3A8YC

Crystal structure of the complex between the bag5 bd5 and hsp70 nbd
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
KEALEKRKLFACEEHPSHKAVWNVLGNLSEIQGEVLSFDGNRTDKNYIRLEELLTKQLLALDAVDPQGEEKCKAARKQAVRLAQNILSYLDLKSDEWEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heat shock 70 kDa protein 1
publication title The C-terminal BAG domain of BAG5 induces conformational changes of the Hsp70 nucleotide-binding domain for ADP-ATP exchange
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 34
structure length 99
sequence length 99
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 3a8yC00
3FZLB 5AQJB 4HWCA 5AQQB 5AQOB 3FZFB 5AQVB 1HX1B 5AQHB 3FZHB 5AQMB 3A8YC 3FZMB 4HWDA 5AQKB 1UGOA 3FZKB 1M7KA 5AQSB 2D9DA 4HWFA 5AQPB 1M62A 5AQGB 4HWHA 4HWIB 5AQFB 5AQIB 5AQRB 3LDQB 1T7SA 5AQNB 5AQLB 5AQUB 1I6ZA 1UK5A 3M3ZB 5AQTB
chains in the Genus database with same CATH superfamily
4NXMT 2H3RA 3Q5EA 2NOXA 1S35A 1HFAA 1U4QA 4YTPA 2V7MA 3VU7H 1XNQT 4X5TA 5FKYA 3CVRA 3LDQB 2VURA 2PTFA 2UXCT 4C91A 3PDYA 3VR9A 2JJ9A 4B3TT 3N9MA 3ZYMA 5LBQB 5L3EB 4YHJA 3RYFE 2VKJA 3ABVA 3JADA 3ZCIA 3ZSSA 3ONXA 1MMNA 3ZT7A 3GN5B 4HFDA 2D0UA 1N34T 3FZFB 2I0MA 4DNDA 3UUBA 2A72A 3KV4A 1QSDA 2Q9QB 3UU6A 5ABEA 5JDGA 3RYHE 3JAEA 3RLFF 4ZI2D 1YW0A 4JYAT 5EK3A 2UUBT 4LFCT 3B57A 2IC9A 1KNRA 4TV9E 2IUBA 3AA1B 3QNUA 2VQET 3VKGA 5AQUB 2OLTA 2NW9A 4UF0A 4PJMA 3VKHA 2X9YA 2BBHA 2LM9A 4A98A 2VKHA 4QXCB 2VWAA 4O8SA 4QH4A 4ZXLA 2DCFA 2FJAA 2ZM0A 3G06A 2A2FX 4HWDA 2EHOA 3HL6A 3T1YT 5LP6E 4CN4A 2LEHA 2BG9B 3N5LA 3OPCA 2YINA 5CA1E 2V7JA 1IJ6A 1KK7A 2X0LB 4JLEA 4UVBB 4ZZBA 2CXLA 1ZV4X 2PJQA 4IL9A 2YDQA 3DJBA 2RA1A 2RPAA 3P4WA 3PUWF 3CPZA 4EEBA 3C4XA 4LMKA 2BS4A 3KV9A 3DTOA 5AFUL 3AAAB 1DU2A 3K1SA 4K0UA 1ZEEA 4UV9B 4JV5T 2I6HA 3A8YC 3ZSTA 3LK2B 5ETWA 4ZI3C 2R6GF 2RP4A 4LF9T 2V5CA 5JRCA 2X51A 2WBLA 3C98B 4ISTA 3W15B 2VKDA 3E22E 2YU1A 2DLRA 2JQ9A 2DI4A 4HTEA 2CCQA 4EIWA 4Z8XA 3ANWA 1I94T 2MAWA 4ASKA 2XAFB 2VB6A 4TV8E 3VR8A 3LBXB 2BBJA 4F6RC 3RIUC 1Z0PA 2XPKA 4DR6T 3LFMA 5HXEA 1WCRA 4YSXA 2KLQA 5AQMB 4TUYE 1SUMB 3B13A 1D0YA 2W2UA 2V7KA 2Y8DA 3C4ZA 2FJDA 4UVAB 5FVLA 1X9BA 2XAJB 3NBXX 2MOZA 5LG3A 3ZC0A 5CFBA 4UIGA 2WSSV 1MMGA 3NVOA 4QXBB 5C3JA 4EV6A 3NKZA 4ISSA 3PUZF 4IDPA 1HF8A 1CUNA 1NWMX 1OEDC 2J4GA 2KXPB 2LT3A 5LGNB 4AQFC 1US7B 1YQ4A 4PFPA 2CRBA 5JTGA 4O2AE 2BVLA 1M7KA 4P09A 3N2OA 1UURA 3O1IA 2IMLA 3OKQA 4IHJE 2J47A 2OV9A 2XY8B 5JQGE 4YY3T 3P8CD 4G63A 3CQCB 3L39A 2QGSA 3B5MA 2JQKA 3I0OA 4IDOA 4N78D 5KDMC 4A56A 4CQIA 1J5ET 2XTLA 4ILAA 3E0ZA 3TLTA 1UX4A 2KWIB 1HCIA 2WCAA 3TLVA 5LOVE 2CEAA 1LKXA 1QUUA 3C51A 4CI1B 1OEDE 5LMUT 3RIUA 1HG5A 1T7SA 1I6ZA 1ZKEA 3NRYA 3FBLA 3FZHB 4CXWA 3ZYLA 3UFEA 4HFIA 4GYSA 4TWDA 3RIFA 3ZT6A 1BR0A 3UQ4A 5ABFA 3O1JA 4B3RT 3Q2MA 2Q9QC 2BVMA 3PUXF 2AXDS 4O4LE 3PUAA 2LSJA 3N9QA 3K8PC 4IL4A 1NAFA 1IBMT 1OEDA 3AE8A 4Z91A 5HEGA 3UULA 4DR4T 4AQFA 1UK5A 2MPKA 1HX8A 2MTQA 2JQHA 5DQWA 2J1DG 1HR0T 3J9X1 3ZT5A 1WLXA 5IYZE 5LXTE 4YTMA 2X66A 2HH7A 4EOZB 3BK9A 3ZMTB 3AECA 1XDOA 2H89A 3AE2A 2VK9A 3E08A 1YD8G 4CI2B 4HWCA 2BG9C 2YEVC 3PUVF 5CB4E 2X9HA 2HN1A 3FZKB 1IAPA 4DV6T 5JREA 5FXWA 1ZHCA 3N2GE 5LGUB 3AVSA 2LRLA 1H7CA 3N9NA 1MNDA 3RKGA 3OTOT 2FJBA 4DR1T 3CKDA 3FZLB 5FYMA 2V7LA 1BR2A 4JBWF 2I59A 3OBVE 3GN5A 2WWUA 3Q9DA 5L3DB 2JRKA 3ZN0B 3CQGB 4YT0A 2BG9E 4UEMA 4DMVA 2XQ4A 4AI6A 2LOSA 5AQIB 3X1DA 2Q9QA 3TLSA 4KMCA 3L09A 5AQNB 1FMVA 1MMDA 4YLHA 2KZ7B 1V9DA 3ZEFB 4QKNA 4ILCA 4L0RA 3UU4A 3KVAA 5HXRA 1XWMA 4H9OC 3UQ7A 3RX6A 2XAGB 3N2KE 3S4UA 5F8PA 5J0ZA 4BJMA 3R6NA 4L9IA 4U2YA 4H9RC 4ILUA 4JUYA 1X79A 4DVDA 3RYCE 3P4QA 4BJNA 2BG9A 1J1JA 4QH1A 1MNEA 2XAQB 3ZMUB 4H63V 2D0TA 1HX1B 2E8IA 2WB5A 2NP9A 2ZM6T 4CXXA 4PJJA 5LA6E 4YJ2E 5J2UE 5IWAT 3RQWA 1HG2A 4AQYT 3LSVA 4B3ST 2LKHA 2KMFA 3HKBE 2JPFA 3HKCE 4EEDA 2J62A 3KFWX 5FL0A 3MA9A 3CMLA 2G0UA 4B3MT 4OFZA 3AVRA 2WU5A 3L3PA 3AE5A 5JDQA 2DHRA 4DIDB 4BAYB 1IZNB 1E2AA 3PJAA 1HNZT 4LF6T 3AE6A 1OWAA 4CN1A 1LVFA 4TWFA 3WI3A 4DO0A 2YDSA 4NUUA 5A1LA 2DWKA 2VVSA 2WY2A 3FXDB 2N9DA 5AQKB 1LRZA 5L3FB 3AEBA 4LMJA 3EDUA 3KVBA 4WBOA 3UFGA 2E9XD 4OX9T 3MK7C 4GIWA 2L9QA 4H9QC 2W4XA 4EZHA 2WDVA 3CX6B 2V7IA 3LBXA 1T72A 4H9SE 3AE7A 3P7IA 3RGLA 5DJQC 1S94A 3OYZA 3UU8A 4I4TE 4ZI7E 4HWFA 1BR1A 2XQ5A 5EK4A 3VHLA 5J1GA 3PUQA 4QX7B 3FXEB 2YOEA 3ZJ1A 5HEUA 3VRAA 5H6QB 1W09A 2PFVA 2FJEA 3CQXC 2KWHA 4DBRA 2Y48B 5LJNA 2SPCA 4ZS2A 4ZI2C 5HYAA 4HFBA 5L3BB 4GK0E 1QLBA 1IBLT 5LCYA 5KXJA 3UTKA 3SOLA 2XQYA 4TNVA 3ZPOA 5CJ5A 1XMOT 4PK5A 3CIRA 2N2NA 4NUVA 4AKHA 3EVYA 4E7SA 2AE9A 4I43B 4O2BE 1Y01A 4PJNA 1Y64B 4EZ4A 2WDQA 4K0KT 3HI2A 4X1YE 4TNWA 3ZYKA 3ZMSB 4GK5E 4DUYT 4U7IA 3PUGA 4EAHA 4UXNB 1E1HB 4V1Av 1T98A 2IDOB 2CMRA 3A7MA 4UV8B 3BQIA 2YKSA 3ZKRA 3M3ZB 3I0QA 3KV6A 3QOFA 4KX6A 2NW8A 3CX7B 3U3IA 4GOUA 4JI5T 4ERRA 4IE5A 2ACXA 5LGTB 4X1KE 2B1EA 1KNPA 3T8OA 2NTXA 2Z6EA 1WRDA 2CLYB 4PNIA 4TX5A 1HNXT 3NWIA 1OXZA 3PU3A 4O4IE 4OK0A 5F5WA 3T1HT 2L3LA 3ZJ2A 4X65T 4DV3T 2WS3A 3I9YA 5LG4A 4DV5T 4P0BA 4CI3B 4TZ4C 2LRKA 3K3NA 2UXDT 4ZZCA 5EZYE 4X20E 3ETUA 2KNDA 4TN7B 4LF8T 1Z8UA 4MBQA 5LB7B 4FJOA 3WAJA 4IIJE 2A9UA 5FXVA 3K3OA 4PK4A 3OJAA 4IGUA 4KHPT 5LJMA 3C50A 3ONLC 2PG8A 1CHUA 5HEOA 2ODUA 2X67A 3Q5DA 2VQFT 5ADXL 1D1CA 3N9LA 3QB5K 2MYSA 4JI6T 4CZZB 5AQRB 2V26A 3AAIA 1N32T 3EUHA 5HCMA 1SA0E 4AQGA 1MMAA 5HXHA 3AA0B 3PJAJ 4HWIB 1VOMA 5ABGA 4AKRB 3EI0A 4AKLA 2LSIA 1AJ3A 2W62A 1HNWT 4FI5A 5FNVE 2XQ8A 2JQQA 1SE7A 3C64A 3UUNA 3SFDA 1M62A 3LJCA 3MACA 3IHRA 5C2TA 2LLYA 3UU3A 4YSYA 4JI2T 3EDVA 4JEHB 4I0UA 4ZS3A 5AQHB 2X0YA 4DV2T 5IHYA 3ZMVB 3UUMA 4JI3T 2W0GA 3AXJB 4HN9A 5L2LA 2IHR1 1L0VA 3PV0F 4OYKA 2LM2A 2V6YB 1FMWA 2E9XB 5LYJE 3ZLIA 2W66A 2XZEA 5FY1A 3UU5A 2B76A 5L3GB 4PK6A 2K5BB 5DQVA 4M1PA 2W00A 5LBMA 1ZP0A 3PUSA 3BQLA 3CK6A 2NR4A 2W67A 4JI7T 4YHHT 3AE9A 5ABHA 2X68A 4ZOLE 5LNKA 4EXTA 2XUEA 2XM2A 3QB5A 3H3MA 3QK6A 5KX5E 4B6XA 3DP7A 2V6XA 2UU9T 2K24A 5AQOB 3MZKB 2UXBT 4QXHB 3IA3A 2XSBA 3SWHA 4H9NC 4JI8T 5FXZA 4AKGA 5H6RB 3GA8A 4XAXB 4NIQA 4C90A 4HFCA 4P0AA 3AEFA 1MIVA 3JC6D 5FL1A 3ZMZB 1D0ZA 4NXNT 3LK3B 3F2EA 2CBIA 5CA0E 4ILBA 4MALA 4GKJT 5HEJA 2YK0A 3VRBA 3MKDA 4QWNB 5TAOA 3O9XA 4MLKA 1N36T 2BZBA 2LOPA 5FMNA 4JEUB 1WR6A 3TLUA 3AE1A 2WP9A 4JI4T 1VCTA 3WAKA 1MIWA 4LF7T 2CE7A 4LF4T 5AQSB 5JDFA 3V5UA 3A5XA 5BMVE 1LVKA 3GWHA 2ZMAA 3HKEE 2CLYC 2EHOD 3EHZA 1XDPA 2VVNA 2CHOA 5JR9B 4UVCB 4U31A 4QHOA 2DNXA 1VCSA 3IBPA 4U74A 2HN2A 2GK9A 3HR0A 2E5LT 2X9WA 2MBGA 5JDHA 4U72A 4DV1T 3RH3A 4KI0F 1U5PA 4HE8A 2XASB 2WQYA 1KF6A 2QA7A 3EABA 3P4SA 1YKHB 4ANJA 4X1IE 4HGAA 4IE7A 2K9AA 3FHNA 1WFDA 5JDNA 1ZOYA 2JMKA 2E2AA 1SHZC 4WBNE 4TWHA 4GKKT 1XZYA 3UUXB 2IAKA 5HXSA 5J2TE 3RRCA 2WWVA 2V1DB 3FB2A 4IE6A 4U2ZA 3V5SA 3IEEA 3ZN1B 4LFAT 5AQQB 3TLWA 3H3AA 4QX8B 1BR4A 2IC6A 2XHEB 2ES0A 3AA7B 2VL8A 1W9RA 2VASA 2H7OA 4NPPA 4WNKA 4YXDA 4DBQA 2M6BA 4A97A 4PAGA 3LG7A 4H9PC 4O4JE 3RQUA 2C5JA 4IE4A 3PU8A 4IDNA 1WYCA 1NEKA 5DABA 4MHCA 3HKDE 4EYUA 3IF8B 1UX5A 4WYVA 2QYWA 2XAHB 5AQFB 1WR0A 4KBMB 3O4XE 2V5DA 1HTJF 2WMOA 3N9OA 3KBTA 3NRXA 4DV4T 4EB6E 5JH7E 3QC9A 2E9XC 2H7VC 3P50A 5FY0A 1EZ3A 4CN6A 1G73A 4WW0A 2LHNA 3O1HA 5F3JA 2X9XA 4IREA 3LK42 2HHHT 2HPLA 1D1AA 2H88A 3F31A 5BR8T 5JDLA 3CX8B 4YSZA 4HFHA 5AQGB 4ZI3D 4MFRA 4L5GA 4QH5A 5AQTB 2LE8A 3P4PA 4DR7T 2LJLA 3NZPA 2D9DA 2OA5A 3PUYF 1FJGT 4HFVA 3P4RA 2NTYA 2PBIA 2DL1A 2JIWA 4X64T 3C4WA 2UXNB 3SFEA 4DV0T 3RRWA 4DUZT 3J7Yq 4PFOA 3MJXA 3ZC1A 5L47A 5LMNT 1JNRA 4CXYA 4F8HA 4U33A 2M6IA 3AEGA 2X0HA 2WM9A 2IW5B 4HKAA 4DR3T 4Q25A 2ZM8A 2CA5A 3CWZB 2CPTA 3AXJA 1KNZA 2ZLYA 2XQ9A 4H63H 3ONJA 3SRZA 2V6YA 3OYXA 4X66T 2E9XA 4WZXA 2WZIA 1KEYA 2LSYA 3MXZA 2LSGA 5LHGB 4DV7T 2CHNA 2ODVA 3AAEB 1YKEB 4UF0B 4KUMB 1WYBA 3ESLA 2EHOB 3AA6B 1JNZA 4AKIA 4HEAA 5LHHB 2CBJA 4PW8A 4JI0T 2YN6A 3FBZA 5HWXA 3KINB 4UR9A 2NW7A 1O3XA 3PURA 2VL0A 5JR9C 2ZM2A 2E5VA 2CWOA 2WZHA 4GYRA 3UT5E 4A5XA 4X62T 3AEDA 2CWYA 3KBUA 4JI1T 1GQEA 3AE3A 3I9WA 5M4YA 2HPJA 4IE0A 3PTRB 2WMNA 4LMLA 3D0TA 3RHWA 2UUCT 5JRCB 3PE0A 2BS2A 2XSAA 1NENA 3ETVA 3RYIE 1W0BA 3RIAA 1FIOA 2LSKA 4OYJA 2W63A 2BKNA 3F57A 2ACZA 4EYYR 3RC8A 3SS1A 4DMWA 3ANWB 3RF1A 2CM0A 2CXDA 1XNRT 2BDEA 4ZEYA 3R84B 2Q9QD 1MIYA 1UUSA 5KMGP 5E0OA 5AQPB 5CGMA 3AEAA 4LFBT 4E7ZA 5HAXA 4DR2T 2C5KT 3GMIA 5L4HA 4I50E 2M67A 5EK2A 5AQVB 2P9BA 1W0AA 4OHFA 3I1AA 3ZCJA 4IT4A 3Q5WA 2WAUA 2BKOA 3KDSE 1E7PA 2FUPA 4UELA 1VRBA 2LKGA 3OVUA 4KHZF 2XQ7A 3AE4A 4U3CA 2D2SA 2IIUA 5JR9A 5JVDE 3KV5A 4IDZA 4XZCA 4ZHQE 4U7YA 4AXPA 5L3CB 5IUXA 2F4VT 4HFEA 4O4HE 3RC3A 2XQ3A 4IDQA 3U78A 3FZMB 5L4EA 2UXXB 1B7TA 2UUAT 4P1NA 1KFYA 4G2AA 2L8KA 2XJ7A 2JMHA 4PJLA 4AISA 2C5IT 3L8RA 3M65A 3N9PA 2BKPA 1IBKT 1YXRA 5GONE 4YTNA 2NWBA 4AIUA 3NZQA 1FEWA 4COFA 2A3DA 2V8SV 2BS3A 5AQJB 2K48A 1D0XA 5C8YE 1UGOA 3HA4A 2KINB 3JCFA 1D1BA 3H37A 4KP3C 4HWHA 2KSRA 3JC6C 3JAFA 5HXCA 4XBFB 3RKOA 2LHRA 3AB3B 1N33T 4EGWA 4LF5T 3EAMA 3AEEA 1XMQT 5FXXA 4DR5T 1HS7A 2Y6XA 4J2CA 4YJ3E 5HCJA 1YQ3A 5ABFB 5FY7A 2YDRA 2XQAA 5LHIB 2WDRA 1G8XA 4ADZA 2DWGA 4BA9A 1T8BA 2D5UA 3QUJA 1OEDB 2C0SA 3K3QC 2QVAA 1IJ5A 5FVKA 2XQ6A 3TKLB 5HEHA 2CXFA 2WU2A 3Q5XA 5AQLB 5FP3A 2W61A 5HWYA 4YFSA 4I55E 1UCUA 2KT9A 3RPUA 1R8IA 5JDMA 1J5WA 2N1GA 2QRXA 3BQKA 2FBWA 2K3WA 4Z90A 2VKOA 3RI5A 2EHOC 2XM1A 2YU2A
chains in the Genus database with same CATH topology
3FZLB 5AQJB 4HWCA 5AQQB 5AQOB 3FZFB 5AQVB 1HX1B 5AQHB 3FZHB 5AQMB 3A8YC 3FZMB 4HWDA 5AQKB 1UGOA 3FZKB 1M7KA 5AQSB 2D9DA 4HWFA 5AQPB 1M62A 5AQGB 4HWHA 4HWIB 5AQFB 5AQIB 5AQRB 3LDQB 1T7SA 5AQNB 5AQLB 5AQUB 1I6ZA 1UK5A 3M3ZB 5AQTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FZL B;  5AQJ B;  4HWC A;  5AQQ B;  5AQO B;  3FZF B;  5AQV B;  1HX1 B;  5AQH B;  3FZH B;  5AQM B;  3A8Y C;  3FZM B;  4HWD A;  5AQK B;  1UGO A;  3FZK B;  1M7K A;  5AQS B;  2D9D A;  4HWF A;  5AQP B;  1M62 A;  5AQG B;  4HWH A;  4HWI B;  5AQF B;  5AQI B;  5AQR B;  3LDQ B;  1T7S A;  5AQN B;  5AQL B;  5AQU B;  1I6Z A;  1UK5 A;  3M3Z B;  5AQT B; 
#chains in the Genus database with same CATH topology
 4NXM T;  2H3R A;  3Q5E A;  2NOX A;  1S35 A;  1HFA A;  1U4Q A;  4YTP A;  2V7M A;  3VU7 H;  1XNQ T;  4X5T A;  5FKY A;  3CVR A;  3LDQ B;  2VUR A;  2PTF A;  2UXC T;  4C91 A;  3PDY A;  3VR9 A;  2JJ9 A;  4B3T T;  3N9M A;  3ZYM A;  5LBQ B;  5L3E B;  4YHJ A;  3RYF E;  2VKJ A;  3ABV A;  3JAD A;  3ZCI A;  3ZSS A;  3ONX A;  1MMN A;  3ZT7 A;  3GN5 B;  4HFD A;  2D0U A;  1N34 T;  3FZF B;  2I0M A;  4DND A;  3UUB A;  2A72 A;  3KV4 A;  1QSD A;  2Q9Q B;  3UU6 A;  5ABE A;  5JDG A;  3RYH E;  3JAE A;  3RLF F;  4ZI2 D;  1YW0 A;  4JYA T;  5EK3 A;  2UUB T;  4LFC T;  3B57 A;  2IC9 A;  1KNR A;  4TV9 E;  2IUB A;  3AA1 B;  3QNU A;  2VQE T;  3VKG A;  5AQU B;  2OLT A;  2NW9 A;  4UF0 A;  4PJM A;  3VKH A;  2X9Y A;  2BBH A;  2LM9 A;  4A98 A;  2VKH A;  4QXC B;  2VWA A;  4O8S A;  4QH4 A;  4ZXL A;  2DCF A;  2FJA A;  2ZM0 A;  3G06 A;  2A2F X;  4HWD A;  2EHO A;  3HL6 A;  3T1Y T;  5LP6 E;  4CN4 A;  2LEH A;  2BG9 B;  3N5L A;  3OPC A;  2YIN A;  5CA1 E;  2V7J A;  1IJ6 A;  1KK7 A;  2X0L B;  4JLE A;  4UVB B;  4ZZB A;  2CXL A;  1ZV4 X;  2PJQ A;  4IL9 A;  2YDQ A;  3DJB A;  2RA1 A;  2RPA A;  3P4W A;  3PUW F;  3CPZ A;  4EEB A;  3C4X A;  4LMK A;  2BS4 A;  3KV9 A;  3DTO A;  5AFU L;  3AAA B;  1DU2 A;  3K1S A;  4K0U A;  1ZEE A;  4UV9 B;  4JV5 T;  2I6H A;  3A8Y C;  3ZST A;  3LK2 B;  5ETW A;  4ZI3 C;  2R6G F;  2RP4 A;  4LF9 T;  2V5C A;  5JRC A;  2X51 A;  2WBL A;  3C98 B;  4IST A;  3W15 B;  2VKD A;  3E22 E;  2YU1 A;  2DLR A;  2JQ9 A;  2DI4 A;  4HTE A;  2CCQ A;  4EIW A;  4Z8X A;  3ANW A;  1I94 T;  2MAW A;  4ASK A;  2XAF B;  2VB6 A;  4TV8 E;  3VR8 A;  3LBX B;  2BBJ A;  4F6R C;  3RIU C;  1Z0P A;  2XPK A;  4DR6 T;  3LFM A;  5HXE A;  1WCR A;  4YSX A;  2KLQ A;  5AQM B;  4TUY E;  1SUM B;  3B13 A;  1D0Y A;  2W2U A;  2V7K A;  2Y8D A;  3C4Z A;  2FJD A;  4UVA B;  5FVL A;  1X9B A;  2XAJ B;  3NBX X;  2MOZ A;  5LG3 A;  3ZC0 A;  5CFB A;  4UIG A;  2WSS V;  1MMG A;  3NVO A;  4QXB B;  5C3J A;  4EV6 A;  3NKZ A;  4ISS A;  3PUZ F;  4IDP A;  1HF8 A;  1CUN A;  1NWM X;  1OED C;  2J4G A;  2KXP B;  2LT3 A;  5LGN B;  4AQF C;  1US7 B;  1YQ4 A;  4PFP A;  2CRB A;  5JTG A;  4O2A E;  2BVL A;  1M7K A;  4P09 A;  3N2O A;  1UUR A;  3O1I A;  2IML A;  3OKQ A;  4IHJ E;  2J47 A;  2OV9 A;  2XY8 B;  5JQG E;  4YY3 T;  3P8C D;  4G63 A;  3CQC B;  3L39 A;  2QGS A;  3B5M A;  2JQK A;  3I0O A;  4IDO A;  4N78 D;  5KDM C;  4A56 A;  4CQI A;  1J5E T;  2XTL A;  4ILA A;  3E0Z A;  3TLT A;  1UX4 A;  2KWI B;  1HCI A;  2WCA A;  3TLV A;  5LOV E;  2CEA A;  1LKX A;  1QUU A;  3C51 A;  4CI1 B;  1OED E;  5LMU T;  3RIU A;  1HG5 A;  1T7S A;  1I6Z A;  1ZKE A;  3NRY A;  3FBL A;  3FZH B;  4CXW A;  3ZYL A;  3UFE A;  4HFI A;  4GYS A;  4TWD A;  3RIF A;  3ZT6 A;  1BR0 A;  3UQ4 A;  5ABF A;  3O1J A;  4B3R T;  3Q2M A;  2Q9Q C;  2BVM A;  3PUX F;  2AXD S;  4O4L E;  3PUA A;  2LSJ A;  3N9Q A;  3K8P C;  4IL4 A;  1NAF A;  1IBM T;  1OED A;  3AE8 A;  4Z91 A;  5HEG A;  3UUL A;  4DR4 T;  4AQF A;  1UK5 A;  2MPK A;  1HX8 A;  2MTQ A;  2JQH A;  5DQW A;  2J1D G;  1HR0 T;  3J9X 1;  3ZT5 A;  1WLX A;  5IYZ E;  5LXT E;  4YTM A;  2X66 A;  2HH7 A;  4EOZ B;  3BK9 A;  3ZMT B;  3AEC A;  1XDO A;  2H89 A;  3AE2 A;  2VK9 A;  3E08 A;  1YD8 G;  4CI2 B;  4HWC A;  2BG9 C;  2YEV C;  3PUV F;  5CB4 E;  2X9H A;  2HN1 A;  3FZK B;  1IAP A;  4DV6 T;  5JRE A;  5FXW A;  1ZHC A;  3N2G E;  5LGU B;  3AVS A;  2LRL A;  1H7C A;  3N9N A;  1MND A;  3RKG A;  3OTO T;  2FJB A;  4DR1 T;  3CKD A;  3FZL B;  5FYM A;  2V7L A;  1BR2 A;  4JBW F;  2I59 A;  3OBV E;  3GN5 A;  2WWU A;  3Q9D A;  5L3D B;  2JRK A;  3ZN0 B;  3CQG B;  4YT0 A;  2BG9 E;  4UEM A;  4DMV A;  2XQ4 A;  4AI6 A;  2LOS A;  5AQI B;  3X1D A;  2Q9Q A;  3TLS A;  4KMC A;  3L09 A;  5AQN B;  1FMV A;  1MMD A;  4YLH A;  2KZ7 B;  1V9D A;  3ZEF B;  4QKN A;  4ILC A;  4L0R A;  3UU4 A;  3KVA A;  5HXR A;  1XWM A;  4H9O C;  3UQ7 A;  3RX6 A;  2XAG B;  3N2K E;  3S4U A;  5F8P A;  5J0Z A;  4BJM A;  3R6N A;  4L9I A;  4U2Y A;  4H9R C;  4ILU A;  4JUY A;  1X79 A;  4DVD A;  3RYC E;  3P4Q A;  4BJN A;  2BG9 A;  1J1J A;  4QH1 A;  1MNE A;  2XAQ B;  3ZMU B;  4H63 V;  2D0T A;  1HX1 B;  2E8I A;  2WB5 A;  2NP9 A;  2ZM6 T;  4CXX A;  4PJJ A;  5LA6 E;  4YJ2 E;  5J2U E;  5IWA T;  3RQW A;  1HG2 A;  4AQY T;  3LSV A;  4B3S T;  2LKH A;  2KMF A;  3HKB E;  2JPF A;  3HKC E;  4EED A;  2J62 A;  3KFW X;  5FL0 A;  3MA9 A;  3CML A;  2G0U A;  4B3M T;  4OFZ A;  3AVR A;  2WU5 A;  3L3P A;  3AE5 A;  5JDQ A;  2DHR A;  4DID B;  4BAY B;  1IZN B;  1E2A A;  3PJA A;  1HNZ T;  4LF6 T;  3AE6 A;  1OWA A;  4CN1 A;  1LVF A;  4TWF A;  3WI3 A;  4DO0 A;  2YDS A;  4NUU A;  5A1L A;  2DWK A;  2VVS A;  2WY2 A;  3FXD B;  2N9D A;  5AQK B;  1LRZ A;  5L3F B;  3AEB A;  4LMJ A;  3EDU A;  3KVB A;  4WBO A;  3UFG A;  2E9X D;  4OX9 T;  3MK7 C;  4GIW A;  2L9Q A;  4H9Q C;  2W4X A;  4EZH A;  2WDV A;  3CX6 B;  2V7I A;  3LBX A;  1T72 A;  4H9S E;  3AE7 A;  3P7I A;  3RGL A;  5DJQ C;  1S94 A;  3OYZ A;  3UU8 A;  4I4T E;  4ZI7 E;  4HWF A;  1BR1 A;  2XQ5 A;  5EK4 A;  3VHL A;  5J1G A;  3PUQ A;  4QX7 B;  3FXE B;  2YOE A;  3ZJ1 A;  5HEU A;  3VRA A;  5H6Q B;  1W09 A;  2PFV A;  2FJE A;  3CQX C;  2KWH A;  4DBR A;  2Y48 B;  5LJN A;  2SPC A;  4ZS2 A;  4ZI2 C;  5HYA A;  4HFB A;  5L3B B;  4GK0 E;  1QLB A;  1IBL T;  5LCY A;  5KXJ A;  3UTK A;  3SOL A;  2XQY A;  4TNV A;  3ZPO A;  5CJ5 A;  1XMO T;  4PK5 A;  3CIR A;  2N2N A;  4NUV A;  4AKH A;  3EVY A;  4E7S A;  2AE9 A;  4I43 B;  4O2B E;  1Y01 A;  4PJN A;  1Y64 B;  4EZ4 A;  2WDQ A;  4K0K T;  3HI2 A;  4X1Y E;  4TNW A;  3ZYK A;  3ZMS B;  4GK5 E;  4DUY T;  4U7I A;  3PUG A;  4EAH A;  4UXN B;  1E1H B;  4V1A v;  1T98 A;  2IDO B;  2CMR A;  3A7M A;  4UV8 B;  3BQI A;  2YKS A;  3ZKR A;  3M3Z B;  3I0Q A;  3KV6 A;  3QOF A;  4KX6 A;  2NW8 A;  3CX7 B;  3U3I A;  4GOU A;  4JI5 T;  4ERR A;  4IE5 A;  2ACX A;  5LGT B;  4X1K E;  2B1E A;  1KNP A;  3T8O A;  2NTX A;  2Z6E A;  1WRD A;  2CLY B;  4PNI A;  4TX5 A;  1HNX T;  3NWI A;  1OXZ A;  3PU3 A;  4O4I E;  4OK0 A;  5F5W A;  3T1H T;  2L3L A;  3ZJ2 A;  4X65 T;  4DV3 T;  2WS3 A;  3I9Y A;  5LG4 A;  4DV5 T;  4P0B A;  4CI3 B;  4TZ4 C;  2LRK A;  3K3N A;  2UXD T;  4ZZC A;  5EZY E;  4X20 E;  3ETU A;  2KND A;  4TN7 B;  4LF8 T;  1Z8U A;  4MBQ A;  5LB7 B;  4FJO A;  3WAJ A;  4IIJ E;  2A9U A;  5FXV A;  3K3O A;  4PK4 A;  3OJA A;  4IGU A;  4KHP T;  5LJM A;  3C50 A;  3ONL C;  2PG8 A;  1CHU A;  5HEO A;  2ODU A;  2X67 A;  3Q5D A;  2VQF T;  5ADX L;  1D1C A;  3N9L A;  3QB5 K;  2MYS A;  4JI6 T;  4CZZ B;  5AQR B;  2V26 A;  3AAI A;  1N32 T;  3EUH A;  5HCM A;  1SA0 E;  4AQG A;  1MMA A;  5HXH A;  3AA0 B;  3PJA J;  4HWI B;  1VOM A;  5ABG A;  4AKR B;  3EI0 A;  4AKL A;  2LSI A;  1AJ3 A;  2W62 A;  1HNW T;  4FI5 A;  5FNV E;  2XQ8 A;  2JQQ A;  1SE7 A;  3C64 A;  3UUN A;  3SFD A;  1M62 A;  3LJC A;  3MAC A;  3IHR A;  5C2T A;  2LLY A;  3UU3 A;  4YSY A;  4JI2 T;  3EDV A;  4JEH B;  4I0U A;  4ZS3 A;  5AQH B;  2X0Y A;  4DV2 T;  5IHY A;  3ZMV B;  3UUM A;  4JI3 T;  2W0G A;  3AXJ B;  4HN9 A;  5L2L A;  2IHR 1;  1L0V A;  3PV0 F;  4OYK A;  2LM2 A;  2V6Y B;  1FMW A;  2E9X B;  5LYJ E;  3ZLI A;  2W66 A;  2XZE A;  5FY1 A;  3UU5 A;  2B76 A;  5L3G B;  4PK6 A;  2K5B B;  5DQV A;  4M1P A;  2W00 A;  5LBM A;  1ZP0 A;  3PUS A;  3BQL A;  3CK6 A;  2NR4 A;  2W67 A;  4JI7 T;  4YHH T;  3AE9 A;  5ABH A;  2X68 A;  4ZOL E;  5LNK A;  4EXT A;  2XUE A;  2XM2 A;  3QB5 A;  3H3M A;  3QK6 A;  5KX5 E;  4B6X A;  3DP7 A;  2V6X A;  2UU9 T;  2K24 A;  5AQO B;  3MZK B;  2UXB T;  4QXH B;  3IA3 A;  2XSB A;  3SWH A;  4H9N C;  4JI8 T;  5FXZ A;  4AKG A;  5H6R B;  3GA8 A;  4XAX B;  4NIQ A;  4C90 A;  4HFC A;  4P0A A;  3AEF A;  1MIV A;  3JC6 D;  5FL1 A;  3ZMZ B;  1D0Z A;  4NXN T;  3LK3 B;  3F2E A;  2CBI A;  5CA0 E;  4ILB A;  4MAL A;  4GKJ T;  5HEJ A;  2YK0 A;  3VRB A;  3MKD A;  4QWN B;  5TAO A;  3O9X A;  4MLK A;  1N36 T;  2BZB A;  2LOP A;  5FMN A;  4JEU B;  1WR6 A;  3TLU A;  3AE1 A;  2WP9 A;  4JI4 T;  1VCT A;  3WAK A;  1MIW A;  4LF7 T;  2CE7 A;  4LF4 T;  5AQS B;  5JDF A;  3V5U A;  3A5X A;  5BMV E;  1LVK A;  3GWH A;  2ZMA A;  3HKE E;  2CLY C;  2EHO D;  3EHZ A;  1XDP A;  2VVN A;  2CHO A;  5JR9 B;  4UVC B;  4U31 A;  4QHO A;  2DNX A;  1VCS A;  3IBP A;  4U74 A;  2HN2 A;  2GK9 A;  3HR0 A;  2E5L T;  2X9W A;  2MBG A;  5JDH A;  4U72 A;  4DV1 T;  3RH3 A;  4KI0 F;  1U5P A;  4HE8 A;  2XAS B;  2WQY A;  1KF6 A;  2QA7 A;  3EAB A;  3P4S A;  1YKH B;  4ANJ A;  4X1I E;  4HGA A;  4IE7 A;  2K9A A;  3FHN A;  1WFD A;  5JDN A;  1ZOY A;  2JMK A;  2E2A A;  1SHZ C;  4WBN E;  4TWH A;  4GKK T;  1XZY A;  3UUX B;  2IAK A;  5HXS A;  5J2T E;  3RRC A;  2WWV A;  2V1D B;  3FB2 A;  4IE6 A;  4U2Z A;  3V5S A;  3IEE A;  3ZN1 B;  4LFA T;  5AQQ B;  3TLW A;  3H3A A;  4QX8 B;  1BR4 A;  2IC6 A;  2XHE B;  2ES0 A;  3AA7 B;  2VL8 A;  1W9R A;  2VAS A;  2H7O A;  4NPP A;  4WNK A;  4YXD A;  4DBQ A;  2M6B A;  4A97 A;  4PAG A;  3LG7 A;  4H9P C;  4O4J E;  3RQU A;  2C5J A;  4IE4 A;  3PU8 A;  4IDN A;  1WYC A;  1NEK A;  5DAB A;  4MHC A;  3HKD E;  4EYU A;  3IF8 B;  1UX5 A;  4WYV A;  2QYW A;  2XAH B;  5AQF B;  1WR0 A;  4KBM B;  3O4X E;  2V5D A;  1HTJ F;  2WMO A;  3N9O A;  3KBT A;  3NRX A;  4DV4 T;  4EB6 E;  5JH7 E;  3QC9 A;  2E9X C;  2H7V C;  3P50 A;  5FY0 A;  1EZ3 A;  4CN6 A;  1G73 A;  4WW0 A;  2LHN A;  3O1H A;  5F3J A;  2X9X A;  4IRE A;  3LK4 2;  2HHH T;  2HPL A;  1D1A A;  2H88 A;  3F31 A;  5BR8 T;  5JDL A;  3CX8 B;  4YSZ A;  4HFH A;  5AQG B;  4ZI3 D;  4MFR A;  4L5G A;  4QH5 A;  5AQT B;  2LE8 A;  3P4P A;  4DR7 T;  2LJL A;  3NZP A;  2D9D A;  2OA5 A;  3PUY F;  1FJG T;  4HFV A;  3P4R A;  2NTY A;  2PBI A;  2DL1 A;  2JIW A;  4X64 T;  3C4W A;  2UXN B;  3SFE A;  4DV0 T;  3RRW A;  4DUZ T;  3J7Y q;  4PFO A;  3MJX A;  3ZC1 A;  5L47 A;  5LMN T;  1JNR A;  4CXY A;  4F8H A;  4U33 A;  2M6I A;  3AEG A;  2X0H A;  2WM9 A;  2IW5 B;  4HKA A;  4DR3 T;  4Q25 A;  2ZM8 A;  2CA5 A;  3CWZ B;  2CPT A;  3AXJ A;  1KNZ A;  2ZLY A;  2XQ9 A;  4H63 H;  3ONJ A;  3SRZ A;  2V6Y A;  3OYX A;  4X66 T;  2E9X A;  4WZX A;  2WZI A;  1KEY A;  2LSY A;  3MXZ A;  2LSG A;  5LHG B;  4DV7 T;  2CHN A;  2ODV A;  3AAE B;  1YKE B;  4UF0 B;  4KUM B;  1WYB A;  3ESL A;  2EHO B;  3AA6 B;  1JNZ A;  4AKI A;  4HEA A;  5LHH B;  2CBJ A;  4PW8 A;  4JI0 T;  2YN6 A;  3FBZ A;  5HWX A;  3KIN B;  4UR9 A;  2NW7 A;  1O3X A;  3PUR A;  2VL0 A;  5JR9 C;  2ZM2 A;  2E5V A;  2CWO A;  2WZH A;  4GYR A;  3UT5 E;  4A5X A;  4X62 T;  3AED A;  2CWY A;  3KBU A;  4JI1 T;  1GQE A;  3AE3 A;  3I9W A;  5M4Y A;  2HPJ A;  4IE0 A;  3PTR B;  2WMN A;  4LML A;  3D0T A;  3RHW A;  2UUC T;  5JRC B;  3PE0 A;  2BS2 A;  2XSA A;  1NEN A;  3ETV A;  3RYI E;  1W0B A;  3RIA A;  1FIO A;  2LSK A;  4OYJ A;  2W63 A;  2BKN A;  3F57 A;  2ACZ A;  4EYY R;  3RC8 A;  3SS1 A;  4DMW A;  3ANW B;  3RF1 A;  2CM0 A;  2CXD A;  1XNR T;  2BDE A;  4ZEY A;  3R84 B;  2Q9Q D;  1MIY A;  1UUS A;  5KMG P;  5E0O A;  5AQP B;  5CGM A;  3AEA A;  4LFB T;  4E7Z A;  5HAX A;  4DR2 T;  2C5K T;  3GMI A;  5L4H A;  4I50 E;  2M67 A;  5EK2 A;  5AQV B;  2P9B A;  1W0A A;  4OHF A;  3I1A A;  3ZCJ A;  4IT4 A;  3Q5W A;  2WAU A;  2BKO A;  3KDS E;  1E7P A;  2FUP A;  4UEL A;  1VRB A;  2LKG A;  3OVU A;  4KHZ F;  2XQ7 A;  3AE4 A;  4U3C A;  2D2S A;  2IIU A;  5JR9 A;  5JVD E;  3KV5 A;  4IDZ A;  4XZC A;  4ZHQ E;  4U7Y A;  4AXP A;  5L3C B;  5IUX A;  2F4V T;  4HFE A;  4O4H E;  3RC3 A;  2XQ3 A;  4IDQ A;  3U78 A;  3FZM B;  5L4E A;  2UXX B;  1B7T A;  2UUA T;  4P1N A;  1KFY A;  4G2A A;  2L8K A;  2XJ7 A;  2JMH A;  4PJL A;  4AIS A;  2C5I T;  3L8R A;  3M65 A;  3N9P A;  2BKP A;  1IBK T;  1YXR A;  5GON E;  4YTN A;  2NWB A;  4AIU A;  3NZQ A;  1FEW A;  4COF A;  2A3D A;  2V8S V;  2BS3 A;  5AQJ B;  2K48 A;  1D0X A;  5C8Y E;  1UGO A;  3HA4 A;  2KIN B;  3JCF A;  1D1B A;  3H37 A;  4KP3 C;  4HWH A;  2KSR A;  3JC6 C;  3JAF A;  5HXC A;  4XBF B;  3RKO A;  2LHR A;  3AB3 B;  1N33 T;  4EGW A;  4LF5 T;  3EAM A;  3AEE A;  1XMQ T;  5FXX A;  4DR5 T;  1HS7 A;  2Y6X A;  4J2C A;  4YJ3 E;  5HCJ A;  1YQ3 A;  5ABF B;  5FY7 A;  2YDR A;  2XQA A;  5LHI B;  2WDR A;  1G8X A;  4ADZ A;  2DWG A;  4BA9 A;  1T8B A;  2D5U A;  3QUJ A;  1OED B;  2C0S A;  3K3Q C;  2QVA A;  1IJ5 A;  5FVK A;  2XQ6 A;  3TKL B;  5HEH A;  2CXF A;  2WU2 A;  3Q5X A;  5AQL B;  5FP3 A;  2W61 A;  5HWY A;  4YFS A;  4I55 E;  1UCU A;  2KT9 A;  3RPU A;  1R8I A;  5JDM A;  1J5W A;  2N1G A;  2QRX A;  3BQK A;  2FBW A;  2K3W A;  4Z90 A;  2VKO A;  3RI5 A;  2EHO C;  2XM1 A;  2YU2 A; 
#chains in the Genus database with same CATH homology
 3FZL B;  5AQJ B;  4HWC A;  5AQQ B;  5AQO B;  3FZF B;  5AQV B;  1HX1 B;  5AQH B;  3FZH B;  5AQM B;  3A8Y C;  3FZM B;  4HWD A;  5AQK B;  1UGO A;  3FZK B;  1M7K A;  5AQS B;  2D9D A;  4HWF A;  5AQP B;  1M62 A;  5AQG B;  4HWH A;  4HWI B;  5AQF B;  5AQI B;  5AQR B;  3LDQ B;  1T7S A;  5AQN B;  5AQL B;  5AQU B;  1I6Z A;  1UK5 A;  3M3Z B;  5AQT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...