2QA7A

Crystal structure of huntingtin-interacting protein 1 (hip1) coiled-coil domain with a basic surface suitable for hip-protein interactor (hippi)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
99
structure length
99
Chain Sequence
DEKDHLIERLYREISGLKAQLENMKTESQRVVLQLKGHVSELEADLAEQQHLRQQAADDCEFLRAELDELRRQREDTEKAQRSLSEIERKAQANEQRYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure at 2.8 A of Huntingtin-interacting protein 1 (HIP1) coiled-coil domain reveals a charged surface suitable for HIP1 protein interactor (HIPPI)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Actin binding
molecule keywords Huntingtin-interacting protein 1
total genus 41
structure length 99
sequence length 99
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-06-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1920 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2qa7A00
2QA7A
chains in the Genus database with same CATH superfamily
3ZT6A 2H89A 2HPJA 1E1HB 2IUBA 5FY0A 3KFWX 3PUWF 3PUGA 5FXVA 3Q5EA 4U7IA 1B7TA 2BG9A 2X68A 3A8YC 3RX6A 1VRBA 4HWHA 3U3IA 4AQFC 5LMNT 3SS1A 2J4GA 1OEDA 3OPCA 4TNVA 2CA5A 3ONXA 3PUYF 2XAQB 3IF8B 2M6BA 1IZNB 2X0HA 3CMLA 4PNIA 2IW5B 3H3MA 2W66A 2DHRA 5LA6E 4I55E 4CQIA 4F6RC 1CUNA 1UX4A 4Z91A 4HWDA 5H6QB 4A56A 5FP3A 2N9DA 4YSYA 2FJEA 3AE1A 1D0YA 1HG2A 2XY8B 3BQKA 1MMGA 5IHYA 3RKGA 4ERRA 5L47A 3FBZA 1LKXA 1OEDE 2XQAA 4OHFA 5JH7E 2M67A 5LHGB 4YHHT 4ILBA 4ZHQE 2CEAA 2G0UA 3JAFA 3T1HT 3AEFA 3RH3A 2ZM2A 5LMUT 5KX5E 3VR8A 5JDLA 2CBJA 2XQ5A 5AQLB 3BK9A 5JVDE 5CFBA 4LFBT 4B3TT 1SHZC 5FKYA 1NAFA 5LHIB 4P0AA 1X9BA 4NUUA 3LBXA 4JEHB 4ZZCA 5C8YE 2LT3A 3ZJ2A 2P9BA 3ZSTA 4IIJE 3PU8A 2XQ6A 1ZP0A 1J1JA 2WMNA 3UT5E 2BG9E 2V6XA 2XZEA 3I0QA 1UX5A 1LVFA 2JRKA 3HKBE 2OV9A 3AEGA 3MXZA 3P4RA 5JDFA 3AA7B 5LGUB 2CE7A 2PJQA 2VK9A 4HFHA 4L5GA 5FY7A 3AEEA 4ZS2A 2BKOA 3AVSA 4H63H 3RIUC 4YY3T 3AE6A 3H37A 5M4YA 4LF5T 2KZ7B 3O4XE 3AE4A 3GWHA 1BR1A 1IAPA 4H63V 1R8IA 3NBXX 4X20E 3RQUA 2XQ9A 1S35A 2JIWA 2XM2A 4PK6A 4YTPA 2X9HA 2VQFT 3KINB 3NRYA 2E2AA 3AE5A 2XTLA 2JPFA 2MPKA 4I4TE 3ETUA 4U74A 4UELA 3UU3A 2D5UA 3B5MA 2LRLA 3EDUA 4H9OC 3V5SA 3I0OA 1D0XA 4PW8A 4IL9A 4GYRA 5HCJA 5L2LA 4LF7T 4H9NC 4TZ4C 1G73A 1N32T 4HFBA 2B76A 3TLTA 4P0BA 3KBUA 4HEAA 1HCIA 4IDNA 2LSJA 4DV1T 3T8OA 1JNRA 4KMCA 3RPUA 2CRBA 5FVLA 2V7KA 4O4HE 2Y48B 3R84B 3SRZA 3WI3A 2XUEA 3N2KE 4DV0T 2W61A 4DV2T 1HS7A 4PK5A 2MOZA 2X67A 2Y6XA 2X0LB 3V5UA 2MTQA 1XNRT 3ZC0A 4IGUA 1T98A 2LM9A 4WNKA 4ADZA 5JR9B 4LF4T 1GQEA 3E22E 4KBMB 4YSZA 4DR3T 2IC6A 4EZ4A 4KHPT 2J1DG 1O3XA 4EOZB 2ZM6T 4DR1T 2EHOA 4HFCA 1MIYA 2XQ7A 1SE7A 4QWNB 4EAHA 1FMWA 3S4UA 3AA6B 2X9XA 4C90A 2IHR1 4TWHA 3O9XA 3P4SA 3QB5A 3F57A 4JLEA 2EHOD 2K5BB 3CK6A 3ESLA 3I9YA 5J2UE 2LSKA 3WAJA 4JV5T 3GN5A 2K24A 4UVCB 5HEOA 4CXXA 2A2FX 2HN1A 4YXDA 1CHUA 1U4QA 2YU2A 3FB2A 3KV5A 4DV4T 4DV6T 4DV7T 3H3AA 4ILUA 2CXLA 2CM0A 2Q9QA 3AEBA 4HGAA 5FMNA 5LOVE 5KXJA 2HPLA 2YOEA 1W0BA 2VASA 4MLKA 4BJNA 4PJJA 3LJCA 1OEDB 3JAEA 4TV8E 3RYHE 2JQQA 3DJBA 4KP3C 2CXDA 1M7KA 3VHLA 4GYSA 4XZCA 3ZEFB 1Z8UA 3VKGA 2DLRA 3VR9A 2EHOC 2LLYA 1U5PA 3ZMUB 4JYAT 3ZT7A 4N78D 2ODVA 1UUSA 3CIRA 2V8SV 3DTOA 5H6RB 5JDMA 5L3FB 2VURA 3AAEB 4HWCA 4PFOA 5JDGA 4ISSA 4X65T 4I43B 5LGNB 1HNWT 4IT4A 4QXBB 5ABGA 3O1IA 3Q2MA 3X1DA 4B3MT 3PU3A 2Y8DA 3KVBA 4UEMA 1H7CA 2C5IT 2V1DB 2V7MA 3HR0A 3RRCA 3CX6B 3FBLA 5HEUA 1XNQT 2ZM0A 5E0OA 1YQ4A 1IJ6A 5ETWA 3VRAA 4GIWA 2BS4A 1KFYA 4UF0A 2IC9A 2JJ9A 3RYCE 3HKCE 2CLYB 5LG4A 4LF9T 3L3PA 2RA1A 2RP4A 3PURA 4NUVA 5ADXL 2WDVA 2ACXA 4HFVA 4ZXLA 3RQWA 3UU6A 1KF6A 4LFAT 2EHOB 2YDSA 3IEEA 3AA0B 4IE0A 4JI5T 2KMFA 2YINA 3UUBA 4B3ST 3A5XA 4H9QC 1OEDC 1UK5A 3EUHA 4IE6A 4PK4A 4UXNB 3J7Yq 3P8CD 2PTFA 4BJMA 2QA7A 3LDQB 4LF8T 2FJBA 2BKNA 3C50A 4LMLA 4OYJA 3ZCIA 1HR0T 3LFMA 3O1JA 3AXJA 2AXDS 2C5JA 4B6XA 2N2NA 1N33T 2WMOA 5HXCA 1W0AA 5IYZE 2I59A 3ZCJA 1L0VA 4GK5E 4IDQA 4A97A 1E2AA 4JEUB 3UUNA 4AXPA 4CXWA 2DWKA 2HN2A 5AQJB 5CA1E 2CLYC 3EDVA 4UIGA 1QSDA 3JCFA 3QK6A 3LK2B 4CZZB 3LG7A 4HE8A 3IBPA 5AQUB 1HG5A 2VKJA 2WWVA 3LSVA 2IAKA 3UQ4A 4PFPA 4U33A 5JDHA 3NWIA 4G63A 4ZS3A 4EYUA 3PJAJ 4JI4T 3TLWA 3Q9DA 4U2YA 4EB6E 2LSIA 3SFDA 3PJAA 3AE3A 3FZKB 2E9XD 1WRDA 4H9PC 5FY1A 3TLVA 3VRBA 2CPTA 5EK2A 2KWHA 2LM2A 2H7OA 3UU5A 2KINB 4X5TA 1FMVA 2B1EA 4AKHA 1WR6A 2J47A 4ISTA 4E7SA 3UU4A 5CJ5A 4EGWA 5ABFB 5L3EB 4IDPA 2X0YA 1Z0PA 3AVRA 4X1YE 3EHZA 3PTRB 3EI0A 2LKHA 4DBQA 1MMDA 2X51A 4M1PA 3ZYMA 4IE4A 4DR4T 4QH5A 2UXBT 2I0MA 1HTJF 3KV4A 2L9QA 3ZYKA 3BQIA 4YJ3E 4P1NA 5KDMC 3PUZF 1XMOT 2YEVC 1YKHB 2WDRA 2VL0A 2X66A 5FXWA 2L3LA 2XAFB 3P4PA 3RI5A 3L09A 4NXNT 2PBIA 1E7PA 2V7IA 5HYAA 3PUSA 1G8XA 2ZMAA 5AQIB 3O1HA 2XAGB 1NWMX 4P09A 2LSGA 1UCUA 5JREA 1D0ZA 1HFAA 4MALA 4AI6A 1HNXT 2XQ8A 2UXXB 4I0UA 3RC3A 5L4EA 4UVAB 4IL4A 4UF0B 4H9SE 4OYKA 1N36T 2E9XA 4DV3T 5L3GB 2WSSV 2IIUA 2WCAA 2IMLA 2XQ3A 1LRZA 2XQ4A 2ZM8A 2CMRA 3AE2A 4QH1A 4ZI7E 3CVRA 2Z6EA 5DQVA 5LXTE 1D1BA 4OK0A 1YKEB 4ILCA 3NVOA 1J5ET 1WFDA 4TN7B 4L9IA 2NW9A 2VQET 2WY2A 2W67A 2WWUA 1FJGT 1YQ3A 1T8BA 1Y64B 2V5DA 2LHRA 2LEHA 3JADA 4PJLA 3DP7A 2KWIB 4O8SA 4ILAA 4YJ2E 4IDZA 2H88A 2LRKA 4O4JE 5AQKB 4EEDA 3ZPOA 4DR2T 3QC9A 2E9XB 2WM9A 3LBXB 4ZI3D 5HCMA 3E08A 5HXEA 4JI1T 5AQRB 2XASB 4TWFA 3OYXA 4A5XA 2UUBT 2CHOA 2NTXA 5AQSB 3T1YT 4AISA 4IE7A 1D1AA 4EYYR 2A3DA 2LHNA 2YU1A 3AA1B 1ZKEA 2J62A 3KV9A 3N9PA 4CN1A 5ABEA 4LFCT 2WS3A 2WBLA 2W4XA 3TKLB 4Z8XA 2RPAA 1MNDA 2BKPA 3JC6C 4MBQA 3OKQA 4QX8B 5DJQC 5LG3A 1MMNA 1D1CA 4CI1B 2LOPA 2YDRA 5AFUL 2YK0A 3HKDE 5DABA 4QX7B 4EIWA 4JI6T 3RIAA 1IBLT 3ZN1B 2OLTA 3HL6A 4G2AA 3NRXA 1YXRA 5FL1A 5HEJA 1M62A 3PUQA 2NWBA 2W62A 3PDYA 4X1KE 3ZJ1A 3AXJB 4AKLA 2QYWA 2BBHA 4XAXB 5JDQA 5JR9A 1S94A 4CN6A 5LBQB 2R6GF 3CQXC 4X66T 5ABHA 5FVKA 4DMVA 5FL0A 3HA4A 2ZLYA 3M65A 5EK3A 3ETVA 4ZEYA 2XAHB 2X9YA 2LSYA 4ZZBA 3FZMB 4U7YA 1ZV4X 2NP9A 2Q9QC 2XHEB 3HKEE 4OFZA 2C0SA 3P7IA 3TLUA 4TUYE 3U78A 3NKZA 4QHOA 3N9LA 2SPCA 3N9QA 3NZPA 2BVLA 4GKJT 5AQTB 4WBNE 1MIVA 2WU5A 3L39A 3Q5DA 2WP9A 2MBGA 3UFEA 4O2AE 5AQHB 3N2OA 2VKOA 3MZKB 1NEKA 2XSBA 3SOLA 3PV0F 4MHCA 2LJLA 2WZIA 5LNKA 1I94T 5L4HA 1XWMA 2BDEA 1QUUA 2XQYA 3B13A 2DL1A 4HWIB 1WR0A 3PUVF 4KUMB 1NENA 1SA0E 5FXZA 3F31A 2KXPB 4HTEA 2D0TA 5HWYA 4TNWA 4LMJA 4GOUA 3ZMVB 4TV9E 4HFDA 5IWAT 4C91A 2VWAA 4U72A 3RYFE 2JMHA 3N9OA 3RYIE 5C3JA 3QB5K 4DVDA 1MMAA 2BVMA 2X9WA 3NZQA 2DNXA 3RF1A 1WYBA 4ZI3C 2KNDA 3ZMTB 1DU2A 4FJOA 4EEBA 4QXCB 3P4WA 3AE7A 4WW0A 4DR7T 5KMGP 3C64A 4HFEA 3KDSE 4YFSA 5ABFA 3CX7B 2MYSA 4O2BE 4JUYA 3IHRA 3ZKRA 2UXDT 2BG9C 2V7JA 2WDQA 3K3OA 3GN5B 4DMWA 4TX5A 2BS2A 4F8HA 1VCTA 3N9MA 1UURA 4DIDB 3A7MA 2K3WA 5LYJE 1W9RA 2V6YA 3E0ZA 1Y01A 4NIQA 3FXEB 2W0GA 3R6NA 4K0UA 3RGLA 4YTNA 3GA8A 3AEDA 3ZC1A 4IDOA 2KSRA 4HKAA 2K9AA 3OVUA 2CBIA 4YT0A 4WZXA 3LK3B 1FIOA 2QGSA 4KI0F 2VKDA 2BG9B 3OYZA 4Q25A 5JQGE 1WYCA 3D0TA 4J2CA 1HF8A 4UR9A 3RIUA 4CN4A 4JI7T 5JDNA 2DCFA 2HH7A 3B57A 1IJ5A 4QKNA 2PFVA 3FZHB 5HAXA 2LOSA 3W15B 1IBKT 1XDPA 3UQ7A 2LKGA 3LK42 1QLBA 5BMVE 2XAJB 5L3CB 1VCSA 5J1GA 4DO0A 3K8PC 4U3CA 4AQFA 3IA3A 3N9NA 5EZYE 3VU7H 2NR4A 2MAWA 5EK4A 3UU8A 3I9WA 4PJMA 5AQFB 3QNUA 2FJAA 3ZSSA 4EXTA 1J5WA 2A9UA 5A1LA 2FBWA 4LF6T 5AQMB 3J9X1 3EVYA 3PUAA 1SUMB 4DUYT 2XSAA 4ZOLE 5CA0E 3FZLB 4JBWF 2VB6A 2FUPA 3EAMA 3RC8A 1UGOA 5LHHB 3M3ZB 2OA5A 1AJ3A 3RRWA 4Z90A 2W00A 2K48A 2NOXA 2JMKA 4HN9A 5JTGA 4O4LE 1BR2A 2ODUA 3AE9A 4IE5A 5LB7B 3RLFF 2PG8A 3UUXB 5CGMA 3K3NA 4DV5T 2AE9A 5JRCA 3QUJA 1I6ZA 1BR0A 4XBFB 2D2SA 3ZMSB 4NXMT 2VVSA 3KBTA 3MACA 4V1Av 5J0ZA 3ZN0B 3CPZA 5L3BB 4NPPA 3N2GE 3UFGA 1N34T 2JQHA 1W09A 5F3JA 3PE0A 5AQQB 4AIUA 4EZHA 1MNEA 2W2UA 3N5LA 4TWDA 1FEWA 1V9DA 1VOMA 1BR4A 3KV6A 4ZI2C 4UV9B 1WCRA 4IHJE 4DBRA 4DUZT 4JI3T 2NW7A 2QVAA 2CHNA 2L8KA 3ANWA 4L0RA 1IBMT 2XJ7A 3HI2A 3OJAA 4GK0E 2WB5A 3P4QA 2IDOB 3AAIA 4YHJA 5AQPB 4DNDA 4QH4A 5LJNA 3AAAB 1OXZA 2KT9A 5LP6E 4FI5A 2VKHA 4I50E 1EZ3A 4A98A 2VL8A 2NTYA 2ACZA 5JR9C 2E5VA 1XZYA 1ZEEA 2E8IA 2V5CA 3ZT5A 4HWFA 2WQYA 2A72A 2D9DA 2BS3A 2E9XC 3FZFB 5AQGB 5LBMA 3MK7C 3WAKA 4QXHB 5JRCB 3C4WA 3FXDB 5AQNB 3RIFA 2CWYA 3FHNA 2YDQA 3JC6D 3ZLIA 2QRXA 1MIWA 3KVAA 5DQWA 4JI8T 1ZOYA 4DR6T 3SWHA 3Q5WA 2NW8A 1WLXA 4UV8B 2YKSA 2N1GA 3UTKA 3BQLA 2ES0A 3ABVA 5HXHA 5FYMA 3OBVE 3CQGB 3CKDA 4CXYA 4O4IE 2JQ9A 2WAUA 2YN6A 4X1IE 3ZYLA 4DR5T 4KX6A 3RHWA 4UVBB 5LCYA 5TAOA 4AQYT 4X62T 4YSXA 1ZHCA 1KK7A 4GKKT 3L8RA 2HHHT 3K1SA 5LGTB 4JI0T 2V6YB 5AQOB 4AKIA 4WYVA 4HFIA 4IREA 1KNRA 3OTOT 2UXCT 4CI2B 5CB4E 2UU9T 2W63A 3C51A 5LJMA 5F5WA 2Q9QD 4CI3B 5FXXA 2H7VC 2DWGA 3Q5XA 3AE8A 4U31A 4EV6A 3GMIA 4BA9A 3CQCB 3MKDA 3CWZB 1HX8A 2CWOA 2H3RA 3C98B 3VKHA 4E7ZA 1KNZA 2D0UA 3G06A 5C2TA 5BR8T 3AECA 2WZHA 1KNPA 2BBJA 4KHZF 4H9RC 2CXFA 5L3DB 3AB3B 4PJNA 2LE8A 4ZI2D 4AKGA 2UUCT 4BAYB 3C4XA 1T7SA 3F2EA 3ONLC 4YTMA 1X79A 5FNVE 5HXSA 2F4VT 2JQKA 4LMKA 2WU2A 4X64T 2Q9QB 1HX1B 2C5KT 3P50A 3RKOA 3ONJA 3UUMA 3K3QC 2UUAT 2VVNA 1JNZA 4MFRA 1YD8G 4WBOA 3UULA 2V7LA 5GONE 2CCQA 1XDOA 5HEGA 2KLQA 5AQVB 2M6IA 5HEHA 3TLSA 4COFA 5HWXA 3EABA 2V26A 1XMQT 2DI4A 5J2TE 4B3RT 2E5LT 1OWAA 2GK9A 3SFEA 4AKRB 5IUXA 1KEYA 4AQGA 4PAGA 3MJXA 3PUXF 4K0KT 3QOFA 3ANWB 3AEAA 2FJDA 2UXNB 2XPKA 2I6HA 2BZBA 2XM1A 3C4ZA 3I1AA 3MA9A 4U2ZA 5HXRA 1LVKA 3ZMZB 4JI2T 1YW0A 3CX8B 1T72A 1US7B 5F8PA 4ANJA 4ASKA 4YLHA 1HNZT 4OX9T
chains in the Genus database with same CATH topology
2HPJA 1E1HB 5FY0A 3KFWX 3PUGA 5FXVA 3U3IA 1B7TA 2X68A 3RX6A 1VRBA 3SS1A 2CA5A 3ONXA 2IW5B 2XAQB 3IF8B 3CMLA 1IZNB 4PNIA 2DHRA 5LA6E 4I55E 4CQIA 4F6RC 1CUNA 1UX4A 5H6QB 4A56A 5FP3A 2N9DA 5IHYA 1D0YA 1HG2A 4ERRA 3BQKA 1MMGA 4CXYA 3FBZA 1LKXA 4OHFA 5JH7E 2M67A 5LHGB 4ZHQE 2CEAA 2G0UA 3RH3A 2ZM2A 5KX5E 5JDLA 3BK9A 5JVDE 1SHZC 1NAFA 5LHIB 4P0AA 4NUUA 3LBXA 4JEHB 5C8YE 2LT3A 3ZJ2A 2P9BA 4IIJE 3PU8A 2WMNA 3UT5E 4PJLA 3I0QA 1UX5A 1LVFA 2JRKA 3HKBE 3MXZA 5JDFA 3AA7B 5LGUB 2CE7A 2PJQA 2VK9A 4L5GA 5FY7A 4ZS2A 3AVSA 4H63H 3H37A 5M4YA 2KZ7B 3O4XE 3GWHA 1BR1A 1IAPA 4H63V 3NBXX 4X20E 1S35A 4PK6A 2X9HA 3KINB 3NRYA 4UELA 2XTLA 2JPFA 4I4TE 3ETUA 4U74A 4AQFC 2D5UA 4H9OC 3EDUA 3V5SA 3I0OA 1D0XA 4PW8A 4GYRA 5L2LA 4H9NC 4TZ4C 1G73A 4P0BA 3KBUA 4HEAA 1HCIA 2LSJA 3T8OA 4KMCA 3RPUA 2V7KA 4O4HE 2Y48B 3R84B 3SRZA 3WI3A 2XUEA 3N2KE 2W61A 1HS7A 4PK5A 2MOZA 2X67A 2Y6XA 2X0LB 3V5UA 2MTQA 3ZC0A 4IGUA 1T98A 2LM9A 4WNKA 4ADZA 5JR9B 3E22E 4KBMB 2IC6A 4EZ4A 2J1DG 1O3XA 4EOZB 2EHOA 4QWNB 1MIYA 4EAHA 1FMWA 3S4UA 3AA6B 2X9XA 4C90A 3O9XA 4JLEA 3F57A 2EHOD 2K5BB 3I9YA 3ESLA 5J2UE 3WAJA 2LSKA 3GN5A 2K24A 4UVCB 4CXXA 2A2FX 1U4QA 2YU2A 3FB2A 3KV5A 3H3AA 4ILUA 2CXLA 2CM0A 2Q9QA 4HGAA 5FMNA 5LOVE 2HPLA 4BJNA 2VASA 4MLKA 4PJJA 3LJCA 4TV8E 3RYHE 2JQQA 3DJBA 4KP3C 2CXDA 3VHLA 4GYSA 4XZCA 3ZEFB 3VKGA 2DLRA 2EHOC 1U5PA 3ZMUB 4N78D 2ODVA 3DTOA 5H6RB 5JDMA 5L3FB 5LNKA 3AAEB 5JDGA 4PFOA 4ISSA 4I43B 5LGNB 4QXBB 3O1IA 3Q2MA 3PU3A 2Y8DA 3KVBA 4UEMA 1H7CA 2C5IT 2V1DB 2V7MA 3HR0A 3RRCA 3CX6B 3FBLA 2ZM0A 5E0OA 1IJ6A 5ETWA 4GIWA 4UF0A 5LG4A 2IC9A 2JJ9A 3RYCE 3HKCE 2CLYB 3L3PA 2RA1A 2RP4A 3PURA 4NUVA 5ADXL 2ACXA 4HFVA 2EHOB 3IEEA 3AA0B 4IE0A 2KMFA 2YINA 3A5XA 4H9QC 3EUHA 4IE6A 4PK4A 4UXNB 3J7Yq 3P8CD 4BJMA 2QA7A 3C50A 3ZCIA 4OYJA 3LFMA 3O1JA 4B6XA 2C5JA 2N2NA 2WMOA 5HXCA 5IYZE 2I59A 3ZCJA 4GK5E 4JEUB 3UUNA 4AXPA 4CXWA 2DWKA 5CA1E 2CLYC 3EDVA 4UIGA 1QSDA 3QK6A 3LK2B 4CZZB 3LG7A 4HE8A 3IBPA 1HG5A 2VKJA 2IAKA 4PFPA 5JDHA 4EYUA 4G63A 4ZS3A 3Q9DA 4EB6E 2LSIA 2E9XD 1WRDA 4H9PC 5FY1A 5EK2A 2KWHA 2H7OA 2KINB 1FMVA 2B1EA 4AKHA 1WR6A 4ISTA 4E7SA 5L3EB 4DBQA 3AVRA 1Z0PA 4X1YE 3PTRB 1MMDA 2X51A 4M1PA 3ZYMA 4IE4A 1HTJF 3KV4A 2L9QA 3ZYKA 3BQIA 4YJ3E 5KDMC 2YEVC 1YKHB 2X66A 5FXWA 2L3LA 2XAFB 3L09A 2PBIA 2V7IA 5HYAA 3PUSA 1G8XA 2ZMAA 3O1HA 2XAGB 1NWMX 4P09A 2LSGA 1UCUA 5JREA 1D0ZA 1HFAA 4MALA 4AI6A 2UXXB 3RC3A 4UVAB 4UF0B 4H9SE 4OYKA 2E9XA 5L3GB 2WSSV 2ZM8A 3RC8A 1LRZA 4ZI7E 2CMRA 3CVRA 2Z6EA 5DQVA 5LXTE 1D1BA 4OK0A 1YKEB 4TN7B 2NW9A 4L9IA 2WWUA 1Y64B 2LHRA 2LEHA 3DP7A 2KWIB 4O8SA 4YJ2E 4IDZA 4O4JE 3ZPOA 3QC9A 2E9XB 2WM9A 3LBXB 4ZI3D 3E08A 5HXEA 2XASB 3OYXA 2NTXA 4IE7A 1D1AA 4EYYR 2A3DA 2LHNA 2YU1A 3AA1B 1ZKEA 3KV9A 3N9PA 2WBLA 3TKLB 4Z8XA 4MBQA 1MNDA 3JC6C 3OKQA 4QX8B 5DJQC 1MMNA 1D1CA 4CI1B 2LOPA 5AFUL 2YK0A 3HKDE 5DABA 4QX7B 4EIWA 3ZN1B 3HL6A 4G2AA 3NRXA 3PUQA 2NWBA 2W62A 3PDYA 4X1KE 3ZJ1A 4AKLA 4XAXB 5JDQA 5JR9A 1S94A 5LBQB 3CQXC 4DMVA 3HA4A 2ZLYA 3M65A 5EK3A 3ETVA 2XAHB 2X9YA 2LSYA 1ZV4X 2NP9A 2Q9QC 2XHEB 3HKEE 4OFZA 2C0SA 3P7IA 3U78A 4TUYE 4QHOA 3N9LA 2SPCA 3N9QA 3NZPA 2BVLA 4WBNE 1MIVA 2MBGA 3UFEA 4O2AE 3N2OA 2VKOA 3MZKB 3SOLA 4MHCA 2LJLA 2BDEA 1QUUA 2XQYA 3B13A 4KUMB 1SA0E 5FXZA 3F31A 2KXPB 4HTEA 2D0TA 5HWYA 4GOUA 3ZMVB 4TV9E 4C91A 2VWAA 4U72A 3RYFE 2JMHA 3N9OA 3RYIE 4DVDA 1MMAA 2BVMA 2X9WA 3NZQA 2DNXA 1WYBA 4ZI3C 2KNDA 3ZMTB 4FJOA 4QXCB 4WW0A 5KMGP 3C64A 3KDSE 4YFSA 3CX7B 2MYSA 4O2BE 4JUYA 3IHRA 2V7JA 4DMWA 3K3OA 3GN5B 4TX5A 3N9MA 5LYJE 3E0ZA 3FXEB 2W0GA 3R6NA 4K0UA 3GA8A 3ZC1A 4HKAA 2K9AA 3LK3B 1FIOA 2QGSA 2VKDA 3OYZA 5JQGE 1WYCA 3D0TA 4J2CA 1HF8A 5JDNA 2DCFA 3B57A 2HH7A 1IJ5A 4QKNA 2PFVA 5HAXA 3W15B 2LOSA 3LK42 5BMVE 2XAJB 5L3CB 5J1GA 4DO0A 3K8PC 4AQFA 3N9NA 5EZYE 3VU7H 5EK4A 3I9WA 4PJMA 4EXTA 5A1LA 3J9X1 3EVYA 3PUAA 4ZOLE 5CA0E 2VB6A 5LHHB 2OA5A 1AJ3A 3RRWA 2W00A 2K48A 2NOXA 2JMKA 4HN9A 4O4LE 1BR2A 2ODUA 4IE5A 3UUXB 2PG8A 5JRCA 3K3NA 3QUJA 1BR0A 4XBFB 2D2SA 3ZMSB 3KBTA 3MACA 4V1Av 3ZN0B 3CPZA 5L3BB 3N2GE 5F3JA 3PE0A 4EZHA 1MNEA 3N5LA 1FEWA 1V9DA 1VOMA 1BR4A 3KV6A 4ZI2C 4UV9B 4IHJE 4DBRA 2NW7A 3ANWA 2L8KA 4L0RA 3HI2A 3OJAA 4GK0E 4DNDA 3AAIA 4YHJA 5LJNA 3AAAB 1OXZA 2KT9A 5LP6E 4FI5A 2VKHA 4I50E 1EZ3A 2VL8A 2NTYA 5JR9C 1ZEEA 2E8IA 2A72A 5LBMA 2E9XC 3MK7C 3WAKA 4QXHB 5JRCB 3C4WA 3FXDB 2CWYA 3FHNA 3JC6D 3ZLIA 3KVAA 1MIWA 5DQWA 3SWHA 3Q5WA 2NW8A 1WLXA 4UV8B 3UTKA 2N1GA 3BQLA 2ES0A 5HXHA 5FYMA 3OBVE 3CQGB 3CKDA 4O4IE 2WAUA 4X1IE 3ZYLA 4UVBB 5LCYA 5TAOA 1ZHCA 1KK7A 5LGTB 4AKIA 4CI2B 5CB4E 2W63A 3C51A 5LJMA 2Q9QD 4CI3B 5FXXA 2H7VC 2DWGA 3Q5XA 3GMIA 4BA9A 3CQCB 3MKDA 3CWZB 1HX8A 2CWOA 2H3RA 3C98B 3VKHA 4E7ZA 1KNZA 2D0UA 4H9RC 2CXFA 5L3DB 3AB3B 4PJNA 2LE8A 4ZI2D 4AKGA 4BAYB 3C4XA 3F2EA 5FNVE 5HXSA 1X79A 2Q9QB 2C5KT 3RKOA 3UUMA 3K3QC 4MFRA 4WBOA 1YD8G 3UULA 2V7LA 5GONE 2CCQA 5HWXA 2KLQA 2V26A 2DI4A 5J2TE 1OWAA 2GK9A 4AKRB 4AQGA 4PAGA 3MJXA 3ANWB 2UXNB 2BZBA 3C4ZA 3I1AA 3MA9A 5HXRA 3ZMZB 1LVKA 1YW0A 3CX8B 1US7B 5F8PA 4ANJA 4ASKA 4YLHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QA7 A; 
#chains in the Genus database with same CATH topology
 3ZT6 A;  2H89 A;  2HPJ A;  1E1H B;  2IUB A;  5FY0 A;  3KFW X;  3PUW F;  3PUG A;  5FXV A;  3Q5E A;  4U7I A;  1B7T A;  2BG9 A;  2X68 A;  3A8Y C;  3RX6 A;  1VRB A;  4HWH A;  3U3I A;  4AQF C;  5LMN T;  3SS1 A;  2J4G A;  1OED A;  3OPC A;  4TNV A;  2CA5 A;  3ONX A;  3PUY F;  2XAQ B;  3IF8 B;  2M6B A;  1IZN B;  2X0H A;  3CML A;  4PNI A;  2IW5 B;  3H3M A;  2W66 A;  2DHR A;  5LA6 E;  4I55 E;  4CQI A;  4F6R C;  1CUN A;  1UX4 A;  4Z91 A;  4HWD A;  5H6Q B;  4A56 A;  5FP3 A;  2N9D A;  4YSY A;  2FJE A;  3AE1 A;  1D0Y A;  1HG2 A;  2XY8 B;  3BQK A;  1MMG A;  5IHY A;  3RKG A;  4ERR A;  5L47 A;  3FBZ A;  1LKX A;  1OED E;  2XQA A;  4OHF A;  5JH7 E;  2M67 A;  5LHG B;  4YHH T;  4ILB A;  4ZHQ E;  2CEA A;  2G0U A;  3JAF A;  3T1H T;  3AEF A;  3RH3 A;  2ZM2 A;  5LMU T;  5KX5 E;  3VR8 A;  5JDL A;  2CBJ A;  2XQ5 A;  5AQL B;  3BK9 A;  5JVD E;  5CFB A;  4LFB T;  4B3T T;  1SHZ C;  5FKY A;  1NAF A;  5LHI B;  4P0A A;  1X9B A;  4NUU A;  3LBX A;  4JEH B;  4ZZC A;  5C8Y E;  2LT3 A;  3ZJ2 A;  2P9B A;  3ZST A;  4IIJ E;  3PU8 A;  2XQ6 A;  1ZP0 A;  1J1J A;  2WMN A;  3UT5 E;  2BG9 E;  2V6X A;  2XZE A;  3I0Q A;  1UX5 A;  1LVF A;  2JRK A;  3HKB E;  2OV9 A;  3AEG A;  3MXZ A;  3P4R A;  5JDF A;  3AA7 B;  5LGU B;  2CE7 A;  2PJQ A;  2VK9 A;  4HFH A;  4L5G A;  5FY7 A;  3AEE A;  4ZS2 A;  2BKO A;  3AVS A;  4H63 H;  3RIU C;  4YY3 T;  3AE6 A;  3H37 A;  5M4Y A;  4LF5 T;  2KZ7 B;  3O4X E;  3AE4 A;  3GWH A;  1BR1 A;  1IAP A;  4H63 V;  1R8I A;  3NBX X;  4X20 E;  3RQU A;  2XQ9 A;  1S35 A;  2JIW A;  2XM2 A;  4PK6 A;  4YTP A;  2X9H A;  2VQF T;  3KIN B;  3NRY A;  2E2A A;  3AE5 A;  2XTL A;  2JPF A;  2MPK A;  4I4T E;  3ETU A;  4U74 A;  4UEL A;  3UU3 A;  2D5U A;  3B5M A;  2LRL A;  3EDU A;  4H9O C;  3V5S A;  3I0O A;  1D0X A;  4PW8 A;  4IL9 A;  4GYR A;  5HCJ A;  5L2L A;  4LF7 T;  4H9N C;  4TZ4 C;  1G73 A;  1N32 T;  4HFB A;  2B76 A;  3TLT A;  4P0B A;  3KBU A;  4HEA A;  1HCI A;  4IDN A;  2LSJ A;  4DV1 T;  3T8O A;  1JNR A;  4KMC A;  3RPU A;  2CRB A;  5FVL A;  2V7K A;  4O4H E;  2Y48 B;  3R84 B;  3SRZ A;  3WI3 A;  2XUE A;  3N2K E;  4DV0 T;  2W61 A;  4DV2 T;  1HS7 A;  4PK5 A;  2MOZ A;  2X67 A;  2Y6X A;  2X0L B;  3V5U A;  2MTQ A;  1XNR T;  3ZC0 A;  4IGU A;  1T98 A;  2LM9 A;  4WNK A;  4ADZ A;  5JR9 B;  4LF4 T;  1GQE A;  3E22 E;  4KBM B;  4YSZ A;  4DR3 T;  2IC6 A;  4EZ4 A;  4KHP T;  2J1D G;  1O3X A;  4EOZ B;  2ZM6 T;  4DR1 T;  2EHO A;  4HFC A;  1MIY A;  2XQ7 A;  1SE7 A;  4QWN B;  4EAH A;  1FMW A;  3S4U A;  3AA6 B;  2X9X A;  4C90 A;  2IHR 1;  4TWH A;  3O9X A;  3P4S A;  3QB5 A;  3F57 A;  4JLE A;  2EHO D;  2K5B B;  3CK6 A;  3ESL A;  3I9Y A;  5J2U E;  2LSK A;  3WAJ A;  4JV5 T;  3GN5 A;  2K24 A;  4UVC B;  5HEO A;  4CXX A;  2A2F X;  2HN1 A;  4YXD A;  1CHU A;  1U4Q A;  2YU2 A;  3FB2 A;  3KV5 A;  4DV4 T;  4DV6 T;  4DV7 T;  3H3A A;  4ILU A;  2CXL A;  2CM0 A;  2Q9Q A;  3AEB A;  4HGA A;  5FMN A;  5LOV E;  5KXJ A;  2HPL A;  2YOE A;  1W0B A;  2VAS A;  4MLK A;  4BJN A;  4PJJ A;  3LJC A;  1OED B;  3JAE A;  4TV8 E;  3RYH E;  2JQQ A;  3DJB A;  4KP3 C;  2CXD A;  1M7K A;  3VHL A;  4GYS A;  4XZC A;  3ZEF B;  1Z8U A;  3VKG A;  2DLR A;  3VR9 A;  2EHO C;  2LLY A;  1U5P A;  3ZMU B;  4JYA T;  3ZT7 A;  4N78 D;  2ODV A;  1UUS A;  3CIR A;  2V8S V;  3DTO A;  5H6R B;  5JDM A;  5L3F B;  2VUR A;  3AAE B;  4HWC A;  4PFO A;  5JDG A;  4ISS A;  4X65 T;  4I43 B;  5LGN B;  1HNW T;  4IT4 A;  4QXB B;  5ABG A;  3O1I A;  3Q2M A;  3X1D A;  4B3M T;  3PU3 A;  2Y8D A;  3KVB A;  4UEM A;  1H7C A;  2C5I T;  2V1D B;  2V7M A;  3HR0 A;  3RRC A;  3CX6 B;  3FBL A;  5HEU A;  1XNQ T;  2ZM0 A;  5E0O A;  1YQ4 A;  1IJ6 A;  5ETW A;  3VRA A;  4GIW A;  2BS4 A;  1KFY A;  4UF0 A;  2IC9 A;  2JJ9 A;  3RYC E;  3HKC E;  2CLY B;  5LG4 A;  4LF9 T;  3L3P A;  2RA1 A;  2RP4 A;  3PUR A;  4NUV A;  5ADX L;  2WDV A;  2ACX A;  4HFV A;  4ZXL A;  3RQW A;  3UU6 A;  1KF6 A;  4LFA T;  2EHO B;  2YDS A;  3IEE A;  3AA0 B;  4IE0 A;  4JI5 T;  2KMF A;  2YIN A;  3UUB A;  4B3S T;  3A5X A;  4H9Q C;  1OED C;  1UK5 A;  3EUH A;  4IE6 A;  4PK4 A;  4UXN B;  3J7Y q;  3P8C D;  2PTF A;  4BJM A;  2QA7 A;  3LDQ B;  4LF8 T;  2FJB A;  2BKN A;  3C50 A;  4LML A;  4OYJ A;  3ZCI A;  1HR0 T;  3LFM A;  3O1J A;  3AXJ A;  2AXD S;  2C5J A;  4B6X A;  2N2N A;  1N33 T;  2WMO A;  5HXC A;  1W0A A;  5IYZ E;  2I59 A;  3ZCJ A;  1L0V A;  4GK5 E;  4IDQ A;  4A97 A;  1E2A A;  4JEU B;  3UUN A;  4AXP A;  4CXW A;  2DWK A;  2HN2 A;  5AQJ B;  5CA1 E;  2CLY C;  3EDV A;  4UIG A;  1QSD A;  3JCF A;  3QK6 A;  3LK2 B;  4CZZ B;  3LG7 A;  4HE8 A;  3IBP A;  5AQU B;  1HG5 A;  2VKJ A;  2WWV A;  3LSV A;  2IAK A;  3UQ4 A;  4PFP A;  4U33 A;  5JDH A;  3NWI A;  4G63 A;  4ZS3 A;  4EYU A;  3PJA J;  4JI4 T;  3TLW A;  3Q9D A;  4U2Y A;  4EB6 E;  2LSI A;  3SFD A;  3PJA A;  3AE3 A;  3FZK B;  2E9X D;  1WRD A;  4H9P C;  5FY1 A;  3TLV A;  3VRB A;  2CPT A;  5EK2 A;  2KWH A;  2LM2 A;  2H7O A;  3UU5 A;  2KIN B;  4X5T A;  1FMV A;  2B1E A;  4AKH A;  1WR6 A;  2J47 A;  4IST A;  4E7S A;  3UU4 A;  5CJ5 A;  4EGW A;  5ABF B;  5L3E B;  4IDP A;  2X0Y A;  1Z0P A;  3AVR A;  4X1Y E;  3EHZ A;  3PTR B;  3EI0 A;  2LKH A;  4DBQ A;  1MMD A;  2X51 A;  4M1P A;  3ZYM A;  4IE4 A;  4DR4 T;  4QH5 A;  2UXB T;  2I0M A;  1HTJ F;  3KV4 A;  2L9Q A;  3ZYK A;  3BQI A;  4YJ3 E;  4P1N A;  5KDM C;  3PUZ F;  1XMO T;  2YEV C;  1YKH B;  2WDR A;  2VL0 A;  2X66 A;  5FXW A;  2L3L A;  2XAF B;  3P4P A;  3RI5 A;  3L09 A;  4NXN T;  2PBI A;  1E7P A;  2V7I A;  5HYA A;  3PUS A;  1G8X A;  2ZMA A;  5AQI B;  3O1H A;  2XAG B;  1NWM X;  4P09 A;  2LSG A;  1UCU A;  5JRE A;  1D0Z A;  1HFA A;  4MAL A;  4AI6 A;  1HNX T;  2XQ8 A;  2UXX B;  4I0U A;  3RC3 A;  5L4E A;  4UVA B;  4IL4 A;  4UF0 B;  4H9S E;  4OYK A;  1N36 T;  2E9X A;  4DV3 T;  5L3G B;  2WSS V;  2IIU A;  2WCA A;  2IML A;  2XQ3 A;  1LRZ A;  2XQ4 A;  2ZM8 A;  2CMR A;  3AE2 A;  4QH1 A;  4ZI7 E;  3CVR A;  2Z6E A;  5DQV A;  5LXT E;  1D1B A;  4OK0 A;  1YKE B;  4ILC A;  3NVO A;  1J5E T;  1WFD A;  4TN7 B;  4L9I A;  2NW9 A;  2VQE T;  2WY2 A;  2W67 A;  2WWU A;  1FJG T;  1YQ3 A;  1T8B A;  1Y64 B;  2V5D A;  2LHR A;  2LEH A;  3JAD A;  4PJL A;  3DP7 A;  2KWI B;  4O8S A;  4ILA A;  4YJ2 E;  4IDZ A;  2H88 A;  2LRK A;  4O4J E;  5AQK B;  4EED A;  3ZPO A;  4DR2 T;  3QC9 A;  2E9X B;  2WM9 A;  3LBX B;  4ZI3 D;  5HCM A;  3E08 A;  5HXE A;  4JI1 T;  5AQR B;  2XAS B;  4TWF A;  3OYX A;  4A5X A;  2UUB T;  2CHO A;  2NTX A;  5AQS B;  3T1Y T;  4AIS A;  4IE7 A;  1D1A A;  4EYY R;  2A3D A;  2LHN A;  2YU1 A;  3AA1 B;  1ZKE A;  2J62 A;  3KV9 A;  3N9P A;  4CN1 A;  5ABE A;  4LFC T;  2WS3 A;  2WBL A;  2W4X A;  3TKL B;  4Z8X A;  2RPA A;  1MND A;  2BKP A;  3JC6 C;  4MBQ A;  3OKQ A;  4QX8 B;  5DJQ C;  5LG3 A;  1MMN A;  1D1C A;  4CI1 B;  2LOP A;  2YDR A;  5AFU L;  2YK0 A;  3HKD E;  5DAB A;  4QX7 B;  4EIW A;  4JI6 T;  3RIA A;  1IBL T;  3ZN1 B;  2OLT A;  3HL6 A;  4G2A A;  3NRX A;  1YXR A;  5FL1 A;  5HEJ A;  1M62 A;  3PUQ A;  2NWB A;  2W62 A;  3PDY A;  4X1K E;  3ZJ1 A;  3AXJ B;  4AKL A;  2QYW A;  2BBH A;  4XAX B;  5JDQ A;  5JR9 A;  1S94 A;  4CN6 A;  5LBQ B;  2R6G F;  3CQX C;  4X66 T;  5ABH A;  5FVK A;  4DMV A;  5FL0 A;  3HA4 A;  2ZLY A;  3M65 A;  5EK3 A;  3ETV A;  4ZEY A;  2XAH B;  2X9Y A;  2LSY A;  4ZZB A;  3FZM B;  4U7Y A;  1ZV4 X;  2NP9 A;  2Q9Q C;  2XHE B;  3HKE E;  4OFZ A;  2C0S A;  3P7I A;  3TLU A;  4TUY E;  3U78 A;  3NKZ A;  4QHO A;  3N9L A;  2SPC A;  3N9Q A;  3NZP A;  2BVL A;  4GKJ T;  5AQT B;  4WBN E;  1MIV A;  2WU5 A;  3L39 A;  3Q5D A;  2WP9 A;  2MBG A;  3UFE A;  4O2A E;  5AQH B;  3N2O A;  2VKO A;  3MZK B;  1NEK A;  2XSB A;  3SOL A;  3PV0 F;  4MHC A;  2LJL A;  2WZI A;  5LNK A;  1I94 T;  5L4H A;  1XWM A;  2BDE A;  1QUU A;  2XQY A;  3B13 A;  2DL1 A;  4HWI B;  1WR0 A;  3PUV F;  4KUM B;  1NEN A;  1SA0 E;  5FXZ A;  3F31 A;  2KXP B;  4HTE A;  2D0T A;  5HWY A;  4TNW A;  4LMJ A;  4GOU A;  3ZMV B;  4TV9 E;  4HFD A;  5IWA T;  4C91 A;  2VWA A;  4U72 A;  3RYF E;  2JMH A;  3N9O A;  3RYI E;  5C3J A;  3QB5 K;  4DVD A;  1MMA A;  2BVM A;  2X9W A;  3NZQ A;  2DNX A;  3RF1 A;  1WYB A;  4ZI3 C;  2KND A;  3ZMT B;  1DU2 A;  4FJO A;  4EEB A;  4QXC B;  3P4W A;  3AE7 A;  4WW0 A;  4DR7 T;  5KMG P;  3C64 A;  4HFE A;  3KDS E;  4YFS A;  5ABF A;  3CX7 B;  2MYS A;  4O2B E;  4JUY A;  3IHR A;  3ZKR A;  2UXD T;  2BG9 C;  2V7J A;  2WDQ A;  3K3O A;  3GN5 B;  4DMW A;  4TX5 A;  2BS2 A;  4F8H A;  1VCT A;  3N9M A;  1UUR A;  4DID B;  3A7M A;  2K3W A;  5LYJ E;  1W9R A;  2V6Y A;  3E0Z A;  1Y01 A;  4NIQ A;  3FXE B;  2W0G A;  3R6N A;  4K0U A;  3RGL A;  4YTN A;  3GA8 A;  3AED A;  3ZC1 A;  4IDO A;  2KSR A;  4HKA A;  2K9A A;  3OVU A;  2CBI A;  4YT0 A;  4WZX A;  3LK3 B;  1FIO A;  2QGS A;  4KI0 F;  2VKD A;  2BG9 B;  3OYZ A;  4Q25 A;  5JQG E;  1WYC A;  3D0T A;  4J2C A;  1HF8 A;  4UR9 A;  3RIU A;  4CN4 A;  4JI7 T;  5JDN A;  2DCF A;  2HH7 A;  3B57 A;  1IJ5 A;  4QKN A;  2PFV A;  3FZH B;  5HAX A;  2LOS A;  3W15 B;  1IBK T;  1XDP A;  3UQ7 A;  2LKG A;  3LK4 2;  1QLB A;  5BMV E;  2XAJ B;  5L3C B;  1VCS A;  5J1G A;  4DO0 A;  3K8P C;  4U3C A;  4AQF A;  3IA3 A;  3N9N A;  5EZY E;  3VU7 H;  2NR4 A;  2MAW A;  5EK4 A;  3UU8 A;  3I9W A;  4PJM A;  5AQF B;  3QNU A;  2FJA A;  3ZSS A;  4EXT A;  1J5W A;  2A9U A;  5A1L A;  2FBW A;  4LF6 T;  5AQM B;  3J9X 1;  3EVY A;  3PUA A;  1SUM B;  4DUY T;  2XSA A;  4ZOL E;  5CA0 E;  3FZL B;  4JBW F;  2VB6 A;  2FUP A;  3EAM A;  3RC8 A;  1UGO A;  5LHH B;  3M3Z B;  2OA5 A;  1AJ3 A;  3RRW A;  4Z90 A;  2W00 A;  2K48 A;  2NOX A;  2JMK A;  4HN9 A;  5JTG A;  4O4L E;  1BR2 A;  2ODU A;  3AE9 A;  4IE5 A;  5LB7 B;  3RLF F;  2PG8 A;  3UUX B;  5CGM A;  3K3N A;  4DV5 T;  2AE9 A;  5JRC A;  3QUJ A;  1I6Z A;  1BR0 A;  4XBF B;  2D2S A;  3ZMS B;  4NXM T;  2VVS A;  3KBT A;  3MAC A;  4V1A v;  5J0Z A;  3ZN0 B;  3CPZ A;  5L3B B;  4NPP A;  3N2G E;  3UFG A;  1N34 T;  2JQH A;  1W09 A;  5F3J A;  3PE0 A;  5AQQ B;  4AIU A;  4EZH A;  1MNE A;  2W2U A;  3N5L A;  4TWD A;  1FEW A;  1V9D A;  1VOM A;  1BR4 A;  3KV6 A;  4ZI2 C;  4UV9 B;  1WCR A;  4IHJ E;  4DBR A;  4DUZ T;  4JI3 T;  2NW7 A;  2QVA A;  2CHN A;  2L8K A;  3ANW A;  4L0R A;  1IBM T;  2XJ7 A;  3HI2 A;  3OJA A;  4GK0 E;  2WB5 A;  3P4Q A;  2IDO B;  3AAI A;  4YHJ A;  5AQP B;  4DND A;  4QH4 A;  5LJN A;  3AAA B;  1OXZ A;  2KT9 A;  5LP6 E;  4FI5 A;  2VKH A;  4I50 E;  1EZ3 A;  4A98 A;  2VL8 A;  2NTY A;  2ACZ A;  5JR9 C;  2E5V A;  1XZY A;  1ZEE A;  2E8I A;  2V5C A;  3ZT5 A;  4HWF A;  2WQY A;  2A72 A;  2D9D A;  2BS3 A;  2E9X C;  3FZF B;  5AQG B;  5LBM A;  3MK7 C;  3WAK A;  4QXH B;  5JRC B;  3C4W A;  3FXD B;  5AQN B;  3RIF A;  2CWY A;  3FHN A;  2YDQ A;  3JC6 D;  3ZLI A;  2QRX A;  1MIW A;  3KVA A;  5DQW A;  4JI8 T;  1ZOY A;  4DR6 T;  3SWH A;  3Q5W A;  2NW8 A;  1WLX A;  4UV8 B;  2YKS A;  2N1G A;  3UTK A;  3BQL A;  2ES0 A;  3ABV A;  5HXH A;  5FYM A;  3OBV E;  3CQG B;  3CKD A;  4CXY A;  4O4I E;  2JQ9 A;  2WAU A;  2YN6 A;  4X1I E;  3ZYL A;  4DR5 T;  4KX6 A;  3RHW A;  4UVB B;  5LCY A;  5TAO A;  4AQY T;  4X62 T;  4YSX A;  1ZHC A;  1KK7 A;  4GKK T;  3L8R A;  2HHH T;  3K1S A;  5LGT B;  4JI0 T;  2V6Y B;  5AQO B;  4AKI A;  4WYV A;  4HFI A;  4IRE A;  1KNR A;  3OTO T;  2UXC T;  4CI2 B;  5CB4 E;  2UU9 T;  2W63 A;  3C51 A;  5LJM A;  5F5W A;  2Q9Q D;  4CI3 B;  5FXX A;  2H7V C;  2DWG A;  3Q5X A;  3AE8 A;  4U31 A;  4EV6 A;  3GMI A;  4BA9 A;  3CQC B;  3MKD A;  3CWZ B;  1HX8 A;  2CWO A;  2H3R A;  3C98 B;  3VKH A;  4E7Z A;  1KNZ A;  2D0U A;  3G06 A;  5C2T A;  5BR8 T;  3AEC A;  2WZH A;  1KNP A;  2BBJ A;  4KHZ F;  4H9R C;  2CXF A;  5L3D B;  3AB3 B;  4PJN A;  2LE8 A;  4ZI2 D;  4AKG A;  2UUC T;  4BAY B;  3C4X A;  1T7S A;  3F2E A;  3ONL C;  4YTM A;  1X79 A;  5FNV E;  5HXS A;  2F4V T;  2JQK A;  4LMK A;  2WU2 A;  4X64 T;  2Q9Q B;  1HX1 B;  2C5K T;  3P50 A;  3RKO A;  3ONJ A;  3UUM A;  3K3Q C;  2UUA T;  2VVN A;  1JNZ A;  4MFR A;  1YD8 G;  4WBO A;  3UUL A;  2V7L A;  5GON E;  2CCQ A;  1XDO A;  5HEG A;  2KLQ A;  5AQV B;  2M6I A;  5HEH A;  3TLS A;  4COF A;  5HWX A;  3EAB A;  2V26 A;  1XMQ T;  2DI4 A;  5J2T E;  4B3R T;  2E5L T;  1OWA A;  2GK9 A;  3SFE A;  4AKR B;  5IUX A;  1KEY A;  4AQG A;  4PAG A;  3MJX A;  3PUX F;  4K0K T;  3QOF A;  3ANW B;  3AEA A;  2FJD A;  2UXN B;  2XPK A;  2I6H A;  2BZB A;  2XM1 A;  3C4Z A;  3I1A A;  3MA9 A;  4U2Z A;  5HXR A;  1LVK A;  3ZMZ B;  4JI2 T;  1YW0 A;  3CX8 B;  1T72 A;  1US7 B;  5F8P A;  4ANJ A;  4ASK A;  4YLH A;  1HNZ T;  4OX9 T; 
#chains in the Genus database with same CATH homology
 2HPJ A;  1E1H B;  5FY0 A;  3KFW X;  3PUG A;  5FXV A;  3U3I A;  1B7T A;  2X68 A;  3RX6 A;  1VRB A;  3SS1 A;  2CA5 A;  3ONX A;  2IW5 B;  2XAQ B;  3IF8 B;  3CML A;  1IZN B;  4PNI A;  2DHR A;  5LA6 E;  4I55 E;  4CQI A;  4F6R C;  1CUN A;  1UX4 A;  5H6Q B;  4A56 A;  5FP3 A;  2N9D A;  5IHY A;  1D0Y A;  1HG2 A;  4ERR A;  3BQK A;  1MMG A;  4CXY A;  3FBZ A;  1LKX A;  4OHF A;  5JH7 E;  2M67 A;  5LHG B;  4ZHQ E;  2CEA A;  2G0U A;  3RH3 A;  2ZM2 A;  5KX5 E;  5JDL A;  3BK9 A;  5JVD E;  1SHZ C;  1NAF A;  5LHI B;  4P0A A;  4NUU A;  3LBX A;  4JEH B;  5C8Y E;  2LT3 A;  3ZJ2 A;  2P9B A;  4IIJ E;  3PU8 A;  2WMN A;  3UT5 E;  4PJL A;  3I0Q A;  1UX5 A;  1LVF A;  2JRK A;  3HKB E;  3MXZ A;  5JDF A;  3AA7 B;  5LGU B;  2CE7 A;  2PJQ A;  2VK9 A;  4L5G A;  5FY7 A;  4ZS2 A;  3AVS A;  4H63 H;  3H37 A;  5M4Y A;  2KZ7 B;  3O4X E;  3GWH A;  1BR1 A;  1IAP A;  4H63 V;  3NBX X;  4X20 E;  1S35 A;  4PK6 A;  2X9H A;  3KIN B;  3NRY A;  4UEL A;  2XTL A;  2JPF A;  4I4T E;  3ETU A;  4U74 A;  4AQF C;  2D5U A;  4H9O C;  3EDU A;  3V5S A;  3I0O A;  1D0X A;  4PW8 A;  4GYR A;  5L2L A;  4H9N C;  4TZ4 C;  1G73 A;  4P0B A;  3KBU A;  4HEA A;  1HCI A;  2LSJ A;  3T8O A;  4KMC A;  3RPU A;  2V7K A;  4O4H E;  2Y48 B;  3R84 B;  3SRZ A;  3WI3 A;  2XUE A;  3N2K E;  2W61 A;  1HS7 A;  4PK5 A;  2MOZ A;  2X67 A;  2Y6X A;  2X0L B;  3V5U A;  2MTQ A;  3ZC0 A;  4IGU A;  1T98 A;  2LM9 A;  4WNK A;  4ADZ A;  5JR9 B;  3E22 E;  4KBM B;  2IC6 A;  4EZ4 A;  2J1D G;  1O3X A;  4EOZ B;  2EHO A;  4QWN B;  1MIY A;  4EAH A;  1FMW A;  3S4U A;  3AA6 B;  2X9X A;  4C90 A;  3O9X A;  4JLE A;  3F57 A;  2EHO D;  2K5B B;  3I9Y A;  3ESL A;  5J2U E;  3WAJ A;  2LSK A;  3GN5 A;  2K24 A;  4UVC B;  4CXX A;  2A2F X;  1U4Q A;  2YU2 A;  3FB2 A;  3KV5 A;  3H3A A;  4ILU A;  2CXL A;  2CM0 A;  2Q9Q A;  4HGA A;  5FMN A;  5LOV E;  2HPL A;  4BJN A;  2VAS A;  4MLK A;  4PJJ A;  3LJC A;  4TV8 E;  3RYH E;  2JQQ A;  3DJB A;  4KP3 C;  2CXD A;  3VHL A;  4GYS A;  4XZC A;  3ZEF B;  3VKG A;  2DLR A;  2EHO C;  1U5P A;  3ZMU B;  4N78 D;  2ODV A;  3DTO A;  5H6R B;  5JDM A;  5L3F B;  5LNK A;  3AAE B;  5JDG A;  4PFO A;  4ISS A;  4I43 B;  5LGN B;  4QXB B;  3O1I A;  3Q2M A;  3PU3 A;  2Y8D A;  3KVB A;  4UEM A;  1H7C A;  2C5I T;  2V1D B;  2V7M A;  3HR0 A;  3RRC A;  3CX6 B;  3FBL A;  2ZM0 A;  5E0O A;  1IJ6 A;  5ETW A;  4GIW A;  4UF0 A;  5LG4 A;  2IC9 A;  2JJ9 A;  3RYC E;  3HKC E;  2CLY B;  3L3P A;  2RA1 A;  2RP4 A;  3PUR A;  4NUV A;  5ADX L;  2ACX A;  4HFV A;  2EHO B;  3IEE A;  3AA0 B;  4IE0 A;  2KMF A;  2YIN A;  3A5X A;  4H9Q C;  3EUH A;  4IE6 A;  4PK4 A;  4UXN B;  3J7Y q;  3P8C D;  4BJM A;  2QA7 A;  3C50 A;  3ZCI A;  4OYJ A;  3LFM A;  3O1J A;  4B6X A;  2C5J A;  2N2N A;  2WMO A;  5HXC A;  5IYZ E;  2I59 A;  3ZCJ A;  4GK5 E;  4JEU B;  3UUN A;  4AXP A;  4CXW A;  2DWK A;  5CA1 E;  2CLY C;  3EDV A;  4UIG A;  1QSD A;  3QK6 A;  3LK2 B;  4CZZ B;  3LG7 A;  4HE8 A;  3IBP A;  1HG5 A;  2VKJ A;  2IAK A;  4PFP A;  5JDH A;  4EYU A;  4G63 A;  4ZS3 A;  3Q9D A;  4EB6 E;  2LSI A;  2E9X D;  1WRD A;  4H9P C;  5FY1 A;  5EK2 A;  2KWH A;  2H7O A;  2KIN B;  1FMV A;  2B1E A;  4AKH A;  1WR6 A;  4IST A;  4E7S A;  5L3E B;  4DBQ A;  3AVR A;  1Z0P A;  4X1Y E;  3PTR B;  1MMD A;  2X51 A;  4M1P A;  3ZYM A;  4IE4 A;  1HTJ F;  3KV4 A;  2L9Q A;  3ZYK A;  3BQI A;  4YJ3 E;  5KDM C;  2YEV C;  1YKH B;  2X66 A;  5FXW A;  2L3L A;  2XAF B;  3L09 A;  2PBI A;  2V7I A;  5HYA A;  3PUS A;  1G8X A;  2ZMA A;  3O1H A;  2XAG B;  1NWM X;  4P09 A;  2LSG A;  1UCU A;  5JRE A;  1D0Z A;  1HFA A;  4MAL A;  4AI6 A;  2UXX B;  3RC3 A;  4UVA B;  4UF0 B;  4H9S E;  4OYK A;  2E9X A;  5L3G B;  2WSS V;  2ZM8 A;  3RC8 A;  1LRZ A;  4ZI7 E;  2CMR A;  3CVR A;  2Z6E A;  5DQV A;  5LXT E;  1D1B A;  4OK0 A;  1YKE B;  4TN7 B;  2NW9 A;  4L9I A;  2WWU A;  1Y64 B;  2LHR A;  2LEH A;  3DP7 A;  2KWI B;  4O8S A;  4YJ2 E;  4IDZ A;  4O4J E;  3ZPO A;  3QC9 A;  2E9X B;  2WM9 A;  3LBX B;  4ZI3 D;  3E08 A;  5HXE A;  2XAS B;  3OYX A;  2NTX A;  4IE7 A;  1D1A A;  4EYY R;  2A3D A;  2LHN A;  2YU1 A;  3AA1 B;  1ZKE A;  3KV9 A;  3N9P A;  2WBL A;  3TKL B;  4Z8X A;  4MBQ A;  1MND A;  3JC6 C;  3OKQ A;  4QX8 B;  5DJQ C;  1MMN A;  1D1C A;  4CI1 B;  2LOP A;  5AFU L;  2YK0 A;  3HKD E;  5DAB A;  4QX7 B;  4EIW A;  3ZN1 B;  3HL6 A;  4G2A A;  3NRX A;  3PUQ A;  2NWB A;  2W62 A;  3PDY A;  4X1K E;  3ZJ1 A;  4AKL A;  4XAX B;  5JDQ A;  5JR9 A;  1S94 A;  5LBQ B;  3CQX C;  4DMV A;  3HA4 A;  2ZLY A;  3M65 A;  5EK3 A;  3ETV A;  2XAH B;  2X9Y A;  2LSY A;  1ZV4 X;  2NP9 A;  2Q9Q C;  2XHE B;  3HKE E;  4OFZ A;  2C0S A;  3P7I A;  3U78 A;  4TUY E;  4QHO A;  3N9L A;  2SPC A;  3N9Q A;  3NZP A;  2BVL A;  4WBN E;  1MIV A;  2MBG A;  3UFE A;  4O2A E;  3N2O A;  2VKO A;  3MZK B;  3SOL A;  4MHC A;  2LJL A;  2BDE A;  1QUU A;  2XQY A;  3B13 A;  4KUM B;  1SA0 E;  5FXZ A;  3F31 A;  2KXP B;  4HTE A;  2D0T A;  5HWY A;  4GOU A;  3ZMV B;  4TV9 E;  4C91 A;  2VWA A;  4U72 A;  3RYF E;  2JMH A;  3N9O A;  3RYI E;  4DVD A;  1MMA A;  2BVM A;  2X9W A;  3NZQ A;  2DNX A;  1WYB A;  4ZI3 C;  2KND A;  3ZMT B;  4FJO A;  4QXC B;  4WW0 A;  5KMG P;  3C64 A;  3KDS E;  4YFS A;  3CX7 B;  2MYS A;  4O2B E;  4JUY A;  3IHR A;  2V7J A;  4DMW A;  3K3O A;  3GN5 B;  4TX5 A;  3N9M A;  5LYJ E;  3E0Z A;  3FXE B;  2W0G A;  3R6N A;  4K0U A;  3GA8 A;  3ZC1 A;  4HKA A;  2K9A A;  3LK3 B;  1FIO A;  2QGS A;  2VKD A;  3OYZ A;  5JQG E;  1WYC A;  3D0T A;  4J2C A;  1HF8 A;  5JDN A;  2DCF A;  3B57 A;  2HH7 A;  1IJ5 A;  4QKN A;  2PFV A;  5HAX A;  3W15 B;  2LOS A;  3LK4 2;  5BMV E;  2XAJ B;  5L3C B;  5J1G A;  4DO0 A;  3K8P C;  4AQF A;  3N9N A;  5EZY E;  3VU7 H;  5EK4 A;  3I9W A;  4PJM A;  4EXT A;  5A1L A;  3J9X 1;  3EVY A;  3PUA A;  4ZOL E;  5CA0 E;  2VB6 A;  5LHH B;  2OA5 A;  1AJ3 A;  3RRW A;  2W00 A;  2K48 A;  2NOX A;  2JMK A;  4HN9 A;  4O4L E;  1BR2 A;  2ODU A;  4IE5 A;  3UUX B;  2PG8 A;  5JRC A;  3K3N A;  3QUJ A;  1BR0 A;  4XBF B;  2D2S A;  3ZMS B;  3KBT A;  3MAC A;  4V1A v;  3ZN0 B;  3CPZ A;  5L3B B;  3N2G E;  5F3J A;  3PE0 A;  4EZH A;  1MNE A;  3N5L A;  1FEW A;  1V9D A;  1VOM A;  1BR4 A;  3KV6 A;  4ZI2 C;  4UV9 B;  4IHJ E;  4DBR A;  2NW7 A;  3ANW A;  2L8K A;  4L0R A;  3HI2 A;  3OJA A;  4GK0 E;  4DND A;  3AAI A;  4YHJ A;  5LJN A;  3AAA B;  1OXZ A;  2KT9 A;  5LP6 E;  4FI5 A;  2VKH A;  4I50 E;  1EZ3 A;  2VL8 A;  2NTY A;  5JR9 C;  1ZEE A;  2E8I A;  2A72 A;  5LBM A;  2E9X C;  3MK7 C;  3WAK A;  4QXH B;  5JRC B;  3C4W A;  3FXD B;  2CWY A;  3FHN A;  3JC6 D;  3ZLI A;  3KVA A;  1MIW A;  5DQW A;  3SWH A;  3Q5W A;  2NW8 A;  1WLX A;  4UV8 B;  3UTK A;  2N1G A;  3BQL A;  2ES0 A;  5HXH A;  5FYM A;  3OBV E;  3CQG B;  3CKD A;  4O4I E;  2WAU A;  4X1I E;  3ZYL A;  4UVB B;  5LCY A;  5TAO A;  1ZHC A;  1KK7 A;  5LGT B;  4AKI A;  4CI2 B;  5CB4 E;  2W63 A;  3C51 A;  5LJM A;  2Q9Q D;  4CI3 B;  5FXX A;  2H7V C;  2DWG A;  3Q5X A;  3GMI A;  4BA9 A;  3CQC B;  3MKD A;  3CWZ B;  1HX8 A;  2CWO A;  2H3R A;  3C98 B;  3VKH A;  4E7Z A;  1KNZ A;  2D0U A;  4H9R C;  2CXF A;  5L3D B;  3AB3 B;  4PJN A;  2LE8 A;  4ZI2 D;  4AKG A;  4BAY B;  3C4X A;  3F2E A;  5FNV E;  5HXS A;  1X79 A;  2Q9Q B;  2C5K T;  3RKO A;  3UUM A;  3K3Q C;  4MFR A;  4WBO A;  1YD8 G;  3UUL A;  2V7L A;  5GON E;  2CCQ A;  5HWX A;  2KLQ A;  2V26 A;  2DI4 A;  5J2T E;  1OWA A;  2GK9 A;  4AKR B;  4AQG A;  4PAG A;  3MJX A;  3ANW B;  2UXN B;  2BZB A;  3C4Z A;  3I1A A;  3MA9 A;  5HXR A;  3ZMZ B;  1LVK A;  1YW0 A;  3CX8 B;  1US7 B;  5F8P A;  4ANJ A;  4ASK A;  4YLH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...