3A8YC

Crystal structure of the complex between the bag5 bd5 and hsp70 nbd
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
KEALEKRKLFACEEHPSHKAVWNVLGNLSEIQGEVLSFDGNRTDKNYIRLEELLTKQLLALDAVDPQGEEKCKAARKQAVRLAQNILSYLDLKSDEWEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Heat shock 70 kDa protein 1
publication title The C-terminal BAG domain of BAG5 induces conformational changes of the Hsp70 nucleotide-binding domain for ADP-ATP exchange
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 99
sequence length 99
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 3a8yC00
1I6ZA 4HWFA 1M7KA 5AQVB 5AQOB 5AQGB 3FZFB 5AQFB 5AQPB 5AQKB 5AQUB 3LDQB 1UGOA 5AQMB 5AQRB 4HWIB 1HX1B 5AQTB 3FZKB 3FZHB 5AQLB 5AQIB 1T7SA 4HWDA 3A8YC 5AQNB 5AQSB 4HWCA 3FZMB 2D9DA 5AQQB 1M62A 4HWHA 3FZLB 5AQJB 1UK5A 5AQHB 3M3ZB
chains in the Genus database with same CATH superfamily
3ZLIA 3I0QA 1EZ3A 3MJXA 3C51A 4QXHB 2NW7A 4O8SA 2WMNA 2ZM6T 4DUYT 2VL8A 2IC9A 3LK3B 4MLKA 2KLQA 4EZHA 1Y01A 2BKPA 4CQIA 2JQQA 2HN1A 4H9PC 4DUZT 3P7IA 4HFIA 4HEAA 4TNVA 1MIVA 3GN5B 1HTJF 4QXBB 5L4EA 3OYXA 3PUZF 4KX6A 3FB2A 2LKHA 4MBQA 3SOLA 5LB7B 5CFBA 1NWMX 2X9HA 2MAWA 2ES0A 4IHJE 5F8PA 4A98A 5LGNB 2I0MA 3B57A 4QH5A 2V7LA 4OK0A 2J62A 2BBHA 2CBIA 4AKRB 3VKGA 2X66A 3AEEA 5JVDE 4EYUA 2BG9C 3AE8A 3QNUA 2V6YA 1Z8UA 2XQ8A 2FJEA 2H3RA 2KZ7B 4QH1A 4X66T 3AE4A 4IE6A 3ONJA 1W09A 5FY1A 1O3XA 4AIUA 1S94A 5C3JA 2EHOC 3S4UA 3EABA 3F57A 3BK9A 4QKNA 2IDOB 4YTPA 4GOUA 2A2FX 3NWIA 2XUEA 3C4WA 4IGUA 3CWZB 3NBXX 4ZOLE 2M67A 4X62T 1T98A 2N1GA 2NTXA 3AAAB 1XDPA 3UFGA 4UF0B 3ABVA 2CRBA 1IBLT 4YHHT 4JI4T 2E5LT 2BKOA 3X1DA 5EK3A 4H9RC 2J1DG 5BR8T 3T1HT 3UQ4A 4P0BA 3CX7B 1KF6A 5LJMA 3RYFE 3K3NA 5JR9B 3N9NA 3HKDE 3ZSSA 3UU6A 1H7CA 3PDYA 5IHYA 4IT4A 2WAUA 4ZZBA 2UU9T 3RQUA 2LSJA 2WWVA 4KP3C 2XQ3A 4TWDA 3IA3A 1KNZA 1OWAA 1OEDA 1YKHB 3T8OA 3RC8A 2JQKA 4X5TA 3I0OA 3ZYMA 2V7MA 1NAFA 3HKCE 5CA0E 2UUBT 2JJ9A 3ZYLA 3KINB 1X79A 1U5PA 2YU2A 3N9PA 3ESLA 4I4TE 4NXMT 2BVMA 4E7SA 5AQOB 2K48A 4HFBA 2WU2A 4HE8A 4B3TT 3VU7H 1N33T 4ZI2D 5LHGB 4AXPA 5EK4A 2LKGA 2RA1A 1LVFA 2RPAA 2FUPA 5LMUT 3QB5K 4X20E 4U2YA 2ZM0A 3CVRA 3QUJA 4ZS2A 2CM0A 1MIYA 1VRBA 2BS2A 2I6HA 4UV8B 2LOPA 2IC6A 4PJNA 4YLHA 2HN2A 3VR8A 3KFWX 2D2SA 1VCSA 4CZZB 1Z0PA 5LXTE 4ZEYA 3UFEA 2XQ5A 4YSYA 4TX5A 4WNKA 5HXHA 1N32T 1B7TA 2YU1A 2LSYA 2KWIB 3C4ZA 2J4GA 3UUNA 2WZHA 3ZJ2A 3CMLA 5AQUB 3AA7B 3FZKB 1BR4A 1ZEEA 2YINA 2K5BB 2W2UA 1D0XA 3RIAA 3ZSTA 4DR6T 1WYCA 5L2LA 2ACXA 4CI1B 2V7IA 5DABA 1WFDA 3RYCE 5ABFB 5AQKB 1CUNA 2MPKA 2ODUA 1FJGT 4X1IE 3PE0A 3Q2MA 2VQET 5LYJE 2MYSA 4KBMB 2X9WA 4PW8A 3UUMA 3RIFA 2KT9A 4XZCA 3AA6B 3K3OA 2YN6A 2DHRA 2KSRA 2QVAA 5IYZE 5KX5E 2JMKA 5FY7A 4DV5T 2IAKA 2MOZA 5HYAA 4ILCA 4AQGA 3L3PA 3ZCJA 1WYBA 2LJLA 3P4SA 4IDZA 2X9XA 2G0UA 5KXJA 5FMNA 2BS4A 3MACA 2X67A 4X1KE 3L09A 3HKEE 2A72A 5F5WA 2XHEB 3AXJB 3AAIA 2XASB 5AQLB 5FVLA 5J0ZA 4DBQA 2H89A 4HFHA 1WR0A 3KBTA 2CLYC 3VHLA 3AA0B 1SHZC 1HR0T 4ILUA 1E2AA 2V7KA 2K3WA 5H6RB 2Q9QD 2VB6A 3QB5A 3OKQA 4AQYT 4H9OC 1FMWA 3AEDA 2E2AA 3HI2A 2CHOA 5J1GA 4PNIA 5FXWA 1UURA 5JDLA 4YFSA 2XTLA 2QGSA 1T7SA 4I0UA 3CIRA 2NWBA 3ETUA 4EXTA 5CB4E 4KMCA 3SRZA 4HTEA 4IDOA 1YQ4A 1LRZA 5FL1A 5LMNT 4QX8B 4U31A 5LBQB 2X51A 4YJ3E 3ZN1B 4CXXA 3AEBA 4Q25A 2CLYB 4HWCA 3ZKRA 4GK5E 3P8CD 3N5LA 2P9BA 2ODVA 3CPZA 3UQ7A 4BJNA 3ZN0B 4L9IA 4IDNA 2ACZA 1UCUA 1S35A 2IW5B 4YSZA 1HNZT 5AQRB 3RX6A 1D0YA 4EIWA 4ANJA 5JQGE 3KV9A 5EK2A 3PUAA 2YDRA 3LSVA 3L39A 5JREA 1KEYA 3V5SA 4ADZA 3CX8B 2XJ7A 3PURA 2LHNA 1FMVA 2F4VT 1IAPA 1YD8G 4U74A 3FBLA 3ANWB 3AAEB 4H63V 2W0GA 2X9YA 4PK4A 3M65A 4UXNB 4DO0A 5FP3A 2E9XB 1AJ3A 2OLTA 1J5WA 4QX7B 2B76A 4A5XA 2DI4A 2LOSA 1MMNA 4YSXA 3Q5DA 2BKNA 2K9AA 3MA9A 4GK0E 2V26A 3RQWA 3G06A 3DP7A 3OVUA 2A3DA 2WB5A 2NOXA 3BQKA 2QYWA 3ONLC 1QLBA 4AKLA 4CI2B 2Y8DA 3KVAA 1XMQT 2VKJA 2FBWA 2VKHA 4FI5A 3UU5A 1WLXA 1U4QA 3FXDB 1V9DA 3B5MA 3UULA 4AI6A 2MTQA 3SFEA 3O1IA 3GA8A 5FKYA 5CJ5A 1E1HB 3LFMA 4WYVA 5LNKA 4YT0A 2NTYA 3H3MA 3FHNA 5AQGB 2OV9A 3AECA 4O2BE 2UUAT 1R8IA 4DR7T 2XAQB 4P09A 4DR4T 2UXBT 4EYYR 4CXWA 2HPJA 4IDQA 1LVKA 2CMRA 2M6BA 3TLTA 2QRXA 1MNEA 2Z6EA 5AFUL 2YDSA 3DJBA 2JPFA 5C8YE 3AE6A 3PUVF 3O1JA 4OFZA 4H9NC 2CWYA 3K8PC 3JADA 2DLRA 4ERRA 2DWGA 2FJAA 1HG5A 2YKSA 1HNXT 2Q9QC 1UK5A 4CN6A 1I6ZA 4K0KT 3NZPA 3HL6A 3KV4A 4LF9T 3PV0F 2XAJB 2X0LB 2IHR1 4U33A 3CQCB 2WM9A 3UT5E 4DV2T 5HXCA 5HXEA 3PUXF 3U3IA 1WR6A 2WDRA 3OYZA 3AA1B 3D0TA 3ZMSB 4HFDA 2XM2A 2BG9B 2XAGB 4P1NA 3OBVE 2XM1A 2W67A 3BQLA 5GONE 2IUBA 3RIUC 4LMJA 3RYHE 3GMIA 4AKIA 3WI3A 2WSSV 4BA9A 2HHHT 2AXDS 2HPLA 1M7KA 1KNPA 2EHOB 4DV3T 3TKLB 4CI3B 3PU3A 4JI2T 3RKGA 4UVAB 4EEBA 4DV4T 2RP4A 3FZHB 3LBXA 1US7B 3LK2B 2Q9QB 2YEVC 4EEDA 4EOZB 3ZYKA 3E08A 5C2TA 3N2GE 4DR2T 5HWXA 4DR3T 4ILAA 4B3RT 4YTNA 3JC6D 3PU8A 3AEGA 2XQ9A 5JRCB 2VVSA 1WCRA 3F2EA 3AVRA 4KUMB 2VKOA 1T8BA 1YQ3A 3FXEB 4I50E 1XMOT 4B6XA 2L3LA 4ZZCA 3R84B 4FJOA 4QH4A 2W4XA 4HGAA 5LJNA 3RYIE 3UU4A 3TLVA 1ZKEA 4ZI7E 4IE7A 2IMLA 5FY0A 5LBMA 2HH7A 3VKHA 1J5ET 5DQWA 3R6NA 2MBGA 3ONXA 4YXDA 5JDGA 4TNWA 2JQHA 2BG9E 4GKKT 2WMOA 4LF8T 4JYAT 3NRYA 3FBZA 2H7OA 2JMHA 2LM2A 2D5UA 3UU8A 1ZV4X 5EZYE 2W62A 4JI0T 1HFAA 1N36T 1IZNB 3IEEA 2X0HA 3M3ZB 2IIUA 4CXYA 4KI0F 5L3FB 3K3QC 4TUYE 5HXSA 3MK7C 2UUCT 4WZXA 1W0AA 4O4IE 3OPCA 2L8KA 4EZ4A 4H9SE 1KK7A 2N2NA 4ILBA 3P4RA 4OHFA 4IE4A 2FJBA 4DV7T 4X1YE 2VL0A 2YK0A 1ZP0A 5FXZA 1J1JA 3ZEFB 1SE7A 1IJ6A 3GN5A 2CXLA 2ZM2A 2BVLA 3OTOT 2K24A 5ABEA 2WZIA 4I43B 2ZLYA 4UELA 3NRXA 3WAJA 2JRKA 4COFA 1HX1B 5JDQA 5HWYA 5HAXA 2A9UA 3NZQA 2V6XA 4GKJT 3N9LA 2VK9A 2FJDA 4HFVA 4HWFA 2W61A 4PK5A 1MIWA 2V6YB 3JCFA 1IBKT 3U78A 2W00A 4LF5T 2CPTA 4U72A 2DL1A 3CKDA 5AQVB 1FEWA 2JIWA 5LG4A 3QOFA 3AB3B 4JV5T 4OYJA 5DJQC 4HN9A 1OEDC 2CE7A 3N2OA 1NENA 4NUUA 4GIWA 3RF1A 3DTOA 2LRLA 1D0ZA 4XBFB 1SA0E 4EV6A 4DNDA 4HFEA 3A5XA 4ISTA 5FNVE 4C91A 1BR1A 3AE2A 2XAHB 2ZMAA 1CHUA 1JNZA 3TLSA 2D9DA 4UF0A 4X64T 2NW9A 2WBLA 3ZC1A 2VURA 5JDHA 4LFAT 3I9YA 4JUYA 4CN1A 2JQ9A 2PFVA 5J2TE 2X0YA 3Q5XA 3TLUA 4JI1T 4JI5T 1GQEA 3AE1A 5L3EB 3EDVA 1D1AA 3KDSE 2UXDT 3Q5EA 4PK6A 3K1SA 4GYRA 4LMKA 5FYMA 3I1AA 3PUGA 4O4HE 4I55E 1MMGA 4TV8E 3AEFA 4XAXB 5JR9A 3C64A 3JC6C 3CK6A 4LMLA 5LHHB 1IBMT 4NUVA 1OEDB 4DMWA 1OXZA 3ZT6A 3H3AA 3ZT7A 3RRWA 3ZMZB 2WP9A 1HG2A 2YOEA 3IHRA 3PJAJ 3PJAA 4AKGA 4ISSA 2PG8A 2XQ7A 2KMFA 4Z90A 5LHIB 4U7YA 3VRBA 5ADXL 4IREA 3TLWA 1JNRA 4DV0T 2XSBA 4LFCT 1UUSA 4U3CA 4ASKA 4U2ZA 4DR5T 3N2KE 4UR9A 2LEHA 4PJJA 3UUXB 4ZI3D 3Q9DA 2CHNA 4PJLA 3UU3A 3ZPOA 2W66A 4DVDA 2V1DB 1NEKA 5FVKA 2B1EA 5JTGA 3SS1A 3N9MA 2WDVA 1WRDA 5E0OA 5AQIB 2CCQA 1XNRT 5LG3A 3RC3A 3P50A 5KMGP 4GYSA 4UIGA 3RH3A 2CA5A 5LGTB 4JI3T 5IWAT 1VOMA 4JEHB 2GK9A 4ZXLA 1N34T 1UX5A 2CXFA 4MALA 2L9QA 4H9QC 5AQTB 2E8IA 2CEAA 3T1YT 4AQFA 3NKZA 1YW0A 2XSAA 4QXCB 1OEDE 1XWMA 4QWNB 3QK6A 2KXPB 3IF8B 3GWHA 4KHZF 1YXRA 5JDMA 5M4YA 2V5CA 3MZKB 3AVSA 3H37A 4PAGA 2DWKA 4IDPA 3C4XA 3E0ZA 5A1LA 4UEMA 4JEUB 2X68A 4UVBB 2AE9A 2XZEA 5ABFA 4X65T 3VRAA 1BR0A 3EVYA 1DU2A 4G63A 4KHPT 2LRKA 3W15B 4Z91A 5HEHA 1D1BA 2LLYA 3OJAA 3JAEA 3CX6B 4TN7B 1X9BA 3A8YC 4V1Av 2D0UA 3RLFF 2NR4A 4HWHA 5AQHB 5JR9C 2XQYA 5ABGA 3EAMA 3VR9A 4HFCA 4A56A 2N9DA 2E5VA 2WDQA 1XDOA 3WAKA 4ZHQE 5HCJA 2XAFB 3AXJA 4M1PA 3FZLB 5HXRA 1HS7A 1QUUA 4OX9T 4JLEA 3PUQA 4N78D 4OYKA 2UXCT 4EAHA 1UX4A 2WY2A 2W63A 3RRCA 3NVOA 3RKOA 5AQNB 4IE0A 1T72A 2I59A 4TV9E 2XQAA 4Z8XA 5L3DB 1XNQT 2PBIA 5JDFA 4DMVA 5KDMC 3ZMVB 2H7VC 2LSKA 2YDQA 3ETVA 1W0BA 3LJCA 3HA4A 2UXXB 4WBNE 4JI8T 4PFPA 2WWUA 5AQPB 4WW0A 5LP6E 4UVCB 1G8XA 2LE8A 3KBUA 4TWHA 2LSGA 4IL4A 5L4HA 2WCAA 3A7MA 4IE5A 1ZHCA 1E7PA 1L0VA 3ZMTB 3RPUA 5L47A 4IL9A 2BDEA 4ZI3C 1UGOA 4H63H 5HEUA 1FIOA 5FXVA 4AQFC 5JH7E 1HF8A 4A97A 2BBJA 5BMVE 4YTMA 2E9XD 3AE9A 3SWHA 3V5UA 2VQFT 2V5DA 4NPPA 3L8RA 4IIJE 4LF7T 1SUMB 3RHWA 3RGLA 5JDNA 2ZM8A 2OA5A 2LT3A 3IBPA 1M62A 4DR1T 2SPCA 2WS3A 3O9XA 3B13A 1YKEB 2J47A 3ANWA 4JI6T 2CXDA 4G2AA 5F3JA 2E9XA 1XZYA 2QA7A 5ETWA 3EUHA 4JBWF 2C5IT 2WU5A 2XPKA 1D1CA 3JAFA 3LG7A 4F6RC 4YHJA 4O2AE 2LHRA 4MFRA 2CBJA 2PJQA 4DIDB 3KVBA 2LSIA 1KNRA 2R6GF 5CA1E 5J2UE 3J7Yq 2V8SV 4J2CA 5HEOA 4AKHA 2C5JA 2M6IA 3AE3A 2Y6XA 4HWIB 3HR0A 3EI0A 1ZOYA 2DCFA 4O4JE 1IJ5A 2NW8A 4EB6E 5IUXA 4B3ST 5H6QB 3ZCIA 4BJMA 4PJMA 5LOVE 1MNDA 5CGMA 4O4LE 5AQMB 1LKXA 4BAYB 2WQYA 4DBRA 3PUWF 5L3BB 5L3GB 4DV1T 3BQIA 3MXZA 3Q5WA 4LF4T 2BZBA 4L0RA 1BR2A 3I9WA 3UUBA 4TWFA 2V7JA 3PUSA 1MMDA 3ZJ1A 2XQ4A 1G73A 1HNWT 2EHOD 4WBOA 2DNXA 1KFYA 3ZC0A 3SFDA 3EDUA 4MHCA 4ZS3A 1HX8A 3KV6A 3PTRB 2KNDA 3P4WA 2BG9A 5AQQB 4LFBT 2CWOA 2VKDA 5LA6E 4PFOA 5LGUB 2BS3A 5AQSB 3AEAA 1I94T 2C5KT 2KINB 3LBXB 3UTKA 4QHOA 5HEJA 3LDQB 1MMAA 3C50A 2LM9A 5ABHA 3O1HA 2XQ6A 2EHOA 5L3CB 1QSDA 4DV6T 5TAOA 4F8HA 2PTFA 3KV5A 2D0TA 2XY8B 3RI5A 3CQGB 4AISA 3J9X1 2VWAA 2Q9QA 5FXXA 3FZFB 5AQFB 2H88A 4EGWA 2E9XC 2VVNA 4JI7T 3AE5A 3ZT5A 3O4XE 3PUYF 4HWDA 5FL0A 2KWHA 4L5GA 3LK42 3HKBE 4ZI2C 2C0SA 3C98B 4P0AA 1VCTA 4K0UA 5JRCA 3MKDA 4C90A 3P4PA 3CQXC 1HCIA 4B3MT 5DQVA 3RIUA 4E7ZA 3ZMUB 3F31A 3QC9A 2Y48B 3P4QA 3N9QA 4NXNT 5LCYA 4U7IA 3E22E 4NIQA 3EHZA 2NP9A 4YJ2E 2UXNB 4CN4A 1Y64B 4YY3T 4UV9B 1W9RA 5HCMA 4HKAA 5HEGA 3FZMB 4LF6T 3N9OA 2VASA 5AQJB 4TZ4C 3AE7A
chains in the Genus database with same CATH topology
1I6ZA 4HWFA 1M7KA 5AQVB 5AQOB 5AQGB 3FZFB 5AQFB 5AQPB 5AQKB 5AQUB 3LDQB 1UGOA 5AQMB 5AQRB 4HWIB 1HX1B 5AQTB 3FZKB 3FZHB 5AQLB 5AQIB 1T7SA 4HWDA 3A8YC 5AQNB 5AQSB 4HWCA 3FZMB 2D9DA 5AQQB 1M62A 4HWHA 3FZLB 5AQJB 1UK5A 5AQHB 3M3ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I6Z A;  4HWF A;  1M7K A;  5AQV B;  5AQO B;  5AQG B;  3FZF B;  5AQF B;  5AQP B;  5AQK B;  5AQU B;  3LDQ B;  1UGO A;  5AQM B;  5AQR B;  4HWI B;  1HX1 B;  5AQT B;  3FZK B;  3FZH B;  5AQL B;  5AQI B;  1T7S A;  4HWD A;  3A8Y C;  5AQN B;  5AQS B;  4HWC A;  3FZM B;  2D9D A;  5AQQ B;  1M62 A;  4HWH A;  3FZL B;  5AQJ B;  1UK5 A;  5AQH B;  3M3Z B; 
#chains in the Genus database with same CATH topology
 3ZLI A;  3I0Q A;  1EZ3 A;  3MJX A;  3C51 A;  4QXH B;  2NW7 A;  4O8S A;  2WMN A;  2ZM6 T;  4DUY T;  2VL8 A;  2IC9 A;  3LK3 B;  4MLK A;  2KLQ A;  4EZH A;  1Y01 A;  2BKP A;  4CQI A;  2JQQ A;  2HN1 A;  4H9P C;  4DUZ T;  3P7I A;  4HFI A;  4HEA A;  4TNV A;  1MIV A;  3GN5 B;  1HTJ F;  4QXB B;  5L4E A;  3OYX A;  3PUZ F;  4KX6 A;  3FB2 A;  2LKH A;  4MBQ A;  3SOL A;  5LB7 B;  5CFB A;  1NWM X;  2X9H A;  2MAW A;  2ES0 A;  4IHJ E;  5F8P A;  4A98 A;  5LGN B;  2I0M A;  3B57 A;  4QH5 A;  2V7L A;  4OK0 A;  2J62 A;  2BBH A;  2CBI A;  4AKR B;  3VKG A;  2X66 A;  3AEE A;  5JVD E;  4EYU A;  2BG9 C;  3AE8 A;  3QNU A;  2V6Y A;  1Z8U A;  2XQ8 A;  2FJE A;  2H3R A;  2KZ7 B;  4QH1 A;  4X66 T;  3AE4 A;  4IE6 A;  3ONJ A;  1W09 A;  5FY1 A;  1O3X A;  4AIU A;  1S94 A;  5C3J A;  2EHO C;  3S4U A;  3EAB A;  3F57 A;  3BK9 A;  4QKN A;  2IDO B;  4YTP A;  4GOU A;  2A2F X;  3NWI A;  2XUE A;  3C4W A;  4IGU A;  3CWZ B;  3NBX X;  4ZOL E;  2M67 A;  4X62 T;  1T98 A;  2N1G A;  2NTX A;  3AAA B;  1XDP A;  3UFG A;  4UF0 B;  3ABV A;  2CRB A;  1IBL T;  4YHH T;  4JI4 T;  2E5L T;  2BKO A;  3X1D A;  5EK3 A;  4H9R C;  2J1D G;  5BR8 T;  3T1H T;  3UQ4 A;  4P0B A;  3CX7 B;  1KF6 A;  5LJM A;  3RYF E;  3K3N A;  5JR9 B;  3N9N A;  3HKD E;  3ZSS A;  3UU6 A;  1H7C A;  3PDY A;  5IHY A;  4IT4 A;  2WAU A;  4ZZB A;  2UU9 T;  3RQU A;  2LSJ A;  2WWV A;  4KP3 C;  2XQ3 A;  4TWD A;  3IA3 A;  1KNZ A;  1OWA A;  1OED A;  1YKH B;  3T8O A;  3RC8 A;  2JQK A;  4X5T A;  3I0O A;  3ZYM A;  2V7M A;  1NAF A;  3HKC E;  5CA0 E;  2UUB T;  2JJ9 A;  3ZYL A;  3KIN B;  1X79 A;  1U5P A;  2YU2 A;  3N9P A;  3ESL A;  4I4T E;  4NXM T;  2BVM A;  4E7S A;  5AQO B;  2K48 A;  4HFB A;  2WU2 A;  4HE8 A;  4B3T T;  3VU7 H;  1N33 T;  4ZI2 D;  5LHG B;  4AXP A;  5EK4 A;  2LKG A;  2RA1 A;  1LVF A;  2RPA A;  2FUP A;  5LMU T;  3QB5 K;  4X20 E;  4U2Y A;  2ZM0 A;  3CVR A;  3QUJ A;  4ZS2 A;  2CM0 A;  1MIY A;  1VRB A;  2BS2 A;  2I6H A;  4UV8 B;  2LOP A;  2IC6 A;  4PJN A;  4YLH A;  2HN2 A;  3VR8 A;  3KFW X;  2D2S A;  1VCS A;  4CZZ B;  1Z0P A;  5LXT E;  4ZEY A;  3UFE A;  2XQ5 A;  4YSY A;  4TX5 A;  4WNK A;  5HXH A;  1N32 T;  1B7T A;  2YU1 A;  2LSY A;  2KWI B;  3C4Z A;  2J4G A;  3UUN A;  2WZH A;  3ZJ2 A;  3CML A;  5AQU B;  3AA7 B;  3FZK B;  1BR4 A;  1ZEE A;  2YIN A;  2K5B B;  2W2U A;  1D0X A;  3RIA A;  3ZST A;  4DR6 T;  1WYC A;  5L2L A;  2ACX A;  4CI1 B;  2V7I A;  5DAB A;  1WFD A;  3RYC E;  5ABF B;  5AQK B;  1CUN A;  2MPK A;  2ODU A;  1FJG T;  4X1I E;  3PE0 A;  3Q2M A;  2VQE T;  5LYJ E;  2MYS A;  4KBM B;  2X9W A;  4PW8 A;  3UUM A;  3RIF A;  2KT9 A;  4XZC A;  3AA6 B;  3K3O A;  2YN6 A;  2DHR A;  2KSR A;  2QVA A;  5IYZ E;  5KX5 E;  2JMK A;  5FY7 A;  4DV5 T;  2IAK A;  2MOZ A;  5HYA A;  4ILC A;  4AQG A;  3L3P A;  3ZCJ A;  1WYB A;  2LJL A;  3P4S A;  4IDZ A;  2X9X A;  2G0U A;  5KXJ A;  5FMN A;  2BS4 A;  3MAC A;  2X67 A;  4X1K E;  3L09 A;  3HKE E;  2A72 A;  5F5W A;  2XHE B;  3AXJ B;  3AAI A;  2XAS B;  5AQL B;  5FVL A;  5J0Z A;  4DBQ A;  2H89 A;  4HFH A;  1WR0 A;  3KBT A;  2CLY C;  3VHL A;  3AA0 B;  1SHZ C;  1HR0 T;  4ILU A;  1E2A A;  2V7K A;  2K3W A;  5H6R B;  2Q9Q D;  2VB6 A;  3QB5 A;  3OKQ A;  4AQY T;  4H9O C;  1FMW A;  3AED A;  2E2A A;  3HI2 A;  2CHO A;  5J1G A;  4PNI A;  5FXW A;  1UUR A;  5JDL A;  4YFS A;  2XTL A;  2QGS A;  1T7S A;  4I0U A;  3CIR A;  2NWB A;  3ETU A;  4EXT A;  5CB4 E;  4KMC A;  3SRZ A;  4HTE A;  4IDO A;  1YQ4 A;  1LRZ A;  5FL1 A;  5LMN T;  4QX8 B;  4U31 A;  5LBQ B;  2X51 A;  4YJ3 E;  3ZN1 B;  4CXX A;  3AEB A;  4Q25 A;  2CLY B;  4HWC A;  3ZKR A;  4GK5 E;  3P8C D;  3N5L A;  2P9B A;  2ODV A;  3CPZ A;  3UQ7 A;  4BJN A;  3ZN0 B;  4L9I A;  4IDN A;  2ACZ A;  1UCU A;  1S35 A;  2IW5 B;  4YSZ A;  1HNZ T;  5AQR B;  3RX6 A;  1D0Y A;  4EIW A;  4ANJ A;  5JQG E;  3KV9 A;  5EK2 A;  3PUA A;  2YDR A;  3LSV A;  3L39 A;  5JRE A;  1KEY A;  3V5S A;  4ADZ A;  3CX8 B;  2XJ7 A;  3PUR A;  2LHN A;  1FMV A;  2F4V T;  1IAP A;  1YD8 G;  4U74 A;  3FBL A;  3ANW B;  3AAE B;  4H63 V;  2W0G A;  2X9Y A;  4PK4 A;  3M65 A;  4UXN B;  4DO0 A;  5FP3 A;  2E9X B;  1AJ3 A;  2OLT A;  1J5W A;  4QX7 B;  2B76 A;  4A5X A;  2DI4 A;  2LOS A;  1MMN A;  4YSX A;  3Q5D A;  2BKN A;  2K9A A;  3MA9 A;  4GK0 E;  2V26 A;  3RQW A;  3G06 A;  3DP7 A;  3OVU A;  2A3D A;  2WB5 A;  2NOX A;  3BQK A;  2QYW A;  3ONL C;  1QLB A;  4AKL A;  4CI2 B;  2Y8D A;  3KVA A;  1XMQ T;  2VKJ A;  2FBW A;  2VKH A;  4FI5 A;  3UU5 A;  1WLX A;  1U4Q A;  3FXD B;  1V9D A;  3B5M A;  3UUL A;  4AI6 A;  2MTQ A;  3SFE A;  3O1I A;  3GA8 A;  5FKY A;  5CJ5 A;  1E1H B;  3LFM A;  4WYV A;  5LNK A;  4YT0 A;  2NTY A;  3H3M A;  3FHN A;  5AQG B;  2OV9 A;  3AEC A;  4O2B E;  2UUA T;  1R8I A;  4DR7 T;  2XAQ B;  4P09 A;  4DR4 T;  2UXB T;  4EYY R;  4CXW A;  2HPJ A;  4IDQ A;  1LVK A;  2CMR A;  2M6B A;  3TLT A;  2QRX A;  1MNE A;  2Z6E A;  5AFU L;  2YDS A;  3DJB A;  2JPF A;  5C8Y E;  3AE6 A;  3PUV F;  3O1J A;  4OFZ A;  4H9N C;  2CWY A;  3K8P C;  3JAD A;  2DLR A;  4ERR A;  2DWG A;  2FJA A;  1HG5 A;  2YKS A;  1HNX T;  2Q9Q C;  1UK5 A;  4CN6 A;  1I6Z A;  4K0K T;  3NZP A;  3HL6 A;  3KV4 A;  4LF9 T;  3PV0 F;  2XAJ B;  2X0L B;  2IHR 1;  4U33 A;  3CQC B;  2WM9 A;  3UT5 E;  4DV2 T;  5HXC A;  5HXE A;  3PUX F;  3U3I A;  1WR6 A;  2WDR A;  3OYZ A;  3AA1 B;  3D0T A;  3ZMS B;  4HFD A;  2XM2 A;  2BG9 B;  2XAG B;  4P1N A;  3OBV E;  2XM1 A;  2W67 A;  3BQL A;  5GON E;  2IUB A;  3RIU C;  4LMJ A;  3RYH E;  3GMI A;  4AKI A;  3WI3 A;  2WSS V;  4BA9 A;  2HHH T;  2AXD S;  2HPL A;  1M7K A;  1KNP A;  2EHO B;  4DV3 T;  3TKL B;  4CI3 B;  3PU3 A;  4JI2 T;  3RKG A;  4UVA B;  4EEB A;  4DV4 T;  2RP4 A;  3FZH B;  3LBX A;  1US7 B;  3LK2 B;  2Q9Q B;  2YEV C;  4EED A;  4EOZ B;  3ZYK A;  3E08 A;  5C2T A;  3N2G E;  4DR2 T;  5HWX A;  4DR3 T;  4ILA A;  4B3R T;  4YTN A;  3JC6 D;  3PU8 A;  3AEG A;  2XQ9 A;  5JRC B;  2VVS A;  1WCR A;  3F2E A;  3AVR A;  4KUM B;  2VKO A;  1T8B A;  1YQ3 A;  3FXE B;  4I50 E;  1XMO T;  4B6X A;  2L3L A;  4ZZC A;  3R84 B;  4FJO A;  4QH4 A;  2W4X A;  4HGA A;  5LJN A;  3RYI E;  3UU4 A;  3TLV A;  1ZKE A;  4ZI7 E;  4IE7 A;  2IML A;  5FY0 A;  5LBM A;  2HH7 A;  3VKH A;  1J5E T;  5DQW A;  3R6N A;  2MBG A;  3ONX A;  4YXD A;  5JDG A;  4TNW A;  2JQH A;  2BG9 E;  4GKK T;  2WMO A;  4LF8 T;  4JYA T;  3NRY A;  3FBZ A;  2H7O A;  2JMH A;  2LM2 A;  2D5U A;  3UU8 A;  1ZV4 X;  5EZY E;  2W62 A;  4JI0 T;  1HFA A;  1N36 T;  1IZN B;  3IEE A;  2X0H A;  3M3Z B;  2IIU A;  4CXY A;  4KI0 F;  5L3F B;  3K3Q C;  4TUY E;  5HXS A;  3MK7 C;  2UUC T;  4WZX A;  1W0A A;  4O4I E;  3OPC A;  2L8K A;  4EZ4 A;  4H9S E;  1KK7 A;  2N2N A;  4ILB A;  3P4R A;  4OHF A;  4IE4 A;  2FJB A;  4DV7 T;  4X1Y E;  2VL0 A;  2YK0 A;  1ZP0 A;  5FXZ A;  1J1J A;  3ZEF B;  1SE7 A;  1IJ6 A;  3GN5 A;  2CXL A;  2ZM2 A;  2BVL A;  3OTO T;  2K24 A;  5ABE A;  2WZI A;  4I43 B;  2ZLY A;  4UEL A;  3NRX A;  3WAJ A;  2JRK A;  4COF A;  1HX1 B;  5JDQ A;  5HWY A;  5HAX A;  2A9U A;  3NZQ A;  2V6X A;  4GKJ T;  3N9L A;  2VK9 A;  2FJD A;  4HFV A;  4HWF A;  2W61 A;  4PK5 A;  1MIW A;  2V6Y B;  3JCF A;  1IBK T;  3U78 A;  2W00 A;  4LF5 T;  2CPT A;  4U72 A;  2DL1 A;  3CKD A;  5AQV B;  1FEW A;  2JIW A;  5LG4 A;  3QOF A;  3AB3 B;  4JV5 T;  4OYJ A;  5DJQ C;  4HN9 A;  1OED C;  2CE7 A;  3N2O A;  1NEN A;  4NUU A;  4GIW A;  3RF1 A;  3DTO A;  2LRL A;  1D0Z A;  4XBF B;  1SA0 E;  4EV6 A;  4DND A;  4HFE A;  3A5X A;  4IST A;  5FNV E;  4C91 A;  1BR1 A;  3AE2 A;  2XAH B;  2ZMA A;  1CHU A;  1JNZ A;  3TLS A;  2D9D A;  4UF0 A;  4X64 T;  2NW9 A;  2WBL A;  3ZC1 A;  2VUR A;  5JDH A;  4LFA T;  3I9Y A;  4JUY A;  4CN1 A;  2JQ9 A;  2PFV A;  5J2T E;  2X0Y A;  3Q5X A;  3TLU A;  4JI1 T;  4JI5 T;  1GQE A;  3AE1 A;  5L3E B;  3EDV A;  1D1A A;  3KDS E;  2UXD T;  3Q5E A;  4PK6 A;  3K1S A;  4GYR A;  4LMK A;  5FYM A;  3I1A A;  3PUG A;  4O4H E;  4I55 E;  1MMG A;  4TV8 E;  3AEF A;  4XAX B;  5JR9 A;  3C64 A;  3JC6 C;  3CK6 A;  4LML A;  5LHH B;  1IBM T;  4NUV A;  1OED B;  4DMW A;  1OXZ A;  3ZT6 A;  3H3A A;  3ZT7 A;  3RRW A;  3ZMZ B;  2WP9 A;  1HG2 A;  2YOE A;  3IHR A;  3PJA J;  3PJA A;  4AKG A;  4ISS A;  2PG8 A;  2XQ7 A;  2KMF A;  4Z90 A;  5LHI B;  4U7Y A;  3VRB A;  5ADX L;  4IRE A;  3TLW A;  1JNR A;  4DV0 T;  2XSB A;  4LFC T;  1UUS A;  4U3C A;  4ASK A;  4U2Z A;  4DR5 T;  3N2K E;  4UR9 A;  2LEH A;  4PJJ A;  3UUX B;  4ZI3 D;  3Q9D A;  2CHN A;  4PJL A;  3UU3 A;  3ZPO A;  2W66 A;  4DVD A;  2V1D B;  1NEK A;  5FVK A;  2B1E A;  5JTG A;  3SS1 A;  3N9M A;  2WDV A;  1WRD A;  5E0O A;  5AQI B;  2CCQ A;  1XNR T;  5LG3 A;  3RC3 A;  3P50 A;  5KMG P;  4GYS A;  4UIG A;  3RH3 A;  2CA5 A;  5LGT B;  4JI3 T;  5IWA T;  1VOM A;  4JEH B;  2GK9 A;  4ZXL A;  1N34 T;  1UX5 A;  2CXF A;  4MAL A;  2L9Q A;  4H9Q C;  5AQT B;  2E8I A;  2CEA A;  3T1Y T;  4AQF A;  3NKZ A;  1YW0 A;  2XSA A;  4QXC B;  1OED E;  1XWM A;  4QWN B;  3QK6 A;  2KXP B;  3IF8 B;  3GWH A;  4KHZ F;  1YXR A;  5JDM A;  5M4Y A;  2V5C A;  3MZK B;  3AVS A;  3H37 A;  4PAG A;  2DWK A;  4IDP A;  3C4X A;  3E0Z A;  5A1L A;  4UEM A;  4JEU B;  2X68 A;  4UVB B;  2AE9 A;  2XZE A;  5ABF A;  4X65 T;  3VRA A;  1BR0 A;  3EVY A;  1DU2 A;  4G63 A;  4KHP T;  2LRK A;  3W15 B;  4Z91 A;  5HEH A;  1D1B A;  2LLY A;  3OJA A;  3JAE A;  3CX6 B;  4TN7 B;  1X9B A;  3A8Y C;  4V1A v;  2D0U A;  3RLF F;  2NR4 A;  4HWH A;  5AQH B;  5JR9 C;  2XQY A;  5ABG A;  3EAM A;  3VR9 A;  4HFC A;  4A56 A;  2N9D A;  2E5V A;  2WDQ A;  1XDO A;  3WAK A;  4ZHQ E;  5HCJ A;  2XAF B;  3AXJ A;  4M1P A;  3FZL B;  5HXR A;  1HS7 A;  1QUU A;  4OX9 T;  4JLE A;  3PUQ A;  4N78 D;  4OYK A;  2UXC T;  4EAH A;  1UX4 A;  2WY2 A;  2W63 A;  3RRC A;  3NVO A;  3RKO A;  5AQN B;  4IE0 A;  1T72 A;  2I59 A;  4TV9 E;  2XQA A;  4Z8X A;  5L3D B;  1XNQ T;  2PBI A;  5JDF A;  4DMV A;  5KDM C;  3ZMV B;  2H7V C;  2LSK A;  2YDQ A;  3ETV A;  1W0B A;  3LJC A;  3HA4 A;  2UXX B;  4WBN E;  4JI8 T;  4PFP A;  2WWU A;  5AQP B;  4WW0 A;  5LP6 E;  4UVC B;  1G8X A;  2LE8 A;  3KBU A;  4TWH A;  2LSG A;  4IL4 A;  5L4H A;  2WCA A;  3A7M A;  4IE5 A;  1ZHC A;  1E7P A;  1L0V A;  3ZMT B;  3RPU A;  5L47 A;  4IL9 A;  2BDE A;  4ZI3 C;  1UGO A;  4H63 H;  5HEU A;  1FIO A;  5FXV A;  4AQF C;  5JH7 E;  1HF8 A;  4A97 A;  2BBJ A;  5BMV E;  4YTM A;  2E9X D;  3AE9 A;  3SWH A;  3V5U A;  2VQF T;  2V5D A;  4NPP A;  3L8R A;  4IIJ E;  4LF7 T;  1SUM B;  3RHW A;  3RGL A;  5JDN A;  2ZM8 A;  2OA5 A;  2LT3 A;  3IBP A;  1M62 A;  4DR1 T;  2SPC A;  2WS3 A;  3O9X A;  3B13 A;  1YKE B;  2J47 A;  3ANW A;  4JI6 T;  2CXD A;  4G2A A;  5F3J A;  2E9X A;  1XZY A;  2QA7 A;  5ETW A;  3EUH A;  4JBW F;  2C5I T;  2WU5 A;  2XPK A;  1D1C A;  3JAF A;  3LG7 A;  4F6R C;  4YHJ A;  4O2A E;  2LHR A;  4MFR A;  2CBJ A;  2PJQ A;  4DID B;  3KVB A;  2LSI A;  1KNR A;  2R6G F;  5CA1 E;  5J2U E;  3J7Y q;  2V8S V;  4J2C A;  5HEO A;  4AKH A;  2C5J A;  2M6I A;  3AE3 A;  2Y6X A;  4HWI B;  3HR0 A;  3EI0 A;  1ZOY A;  2DCF A;  4O4J E;  1IJ5 A;  2NW8 A;  4EB6 E;  5IUX A;  4B3S T;  5H6Q B;  3ZCI A;  4BJM A;  4PJM A;  5LOV E;  1MND A;  5CGM A;  4O4L E;  5AQM B;  1LKX A;  4BAY B;  2WQY A;  4DBR A;  3PUW F;  5L3B B;  5L3G B;  4DV1 T;  3BQI A;  3MXZ A;  3Q5W A;  4LF4 T;  2BZB A;  4L0R A;  1BR2 A;  3I9W A;  3UUB A;  4TWF A;  2V7J A;  3PUS A;  1MMD A;  3ZJ1 A;  2XQ4 A;  1G73 A;  1HNW T;  2EHO D;  4WBO A;  2DNX A;  1KFY A;  3ZC0 A;  3SFD A;  3EDU A;  4MHC A;  4ZS3 A;  1HX8 A;  3KV6 A;  3PTR B;  2KND A;  3P4W A;  2BG9 A;  5AQQ B;  4LFB T;  2CWO A;  2VKD A;  5LA6 E;  4PFO A;  5LGU B;  2BS3 A;  5AQS B;  3AEA A;  1I94 T;  2C5K T;  2KIN B;  3LBX B;  3UTK A;  4QHO A;  5HEJ A;  3LDQ B;  1MMA A;  3C50 A;  2LM9 A;  5ABH A;  3O1H A;  2XQ6 A;  2EHO A;  5L3C B;  1QSD A;  4DV6 T;  5TAO A;  4F8H A;  2PTF A;  3KV5 A;  2D0T A;  2XY8 B;  3RI5 A;  3CQG B;  4AIS A;  3J9X 1;  2VWA A;  2Q9Q A;  5FXX A;  3FZF B;  5AQF B;  2H88 A;  4EGW A;  2E9X C;  2VVN A;  4JI7 T;  3AE5 A;  3ZT5 A;  3O4X E;  3PUY F;  4HWD A;  5FL0 A;  2KWH A;  4L5G A;  3LK4 2;  3HKB E;  4ZI2 C;  2C0S A;  3C98 B;  4P0A A;  1VCT A;  4K0U A;  5JRC A;  3MKD A;  4C90 A;  3P4P A;  3CQX C;  1HCI A;  4B3M T;  5DQV A;  3RIU A;  4E7Z A;  3ZMU B;  3F31 A;  3QC9 A;  2Y48 B;  3P4Q A;  3N9Q A;  4NXN T;  5LCY A;  4U7I A;  3E22 E;  4NIQ A;  3EHZ A;  2NP9 A;  4YJ2 E;  2UXN B;  4CN4 A;  1Y64 B;  4YY3 T;  4UV9 B;  1W9R A;  5HCM A;  4HKA A;  5HEG A;  3FZM B;  4LF6 T;  3N9O A;  2VAS A;  5AQJ B;  4TZ4 C;  3AE7 A; 
#chains in the Genus database with same CATH homology
 1I6Z A;  4HWF A;  1M7K A;  5AQV B;  5AQO B;  5AQG B;  3FZF B;  5AQF B;  5AQP B;  5AQK B;  5AQU B;  3LDQ B;  1UGO A;  5AQM B;  5AQR B;  4HWI B;  1HX1 B;  5AQT B;  3FZK B;  3FZH B;  5AQL B;  5AQI B;  1T7S A;  4HWD A;  3A8Y C;  5AQN B;  5AQS B;  4HWC A;  3FZM B;  2D9D A;  5AQQ B;  1M62 A;  4HWH A;  3FZL B;  5AQJ B;  1UK5 A;  5AQH B;  3M3Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...