3A8YC

Crystal structure of the complex between the bag5 bd5 and hsp70 nbd
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
b'KEALEKRKLFACEEHPSHKAVWNVLGNLSEIQGEVLSFDGNRTDKNYIRLEELLTKQLLALDAVDPQGEEKCKAARKQAVRLAQNILSYLDLKSDEWEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heat shock 70 kDa protein 1
publication title The C-terminal BAG domain of BAG5 induces conformational changes of the Hsp70 nucleotide-binding domain for ADP-ATP exchange
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 34
structure length 99
sequence length 99
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 3a8yC00
4HWFA 5AQIB 5AQFB 1M7KA 1UK5A 1HX1B 4HWDA 5AQQB 4HWIB 1M62A 5AQHB 5AQVB 3FZKB 5AQPB 3M3ZB 5AQRB 5AQKB 5AQJB 5AQLB 4HWCA 3LDQB 3FZMB 5AQUB 3FZHB 5AQOB 1T7SA 1UGOA 4HWHA 5AQGB 3FZFB 3A8YC 5AQTB 1I6ZA 2D9DA 5AQSB 5AQNB 5AQMB 3FZLB
chains in the Genus database with same CATH superfamily
4COFA 5L3DB 3GN5B 5KDMC 2CCQA 2UXBT 4QX8B 3RLFF 4F8HA 2VQFT 1YKEB 4KMCA 3PUSA 3ZMUB 2L9QA 4CN6A 2WQYA 3QUJA 2Q9QB 4CN1A 4HFBA 2IMLA 4MBQA 3PJAA 3HR0A 2OV9A 5FVKA 4X1YE 3ZPOA 2YN6A 3N5LA 2PTFA 4Z8XA 2HH7A 2WU5A 4ZI2D 3ZSSA 2BG9B 5ABHA 4WBOA 2UUBT 2LSGA 2I59A 5JTGA 4TNWA 5LHIB 2HPJA 3RIUC 1KNRA 2CMRA 4AKHA 3CWZB 4U2ZA 2W63A 3DP7A 1G73A 4JEHB 4YFSA 4HWIB 3ONJA 2FUPA 3JC6C 2E2AA 1D0YA 2KWIB 4GYRA 2G0UA 3K3OA 2MTQA 3PUYF 5LG3A 2XM1A 2FJBA 2L8KA 1NAFA 1IJ6A 4QX7B 4JI0T 4HFEA 4DV1T 3NKZA 4ILBA 3AE9A 2KLQA 5HEOA 5JDHA 4KBMB 2BBJA 2NW8A 5AQJB 4HWCA 4C90A 5LB7B 4ZS3A 4IL9A 2ACXA 5JRCA 2E9XB 2RA1A 4CI3B 3P4RA 1ZOYA 4UVAB 3FBZA 1VCTA 2QVAA 2VB6A 4IE5A 3OYXA 4ASKA 5JVDE 4AKRB 4H9PC 2H89A 1VCSA 2C5JA 3AE2A 3F2EA 3Q5XA 2PFVA 1KNPA 3J9X1 3AE1A 4B6XA 1HG5A 4XZCA 2VVSA 4ZI7E 1HS7A 3KFWX 1BR0A 1CHUA 2CWYA 4O4IE 3PU8A 5HCJA 2IAKA 4NUUA 5J0ZA 2BG9E 2ZM0A 4HE8A 2I0MA 2X9HA 4BA9A 3RQUA 3C51A 2RP4A 4EV6A 2LE8A 4FJOA 1E7PA 2OLTA 3OPCA 4UV8B 2C5KT 5E0OA 4GKJT 1W0AA 3LK2B 3UUMA 4YHJA 3UULA 2WWUA 2BVLA 5LMUT 4IDZA 3UUNA 3PU3A 2EHOC 3VHLA 3KV9A 2BKPA 2AE9A 3M65A 5HXRA 4UXNB 4WBNE 4CXYA 3LBXA 3UT5E 1FMWA 4O2BE 3RIUA 5JR9B 1OXZA 2W62A 2CBIA 4DV7T 2DNXA 2MBGA 4JYAT 1N34T 4X62T 3ZMZB 2KSRA 1SUMB 2HN1A 2BVMA 2LJLA 2LRLA 4U7YA 4A98A 2V6YA 3KV5A 4GIWA 3PUZF 3AXJA 3RGLA 2XUEA 4DV6T 4JI4T 3HKEE 1B7TA 4AKIA 3R6NA 2CXLA 4ILCA 3OKQA 1MNEA 5JH7E 4ISSA 4CQIA 4JI2T 1KFYA 2VVNA 4CXWA 3J7Yq 3FZFB 1J1JA 4DR7T 2CPTA 4B3RT 2XASB 5HWYA 5ETWA 4Q25A 3N9LA 2F4VT 3PJAJ 4UV9B 3UFGA 3AAIA 4ANJA 5FP3A 3B5MA 2JQHA 1IAPA 1KK7A 4U72A 3L8RA 4X1IE 3W15B 2ZM2A 5FYMA 2HN2A 5TAOA 2XQ3A 1IZNB 2W0GA 4L0RA 4ZOLE 4YXDA 5ADXL 4H63V 4HFDA 3T1HT 4DUZT 2BKNA 4OFZA 4X65T 2JQ9A 2XQAA 2FBWA 3E22E 1WR0A 3K3NA 2LSKA 5AQGB 2R6GF 1Z8UA 4GKKT 4GK0E 1BR1A 1E2AA 2BS4A 2QA7A 1XZYA 4EB6E 2WM9A 4AXPA 3N2OA 1S94A 3FB2A 3PUGA 4WW0A 3NWIA 2EHOA 3OTOT 3N9NA 1NWMX 2A3DA 5AQQB 3PV0F 1H7CA 4TUYE 5FL0A 4O8SA 5AQKB 3EABA 1XWMA 2LRKA 2UU9T 4LF7T 5HEGA 4LF8T 4YJ3E 1R8IA 5HYAA 5L4HA 3ZT6A 4LFAT 3ETVA 4B3ST 4O2AE 4KHZF 2K48A 4DNDA 2WMNA 4EZHA 1T8BA 1U4QA 5ABFB 2V1DB 2JQQA 5HEUA 2WS3A 4DR5T 1OEDB 2XQ8A 2CWOA 3AEGA 1U5PA 2BS2A 2V7KA 2VL8A 1ZEEA 3P4WA 4LMKA 3UU8A 4AQYT 3AA1B 1HR0T 3UUBA 1UCUA 2D9DA 2DCFA 2Y8DA 4DBQA 3KBTA 3AA6B 4TN7B 1UK5A 2VWAA 5AQHB 4KX6A 1WLXA 4PW8A 4DV3T 2FJDA 4IL4A 3E08A 1FJGT 2JJ9A 4PJMA 4YJ2E 3GN5A 3N9QA 4DR3T 2V7MA 4P09A 4UELA 4NUVA 4OYKA 2QYWA 4L9IA 1HTJF 1SE7A 4DV4T 3PURA 2W2UA 4HFVA 1X79A 3I1AA 2ODUA 2XQ5A 5FKYA 5JDNA 3VR9A 1UGOA 3VR8A 2XY8B 2JIWA 3KBUA 2M67A 4A56A 2RPAA 3CKDA 4U31A 4CN4A 2LHNA 1L0VA 2VL0A 3PDYA 1JNZA 5JDFA 1ZV4X 4OHFA 2Y48B 3PUXF 2J47A 2VKOA 4X20E 3NZQA 2WDQA 4HKAA 4YT0A 2KZ7B 1JNRA 1LVKA 4XBFB 3ZLIA 3C4ZA 3HI2A 4PJNA 5JR9C 2CLYC 1OEDE 3WAKA 4EIWA 4IE0A 3NBXX 4HWFA 3RYHE 2WP9A 5C3JA 4ILUA 5LOVE 2J62A 2IC9A 4OYJA 5HXCA 3BQLA 4HWHA 3AECA 1MMGA 4M1PA 5EZYE 4EAHA 5HXEA 3EHZA 3ZEFB 2LM9A 2A9UA 2V6XA 4PK6A 4DV0T 3G06A 3ANWB 3RRWA 4AQGA 2IHR1 1KNZA 4ZZCA 3I0OA 1MMDA 2XSAA 2V5DA 4QXBB 4NPPA 3S4UA 4I55E 2KMFA 5CA1E 2LM2A 2X67A 2VURA 2MOZA 4EGWA 1MIVA 4QHOA 4LFCT 3TLVA 3AVRA 5AQTB 1ZP0A 5FY1A 2KNDA 2CXDA 4EYYR 4TV8E 5L3CB 3P4QA 4E7SA 2V7LA 4FI5A 5HEHA 5LBMA 5F5WA 5LJMA 1XDPA 1BR2A 4ZXLA 2LOPA 3SWHA 4BAYB 3JC6D 4EOZB 2N9DA 2LLYA 3VKGA 5FXZA 4U2YA 5EK4A 3I9YA 3Q5EA 3UU4A 1AJ3A 3DTOA 5AQFB 1MNDA 4BJNA 5LP6E 3CPZA 1LRZA 2CHOA 3O1HA 3ZN0B 1HNWT 3SOLA 3MK7C 2PJQA 4J2CA 5HXSA 4IDNA 1MIYA 3N2KE 4UVBB 5H6RB 3ONLC 2DL1A 1V9DA 2XZEA 4GK5E 4HWDA 1FMVA 4YTPA 4DMWA 4JUYA 3JAEA 4L5GA 2H7OA 1HX8A 5F3JA 1YQ4A 2D2SA 2JMHA 2DWGA 4AI6A 2XTLA 5A1LA 2D0TA 5JR9A 3N9MA 5EK3A 2PG8A 4HEAA 3LG7A 5AQRB 3ZT7A 3HKDE 2VKJA 3AA7B 3C98B 3X1DA 2WDVA 4EXTA 5FMNA 3A7MA 3ZMTB 3RYFE 2GK9A 1BR4A 4O4LE 4CZZB 4XAXB 1ZHCA 4JI6T 3QOFA 1SHZC 3UUXB 3UU6A 4ADZA 5AQPB 2YK0A 2ACZA 3ZJ1A 4AISA 1UURA 1WYCA 3AE6A 3F31A 1HCIA 5J2TE 3CIRA 1MMNA 3BK9A 2A72A 3NVOA 3IHRA 4YSYA 4K0KT 2IC6A 4P0BA 5BR8T 2YINA 4YY3T 1UUSA 3PUVF 4A97A 3FXEB 3EDUA 3NRXA 4JBWF 4PNIA 2EHOD 4IDOA 5C2TA 2LOSA 4H9NC 5AQSB 2K9AA 5LGTB 3ZYMA 2OA5A 4LF6T 3MZKB 4PK4A 2IUBA 4MHCA 4H9RC 1D0XA 4LF9T 3ESLA 4UIGA 2XAGB 3RC8A 5AQOB 3RYCE 2UUCT 3ZMSB 4DV5T 4PJLA 3ZMVB 4UF0A 3CMLA 3EAMA 1G8XA 3L3PA 3AE5A 3FZHB 3MXZA 2CXFA 4NXMT 4B3MT 5DABA 3O9XA 4ZI3C 1M7KA 1HX1B 4YLHA 3SRZA 4DR6T 4YHHT 4QXHB 2VASA 2K5BB 4WNKA 3TKLB 3VU7H 2LSJA 4IE4A 3A5XA 2V6YB 1D1CA 4AKGA 1CUNA 2YEVC 3AXJB 3RI5A 2X68A 4TV9E 5LHHB 4TWHA 1NENA 1N33T 4IGUA 2KXPB 3CVRA 3FHNA 2AXDS 5LHGB 2XAJB 3ZCIA 4DIDB 2UUAT 2Q9QC 4TZ4C 1T7SA 4H9OC 3AE8A 4CI1B 5L3EB 1IBLT 2X0YA 4ZEYA 3SFDA 1KEYA 3IBPA 4LMJA 2X51A 1W9RA 2BKOA 2UXDT 1N32T 1N36T 2D5UA 5FXVA 1HF8A 4DVDA 1WYBA 3HL6A 3KVBA 1WR6A 2W00A 4PFOA 2BG9C 2NW7A 2DWKA 2WSSV 5LA6E 2DI4A 5LNKA 3H3AA 4KI0F 2ZM8A 3O1IA 3ZYLA 1ZKEA 3C4XA 4JI3T 2HPLA 4HFIA 2NW9A 3UTKA 1WCRA 4ILAA 4Z90A 3B13A 2LEHA 1Z0PA 1XMOT 5LJNA 4AKLA 4AIUA 4JV5T 1HFAA 1IBMT 3AB3B 5LXTE 3U78A 3O4XE 3CX6B 3OJAA 5LCYA 4HGAA 3ZJ2A 1T98A 4YTNA 3Q2MA 2WU2A 4I50E 2X9WA 1J5ET 5L3GB 3L39A 2E9XC 2VKDA 2WAUA 1T72A 1FIOA 3OBVE 2QRXA 2WZHA 3K3QC 2WY2A 3I9WA 4X64T 2A2FX 3SS1A 4U33A 4MLKA 4P1NA 4H9QC 2HHHT 2NTXA 3FZKB 2M6BA 2D0UA 4QWNB 3DJBA 5JDQA 4X5TA 3CQGB 3FBLA 5KX5E 2KT9A 3OVUA 2VQET 2E5LT 1HG2A 5HCMA 4IDQA 5BMVE 5LGNB 2ZLYA 2WCAA 2LKHA 5IUXA 3V5UA 5L3FB 4QH5A 4IIJE 3PE0A 3VRBA 5JDMA 3PUQA 4B3TT 2CRBA 2CA5A 4QH4A 4DR1T 3P4PA 2Q9QA 3HKBE 3TLTA 4HFCA 4OK0A 1W0BA 1Y01A 2X9XA 4GYSA 4DBRA 1NEKA 4DV2T 4LMLA 5FY7A 2YDSA 2WZIA 3KINB 5DQWA 2BG9A 1YQ3A 2DLRA 2YDQA 3ZSTA 2W66A 5IWAT 3ANWA 3RKOA 5AQVB 4DMVA 3QB5A 4ISTA 3T8OA 3UU5A 5CFBA 1MMAA 4ZS2A 2WB5A 5CJ5A 4HTEA 4IDPA 3P50A 3D0TA 3MA9A 4UVCB 1I94T 2H3RA 1YD8G 2WMOA 2MYSA 3LK3B 3WAJA 3ZC1A 5IYZE 2YOEA 4ZI2C 2Z6EA 4NXNT 4OX9T 2BZBA 5FNVE 3I0QA 1GQEA 1VOMA 5LG4A 4EZ4A 5JREA 2E9XA 1WRDA 5C8YE 5CB4E 1VRBA 2V26A 3ZCJA 2E5VA 3BQIA 3AE7A 3GWHA 5FL1A 1M62A 4YSXA 5H6QB 4DUYT 3ETUA 3LDQB 2FJAA 4EEDA 5LGUB 5M4YA 3ZYKA 4JEUB 5DJQC 5LMNT 2XAQB 2J1DG 2XQYA 2N1GA 2KINB 2SPCA 3RC3A 3AEAA 3E0ZA 1XNQT 3TLWA 5JDGA 3L09A 3AEDA 3LK42 4PAGA 3B57A 4V1Av 2ES0A 4BJMA 1HNZT 3UU3A 3FZLB 3VRAA 3QB5K 1E1HB 2V7JA 1YXRA 2LKGA 3RKGA 1DU2A 5J1GA 2BDEA 3QC9A 2YU2A 5HXHA 3BQKA 4DR2T 1XDOA 3GA8A 3H3MA 3RPUA 3LJCA 1XMQT 2E8IA 4TWFA 4ZZBA 2XQ7A 5J2UE 2UXNB 4IT4A 2VK9A 4CXXA 5HWXA 5FY0A 5LYJE 1UX5A 1D0ZA 2FJEA 4C91A 1S35A 2C5IT 2B76A 2XAHB 2W67A 5L4EA 2XSBA 2K24A 3IA3A 3Q5DA 3JAFA 2B1EA 5JRCB 2XQ9A 2MAWA 5AQNB 4UEMA 1O3XA 4IREA 3O1JA 5KXJA 1LKXA 4AQFC 3IEEA 3TLUA 2DHRA 1UX4A 1OEDC 3AVSA 5DQVA 3Q9DA 4KUMB 3N9OA 4H63H 4Z91A 3ONXA 3T1YT 1I6ZA 5AQMB 4TWDA 4GOUA 3K1SA 2V8SV 3AEBA 4JI7T 2I6HA 2JQKA 3AA0B 3P7IA 3KVAA 2YU1A 4U3CA 2LSYA 3PUWF 2NWBA 3AEFA 2CLYB 4F6RC 3JADA 3PTRB 2H88A 2W61A 2XPKA 2MPKA 3CX8B 4U74A 2QGSA 4LF4T 4WZXA 4JI1T 4YTMA 2CHNA 5JQGE 2WDRA 3RHWA 4JLEA 2NP9A 5FVLA 3SFEA 5CGMA 5AFUL 5IHYA 3M3ZB 4WYVA 2IIUA 4I4TE 4DO0A 4CI2B 3NZPA 3LBXB 2JRKA 2V7IA 2BBHA 4QXCB 5L3BB 3CQXC 4JI5T 3C4WA 4O4JE 3RX6A 3U3IA 2ZM6T 1KF6A 3AE4A 2V5CA 2WWVA 1QUUA 3GMIA 5CA0E 1HNXT 2N2NA 4ZHQE 3C50A 2IDOB 5HAXA 5AQIB 2LT3A 4ZI3D 4IE6A 3CX7B 4MALA 3FZMB 1IBKT 3AAEB 2XHEB 4PFPA 3EI0A 3A8YC 3RH3A 1Y64B 2H7VC 3N2GE 3EVYA 2W4XA 3NRYA 5HEJA 4UF0B 5KMGP 4LF5T 5ABFA 1US7B 1SA0E 5AQLB 4IHJE 4AQFA 5LBQB 3C64A 4I0UA 3UQ7A 5ABGA 1OEDA 5GONE 2Q9QD 4ERRA 2CM0A 5L47A 5L2LA 4KHPT 3EDVA 2Y6XA 2PBIA 1J5WA 1FEWA 5AQUB 2LSIA 2KWHA 2YKSA 1LVFA 2P9BA 3H37A 4HFHA 5FXXA 4TX5A 2L3LA 3HKCE 4QH1A 4NIQA 3RYIE 3AEEA 3Q5WA 4I43B 3OYZA 3KV4A 5EK2A 4JI8T 3ZC0A 3KDSE 2IW5B 2WBLA 2JPFA 3CQCB 2CEAA 3WI3A 4YSZA 4PK5A 3RIAA 4G2AA 2JMKA 3N9PA 3P4SA 2CE7A 4U7IA 3HA4A 4DR4T 1OWAA 3RIFA 1EZ3A 3P8CD 3LFMA 2EHOB 1YW0A 3F57A 3V5SA 4LFBT 1QSDA 2K3WA 2XAFB 1WFDA 3CK6A 4TNVA 1IJ5A 5F8PA 4IE7A 1W09A 2J4GA 2ZMAA 4N78D 3RQWA 1QLBA 3JCFA 2CBJA 2E9XD 5FXWA 3AE3A 4EYUA 4KP3C 4P0AA 2XQ6A 2NTYA 2LHRA 3IF8B 3MJXA 4PJJA 2UXCT 3K8PC 3EUHA 2NR4A 4EEBA 1D1BA 2X0LB 2BS3A 4HN9A 4E7ZA 3TLSA 2X66A 2XJ7A 1XNRT 3ZT5A 3ZKRA 4K0UA 1YKHB 2XQ4A 3R84B 1MIWA 4QKNA 2M6IA 1X9BA 4G63A 4X1KE 4X66T 3UQ4A 3LSVA 4H9SE 3ZN1B 2X9YA 3RF1A 3QNUA 4O4HE 3MACA 3FXDB 2VKHA 3VKHA 2UXXB 2NOXA 3MKDA 3QK6A 3ABVA 2X0HA 4UR9A 2YDRA 3RRCA 3PUAA 5JDLA 3UFEA 3KV6A 5ABEA 2C0SA 4A5XA 3AAAB 4MFRA 2XM2A 1D1AA 2ODVA
chains in the Genus database with same CATH topology
4HWFA 5AQIB 5AQFB 1M7KA 1UK5A 1HX1B 4HWDA 5AQQB 4HWIB 1M62A 5AQHB 5AQVB 3FZKB 5AQPB 3M3ZB 5AQRB 5AQKB 5AQJB 5AQLB 4HWCA 3LDQB 3FZMB 5AQUB 3FZHB 5AQOB 1T7SA 1UGOA 4HWHA 5AQGB 3FZFB 3A8YC 5AQTB 1I6ZA 2D9DA 5AQSB 5AQNB 5AQMB 3FZLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HWF A;  5AQI B;  5AQF B;  1M7K A;  1UK5 A;  1HX1 B;  4HWD A;  5AQQ B;  4HWI B;  1M62 A;  5AQH B;  5AQV B;  3FZK B;  5AQP B;  3M3Z B;  5AQR B;  5AQK B;  5AQJ B;  5AQL B;  4HWC A;  3LDQ B;  3FZM B;  5AQU B;  3FZH B;  5AQO B;  1T7S A;  1UGO A;  4HWH A;  5AQG B;  3FZF B;  3A8Y C;  5AQT B;  1I6Z A;  2D9D A;  5AQS B;  5AQN B;  5AQM B;  3FZL B; 
#chains in the Genus database with same CATH topology
 4COF A;  5L3D B;  3GN5 B;  5KDM C;  2CCQ A;  2UXB T;  4QX8 B;  3RLF F;  4F8H A;  2VQF T;  1YKE B;  4KMC A;  3PUS A;  3ZMU B;  2L9Q A;  4CN6 A;  2WQY A;  3QUJ A;  2Q9Q B;  4CN1 A;  4HFB A;  2IML A;  4MBQ A;  3PJA A;  3HR0 A;  2OV9 A;  5FVK A;  4X1Y E;  3ZPO A;  2YN6 A;  3N5L A;  2PTF A;  4Z8X A;  2HH7 A;  2WU5 A;  4ZI2 D;  3ZSS A;  2BG9 B;  5ABH A;  4WBO A;  2UUB T;  2LSG A;  2I59 A;  5JTG A;  4TNW A;  5LHI B;  2HPJ A;  3RIU C;  1KNR A;  2CMR A;  4AKH A;  3CWZ B;  4U2Z A;  2W63 A;  3DP7 A;  1G73 A;  4JEH B;  4YFS A;  4HWI B;  3ONJ A;  2FUP A;  3JC6 C;  2E2A A;  1D0Y A;  2KWI B;  4GYR A;  2G0U A;  3K3O A;  2MTQ A;  3PUY F;  5LG3 A;  2XM1 A;  2FJB A;  2L8K A;  1NAF A;  1IJ6 A;  4QX7 B;  4JI0 T;  4HFE A;  4DV1 T;  3NKZ A;  4ILB A;  3AE9 A;  2KLQ A;  5HEO A;  5JDH A;  4KBM B;  2BBJ A;  2NW8 A;  5AQJ B;  4HWC A;  4C90 A;  5LB7 B;  4ZS3 A;  4IL9 A;  2ACX A;  5JRC A;  2E9X B;  2RA1 A;  4CI3 B;  3P4R A;  1ZOY A;  4UVA B;  3FBZ A;  1VCT A;  2QVA A;  2VB6 A;  4IE5 A;  3OYX A;  4ASK A;  5JVD E;  4AKR B;  4H9P C;  2H89 A;  1VCS A;  2C5J A;  3AE2 A;  3F2E A;  3Q5X A;  2PFV A;  1KNP A;  3J9X 1;  3AE1 A;  4B6X A;  1HG5 A;  4XZC A;  2VVS A;  4ZI7 E;  1HS7 A;  3KFW X;  1BR0 A;  1CHU A;  2CWY A;  4O4I E;  3PU8 A;  5HCJ A;  2IAK A;  4NUU A;  5J0Z A;  2BG9 E;  2ZM0 A;  4HE8 A;  2I0M A;  2X9H A;  4BA9 A;  3RQU A;  3C51 A;  2RP4 A;  4EV6 A;  2LE8 A;  4FJO A;  1E7P A;  2OLT A;  3OPC A;  4UV8 B;  2C5K T;  5E0O A;  4GKJ T;  1W0A A;  3LK2 B;  3UUM A;  4YHJ A;  3UUL A;  2WWU A;  2BVL A;  5LMU T;  4IDZ A;  3UUN A;  3PU3 A;  2EHO C;  3VHL A;  3KV9 A;  2BKP A;  2AE9 A;  3M65 A;  5HXR A;  4UXN B;  4WBN E;  4CXY A;  3LBX A;  3UT5 E;  1FMW A;  4O2B E;  3RIU A;  5JR9 B;  1OXZ A;  2W62 A;  2CBI A;  4DV7 T;  2DNX A;  2MBG A;  4JYA T;  1N34 T;  4X62 T;  3ZMZ B;  2KSR A;  1SUM B;  2HN1 A;  2BVM A;  2LJL A;  2LRL A;  4U7Y A;  4A98 A;  2V6Y A;  3KV5 A;  4GIW A;  3PUZ F;  3AXJ A;  3RGL A;  2XUE A;  4DV6 T;  4JI4 T;  3HKE E;  1B7T A;  4AKI A;  3R6N A;  2CXL A;  4ILC A;  3OKQ A;  1MNE A;  5JH7 E;  4ISS A;  4CQI A;  4JI2 T;  1KFY A;  2VVN A;  4CXW A;  3J7Y q;  3FZF B;  1J1J A;  4DR7 T;  2CPT A;  4B3R T;  2XAS B;  5HWY A;  5ETW A;  4Q25 A;  3N9L A;  2F4V T;  3PJA J;  4UV9 B;  3UFG A;  3AAI A;  4ANJ A;  5FP3 A;  3B5M A;  2JQH A;  1IAP A;  1KK7 A;  4U72 A;  3L8R A;  4X1I E;  3W15 B;  2ZM2 A;  5FYM A;  2HN2 A;  5TAO A;  2XQ3 A;  1IZN B;  2W0G A;  4L0R A;  4ZOL E;  4YXD A;  5ADX L;  4H63 V;  4HFD A;  3T1H T;  4DUZ T;  2BKN A;  4OFZ A;  4X65 T;  2JQ9 A;  2XQA A;  2FBW A;  3E22 E;  1WR0 A;  3K3N A;  2LSK A;  5AQG B;  2R6G F;  1Z8U A;  4GKK T;  4GK0 E;  1BR1 A;  1E2A A;  2BS4 A;  2QA7 A;  1XZY A;  4EB6 E;  2WM9 A;  4AXP A;  3N2O A;  1S94 A;  3FB2 A;  3PUG A;  4WW0 A;  3NWI A;  2EHO A;  3OTO T;  3N9N A;  1NWM X;  2A3D A;  5AQQ B;  3PV0 F;  1H7C A;  4TUY E;  5FL0 A;  4O8S A;  5AQK B;  3EAB A;  1XWM A;  2LRK A;  2UU9 T;  4LF7 T;  5HEG A;  4LF8 T;  4YJ3 E;  1R8I A;  5HYA A;  5L4H A;  3ZT6 A;  4LFA T;  3ETV A;  4B3S T;  4O2A E;  4KHZ F;  2K48 A;  4DND A;  2WMN A;  4EZH A;  1T8B A;  1U4Q A;  5ABF B;  2V1D B;  2JQQ A;  5HEU A;  2WS3 A;  4DR5 T;  1OED B;  2XQ8 A;  2CWO A;  3AEG A;  1U5P A;  2BS2 A;  2V7K A;  2VL8 A;  1ZEE A;  3P4W A;  4LMK A;  3UU8 A;  4AQY T;  3AA1 B;  1HR0 T;  3UUB A;  1UCU A;  2D9D A;  2DCF A;  2Y8D A;  4DBQ A;  3KBT A;  3AA6 B;  4TN7 B;  1UK5 A;  2VWA A;  5AQH B;  4KX6 A;  1WLX A;  4PW8 A;  4DV3 T;  2FJD A;  4IL4 A;  3E08 A;  1FJG T;  2JJ9 A;  4PJM A;  4YJ2 E;  3GN5 A;  3N9Q A;  4DR3 T;  2V7M A;  4P09 A;  4UEL A;  4NUV A;  4OYK A;  2QYW A;  4L9I A;  1HTJ F;  1SE7 A;  4DV4 T;  3PUR A;  2W2U A;  4HFV A;  1X79 A;  3I1A A;  2ODU A;  2XQ5 A;  5FKY A;  5JDN A;  3VR9 A;  1UGO A;  3VR8 A;  2XY8 B;  2JIW A;  3KBU A;  2M67 A;  4A56 A;  2RPA A;  3CKD A;  4U31 A;  4CN4 A;  2LHN A;  1L0V A;  2VL0 A;  3PDY A;  1JNZ A;  5JDF A;  1ZV4 X;  4OHF A;  2Y48 B;  3PUX F;  2J47 A;  2VKO A;  4X20 E;  3NZQ A;  2WDQ A;  4HKA A;  4YT0 A;  2KZ7 B;  1JNR A;  1LVK A;  4XBF B;  3ZLI A;  3C4Z A;  3HI2 A;  4PJN A;  5JR9 C;  2CLY C;  1OED E;  3WAK A;  4EIW A;  4IE0 A;  3NBX X;  4HWF A;  3RYH E;  2WP9 A;  5C3J A;  4ILU A;  5LOV E;  2J62 A;  2IC9 A;  4OYJ A;  5HXC A;  3BQL A;  4HWH A;  3AEC A;  1MMG A;  4M1P A;  5EZY E;  4EAH A;  5HXE A;  3EHZ A;  3ZEF B;  2LM9 A;  2A9U A;  2V6X A;  4PK6 A;  4DV0 T;  3G06 A;  3ANW B;  3RRW A;  4AQG A;  2IHR 1;  1KNZ A;  4ZZC A;  3I0O A;  1MMD A;  2XSA A;  2V5D A;  4QXB B;  4NPP A;  3S4U A;  4I55 E;  2KMF A;  5CA1 E;  2LM2 A;  2X67 A;  2VUR A;  2MOZ A;  4EGW A;  1MIV A;  4QHO A;  4LFC T;  3TLV A;  3AVR A;  5AQT B;  1ZP0 A;  5FY1 A;  2KND A;  2CXD A;  4EYY R;  4TV8 E;  5L3C B;  3P4Q A;  4E7S A;  2V7L A;  4FI5 A;  5HEH A;  5LBM A;  5F5W A;  5LJM A;  1XDP A;  1BR2 A;  4ZXL A;  2LOP A;  3SWH A;  4BAY B;  3JC6 D;  4EOZ B;  2N9D A;  2LLY A;  3VKG A;  5FXZ A;  4U2Y A;  5EK4 A;  3I9Y A;  3Q5E A;  3UU4 A;  1AJ3 A;  3DTO A;  5AQF B;  1MND A;  4BJN A;  5LP6 E;  3CPZ A;  1LRZ A;  2CHO A;  3O1H A;  3ZN0 B;  1HNW T;  3SOL A;  3MK7 C;  2PJQ A;  4J2C A;  5HXS A;  4IDN A;  1MIY A;  3N2K E;  4UVB B;  5H6R B;  3ONL C;  2DL1 A;  1V9D A;  2XZE A;  4GK5 E;  4HWD A;  1FMV A;  4YTP A;  4DMW A;  4JUY A;  3JAE A;  4L5G A;  2H7O A;  1HX8 A;  5F3J A;  1YQ4 A;  2D2S A;  2JMH A;  2DWG A;  4AI6 A;  2XTL A;  5A1L A;  2D0T A;  5JR9 A;  3N9M A;  5EK3 A;  2PG8 A;  4HEA A;  3LG7 A;  5AQR B;  3ZT7 A;  3HKD E;  2VKJ A;  3AA7 B;  3C98 B;  3X1D A;  2WDV A;  4EXT A;  5FMN A;  3A7M A;  3ZMT B;  3RYF E;  2GK9 A;  1BR4 A;  4O4L E;  4CZZ B;  4XAX B;  1ZHC A;  4JI6 T;  3QOF A;  1SHZ C;  3UUX B;  3UU6 A;  4ADZ A;  5AQP B;  2YK0 A;  2ACZ A;  3ZJ1 A;  4AIS A;  1UUR A;  1WYC A;  3AE6 A;  3F31 A;  1HCI A;  5J2T E;  3CIR A;  1MMN A;  3BK9 A;  2A72 A;  3NVO A;  3IHR A;  4YSY A;  4K0K T;  2IC6 A;  4P0B A;  5BR8 T;  2YIN A;  4YY3 T;  1UUS A;  3PUV F;  4A97 A;  3FXE B;  3EDU A;  3NRX A;  4JBW F;  4PNI A;  2EHO D;  4IDO A;  5C2T A;  2LOS A;  4H9N C;  5AQS B;  2K9A A;  5LGT B;  3ZYM A;  2OA5 A;  4LF6 T;  3MZK B;  4PK4 A;  2IUB A;  4MHC A;  4H9R C;  1D0X A;  4LF9 T;  3ESL A;  4UIG A;  2XAG B;  3RC8 A;  5AQO B;  3RYC E;  2UUC T;  3ZMS B;  4DV5 T;  4PJL A;  3ZMV B;  4UF0 A;  3CML A;  3EAM A;  1G8X A;  3L3P A;  3AE5 A;  3FZH B;  3MXZ A;  2CXF A;  4NXM T;  4B3M T;  5DAB A;  3O9X A;  4ZI3 C;  1M7K A;  1HX1 B;  4YLH A;  3SRZ A;  4DR6 T;  4YHH T;  4QXH B;  2VAS A;  2K5B B;  4WNK A;  3TKL B;  3VU7 H;  2LSJ A;  4IE4 A;  3A5X A;  2V6Y B;  1D1C A;  4AKG A;  1CUN A;  2YEV C;  3AXJ B;  3RI5 A;  2X68 A;  4TV9 E;  5LHH B;  4TWH A;  1NEN A;  1N33 T;  4IGU A;  2KXP B;  3CVR A;  3FHN A;  2AXD S;  5LHG B;  2XAJ B;  3ZCI A;  4DID B;  2UUA T;  2Q9Q C;  4TZ4 C;  1T7S A;  4H9O C;  3AE8 A;  4CI1 B;  5L3E B;  1IBL T;  2X0Y A;  4ZEY A;  3SFD A;  1KEY A;  3IBP A;  4LMJ A;  2X51 A;  1W9R A;  2BKO A;  2UXD T;  1N32 T;  1N36 T;  2D5U A;  5FXV A;  1HF8 A;  4DVD A;  1WYB A;  3HL6 A;  3KVB A;  1WR6 A;  2W00 A;  4PFO A;  2BG9 C;  2NW7 A;  2DWK A;  2WSS V;  5LA6 E;  2DI4 A;  5LNK A;  3H3A A;  4KI0 F;  2ZM8 A;  3O1I A;  3ZYL A;  1ZKE A;  3C4X A;  4JI3 T;  2HPL A;  4HFI A;  2NW9 A;  3UTK A;  1WCR A;  4ILA A;  4Z90 A;  3B13 A;  2LEH A;  1Z0P A;  1XMO T;  5LJN A;  4AKL A;  4AIU A;  4JV5 T;  1HFA A;  1IBM T;  3AB3 B;  5LXT E;  3U78 A;  3O4X E;  3CX6 B;  3OJA A;  5LCY A;  4HGA A;  3ZJ2 A;  1T98 A;  4YTN A;  3Q2M A;  2WU2 A;  4I50 E;  2X9W A;  1J5E T;  5L3G B;  3L39 A;  2E9X C;  2VKD A;  2WAU A;  1T72 A;  1FIO A;  3OBV E;  2QRX A;  2WZH A;  3K3Q C;  2WY2 A;  3I9W A;  4X64 T;  2A2F X;  3SS1 A;  4U33 A;  4MLK A;  4P1N A;  4H9Q C;  2HHH T;  2NTX A;  3FZK B;  2M6B A;  2D0U A;  4QWN B;  3DJB A;  5JDQ A;  4X5T A;  3CQG B;  3FBL A;  5KX5 E;  2KT9 A;  3OVU A;  2VQE T;  2E5L T;  1HG2 A;  5HCM A;  4IDQ A;  5BMV E;  5LGN B;  2ZLY A;  2WCA A;  2LKH A;  5IUX A;  3V5U A;  5L3F B;  4QH5 A;  4IIJ E;  3PE0 A;  3VRB A;  5JDM A;  3PUQ A;  4B3T T;  2CRB A;  2CA5 A;  4QH4 A;  4DR1 T;  3P4P A;  2Q9Q A;  3HKB E;  3TLT A;  4HFC A;  4OK0 A;  1W0B A;  1Y01 A;  2X9X A;  4GYS A;  4DBR A;  1NEK A;  4DV2 T;  4LML A;  5FY7 A;  2YDS A;  2WZI A;  3KIN B;  5DQW A;  2BG9 A;  1YQ3 A;  2DLR A;  2YDQ A;  3ZST A;  2W66 A;  5IWA T;  3ANW A;  3RKO A;  5AQV B;  4DMV A;  3QB5 A;  4IST A;  3T8O A;  3UU5 A;  5CFB A;  1MMA A;  4ZS2 A;  2WB5 A;  5CJ5 A;  4HTE A;  4IDP A;  3P50 A;  3D0T A;  3MA9 A;  4UVC B;  1I94 T;  2H3R A;  1YD8 G;  2WMO A;  2MYS A;  3LK3 B;  3WAJ A;  3ZC1 A;  5IYZ E;  2YOE A;  4ZI2 C;  2Z6E A;  4NXN T;  4OX9 T;  2BZB A;  5FNV E;  3I0Q A;  1GQE A;  1VOM A;  5LG4 A;  4EZ4 A;  5JRE A;  2E9X A;  1WRD A;  5C8Y E;  5CB4 E;  1VRB A;  2V26 A;  3ZCJ A;  2E5V A;  3BQI A;  3AE7 A;  3GWH A;  5FL1 A;  1M62 A;  4YSX A;  5H6Q B;  4DUY T;  3ETU A;  3LDQ B;  2FJA A;  4EED A;  5LGU B;  5M4Y A;  3ZYK A;  4JEU B;  5DJQ C;  5LMN T;  2XAQ B;  2J1D G;  2XQY A;  2N1G A;  2KIN B;  2SPC A;  3RC3 A;  3AEA A;  3E0Z A;  1XNQ T;  3TLW A;  5JDG A;  3L09 A;  3AED A;  3LK4 2;  4PAG A;  3B57 A;  4V1A v;  2ES0 A;  4BJM A;  1HNZ T;  3UU3 A;  3FZL B;  3VRA A;  3QB5 K;  1E1H B;  2V7J A;  1YXR A;  2LKG A;  3RKG A;  1DU2 A;  5J1G A;  2BDE A;  3QC9 A;  2YU2 A;  5HXH A;  3BQK A;  4DR2 T;  1XDO A;  3GA8 A;  3H3M A;  3RPU A;  3LJC A;  1XMQ T;  2E8I A;  4TWF A;  4ZZB A;  2XQ7 A;  5J2U E;  2UXN B;  4IT4 A;  2VK9 A;  4CXX A;  5HWX A;  5FY0 A;  5LYJ E;  1UX5 A;  1D0Z A;  2FJE A;  4C91 A;  1S35 A;  2C5I T;  2B76 A;  2XAH B;  2W67 A;  5L4E A;  2XSB A;  2K24 A;  3IA3 A;  3Q5D A;  3JAF A;  2B1E A;  5JRC B;  2XQ9 A;  2MAW A;  5AQN B;  4UEM A;  1O3X A;  4IRE A;  3O1J A;  5KXJ A;  1LKX A;  4AQF C;  3IEE A;  3TLU A;  2DHR A;  1UX4 A;  1OED C;  3AVS A;  5DQV A;  3Q9D A;  4KUM B;  3N9O A;  4H63 H;  4Z91 A;  3ONX A;  3T1Y T;  1I6Z A;  5AQM B;  4TWD A;  4GOU A;  3K1S A;  2V8S V;  3AEB A;  4JI7 T;  2I6H A;  2JQK A;  3AA0 B;  3P7I A;  3KVA A;  2YU1 A;  4U3C A;  2LSY A;  3PUW F;  2NWB A;  3AEF A;  2CLY B;  4F6R C;  3JAD A;  3PTR B;  2H88 A;  2W61 A;  2XPK A;  2MPK A;  3CX8 B;  4U74 A;  2QGS A;  4LF4 T;  4WZX A;  4JI1 T;  4YTM A;  2CHN A;  5JQG E;  2WDR A;  3RHW A;  4JLE A;  2NP9 A;  5FVL A;  3SFE A;  5CGM A;  5AFU L;  5IHY A;  3M3Z B;  4WYV A;  2IIU A;  4I4T E;  4DO0 A;  4CI2 B;  3NZP A;  3LBX B;  2JRK A;  2V7I A;  2BBH A;  4QXC B;  5L3B B;  3CQX C;  4JI5 T;  3C4W A;  4O4J E;  3RX6 A;  3U3I A;  2ZM6 T;  1KF6 A;  3AE4 A;  2V5C A;  2WWV A;  1QUU A;  3GMI A;  5CA0 E;  1HNX T;  2N2N A;  4ZHQ E;  3C50 A;  2IDO B;  5HAX A;  5AQI B;  2LT3 A;  4ZI3 D;  4IE6 A;  3CX7 B;  4MAL A;  3FZM B;  1IBK T;  3AAE B;  2XHE B;  4PFP A;  3EI0 A;  3A8Y C;  3RH3 A;  1Y64 B;  2H7V C;  3N2G E;  3EVY A;  2W4X A;  3NRY A;  5HEJ A;  4UF0 B;  5KMG P;  4LF5 T;  5ABF A;  1US7 B;  1SA0 E;  5AQL B;  4IHJ E;  4AQF A;  5LBQ B;  3C64 A;  4I0U A;  3UQ7 A;  5ABG A;  1OED A;  5GON E;  2Q9Q D;  4ERR A;  2CM0 A;  5L47 A;  5L2L A;  4KHP T;  3EDV A;  2Y6X A;  2PBI A;  1J5W A;  1FEW A;  5AQU B;  2LSI A;  2KWH A;  2YKS A;  1LVF A;  2P9B A;  3H37 A;  4HFH A;  5FXX A;  4TX5 A;  2L3L A;  3HKC E;  4QH1 A;  4NIQ A;  3RYI E;  3AEE A;  3Q5W A;  4I43 B;  3OYZ A;  3KV4 A;  5EK2 A;  4JI8 T;  3ZC0 A;  3KDS E;  2IW5 B;  2WBL A;  2JPF A;  3CQC B;  2CEA A;  3WI3 A;  4YSZ A;  4PK5 A;  3RIA A;  4G2A A;  2JMK A;  3N9P A;  3P4S A;  2CE7 A;  4U7I A;  3HA4 A;  4DR4 T;  1OWA A;  3RIF A;  1EZ3 A;  3P8C D;  3LFM A;  2EHO B;  1YW0 A;  3F57 A;  3V5S A;  4LFB T;  1QSD A;  2K3W A;  2XAF B;  1WFD A;  3CK6 A;  4TNV A;  1IJ5 A;  5F8P A;  4IE7 A;  1W09 A;  2J4G A;  2ZMA A;  4N78 D;  3RQW A;  1QLB A;  3JCF A;  2CBJ A;  2E9X D;  5FXW A;  3AE3 A;  4EYU A;  4KP3 C;  4P0A A;  2XQ6 A;  2NTY A;  2LHR A;  3IF8 B;  3MJX A;  4PJJ A;  2UXC T;  3K8P C;  3EUH A;  2NR4 A;  4EEB A;  1D1B A;  2X0L B;  2BS3 A;  4HN9 A;  4E7Z A;  3TLS A;  2X66 A;  2XJ7 A;  1XNR T;  3ZT5 A;  3ZKR A;  4K0U A;  1YKH B;  2XQ4 A;  3R84 B;  1MIW A;  4QKN A;  2M6I A;  1X9B A;  4G63 A;  4X1K E;  4X66 T;  3UQ4 A;  3LSV A;  4H9S E;  3ZN1 B;  2X9Y A;  3RF1 A;  3QNU A;  4O4H E;  3MAC A;  3FXD B;  2VKH A;  3VKH A;  2UXX B;  2NOX A;  3MKD A;  3QK6 A;  3ABV A;  2X0H A;  4UR9 A;  2YDR A;  3RRC A;  3PUA A;  5JDL A;  3UFE A;  3KV6 A;  5ABE A;  2C0S A;  4A5X A;  3AAA B;  4MFR A;  2XM2 A;  1D1A A;  2ODV A; 
#chains in the Genus database with same CATH homology
 4HWF A;  5AQI B;  5AQF B;  1M7K A;  1UK5 A;  1HX1 B;  4HWD A;  5AQQ B;  4HWI B;  1M62 A;  5AQH B;  5AQV B;  3FZK B;  5AQP B;  3M3Z B;  5AQR B;  5AQK B;  5AQJ B;  5AQL B;  4HWC A;  3LDQ B;  3FZM B;  5AQU B;  3FZH B;  5AQO B;  1T7S A;  1UGO A;  4HWH A;  5AQG B;  3FZF B;  3A8Y C;  5AQT B;  1I6Z A;  2D9D A;  5AQS B;  5AQN B;  5AQM B;  3FZL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...