLA 2QQLA 1SPPA 4XILA 2WP9A 3RC8A 3ES4A 4Y26A 5F3EA 1IJ6A 1YW0A 2D0UA 2K9AA 2YN6A 2X5IB 3WAKA 3INAA 1QJU2 3RI9A 1KITA 1CX1A 4CUGA 2WNVC 4TYSA 3UETA 1YQCA 2DURA 3I0OA 3CPZA 4WZCA 2DVGA 4BZ4A 2VQAA 3ELNA 2JG9A 1O6UA 1YQ4A 3AJZA 2WN3A 2YDRA 4MGKE 2XQ4A 1V6IA 1FMD1 1UIKA 2DVFA 3U10A 1OLME 3HQRA 1T98A 2XM2A 2HH9A 4AQ2A 5HPOA 1N1SA 1PVC3 5FLHA 3P4SA 4Q2FA 2XQAA 4COZA 1QJU3 3ABZA 3G06A 2WN2A 3PMEA 4DMIA 2DWRA 4Q0UA 4COWA 3E5XA 3P4RA 3LFMA 2QQNA 5FPXA 1HNZT 2LALA 1AX1A 1N32T 2WQZC 4FOYA 4HXCA 3ZT7A 3OEBA 2I6HA 1YIFA 3QACA 4MHUA 2ZAHA 2IZWA 3WY6A 2WO2A 2V5YA 1RUNA 4V1PA 1ULDA 1LODA 5IK8A 1EV12 1WCUA 1VBA1 3QBQA 4PCRA 5EJ3A 5K0UB 3O0XA 3O1SA 3FJSA 5JR9B 2FMDA 4UVAB 5E89A 4PAGA 5EWSA 4LHNA 3T1MA 2V4AA 3ZYIB 3NKGA 5LGTB 1ZZ8A 2WSVA 1V9U1 3H37A 3H3MA 2WQ4A 4LMKA 1JNRA 1CR7A 4A2UA 3BKZA 3K1SA 5D8AA 2JIGA 1IPKA 3R6NA 2B45X 4PLOA 2RS52 4D6SA 4LJHA 1JYVA 3D0TA 5FPUA 2GALA 4OVEA 1EUUA 4LMFA 1D0XA 2VZPA 2XLGA 1HQWA 2LRLA 4CXXA 5FYVA 4H9RC 4MHRA 5JVVA 3PUAA 1QJFA 3FN9A 1QWRA 3WUDA 2AH2A 2BQPA 3I2DA 1SLCA 3AYAA 2X9YA 5T3NA 3K4AA 4IREA 4GKKT 3AK0A 5C9AA 5HBAA 4GOUA 1FOD1 3AFKA 4PW8A 2RS53 4ISTA 3A0KA 3RYFE 2FUPA 3GZEA 4IEVA 2TUNA 2CYFA 3M3CA 4UFIA 1WCDJ 3H8XA 1U12A 3QOFA 5IYZE 4XETA 1JI6A 5DXDA 3FZMB 3KWVA 3ZFEC 2JEMA 2BKPA 2BRTA 1W8FA 5DUWA 3ZCIA 1XNDA 3LA3A 4HT1T 3P50A 1REFA 1RUI1 2XJRA 3POEA 3SFDA 2NP0A 4E7SA 1O3TA 3IDEA 3DXUA 4JDMA 3CDZB 1BJQA 2JDAA 4A45A 4YVSA 4AHXA 3GHNA 1DP0A 2QZ2A 1T6GC 4DR7T 5ABGA 5BNNC 5J2UE 4L11A 3WX5A 3PUSA 4ZOLE 1IS6A 3OVUA 2JECA 4R9DA 4GK0E 4BHPA 4AAPA 5AQHB 4COFA 4ZU5A 1I3HA 5FAXA 3KFWX 3TYJA 5LJNA 2VUDA 4WNKA 3Q2MA 4IV1B 1KF6A 5FBJA 1V6KA 4MSVA 3DYPA 1J84A 4NHKA 5H6RB 3AZVA 2JDPA 3OGJA 3CF6E 2BBVA 2N7GA 1GNHA 4OX9T 4NPMA 1ND3A 2RG4A 2ZGLA 5AQLB 5K7PA 1CPMA 3KF3A 3LGRA 4IE6A 5AQNB 2Z6EA 3PJAA 4OHYA 4KNCA 1S2KA 1IBKT 1GNYA 3UGFA 3I2JA 4MZUA 1W6MA 4M3CA 4RN5A 4MHCA 3B69A 5LRRA 4CN1A 3NKTA 3NVCA 1W2UA 3I2OA 2CHNA 5JDLA 2HWC2 1QHDA 4AEMA 2VMFA 4E7ZA 2WS92 2X68A 2W87A 4Q4Y3 4WBBA 3OYWB 1HQLA 4CXYA 1JW6A 3FX3A 2OT7A 2QQWA 3ETPA 2PA7A 2PHDA 4LKSA 2IXHA 2VU9A 5DUUA 4YRDA 5DUVA 5C3JA 1TME2 3RRDA 2W3JA 2V7KA 2YFZA 2WO1A 2XY8B 2ZGKA 5JZGC 5LXTE 1WFDA 4QKDA 4IL7A 2O8OA 4H9SE 1ULGA 1MS5A 2ADEA 5AQKB 1WCRA 4LE3A 2YDQA 3CLPA 4IGQA 3WAJA 1MZ6A 1ALYA 2UXDT 5T5LA 2HWC3 1W3VA 3TEXA 2EIDA 4Z07A 2WS93 4YHHT 4M0HA 4K0KT 2XZEA 5FYHA 4YSXA 3PTRB 1CZTA 4L0PA 3UK9A 1OBNA 5C2TA 1TME3 3UQ4A 4FFHA 1APNA 3RZHA 1LHWA 3EXUA 3ZVXA 1UKRA 2VR4A 5HCAA 4BISA 1K5MB 4V2VA 5FY5A 4R4ZA 3UUNA 4E4ZA 1KFYA 4CVUA 5JMCA 5FFOC 2P6CA 2WAAA 1ND2B 1OURA 3ILRA 1SLLA 3DECA 4JGYC 4DOUA 1OVPA 4RGKA 1QMJA 4FI9A 1E5IA 4J1XA 1ZRDA 2O0OA 5F5CA 2OZJA 2O8QA 4NAOA 4CE8A 2JG8C 3R4UA 4XJ9A 4HFCA 2FCVA 5DUXA 1OD5A 4CEWC 2YGLA 3ZMUB 2ARBA 5EHDA 1GSLA 2GC2A 1DGWX 1PO22 2LHNA 2DBNA 3J7HA 2ZGUA 3AA1B 2KA3A 1MS8A 4OLLA 4CCMA 4OQ9A 1JZ5A 3VRBA 4E2GA 3VHNA 2VUAA 3MHZA 4DV5T 4Y1ZA 3RKOA 3DGTA 4HONA 5JSPA 4Q0PA 2HN1A 1VRH1 2WFF2 3K77A 1EAH2 3K3NA 1XNCA 3FC0A 2ZEWA 4CCNA 4LK6A 2XWBB 3P4QA 1GQPA 2ZABA 3DN7A 4L5GA 1NLQA 4BA9A 1KD7A 2WWUA 5IWFA 3MKDA 1CAUB 3RH3A 2DCYA 2C6SA 4YZ4A 5JTGA 2YK0A 3UUBA 1UZYA 1DFQA 4HG6B 3CJIC 1W6OB 4IQPA 4ZI2C 2PHFA 5JOZA 5HYAA 2FZ1A 5BNQA 3ACFA 4ES9A 3POYA 5H6QB 5C71A 1LCLA 4DVDA 4FPGA 2CCQA 3RYKA 4XYXA 2VNVA 3QH7A 1DDLA 2WFF3 5IUQA 1EAH3 3VKMA 3B94A 1VALA 4P9YA 3JB4C 3QCWA 4EIWA 2W1QA 3DPRA 4IESA 4QPGB 4EZHA 1IJ5A 4Y24A 5L73A 1R092 1VRBA 5F6LB 4AISA 3JQWA 4Z8BA 4HTEA 5LBMA 4C1WA 2W00A 5HWXA 5KHGA 3VBOC 4B29A 1H6YA 2Q0AA 1YCIA 4LQRA 5LBCA 1ACCA 4JI0T 3RQWA 3SMHA 2LEHA 3E6CC 3F95A 5J48A 1GLHA 2EXHA 5BMVE 3U07A 2HBUA 3CMLA 1HR0T 4LF7T 3BQLA 2LE8A 2VJXA 2E9XB 5L7OB 1NE6A 1WZXA 5IVVA 1O5LA 4BIOA 3UT5E 1YD8G 2JQQA 1R093 1M06G 1KK7A 1ZA4A 1Y7BA 5LBBA 3ZKYA 1RUD1 2IHR1 2XM1A 1QH7A 4PDWC 3WNKA 4HWDA 5FP7A 3CNAA 3TLSA 2VZ3A 4XUOA 4FPJA 4DR5T 4QDQA 5E88A 1YKHB 4IL9A 4DXZA 4TTGA 3AL6A 5A7OA 5BNOC 4YWAA 2LJLA 5EK4A 1RUE1 2FD8A 4G2AA 5HXRA 4KI5M 1RUJ3 2V09A 2XBO2 4ONUA 4RR3A 1HRV1 2QQVA 4I0WB 5IHRA 4E2SA 4CEYC 3ITQA 4M3CE 3FZHB 4BK4A 1MACA 4P9JA 4KGQA 4NE9A 4QMAA 1NCQA 3GJAA 4YXDA 1NKGA 2JE7A 3J8F2 4IEYA 4ADZA 3C7OA 3H9AA 3V0BA 4N9IA 3LPGA 2PQSA 3O12A 4XAAA 5AQOB 2Z5WA 3CQOA 4KH9A 4TXWA 4KMCA 1I6XA 1N33T 1XU1A 1W8TA 3IPVB 4EROA 3FBMA 5L3BB 5BPXA 4O2AE 4COVA 3AMHA 1GWMA 1G9AA 1AYM2 2PHLA 1Y43B 2C0SA 1BXHA 1HTJF 1UOFA 3A23A 1J5WA 3OY8A 5LY1A 1S0CA 3TB0A 5AC92 4FPLA 4H9NC 1U5PA 2VMCA 2JMHA 5FNVE 4JQTA 3J8F3 5KR7A 1W03A 2WJSA 3FHNA 1F4AA 4HSJA 3LK3B 2ZJCA 2D3PA 1XNBA 5IVYA 3D0JA 1S94A 3SHRA 3MACA 1QOOA 3ESLA 2VZQA 4XJ8A 1X82A 1GP6A 3X1DA 4CI2B 3VBUC 2ZMNA 3RQ0A 1D0YA 1AYM3 1S0FA 3EHZA 3SC7X 1U5IA 1NE4A 1JZ2A 3C3VA 4BXFA 3N2GE 1LESA 5AC93 5HCFA 3M2MA 2VZTA 4YJ3E 1IS4A 5L4HA 3SOLA 4ZXEA 4IHJE 3EVYA 1UU6A 3MF6A 4AI0A 2IFRA 3WG2A 4ZZ8A 3GJBA 5ABEA 2CRBA 3C4WA 1US3A 1GFF2 2WZHA 3B9CA 1AXYA 5FY7A 3BVCA 1F9KA 3UNPA 3KQRA 2A72A 1OEDC 1JHJA 1Z7S2 2ENRA 5IYYA 2VQ0A 3ZJ1A 5H9PA 2Q8EA 2DTWA 1I94T 2XUEA 3O4XE 4CDQB 4B7KA 2SLIA 3OTOT 5J1GA 2EALA 2UU9T 3AAAB 2JXAA 2B7YA 2VVEA 2KINB 4AI3A 1NZCA 2IXCA 4JTNA 4FJOA 1TMF1 1GZWB 1H2MA 5DMYA 4WVMB 1F31A 2D2SA 3SITA 2WNVA 3C2UA 5EJZB 5C4WC 5AQIB 4RSUA 1YRZA 2JICA 4A7KA 4L92A 3J7NA 1YNAA 5JMOA 1HXS3 1U0AA 2HN2A 2BFUS 3O1HA 1XB9A 4WM8B 1OLQA 3HT2A 2KXLA 5T5JA 1OF3A 3NWKA 4B4RA 2VNOA 5I8YA 1X8EA 4BQ3A 2ZGTA 3PUXF 3S7EA 4YVWC 1G86A 1DHKB 1W6QA 4AQ6A 2YZ4A 4N9HA 1NLRA 4GJZA 2RE9A 3FB2A 5AQSB 4GWNA 2NTXA 3KVAA 5AVAA 4IDPA 1F15A 4MGIE 2A3DA 2X29A 1COV1 1K42A 3WR0A 4YGCA 1SHWB 1GYKA 5FMBA 3DV8A 2XASB 3JQXA 5LG4A 5FXZA 4IV3B 1M4WA 4F83A 1C28A 1OQ1A 4LFBT 3ZSTA 5CA1E 1MQTA 3WD5A 4AI9A 4A3ZA 3HQUA 1AR81 3OUJA 1OC1A 2JDHA 4Y5TA 2VXJA 5LRSA 2D6OX 5JIUA 4MGSA 4WW0A 1HN1A 2D6MA 3N9PA 2XPJA 2ZM6T 4AQSA 1NXD1 2YC0A 4X6RB 2WAOA 1R1A1 3BGAA 2HEWF 1UK5A 1HJFA 4U2AA 4D8MA 3ZR5A 5CFBA 2IXJA 1ZZ7A 5FP8A 1ZZ9A 4I01A 3RZGA 2XUMA 2BTVC 2JQHA 1JOPA 2GH2A 3NJVA 4RGGA 2LM9A 2GC3A 2ZA9A 4IE4A 2KWIB 5A6XA 3PVBB 5ABJC 1NWMX 3SS1A 2ZM2A 5I0DA 3DXTA 4LA2A 1OUXA 1W90A 3OYZA 3JAEA 3ACLA 5A1LA 4HOOA 2RDQA 4JYAT 1R081 1AR61 3THTA 3AP7A 4J6GA 1V0AA 4XPVA 2PHUA 1HF8A 1UY3A 2CWSA 2V7LA 4CP2A 5FVLA 4JUYA 3WF1A 3EABA 2W66A 1SA0E 3TN93 5K8SA 2Y6HA 4CI3B 2UUAT 2VG9A 4UBGA 3JBG2 3AE7A 2GC1A 4Q26A 4IIJE 4AXPA 2B76A 2ORXA 5GZEA 3LQCA 3ZFEA 4FAHA 3T1YT 3P1IA 3FLTA 4Y20A 3I2HA 3JB8A 2QVAA 1D1BA 4NPRA 4X64T 4BLIA 1SBEA 2IUBA 3FMGA 2AEZA 2Y26A 1YXRA 1FPN2 1OLRA 4XUNA 4GMP1 3KGLA 1SFNA 5LGNB 2NOXA 4AHWA 5GLWA 1RVF2 5J0ZA 1WGPA 3JBG3 3K75B 5E16A 1T7SA 3ME2A 5C8CB 5A7WA 3LBXB 1LEMA 2LHRA 3HI2A 1UYPA 2QYWA 1B7TA 1D0HA 2VZ1A 4A42A 4X1IE 4WZFA 2OPKA 3ZKUA 3VBFA 5EFUA 3BOPA 2J42A 4BDVB 3WDTA 2XAQB 3NVOA 3ZFFB 5FYZA 2R30A 3THDA 1ZYBA 2MPKA 1YQ2A 1LOGA 3E6BA 1UMZA 5K0UC 4WZXA 4JCKA 2QDNA 1AJKA 1LOCA 4YW1A 5JR9C 2H7OA 1FX5A 1RVF3 2K3WA 1CGPA 4XC9A 1T2XA 4YM0A 3RKGA 3T0DA 2W62A 3KQ4B 3BQKA 2VURA 1JNZA 2R071 2EIBA 5DAQA 1H4GA 4ITCA 4Y33A 2VCMA 3E5QA 4N7UA 3ZX7A 5FUPA 4JKLA 4D0QA 1DZQA 4MUVA 5JZGA 1S2EA 3ZKRA 2FDIA 1C8M2 1UX7A 3ZSMA 4EYUA 2Q1FA 2W47A 2WA4A 1CAXA 4S2DA 3SCFA 4CCKA 1ZREA 3BIEA 3W5MA 4XDQA 2XMLA 2PBIA 1S0GA 4B3MT 1POQA 4XFIA 5AQPB 2CGNA 1PZ8A 4LBNA 2IIUA 1RUF2 3RGBA 4XZPA 4PIYA 4JHTA 1IOAA 3MLLA 4BMEA 1C5IA 5KXDA 3WG4A 5GZDA 1V6MA 5A1FA 4HFSA 1YLLA 4UFLA 5FZ9A 3BTXA 2PHTA 3KINB 3AMPA 1NA1B 1C8M3 1ZHCA 2MNGA 2YB7A 1SLAA 2JD4A 4LHKA 4P02B 4DUVA 4EEDA 1B35C 3Q8BA 4JI4T 1ZOYA 5FYMA 5FJHA 4YZ1A 1RUF3 5C3OA 4LXLA 3Q8EA 5CFCA 2ZX4A 4TWHA 1ZX5A 4JGYA 3I3QA 3FE5A 5C6CA 5FP3A 5FZ1A 2E32A 4L8QA 2A71A 1UWWA 2EAKA 3A8YC 2IXLA 2R062 4QX2A 1JXNA 5DPNA 2HHHT 4Q4X2 3WDUA 4UFJA 5D1IA 5A33A 5CU1A 1YI7A 3MIFA 2VK9A 3L09A 2GP3A 4JI7T 4QQLA 4NVPA 3DUIA 1ASJ1 1QXRA 4ISRA 3I4IA 3ONXA 2W2IA 1HG2A 2UY8A 4BCUA 4B8EA 1YFWA 1CPNA 2Q4SA 2A7AA 3AP4A 2D0TA 1GWLA 3A0NA 3FXDB 3FBZA 3N2OA 1SFYA 1V9U2 4PFOA 3T08A 4HKOA 3AEBA 2LM2A 1VMHA 2ZX3A 4BQ1A 3VBSA 4MADA 3I1AA 2LSIA 5APAA 3AZYA 2I59A 3DP7A 2HWD1 2R063 1W0AA 3VHRA 1LHOA 3GNEA 4YG3A 4YFZA 1UZVA 1QY4A 4I0BA 5JDBA 2IAKA 2MTQA 5L3GB 2JB4A 2W46A 4ILUA 4U74A 2XJQA 4XMIA 2FCTA 4JEUB 5FZIA 1L3JA 3FFZA 3AYEA 1PO12 1LOFA 2ZAAA 2ODVA 4BQ4A 2XGXA 1V9U3 1IQDC 3VD3A 2DUQA 4U7YA 4JI8T 5FZ6A 3VRAA 2W0GA 1UMHA 5IVBA 4B1LA 2YBKA 4NUUA 4QQHA 3CX8B 2Z69A 4NRMA 1VJ2A 4XBFB 2KZ7B 4NIHA 4LR4A 2ZMAA 2YDEA 1KQRA 4O9GA 5LASA 5ADXL 4RS5B 2UYBA 1HFAA 4Z1VA 3ZN6A 1N3QA 1JUHA 1PK6C 3ZMTB 1PO13 2HWE1 2OA2A 3UU6A 4A97A 2EHOD 1RUI2 4UF0B 3WT3A 4DR4T 4YW6A 2QQPA 1SPPB 2IC1A 3ZN4A 4MYEA 2WLQA 3C8XA 3VKGA 4JZRA 4F6RC 1O8SA 1RXFA 1C57A 1K5MC 1POV1 2QQOA 3VDDA 2RM21 4M00A 4AL9A 1E7PA 1YQ5A 1FNYA 3AYCA 4PDWA 1LECA 3MPPG 4EAHA 5HI0A 2PHRA 2JG9B 1WMFA 1BVP1 2X9XA 1RUI3 2CXFA 1W39A 4AQGA 5BNOA 1FAYA 5EK3A 1GZCA 5F32A 2OQ7A 2VTXJ 4JHZA 4RGAA 5I0TA 2FDGA 1V6JA 5CEHA 3N9LA 4Q5OA 1LJ7A 4CEYA 2QJVA 5LA6E 4J1WA 1ENSA 5CKMA 4AGRA 5FXXA 3K46A 4YZ5A 2RS12 3AXJA 5AVPA 5A32A 3H7JA 1Q8SA 3D0SA 4B6XA 2BS3A 2F4VT 2GNTA 5A3OA 1P8JA 2BWAA 5F3GA 3FL7A 4DB5A 3MW4A 4KU8A 4WBOA 4LO6B 2GZWA 1RHI1 3HKEE 1I5ZA 3ABVA 4NMIA 2JIWA 4QXCA 5HEGA 1ODMA 1J1TA 4UWDA 5ETWA 1C5HA 2JPFA 3VKOA 3JUUA 5I93A 1VAMA 4IE7A 1W8NA 3RIAA 2X9HA 3W15B 4NJ4A 5KMGP 3RJRA 4RHV2 3NV2A 5A6ZA 5FMOL 4E4SA 2RS13 1I1EA 5EPAA 4DRVA 2NTYA 2WABA 2NM1A 4UBHA 2ES0A 1OF4A 1UY1A 3VDAA 4YGDA 1LGBA 3H42B 4PLMA 2XVKA 4TSVA 3P3NA 4QPGC 5D8AB 1OXZA 3BI3A 2W63A 3ZXJA 3VBHA 4FCAA 1WW5A 4O4JE 2BP6A 3LJCA 3A5XA 5T50A 4X66T 3EQEA 2PHXA 1ZBA1 3EUHA 4HWCA 3RSJA 4K40A 1CQ9A 1DQ4A 4AZZA 2FMYA 1JZ7A 1ZZ6A 4RHV3 3OBRA 2DI4A 2ZPXA 4DY3A 1HX8A 2BBJA 2Y6JA 3EB7A 4O7XA 1QNYA 5BNPA 3ZIXA 1UGOA 4BLJA 3GGLA 1RL3A 5DZFA 1JYTA 1MEC2 2XSAA 2R042 1JYWA 5GLUA 1ODNA 1VPHA 1LAJA 2K24A 4R4XA 3RGLA 4PI2A 2B39A 5C9AB 3KCYA 1AL21 2J1TA 1PIV1 2ZX2A 3ONJA 1OEDA 3ZM8A 3H8UA 4K9SA 2J7MA 1MR5A 4QGLA 3DYMA 1PGW1 2A6YA 5LGUB 1SBDA 3HMYA 4GKXA 4LO4B 4I43B 2WZR2 2Y8KA 2G9FA 3LPFA 1TNFA 4KMQA 2QA7A 2RMU2 3RLFF 1J1JA 4I30A 1UMIA 3PE0A 1A78A 2Y6GA 1KFUL 4JV4A 4MXWA 4UR9A 1MEC3 3PJQA 3SLIA 4QAWA 2FJBA 2CDOA 4N78D 2PFWA 4YVSB 2W52A 4FPEA 2AACA 3HBKA 2FDFA 1H0BA 5M0TA 1W8WA 3T30A 3MIBA 5FY0A 2FJAA 3N9MA 1KXGA 2YFUA 1OFNA 5IUXA 4XZUG 4N53C 2IDOB 2P9BA 5FZLA 2WZR3 1MVEA 4NPLA 2LT3A 4YW2A 1B09A 2RMU3 1GOHA 1CAVA 4D6QA 1G9CA 2XQ5A 4ERRA 2XTLA 4XIKA 4K1YA 4FPCA 1BEV1 1WW4A 5CIRA 3KVBA 2YV8A 2P6HA 3U37A 1J3RA 3UU8A 4FVVA 4C8DA 1ND3B 2BNNA 2J1RA 4HANA 5BYNA 4XQDA 2MBGA 1W0BA 2D3RA 4EB6E 1HV1A 4JGZA 2K9ZA 5J36A 1D4M2 1G8XA 1HNXT 4CDUA 1W6MB 4M3CB 3U75A 5TAOA 2XONA 3PL0A 1CUNA 3MW2A 1LVKA 5GONE 4QXBA 2ZGPA 2BG9C 3K51A 4KG8A 2ZCWA 3TKLB 4IGPA 2W61A 1NZIA 3GXUA 4LA3A 4CU9A 2V1DB 2Q8OA 4LLOA 2VWAA 1N1TA 1SHZC 2P3IA 3DJBA 4GMP0 5CFDA 3U3IA 4ZY9A 3CMGA 4TWFA 2XLFA 3ALQA 3VL8A 4P08A 5FR3A 1JS9A 3IWZA 3TLWA 2XOMA 2OUHA 3IMMA 3BB6A 5KWRA 5GKAC 5LBFA 4R9BA 2DTYA 5L2LA 1WR6A 2BVBA 2VPVA 4KWLA 1H30A 4DINB 2TNFA 4Q1PA 1VBC2 5FOBB 1QU0A 2EIEA 3LSDA 2WDRA 4BA6A 2BUKA 2C9KA 1XMOT 2DVBA 1K5JA 1RUE2 4ZZ5A 4NIQA 1CONA 2W4XA 1JOBA 1V6LA 1SZBA 5HCHA 2R1BA 4AI8A 5A3LA 1ST8A 2V5CA 4TZDA 3B57A 3RYIE 2IC9A 4UFMA 5J1XA 1G9DA 2ZKLA 4CDQC 2LOPA 2Q8CA 4E27A 1OPMA 1J83A 2A5ZA 1QSDA 2IVJA 1AF9A 1HDKA 3HAGA 3VL9A 1VBC3 2V72A 5FUIA 4QDRA 2ZGRA 2FDKA 4AQFC 3B5MA 1QF3A 4DRRA 4Q27A 4GALA 1RB8G 1RUE3 1JOJA 3BOWA 1D7PM 3HNYM 1UO9A 1HG5A 3BIWE 1E1HB 1ZVFA 2EXJA 5AQQB 2ZM8A 4OFGA 2VOKA 4OHXA 2HWF2 3UU4A 5I0RA 2GN7A 4Y4RA 4WM8C 1L7RA 1S0IA 2X67A 4UELA 3OBAA 2EF6A 1QJX1 3WXPA 4FP3A 2VO5A 3N9NA 3FZ3A 1FI2A 4XF9A 1VBE1 3U4XA 4WM7A 4ES8A 4Q4W1 5FP4A 2Y48B 2VL4A 4HSLA 5A3PA 3D4KA 4A3XA 4DV3T 4I4TE 3FXEB 2HYXA 2WT1A 4AGGA 3FHQA 4JKMA 1OKOA 1KJRA 2HWF3 2B9UA 3OB8A 4IV3C 2YXSA 2OIIA 5HXCA 1QEXA 2RS32 3ZC1A 4QKBA 2VECA 4CP0A 2E7QA 2XPKA 1HNWT 1WYBA 2P4EA 3JC6D 1C8NA 1AZDA 2A75A 4LO5B 5CJ5A 3DYOA 2VM9A 4YSZA 3OTFA 2IC6A 2BU9A 3UT0A 1AVBA 3MGUA 3WW3A 3UYJA 2H6BA 4O9EA 3ZPYA 2CXDA 3IAPA 1DIWA 3DPRB 1FT9A 2YPDA 1TEIA 2H3RA 4DV7T 4JDNA 2DUOA 1OEDE 2WB5A 1NLSA 5LY2A 1ULEA 1E2AA 2RS33 3ZMOA 4BXSV 1FEWA 2X05A 4QXKA 2ZGMA 3J7Yq 4LF6T 1DLCA 4C0HA 5L3CB 1CZVA 3V64A 5A7PA 5T55A 3LK42 1U4QA 3NRYA 1ZNPA 4FPYA 3ZFGC 3OKQA 4U2ZA 4PQQA 1MS3A 2VVNA 4E9KA 3IB3A 1IG0A 3PU8A 3FBYA 1RMU2 1W28A 4UW6A 4R8HA 3SFEA 4BJ0A 1N34T 1ZA7A 1H6XA 4KI0F 4ZI3D 3H50A 4BK5A 4N7IA 1WLDA 3RZLA 1DGRN 1QXJA 2SPCA 2WCAA 1DQ0A 3B7MA 4ILAA 1NT0A 3LDQB 1B35A 4ISQA 5LK7B 3ZPOA 4CUBA 2W0XA 2ZACA 3HWJA 3RZKA 3CZUA 4JEHB 1COV2 4CN4A 2G0UA 4RR3B 1EPWA 2ZEYA 2J4GA 3MLJA 3AE1A 5AQVB 2BDEA 4QXHA 1YXWA 5DAXA 2X51A 3KCXA 1W6PA 3SKVA 1JU4A 3WDWA 4P09A 4XDOA 1G9BA 2R7EB 1QJU1 1NCQB 1UYYA 4BB3A 3AJYA 1YQ3A 5CG8A 3V0BB 4A6SA 4CUAA 5CB7A 4NROA 5C8CC 3N9QA 4BJNA 1JYNA 3HKCE 5JI7A 5TSWA 2FDJA 1WLXA 4AFAA 2C5JA 1COV3 1POV0 4M0NA 2EHOA 2VL0A 2DBIA 3LDBA 1SACA 1QJEA 2V7JA 5L19A 4YZ3A 1S2BA 3VZOA 2E63A 2O1QA 3ZFFC 2LRKA 3V5UA 4ILCA 4XUPA 3IA3A 3OY8B 2GK9A 1TE1B 2XR4A 4QQOA 1CD3G 3CL1A 4ASLA 1WBFA 2X8KA 4KBZA 4H2AA 3O1IA 3AE4A 2ILMA 1SLBA 3IDAA 2DU0A 1D0ZA 4AQTA 5JXIA 4X5TA 3PVOA 1R1A3 1Y9MA 2WBLA 2WMOA 3VBRA 4XOGA 4I3PA 1EPZA 4N43B 1NXMA 1AR62 1NEKA 4QH4A 3HR0A 3AKSA 2X53S 1HX6A 4DZGA 1EV11 4P5HA 3Q5DA 1QDCA 2ARAA 2CTVA 3O0WA 5C33A 3GHMA 4LPLA 2HBTA 1JODA 3I2FA 4GH4C 3I0QA 4BM8A 3NSTA 4V1Av 1HB1A 1SCRA 1PK6A 2RR12 2HWB2 2VW0A 1DZTA 3WW2A 3L8RA 4X8NA 2A1XA 2V7MA 1AR63 1PNFA 2BERA 2RS51 3POJA 2Q8DA 2RJLA 5LZ6A 3ZXEA 2G1MA 1UQXA 1OFSA 1K5MA 3K2OA 1H2LA 2MHFA 1M7KA 2W91A 3H1WA 3KT7A 1AJOA 2WNVB 2RPAA 2D6LX 1O5UA 2ZTNA 1OOPA 1N1VA 5CB4E 4B4PA 2D98A 2JJ6A 4KBMB 1F2NA 1GICA 4O65A 3HJRA 2VVDA 3AE9A 5F5QA 2E51A 5CA6A 5HEHA 1S0DA 3R4DB 1OWAA 4ZXKA 1PGL2 3ORJA 2PYTA 3HR9A 2VQFT 4QHZA 4AFDA 2P17A 1HCIA 2QQKA 5ACA2 5LA2A 4Q4V2 4GMP3 1W6QB 3NWIA 2I45A 1VBD2 3B00A 3OF1A 5LEKA 2JDKA 4TZ4C 4LFCT 2Y0OA 4PK5A 4Q0VA 3AMNA 3ZMSB 5GALA 2DVDA 2VUCA 1G73A 2LUWA 2XVLA 1L7QA 1PMHX 5I8TA 2X0LB 1JUIA 1XE7A 3I9YA 3S6PA 2Y6LA 3RMYA 2Q9QD 2OVUA 2XQ8A 3KT4A 3WHTA 3OD4A 1WMXA 1JHNA 4Y22A 5LB7B 4MVTA 5FO8B 5A3MA 2LRPA 2J1DG 3ZYMA 1PVC2 2FQPA 1MQTB 2YHJA 4H9PC 3WG3A 1LOBA 5ACA3 1G9FA 4Q4V3 2EVXA 4AR2A 1VBD3 5FYUA 3PUYF 3ZOIA 4GWJA 1YKEB 3WEZA 5HXHA 4QX8A 3A21A 5F3JA 3N5LA 4A98A 4S2FA 4KGGA 4CUCA 1J59A 2UU8A 2GU9A 2R073 5IFTA 1V70A 2EXKA 5IK7A 3M3ZB 4HEAA 3UL2A 1NG0A 5JXHA 2OLTA 3P5BA 3KDSE 4XDPA 3MZKB 3NV4A 4HN9A 4TN7B 5CA0E 4EE2A 4TV8E 3AZXA 3BODA 2P3KA 4UI9L 3UKVA 2VKOA 3C7GA 2GMEA 1RITA 1LRZA 5FVKA 3DKWA 4CU6A 4RS5C 3H3AA 3AXEA 4HK9A 5HCMA 3B93A 2VZVA 1RUC2 2VBBA 2LS6A 4OMCA 2HWC1 2M6IA 3QLQA 5GZFA 2WS91 4JRAA 4E4HA 4IEUA 4MV2A 3OGGA 5B2GB 4OCTA 4Y1YA 3V5SA 1W6NA 5C3SA 4L9BA 4XAEA 4YG0A 4IEWA 4QGMA 3T0BA 3I2GA 4XHBA 1IG3A 5C3QA 2CHOA 4QH5A 3A7MA 2VKDA 3E6DA 5J96B 3AE6A 3CX6B 1AXKA 3VV1A 1SEFA 1QJZA 4YT0A 1BVVA 3MF9A 1RUC3 2LTNA 3ZFEB 4OYUA 5IK5A 1XYPA 3WW1A 4Y20B 2JG9C 4MLOA 4W4ZA 2EXIA 4PI0A 4E8CA 3PNAA 3ZXDA 3IHRA 4B3RT 2D9DA 4P5YA 2VZRA 4B7EA 2KWHA 2W1WA 1WUVA 1XU2A 4RA0A 1IZNB 2Q1ZB 2QVSB 3OCPA 3ILFA 3W58A 1UU5A 4PQ9A 5CAZA 2JENA 4XF4A 2UXXB 3GMIA 2WYSA 4HWFA 3AXDA 2AE9A 4N53A 2DDUA 1U5XA 1Z0HA 5A7WB 4NO4A 5JOYA 1WW7A 4MGZE 5J7MA 1YYNA 2C0ZA 1RXGA 2XQ7A 3VBFB 3T2PA 4DXTA 4XJWA 5FUNA 2X66A 4AF9A 4LIVA 1DLLA 1QJY2 1YI9A 3N7MA 4UXAA 1GUIA 1H4HA 4D7TA 3UFGA 4M4PA 1Y64B 2HPJA 5LHIB 1PO21 4QB1A 3OPZA 4YNIA 4BQYA 3VDCA 3QUJA 3ANWA 5ISLA 3T0AA 3WF4A 5KC6A 3O1JA 5T5PA 4GYSA 3POWA 5FZ8A 3N7JA 4GIWA 3U11A 2BG9A 2WFF1 1US7B 3MXZA 1EAH1 2ZGSA 2WSUA 4QH1A 3URFA 2X9WA 1F5FA 2FZ2A 1S55A 5JOWA 5D8AC 5IW0A 4FXKB 3HD8B 1NAEA 1H1AA 4K8FA 3CIRA 3C7EA 3K8PC 1QJY3 4FOVA 1OT5A 3K3OA 2AENA 3PDQA 1CAXB 1V00A 3MW3A 3ZT5A 1Q8OA 2Q1MA 3PURA 3V0AA 2BYVE 3P6BA 2J1VA 1QQP1 4Q4Y2 3RPQA 1C1FA 1W06A 5L9VA 2YY1A 2Y60A 2YYOA 2VVSA 3MUY1 4P9IA 5JRCA 4H9QC 3BTZA 3UU5A 5C9AC 3KCCA 4TNWA 4YHJA 1LTEA 4OYJA 1VBB2 4AOCA 4H3WA 2P2KA 2BGCA 1REDA 3OGRA 2P5BA 4CDQA 1YC61 5CGMA 3NMBA 5FLJA 3KV6A 1BBT2 2RM23 1KEXA 1UAIA 4KU7A 3T1HT 3KM5A 3O1RA 3VKHA 4Z8XA 5HCJA 1GMMA 4IL4A 2VZSA 5CFCB 4H9OC 3VHPA 2EIGA 3PUZF 5CKNA 4JGYB 2JIJA 1JH5A 3RYRA 1VOMA 1RHI2 2TEPA 3AMQA 2QQMA 4HFEA 3THCA 3MFCA 4XJAA 2Q30A 2WU5A 2V4VA 1H9WA 4LO8A 3H3LA 3LZZA 3M7AA 3RI5A 4O8SA 3F2EA 5A33B 5G05L 1VBB3 5ANNA 4EOZB 3WP5A 5F3IA 3NRXA 4EN8B 3DF0A 4LBQD 5AFEA 3BU0A 1PX4A 1XYNA 5FYCA 3EMRA 3NNMA 2A3YA 2TBVA 3UGHA 1BBT3 2HLEA 2R49A 3NNFA 2VMIA 4QPYA 3Q9DA 1LKNA 5F7UA 1HW5A 4ASMB 1HRI1 1XC6A 5JUVA 3ZXAC 1UX4A 5HXSA 4FAGA 1IPJA 5E0OA 1QUUA 2ZMLA 3VHOA 2A3XA 4IUGA 3VBSB 1RHI3 3S7IA 1ND3C 5FPZA 3C98B 4ZU4A 1NUKA 4H55A 5JPMB 1CJPA 5HCBA 1E5HA 2I2SA 4UIGA 5ABHA 4V2WA 4XFFA 4KWKA 3ON7A 4CU7A 4RQPA 1X33A 4BMBA 2XBO1 2NW7A 4X65T 2BGOA 4EGWA 4XAXB 4QPIA 2ZGOA 2L9QA 1UCUA 4CCJA 3RQUA 3NAPC 3ZYFA 4IEPA 1H8VA 5DZEA 1W9FA 2KD7A 2CU5A 3J8F1 3IN9A 3AP5A 2G19A 2VGDA 2YINA 4XBLA 4ILBA 3LIGA 1SLTA 2JWPA 2XAGB 1SLIA 2A6ZA 3ZJ2A 1YUDA 1HX1B 3POIA 2DUPA 2WT2A 2W68A 2D5FA 3N2KE 4BE3A 1LR5A 3GN5A 3M65A 5EJ1B 4QKFA 2OA5A 3NZPA 3NRUA 1UF2C 1NY72 1AYM1 1HV0A 1IKQA 1UY2A 4M1PA 4ANJA 1AHSA 1CX4A 1ZP0A 4AKRB 3ZN6B 2HEVF 5AC91 3HBZA 4Q8LA 2JQKA 5JSOA 2HPLA 2H88A 3WNPA 5JXGA 4EN7B 1XQNA 4B3NA 3ZFGA 5FOJB 5KX5E 4PT6A 3VZLA 2PLV2 4GWIA 2PJQA 3POGA 4CDWC 1AL23 2FBWA 2J1UA 3AVRA 1G7YA 5L3FB 4QGNA 1UY4A 2BS4A 2CE7A 1A3KA 3VDDB 1GU3A 5EXOA 5FCCA 3T3YA 2GAUA 2VQTA 4GB32 4PDWB 1H8TA 1SUMB 2FCUA 1TG7A 4PIXA 3AA6B 1AJ3A 4HLTA 3SXWA 1O3SA 3ZSSA 2E53A 4FPFA 5E6HA 5BNOB 3WQ0A 2J1AA 3L2YA 4ISSA 3GA8A 4LF5T 1C3HA 2PLV3 2UUCT 3HOBA 4H14A 3LDRA 1CIYA 1Z7S1 5GJ6A 3IAQA 5DDJ1 4CEYB 3C51A 1FMVA 1JMUB 3CZJA 3I2KA 4O4IE 3KHCA 1LEDA 2AZ5A 2W92A 3PJAJ 4LE4A 3WLUA 4HKWA 2WQ8A 3RWNA 3AXJB 1FMWA 3RYHE 5A32B 3LSEA 4GB33 4QQ2A 2BG9E 2VOWA 2ZX1A 5KXCA 4I0AA 3AM2A 2NMNA 3C4XA 3H1MA 4OMDA 2DCJA 1IS3A 2BNOA 1NAFA 4QXCB 3LBXA 4JKKA 4YG6A 1RUJ2 1WD4A 4PLNA 4CDXC 4DUZT 3U4SA 1HKDA 3T8OA 3HN3A 1TZOA 3BPSA 2VOVA 1ZZBA 5FZ4A 2XQ6A 3ZDSA 1AYN2 2YGMA 4ZI2D 1BR4A 1AR91 2DV9A 2WA3A 4XABA 1XOYA 1S35A 2PAMA 2DLRA 5AQUB 3AEAA 1IKPA 5GZGA 5C70A 2ZLYA 4Y1VA 4NWWA 3PU3A 5FZCA 3ZYGA 1LOAA 3JU9A 3DPRC 3N7LA 2XQ9A 4K20A 1GOGA 3P7IA 3LEGA 5CG9A 3S4UA 2R32A 4DV2T 3VBHB 2Z79A 3LEKA 4KHZF 2IMLA 1RINA 1XDPA 3LWCA 4Q0SA 3NW4A 5FZ0A 2LSJA 1AYN3 4JI3T 1ZRIA 4NN0A 2NP9A 3O9XA 3CO2A 4YLHA 4IGUA 1W9TA 3J9SA 5BNPB 1BHGA 3POSA 4D3WA 5H9SA 4ZS3A 3U1XA 3ST7A 2RDRA 4GH4A 2BPA2 4AEDA 2C1FA 2JDUA 3DEMA 3OUIA 3D3AA 4FFIA 3OGVA 1YJKA 4LORA 4P9XA 1DGWA 5JWPA 1OEDB 1UX5A 2Q9QA 5AQGB 4BQ5A 1XSRA 1OHFA 4DS0A 2KLQA 4GZ9A 1QJX2 1E5SA 1XBFA 2Y64A 3D8CA 1OSGA 2VAUA 4MXWB 2PAEA 1WBLA 2VNRA 2ZBJA 2ZKNA 4FBFA 5LATA 3L2HA 2DCTA 4ZONA 2CPTA 3R84B 3ZT6A 1RGSA 4UW5A 1O7FA 3NO8A 2MAWA 4ATEA 2QRXA 3JCFA 5C3RA 1CAWA 3AEEA 3LSVA 5FP9A 4TUYE 3RMXA 1JZ6A 1MZEA 5E1RA 3RG0A 4JRLA 1RUOA 5DQWA 1SDDB 5J37A 1QJX3 2CWOA 4YZ2A 5HEOA 4UXNB 4LT5A 1NCQC 1MNEA 4LUMA 1CAVB 3J26N 3F31A 1K12A 1YQ6A 5F2WA 4AGVA 4NIGA 4AFMA 1DQ6A 3WP4A 3SH5A 1LHVA 3JBG1 3EDUA 5IVCA 5FXVA 3UESA 4S2GA 4TNVA 1ZBE2 2VBPA 2IUWA 4PBOA 4DMVA 4ASKA 1VIWB 1V9DA 3VUOA 1QH6A 4UV9B 5CADA 1HXS2 4AKGA 4D7SA 1VLNA 4IDNA 4CP1A 1JZ4A 4JGZB 5F9TA 1ZV4X 4AHYA 3ZXLA 5FZKA 2YU1A 1U5ZA 4CDUB 3PUIA 4JI5T 1N1YA 3U0ZA 1FPN1 3OD0A 1UZWA 5FIXA 3UV9A 4GXLA 4ZPIA 2C26A 3OSDA 3TLUA 4QXBB 2WWVA 5JH7E 2ARXA 2L9LA 4P14A 3Q8CA 1O59A 4U72A 1RVF1 4CP9A 4D6RA 4NHLA 4DV6T 4CCLA 3T2TA 3I54A 4PK6A 1FYUA 1ZBE3 1GBGA 2GC0A 3ZSLA 4HZFA 2VZOA 5CFDB 3VN4A 3JZVA 2C9AA 3FUOA 2A6WA 4H7MA 3OPCA 3HKDE 4CXWA 4N43C 1GZ9A 3SH3A 3IMNA 1C4RA 4XURA 4PF1A 2V6YA 2OS2A 3RPUA 3E5UA 1KS4A 3FWEA 2AEYA 4ZEYA 4AFBA 2QUOA 4CN6A 3P4WA 4N8MA 4LTAA 2HKXA 4HGAA 3E08A 1H2KA 2WWJA 3CJXA 4BYYA 3A22A 4WVVA 4FOWA 3E97A 2M67A 4XVHA 1WCSA 2P1BA 3ZCJA 4MH0E 5HV4A 1S0JA 3ZYKA 4YTNA 2WC2A 2E5LT 4MBQA 3UU3A 3HPNA 3ATGA 5HAXA 1WWYA 2P37A 3RVHA 4LOTA 2V7IA 3ZEFB 5DZGA 5FZBA 4D69A 3KZ4C 4G63A 1JYXA 4K1ZA 1SDWA 1JU3A 4ZZCA 3IDBB 2LW8A 1C8M1 3CQXC 2ZEZA 5I8SA 1N47A 4F7ZA 3IM0A 2VZUA 1L7LA 3LIHA 3RZMA 4XIOA 5FY1A 5LJMA 5LMNT 2KM2A 3H1YA 2NLRA 5BR8T 4KHPT 4LKFA 2WNUB 4QHBA 3MO4A 1RUF1 1BYHA 2KT9A 4QQPA 5BV6A 1UPIA 4MFRA 4OFZA 3T09A 4OHWA 2QTWB 4Y5SA 3E1F1 4AI6A 2PAKA 1DQ5A 1OQDA 3V65A 4O4HE 4AKIA 5FZOA 3BCWA 5B4XA 3KB5A 4HWIB 3BQIA 1W8HA 3VKLA 2QZ3A 2AUYA 1XNAA 2B4KA 3AKRA 4UAPA 3F2ZA 5GLTA 3GDBA 3TN92 4WM7B 4IE5A 1BR1A 4LMJA 5IJRA 2A2FX 2PHWA 5JDQA 4XHXA 3WNOA 1HQNA 3RNSA 3TWIA 1FNZA 2C5KT 2ZM0A 3AECA 1NCRC 1RUG2 1IQAA 3OBZA 1Q8PA 5IHYA 4PJMA 3VD7A 1KEYA 4QX5A 4LEJA 4YGEA 1MS0A 4FTBA 3ZC0A 4MXVA 2R061 3ETQA 3RYCE 2N2NA 2EICA 4Q4X1 2X5IC 1MQTC 2LSKA 1VCTA 2W1UA 3BK9A 2D40A 1MMNA 4C90A 5A70A 4IDOA 5LNKA 4YM2A 3AKPA 5FZDA 2QKDA 3MPBA 2VBDA 4AVSA 4LNVA 2YOEA 1NX9A 4F8AA 4DR6T 1S4CA 1W8UA 1RUG3 3FHIB 1X9PA 3CQCB 4KG0A 4UVCB 2VD7A 2WU2A 4DXSA 1F4HA 3CBNA 3I97A 3QC9A 4AAXA 3GBWA 2B42B 5FDBA 3P8CD 4N90A 4CCEA 4DMWA 2E33A 2WL1A 1WYCA 3J4UH 3W20A 1FATA 2WNEA 2JE9A 4KWUA 5FWEA 1EV13 1W2TA 5BNNA 2VL8A 2VASA 3KLSA 3SCHA 3RIFA 4JAAA 1T6BX 3AYDA 4LBQA 3CKDA 2VC9A 4EXTA 3VR8A 1VP6A 4WV8A 2Q5TA 3ETUA 4PK4A 1N36T 3TNPB 3BN6A 2IXIA 5JQGE 1PO11 3AP9A 2CMRA 3E0ZA 4G9SB 3PIJA 4AG4A 5FZGA 5FYBA 5IWAT 2VW2A 5EYXA 4TX5A 2BVVA 1Y4WA 4EWDA 3GZTB 1NQJA 4XXAA 3UTKA 4DBQA 2BFUL 4OHFA 5J98B 3JD72 4INDA 1A34A 1H1MA 3T1LA 5FL0A 1YJLA 4HPKA 4XCBA 4DUXA 3ZYHA 3I59A 3ZDVA 2DWGA 1DGRA 3ZYRA 1KNZA 2H89A 4AEKA 1LKXA 1JN2P 4EN0A 5JLVA 5KHIA 2EAAA 3CEWA 1B35B 3KSCA 1UURA 3ACGA 2D43A 2GNBA 2CBIA 1LRHA 3HVDA 3VZNA 5L3DB 3AFGA 4PJLA 2F4PA 2DCFA 2BDRA 4YLZA 1WCQA 4QXHB 4GJYA 4I3GA 3JD73 1W6PB 1K3IA 2DVAA 4WVWA 3PDYA 4AIUA 1R1ZA 3TRSB 1IBLT 5JI9A 1FV3A 3K48A 1DYKA 1REEA 1WLWA 1LB2A 2VH9A 3EAMA 2W1SA 3AZZA 2VB6A 5HEUA 1WW6A 4PHZA 1FMD2 3ILNA 4JVAA 2EHOB 1W2NA 2UURA 1UXXX 1W05A 3VBFC 2WZIA 3VLBB 4EYYR 2W39A 4MO3M 4ZU7A 3MDPA 3ZMVB 3LDKA 3UFEA 5FPLA 2P3YA 1MVQA 3H3ZA 4XMAA 1J1LA 5A1AA 1URXA 1ZRFA 4QB6A 4QDSA 2CLYB 5KXBA 2QCSB 2ACZA 2AXDS 5FMCA 5LOVE 2RS11 5LWBA 2BV4A 1KRIA 2UWBA 3NAPA 1LNSA 2E9QA 2J1EA 3NZQA 5F3CA 1FMD3 5FL1A 4L9IA 2AR6A 3UQ7A 3VBRB 1D1CA 4XBNA 1MZFA 3HKBE 4IDQA 2LROA 2DF7A 1BK0A 2JG8A 2R1DA 4P0AA 3GCXA 4A56A 4CEWA 5F6KA 1VBA2 2CNAA 2RHPA 2ES3A 3WF3A 5FZMA 4CCCA 1T8BA 1J58A 3WNNA 5LCYA 5F2SA 1HN0A 5C8WA 4MG2A 4RHV1 4META 4QX3A 4C1XA 1O91A 2ZHNA 2E8IA 2QFEA 3AA0B 4DPNA 1J5ET 3S57A 2J22A 2CL2A 2XHKA 4XJZA 4FTSA 5ERLA 4IV1C 1DZRA 1PK6B 2NW8A 3RIUC 4HBNA 1Q8QA 3TOJA 5JVDE 2GNDA 2WMNA 3OG2A 4XF3A 3U78A 4G3YC 4OUSA 4Z2AA 3O1MA 2E6VA 3M70A 1DU3D 3UUMA 4QKNA 3R6SA 5KHHA 4CDWA 3I8TA 1C1LA 3PJYA 4OULA 3M3OA 1X50A 4Y4YA 3ZR6A 4U7IA 3SQOA 3LFIA 1GP5A 1KJLA 1VBA3 3IIIA 1STMA 3CJIA 2YC4A 3PMSA 3IDCB 4MGQA 2LM3A 2Y0IA 4AFCA 5A6QA 3ZYJB 5IAXA 2KSRA 1YQ8A 4H7LA 3TLTA 5FY4A 2RDNA 3H8RA 4Y1XA 1YO8A 4ORFA 4OQ8A 1Y3TA 1OOPB 4QHOA 5FRAA 3JXSA 4I55E 5DAVA 5CFCC 2D44A 4E4DX 4TV9E 3WNLA 4NIIA 5JR2A 4PJNA 2D6PA 5LMUT 4NXMT 4R52A 3USUA 1Y9QA 5C3PA 1MEC1 5DABA 4DEQA 5DQ0A 4QX7A 2R041 4URAA 1HJGA 3RZZA 5CVRA 1SCSA 2IVIB 4B4QA 1FOD2 3AMMA 5DJQC 2I07B 3DKQA 1AUYA 2XJTA 3VBOA 5JDHA 4GQ7A 4U36A 5LHGB 2A73B 2WZR1 3B01A 2WZPP 4RFRB 2V5DA 2RMU1 3VKNA 1PZ7A 3PVNA 1UZZA 1XYOA 4BQWA 3VBSC 1A6CA 4QWNA 3GWHA 2RP4A 2CBJA 4OUEA 5I0UA 1MS9A 3OBTA 1V6OA 5GZCA 4Y22B 4CDXA 3THPA 4YPJA 3AE3A 1FOD3 3FFQA 5FBZA 3LG7A 1ZRCA 3FLRA 1LU1A 2A6XA 3D82A 4JI6T 2GH8A 1PO23 3I3DA 4BQ2A 1O3RA 4EN9B 3MV11 3RJ2X 1QQP2 1ND2C 5G04L 1X79A 1LOFC 3I3MA 4QX8B 3JADA 3SWHA 3B5LB 4EZ4A 1QXPA 2K48A 4L99A 4HFBA 2C24A 3H3UA 4HK8A 3N4MA 3WNXA 4F3JA 1W9SA 5JDGA 2BOJA 2CDPA 5T52A 3CVRA 4I09A 4OZOA 5FZ3A 1W99A 3KT1A 3PLQA 2JJ9A 3OGSA 5FYYA 1DCSA 1XDOA 4XTMA 1D4M1 1BR2A 1RYYA 1AX0A 3ZIWA 1ULFA 1QQP3 1FXZA 3KBUA 2VY0A 2JDZA 5CZKA 5ABFA 4KUMB 1XPWA 5H9QA 2QNKA 3FBLA 5HWYA 1W6NB 4JLEA 2ZZQA 4AVVA 2XHEB 2BWCA 5J09A 1JZ3A 3FZLB 2JDNA 4EQVA 5A7NA 3JAFA 2XAFB 4IERA 4FPKA 2WKKA 4O61A 1SMVA 4JDOA 3WG1A 1OPOA 4OUMA 2YUEA 3ZYLA 4LLFA 3VDDC 4RYDA 4TWDA 4GA9A 2N1GA 5A7QA 1HRI2 4CRQA 4E2QA 4AKHA 3WZ1A 1VBC1 2IXKA 2OPWA 5AQTB 2IWGB 4AYUA 1CIWA 2CAUA 2DYCA 3T4VA 1WD3A 3AKTA 3MIGA 2BS2A 3UJQA 4HMZA 4I50E 2CGOA 4H63H 4FO9A 5DG2A 1KNRA 3UJOA 1UD1A 2VW1A 1US2A 2JX9A 1XE8A 2E31A 3B3QE 4Q29A 2E26A 4NRQA 3VBUA 3RF1A 1SFPA 2YG0A 3LE0A 4GD4A 4KX6A 1O4ZA 4UV8B
chains in the Genus database with same CATH topology
2M67A 3SOLA 2LOPA 5LA6E 2Q8CA 5LOVE 4DBRA 5E6HA 5FPAA 4IHJE 3ZCJA 5JDNA 5JREA 3EVYA 5LWBA 5JR9C 2XXZA 5FUNA 2H7OA 2X66A 5LP6E 3ZYKA 4ISSA 5ANQA 4LIVA 3GA8A 3HR0A 1QSDA 4MBQA 2DWKA 5FXXA 3ZN0B 5F5CA 3NZQA 2W62A 3C4WA 4O4LE 1Y64B 5HAXA 5JR9A 5F3CA 5A80A 2HPJA 5LHIB 1MIVA 4B6XA 4L9IA 3BQKA 3RVHA 1D1CA 2LSYA 2V7IA 1FMVA 3C51A 5FY7A 3ZEFB 2ACXA 3PUQA 4OYKA 3ZMUB 5FZBA 3HKBE 4O4IE 2A72A 3QUJA 4CQIA 3ANWA 2E9XC 5F3GA 2CA5A 3KV5A 4AQFC 5ISLA 4Y33A 2LHNA 4WBOA 3ZJ1A 4G63A 4X1KE 3HKEE 2Q8EA 3I0QA 3AA1B 3O1JA 3RC3A 4P0AA 2XUEA 4GYSA 1HS7A 4QXCA 4A56A 3O4XE 4CCMA 5FZ8A 1FMWA 3RYHE 4FI5A 5J1GA 4AQFA 4V1Av 1HG5A 1E1HB 3CQXC 5ETWA 5JR9B 2JPFA 3AAAB 2CXLA 4GIWA 5FUPA 5FZMA 4UVAB 2ZM8A 4PAGA 2KINB 5LCYA 5F2SA 1US7B 3MXZA 3LD8A 5JDFA 4FJOA 3RKOA 1MMGA 4HONA 4Y4RA 5FY9A 2X9WA 5FY1A 4IE7A 4EYUA 5LJMA 3ANWB 3C4XA 2X9HA 3N9OA 3W15B 3I9WA 2X67A 4HE8A 2E8IA 5LGTB 2H7VC 3K3NA 5KMGP 3AA0B 2V7MA 2D2SA 5IW0A 5K4LA 4CCKA 4UELA 1NAFA 4QXCB 3LBXA 3QK6A 2YBPA 4CCNA 1BR0A 3ETVA 5A7SA 2XMLA 2PBIA 3ZMZB 3H37A 2KT9A 3K8PC 2NW8A 3U4SA 3N9NA 2Q8DA 4MFRA 5F37A 4OFZA 3T8OA 4DIQA 5JVDE 2WMNA 3R6NA 4L5GA 4BA9A 3K3OA 3U78A 3PDQA 2OX0A 3OYXA 2WWUA 4AI6A 3MKDA 5IWFA 4D6SA 2NTYA 5FZ4A 5HXEA 5FP4A 4ZI7E 3K2OA 2ES0A 2Y48B 3RH3A 2B1EA 3D0TA 5FPUA 3PURA 2LOSA 4O4HE 4ZI2D 4PJJA 5JDMA 4AKIA 5FV3A 5FZOA 2YK0A 1BR4A 4QKNA 3UUMA 3B13A 5A3PA 1D0XA 3Q5XA 3O1HA 4CCOA 2C5IT 1D1AA 1LVFA 3BQIA 4I4TE 3FXEB 2XAJB 4OK0A 3AAIA 5M4YA 3C4ZA 1S35A 4ZI2C 5A1FA 3J9X1 4CXXA 1OXZA 2W63A 5HYAA 5CB4E 2DLRA 5FYVA 2CM0A 1H7CA 4H9RC 4WBNE 5FZ9A 4O4JE 5H6QB 5FJKA 3LJCA 2ZLYA 3A5XA 3KINB 4IE5A 4DVDA 4KBMB 1BR1A 3PUAA 3PU3A 5FZCA 2A2FX 4PFPA 2CWYA 2K5BB 2CCQA 3EUHA 5JDQA 1ZHCA 5FZOB 5FPVA 3MA9A 5HXCA 4QU1A 5FY4A 5F8PA 5JRCA 3ZC1A 4H9QC 4DNDA 1MMAA 4H63V 1OWAA 5L3EB 2LSGA 2C5KT 2ZM0A 3RX6A 2Y8DA 3MK7C 3P7IA 3EDVA 4GJZA 1WYBA 4QHOA 3S4UA 5IVFA 4GYRA 3JC6D 4YHJA 4I55E 4OYJA 1HCIA 2DI4A 5FYIA 4TV9E 3FB2A 4EIWA 1HX8A 2L8KA 5IHYA 2X9YA 2JMKA 5FYMA 4PJMA 4PJNA 4NUVA 5FJHA 2NTXA 2PG8A 3KVAA 4YFSA 4LXLA 1O3XA 2XQYA 3JC6C 2IC6A 4GOUA 2A3DA 5DABA 2P5BA 4QX7A 4PW8A 4EZHA 1IJ5A 3ZC0A 4ISTA 5JRCB 4URAA 2E9XD 3HL6A 3RYFE 3KV6A 5FZ0A 5A3WA 2LSJA 5LW9A 3UYJA 2XASB 1VRBA 3RYCE 2N2NA 4TZ4C 2CEAA 4HTEA 5FP3A 5LG4A 5FXZA 2CXDA 4PK5A 5FZ1A 4J2CA 3IEEA 5DJQC 2NP9A 4KP3C 5LBMA 3ZMSB 3O9XA 2W00A 2LSKA 4IDZA 5HWXA 4C91A 3VKHA 3BK9A 1MMNA 4Z8XA 2K24A 3C64A 2YPDA 3C50A 5IYZE 5FXWA 4CSWA 4YLHA 1G73A 4C90A 4IGUA 2H3RA 2X0LB 3OBVE 5CA1E 3I9YA 4H9OC 3ZLIA 5LNKA 4AI9A 4QX7B 4HKAA 2VK9A 2E9XA 5JDHA 2KNDA 3L09A 5FZDA 2Q9QD 3ZCIA 1VOMA 4ZS3A 4NUBA 3CWZB 2GP3A 5LY2A 5LHGB 1EZ3A 5FMNA 5LGUB 2LEHA 5F5AA 5FYTA 2UXNB 4WW0A 4K0UA 3AL5A 3ONXA 2NWBA 1HG2A 2W2IA 3N9PA 1FEWA 2Q9QC 4I43B 5BMVE 2J1DG 2N9DA 2NW9A 3ZYMA 3NJYA 4E7SA 4O8SA 2QA7A 3J7Yq 3CQCB 3F2EA 4UVCB 2D0TA 2VD7A 2V26A 3DXUA 4ZS2A 4H9PC 5L3CB 3CMLA 4MALA 4EOZB 3L3PA 5F3IA 3NRXA 3BQLA 3FXDB 3QC9A 5J2TE 3AB3B 3KV4A 2LE8A 3PE0A 1UX5A 2E9XB 2Q9QA 3IBPA 3FBZA 3P8CD 3SRZA 4QWNA 5A7PA 5IVVA 3GWHA 4DMWA 2RP4A 3N2OA 4O2BE 1WYCA 2KLQA 3UT5E 4PFOA 3LK42 5FYCA 2MYSA 1U4QA 1YD8G 5FYUA 2HH7A 2JQQA 3NRYA 3I1AA 2Y6XA 2LSIA 5J2UE 1KK7A 3PUSA 5FWEA 3Q9DA 4ZOLE 1YKEB 3LG7A 5HXHA 2I59A 3DP7A 4QX8A 4XZCA 1MNDA 3N5LA 1UX4A 2RA1A 3OKQA 5F3JA 5HXSA 2DHRA 4ZHQE 4N78D 4GK0E 2BVMA 2VKJA 2VL8A 2VASA 3E22E 4AAPA 5E0OA 2Q9QB 3CQGB 4QWNB 1QUUA 4X20E 2MOZA 3CKDA 5FP7A 5FP8A 2IAKA 3PU8A 4EXTA 3KFWX 3DTOA 4HEAA 2MTQA 4AKLA 5LJNA 5FZEA 4BAYB 4WNKA 3Q2MA 3ETUA 4PK4A 5L3GB 5FBJA 3C98B 4ILUA 2JRKA 1X79A 5FY0A 1YKHB 4U74A 3R84B 3KDSE 4XDPA 5JQGE 5H6RB 2LM9A 3N9MA 4QX8B 3AL6A 5A7OA 2CMRA 3MZKB 3E0ZA 4ZI3D 4UIGA 5FZAA 4JEUB 4V2WA 5FZIA 4HN9A 4IE4A 4TN7B 2LJLA 2P9BA 5EK4A 4LITA 5CA0E 5FZLA 5FZGA 3SWHA 2KWIB 5FYBA 2LT3A 4TV8E 4EZ4A 1NWMX 2VKOA 5LHHB 4G2AA 3IF8B 4TUYE 4TX5A 5HXRA 3SS1A 2NW7A 5FP9A 5FYSA 4D6QA 2ODVA 4ZI3C 2ZM2A 3OPTA 1LRZA 3RRCA 4ERRA 2SPCA 2K48A 3DXTA 5AFUL 3H3AA 2XTLA 4XAXB 4IE6A 4CZZB 3UTKA 5DQWA 3OYZA 2L9QA 2Z6EA 4Y3OA 1Z0PA 4DBQA 5FWJA 1UCUA 3KVBA 4OHFA 5A1LA 2OQ6A 4HOOA 3UULA 3VU7H 2YBSA 4P0BA 2VKHA 2XAHB 5FZ6A 2CWOA 5FPBA 5FZ7A 2W0GA 3ZPOA 5JDGA 4CCJA 4L0RA 4UXNB 5F39A 3MJXA 4C8DA 3CVRA 1MNEA 4MHCA 1HF8A 4DO0A 4JEHB 5LBQB 4E4HA 5IVBA 4YJ2E 3VHLA 5FZ3A 2G0UA 3F31A 2V7LA 2MBGA 4NUUA 2YBKA 5EZYE 5JDLA 3V5SA 3CX8B 5DQVA 2JJ9A 4EB6E 5F2WA 5FYYA 2DWGA 4E7ZA 2X68A 4JUYA 1BR2A 2BZBA 4CXYA 3WI3A 1KNZA 2KZ7B 4XBFB 3EDUA 4UF0A 1LKXA 2OT7A 2YINA 5IVCA 5FXVA 2WM9A 2BVLA 2ZMAA 1SA0E 2XAGB 4ADZA 2BDEA 2L3LA 3UUXB 4CI3B 4QXHA