3HI2A

Structure of the n-terminal domain of the e. coli antitoxin mqsa (ygit/b3021) in complex with the e. coli toxin mqsr (ygiu/b3022)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
70
structure length
70
Chain Sequence
b'MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator mqsA(ygiT)
molecule tags Dna binding protein/toxin
source organism Escherichia coli k-12
publication title Three dimensional structure of the MqsR:MqsA complex: a novel TA pair comprised of a toxin homologous to RelE and an antitoxin with unique properties.
pubmed doi rcsb
total genus 14
structure length 70
sequence length 70
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.720 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3hi2A00
3GN5A 3O9XA 3GN5B 3GA8A 3HI2A
chains in the Genus database with same CATH superfamily
3UTKA 2V6YA 3AE5A 3MACA 4ZOLE 3EDUA 5HXCA 4CXXA 5JDHA 2E8IA 4WYVA 3G06A 4IL9A 4QXHB 1DU2A 1R8IA 2CEAA 3AA7B 2VVSA 5HXHA 3B5MA 5LMNT 1HS7A 3OJAA 2CA5A 2VK9A 2Y8DA 2MBGA 1XDOA 4N78D 2MYSA 2XM2A 2NW7A 3C64A 2JIWA 2LSYA 3CVRA 4O4LE 3RQUA 3L09A 5LP6E 2M6IA 2YDRA 2YN6A 3P4PA 4ZI2C 5BMVE 4HFBA 3AE1A 4YXDA 5LGTB 3VKHA 2UUCT 2DWKA 1HFAA 2L9QA 3LK2B 4A56A 5J0ZA 5HEGA 5LCYA 3RC8A 2W0GA 4UR9A 4LF5T 1WR6A 1QLBA 3EI0A 4DUYT 2CXLA 1JNRA 2E5LT 1BR4A 3O4XE 4UXNB 5CB4E 3UU3A 2C0SA 3M65A 3L3PA 4X1YE 4OFZA 2VKDA 3H3AA 5LB7B 3R6NA 1BR1A 2LSJA 2BS2A 1WLXA 3BQIA 3HKEE 2CBIA 2VASA 2PTFA 4Z91A 3EDVA 3QOFA 2Q9QA 2XSAA 1L0VA 2NW9A 4K0KT 5FY1A 4U33A 4AQGA 5CA0E 4U2YA 3RKOA 1HR0T 5IUXA 5HEUA 4HN9A 4JI2T 2EHOB 4IDPA 4OHFA 2IAKA 2SPCA 3JC6C 3X1DA 2RPAA 4DMWA 4EB6E 4I4TE 5LJNA 3GN5A 5ABEA 3VHLA 1T8BA 3FZHB 4KP3C 3RH3A 4QHOA 2LE8A 2HN1A 4LMLA 4TX5A 4U7IA 2NR4A 4MLKA 4KHPT 2CHOA 3BQKA 3LBXA 4U2ZA 2I59A 4LMKA 3C4WA 3O9XA 1KNPA 4EXTA 3J7Yq 2UUBT 2NP9A 1T98A 3N2OA 3O1JA 4B3RT 4ZS2A 3ZYKA 1MIVA 2W4XA 5AQRB 3LK42 5LHHB 3HI2A 3LK3B 3UU5A 5LBMA 2QYWA 4JI5T 1WR0A 1IBLT 3AA1B 2YDQA 3IEEA 2H7VC 4ILCA 4A97A 5HEJA 4O4HE 1ZKEA 3P50A 3SFDA 1EZ3A 1E2AA 1MMAA 5AQPB 4C90A 1Z8UA 4MHCA 4JI4T 1HG2A 4COFA 2XQ4A 3ZYLA 1D0YA 3N9LA 4I55E 2PG8A 3PU3A 4LF8T 4QWNB 3AVSA 3DP7A 3FBLA 4F8HA 1V9DA 2A9UA 2V1DB 4PFPA 3UT5E 4MALA 4DO0A 4IE7A 4KMCA 2LT3A 4Z90A 5HEOA 2V8SV 3A5XA 2X0HA 1OEDE 5LBQB 3PUQA 4CXWA 3P4QA 3P4RA 3PUAA 3TLWA 3O1HA 2WDVA 2VL8A 3LJCA 2W2UA 2DNXA 4TV8E 1OEDB 5AQTB 3RF1A 3RYIE 4YHHT 4DV1T 4B3MT 4ZI2D 2LM2A 4P1NA 4ERRA 3AB3B 1KEYA 2X9HA 2OV9A 2K24A 4GIWA 3U3IA 2KNDA 3CWZB 4NUUA 4Q25A 3RKGA 1FJGT 1HX1B 2A2FX 2UXNB 2FUPA 3ZC0A 3RX6A 4IT4A 5BR8T 1LVFA 2JJ9A 3QB5K 4DR7T 3AE4A 3ZCJA 2DHRA 1IZNB 1U4QA 5DABA 3E0ZA 4HEAA 5LA6E 3R84B 3ZMVB 4EEBA 4L0RA 3LDQB 4BA9A 5HXEA 3WAJA 4UVBB 2CXDA 4DV6T 2C5KT 2I0MA 2WU2A 3N2GE 5HYAA 3ANWB 3Q2MA 2D0UA 1WRDA 3P8CD 2Z6EA 2Y48B 1N36T 5KDMC 4M1PA 2E2AA 2I6HA 3OKQA 3OYXA 1MNEA 2ES0A 1SE7A 4WW0A 5ABGA 1LRZA 3AECA 1VRBA 3CMLA 4I50E 1MMNA 2XAFB 5AQLB 3CX7B 2K5BB 3W15B 1D1BA 3RYFE 4OYJA 1FMWA 4O4JE 3RIAA 4GKJT 5CFBA 1ZOYA 2VVNA 3RLFF 2RA1A 5L4HA 3ZEFB 4IDZA 3T8OA 1HTJF 4PK4A 5L3EB 4DBRA 2HPLA 4X1IE 2Q9QD 2WSSV 4TNVA 3PURA 4DV7T 4V1Av 2KMFA 4ANJA 4JI3T 3VR9A 4O8SA 4TN7B 5EZYE 2W63A 3E22E 2J47A 4EIWA 1HF8A 1ZHCA 3KVAA 4DV5T 2XQ3A 2BG9B 3F31A 3N2KE 2KLQA 3C98B 1VCTA 3C51A 3ONLC 3EHZA 3P7IA 5LOVE 1UK5A 3MZKB 5JQGE 4HTEA 5EK4A 5GONE 3BK9A 4IDOA 4YFSA 3U78A 2YEVC 2GK9A 3B13A 1N34T 2UUAT 1US7B 2XQ6A 2UXBT 4PK5A 5LHGB 3CIRA 4DR6T 5ADXL 2EHOC 2W62A 1J5WA 2V7IA 3KINB 4JUYA 4DUZT 3EABA 5HEHA 2XQ7A 4LFCT 4IDQA 5JDGA 4YTPA 5FKYA 3CX6B 3VRBA 4FJOA 1YQ4A 3UUMA 2DI4A 2E9XD 5FP3A 1IJ5A 2XQYA 4YTMA 4LFAT 1J1JA 5L47A 3ZSTA 4UELA 2AXDS 3ZJ1A 4HWCA 2BVMA 2LSIA 1CHUA 3KBUA 4H9SE 2WM9A 3SS1A 3ZSSA 2XSBA 3KV4A 3LBXB 2XAHB 4QH5A 1I94T 1AJ3A 4AKGA 5FY0A 3IF8B 1HNWT 1WCRA 1UUSA 5ABFB 4IIJE 2DWGA 4DMVA 2CHNA 4ZI3C 2UXXB 1ZEEA 2VKHA 3AEDA 3HA4A 4YHJA 5IYZE 3JCFA 5JDQA 4OX9T 1QSDA 5C3JA 3O1IA 2EHOA 4H9PC 4KHZF 2IIUA 4QKNA 4X5TA 4PFOA 1FMVA 5FXWA 3RHWA 3SRZA 4CN1A 2YDSA 5ETWA 4B3TT 1MIWA 3C4XA 4OK0A 4ASKA 1M7KA 4UIGA 4QH1A 4YTNA 3AAEB 4CN6A 2HH7A 4UF0A 2WB5A 1I6ZA 4NIQA 4EGWA 1UX4A 4H9RC 2L8KA 2CPTA 5LXTE 1W09A 2X66A 4PJNA 4CI1B 2BKNA 4EOZB 2WP9A 1XZYA 3K3OA 3FHNA 2F4VT 1E1HB 2OLTA 3CPZA 2V7MA 3I9YA 3MXZA 4NPPA 3FZLB 4YJ3E 3SFEA 3TKLB 1NENA 2B1EA 3OPCA 2MPKA 2NWBA 3RRCA 1LVKA 4IE6A 5FY7A 4B6XA 4DR1T 2ODUA 3ZT5A 2LLYA 3PUXF 4O2BE 1T7SA 3L39A 4LMJA 3ZT6A 3ZMSB 4EEDA 2XQ9A 1Y64B 4IGUA 4TNWA 3RI5A 3B57A 4KI0F 2W00A 4G63A 3C50A 3RPUA 2XAQB 4XAXB 3PJAJ 2X0LB 3TLVA 1MMGA 1XNRT 3QUJA 4JI6T 2V7KA 3NBXX 3AXJB 4AKLA 4EYYR 1QUUA 1N33T 4H63V 1BR0A 3NRYA 3V5UA 4YT0A 3UUNA 3UU8A 5LG4A 2CWYA 2CLYC 4QXBB 3MKDA 3QNUA 4UEMA 3IHRA 4PW8A 2D2SA 3GA8A 5F8PA 4X62T 2OA5A 4X66T 4ILBA 2CE7A 4KBMB 3Q9DA 4ZEYA 4DR2T 3FZMB 2KWIB 5L3GB 4GYSA 3FXDB 2WMNA 3ONXA 5EK3A 4CI3B 4DR3T 1OXZA 2G0UA 2CMRA 2JPFA 3RIUC 2YKSA 2ZMAA 4ADZA 4EAHA 5EK2A 4X64T 2V5DA 2BG9E 4PK6A 1Y01A 3K3NA 2VQET 1XDPA 1NWMX 4DV3T 2IUBA 1B7TA 3Q5DA 1SHZC 2YU2A 4H9NC 4LFBT 1ZV4X 1IJ6A 2LRKA 2E9XA 3AE7A 3JAEA 4NUVA 3AEEA 5A1LA 2XASB 4JI1T 2FJAA 4GK0E 2D5UA 5LJMA 5LGNB 5AFUL 2IC6A 1MNDA 3AXJA 2JQHA 4PJJA 5AQUB 3IA3A 1IBMT 3AAIA 4JLEA 2QVAA 4IE4A 2ZLYA 2CWOA 4CI2B 4HFHA 5H6RB 3AEAA 4YSYA 4DIDB 2ZM0A 2QRXA 2MTQA 1KF6A 2XZEA 3TLUA 4BJNA 3ETUA 5CJ5A 5J2UE 3P4WA 2EHOD 2CRBA 4C91A 2BG9A 2VL0A 3SOLA 4HWHA 2DL1A 3ZN1B 5FL1A 1XNQT 4JV5T 3PUWF 4OYKA 3WAKA 3ZYMA 5ABFA 4X20E 5HXSA 4DV4T 1HNXT 5HWXA 3ZT7A 2UU9T 1WFDA 4KUMB 4QH4A 4AISA 2XY8B 3A7MA 3F57A 3I9WA 2KT9A 4QX8B 1OEDA 4CN4A 4EZHA 3NZPA 4X1KE 3AE6A 1KNZA 1VCSA 2HN2A 2ODVA 5FL0A 5HAXA 5L3FB 1LKXA 2AE9A 4L5GA 4AI6A 4WBNE 4HGAA 1N32T 2IHR1 4TUYE 4U3CA 5L2LA 1IBKT 3ZPOA 2HHHT 4JYAT 2VURA 1ZP0A 3CQCB 3JAFA 3UU4A 4HFEA 3PJAA 4ZI3D 5TAOA 3PDYA 1KNRA 2Q9QB 4P0BA 3KVBA 3ZKRA 5JR9B 4JI7T 2KWHA 4HFIA 2LHNA 3UULA 3AEGA 4H63H 2WCAA 5J2TE 3AEBA 5L3CB 2XQAA 3PUVF 1UURA 2JMKA 3ZN0B 1U5PA 2ACZA 3KBTA 4L9IA 2LSKA 1YKEB 3AA6B 3F2EA 2NTXA 2XM1A 3C4ZA 3I0OA 2NTYA 3K1SA 2V5CA 3AE3A 2FJDA 1YW0A 4PNIA 1XMOT 3NKZA 3N5LA 2WWVA 3VR8A 2A3DA 4HFVA 3ZLIA 2YU1A 2M6BA 4HE8A 3LG7A 4HWDA 5AQIB 2WZIA 5AQOB 5IHYA 2FJEA 3NVOA 1YQ3A 4EYUA 5LHIB 3NWIA 1KK7A 4A5XA 4MFRA 4DV2T 2CBJA 4UV9B 5JR9C 2RP4A 2Q9QC 2X67A 2YK0A 1H7CA 3FBZA 1O3XA 2BDEA 3E08A 3H37A 3I1AA 3M3ZB 3MA9A 5FVLA 5FYMA 1HG5A 2M67A 5AQSB 2UXCT 2FJBA 4TV9E 4LF4T 4AKIA 2J62A 2ACXA 4QXCB 4UVAB 2PJQA 3QK6A 1NEKA 4TZ4C 5HCJA 3KFWX 3TLSA 3ESLA 3TLTA 4H9QC 5F3JA 2WMOA 4DV0T 3FZFB 3Q5WA 4ISTA 3FXEB 4IL4A 3VRAA 3HKCE 3LSVA 2A72A 2WU5A 1SA0E 3QB5A 4UVCB 5L4EA 4DBQA 1X79A 5JREA 4U72A 2B76A 4YLHA 3FZKB 2D0TA 2V7LA 3RC3A 1T72A 4CZZB 4PJMA 3AE9A 3CQXC 5LG3A 3RYHE 1UCUA 4JBWF 3ZC1A 4JEHB 2CLYB 5AQKB 1IAPA 3AAAB 3EUHA 4ILAA 3UFEA 2LKGA 2WQYA 5JTGA 3A8YC 1G8XA 3CKDA 3KV5A 5FXZA 2H3RA 2XAGB 3RYCE 4HWFA 4LF6T 1YD8G 3KV6A 2C5IT 2NW8A 3EVYA 4HFCA 2LEHA 5FVKA 2X9YA 3UFGA 5AQMB 3CK6A 3UQ7A 2XHEB 3WI3A 2J4GA 3HKDE 4DNDA 4CXYA 4U31A 1NAFA 4G2AA 5M4YA 4ZXLA 4IHJE 4XBFB 2W61A 2DCFA 4PJLA 5ABHA 3RIFA 1J5ET 4ZZCA 2LSGA 5FXXA 2ZM8A 2E5VA 3UQ4A 5LGUB 3L8RA 3BQLA 1UGOA 3D0TA 3PUZF 5DQVA 5HXRA 3UUBA 4BJMA 4F6RC 2CM0A 3ZMZB 2XQ8A 5C8YE 2MAWA 3N9OA 5L3DB 3OTOT 1WYBA 3PU8A 1HNZT 1FEWA 4NXNT 1E7PA 5JR9A 2YOEA 2ZM2A 2WZHA 4WNKA 3PUSA 3ZJ2A 5LMUT 2JRKA 4AQFC 2DLRA 3IBPA 1XMQT 3JC6D 4P0AA 1D1CA 1MIYA 3MK7C 2XPKA 3H3MA 2P9BA 1WYCA 5AQGB 4AKRB 4DVDA 2MOZA 3AA0B 3HKBE 2JQ9A 5JH7E 4JI0T 2IDOB 3NZQA 1SUMB 3GN5B 3KDSE 5FMNA 3ZCIA 5KX5E 2VKOA 4ZI7E 3OVUA 1Z0PA 2VB6A 3QC9A 2CCQA 4E7ZA 1W9RA 5JRCB 4TWDA 1BR2A 2FBWA 4WZXA 2N1GA 1S35A 2V6YB 4O4IE 4LF9T 5AQVB 2IC9A 5LYJE 4U7YA 2LOPA 2VQFT 1UX5A 3AE2A 2ZM6T 3AVRA 3DJBA 4H9OC 2Y6XA 5AQNB 4AXPA 4IDNA 2LJLA 3K3QC 3KV9A 2JQKA 1X9BA 3ANWA 2X68A 2D9DA 1YKHB 4YSXA 3K8PC 5C2TA 4KX6A 3N9MA 5AQFB 4YSZA 1HX8A 2BZBA 2X9WA 4QX7B 2XJ7A 4Z8XA 3AE8A 4CQIA 5CGMA 4GKKT 3Q5XA 5JRCA 4NXMT 2WDRA 4YY3T 4X65T 4AQYT 1W0BA 3PE0A 4ISSA 1D0ZA 3PTRB 4J2CA 2LM9A 3PUGA 3ONJA 4HFDA 5AQQB 2J1DG 3VU7H 2W66A 2V26A 2XAJB 2HPJA 3ZMUB 5CA1E 2IMLA 4DR5T 2LOSA 3T1YT 3FB2A 5F5WA 5FNVE 4B3ST 3RRWA 3GWHA 5LNKA 4ZZBA 2BS4A 2BG9C 2PFVA 2IW5B 4IE0A 1MMDA 1JNZA 2PBIA 2QA7A 2WDQA 4IE5A 5HWYA 3SWHA 5JVDE 4LF7T 3N9NA 2JMHA 3OBVE 4UV8B 4AQFA 2KXPB 4YJ2E 3DTOA 4ZHQE 1OEDC 5AQHB 1S94A 4I0UA 2CXFA 4GOUA 2K3WA 4DR4T 2BKOA 2N2NA 2XTLA 3UUXB 2K48A 5DQWA 1G73A 4MBQA 5DJQC 2WBLA 2XUEA 3RIUA 3P4SA 3UU6A 3PUYF 4TWHA 2E9XC 1D0XA 2BBJA 3HL6A 3N9PA 4HWIB 2YINA 5FXVA 4AKHA 2JQQA 5H6QB 2BS3A 3MJXA 3CQGB 2QGSA 4GYRA 2L3LA 4U74A 4GK5E 2LHRA 2X9XA 2E9XB 3PV0F 4FI5A 2VKJA 2V7JA 5AQJB 4AIUA 1KFYA 2X51A 2R6GF 2C5JA 2LKHA 4IREA 2BVLA 1W0AA 4P09A 3N9QA 3J9X1 4EV6A 4EZ4A 2H89A 1GQEA 1YXRA 1XWMA 2WAUA 3EAMA 3NRXA 4PAGA 2NOXA 2BBHA 5JDMA 3Q5EA 2WWUA 5HCMA 1HCIA 5KMGP 5E0OA 5J1GA 3ETVA 3RGLA 3GMIA 5L3BB 2WS3A 3AEFA 3I0QA 5IWAT 3T1HT 1CUNA 4WBOA 1FIOA 4K0UA 5JDLA 3VKGA 1D1AA 4HKAA 1VOMA 2N9DA 3OYZA 3ABVA 4ZS3A 5JDFA 2BKPA 4E7SA 2UXDT 2H7OA 4BAYB 4ILUA 2K9AA 4O2AE 5JDNA 2X0YA 3CX8B 4JEUB 2WY2A 2V6XA 1M62A 2KSRA 4JI8T 1OWAA 2XQ5A 4TWFA 2H88A 3HR0A 3V5SA 3JADA 2KINB 3LFMA 4UF0B 4XZCA 3ZMTB 4A98A 2KZ7B 2VWAA 2W67A 3S4UA 4I43B 3RQWA 5KXJA 2LRLA
chains in the Genus database with same CATH topology
3UTKA 3MACA 4ZOLE 3EDUA 5HXCA 4CXXA 5JDHA 2E8IA 4QXHB 3AA7B 2CEAA 5HXHA 1HS7A 3OJAA 2CA5A 2VK9A 2Y8DA 2MBGA 4N78D 2MYSA 3C64A 2NW7A 2LSYA 3CVRA 4O4LE 3L09A 5LP6E 4ZI2C 5BMVE 5LGTB 3VKHA 2DWKA 1HFAA 2L9QA 3LK2B 4A56A 3RC8A 5LCYA 2W0GA 1WR6A 2CXLA 1BR4A 3O4XE 4UXNB 5CB4E 2C0SA 3M65A 3L3PA 4X1YE 4OFZA 2VKDA 3H3AA 3R6NA 1BR1A 2LSJA 1WLXA 3BQIA 3HKEE 2VASA 2NW9A 3EDVA 2Q9QA 5FY1A 4AQGA 5CA0E 3RKOA 4HN9A 2EHOB 4OHFA 2IAKA 2SPCA 3JC6C 4DMWA 4EB6E 4I4TE 5LJNA 3GN5A 3VHLA 3RH3A 4KP3C 4QHOA 2LE8A 4TX5A 4MLKA 3BQKA 3LBXA 2I59A 3C4WA 3O9XA 3J7Yq 4EXTA 2NP9A 1T98A 3N2OA 3O1JA 4ZS2A 3ZYKA 1MIVA 5LHHB 3LK42 3HI2A 3LK3B 5LBMA 3AA1B 3IEEA 2H7VC 4O4HE 1ZKEA 1EZ3A 1MMAA 4C90A 4MHCA 1HG2A 3ZYLA 1D0YA 3N9LA 4I55E 2PG8A 3PU3A 4QWNB 3AVSA 3DP7A 3FBLA 1V9DA 3UT5E 2V1DB 4PFPA 4DO0A 4MALA 4IE7A 4KMCA 2LT3A 3A5XA 5LBQB 3PUQA 4CXWA 3PUAA 3O1HA 2VL8A 3LJCA 2DNXA 4TV8E 3RYIE 4ZI2D 4ERRA 3AB3B 2X9HA 2K24A 4GIWA 3U3IA 2KNDA 3CWZB 4NUUA 3ZC0A 2A2FX 2UXNB 3RX6A 1LVFA 2JJ9A 3ZCJA 2DHRA 1IZNB 1U4QA 5DABA 3E0ZA 4HEAA 5LA6E 3R84B 3ZMVB 4L0RA 4BA9A 5HXEA 3WAJA 4UVBB 2CXDA 2C5KT 3N2GE 5HYAA 3ANWB 3Q2MA 2D0UA 1WRDA 3P8CD 2Z6EA 2Y48B 5KDMC 4M1PA 3OKQA 3OYXA 1MNEA 2ES0A 4WW0A 1LRZA 1VRBA 3CMLA 4I50E 1MMNA 2XAFB 3CX7B 2K5BB 3W15B 1D1BA 3RYFE 4OYJA 1FMWA 4O4JE 2RA1A 3ZEFB 4IDZA 3T8OA 1HTJF 4PK4A 5L3EB 4DBRA 2HPLA 4X1IE 2Q9QD 2WSSV 3PURA 4V1Av 2KMFA 4ANJA 4O8SA 4TN7B 5EZYE 2W63A 3E22E 4EIWA 1HF8A 1ZHCA 3KVAA 3F31A 3N2KE 3P7IA 2KLQA 3C98B 3C51A 5LOVE 3MZKB 5JQGE 4HTEA 5EK4A 5GONE 3BK9A 4YFSA 3U78A 2YEVC 2GK9A 3B13A 1US7B 4PK5A 5LHGB 5ADXL 2EHOC 2W62A 3KINB 2V7IA 4JUYA 5JDGA 3CX6B 4FJOA 3UUMA 2DI4A 2E9XD 5FP3A 1IJ5A 2XQYA 4UELA 3ZJ1A 2BVMA 2LSIA 3KBUA 4H9SE 2WM9A 3SS1A 3LBXB 3KV4A 1AJ3A 2XAHB 4AKGA 5FY0A 3IF8B 4IIJE 2DWGA 4DMVA 4ZI3C 2UXXB 1ZEEA 2VKHA 3HA4A 4YHJA 5IYZE 5JDQA 1QSDA 3O1IA 2EHOA 4H9PC 4QKNA 3SRZA 4PFOA 1FMVA 5FXWA 5ETWA 1MIWA 3C4XA 4OK0A 4ASKA 4UIGA 3AAEB 2HH7A 4UF0A 1UX4A 4H9RC 2L8KA 5LXTE 2X66A 4PJNA 4CI1B 4EOZB 3K3OA 3FHNA 1E1HB 3CPZA 3I9YA 2V7MA 4YJ3E 3MXZA 3TKLB 4EAHA 2B1EA 2NWBA 3RRCA 1LVKA 4IE6A 5FY7A 4B6XA 2ODUA 4O2BE 3ZMSB 4IGUA 1Y64B 3B57A 2W00A 4G63A 3C50A 3RPUA 2XAQB 4XAXB 2X0LB 1MMGA 3QUJA 2V7KA 3NBXX 4AKLA 4EYYR 1QUUA 4H63V 1BR0A 3NRYA 3V5UA 3UUNA 5LG4A 2CWYA 2CLYC 4QXBB 3MKDA 4UEMA 5F8PA 3IHRA 4PW8A 2D2SA 3GA8A 2OA5A 4KBMB 2CE7A 3Q9DA 2KWIB 5L3GB 4GYSA 3FXDB 2WMNA 3ONXA 5EK3A 4CI3B 1OXZA 2G0UA 2CMRA 2JPFA 4ADZA 2ZMAA 4PK6A 3K3NA 1NWMX 1B7TA 1SHZC 2YU2A 4H9NC 1ZV4X 1IJ6A 4NUVA 2E9XA 5A1LA 2XASB 4GK0E 2D5UA 5LJMA 5LGNB 5AFUL 2IC6A 1MNDA 4PJJA 3AAIA 4JLEA 4IE4A 2ZLYA 2CWOA 4CI2B 5H6RB 2ZM0A 2MTQA 4BJNA 3ETUA 5J2UE 2EHOD 4C91A 3SOLA 3ZN1B 4OYKA 3WAKA 3ZYMA 5HXSA 4X20E 5HWXA 4KUMB 3F57A 3I9WA 2KT9A 4QX8B 4EZHA 3NZPA 4X1KE 1KNZA 2ODVA 5HAXA 5L3FB 1LKXA 4L5GA 4AI6A 4WBNE 4HGAA 4TUYE 5L2LA 3ZPOA 3CQCB 4ZI3D 5TAOA 3PDYA 2Q9QB 5JR9B 4P0BA 3KVBA 2KWHA 2LHNA 3UULA 4H63H 5J2TE 5L3CB 2JMKA 3ZN0B 1U5PA 3KBTA 4L9IA 2LSKA 1YKEB 3AA6B 3F2EA 2NTXA 3C4ZA 3I0OA 2NTYA 1YW0A 4PNIA 3N5LA 2A3DA 4HFVA 3ZLIA 2YU1A 4HE8A 3LG7A 5IHYA 4EYUA 5LHIB 1KK7A 4MFRA 4UV9B 5JR9C 2Q9QC 2RP4A 2X67A 2YK0A 1H7CA 3FBZA 1O3XA 2BDEA 3H37A 3E08A 3I1AA 3MA9A 5FYMA 2IW5B 4AKIA 1HG5A 2M67A 4TV9E 2ACXA 4QXCB 4UVAB 2PJQA 3QK6A 4TZ4C 5F3JA 3KFWX 3ESLA 4H9QC 2WMOA 3Q5WA 4ISTA 3FXEB 3HKCE 2A72A 5JREA 1SA0E 4UVCB 4DBQA 1X79A 4U72A 4YLHA 2D0TA 2V7LA 3RC3A 4CZZB 4PJMA 3CQXC 3RYHE 1UCUA 3ZC1A 4JEHB 2CLYB 1IAPA 3AAAB 3EUHA 3UFEA 3KV5A 1G8XA 3CKDA 3RYCE 5FXZA 2H3RA 2XAGB 1YD8G 3KV6A 2C5IT 2NW8A 3EVYA 2LEHA 2X9YA 2XHEB 3WI3A 3HKDE 4DNDA 4CXYA 1NAFA 4G2AA 5M4YA 4IHJE 4XBFB 2W61A 2DCFA 4PJLA 2LSGA 5FXXA 2ZM8A 5LGUB 3BQLA 3D0TA 5HXRA 4BJMA 5DQVA 5EK2A 4F6RC 5C8YE 2CM0A 3ZMZB 5L3DB 3N9OA 1WYBA 3PU8A 1FEWA 5JR9A 2ZM2A 4WNKA 3PUSA 3ZJ2A 2JRKA 4AQFC 2DLRA 3IBPA 4P0AA 3JC6D 1D1CA 1MIYA 3MK7C 4AKRB 2P9BA 1WYCA 4DVDA 2MOZA 3AA0B 3HKBE 5JH7E 3NZQA 3GN5B 3KDSE 5FMNA 3ZCIA 5KX5E 2VKOA 4ZI7E 1Z0PA 2VB6A 3QC9A 2CCQA 4E7ZA 5JRCB 1BR2A 2N1GA 1S35A 4O4IE 2IC9A 5LYJE 2LOPA 1UX5A 3AVRA 3DJBA 4H9OC 2Y6XA 4AXPA 2LJLA 3K3QC 3KV9A 3ANWA 2X68A 1YKHB 3K8PC 3N9MA 1HX8A 2BZBA 2X9WA 4QX7B 4Z8XA 4CQIA 5JRCA 3Q5XA 3PE0A 4ISSA 1D0ZA 3PTRB 4J2CA 2LM9A 3PUGA 2J1DG 3VU7H 2XAJB 2V26A 3ZMUB 2HPJA 5CA1E 2LOSA 3FB2A 5FNVE 3RRWA 3GWHA 5LNKA 2PFVA 4IE0A 1MMDA 4IE5A 2PBIA 2QA7A 5HWYA 3SWHA 5JVDE 3N9NA 2JMHA 3OBVE 4UV8B 4AQFA 2KXPB 4YJ2E 3DTOA 4ZHQE 1S94A 2CXFA 4GOUA 2N2NA 2XTLA 3UUXB 2K48A 5DQWA 1G73A 4MBQA 5DJQC 2WBLA 2XUEA 2E9XC 1D0XA 3HL6A 3N9PA 2YINA 5FXVA 4AKHA 2JQQA 5H6QB 4GYRA 3MJXA 3CQGB 2QGSA 4U74A 2L3LA 4GK5E 2LHRA 2X9XA 2E9XB 4FI5A 2VKJA 2V7JA 2X51A 2C5JA 2BVLA 3J9X1 4P09A 3N9QA 4EZ4A 3NRXA 2WAUA 4PAGA 2NOXA 5JDMA 2WWUA 1HCIA 5KMGP 5E0OA 5J1GA 3ETVA 3GMIA 5L3BB 3I0QA 1CUNA 4WBOA 1FIOA 4K0UA 5JDLA 3VKGA 1D1AA 4HKAA 1VOMA 2N9DA 3OYZA 4ZS3A 4E7SA 5JDFA 2H7OA 4BAYB 4ILUA 2K9AA 4O2AE 5JDNA 3CX8B 4JEUB 1OWAA 3V5SA 3HR0A 3LFMA 4UF0B 3ZMTB 4XZCA 2KZ7B 2VWAA 3S4UA 4I43B 2KINB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GN5 A;  3O9X A;  3GN5 B;  3GA8 A;  3HI2 A; 
#chains in the Genus database with same CATH topology
 3UTK A;  2V6Y A;  3AE5 A;  3MAC A;  4ZOL E;  3EDU A;  5HXC A;  4CXX A;  5JDH A;  2E8I A;  4WYV A;  3G06 A;  4IL9 A;  4QXH B;  1DU2 A;  1R8I A;  2CEA A;  3AA7 B;  2VVS A;  5HXH A;  3B5M A;  5LMN T;  1HS7 A;  3OJA A;  2CA5 A;  2VK9 A;  2Y8D A;  2MBG A;  1XDO A;  4N78 D;  2MYS A;  2XM2 A;  2NW7 A;  3C64 A;  2JIW A;  2LSY A;  3CVR A;  4O4L E;  3RQU A;  3L09 A;  5LP6 E;  2M6I A;  2YDR A;  2YN6 A;  3P4P A;  4ZI2 C;  5BMV E;  4HFB A;  3AE1 A;  4YXD A;  5LGT B;  3VKH A;  2UUC T;  2DWK A;  1HFA A;  2L9Q A;  3LK2 B;  4A56 A;  5J0Z A;  5HEG A;  5LCY A;  3RC8 A;  2W0G A;  4UR9 A;  4LF5 T;  1WR6 A;  1QLB A;  3EI0 A;  4DUY T;  2CXL A;  1JNR A;  2E5L T;  1BR4 A;  3O4X E;  4UXN B;  5CB4 E;  3UU3 A;  2C0S A;  3M65 A;  3L3P A;  4X1Y E;  4OFZ A;  2VKD A;  3H3A A;  5LB7 B;  3R6N A;  1BR1 A;  2LSJ A;  2BS2 A;  1WLX A;  3BQI A;  3HKE E;  2CBI A;  2VAS A;  2PTF A;  4Z91 A;  3EDV A;  3QOF A;  2Q9Q A;  2XSA A;  1L0V A;  2NW9 A;  4K0K T;  5FY1 A;  4U33 A;  4AQG A;  5CA0 E;  4U2Y A;  3RKO A;  1HR0 T;  5IUX A;  5HEU A;  4HN9 A;  4JI2 T;  2EHO B;  4IDP A;  4OHF A;  2IAK A;  2SPC A;  3JC6 C;  3X1D A;  2RPA A;  4DMW A;  4EB6 E;  4I4T E;  5LJN A;  3GN5 A;  5ABE A;  3VHL A;  1T8B A;  3FZH B;  4KP3 C;  3RH3 A;  4QHO A;  2LE8 A;  2HN1 A;  4LML A;  4TX5 A;  4U7I A;  2NR4 A;  4MLK A;  4KHP T;  2CHO A;  3BQK A;  3LBX A;  4U2Z A;  2I59 A;  4LMK A;  3C4W A;  3O9X A;  1KNP A;  4EXT A;  3J7Y q;  2UUB T;  2NP9 A;  1T98 A;  3N2O A;  3O1J A;  4B3R T;  4ZS2 A;  3ZYK A;  1MIV A;  2W4X A;  5AQR B;  3LK4 2;  5LHH B;  3HI2 A;  3LK3 B;  3UU5 A;  5LBM A;  2QYW A;  4JI5 T;  1WR0 A;  1IBL T;  3AA1 B;  2YDQ A;  3IEE A;  2H7V C;  4ILC A;  4A97 A;  5HEJ A;  4O4H E;  1ZKE A;  3P50 A;  3SFD A;  1EZ3 A;  1E2A A;  1MMA A;  5AQP B;  4C90 A;  1Z8U A;  4MHC A;  4JI4 T;  1HG2 A;  4COF A;  2XQ4 A;  3ZYL A;  1D0Y A;  3N9L A;  4I55 E;  2PG8 A;  3PU3 A;  4LF8 T;  4QWN B;  3AVS A;  3DP7 A;  3FBL A;  4F8H A;  1V9D A;  2A9U A;  2V1D B;  4PFP A;  3UT5 E;  4MAL A;  4DO0 A;  4IE7 A;  4KMC A;  2LT3 A;  4Z90 A;  5HEO A;  2V8S V;  3A5X A;  2X0H A;  1OED E;  5LBQ B;  3PUQ A;  4CXW A;  3P4Q A;  3P4R A;  3PUA A;  3TLW A;  3O1H A;  2WDV A;  2VL8 A;  3LJC A;  2W2U A;  2DNX A;  4TV8 E;  1OED B;  5AQT B;  3RF1 A;  3RYI E;  4YHH T;  4DV1 T;  4B3M T;  4ZI2 D;  2LM2 A;  4P1N A;  4ERR A;  3AB3 B;  1KEY A;  2X9H A;  2OV9 A;  2K24 A;  4GIW A;  3U3I A;  2KND A;  3CWZ B;  4NUU A;  4Q25 A;  3RKG A;  1FJG T;  1HX1 B;  2A2F X;  2UXN B;  2FUP A;  3ZC0 A;  3RX6 A;  4IT4 A;  5BR8 T;  1LVF A;  2JJ9 A;  3QB5 K;  4DR7 T;  3AE4 A;  3ZCJ A;  2DHR A;  1IZN B;  1U4Q A;  5DAB A;  3E0Z A;  4HEA A;  5LA6 E;  3R84 B;  3ZMV B;  4EEB A;  4L0R A;  3LDQ B;  4BA9 A;  5HXE A;  3WAJ A;  4UVB B;  2CXD A;  4DV6 T;  2C5K T;  2I0M A;  2WU2 A;  3N2G E;  5HYA A;  3ANW B;  3Q2M A;  2D0U A;  1WRD A;  3P8C D;  2Z6E A;  2Y48 B;  1N36 T;  5KDM C;  4M1P A;  2E2A A;  2I6H A;  3OKQ A;  3OYX A;  1MNE A;  2ES0 A;  1SE7 A;  4WW0 A;  5ABG A;  1LRZ A;  3AEC A;  1VRB A;  3CML A;  4I50 E;  1MMN A;  2XAF B;  5AQL B;  3CX7 B;  2K5B B;  3W15 B;  1D1B A;  3RYF E;  4OYJ A;  1FMW A;  4O4J E;  3RIA A;  4GKJ T;  5CFB A;  1ZOY A;  2VVN A;  3RLF F;  2RA1 A;  5L4H A;  3ZEF B;  4IDZ A;  3T8O A;  1HTJ F;  4PK4 A;  5L3E B;  4DBR A;  2HPL A;  4X1I E;  2Q9Q D;  2WSS V;  4TNV A;  3PUR A;  4DV7 T;  4V1A v;  2KMF A;  4ANJ A;  4JI3 T;  3VR9 A;  4O8S A;  4TN7 B;  5EZY E;  2W63 A;  3E22 E;  2J47 A;  4EIW A;  1HF8 A;  1ZHC A;  3KVA A;  4DV5 T;  2XQ3 A;  2BG9 B;  3F31 A;  3N2K E;  2KLQ A;  3C98 B;  1VCT A;  3C51 A;  3ONL C;  3EHZ A;  3P7I A;  5LOV E;  1UK5 A;  3MZK B;  5JQG E;  4HTE A;  5EK4 A;  5GON E;  3BK9 A;  4IDO A;  4YFS A;  3U78 A;  2YEV C;  2GK9 A;  3B13 A;  1N34 T;  2UUA T;  1US7 B;  2XQ6 A;  2UXB T;  4PK5 A;  5LHG B;  3CIR A;  4DR6 T;  5ADX L;  2EHO C;  2W62 A;  1J5W A;  2V7I A;  3KIN B;  4JUY A;  4DUZ T;  3EAB A;  5HEH A;  2XQ7 A;  4LFC T;  4IDQ A;  5JDG A;  4YTP A;  5FKY A;  3CX6 B;  3VRB A;  4FJO A;  1YQ4 A;  3UUM A;  2DI4 A;  2E9X D;  5FP3 A;  1IJ5 A;  2XQY A;  4YTM A;  4LFA T;  1J1J A;  5L47 A;  3ZST A;  4UEL A;  2AXD S;  3ZJ1 A;  4HWC A;  2BVM A;  2LSI A;  1CHU A;  3KBU A;  4H9S E;  2WM9 A;  3SS1 A;  3ZSS A;  2XSB A;  3KV4 A;  3LBX B;  2XAH B;  4QH5 A;  1I94 T;  1AJ3 A;  4AKG A;  5FY0 A;  3IF8 B;  1HNW T;  1WCR A;  1UUS A;  5ABF B;  4IIJ E;  2DWG A;  4DMV A;  2CHN A;  4ZI3 C;  2UXX B;  1ZEE A;  2VKH A;  3AED A;  3HA4 A;  4YHJ A;  5IYZ E;  3JCF A;  5JDQ A;  4OX9 T;  1QSD A;  5C3J A;  3O1I A;  2EHO A;  4H9P C;  4KHZ F;  2IIU A;  4QKN A;  4X5T A;  4PFO A;  1FMV A;  5FXW A;  3RHW A;  3SRZ A;  4CN1 A;  2YDS A;  5ETW A;  4B3T T;  1MIW A;  3C4X A;  4OK0 A;  4ASK A;  1M7K A;  4UIG A;  4QH1 A;  4YTN A;  3AAE B;  4CN6 A;  2HH7 A;  4UF0 A;  2WB5 A;  1I6Z A;  4NIQ A;  4EGW A;  1UX4 A;  4H9R C;  2L8K A;  2CPT A;  5LXT E;  1W09 A;  2X66 A;  4PJN A;  4CI1 B;  2BKN A;  4EOZ B;  2WP9 A;  1XZY A;  3K3O A;  3FHN A;  2F4V T;  1E1H B;  2OLT A;  3CPZ A;  2V7M A;  3I9Y A;  3MXZ A;  4NPP A;  3FZL B;  4YJ3 E;  3SFE A;  3TKL B;  1NEN A;  2B1E A;  3OPC A;  2MPK A;  2NWB A;  3RRC A;  1LVK A;  4IE6 A;  5FY7 A;  4B6X A;  4DR1 T;  2ODU A;  3ZT5 A;  2LLY A;  3PUX F;  4O2B E;  1T7S A;  3L39 A;  4LMJ A;  3ZT6 A;  3ZMS B;  4EED A;  2XQ9 A;  1Y64 B;  4IGU A;  4TNW A;  3RI5 A;  3B57 A;  4KI0 F;  2W00 A;  4G63 A;  3C50 A;  3RPU A;  2XAQ B;  4XAX B;  3PJA J;  2X0L B;  3TLV A;  1MMG A;  1XNR T;  3QUJ A;  4JI6 T;  2V7K A;  3NBX X;  3AXJ B;  4AKL A;  4EYY R;  1QUU A;  1N33 T;  4H63 V;  1BR0 A;  3NRY A;  3V5U A;  4YT0 A;  3UUN A;  3UU8 A;  5LG4 A;  2CWY A;  2CLY C;  4QXB B;  3MKD A;  3QNU A;  4UEM A;  3IHR A;  4PW8 A;  2D2S A;  3GA8 A;  5F8P A;  4X62 T;  2OA5 A;  4X66 T;  4ILB A;  2CE7 A;  4KBM B;  3Q9D A;  4ZEY A;  4DR2 T;  3FZM B;  2KWI B;  5L3G B;  4GYS A;  3FXD B;  2WMN A;  3ONX A;  5EK3 A;  4CI3 B;  4DR3 T;  1OXZ A;  2G0U A;  2CMR A;  2JPF A;  3RIU C;  2YKS A;  2ZMA A;  4ADZ A;  4EAH A;  5EK2 A;  4X64 T;  2V5D A;  2BG9 E;  4PK6 A;  1Y01 A;  3K3N A;  2VQE T;  1XDP A;  1NWM X;  4DV3 T;  2IUB A;  1B7T A;  3Q5D A;  1SHZ C;  2YU2 A;  4H9N C;  4LFB T;  1ZV4 X;  1IJ6 A;  2LRK A;  2E9X A;  3AE7 A;  3JAE A;  4NUV A;  3AEE A;  5A1L A;  2XAS B;  4JI1 T;  2FJA A;  4GK0 E;  2D5U A;  5LJM A;  5LGN B;  5AFU L;  2IC6 A;  1MND A;  3AXJ A;  2JQH A;  4PJJ A;  5AQU B;  3IA3 A;  1IBM T;  3AAI A;  4JLE A;  2QVA A;  4IE4 A;  2ZLY A;  2CWO A;  4CI2 B;  4HFH A;  5H6R B;  3AEA A;  4YSY A;  4DID B;  2ZM0 A;  2QRX A;  2MTQ A;  1KF6 A;  2XZE A;  3TLU A;  4BJN A;  3ETU A;  5CJ5 A;  5J2U E;  3P4W A;  2EHO D;  2CRB A;  4C91 A;  2BG9 A;  2VL0 A;  3SOL A;  4HWH A;  2DL1 A;  3ZN1 B;  5FL1 A;  1XNQ T;  4JV5 T;  3PUW F;  4OYK A;  3WAK A;  3ZYM A;  5ABF A;  4X20 E;  5HXS A;  4DV4 T;  1HNX T;  5HWX A;  3ZT7 A;  2UU9 T;  1WFD A;  4KUM B;  4QH4 A;  4AIS A;  2XY8 B;  3A7M A;  3F57 A;  3I9W A;  2KT9 A;  4QX8 B;  1OED A;  4CN4 A;  4EZH A;  3NZP A;  4X1K E;  3AE6 A;  1KNZ A;  1VCS A;  2HN2 A;  2ODV A;  5FL0 A;  5HAX A;  5L3F B;  1LKX A;  2AE9 A;  4L5G A;  4AI6 A;  4WBN E;  4HGA A;  1N32 T;  2IHR 1;  4TUY E;  4U3C A;  5L2L A;  1IBK T;  3ZPO A;  2HHH T;  4JYA T;  2VUR A;  1ZP0 A;  3CQC B;  3JAF A;  3UU4 A;  4HFE A;  3PJA A;  4ZI3 D;  5TAO A;  3PDY A;  1KNR A;  2Q9Q B;  4P0B A;  3KVB A;  3ZKR A;  5JR9 B;  4JI7 T;  2KWH A;  4HFI A;  2LHN A;  3UUL A;  3AEG A;  4H63 H;  2WCA A;  5J2T E;  3AEB A;  5L3C B;  2XQA A;  3PUV F;  1UUR A;  2JMK A;  3ZN0 B;  1U5P A;  2ACZ A;  3KBT A;  4L9I A;  2LSK A;  1YKE B;  3AA6 B;  3F2E A;  2NTX A;  2XM1 A;  3C4Z A;  3I0O A;  2NTY A;  3K1S A;  2V5C A;  3AE3 A;  2FJD A;  1YW0 A;  4PNI A;  1XMO T;  3NKZ A;  3N5L A;  2WWV A;  3VR8 A;  2A3D A;  4HFV A;  3ZLI A;  2YU1 A;  2M6B A;  4HE8 A;  3LG7 A;  4HWD A;  5AQI B;  2WZI A;  5AQO B;  5IHY A;  2FJE A;  3NVO A;  1YQ3 A;  4EYU A;  5LHI B;  3NWI A;  1KK7 A;  4A5X A;  4MFR A;  4DV2 T;  2CBJ A;  4UV9 B;  5JR9 C;  2RP4 A;  2Q9Q C;  2X67 A;  2YK0 A;  1H7C A;  3FBZ A;  1O3X A;  2BDE A;  3E08 A;  3H37 A;  3I1A A;  3M3Z B;  3MA9 A;  5FVL A;  5FYM A;  1HG5 A;  2M67 A;  5AQS B;  2UXC T;  2FJB A;  4TV9 E;  4LF4 T;  4AKI A;  2J62 A;  2ACX A;  4QXC B;  4UVA B;  2PJQ A;  3QK6 A;  1NEK A;  4TZ4 C;  5HCJ A;  3KFW X;  3TLS A;  3ESL A;  3TLT A;  4H9Q C;  5F3J A;  2WMO A;  4DV0 T;  3FZF B;  3Q5W A;  4IST A;  3FXE B;  4IL4 A;  3VRA A;  3HKC E;  3LSV A;  2A72 A;  2WU5 A;  1SA0 E;  3QB5 A;  4UVC B;  5L4E A;  4DBQ A;  1X79 A;  5JRE A;  4U72 A;  2B76 A;  4YLH A;  3FZK B;  2D0T A;  2V7L A;  3RC3 A;  1T72 A;  4CZZ B;  4PJM A;  3AE9 A;  3CQX C;  5LG3 A;  3RYH E;  1UCU A;  4JBW F;  3ZC1 A;  4JEH B;  2CLY B;  5AQK B;  1IAP A;  3AAA B;  3EUH A;  4ILA A;  3UFE A;  2LKG A;  2WQY A;  5JTG A;  3A8Y C;  1G8X A;  3CKD A;  3KV5 A;  5FXZ A;  2H3R A;  2XAG B;  3RYC E;  4HWF A;  4LF6 T;  1YD8 G;  3KV6 A;  2C5I T;  2NW8 A;  3EVY A;  4HFC A;  2LEH A;  5FVK A;  2X9Y A;  3UFG A;  5AQM B;  3CK6 A;  3UQ7 A;  2XHE B;  3WI3 A;  2J4G A;  3HKD E;  4DND A;  4CXY A;  4U31 A;  1NAF A;  4G2A A;  5M4Y A;  4ZXL A;  4IHJ E;  4XBF B;  2W61 A;  2DCF A;  4PJL A;  5ABH A;  3RIF A;  1J5E T;  4ZZC A;  2LSG A;  5FXX A;  2ZM8 A;  2E5V A;  3UQ4 A;  5LGU B;  3L8R A;  3BQL A;  1UGO A;  3D0T A;  3PUZ F;  5DQV A;  5HXR A;  3UUB A;  4BJM A;  4F6R C;  2CM0 A;  3ZMZ B;  2XQ8 A;  5C8Y E;  2MAW A;  3N9O A;  5L3D B;  3OTO T;  1WYB A;  3PU8 A;  1HNZ T;  1FEW A;  4NXN T;  1E7P A;  5JR9 A;  2YOE A;  2ZM2 A;  2WZH A;  4WNK A;  3PUS A;  3ZJ2 A;  5LMU T;  2JRK A;  4AQF C;  2DLR A;  3IBP A;  1XMQ T;  3JC6 D;  4P0A A;  1D1C A;  1MIY A;  3MK7 C;  2XPK A;  3H3M A;  2P9B A;  1WYC A;  5AQG B;  4AKR B;  4DVD A;  2MOZ A;  3AA0 B;  3HKB E;  2JQ9 A;  5JH7 E;  4JI0 T;  2IDO B;  3NZQ A;  1SUM B;  3GN5 B;  3KDS E;  5FMN A;  3ZCI A;  5KX5 E;  2VKO A;  4ZI7 E;  3OVU A;  1Z0P A;  2VB6 A;  3QC9 A;  2CCQ A;  4E7Z A;  1W9R A;  5JRC B;  4TWD A;  1BR2 A;  2FBW A;  4WZX A;  2N1G A;  1S35 A;  2V6Y B;  4O4I E;  4LF9 T;  5AQV B;  2IC9 A;  5LYJ E;  4U7Y A;  2LOP A;  2VQF T;  1UX5 A;  3AE2 A;  2ZM6 T;  3AVR A;  3DJB A;  4H9O C;  2Y6X A;  5AQN B;  4AXP A;  4IDN A;  2LJL A;  3K3Q C;  3KV9 A;  2JQK A;  1X9B A;  3ANW A;  2X68 A;  2D9D A;  1YKH B;  4YSX A;  3K8P C;  5C2T A;  4KX6 A;  3N9M A;  5AQF B;  4YSZ A;  1HX8 A;  2BZB A;  2X9W A;  4QX7 B;  2XJ7 A;  4Z8X A;  3AE8 A;  4CQI A;  5CGM A;  4GKK T;  3Q5X A;  5JRC A;  4NXM T;  2WDR A;  4YY3 T;  4X65 T;  4AQY T;  1W0B A;  3PE0 A;  4ISS A;  1D0Z A;  3PTR B;  4J2C A;  2LM9 A;  3PUG A;  3ONJ A;  4HFD A;  5AQQ B;  2J1D G;  3VU7 H;  2W66 A;  2V26 A;  2XAJ B;  2HPJ A;  3ZMU B;  5CA1 E;  2IML A;  4DR5 T;  2LOS A;  3T1Y T;  3FB2 A;  5F5W A;  5FNV E;  4B3S T;  3RRW A;  3GWH A;  5LNK A;  4ZZB A;  2BS4 A;  2BG9 C;  2PFV A;  2IW5 B;  4IE0 A;  1MMD A;  1JNZ A;  2PBI A;  2QA7 A;  2WDQ A;  4IE5 A;  5HWY A;  3SWH A;  5JVD E;  4LF7 T;  3N9N A;  2JMH A;  3OBV E;  4UV8 B;  4AQF A;  2KXP B;  4YJ2 E;  3DTO A;  4ZHQ E;  1OED C;  5AQH B;  1S94 A;  4I0U A;  2CXF A;  4GOU A;  2K3W A;  4DR4 T;  2BKO A;  2N2N A;  2XTL A;  3UUX B;  2K48 A;  5DQW A;  1G73 A;  4MBQ A;  5DJQ C;  2WBL A;  2XUE A;  3RIU A;  3P4S A;  3UU6 A;  3PUY F;  4TWH A;  2E9X C;  1D0X A;  2BBJ A;  3HL6 A;  3N9P A;  4HWI B;  2YIN A;  5FXV A;  4AKH A;  2JQQ A;  5H6Q B;  2BS3 A;  3MJX A;  3CQG B;  2QGS A;  4GYR A;  2L3L A;  4U74 A;  4GK5 E;  2LHR A;  2X9X A;  2E9X B;  3PV0 F;  4FI5 A;  2VKJ A;  2V7J A;  5AQJ B;  4AIU A;  1KFY A;  2X51 A;  2R6G F;  2C5J A;  2LKH A;  4IRE A;  2BVL A;  1W0A A;  4P09 A;  3N9Q A;  3J9X 1;  4EV6 A;  4EZ4 A;  2H89 A;  1GQE A;  1YXR A;  1XWM A;  2WAU A;  3EAM A;  3NRX A;  4PAG A;  2NOX A;  2BBH A;  5JDM A;  3Q5E A;  2WWU A;  5HCM A;  1HCI A;  5KMG P;  5E0O A;  5J1G A;  3ETV A;  3RGL A;  3GMI A;  5L3B B;  2WS3 A;  3AEF A;  3I0Q A;  5IWA T;  3T1H T;  1CUN A;  4WBO A;  1FIO A;  4K0U A;  5JDL A;  3VKG A;  1D1A A;  4HKA A;  1VOM A;  2N9D A;  3OYZ A;  3ABV A;  4ZS3 A;  5JDF A;  2BKP A;  4E7S A;  2UXD T;  2H7O A;  4BAY B;  4ILU A;  2K9A A;  4O2A E;  5JDN A;  2X0Y A;  3CX8 B;  4JEU B;  2WY2 A;  2V6X A;  1M62 A;  2KSR A;  4JI8 T;  1OWA A;  2XQ5 A;  4TWF A;  2H88 A;  3HR0 A;  3V5S A;  3JAD A;  2KIN B;  3LFM A;  4UF0 B;  4XZC A;  3ZMT B;  4A98 A;  2KZ7 B;  2VWA A;  2W67 A;  3S4U A;  4I43 B;  3RQW A;  5KXJ A;  2LRL A; 
#chains in the Genus database with same CATH homology
 3UTK A;  3MAC A;  4ZOL E;  3EDU A;  5HXC A;  4CXX A;  5JDH A;  2E8I A;  4QXH B;  3AA7 B;  2CEA A;  5HXH A;  1HS7 A;  3OJA A;  2CA5 A;  2VK9 A;  2Y8D A;  2MBG A;  4N78 D;  2MYS A;  3C64 A;  2NW7 A;  2LSY A;  3CVR A;  4O4L E;  3L09 A;  5LP6 E;  4ZI2 C;  5BMV E;  5LGT B;  3VKH A;  2DWK A;  1HFA A;  2L9Q A;  3LK2 B;  4A56 A;  3RC8 A;  5LCY A;  2W0G A;  1WR6 A;  2CXL A;  1BR4 A;  3O4X E;  4UXN B;  5CB4 E;  2C0S A;  3M65 A;  3L3P A;  4X1Y E;  4OFZ A;  2VKD A;  3H3A A;  3R6N A;  1BR1 A;  2LSJ A;  1WLX A;  3BQI A;  3HKE E;  2VAS A;  2NW9 A;  3EDV A;  2Q9Q A;  5FY1 A;  4AQG A;  5CA0 E;  3RKO A;  4HN9 A;  2EHO B;  4OHF A;  2IAK A;  2SPC A;  3JC6 C;  4DMW A;  4EB6 E;  4I4T E;  5LJN A;  3GN5 A;  3VHL A;  3RH3 A;  4KP3 C;  4QHO A;  2LE8 A;  4TX5 A;  4MLK A;  3BQK A;  3LBX A;  2I59 A;  3C4W A;  3O9X A;  3J7Y q;  4EXT A;  2NP9 A;  1T98 A;  3N2O A;  3O1J A;  4ZS2 A;  3ZYK A;  1MIV A;  5LHH B;  3LK4 2;  3HI2 A;  3LK3 B;  5LBM A;  3AA1 B;  3IEE A;  2H7V C;  4O4H E;  1ZKE A;  1EZ3 A;  1MMA A;  4C90 A;  4MHC A;  1HG2 A;  3ZYL A;  1D0Y A;  3N9L A;  4I55 E;  2PG8 A;  3PU3 A;  4QWN B;  3AVS A;  3DP7 A;  3FBL A;  1V9D A;  3UT5 E;  2V1D B;  4PFP A;  4DO0 A;  4MAL A;  4IE7 A;  4KMC A;  2LT3 A;  3A5X A;  5LBQ B;  3PUQ A;  4CXW A;  3PUA A;  3O1H A;  2VL8 A;  3LJC A;  2DNX A;  4TV8 E;  3RYI E;  4ZI2 D;  4ERR A;  3AB3 B;  2X9H A;  2K24 A;  4GIW A;  3U3I A;  2KND A;  3CWZ B;  4NUU A;  3ZC0 A;  2A2F X;  2UXN B;  3RX6 A;  1LVF A;  2JJ9 A;  3ZCJ A;  2DHR A;  1IZN B;  1U4Q A;  5DAB A;  3E0Z A;  4HEA A;  5LA6 E;  3R84 B;  3ZMV B;  4L0R A;  4BA9 A;  5HXE A;  3WAJ A;  4UVB B;  2CXD A;  2C5K T;  3N2G E;  5HYA A;  3ANW B;  3Q2M A;  2D0U A;  1WRD A;  3P8C D;  2Z6E A;  2Y48 B;  5KDM C;  4M1P A;  3OKQ A;  3OYX A;  1MNE A;  2ES0 A;  4WW0 A;  1LRZ A;  1VRB A;  3CML A;  4I50 E;  1MMN A;  2XAF B;  3CX7 B;  2K5B B;  3W15 B;  1D1B A;  3RYF E;  4OYJ A;  1FMW A;  4O4J E;  2RA1 A;  3ZEF B;  4IDZ A;  3T8O A;  1HTJ F;  4PK4 A;  5L3E B;  4DBR A;  2HPL A;  4X1I E;  2Q9Q D;  2WSS V;  3PUR A;  4V1A v;  2KMF A;  4ANJ A;  4O8S A;  4TN7 B;  5EZY E;  2W63 A;  3E22 E;  4EIW A;  1HF8 A;  1ZHC A;  3KVA A;  3F31 A;  3N2K E;  3P7I A;  2KLQ A;  3C98 B;  3C51 A;  5LOV E;  3MZK B;  5JQG E;  4HTE A;  5EK4 A;  5GON E;  3BK9 A;  4YFS A;  3U78 A;  2YEV C;  2GK9 A;  3B13 A;  1US7 B;  4PK5 A;  5LHG B;  5ADX L;  2EHO C;  2W62 A;  3KIN B;  2V7I A;  4JUY A;  5JDG A;  3CX6 B;  4FJO A;  3UUM A;  2DI4 A;  2E9X D;  5FP3 A;  1IJ5 A;  2XQY A;  4UEL A;  3ZJ1 A;  2BVM A;  2LSI A;  3KBU A;  4H9S E;  2WM9 A;  3SS1 A;  3LBX B;  3KV4 A;  1AJ3 A;  2XAH B;  4AKG A;  5FY0 A;  3IF8 B;  4IIJ E;  2DWG A;  4DMV A;  4ZI3 C;  2UXX B;  1ZEE A;  2VKH A;  3HA4 A;  4YHJ A;  5IYZ E;  5JDQ A;  1QSD A;  3O1I A;  2EHO A;  4H9P C;  4QKN A;  3SRZ A;  4PFO A;  1FMV A;  5FXW A;  5ETW A;  1MIW A;  3C4X A;  4OK0 A;  4ASK A;  4UIG A;  3AAE B;  2HH7 A;  4UF0 A;  1UX4 A;  4H9R C;  2L8K A;  5LXT E;  2X66 A;  4PJN A;  4CI1 B;  4EOZ B;  3K3O A;  3FHN A;  1E1H B;  3CPZ A;  3I9Y A;  2V7M A;  4YJ3 E;  3MXZ A;  3TKL B;  4EAH A;  2B1E A;  2NWB A;  3RRC A;  1LVK A;  4IE6 A;  5FY7 A;  4B6X A;  2ODU A;  4O2B E;  3ZMS B;  4IGU A;  1Y64 B;  3B57 A;  2W00 A;  4G63 A;  3C50 A;  3RPU A;  2XAQ B;  4XAX B;  2X0L B;  1MMG A;  3QUJ A;  2V7K A;  3NBX X;  4AKL A;  4EYY R;  1QUU A;  4H63 V;  1BR0 A;  3NRY A;  3V5U A;  3UUN A;  5LG4 A;  2CWY A;  2CLY C;  4QXB B;  3MKD A;  4UEM A;  5F8P A;  3IHR A;  4PW8 A;  2D2S A;  3GA8 A;  2OA5 A;  4KBM B;  2CE7 A;  3Q9D A;  2KWI B;  5L3G B;  4GYS A;  3FXD B;  2WMN A;  3ONX A;  5EK3 A;  4CI3 B;  1OXZ A;  2G0U A;  2CMR A;  2JPF A;  4ADZ A;  2ZMA A;  4PK6 A;  3K3N A;  1NWM X;  1B7T A;  1SHZ C;  2YU2 A;  4H9N C;  1ZV4 X;  1IJ6 A;  4NUV A;  2E9X A;  5A1L A;  2XAS B;  4GK0 E;  2D5U A;  5LJM A;  5LGN B;  5AFU L;  2IC6 A;  1MND A;  4PJJ A;  3AAI A;  4JLE A;  4IE4 A;  2ZLY A;  2CWO A;  4CI2 B;  5H6R B;  2ZM0 A;  2MTQ A;  4BJN A;  3ETU A;  5J2U E;  2EHO D;  4C91 A;  3SOL A;  3ZN1 B;  4OYK A;  3WAK A;  3ZYM A;  5HXS A;  4X20 E;  5HWX A;  4KUM B;  3F57 A;  3I9W A;  2KT9 A;  4QX8 B;  4EZH A;  3NZP A;  4X1K E;  1KNZ A;  2ODV A;  5HAX A;  5L3F B;  1LKX A;  4L5G A;  4AI6 A;  4WBN E;  4HGA A;  4TUY E;  5L2L A;  3ZPO A;  3CQC B;  4ZI3 D;  5TAO A;  3PDY A;  2Q9Q B;  5JR9 B;  4P0B A;  3KVB A;  2KWH A;  2LHN A;  3UUL A;  4H63 H;  5J2T E;  5L3C B;  2JMK A;  3ZN0 B;  1U5P A;  3KBT A;  4L9I A;  2LSK A;  1YKE B;  3AA6 B;  3F2E A;  2NTX A;  3C4Z A;  3I0O A;  2NTY A;  1YW0 A;  4PNI A;  3N5L A;  2A3D A;  4HFV A;  3ZLI A;  2YU1 A;  4HE8 A;  3LG7 A;  5IHY A;  4EYU A;  5LHI B;  1KK7 A;  4MFR A;  4UV9 B;  5JR9 C;  2Q9Q C;  2RP4 A;  2X67 A;  2YK0 A;  1H7C A;  3FBZ A;  1O3X A;  2BDE A;  3H37 A;  3E08 A;  3I1A A;  3MA9 A;  5FYM A;  2IW5 B;  4AKI A;  1HG5 A;  2M67 A;  4TV9 E;  2ACX A;  4QXC B;  4UVA B;  2PJQ A;  3QK6 A;  4TZ4 C;  5F3J A;  3KFW X;  3ESL A;  4H9Q C;  2WMO A;  3Q5W A;  4IST A;  3FXE B;  3HKC E;  2A72 A;  5JRE A;  1SA0 E;  4UVC B;  4DBQ A;  1X79 A;  4U72 A;  4YLH A;  2D0T A;  2V7L A;  3RC3 A;  4CZZ B;  4PJM A;  3CQX C;  3RYH E;  1UCU A;  3ZC1 A;  4JEH B;  2CLY B;  1IAP A;  3AAA B;  3EUH A;  3UFE A;  3KV5 A;  1G8X A;  3CKD A;  3RYC E;  5FXZ A;  2H3R A;  2XAG B;  1YD8 G;  3KV6 A;  2C5I T;  2NW8 A;  3EVY A;  2LEH A;  2X9Y A;  2XHE B;  3WI3 A;  3HKD E;  4DND A;  4CXY A;  1NAF A;  4G2A A;  5M4Y A;  4IHJ E;  4XBF B;  2W61 A;  2DCF A;  4PJL A;  2LSG A;  5FXX A;  2ZM8 A;  5LGU B;  3BQL A;  3D0T A;  5HXR A;  4BJM A;  5DQV A;  5EK2 A;  4F6R C;  5C8Y E;  2CM0 A;  3ZMZ B;  5L3D B;  3N9O A;  1WYB A;  3PU8 A;  1FEW A;  5JR9 A;  2ZM2 A;  4WNK A;  3PUS A;  3ZJ2 A;  2JRK A;  4AQF C;  2DLR A;  3IBP A;  4P0A A;  3JC6 D;  1D1C A;  1MIY A;  3MK7 C;  4AKR B;  2P9B A;  1WYC A;  4DVD A;  2MOZ A;  3AA0 B;  3HKB E;  5JH7 E;  3NZQ A;  3GN5 B;  3KDS E;  5FMN A;  3ZCI A;  5KX5 E;  2VKO A;  4ZI7 E;  1Z0P A;  2VB6 A;  3QC9 A;  2CCQ A;  4E7Z A;  5JRC B;  1BR2 A;  2N1G A;  1S35 A;  4O4I E;  2IC9 A;  5LYJ E;  2LOP A;  1UX5 A;  3AVR A;  3DJB A;  4H9O C;  2Y6X A;  4AXP A;  2LJL A;  3K3Q C;  3KV9 A;  3ANW A;  2X68 A;  1YKH B;  3K8P C;  3N9M A;  1HX8 A;  2BZB A;  2X9W A;  4QX7 B;  4Z8X A;  4CQI A;  5JRC A;  3Q5X A;  3PE0 A;  4ISS A;  1D0Z A;  3PTR B;  4J2C A;  2LM9 A;  3PUG A;  2J1D G;  3VU7 H;  2XAJ B;  2V26 A;  3ZMU B;  2HPJ A;  5CA1 E;  2LOS A;  3FB2 A;  5FNV E;  3RRW A;  3GWH A;  5LNK A;  2PFV A;  4IE0 A;  1MMD A;  4IE5 A;  2PBI A;  2QA7 A;  5HWY A;  3SWH A;  5JVD E;  3N9N A;  2JMH A;  3OBV E;  4UV8 B;  4AQF A;  2KXP B;  4YJ2 E;  3DTO A;  4ZHQ E;  1S94 A;  2CXF A;  4GOU A;  2N2N A;  2XTL A;  3UUX B;  2K48 A;  5DQW A;  1G73 A;  4MBQ A;  5DJQ C;  2WBL A;  2XUE A;  2E9X C;  1D0X A;  3HL6 A;  3N9P A;  2YIN A;  5FXV A;  4AKH A;  2JQQ A;  5H6Q B;  4GYR A;  3MJX A;  3CQG B;  2QGS A;  4U74 A;  2L3L A;  4GK5 E;  2LHR A;  2X9X A;  2E9X B;  4FI5 A;  2VKJ A;  2V7J A;  2X51 A;  2C5J A;  2BVL A;  3J9X 1;  4P09 A;  3N9Q A;  4EZ4 A;  3NRX A;  2WAU A;  4PAG A;  2NOX A;  5JDM A;  2WWU A;  1HCI A;  5KMG P;  5E0O A;  5J1G A;  3ETV A;  3GMI A;  5L3B B;  3I0Q A;  1CUN A;  4WBO A;  1FIO A;  4K0U A;  5JDL A;  3VKG A;  1D1A A;  4HKA A;  1VOM A;  2N9D A;  3OYZ A;  4ZS3 A;  4E7S A;  5JDF A;  2H7O A;  4BAY B;  4ILU A;  2K9A A;  4O2A E;  5JDN A;  3CX8 B;  4JEU B;  1OWA A;  3V5S A;  3HR0 A;  3LFM A;  4UF0 B;  3ZMT B;  4XZC A;  2KZ7 B;  2VWA A;  3S4U A;  4I43 B;  2KIN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...