2QA7A

Crystal structure of huntingtin-interacting protein 1 (hip1) coiled-coil domain with a basic surface suitable for hip-protein interactor (hippi)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
99
structure length
99
Chain Sequence
DEKDHLIERLYREISGLKAQLENMKTESQRVVLQLKGHVSELEADLAEQQHLRQQAADDCEFLRAELDELRRQREDTEKAQRSLSEIERKAQANEQRYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Actin binding
molecule keywords Huntingtin-interacting protein 1
publication title Crystal structure at 2.8 A of Huntingtin-interacting protein 1 (HIP1) coiled-coil domain reveals a charged surface suitable for HIP1 protein interactor (HIPPI)
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 99
sequence length 99
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-06-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1920 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2qa7A00
2QA7A
chains in the Genus database with same CATH superfamily
5L3BB 2K48A 4TWHA 2JPFA 4UR9A 4DR2T 2LRKA 3EUHA 4TWFA 2KWHA 4JEUB 2K3WA 5LA6E 2LHNA 3AEAA 3SS1A 4JI1T 5IHYA 4DMWA 1YKEB 3JAEA 3QNUA 2V7LA 4XAXB 4UV8B 4OYJA 1CHUA 2XUEA 3AE2A 1T72A 3OYZA 5KX5E 3L8RA 5ETWA 4ASKA 4IE4A 4X20E 4X1KE 3UQ7A 3RPUA 4UVAB 2CWOA 2WMNA 5LBQB 3VR8A 1OEDE 3N9LA 4WBNE 4HFCA 5HCJA 2DHRA 3JCFA 3T8OA 2LRLA 3N5LA 1MMDA 2W62A 2X9YA 3C51A 4AXPA 1SHZC 2Y6XA 3RI5A 3ZLIA 1HCIA 4X66T 3B13A 3ZMVB 3NKZA 3FBZA 1N34T 2UXDT 4YJ3E 4CN6A 4ZZBA 2CE7A 4LFCT 4WZXA 5HXRA 2CBIA 4U74A 3RKOA 5LJNA 3KV9A 3B57A 2DI4A 1HS7A 2XM2A 1KNZA 1W0AA 3SOLA 1UURA 2ODUA 3PUVF 2CWYA 3AXJA 4JI0T 3ETVA 4DV1T 4DNDA 4GK0E 3O1HA 4JLEA 3X1DA 1B7TA 5AQLB 5ABFA 5CGMA 4O2BE 3OBVE 3AAEB 3GWHA 4DR4T 2V5DA 2WB5A 2YN6A 5C3JA 3N2KE 4CQIA 2DNXA 3RQUA 4IL4A 1ZOYA 3I9WA 2UXNB 4UEMA 1MIVA 4TV9E 1H7CA 4CXWA 4ILBA 5LOVE 2DWKA 2WDQA 1HX1B 3N2OA 3KV5A 1W09A 5FP3A 4PNIA 4LMKA 4TNWA 1GQEA 3A7MA 1WR6A 4PK4A 2EHOD 5AQNB 5FY1A 4WYVA 2SPCA 4PJLA 4YXDA 1IAPA 4CI3B 4YSYA 2NTXA 4ZZCA 2KINB 1AJ3A 4NXMT 3PV0F 3UU3A 3ZMUB 2LEHA 3NZQA 4B3RT 2UU9T 3QB5A 2BS2A 2E2AA 4MHCA 4DV2T 4HFEA 3AVRA 4QHOA 4C90A 4Q25A 2A2FX 4ISSA 2N1GA 3FZLB 5ABGA 4QXHB 4AQFC 1YD8G 2LJLA 5ABEA 5LJMA 2W67A 4JI4T 4AKRB 2BG9B 3RHWA 5JDHA 3RRWA 1JNRA 4G2AA 2LKGA 3LBXA 3ZPOA 3HL6A 1D0XA 5JR9C 2FJEA 2XQAA 1ZP0A 4XBFB 2A3DA 4JI2T 3IBPA 4K0UA 4OFZA 1FIOA 3AVSA 1SA0E 4PK6A 3K3QC 1QLBA 4NUUA 2J1DG 1XMOT 2NTYA 5HWYA 2VB6A 2D9DA 1XNRT 5JDMA 1Z8UA 4KI0F 5L3CB 4P0BA 2VURA 4ZEYA 3AE5A 4CZZB 4CXYA 4H9SE 5FL1A 2EHOC 4KP3C 2HH7A 5JTGA 2WSSV 1UX4A 3SFDA 4A98A 4AKGA 1MIWA 2WDRA 1KEYA 1T7SA 3ZEFB 4IL9A 3RYFE 4OYKA 2WDVA 3AEGA 3AEFA 2VKHA 2JMHA 2V7KA 3PUSA 5KDMC 3P7IA 2H7OA 2NW8A 3ZJ2A 3W15B 2KWIB 5JH7E 3CK6A 2CPTA 4HWFA 4DR5T 4OX9T 4L5GA 3PJAJ 2XAQB 2XQYA 3I0OA 3GN5B 4N78D 3FXDB 2KSRA 3Q5EA 4WW0A 4EZ4A 2XM1A 2FUPA 2D0UA 3OPCA 2W00A 4COFA 3RIUC 4QH1A 3RLFF 2PTFA 2Y48B 5KMGP 4DV3T 4H9PC 4QKNA 4C91A 3EDVA 2A9UA 1SE7A 5JDQA 5CJ5A 4QWNB 2E9XD 1N36T 4HWIB 3BK9A 2XQ5A 2DCFA 4IDQA 3PDYA 1OEDC 3EHZA 4JBWF 3ZSTA 1FJGT 1XDPA 4KHPT 4YSZA 4EYYR 3EABA 3P4RA 2WBLA 2UXBT 4EZHA 3U3IA 3ZN0B 1OWAA 3KVAA 4I4TE 4AIUA 2D2SA 3H3MA 3P4PA 5AQPB 2WZHA 4L9IA 1M7KA 2UUBT 5F5WA 3UFEA 2N2NA 2YKSA 4Z91A 2HN2A 3LG7A 3D0TA 4QX8B 3ZN1B 3HKCE 3ZT7A 2L3LA 2ZM2A 4B6XA 1Z0PA 4XZCA 5FVLA 3L39A 4TZ4C 4DV4T 5AQGB 3RF1A 3LK42 4KBMB 2VVSA 4YHHT 2LE8A 2LM2A 1US7B 2WP9A 4EIWA 3OVUA 1QUUA 3FZMB 3I0QA 4HN9A 2IIUA 5FXXA 4FJOA 4ADZA 5H6QB 1D0ZA 4IE5A 5J0ZA 3AE1A 5CA1E 3RH3A 2NW7A 4Z90A 4IE7A 3LFMA 4P1NA 1IZNB 2X0YA 1IJ6A 4KUMB 3ZCIA 3HKBE 2JQ9A 3T1YT 4H9NC 4NUVA 2RP4A 3R6NA 1X79A 5HEUA 4IDPA 4YHJA 3FHNA 5LHGB 3V5UA 2E9XC 1WCRA 1NAFA 1WYCA 5FVKA 1L0VA 5IUXA 2Q9QA 1WRDA 3N9PA 4P0AA 1BR1A 1HTJF 4H63H 2YINA 2LM9A 5LMUT 5EK2A 3WI3A 3AE4A 1D1AA 3J9X1 3EAMA 5FXZA 4JUYA 3RQWA 4TNVA 3KDSE 2AE9A 4PAGA 3V5SA 3Q5DA 3MA9A 3JC6D 4QH4A 5EK3A 2CEAA 2W61A 3AECA 3VKHA 1WFDA 2VQET 5JR9B 2V6YB 4IE6A 3R84B 2QRXA 4TX5A 3SFEA 5LG4A 2M6IA 4IREA 3I1AA 5FY7A 3RC8A 4HFDA 5LXTE 1BR0A 2ZM6T 3FZHB 5FXWA 4AQFA 3UT5E 2ACZA 2XJ7A 3EVYA 5LGTB 5DJQC 2V6XA 3PE0A 1ZHCA 2NW9A 1LVKA 1MIYA 2EHOB 2VKJA 4U7IA 3UU8A 4JI8T 1YXRA 2BKPA 2FJBA 5LNKA 4I55E 4PJMA 3KINB 2HHHT 2WQYA 1I94T 1XMQT 3N9QA 4OK0A 2V8SV 3FB2A 2HN1A 4U3CA 2D5UA 2J62A 3UU4A 4LFBT 4LF8T 2A72A 4ZS3A 5LG3A 4AI6A 4DV6T 3DP7A 4X62T 1XNQT 2XQ4A 2ZMAA 1R8IA 5LHHB 5L4EA 3LK2B 4ZXLA 2L8KA 3KVBA 1E1HB 5C2TA 1QSDA 1HNWT 2WS3A 5JQGE 2H88A 3HKDE 4ZOLE 3P50A 3P4SA 4HFVA 3C50A 4YLHA 2B76A 3VRAA 3MACA 1OXZA 3E0ZA 3A8YC 3JC6C 4JEHB 2BDEA 2LOSA 3IEEA 5AQUB 1KNPA 3NBXX 3HR0A 4JI5T 5EK4A 1OEDB 4P09A 4HWDA 4I43B 3C98B 2ODVA 3EDUA 2KLQA 2BVMA 5LGNB 5HEHA 1FEWA 3MXZA 3HI2A 5JDNA 2AXDS 3ZC1A 3TLTA 5DQWA 3N9NA 5FYMA 4QXBB 1V9DA 2V7IA 3VHLA 2UXXB 4HFHA 1HX8A 5TAOA 3UTKA 3AE7A 5L4HA 3CKDA 4PK5A 3AEBA 4ISTA 3AE6A 3M65A 2UXCT 2X51A 4PJJA 3AE9A 4ZI2D 4Z8XA 1UCUA 3UUMA 3VR9A 1VCSA 4OHFA 2LOPA 4BJNA 3CWZB 1LVFA 4MALA 2X68A 3Q9DA 4U33A 2YDRA 4EGWA 3ANWB 1HR0T 1N32T 2J4GA 2C0SA 3CIRA 3ZKRA 4BAYB 1LRZA 2L9QA 5HEOA 4O4JE 1YKHB 4U2ZA 5FKYA 4GKKT 2QA7A 3P4WA 2OLTA 3CX8B 2P9BA 4M1PA 2XAJB 1DU2A 3NZPA 4YTMA 3E08A 4KMCA 2VASA 2E9XB 3WAJA 4O4LE 5L3FB 3CX6B 4DBQA 4B3ST 1MNDA 1HNZT 2ACXA 2BG9A 1J5ET 5H6RB 3FXEB 2XZEA 2MPKA 2UUCT 4AQYT 1KK7A 1U4QA 3IHRA 2W66A 3AEDA 3RYHE 5E0OA 2WY2A 3UUNA 3BQLA 4DVDA 2RPAA 5AQFB 3OTOT 4NPPA 5F8PA 3AB3B 3FZKB 4ILCA 3I9YA 4KX6A 1J5WA 3K1SA 2MYSA 4V1Av 4HWHA 2QGSA 4ZI2C 2BBHA 5L3GB 1XDOA 2C5IT 5L2LA 2X9HA 3ZT5A 4PFPA 5LYJE 3ZC0A 5FXVA 3ZCJA 1HF8A 2W2UA 5LHIB 3AA1B 1YQ3A 2UUAT 3TLSA 3KBUA 4A5XA 2G0UA 5F3JA 3NRXA 3J7Yq 4U72A 3LJCA 4KHZF 3F31A 3C4XA 1HG2A 3UU6A 2JRKA 4UVBB 4YTPA 2QYWA 5LCYA 3HKEE 2X0HA 2X0LB 3C4ZA 4MBQA 3T1HT 4DIDB 3UU5A 2V5CA 4DR7T 3GN5A 2X67A 3CQCB 4IDZA 3UUXB 2CXDA 2YK0A 1IJ5A 4PW8A 4H9OC 2BKOA 4CN1A 2MTQA 3SRZA 4TUYE 5AQMB 3PTRB 5AQTB 3MJXA 1G8XA 4UVCB 3PU8A 1W9RA 4DO0A 2W0GA 2LSKA 1CUNA 4ILUA 5JDGA 1HG5A 2H3RA 4HEAA 5M4YA 3ABVA 3PJAA 2F4VT 2JIWA 4DR6T 1I6ZA 4DR1T 3QB5K 2WM9A 4QH5A 1NENA 2DLRA 5ADXL 5AQQB 2X9XA 2MOZA 3G06A 2OV9A 3NRYA 4UF0B 1WLXA 2M6BA 2FBWA 3O4XE 4LF4T 4CXXA 4HE8A 4B3MT 3ZMTB 3F2EA 3QUJA 4HWCA 1Y64B 1IBKT 3KBTA 1NEKA 4H9RC 4I50E 1ZV4X 5JRCB 2VKOA 2XASB 5BMVE 4ZI3D 3ETUA 1UX5A 5CFBA 4E7SA 2XPKA 3QC9A 1Y01A 1JNZA 3PUZF 4H63V 4AKHA 3PUYF 2WAUA 5HXHA 3JADA 2XSBA 4CI1B 4E7ZA 4ILAA 3RKGA 2IC9A 4YTNA 5HWXA 1YQ4A 3ZYKA 4QXCB 2WCAA 2K24A 3TKLB 3GMIA 4BA9A 2CBJA 4DUYT 3C64A 4LF6T 4NIQA 2D0TA 3M3ZB 4GK5E 1UK5A 2YOEA 3E22E 2I6HA 1E7PA 3ZMZB 2XTLA 4CN4A 4GKJT 5JDFA 4DUZT 3LDQB 2IAKA 2IW5B 2XY8B 5JREA 3ONJA 4K0KT 3DTOA 4U7YA 5CB4E 3AEEA 4DMVA 2CMRA 3SWHA 4DV7T 4MLKA 4YY3T 5HCMA 1XZYA 3L3PA 3BQIA 4JI3T 2PG8A 4EEDA 2BVLA 2V1DB 2LLYA 2Q9QD 1S35A 3L09A 3Q2MA 3AA6B 3UQ4A 4ZI3C 4F8HA 3AE3A 3ZT6A 5BR8T 4ZS2A 5JR9A 2V6YA 4LF7T 5EZYE 4HKAA 4L0RA 2WWVA 3MKDA 5FMNA 2VL8A 2I59A 2V7JA 5DABA 2MBGA 3AXJB 3F57A 2HPJA 1HNXT 1HFAA 3RIAA 2C5JA 1ZKEA 4IIJE 2H89A 3FBLA 1U5PA 2PJQA 5HXSA 3DJBA 2JQKA 3K3NA 5ABFB 4O4HE 3IF8B 3S4UA 2C5KT 4I0UA 3Q5XA 4IDOA 1W0BA 1UUSA 2QVAA 3VU7H 2EHOA 3OJAA 3O9XA 2E5VA 2CA5A 3BQKA 2B1EA 3PUGA 3B5MA 2WZIA 2CHOA 3PURA 3TLUA 2N9DA 3OKQA 5LB7B 4FI5A 2XAGB 3P4QA 2WWUA 2W4XA 4EXTA 1YW0A 4ERRA 2ES0A 2XQ6A 1EZ3A 2XAFB 1ZEEA 4ZHQE 2GK9A 4LMJA 2MAWA 5AQSB 2XQ9A 2CHNA 5FY0A 2BG9E 2XQ8A 2CCQA 3ZYMA 2KNDA 4BJMA 2NWBA 3CMLA 1KNRA 5A1LA 2YDQA 3OYXA 4YT0A 2V7MA 3RIUA 2ZLYA 2CLYC 2PFVA 3ZYLA 2FJAA 2KZ7B 2Q9QC 4IHJE 4EEBA 3RGLA 4EYUA 2YU2A 4TN7B 3CX7B 2NOXA 1WYBA 2E8IA 3IA3A 3RX6A 4X1YE 5AQHB 3CVRA 2IMLA 5C8YE 1VCTA 2R6GF 4H9QC 1MMNA 1OEDA 3UULA 1IBLT 4GIWA 3TLVA 2XAHB 2YEVC 2RA1A 1IBMT 4LFAT 1FMVA 2X66A 3K8PC 3LBXB 4ANJA 2LKHA 3FZFB 3O1IA 2JJ9A 3AAAB 5L3DB 4YFSA 5AQOB 1NWMX 3PUXF 4O4IE 3U78A 3PU3A 3A5XA 1VRBA 1KFYA 3AAIA 3UFGA 2KXPB 3N9OA 2VQFT 1S94A 4X64T 4PFOA 5AQIB 5FNVE 5HYAA 4GYRA 2IDOB 4EV6A 2VVNA 5HEJA 3QK6A 3TLWA 4TV8E 3N2GE 5IWAT 1J1JA 2CM0A 5L47A 5AQRB 5LMNT 3ANWA 4LF5T 1UGOA 2IHR1 5IYZE 4DV5T 2HPLA 2LHRA 4YJ2E 3ONLC 4HFBA 2JQQA 2YU1A 3WAKA 3NVOA 5LGUB 1KF6A 1D1CA 4UIGA 2LSGA 4IE0A 5ABHA 2Z6EA 5HXCA 3AA0B 2J47A 3ZJ1A 4NXNT 5LP6E 5HXEA 5DQVA 2VK9A 3ESLA 4A56A 2E9XA 4JV5T 1M62A 4HFIA 2XHEB 4TWDA 4UV9B 3GA8A 4EOZB 4YSXA 4PJNA 1XWMA 2V26A 1MMAA 3PUQA 3RC3A 2WMOA 4AQGA 2CRBA 2LSYA 4QX7B 3H3AA 3JAFA 2BS4A 1O3XA 2X9WA 2Y8DA 4A97A 1MNEA 5GONE 4DR3T 3VRBA 3AE8A 3PUWF 2KT9A 2IUBA 1BR2A 4WNKA 4MFRA 5HAXA 3UUBA 4LF9T 2DWGA 4O8SA 4IGUA 2BS3A 2E5LT 2M67A 4GOUA 4JI6T 2H7VC 3MZKB 2IC6A 1X9BA 2CXFA 1E2AA 2VL0A 4X65T 4WBOA 2KMFA 5AQVB 1FMWA 2WU2A 3Q5WA 5HEGA 5AFUL 5JVDE 4IT4A 1SUMB 4O2AE 4GYSA 2K9AA 4X5TA 4UELA 4AKLA 1LKXA 2NR4A 3AA7B 2LT3A 4HGAA 1D1BA 3NWIA 4U31A 2NP9A 3KFWX 3PUAA 1WR0A 2BBJA 3CQXC 2CXLA 2DL1A 2FJDA 5FL0A 2PBIA 3ZSSA 4B3TT 3RYCE 5AQJB 4JYAT 2VKDA 2XQ7A 3QOFA 3MK7C 3O1JA 3ONXA 4DBRA 3P8CD 3RRCA 5L3EB 2JMKA 4IDNA 5CA0E 5J2UE 4HTEA 2I0MA 3ZMSB 2LSIA 5J2TE 2JQHA 1BR4A 5AQKB 4AKIA 4F6RC 4X1IE 2BKNA 2K5BB 3LK3B 2CLYB 3KV4A 2XQ3A 1MMGA 2Q9QB 2ZM0A 4UXNB 4CI2B 2YDSA 2LSJA 3EI0A 2OA5A 4UF0A 1G73A 2BG9C 2WU5A 2W63A 4ZI7E 3LSVA 5J1GA 5JDLA 3H37A 4LMLA 4AISA 1T98A 3C4WA 3CQGB 4EB6E 1VOMA 5JRCA 3KV6A 3RIFA 4J2CA 1N33T 3N9MA 4JI7T 4EAHA 5KXJA 5LBMA 3VKGA 2XSAA 2ZM8A 4G63A 4U2YA 2BZBA 4DV0T 3CPZA 3RYIE 3K3OA 1T8BA 3HA4A 2VWAA 1D0YA
chains in the Genus database with same CATH topology
4EYYR 2WWUA 5L3BB 2K48A 4EXTA 3CX8B 2P9BA 4M1PA 1YW0A 4ERRA 2JPFA 2ES0A 2XAJB 1EZ3A 3NZPA 2XAFB 2WBLA 3E08A 4KMCA 3EUHA 2VASA 1ZEEA 2E9XB 3WAJA 2KWHA 4JEUB 4ZHQE 2GK9A 4EZHA 5LA6E 2LHNA 3U3IA 3ZN0B 4O4LE 5L3FB 3SS1A 3CX6B 1OWAA 4DBQA 3KVAA 5FY0A 5IHYA 1MNDA 4I4TE 2CCQA 2D2SA 4DMWA 1YKEB 3ZYMA 2KNDA 2ACXA 2V7LA 2NWBA 4BJMA 3CMLA 5H6RB 3FXEB 4L9IA 4XAXB 3UFEA 5A1LA 2N2NA 3OYXA 2V7MA 4UV8B 1KK7A 4OYJA 3LG7A 2ZLYA 2XUEA 1U4QA 3IHRA 2CLYC 2PFVA 5E0OA 3RYHE 3ZYLA 2KZ7B 3D0TA 3UUNA 4QX8B 3ZN1B 3OYZA 3HKCE 2Q9QC 2L3LA 3BQLA 4IHJE 4DVDA 5KX5E 4EYUA 2YU2A 2ZM2A 4TN7B 3CX7B 5ETWA 4B6XA 1Z0PA 4XZCA 4ASKA 4IE4A 5F8PA 4X20E 3AB3B 4TZ4C 3I9YA 4X1KE 2NOXA 3RPUA 3LK42 4UVAB 1WYBA 2E8IA 4KBMB 2CWOA 2WMNA 3RX6A 2MYSA 4V1Av 4X1YE 5LBQB 2LE8A 1US7B 3N9LA 4WBNE 3CVRA 2QGSA 4EIWA 5C8YE 4ZI2C 5L3GB 4H9QC 2C5IT 1MMNA 5L2LA 1QUUA 2DHRA 3T8OA 2X9HA 4PFPA 3UULA 3I0QA 4HN9A 4GIWA 5LYJE 5FXXA 3ZC0A 3N5LA 4FJOA 1MMDA 5FXVA 2W62A 2XAHB 2X9YA 3C51A 3ZCJA 1HF8A 4ADZA 2YEVC 5LHIB 3AA1B 5H6QB 1D0ZA 1SHZC 4AXPA 4IE5A 2RA1A 3KBUA 5F3JA 2G0UA 5CA1E 3NRXA 3RH3A 2Y6XA 2NW7A 1FMVA 2X66A 4IE7A 3LFMA 1IZNB 3ZLIA 3J7Yq 1HCIA 3K8PC 1IJ6A 3B13A 3LBXB 4U72A 3ZMVB 4ANJA 4KUMB 3ZCIA 3LJCA 3FBZA 3F31A 3O1IA 2JJ9A 3AAAB 3HKBE 3C4XA 1HG2A 5L3DB 4YJ3E 4H9NC 4YFSA 2JRKA 2CE7A 4UVBB 1NWMX 4NUVA 2RP4A 4O4IE 3U78A 5LCYA 3R6NA 3PU3A 1X79A 3A5XA 4YHJA 1VRBA 3AAIA 3FHNA 5HXRA 5LHGB 3HKEE 2KXPB 4U74A 3RKOA 3N9OA 3V5UA 2E9XC 2X0LB 5LJNA 1S94A 3KV9A 4PFOA 5FNVE 5HYAA 4GYRA 3B57A 2DI4A 1HS7A 1NAFA 1WYCA 3C4ZA 2Q9QA 4MBQA 1KNZA 1WRDA 3SOLA 3QK6A 3N9PA 2ODUA 4P0AA 2CWYA 4TV8E 3GN5A 1BR1A 3N2GE 2X67A 3CQCB 4IDZA 1HTJF 4H63H 2YINA 3ETVA 2CM0A 3UUXB 2LM9A 2CXDA 2YK0A 1IJ5A 4DNDA 5EK2A 4PW8A 4GK0E 3O1HA 4H9OC 4JLEA 3WI3A 1D1AA 3ANWA 1B7TA 3J9X1 2MTQA 3SRZA 4O2BE 3OBVE 4TUYE 5FXZA 3AAEB 3GWHA 3PTRB 5IYZE 4JUYA 3MJXA 2HPLA 3N2KE 1G8XA 2DNXA 2LHRA 3KDSE 4CQIA 4YJ2E 4PAGA 4UVCB 3PU8A 3V5SA 4DO0A 3MA9A 2W0GA 2LSKA 3I9WA 2UXNB 3JC6D 1CUNA 4UEMA 1MIVA 4ILUA 2JQQA 5JDGA 4TV9E 1H7CA 1HG5A 2YU1A 5EK3A 3WAKA 5LGUB 2CEAA 1D1CA 2H3RA 2W61A 4HEAA 4UIGA 4CXWA 5M4YA 3VKHA 2LSGA 4IE0A 2Z6EA 5LOVE 5JR9B 4IE6A 3R84B 2DWKA 3AA0B 5HXCA 4TX5A 2WM9A 5LG4A 3N2OA 2DLRA 3KV5A 3ZJ1A 5ADXL 5LP6E 2X9XA 2MOZA 5FP3A 4PNIA 5HXEA 3I1AA 5FY7A 5DQVA 3NRYA 2VK9A 3RC8A 4UF0B 1WLXA 3ESLA 4PK4A 1WR6A 4A56A 2EHOD 5LXTE 1BR0A 2E9XA 3O4XE 5FY1A 2SPCA 4CXXA 5FXWA 2XHEB 4AQFA 4HE8A 4UV9B 4PJLA 3GA8A 1IAPA 3ZMTB 4EOZB 3F2EA 3QUJA 3UT5E 1Y64B 3EVYA 5LGTB 5DJQC 4PJNA 3KBTA 4H9RC 4I50E 4CI3B 1ZV4X 2V26A 1MMAA 5JRCB 3PUQA 2VKOA 2WMOA 3RC3A 3PE0A 1ZHCA 2XASB 4AQGA 5BMVE 2NTXA 2NW9A 4ZI3D 2KINB 2LSYA 4QX7B 1AJ3A 3H3AA 1LVKA 3ETUA 1MIYA 2EHOB 2VKJA 3ZMUB 2LEHA 3NZQA 1O3XA 1UX5A 2X9WA 2Y8DA 1MNEA 4E7SA 5GONE 3QC9A 5LNKA 4I55E 4PJMA 3KINB 4MHCA 2KT9A 3AVRA 3N9QA 1BR2A 4OK0A 4WNKA 4H63V 3FB2A 4MFRA 4AKHA 4QHOA 4C90A 5HAXA 2WAUA 2A2FX 2D5UA 4ISSA 5HXHA 2N1GA 2A72A 4ZS3A 2DWGA 4CI1B 4AI6A 4QXHB 4O8SA 4AQFC 3DP7A 4IGUA 1YD8G 4E7ZA 2LJLA 2M67A 4GOUA 2H7VC 2IC9A 3MZKB 2IC6A 2ZMAA 5HWXA 5LJMA 5LHHB 3LK2B 2L8KA 3ZYKA 4QXCB 2CXFA 3KVBA 2K24A 1E1HB 4AKRB 4WBOA 1QSDA 3TKLB 3GMIA 4BA9A 5JDHA 3RRWA 5JQGE 4G2AA 3HKDE 3LBXA 4ZOLE 3ZPOA 2KMFA 1FMWA 4HFVA 3C64A 3C50A 3HL6A 1D0XA 3Q5WA 5JR9C 5AFUL 4XBFB 2D0TA 2A3DA 4GK5E 5JVDE 3IBPA 4O2AE 4GYSA 2K9AA 4K0UA 4UELA 4OFZA 4YLHA 3E22E 4AKLA 1FIOA 1LKXA 3AVSA 1SA0E 3AA7B 2LT3A 4HGAA 4PK6A 3K3QC 3ZMZB 3MACA 1D1BA 2XTLA 1OXZA 3E0ZA 4NUUA 2NP9A 2J1DG 3JC6C 5JDFA 3KFWX 4JEHB 3PUAA 2NTYA 3CQXC 2BDEA 2IAKA 2IW5B 2LOSA 3IEEA 2VB6A 5HWYA 5JREA 2CXLA 3NBXX 3HR0A 5JDMA 5EK4A 3DTOA 2PBIA 4P09A 3RYCE 4I43B 5CB4E 5L3CB 4DMVA 2CMRA 3C98B 4P0BA 2ODVA 3SWHA 4MLKA 3EDUA 4CZZB 2VKDA 2KLQA 4CXYA 4H9SE 3MK7C 2BVMA 3O1JA 3ONXA 5LGNB 3L3PA 2EHOC 4KP3C 3BQIA 2HH7A 1FEWA 3MXZA 4DBRA 3HI2A 5JDNA 3P8CD 3RRCA 3ZC1A 2PG8A 5DQWA 3N9NA 5FYMA 2BVLA 2V1DB 2WSSV 1UX4A 5L3EB 2JMKA 4QXBB 1V9DA 2V7IA 2Q9QD 4AKGA 1MIWA 1S35A 3L09A 3VHLA 3ZEFB 5CA0E 5J2UE 2UXXB 3Q2MA 4HTEA 1HX8A 5TAOA 3UTKA 3RYFE 3AA6B 4OYKA 3ZMSB 2LSIA 5J2TE 3CKDA 4PK5A 4ZI3C 2VKHA 4ISTA 1BR4A 2JMHA 4AKIA 2V7KA 3PUSA 4F6RC 5KDMC 3P7IA 4X1IE 3M65A 2X51A 2K5BB 4ZS2A 2H7OA 2NW8A 4PJJA 3ZJ2A 5JR9A 3W15B 3LK3B 4ZI2D 5EZYE 2KWIB 4HKAA 4L0RA 5JH7E 2CLYB 3KV4A 4Z8XA 3MKDA 1UCUA 1MMGA 2Q9QB 2ZM0A 3UUMA 5FMNA 4UXNB 4L5GA 2VL8A 4CI2B 2I59A 2LSJA 2V7JA 2XAQB 2LOPA 2XQYA 4OHFA 3I0OA 5DABA 4BJNA 2OA5A 3CWZB 2MBGA 4UF0A 1LVFA 4MALA 2X68A 3GN5B 1G73A 3Q9DA 3F57A 2HPJA 4N78D 1HFAA 2W63A 3FXDB 4ZI7E 5J1GA 4EZ4A 4WW0A 5JDLA 2D0UA 2C5JA 2W00A 3H37A 1ZKEA 4IIJE 3FBLA 3ANWB 1U5PA 2PJQA 1T98A 5HXSA 3C4WA 3CQGB 4EB6E 3DJBA 3K3NA 4O4HE 1VOMA 5JRCA 3IF8B 3KV6A 3S4UA 2C5KT 4J2CA 3Q5XA 2C0SA 2Y48B 3N9MA 5KMGP 4EAHA 5LBMA 4H9PC 4QKNA 2EHOA 3VU7H 4C91A 3EDVA 3VKGA 4BAYB 3OJAA 5JDQA 3O9XA 4QWNB 2ZM8A 2E9XD 4G63A 3BQKA 2CA5A 2B1EA 1LRZA 2L9QA 3PUGA 3BK9A 3PURA 4O4JE 1YKHB 2BZBA 2DCFA 2N9DA 3OKQA 3PDYA 4FI5A 3CPZA 3RYIE 3K3OA 3HA4A 2VWAA 1D0YA 2XAGB 2QA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QA7 A; 
#chains in the Genus database with same CATH topology
 5L3B B;  2K48 A;  4TWH A;  2JPF A;  4UR9 A;  4DR2 T;  2LRK A;  3EUH A;  4TWF A;  2KWH A;  4JEU B;  2K3W A;  5LA6 E;  2LHN A;  3AEA A;  3SS1 A;  4JI1 T;  5IHY A;  4DMW A;  1YKE B;  3JAE A;  3QNU A;  2V7L A;  4XAX B;  4UV8 B;  4OYJ A;  1CHU A;  2XUE A;  3AE2 A;  1T72 A;  3OYZ A;  5KX5 E;  3L8R A;  5ETW A;  4ASK A;  4IE4 A;  4X20 E;  4X1K E;  3UQ7 A;  3RPU A;  4UVA B;  2CWO A;  2WMN A;  5LBQ B;  3VR8 A;  1OED E;  3N9L A;  4WBN E;  4HFC A;  5HCJ A;  2DHR A;  3JCF A;  3T8O A;  2LRL A;  3N5L A;  1MMD A;  2W62 A;  2X9Y A;  3C51 A;  4AXP A;  1SHZ C;  2Y6X A;  3RI5 A;  3ZLI A;  1HCI A;  4X66 T;  3B13 A;  3ZMV B;  3NKZ A;  3FBZ A;  1N34 T;  2UXD T;  4YJ3 E;  4CN6 A;  4ZZB A;  2CE7 A;  4LFC T;  4WZX A;  5HXR A;  2CBI A;  4U74 A;  3RKO A;  5LJN A;  3KV9 A;  3B57 A;  2DI4 A;  1HS7 A;  2XM2 A;  1KNZ A;  1W0A A;  3SOL A;  1UUR A;  2ODU A;  3PUV F;  2CWY A;  3AXJ A;  4JI0 T;  3ETV A;  4DV1 T;  4DND A;  4GK0 E;  3O1H A;  4JLE A;  3X1D A;  1B7T A;  5AQL B;  5ABF A;  5CGM A;  4O2B E;  3OBV E;  3AAE B;  3GWH A;  4DR4 T;  2V5D A;  2WB5 A;  2YN6 A;  5C3J A;  3N2K E;  4CQI A;  2DNX A;  3RQU A;  4IL4 A;  1ZOY A;  3I9W A;  2UXN B;  4UEM A;  1MIV A;  4TV9 E;  1H7C A;  4CXW A;  4ILB A;  5LOV E;  2DWK A;  2WDQ A;  1HX1 B;  3N2O A;  3KV5 A;  1W09 A;  5FP3 A;  4PNI A;  4LMK A;  4TNW A;  1GQE A;  3A7M A;  1WR6 A;  4PK4 A;  2EHO D;  5AQN B;  5FY1 A;  4WYV A;  2SPC A;  4PJL A;  4YXD A;  1IAP A;  4CI3 B;  4YSY A;  2NTX A;  4ZZC A;  2KIN B;  1AJ3 A;  4NXM T;  3PV0 F;  3UU3 A;  3ZMU B;  2LEH A;  3NZQ A;  4B3R T;  2UU9 T;  3QB5 A;  2BS2 A;  2E2A A;  4MHC A;  4DV2 T;  4HFE A;  3AVR A;  4QHO A;  4C90 A;  4Q25 A;  2A2F X;  4ISS A;  2N1G A;  3FZL B;  5ABG A;  4QXH B;  4AQF C;  1YD8 G;  2LJL A;  5ABE A;  5LJM A;  2W67 A;  4JI4 T;  4AKR B;  2BG9 B;  3RHW A;  5JDH A;  3RRW A;  1JNR A;  4G2A A;  2LKG A;  3LBX A;  3ZPO A;  3HL6 A;  1D0X A;  5JR9 C;  2FJE A;  2XQA A;  1ZP0 A;  4XBF B;  2A3D A;  4JI2 T;  3IBP A;  4K0U A;  4OFZ A;  1FIO A;  3AVS A;  1SA0 E;  4PK6 A;  3K3Q C;  1QLB A;  4NUU A;  2J1D G;  1XMO T;  2NTY A;  5HWY A;  2VB6 A;  2D9D A;  1XNR T;  5JDM A;  1Z8U A;  4KI0 F;  5L3C B;  4P0B A;  2VUR A;  4ZEY A;  3AE5 A;  4CZZ B;  4CXY A;  4H9S E;  5FL1 A;  2EHO C;  4KP3 C;  2HH7 A;  5JTG A;  2WSS V;  1UX4 A;  3SFD A;  4A98 A;  4AKG A;  1MIW A;  2WDR A;  1KEY A;  1T7S A;  3ZEF B;  4IL9 A;  3RYF E;  4OYK A;  2WDV A;  3AEG A;  3AEF A;  2VKH A;  2JMH A;  2V7K A;  3PUS A;  5KDM C;  3P7I A;  2H7O A;  2NW8 A;  3ZJ2 A;  3W15 B;  2KWI B;  5JH7 E;  3CK6 A;  2CPT A;  4HWF A;  4DR5 T;  4OX9 T;  4L5G A;  3PJA J;  2XAQ B;  2XQY A;  3I0O A;  3GN5 B;  4N78 D;  3FXD B;  2KSR A;  3Q5E A;  4WW0 A;  4EZ4 A;  2XM1 A;  2FUP A;  2D0U A;  3OPC A;  2W00 A;  4COF A;  3RIU C;  4QH1 A;  3RLF F;  2PTF A;  2Y48 B;  5KMG P;  4DV3 T;  4H9P C;  4QKN A;  4C91 A;  3EDV A;  2A9U A;  1SE7 A;  5JDQ A;  5CJ5 A;  4QWN B;  2E9X D;  1N36 T;  4HWI B;  3BK9 A;  2XQ5 A;  2DCF A;  4IDQ A;  3PDY A;  1OED C;  3EHZ A;  4JBW F;  3ZST A;  1FJG T;  1XDP A;  4KHP T;  4YSZ A;  4EYY R;  3EAB A;  3P4R A;  2WBL A;  2UXB T;  4EZH A;  3U3I A;  3ZN0 B;  1OWA A;  3KVA A;  4I4T E;  4AIU A;  2D2S A;  3H3M A;  3P4P A;  5AQP B;  2WZH A;  4L9I A;  1M7K A;  2UUB T;  5F5W A;  3UFE A;  2N2N A;  2YKS A;  4Z91 A;  2HN2 A;  3LG7 A;  3D0T A;  4QX8 B;  3ZN1 B;  3HKC E;  3ZT7 A;  2L3L A;  2ZM2 A;  4B6X A;  1Z0P A;  4XZC A;  5FVL A;  3L39 A;  4TZ4 C;  4DV4 T;  5AQG B;  3RF1 A;  3LK4 2;  4KBM B;  2VVS A;  4YHH T;  2LE8 A;  2LM2 A;  1US7 B;  2WP9 A;  4EIW A;  3OVU A;  1QUU A;  3FZM B;  3I0Q A;  4HN9 A;  2IIU A;  5FXX A;  4FJO A;  4ADZ A;  5H6Q B;  1D0Z A;  4IE5 A;  5J0Z A;  3AE1 A;  5CA1 E;  3RH3 A;  2NW7 A;  4Z90 A;  4IE7 A;  3LFM A;  4P1N A;  1IZN B;  2X0Y A;  1IJ6 A;  4KUM B;  3ZCI A;  3HKB E;  2JQ9 A;  3T1Y T;  4H9N C;  4NUV A;  2RP4 A;  3R6N A;  1X79 A;  5HEU A;  4IDP A;  4YHJ A;  3FHN A;  5LHG B;  3V5U A;  2E9X C;  1WCR A;  1NAF A;  1WYC A;  5FVK A;  1L0V A;  5IUX A;  2Q9Q A;  1WRD A;  3N9P A;  4P0A A;  1BR1 A;  1HTJ F;  4H63 H;  2YIN A;  2LM9 A;  5LMU T;  5EK2 A;  3WI3 A;  3AE4 A;  1D1A A;  3J9X 1;  3EAM A;  5FXZ A;  4JUY A;  3RQW A;  4TNV A;  3KDS E;  2AE9 A;  4PAG A;  3V5S A;  3Q5D A;  3MA9 A;  3JC6 D;  4QH4 A;  5EK3 A;  2CEA A;  2W61 A;  3AEC A;  3VKH A;  1WFD A;  2VQE T;  5JR9 B;  2V6Y B;  4IE6 A;  3R84 B;  2QRX A;  4TX5 A;  3SFE A;  5LG4 A;  2M6I A;  4IRE A;  3I1A A;  5FY7 A;  3RC8 A;  4HFD A;  5LXT E;  1BR0 A;  2ZM6 T;  3FZH B;  5FXW A;  4AQF A;  3UT5 E;  2ACZ A;  2XJ7 A;  3EVY A;  5LGT B;  5DJQ C;  2V6X A;  3PE0 A;  1ZHC A;  2NW9 A;  1LVK A;  1MIY A;  2EHO B;  2VKJ A;  4U7I A;  3UU8 A;  4JI8 T;  1YXR A;  2BKP A;  2FJB A;  5LNK A;  4I55 E;  4PJM A;  3KIN B;  2HHH T;  2WQY A;  1I94 T;  1XMQ T;  3N9Q A;  4OK0 A;  2V8S V;  3FB2 A;  2HN1 A;  4U3C A;  2D5U A;  2J62 A;  3UU4 A;  4LFB T;  4LF8 T;  2A72 A;  4ZS3 A;  5LG3 A;  4AI6 A;  4DV6 T;  3DP7 A;  4X62 T;  1XNQ T;  2XQ4 A;  2ZMA A;  1R8I A;  5LHH B;  5L4E A;  3LK2 B;  4ZXL A;  2L8K A;  3KVB A;  1E1H B;  5C2T A;  1QSD A;  1HNW T;  2WS3 A;  5JQG E;  2H88 A;  3HKD E;  4ZOL E;  3P50 A;  3P4S A;  4HFV A;  3C50 A;  4YLH A;  2B76 A;  3VRA A;  3MAC A;  1OXZ A;  3E0Z A;  3A8Y C;  3JC6 C;  4JEH B;  2BDE A;  2LOS A;  3IEE A;  5AQU B;  1KNP A;  3NBX X;  3HR0 A;  4JI5 T;  5EK4 A;  1OED B;  4P09 A;  4HWD A;  4I43 B;  3C98 B;  2ODV A;  3EDU A;  2KLQ A;  2BVM A;  5LGN B;  5HEH A;  1FEW A;  3MXZ A;  3HI2 A;  5JDN A;  2AXD S;  3ZC1 A;  3TLT A;  5DQW A;  3N9N A;  5FYM A;  4QXB B;  1V9D A;  2V7I A;  3VHL A;  2UXX B;  4HFH A;  1HX8 A;  5TAO A;  3UTK A;  3AE7 A;  5L4H A;  3CKD A;  4PK5 A;  3AEB A;  4IST A;  3AE6 A;  3M65 A;  2UXC T;  2X51 A;  4PJJ A;  3AE9 A;  4ZI2 D;  4Z8X A;  1UCU A;  3UUM A;  3VR9 A;  1VCS A;  4OHF A;  2LOP A;  4BJN A;  3CWZ B;  1LVF A;  4MAL A;  2X68 A;  3Q9D A;  4U33 A;  2YDR A;  4EGW A;  3ANW B;  1HR0 T;  1N32 T;  2J4G A;  2C0S A;  3CIR A;  3ZKR A;  4BAY B;  1LRZ A;  2L9Q A;  5HEO A;  4O4J E;  1YKH B;  4U2Z A;  5FKY A;  4GKK T;  2QA7 A;  3P4W A;  2OLT A;  3CX8 B;  2P9B A;  4M1P A;  2XAJ B;  1DU2 A;  3NZP A;  4YTM A;  3E08 A;  4KMC A;  2VAS A;  2E9X B;  3WAJ A;  4O4L E;  5L3F B;  3CX6 B;  4DBQ A;  4B3S T;  1MND A;  1HNZ T;  2ACX A;  2BG9 A;  1J5E T;  5H6R B;  3FXE B;  2XZE A;  2MPK A;  2UUC T;  4AQY T;  1KK7 A;  1U4Q A;  3IHR A;  2W66 A;  3AED A;  3RYH E;  5E0O A;  2WY2 A;  3UUN A;  3BQL A;  4DVD A;  2RPA A;  5AQF B;  3OTO T;  4NPP A;  5F8P A;  3AB3 B;  3FZK B;  4ILC A;  3I9Y A;  4KX6 A;  1J5W A;  3K1S A;  2MYS A;  4V1A v;  4HWH A;  2QGS A;  4ZI2 C;  2BBH A;  5L3G B;  1XDO A;  2C5I T;  5L2L A;  2X9H A;  3ZT5 A;  4PFP A;  5LYJ E;  3ZC0 A;  5FXV A;  3ZCJ A;  1HF8 A;  2W2U A;  5LHI B;  3AA1 B;  1YQ3 A;  2UUA T;  3TLS A;  3KBU A;  4A5X A;  2G0U A;  5F3J A;  3NRX A;  3J7Y q;  4U72 A;  3LJC A;  4KHZ F;  3F31 A;  3C4X A;  1HG2 A;  3UU6 A;  2JRK A;  4UVB B;  4YTP A;  2QYW A;  5LCY A;  3HKE E;  2X0H A;  2X0L B;  3C4Z A;  4MBQ A;  3T1H T;  4DID B;  3UU5 A;  2V5C A;  4DR7 T;  3GN5 A;  2X67 A;  3CQC B;  4IDZ A;  3UUX B;  2CXD A;  2YK0 A;  1IJ5 A;  4PW8 A;  4H9O C;  2BKO A;  4CN1 A;  2MTQ A;  3SRZ A;  4TUY E;  5AQM B;  3PTR B;  5AQT B;  3MJX A;  1G8X A;  4UVC B;  3PU8 A;  1W9R A;  4DO0 A;  2W0G A;  2LSK A;  1CUN A;  4ILU A;  5JDG A;  1HG5 A;  2H3R A;  4HEA A;  5M4Y A;  3ABV A;  3PJA A;  2F4V T;  2JIW A;  4DR6 T;  1I6Z A;  4DR1 T;  3QB5 K;  2WM9 A;  4QH5 A;  1NEN A;  2DLR A;  5ADX L;  5AQQ B;  2X9X A;  2MOZ A;  3G06 A;  2OV9 A;  3NRY A;  4UF0 B;  1WLX A;  2M6B A;  2FBW A;  3O4X E;  4LF4 T;  4CXX A;  4HE8 A;  4B3M T;  3ZMT B;  3F2E A;  3QUJ A;  4HWC A;  1Y64 B;  1IBK T;  3KBT A;  1NEK A;  4H9R C;  4I50 E;  1ZV4 X;  5JRC B;  2VKO A;  2XAS B;  5BMV E;  4ZI3 D;  3ETU A;  1UX5 A;  5CFB A;  4E7S A;  2XPK A;  3QC9 A;  1Y01 A;  1JNZ A;  3PUZ F;  4H63 V;  4AKH A;  3PUY F;  2WAU A;  5HXH A;  3JAD A;  2XSB A;  4CI1 B;  4E7Z A;  4ILA A;  3RKG A;  2IC9 A;  4YTN A;  5HWX A;  1YQ4 A;  3ZYK A;  4QXC B;  2WCA A;  2K24 A;  3TKL B;  3GMI A;  4BA9 A;  2CBJ A;  4DUY T;  3C64 A;  4LF6 T;  4NIQ A;  2D0T A;  3M3Z B;  4GK5 E;  1UK5 A;  2YOE A;  3E22 E;  2I6H A;  1E7P A;  3ZMZ B;  2XTL A;  4CN4 A;  4GKJ T;  5JDF A;  4DUZ T;  3LDQ B;  2IAK A;  2IW5 B;  2XY8 B;  5JRE A;  3ONJ A;  4K0K T;  3DTO A;  4U7Y A;  5CB4 E;  3AEE A;  4DMV A;  2CMR A;  3SWH A;  4DV7 T;  4MLK A;  4YY3 T;  5HCM A;  1XZY A;  3L3P A;  3BQI A;  4JI3 T;  2PG8 A;  4EED A;  2BVL A;  2V1D B;  2LLY A;  2Q9Q D;  1S35 A;  3L09 A;  3Q2M A;  3AA6 B;  3UQ4 A;  4ZI3 C;  4F8H A;  3AE3 A;  3ZT6 A;  5BR8 T;  4ZS2 A;  5JR9 A;  2V6Y A;  4LF7 T;  5EZY E;  4HKA A;  4L0R A;  2WWV A;  3MKD A;  5FMN A;  2VL8 A;  2I59 A;  2V7J A;  5DAB A;  2MBG A;  3AXJ B;  3F57 A;  2HPJ A;  1HNX T;  1HFA A;  3RIA A;  2C5J A;  1ZKE A;  4IIJ E;  2H89 A;  3FBL A;  1U5P A;  2PJQ A;  5HXS A;  3DJB A;  2JQK A;  3K3N A;  5ABF B;  4O4H E;  3IF8 B;  3S4U A;  2C5K T;  4I0U A;  3Q5X A;  4IDO A;  1W0B A;  1UUS A;  2QVA A;  3VU7 H;  2EHO A;  3OJA A;  3O9X A;  2E5V A;  2CA5 A;  3BQK A;  2B1E A;  3PUG A;  3B5M A;  2WZI A;  2CHO A;  3PUR A;  3TLU A;  2N9D A;  3OKQ A;  5LB7 B;  4FI5 A;  2XAG B;  3P4Q A;  2WWU A;  2W4X A;  4EXT A;  1YW0 A;  4ERR A;  2ES0 A;  2XQ6 A;  1EZ3 A;  2XAF B;  1ZEE A;  4ZHQ E;  2GK9 A;  4LMJ A;  2MAW A;  5AQS B;  2XQ9 A;  2CHN A;  5FY0 A;  2BG9 E;  2XQ8 A;  2CCQ A;  3ZYM A;  2KND A;  4BJM A;  2NWB A;  3CML A;  1KNR A;  5A1L A;  2YDQ A;  3OYX A;  4YT0 A;  2V7M A;  3RIU A;  2ZLY A;  2CLY C;  2PFV A;  3ZYL A;  2FJA A;  2KZ7 B;  2Q9Q C;  4IHJ E;  4EEB A;  3RGL A;  4EYU A;  2YU2 A;  4TN7 B;  3CX7 B;  2NOX A;  1WYB A;  2E8I A;  3IA3 A;  3RX6 A;  4X1Y E;  5AQH B;  3CVR A;  2IML A;  5C8Y E;  1VCT A;  2R6G F;  4H9Q C;  1MMN A;  1OED A;  3UUL A;  1IBL T;  4GIW A;  3TLV A;  2XAH B;  2YEV C;  2RA1 A;  1IBM T;  4LFA T;  1FMV A;  2X66 A;  3K8P C;  3LBX B;  4ANJ A;  2LKH A;  3FZF B;  3O1I A;  2JJ9 A;  3AAA B;  5L3D B;  4YFS A;  5AQO B;  1NWM X;  3PUX F;  4O4I E;  3U78 A;  3PU3 A;  3A5X A;  1VRB A;  1KFY A;  3AAI A;  3UFG A;  2KXP B;  3N9O A;  2VQF T;  1S94 A;  4X64 T;  4PFO A;  5AQI B;  5FNV E;  5HYA A;  4GYR A;  2IDO B;  4EV6 A;  2VVN A;  5HEJ A;  3QK6 A;  3TLW A;  4TV8 E;  3N2G E;  5IWA T;  1J1J A;  2CM0 A;  5L47 A;  5AQR B;  5LMN T;  3ANW A;  4LF5 T;  1UGO A;  2IHR 1;  5IYZ E;  4DV5 T;  2HPL A;  2LHR A;  4YJ2 E;  3ONL C;  4HFB A;  2JQQ A;  2YU1 A;  3WAK A;  3NVO A;  5LGU B;  1KF6 A;  1D1C A;  4UIG A;  2LSG A;  4IE0 A;  5ABH A;  2Z6E A;  5HXC A;  3AA0 B;  2J47 A;  3ZJ1 A;  4NXN T;  5LP6 E;  5HXE A;  5DQV A;  2VK9 A;  3ESL A;  4A56 A;  2E9X A;  4JV5 T;  1M62 A;  4HFI A;  2XHE B;  4TWD A;  4UV9 B;  3GA8 A;  4EOZ B;  4YSX A;  4PJN A;  1XWM A;  2V26 A;  1MMA A;  3PUQ A;  3RC3 A;  2WMO A;  4AQG A;  2CRB A;  2LSY A;  4QX7 B;  3H3A A;  3JAF A;  2BS4 A;  1O3X A;  2X9W A;  2Y8D A;  4A97 A;  1MNE A;  5GON E;  4DR3 T;  3VRB A;  3AE8 A;  3PUW F;  2KT9 A;  2IUB A;  1BR2 A;  4WNK A;  4MFR A;  5HAX A;  3UUB A;  4LF9 T;  2DWG A;  4O8S A;  4IGU A;  2BS3 A;  2E5L T;  2M67 A;  4GOU A;  4JI6 T;  2H7V C;  3MZK B;  2IC6 A;  1X9B A;  2CXF A;  1E2A A;  2VL0 A;  4X65 T;  4WBO A;  2KMF A;  5AQV B;  1FMW A;  2WU2 A;  3Q5W A;  5HEG A;  5AFU L;  5JVD E;  4IT4 A;  1SUM B;  4O2A E;  4GYS A;  2K9A A;  4X5T A;  4UEL A;  4AKL A;  1LKX A;  2NR4 A;  3AA7 B;  2LT3 A;  4HGA A;  1D1B A;  3NWI A;  4U31 A;  2NP9 A;  3KFW X;  3PUA A;  1WR0 A;  2BBJ A;  3CQX C;  2CXL A;  2DL1 A;  2FJD A;  5FL0 A;  2PBI A;  3ZSS A;  4B3T T;  3RYC E;  5AQJ B;  4JYA T;  2VKD A;  2XQ7 A;  3QOF A;  3MK7 C;  3O1J A;  3ONX A;  4DBR A;  3P8C D;  3RRC A;  5L3E B;  2JMK A;  4IDN A;  5CA0 E;  5J2U E;  4HTE A;  2I0M A;  3ZMS B;  2LSI A;  5J2T E;  2JQH A;  1BR4 A;  5AQK B;  4AKI A;  4F6R C;  4X1I E;  2BKN A;  2K5B B;  3LK3 B;  2CLY B;  3KV4 A;  2XQ3 A;  1MMG A;  2Q9Q B;  2ZM0 A;  4UXN B;  4CI2 B;  2YDS A;  2LSJ A;  3EI0 A;  2OA5 A;  4UF0 A;  1G73 A;  2BG9 C;  2WU5 A;  2W63 A;  4ZI7 E;  3LSV A;  5J1G A;  5JDL A;  3H37 A;  4LML A;  4AIS A;  1T98 A;  3C4W A;  3CQG B;  4EB6 E;  1VOM A;  5JRC A;  3KV6 A;  3RIF A;  4J2C A;  1N33 T;  3N9M A;  4JI7 T;  4EAH A;  5KXJ A;  5LBM A;  3VKG A;  2XSA A;  2ZM8 A;  4G63 A;  4U2Y A;  2BZB A;  4DV0 T;  3CPZ A;  3RYI E;  3K3O A;  1T8B A;  3HA4 A;  2VWA A;  1D0Y A; 
#chains in the Genus database with same CATH homology
 4EYY R;  2WWU A;  5L3B B;  2K48 A;  4EXT A;  3CX8 B;  2P9B A;  4M1P A;  1YW0 A;  4ERR A;  2JPF A;  2ES0 A;  2XAJ B;  1EZ3 A;  3NZP A;  2XAF B;  2WBL A;  3E08 A;  4KMC A;  3EUH A;  2VAS A;  1ZEE A;  2E9X B;  3WAJ A;  2KWH A;  4JEU B;  4ZHQ E;  2GK9 A;  4EZH A;  5LA6 E;  2LHN A;  3U3I A;  3ZN0 B;  4O4L E;  5L3F B;  3SS1 A;  3CX6 B;  1OWA A;  4DBQ A;  3KVA A;  5FY0 A;  5IHY A;  1MND A;  4I4T E;  2CCQ A;  2D2S A;  4DMW A;  1YKE B;  3ZYM A;  2KND A;  2ACX A;  2V7L A;  2NWB A;  4BJM A;  3CML A;  5H6R B;  3FXE B;  4L9I A;  4XAX B;  3UFE A;  5A1L A;  2N2N A;  3OYX A;  2V7M A;  4UV8 B;  1KK7 A;  4OYJ A;  3LG7 A;  2ZLY A;  2XUE A;  1U4Q A;  3IHR A;  2CLY C;  2PFV A;  5E0O A;  3RYH E;  3ZYL A;  2KZ7 B;  3D0T A;  3UUN A;  4QX8 B;  3ZN1 B;  3OYZ A;  3HKC E;  2Q9Q C;  2L3L A;  3BQL A;  4IHJ E;  4DVD A;  5KX5 E;  4EYU A;  2YU2 A;  2ZM2 A;  4TN7 B;  3CX7 B;  5ETW A;  4B6X A;  1Z0P A;  4XZC A;  4ASK A;  4IE4 A;  5F8P A;  4X20 E;  3AB3 B;  4TZ4 C;  3I9Y A;  4X1K E;  2NOX A;  3RPU A;  3LK4 2;  4UVA B;  1WYB A;  2E8I A;  4KBM B;  2CWO A;  2WMN A;  3RX6 A;  2MYS A;  4V1A v;  4X1Y E;  5LBQ B;  2LE8 A;  1US7 B;  3N9L A;  4WBN E;  3CVR A;  2QGS A;  4EIW A;  5C8Y E;  4ZI2 C;  5L3G B;  4H9Q C;  2C5I T;  1MMN A;  5L2L A;  1QUU A;  2DHR A;  3T8O A;  2X9H A;  4PFP A;  3UUL A;  3I0Q A;  4HN9 A;  4GIW A;  5LYJ E;  5FXX A;  3ZC0 A;  3N5L A;  4FJO A;  1MMD A;  5FXV A;  2W62 A;  2XAH B;  2X9Y A;  3C51 A;  3ZCJ A;  1HF8 A;  4ADZ A;  2YEV C;  5LHI B;  3AA1 B;  5H6Q B;  1D0Z A;  1SHZ C;  4AXP A;  4IE5 A;  2RA1 A;  3KBU A;  5F3J A;  2G0U A;  5CA1 E;  3NRX A;  3RH3 A;  2Y6X A;  2NW7 A;  1FMV A;  2X66 A;  4IE7 A;  3LFM A;  1IZN B;  3ZLI A;  3J7Y q;  1HCI A;  3K8P C;  1IJ6 A;  3B13 A;  3LBX B;  4U72 A;  3ZMV B;  4ANJ A;  4KUM B;  3ZCI A;  3LJC A;  3FBZ A;  3F31 A;  3O1I A;  2JJ9 A;  3AAA B;  3HKB E;  3C4X A;  1HG2 A;  5L3D B;  4YJ3 E;  4H9N C;  4YFS A;  2JRK A;  2CE7 A;  4UVB B;  1NWM X;  4NUV A;  2RP4 A;  4O4I E;  3U78 A;  5LCY A;  3R6N A;  3PU3 A;  1X79 A;  3A5X A;  4YHJ A;  1VRB A;  3AAI A;  3FHN A;  5HXR A;  5LHG B;  3HKE E;  2KXP B;  4U74 A;  3RKO A;  3N9O A;  3V5U A;  2E9X C;  2X0L B;  5LJN A;  1S94 A;  3KV9 A;  4PFO A;  5FNV E;  5HYA A;  4GYR A;  3B57 A;  2DI4 A;  1HS7 A;  1NAF A;  1WYC A;  3C4Z A;  2Q9Q A;  4MBQ A;  1KNZ A;  1WRD A;  3SOL A;  3QK6 A;  3N9P A;  2ODU A;  4P0A A;  2CWY A;  4TV8 E;  3GN5 A;  1BR1 A;  3N2G E;  2X67 A;  3CQC B;  4IDZ A;  1HTJ F;  4H63 H;  2YIN A;  3ETV A;  2CM0 A;  3UUX B;  2LM9 A;  2CXD A;  2YK0 A;  1IJ5 A;  4DND A;  5EK2 A;  4PW8 A;  4GK0 E;  3O1H A;  4H9O C;  4JLE A;  3WI3 A;  1D1A A;  3ANW A;  1B7T A;  3J9X 1;  2MTQ A;  3SRZ A;  4O2B E;  3OBV E;  4TUY E;  5FXZ A;  3AAE B;  3GWH A;  3PTR B;  5IYZ E;  4JUY A;  3MJX A;  2HPL A;  3N2K E;  1G8X A;  2DNX A;  2LHR A;  3KDS E;  4CQI A;  4YJ2 E;  4PAG A;  4UVC B;  3PU8 A;  3V5S A;  4DO0 A;  3MA9 A;  2W0G A;  2LSK A;  3I9W A;  2UXN B;  3JC6 D;  1CUN A;  4UEM A;  1MIV A;  4ILU A;  2JQQ A;  5JDG A;  4TV9 E;  1H7C A;  1HG5 A;  2YU1 A;  5EK3 A;  3WAK A;  5LGU B;  2CEA A;  1D1C A;  2H3R A;  2W61 A;  4HEA A;  4UIG A;  4CXW A;  5M4Y A;  3VKH A;  2LSG A;  4IE0 A;  2Z6E A;  5LOV E;  5JR9 B;  4IE6 A;  3R84 B;  2DWK A;  3AA0 B;  5HXC A;  4TX5 A;  2WM9 A;  5LG4 A;  3N2O A;  2DLR A;  3KV5 A;  3ZJ1 A;  5ADX L;  5LP6 E;  2X9X A;  2MOZ A;  5FP3 A;  4PNI A;  5HXE A;  3I1A A;  5FY7 A;  5DQV A;  3NRY A;  2VK9 A;  3RC8 A;  4UF0 B;  1WLX A;  3ESL A;  4PK4 A;  1WR6 A;  4A56 A;  2EHO D;  5LXT E;  1BR0 A;  2E9X A;  3O4X E;  5FY1 A;  2SPC A;  4CXX A;  5FXW A;  2XHE B;  4AQF A;  4HE8 A;  4UV9 B;  4PJL A;  3GA8 A;  1IAP A;  3ZMT B;  4EOZ B;  3F2E A;  3QUJ A;  3UT5 E;  1Y64 B;  3EVY A;  5LGT B;  5DJQ C;  4PJN A;  3KBT A;  4H9R C;  4I50 E;  4CI3 B;  1ZV4 X;  2V26 A;  1MMA A;  5JRC B;  3PUQ A;  2VKO A;  2WMO A;  3RC3 A;  3PE0 A;  1ZHC A;  2XAS B;  4AQG A;  5BMV E;  2NTX A;  2NW9 A;  4ZI3 D;  2KIN B;  2LSY A;  4QX7 B;  1AJ3 A;  3H3A A;  1LVK A;  3ETU A;  1MIY A;  2EHO B;  2VKJ A;  3ZMU B;  2LEH A;  3NZQ A;  1O3X A;  1UX5 A;  2X9W A;  2Y8D A;  1MNE A;  4E7S A;  5GON E;  3QC9 A;  5LNK A;  4I55 E;  4PJM A;  3KIN B;  4MHC A;  2KT9 A;  3AVR A;  3N9Q A;  1BR2 A;  4OK0 A;  4WNK A;  4H63 V;  3FB2 A;  4MFR A;  4AKH A;  4QHO A;  4C90 A;  5HAX A;  2WAU A;  2A2F X;  2D5U A;  4ISS A;  5HXH A;  2N1G A;  2A72 A;  4ZS3 A;  2DWG A;  4CI1 B;  4AI6 A;  4QXH B;  4O8S A;  4AQF C;  3DP7 A;  4IGU A;  1YD8 G;  4E7Z A;  2LJL A;  2M67 A;  4GOU A;  2H7V C;  2IC9 A;  3MZK B;  2IC6 A;  2ZMA A;  5HWX A;  5LJM A;  5LHH B;  3LK2 B;  2L8K A;  3ZYK A;  4QXC B;  2CXF A;  3KVB A;  2K24 A;  1E1H B;  4AKR B;  4WBO A;  1QSD A;  3TKL B;  3GMI A;  4BA9 A;  5JDH A;  3RRW A;  5JQG E;  4G2A A;  3HKD E;  3LBX A;  4ZOL E;  3ZPO A;  2KMF A;  1FMW A;  4HFV A;  3C64 A;  3C50 A;  3HL6 A;  1D0X A;  3Q5W A;  5JR9 C;  5AFU L;  4XBF B;  2D0T A;  2A3D A;  4GK5 E;  5JVD E;  3IBP A;  4O2A E;  4GYS A;  2K9A A;  4K0U A;  4UEL A;  4OFZ A;  4YLH A;  3E22 E;  4AKL A;  1FIO A;  1LKX A;  3AVS A;  1SA0 E;  3AA7 B;  2LT3 A;  4HGA A;  4PK6 A;  3K3Q C;  3ZMZ B;  3MAC A;  1D1B A;  2XTL A;  1OXZ A;  3E0Z A;  4NUU A;  2NP9 A;  2J1D G;  3JC6 C;  5JDF A;  3KFW X;  4JEH B;  3PUA A;  2NTY A;  3CQX C;  2BDE A;  2IAK A;  2IW5 B;  2LOS A;  3IEE A;  2VB6 A;  5HWY A;  5JRE A;  2CXL A;  3NBX X;  3HR0 A;  5JDM A;  5EK4 A;  3DTO A;  2PBI A;  4P09 A;  3RYC E;  4I43 B;  5CB4 E;  5L3C B;  4DMV A;  2CMR A;  3C98 B;  4P0B A;  2ODV A;  3SWH A;  4MLK A;  3EDU A;  4CZZ B;  2VKD A;  2KLQ A;  4CXY A;  4H9S E;  3MK7 C;  2BVM A;  3O1J A;  3ONX A;  5LGN B;  3L3P A;  2EHO C;  4KP3 C;  3BQI A;  2HH7 A;  1FEW A;  3MXZ A;  4DBR A;  3HI2 A;  5JDN A;  3P8C D;  3RRC A;  3ZC1 A;  2PG8 A;  5DQW A;  3N9N A;  5FYM A;  2BVL A;  2V1D B;  2WSS V;  1UX4 A;  5L3E B;  2JMK A;  4QXB B;  1V9D A;  2V7I A;  2Q9Q D;  4AKG A;  1MIW A;  1S35 A;  3L09 A;  3VHL A;  3ZEF B;  5CA0 E;  5J2U E;  2UXX B;  3Q2M A;  4HTE A;  1HX8 A;  5TAO A;  3UTK A;  3RYF E;  3AA6 B;  4OYK A;  3ZMS B;  2LSI A;  5J2T E;  3CKD A;  4PK5 A;  4ZI3 C;  2VKH A;  4IST A;  1BR4 A;  2JMH A;  4AKI A;  2V7K A;  3PUS A;  4F6R C;  5KDM C;  3P7I A;  4X1I E;  3M65 A;  2X51 A;  2K5B B;  4ZS2 A;  2H7O A;  2NW8 A;  4PJJ A;  3ZJ2 A;  5JR9 A;  3W15 B;  3LK3 B;  4ZI2 D;  5EZY E;  2KWI B;  4HKA A;  4L0R A;  5JH7 E;  2CLY B;  3KV4 A;  4Z8X A;  3MKD A;  1UCU A;  1MMG A;  2Q9Q B;  2ZM0 A;  3UUM A;  5FMN A;  4UXN B;  4L5G A;  2VL8 A;  4CI2 B;  2I59 A;  2LSJ A;  2V7J A;  2XAQ B;  2LOP A;  2XQY A;  4OHF A;  3I0O A;  5DAB A;  4BJN A;  2OA5 A;  3CWZ B;  2MBG A;  4UF0 A;  1LVF A;  4MAL A;  2X68 A;  3GN5 B;  1G73 A;  3Q9D A;  3F57 A;  2HPJ A;  4N78 D;  1HFA A;  2W63 A;  3FXD B;  4ZI7 E;  5J1G A;  4EZ4 A;  4WW0 A;  5JDL A;  2D0U A;  2C5J A;  2W00 A;  3H37 A;  1ZKE A;  4IIJ E;  3FBL A;  3ANW B;  1U5P A;  2PJQ A;  1T98 A;  5HXS A;  3C4W A;  3CQG B;  4EB6 E;  3DJB A;  3K3N A;  4O4H E;  1VOM A;  5JRC A;  3IF8 B;  3KV6 A;  3S4U A;  2C5K T;  4J2C A;  3Q5X A;  2C0S A;  2Y48 B;  3N9M A;  5KMG P;  4EAH A;  5LBM A;  4H9P C;  4QKN A;  2EHO A;  3VU7 H;  4C91 A;  3EDV A;  3VKG A;  4BAY B;  3OJA A;  5JDQ A;  3O9X A;  4QWN B;  2ZM8 A;  2E9X D;  4G63 A;  3BQK A;  2CA5 A;  2B1E A;  1LRZ A;  2L9Q A;  3PUG A;  3BK9 A;  3PUR A;  4O4J E;  1YKH B;  2BZB A;  2DCF A;  2N9D A;  3OKQ A;  3PDY A;  4FI5 A;  3CPZ A;  3RYI E;  3K3O A;  3HA4 A;  2VWA A;  1D0Y A;  2XAG B;  2QA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...