3HI2A

Structure of the n-terminal domain of the e. coli antitoxin mqsa (ygit/b3021) in complex with the e. coli toxin mqsr (ygiu/b3022)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
70
structure length
70
Chain Sequence
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three dimensional structure of the MqsR:MqsA complex: a novel TA pair comprised of a toxin homologous to RelE and an antitoxin with unique properties.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Dna binding protein/toxin
molecule keywords HTH-type transcriptional regulator mqsA(ygiT)
total genus 14
structure length 70
sequence length 70
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.720 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3hi2A00
3O9XA 3GN5A 3HI2A 3GA8A 3GN5B
chains in the Genus database with same CATH superfamily
1IAPA 3VRAA 2UUCT 4J2CA 4EV6A 4DR6T 1MMAA 5JH7E 2CM0A 2X9XA 4EIWA 5FXWA 2LJLA 2M67A 1HG2A 1US7B 2RA1A 3K3QC 2CWOA 2Y6XA 3KV5A 4LF4T 4UF0B 3NVOA 3ZMSB 2XSBA 2VL0A 2DL1A 2LHRA 3CQCB 4TV9E 4ZI2D 2PG8A 2QYWA 2WU5A 2V7LA 4IDOA 1KEYA 4LFBT 2CBJA 4BJNA 3T8OA 3UQ7A 4LF6T 3QUJA 2CEAA 5HXCA 4HFBA 5FP3A 5HYAA 4YT0A 2D2SA 2V7IA 4U31A 2NP9A 4PK5A 2NOXA 4CXXA 4L9IA 4IGUA 3B57A 4PAGA 3TLSA 1HR0T 3ZT7A 2M6BA 2ODVA 1MNDA 2NR4A 5KMGP 5FXZA 4DUYT 3FZHB 3KVBA 1QLBA 3LBXA 2Q9QC 4O4JE 2E5LT 4IT4A 3PU8A 2CWYA 3AECA 4XAXB 3UUNA 5LNKA 2WAUA 5HEOA 4DBRA 2LSJA 3GA8A 5FY0A 4XBFB 2QVAA 3PUAA 2KINB 3I0QA 4JI1T 2CBIA 3JAEA 2E9XA 3EVYA 2UXBT 3D0TA 3KFWX 2M6IA 2XTLA 2LRLA 4AQFA 2VKDA 1HCIA 2V7MA 1HNZT 5DQVA 2R6GF 1LVKA 3ZEFB 3AEFA 5LP6E 2YU1A 3BQIA 1HTJF 2IAKA 4A56A 3J7Yq 3BQKA 2CHOA 4DV3T 3ZMVB 4B3ST 2JMHA 1FMVA 2XHEB 2HN1A 2VKHA 4HFCA 3ZJ2A 1OEDB 3TKLB 4LFAT 4X65T 2X67A 3AA0B 5ABFB 4YTMA 4JYAT 3RC3A 2BG9E 4IE6A 4ZEYA 3ZC0A 3AE6A 1FEWA 5L3BB 2WS3A 4YXDA 2EHOC 2JQKA 3RIUA 3RF1A 4AKRB 3CWZB 5LGNB 1IBKT 4NXNT 2KNDA 2BZBA 2JJ9A 5FKYA 5JREA 4LF9T 2XY8B 4JLEA 4AQFC 5FY7A 1EZ3A 2DLRA 1XDOA 4JUYA 4TV8E 2E9XC 3L3PA 1D1BA 1LRZA 1OEDA 3N2GE 3K8PC 2WWVA 1MIWA 4UV8B 2Q9QB 3TLWA 4ZHQE 3UU3A 5HXSA 4YHHT 2KWHA 5LHGB 1D1AA 3LSVA 2V26A 1G73A 2XQ6A 2BBHA 2W67A 2IIUA 4I55E 4MALA 3IF8B 2V8SV 2I6HA 3P4PA 3CQGB 3ETUA 3VRBA 3HA4A 2XQAA 4ZOLE 4I0UA 4QXBB 3FBLA 4L5GA 3LK2B 2K48A 5HWXA 5JDMA 3AE9A 4HEAA 4WNKA 2K9AA 3QOFA 2CMRA 2W2UA 1OWAA 3AE7A 3OBVE 3PUVF 4UR9A 2LSKA 2W61A 2JMKA 1HX1B 2X0LB 3G06A 3H3MA 1Y64B 4H9SE 5DJQC 4CI3B 1WLXA 4E7ZA 4NXMT 1YXRA 2UXNB 2XASB 3PUGA 4K0KT 2CXLA 3PUXF 3AE2A 4IE5A 2XQ7A 3A5XA 4H9NC 2UU9T 3GWHA 5JDQA 1M62A 4PJMA 4ERRA 4GIWA 3P4SA 2ZM0A 1LVFA 5HXRA 4I50E 3FBZA 4OHFA 2Z6EA 3ONJA 2YN6A 2D5UA 2LT3A 3KV9A 2I59A 3P8CD 4P1NA 1HNXT 2E5VA 3EDUA 3VR9A 4GKKT 3GN5B 3VKHA 3U78A 2KT9A 1KFYA 3CPZA 4X66T 5JVDE 2FBWA 2UUAT 1UK5A 4H63V 3CX7B 4KMCA 1FJGT 2Q9QD 2E9XB 5DABA 4GOUA 1AJ3A 3RHWA 2LOSA 4QH1A 5AQSB 5JDLA 4U3CA 3HKBE 4PFPA 4DV2T 2WDRA 3J9X1 3HKDE 4JI7T 3RYFE 1DU2A 1KNRA 4EYUA 4AKHA 2XSAA 5LCYA 1FMWA 4P0BA 4DV5T 1XNQT 2XM2A 3AA6B 2WCAA 3F57A 4AQYT 4U72A 3DJBA 4GK0E 2UXXB 5F8PA 4DV6T 4DVDA 2H89A 3P4RA 4AQGA 2VVNA 5BR8T 1IBLT 3JAFA 4ZZBA 4NUUA 1MIYA 3N2KE 4OK0A 4U2ZA 4WYVA 4AKGA 5FY1A 2IMLA 4GYRA 5EZYE 2KSRA 4EB6E 2LSYA 5HAXA 3WAKA 4E7SA 4YFSA 4PJLA 1XNRT 3Q5XA 3MA9A 4DO0A 3PUQA 1LKXA 4JV5T 3FHNA 5FXXA 5IHYA 4P0AA 3CQXC 3SRZA 5EK4A 1ZHCA 3RH3A 3CIRA 2W00A 2CXFA 4TWDA 4TWFA 4X1YE 3RRWA 3I1AA 5E0OA 5BMVE 5JDGA 3O9XA 4CI2B 2YEVC 2QRXA 3HI2A 4OYJA 1X9BA 3HL6A 3KV4A 2WMNA 3DP7A 3OKQA 2XAQB 3OPCA 5DQWA 3SFDA 4O4HE 4HWIB 5F3JA 2IDOB 3O1IA 2A3DA 1MIVA 2WU2A 4IREA 3ZCIA 1JNRA 5KXJA 3KVAA 1OEDC 2C0SA 4IIJE 3PJAA 4GKJT 2X9WA 3PURA 3C51A 1MMNA 5FL0A 3IEEA 4A5XA 5JR9B 1VRBA 5JDNA 1J1JA 4DV7T 1HNWT 1MNEA 3CKDA 5M4YA 2ZLYA 2J4GA 1YW0A 3Q5DA 5CFBA 4COFA 4YSZA 2V5DA 2UXDT 1NAFA 4DUZT 2V6YB 4ISSA 1XWMA 1ZP0A 2V5CA 4YLHA 1R8IA 2NW7A 4TX5A 2RPAA 5LMNT 2H7VC 2KLQA 5HEGA 4QXHB 2XZEA 2CA5A 2BG9B 5L4HA 3PUSA 3Q5WA 4HN9A 4AKIA 3PJAJ 3TLTA 4NIQA 2KZ7B 2MPKA 3RI5A 2W63A 2EHOD 2YKSA 4H9QC 2XJ7A 4LF7T 5ADXL 1ZV4X 4UVCB 4O8SA 3UUXB 2K5BB 4HKAA 1I94T 3LBXB 4X1IE 4V1Av 3UU6A 1YQ4A 2NWBA 5AQIB 5IYZE 5KX5E 1HX8A 4C91A 2BS2A 4QH4A 4JI4T 4KX6A 4DR7T 2CLYB 4U7YA 1D0ZA 1ZOYA 2W0GA 1O3XA 5L3EB 4IDPA 4YJ3E 2LSGA 4A97A 1WYBA 4KI0F 3ZMZB 3CVRA 4X20E 4CN1A 1M7KA 3AE1A 4A98A 3JC6D 3LG7A 2LSIA 5JR9C 3U3IA 3UU4A 3RIFA 5ABHA 2DNXA 3RKGA 1J5WA 5AQRB 5KDMC 4ILUA 2C5JA 4HWHA 3OTOT 1N32T 5EK2A 4DV0T 3AAIA 3ZKRA 3NRYA 2MYSA 1UX5A 2GK9A 4XZCA 3EI0A 4IL4A 4U7IA 1HF8A 3ZCJA 3OVUA 5L4EA 5C3JA 5LJMA 1XMOT 1YKHB 4WW0A 5JR9A 3N2OA 3N9PA 1XZYA 3PV0F 2VQFT 3N9NA 3E08A 2OA5A 3PUYF 4ISTA 3V5UA 4F8HA 2A2FX 3M3ZB 3FB2A 4NUVA 2IHR1 3EABA 3R84B 2DCFA 5CA0E 4AI6A 2X66A 4IL9A 4HE8A 2ZM8A 3ESLA 4K0UA 2NW8A 2V7KA 5J2TE 3AEAA 3VU7H 2NTYA 3RGLA 5EK3A 3RLFF 4DR1T 3AAEB 1NWMX 5CB4E 2PJQA 3AE5A 3FZFB 3P4QA 1BR4A 4B6XA 5FL1A 5LG4A 1ZKEA 2V1DB 2LLYA 4ILCA 1KK7A 2BKNA 2J62A 2WMOA 1Z0PA 2FJEA 2V7JA 4ZI3D 4ZZCA 5HXEA 3KBUA 2VKJA 2CRBA 3NZPA 4HWCA 4UIGA 2XAJB 3X1DA 1IZNB 2X68A 5H6QB 4EEDA 4F6RC 3UUMA 5L3FB 4CN4A 4AKLA 4EEBA 4WBNE 4BJMA 3E22E 2BKPA 2HPLA 3ZMTB 2SPCA 2W66A 2A72A 3ABVA 2FJBA 3BK9A 3H3AA 2WSSV 5AQKB 3ZT6A 5LXTE 2AE9A 1UUSA 2OV9A 2FJDA 2Y8DA 4KUMB 4ZS3A 4UXNB 5ABGA 2L8KA 4QX8B 4EZ4A 1UX4A 5J2UE 3FZMB 4H9PC 2VQET 2Y48B 2ZMAA 4ZI7E 4IDQA 4UEMA 3KV6A 2ACXA 2LKHA 2VWAA 3GN5A 3PUZF 3QB5K 1Y01A 4GK5E 5HEUA 2F4VT 3FZKB 3OYZA 3IHRA 5L2LA 3PDYA 1X79A 2ACZA 3LK42 3OYXA 1YKEB 2JRKA 3C4WA 2DWGA 4H63H 3ZYLA 4TUYE 4DMVA 5LG3A 2ZM6T 5AFUL 4UVBB 2X9YA 4YTNA 4FJOA 3R6NA 3EHZA 5AQOB 5FVKA 3L8RA 3MACA 4MHCA 3ZSSA 2VASA 1D0YA 4O2AE 4BAYB 2MBGA 4L0RA 1OXZA 5LB7B 4YSXA 4JI3T 4YJ2E 3NKZA 4G63A 3UU5A 2H3RA 3K3OA 3P7IA 3PE0A 3KBTA 2XPKA 3UU8A 4PJNA 5L3CB 3WAJA 4LFCT 2J47A 1KF6A 1MMGA 2DI4A 4PNIA 5AQHB 3S4UA 3PTRB 3RIAA 3RRCA 2CCQA 3RX6A 2D0TA 3ZJ1A 2E2AA 4TZ4C 4AXPA 4UF0A 4JEUB 4CXWA 2ODUA 2JQQA 2LHNA 5ABFA 3VR8A 2VL8A 4Z90A 3Q9DA 4MFRA 4QKNA 4EGWA 3WI3A 3EAMA 2NW9A 4DR2T 3VHLA 4KHZF 3KDSE 4UV9B 2PTFA 3AEGA 2N9DA 2AXDS 3TLVA 4ADZA 1N33T 1IBMT 3ONLC 3NZQA 4X64T 2QGSA 3LK3B 3N5LA 4FI5A 3VKGA 5JRCA 2VKOA 3UT5E 4EXTA 1XMQT 3RYHE 1NEKA 4BA9A 3I9WA 2HN2A 4JI5T 2B1EA 4LMJA 1W9RA 4H9RC 4U2YA 1U5PA 5AQLB 5ETWA 4ZXLA 3RQWA 2WM9A 1IJ6A 3CX8B 1HG5A 5FXVA 3HR0A 1T98A 2IC9A 3C98B 4IE4A 2E9XD 4JEHB 5JDHA 5L47A 2WDVA 3EDVA 5A1LA 4AIUA 2WBLA 1SE7A 1W09A 2LKGA 2Q9QA 4HGAA 4O4LE 3ETVA 2J1DG 4PK6A 4WZXA 3ZT5A 3ZYKA 4JBWF 3ZMUB 3CK6A 3LJCA 4LF5T 2YINA 3ANWB 3RPUA 3GMIA 5FVLA 2JQHA 3C4ZA 4ANJA 5LYJE 2A9UA 2N1GA 5IUXA 3FZLB 3UFGA 2QA7A 2XQ9A 4HFIA 3RYCE 2D9DA 4HFHA 3CMLA 5AQNB 3I9YA 3AA1B 3IBPA 4O4IE 4H9OC 4IE0A 5LBQB 3N9OA 1L0VA 3ZLIA 4HWDA 4C90A 1VOMA 2BDEA 3AAAB 3ZPOA 3LDQB 1QSDA 5TAOA 2XQ8A 3DTOA 4OYKA 3PUWF 4G2AA 4QWNB 4PK4A 5HEHA 3N9MA 1XDPA 3MK7C 4DMWA 2WB5A 2XAHB 4P09A 5J0ZA 1BR2A 2CXDA 1T72A 3SOLA 4CN6A 4AISA 4IHJE 4DBQA 3P4WA 4U74A 2IW5B 1BR0A 1VCSA 4HFDA 3SS1A 5C2TA 4MBQA 1UCUA 3UUBA 4EAHA 3AVSA 2ZM2A 5CGMA 3ONXA 4YHJA 1H7CA 5AQTB 1OEDE 5F5WA 5LGTB 2KXPB 4YSYA 5LGUB 2I0MA 2W62A 5AQUB 3T1YT 1Z8UA 2N2NA 4KHPT 1CUNA 1CHUA 2XAGB 3MXZA 3MZKB 4Q25A 2WZHA 5FYMA 3T1HT 2IC6A 2WQYA 1D1CA 2XM1A 4I4TE 2BS4A 1MMDA 3H37A 4IDNA 4TWHA 3W15B 2YOEA 1WRDA 2YK0A 3BQLA 5HCJA 2XQ4A 2BG9C 2JIWA 5AQVB 2HPJA 2V6YA 1NENA 3A7MA 2YU2A 3AEDA 2MOZA 4JI2T 3UTKA 4M1PA 3RC8A 1KNPA 3RYIE 2D0UA 4KBMB 4CXYA 3MKDA 4B3RT 4IDZA 2WY2A 3P50A 5LMUT 4YTPA 2P9BA 2X0YA 3AXJB 2FJAA 3AEBA 2CPTA 2VK9A 3B13A 1JNZA 3L09A 3NWIA 4Z8XA 2XAFB 4HTEA 2CHNA 4DNDA 2L3LA 5JRCB 3AB3B 5LBMA 1I6ZA 4N78D 5HXHA 3ANWA 4B3MT 4ILBA 5J1GA 2YDQA 3UFEA 2LM2A 2LRKA 4MLKA 2UUBT 2BBJA 4EZHA 2NTXA 2EHOB 3NRXA 3C64A 5LHIB 3JCFA 1SHZC 2DHRA 2B76A 3B5MA 3TLUA 5IWAT 3K1SA 4YY3T 3N9LA 4U33A 1N36T 2IUBA 1S94A 1YQ3A 2WWUA 4LMKA 5AQMB 5L3DB 4PW8A 4GYSA 2V6XA 4PFOA 3ZC1A 3AE8A 2BKOA 3F2EA 4DV1T 2VB6A 2PBIA 4I43B 1J5ET 2XUEA 3LFMA 2FUPA 4TNVA 5JQGE 4EYYR 1IJ5A 3I0OA 3RKOA 1D0XA 2BG9A 4B3TT 1YD8G 2OLTA 5AQPB 1QUUA 3AVRA 1U4QA 3MJXA 3JADA 2KWIB 3M65A 5AQGB 2JQ9A 3ZYMA 4ZI2C 1HS7A 1T8BA 1E2AA 2C5IT 5HWYA 3L39A 3N9QA 3QK6A 5GONE 2HHHT 1ZEEA 3HKCE 4JI0T 5LOVE 4X62T 2K24A 4PJJA 3ZSTA 3KINB 4TN7B 4X1KE 5LHHB 2MTQA 1E7PA 2X0HA 3O1JA 3V5SA 3EUHA 2UXCT 3FXEB 3QC9A 2ES0A 2VVSA 2WDQA 3C50A 1E1HB 2LM9A 4OFZA 1N34T 3SFEA 4JI6T 2DWKA 4QX7B 5AQJB 2WP9A 3AE3A 4CQIA 1GQEA 5L3GB 4DV4T 4QXCB 4ASKA 2BS3A 3O4XE 4HFEA 4ILAA 1W0BA 2RP4A 3AA7B 1WFDA 5H6RB 2YDRA 3QB5A 4HWFA 4UVAB 3NBXX 2H7OA 2X51A 2K3WA 3E0ZA 1B7TA 1UGOA 3AE4A 3AEEA 4LF8T 3SWHA 5HEJA 2WZIA 4DR3T 5LA6E 4JI8T 2CLYC 3RQUA 2PFVA 4QHOA 3AXJA 2H88A 2BVMA 3UULA 2YDSA 3Q2MA 1G8XA 2CE7A 3PU3A 2EHOA 4UELA 5AQQB 2G0UA 2JPFA 2HH7A 3HKEE 4KP3C 1HFAA 1T7SA 5ABEA 1SA0E 1VCTA 2XQ3A 5LJNA 1SUMB 2BVLA 4ZS2A 4CZZB 5FMNA 5JDFA 4CI1B 5AQFB 2LOPA 4ZI3C 3ZN1B 4DR5T 1WR0A 1UURA 3K3NA 2C5KT 2MAWA 4HFVA 3A8YC 3ZN0B 4EOZB 5FNVE 4X5TA 5JTGA 3FXDB 4O2BE 3UQ4A 5HCMA 5CJ5A 1V9DA 2X9HA 1WYCA 2KMFA 3F31A 2XQ5A 2LE8A 2W4XA 4IE7A 4WBOA 2L9QA 2LEHA 1BR1A 3Q5EA 5CA1E 4LMLA 4TNWA 1S35A 2XQYA 1W0AA 2E8IA 3C4XA 4OX9T 3O1HA 1FIOA 3JC6C 1WR6A 4QH5A 3QNUA 3RIUC 3CX6B 3IA3A 4DIDB 4Z91A 4NPPA 4DR4T 5C8YE 3OJAA 1WCRA 1KNZA 2VURA
chains in the Genus database with same CATH topology
1IAPA 4J2CA 1MMAA 5JH7E 2CM0A 2X9XA 4EIWA 5FXWA 2LJLA 2M67A 1HG2A 1US7B 2RA1A 3K3QC 2CWOA 2Y6XA 3KV5A 4UF0B 3ZMSB 2LHRA 3CQCB 4ZI2D 4TV9E 2PG8A 2V7LA 4BJNA 3T8OA 3QUJA 2CEAA 5HXCA 5FP3A 5HYAA 2D2SA 2V7IA 2NP9A 4PK5A 2NOXA 4CXXA 4L9IA 4IGUA 3B57A 4PAGA 2ODVA 1MNDA 5KMGP 5FXZA 3KVBA 3LBXA 4O4JE 2Q9QC 3PU8A 2CWYA 4XAXB 3UUNA 5LNKA 2WAUA 4DBRA 2LSJA 3GA8A 5FY0A 4XBFB 3PUAA 2KINB 3I0QA 2E9XA 3EVYA 3D0TA 3KFWX 2XTLA 4AQFA 2VKDA 1HCIA 2V7MA 5DQVA 1LVKA 5LP6E 3J7Yq 2YU1A 3BQIA 1HTJF 2IAKA 4A56A 3BQKA 3ZMVB 2JMHA 1FMVA 2XHEB 2VKHA 3TKLB 2X67A 3AA0B 3RC3A 4IE6A 3ZC0A 1FEWA 2EHOC 4AKRB 3CWZB 5LGNB 2KNDA 2BZBA 2JJ9A 5JREA 4AQFC 4JLEA 5FY7A 1EZ3A 2DLRA 4JUYA 4TV8E 2E9XC 3L3PA 1D1BA 1LRZA 3N2GE 3K8PC 4ZHQE 1MIWA 4UV8B 2Q9QB 5HXSA 2KWHA 5LHGB 1D1AA 2V26A 1G73A 4I55E 4MALA 4QKNA 5H6RB 3IF8B 3CQGB 3ETUA 3HA4A 4ZOLE 4QXBB 3FBLA 4L5GA 3LK2B 2K48A 5HWXA 5JDMA 4HEAA 4WNKA 2K9AA 2CMRA 1OWAA 3OBVE 2LSKA 2W61A 2JMKA 2X0LB 4CI3B 4E7ZA 1Y64B 4H9SE 5DJQC 1WLXA 3PUGA 2UXNB 2XASB 2CXLA 4IE5A 3A5XA 4H9NC 3GWHA 4PJMA 4ERRA 4GIWA 2ZM0A 1LVFA 5HXRA 4I50E 3FBZA 4OHFA 2Z6EA 2D5UA 2LT3A 3KV9A 2I59A 3P8CD 3VKHA 3EDUA 3GN5B 3U78A 2KT9A 3CPZA 5JVDE 4H63V 3CX7B 4KMCA 2Q9QD 2E9XB 5DABA 4GOUA 1AJ3A 2LOSA 5JDLA 3HKBE 4PFPA 3J9X1 3HKDE 3RYFE 4AKHA 4EYUA 5LCYA 1FMWA 4P0BA 3AA6B 3F57A 4U72A 3DJBA 4GK0E 2UXXB 5F8PA 4DVDA 4AQGA 4NUUA 1MIYA 3N2KE 4OK0A 4AKGA 5FY1A 4GYRA 5EZYE 4EB6E 2LSYA 5HAXA 3WAKA 4E7SA 4YFSA 4PJLA 3Q5XA 3MA9A 4DO0A 3PUQA 1LKXA 3FHNA 5FXXA 5IHYA 4P0AA 3CQXC 3SRZA 5EK4A 1ZHCA 3RH3A 5J2UE 2W00A 2CXFA 4X1YE 3RRWA 3I1AA 5E0OA 5BMVE 5JDGA 3O9XA 4CI2B 2YEVC 3HI2A 4OYJA 3HL6A 3KV4A 2WMNA 3DP7A 3OKQA 2XAQB 5DQWA 4O4HE 5F3JA 3O1IA 2A3DA 1MIVA 3ZCIA 3KVAA 2C0SA 4IIJE 2X9WA 3PURA 3C51A 1MMNA 5JR9B 3IEEA 1VRBA 5JDNA 1MNEA 3CKDA 5M4YA 2ZLYA 1YW0A 1NAFA 4ISSA 4YLHA 2NW7A 4TX5A 2H7VC 2KLQA 4QXHB 2CA5A 3PUSA 3Q5WA 4HN9A 4AKIA 2KZ7B 2W63A 2EHOD 4H9QC 5ADXL 1ZV4X 4UVCB 4O8SA 3UUXB 2K5BB 4HKAA 3LBXB 4X1IE 4V1Av 2NWBA 5IYZE 5KX5E 1HX8A 4C91A 2CLYB 1D0ZA 2W0GA 1O3XA 5L3EB 4YJ3E 5LJNA 2LSGA 1WYBA 3ZMZB 3CVRA 4X20E 5JR9C 3JC6D 3LG7A 2LSIA 3U3IA 2DNXA 5KDMC 4ILUA 2C5JA 5EK2A 3AAIA 3NRYA 2MYSA 1UX5A 2GK9A 4XZCA 3ZCJA 1HF8A 5LJMA 1YKHB 4WW0A 5JR9A 3N2OA 3N9PA 3N9NA 3E08A 2OA5A 4ISTA 3V5UA 2A2FX 3FB2A 4NUVA 3R84B 2DCFA 5CA0E 4AI6A 2X66A 4HE8A 2ZM8A 3ESLA 4K0UA 2NW8A 2V7KA 5J2TE 3VU7H 2NTYA 5EK3A 3AAEB 1NWMX 5CB4E 2PJQA 1BR4A 4B6XA 5LG4A 1ZKEA 2V1DB 1KK7A 2WMOA 5HXEA 1Z0PA 2V7JA 4ZI3D 3KBUA 2VKJA 3NZPA 4UIGA 2XAJB 1IZNB 2X68A 5H6QB 4F6RC 3UUMA 5L3FB 4AKLA 4WBNE 4BJMA 3E22E 2HPLA 3ZMTB 2SPCA 3H3AA 2A72A 5JDQA 3BK9A 5LXTE 5JRCB 2WSSV 4ZS3A 2Y8DA 5L3BB 4KUMB 5LHIB 4UXNB 2L8KA 4QX8B 4EZ4A 1UX4A 4H9PC 2Y48B 2ZMAA 4ZI7E 4UEMA 3KV6A 2ACXA 2VWAA 3GN5A 4GK5E 3OYZA 3IHRA 5L2LA 3PDYA 1X79A 3LK42 3OYXA 1YKEB 2JRKA 3C4WA 2DWGA 4H63H 3ZYLA 4TUYE 4DMVA 5AFUL 4UVBB 2X9YA 4FJOA 3R6NA 3MACA 4MHCA 4BAYB 2VASA 1D0YA 4O2AE 2MBGA 4L0RA 1OXZA 4YJ2E 4G63A 2H3RA 3K3OA 3P7IA 3PE0A 3KBTA 5L3CB 4PJNA 3WAJA 4PNIA 1MMGA 2DI4A 3S4UA 3PTRB 3RRCA 2CCQA 3RX6A 2D0TA 3ZJ1A 4TZ4C 4AXPA 4UF0A 4JEUB 4CXWA 2ODUA 2JQQA 2LHNA 2VL8A 3Q9DA 4MFRA 3WI3A 2NW9A 3VHLA 3KDSE 4UV9B 4ADZA 2N9DA 3NZQA 3VKGA 2QGSA 3LK3B 3N5LA 4FI5A 5JRCA 2VKOA 3UT5E 4EXTA 3RYHE 4BA9A 3ZEFB 3I9WA 2B1EA 4H9RC 1U5PA 5ETWA 2WM9A 1IJ6A 3CX8B 1HG5A 5FXVA 3HR0A 1T98A 2IC9A 3C98B 4IE4A 2E9XD 4JEHB 5JDHA 3EDVA 5A1LA 2WBLA 4HGAA 2Q9QA 4O4LE 3ETVA 2J1DG 4PK6A 3ZYKA 3ZMUB 3LJCA 2YINA 3ANWB 3RPUA 3GMIA 3C4ZA 4ANJA 5LYJE 2N1GA 2QA7A 3RYCE 3CMLA 3I9YA 3AA1B 3IBPA 4O4IE 4H9OC 4IE0A 5LBQB 3N9OA 3ZLIA 4C90A 3AAAB 1VOMA 2BDEA 3ZPOA 5TAOA 1QSDA 3DTOA 4OYKA 4QWNB 4G2AA 4PK4A 4DMWA 3N9MA 3MK7C 2XAHB 4P09A 1BR2A 2CXDA 3SOLA 4IHJE 4DBQA 4U74A 2IW5B 1BR0A 3SS1A 4MBQA 1UCUA 4EAHA 3AVSA 2ZM2A 3ONXA 4YHJA 1H7CA 5LGTB 2KXPB 5LGUB 2W62A 2N2NA 1CUNA 2XAGB 3MXZA 3MZKB 5FYMA 2IC6A 4I4TE 1D1CA 1MMDA 3H37A 3W15B 1WRDA 2YK0A 3BQLA 2HPJA 3RC8A 2YU2A 3UTKA 2MOZA 4M1PA 3RYIE 2D0UA 4KBMB 4CXYA 3MKDA 4IDZA 2P9BA 2VK9A 3B13A 3L09A 4Z8XA 2XAFB 4HTEA 4DNDA 2L3LA 3AB3B 5LBMA 4N78D 5HXHA 3ANWA 5J1GA 3UFEA 4MLKA 4EZHA 2NTXA 2EHOB 3NRXA 3C64A 1SHZC 2DHRA 3N9LA 1S94A 2WWUA 5L3DB 4PW8A 4GYSA 4PFOA 3ZC1A 3F2EA 2VB6A 2PBIA 4I43B 2XUEA 3LFMA 5JQGE 4EYYR 1IJ5A 3I0OA 3RKOA 1D0XA 1YD8G 1QUUA 3AVRA 1U4QA 3MJXA 2KWIB 3M65A 3ZYMA 4ZI2C 1HS7A 2C5IT 5HWYA 3N9QA 3QK6A 5GONE 1ZEEA 3HKCE 5LOVE 2K24A 4PJJA 3KINB 4TN7B 4X1KE 5LHHB 2MTQA 3O1JA 3V5SA 3EUHA 3FXEB 3QC9A 2ES0A 3C50A 1E1HB 2LM9A 4OFZA 2DWKA 4QX7B 4CQIA 5L3GB 4QXCB 4ASKA 3O4XE 3ZJ2A 2RP4A 3AA7B 4UVAB 3NBXX 2H7OA 2X51A 3E0ZA 1B7TA 3SWHA 5LA6E 2CLYC 2PFVA 4QHOA 2BVMA 3UULA 3Q2MA 1G8XA 2CE7A 3PU3A 2EHOA 4UELA 2G0UA 2JPFA 2HH7A 3HKEE 4KP3C 1HFAA 1SA0E 2BVLA 4ZS2A 4CZZB 5FMNA 5JDFA 4CI1B 2LOPA 4ZI3C 3ZN1B 3K3NA 2C5KT 4HFVA 4EOZB 3ZN0B 5FNVE 3FXDB 4O2BE 1V9DA 2X9HA 1WYCA 2KMFA 3F31A 2LE8A 4IE7A 4WBOA 2L9QA 2LEHA 1BR1A 5CA1E 1S35A 2XQYA 2E8IA 3C4XA 3O1HA 1FIOA 3JC6C 1WR6A 3CX6B 5C8YE 3OJAA 1KNZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O9X A;  3GN5 A;  3HI2 A;  3GA8 A;  3GN5 B; 
#chains in the Genus database with same CATH topology
 1IAP A;  3VRA A;  2UUC T;  4J2C A;  4EV6 A;  4DR6 T;  1MMA A;  5JH7 E;  2CM0 A;  2X9X A;  4EIW A;  5FXW A;  2LJL A;  2M67 A;  1HG2 A;  1US7 B;  2RA1 A;  3K3Q C;  2CWO A;  2Y6X A;  3KV5 A;  4LF4 T;  4UF0 B;  3NVO A;  3ZMS B;  2XSB A;  2VL0 A;  2DL1 A;  2LHR A;  3CQC B;  4TV9 E;  4ZI2 D;  2PG8 A;  2QYW A;  2WU5 A;  2V7L A;  4IDO A;  1KEY A;  4LFB T;  2CBJ A;  4BJN A;  3T8O A;  3UQ7 A;  4LF6 T;  3QUJ A;  2CEA A;  5HXC A;  4HFB A;  5FP3 A;  5HYA A;  4YT0 A;  2D2S A;  2V7I A;  4U31 A;  2NP9 A;  4PK5 A;  2NOX A;  4CXX A;  4L9I A;  4IGU A;  3B57 A;  4PAG A;  3TLS A;  1HR0 T;  3ZT7 A;  2M6B A;  2ODV A;  1MND A;  2NR4 A;  5KMG P;  5FXZ A;  4DUY T;  3FZH B;  3KVB A;  1QLB A;  3LBX A;  2Q9Q C;  4O4J E;  2E5L T;  4IT4 A;  3PU8 A;  2CWY A;  3AEC A;  4XAX B;  3UUN A;  5LNK A;  2WAU A;  5HEO A;  4DBR A;  2LSJ A;  3GA8 A;  5FY0 A;  4XBF B;  2QVA A;  3PUA A;  2KIN B;  3I0Q A;  4JI1 T;  2CBI A;  3JAE A;  2E9X A;  3EVY A;  2UXB T;  3D0T A;  3KFW X;  2M6I A;  2XTL A;  2LRL A;  4AQF A;  2VKD A;  1HCI A;  2V7M A;  1HNZ T;  5DQV A;  2R6G F;  1LVK A;  3ZEF B;  3AEF A;  5LP6 E;  2YU1 A;  3BQI A;  1HTJ F;  2IAK A;  4A56 A;  3J7Y q;  3BQK A;  2CHO A;  4DV3 T;  3ZMV B;  4B3S T;  2JMH A;  1FMV A;  2XHE B;  2HN1 A;  2VKH A;  4HFC A;  3ZJ2 A;  1OED B;  3TKL B;  4LFA T;  4X65 T;  2X67 A;  3AA0 B;  5ABF B;  4YTM A;  4JYA T;  3RC3 A;  2BG9 E;  4IE6 A;  4ZEY A;  3ZC0 A;  3AE6 A;  1FEW A;  5L3B B;  2WS3 A;  4YXD A;  2EHO C;  2JQK A;  3RIU A;  3RF1 A;  4AKR B;  3CWZ B;  5LGN B;  1IBK T;  4NXN T;  2KND A;  2BZB A;  2JJ9 A;  5FKY A;  5JRE A;  4LF9 T;  2XY8 B;  4JLE A;  4AQF C;  5FY7 A;  1EZ3 A;  2DLR A;  1XDO A;  4JUY A;  4TV8 E;  2E9X C;  3L3P A;  1D1B A;  1LRZ A;  1OED A;  3N2G E;  3K8P C;  2WWV A;  1MIW A;  4UV8 B;  2Q9Q B;  3TLW A;  4ZHQ E;  3UU3 A;  5HXS A;  4YHH T;  2KWH A;  5LHG B;  1D1A A;  3LSV A;  2V26 A;  1G73 A;  2XQ6 A;  2BBH A;  2W67 A;  2IIU A;  4I55 E;  4MAL A;  3IF8 B;  2V8S V;  2I6H A;  3P4P A;  3CQG B;  3ETU A;  3VRB A;  3HA4 A;  2XQA A;  4ZOL E;  4I0U A;  4QXB B;  3FBL A;  4L5G A;  3LK2 B;  2K48 A;  5HWX A;  5JDM A;  3AE9 A;  4HEA A;  4WNK A;  2K9A A;  3QOF A;  2CMR A;  2W2U A;  1OWA A;  3AE7 A;  3OBV E;  3PUV F;  4UR9 A;  2LSK A;  2W61 A;  2JMK A;  1HX1 B;  2X0L B;  3G06 A;  3H3M A;  1Y64 B;  4H9S E;  5DJQ C;  4CI3 B;  1WLX A;  4E7Z A;  4NXM T;  1YXR A;  2UXN B;  2XAS B;  3PUG A;  4K0K T;  2CXL A;  3PUX F;  3AE2 A;  4IE5 A;  2XQ7 A;  3A5X A;  4H9N C;  2UU9 T;  3GWH A;  5JDQ A;  1M62 A;  4PJM A;  4ERR A;  4GIW A;  3P4S A;  2ZM0 A;  1LVF A;  5HXR A;  4I50 E;  3FBZ A;  4OHF A;  2Z6E A;  3ONJ A;  2YN6 A;  2D5U A;  2LT3 A;  3KV9 A;  2I59 A;  3P8C D;  4P1N A;  1HNX T;  2E5V A;  3EDU A;  3VR9 A;  4GKK T;  3GN5 B;  3VKH A;  3U78 A;  2KT9 A;  1KFY A;  3CPZ A;  4X66 T;  5JVD E;  2FBW A;  2UUA T;  1UK5 A;  4H63 V;  3CX7 B;  4KMC A;  1FJG T;  2Q9Q D;  2E9X B;  5DAB A;  4GOU A;  1AJ3 A;  3RHW A;  2LOS A;  4QH1 A;  5AQS B;  5JDL A;  4U3C A;  3HKB E;  4PFP A;  4DV2 T;  2WDR A;  3J9X 1;  3HKD E;  4JI7 T;  3RYF E;  1DU2 A;  1KNR A;  4EYU A;  4AKH A;  2XSA A;  5LCY A;  1FMW A;  4P0B A;  4DV5 T;  1XNQ T;  2XM2 A;  3AA6 B;  2WCA A;  3F57 A;  4AQY T;  4U72 A;  3DJB A;  4GK0 E;  2UXX B;  5F8P A;  4DV6 T;  4DVD A;  2H89 A;  3P4R A;  4AQG A;  2VVN A;  5BR8 T;  1IBL T;  3JAF A;  4ZZB A;  4NUU A;  1MIY A;  3N2K E;  4OK0 A;  4U2Z A;  4WYV A;  4AKG A;  5FY1 A;  2IML A;  4GYR A;  5EZY E;  2KSR A;  4EB6 E;  2LSY A;  5HAX A;  3WAK A;  4E7S A;  4YFS A;  4PJL A;  1XNR T;  3Q5X A;  3MA9 A;  4DO0 A;  3PUQ A;  1LKX A;  4JV5 T;  3FHN A;  5FXX A;  5IHY A;  4P0A A;  3CQX C;  3SRZ A;  5EK4 A;  1ZHC A;  3RH3 A;  3CIR A;  2W00 A;  2CXF A;  4TWD A;  4TWF A;  4X1Y E;  3RRW A;  3I1A A;  5E0O A;  5BMV E;  5JDG A;  3O9X A;  4CI2 B;  2YEV C;  2QRX A;  3HI2 A;  4OYJ A;  1X9B A;  3HL6 A;  3KV4 A;  2WMN A;  3DP7 A;  3OKQ A;  2XAQ B;  3OPC A;  5DQW A;  3SFD A;  4O4H E;  4HWI B;  5F3J A;  2IDO B;  3O1I A;  2A3D A;  1MIV A;  2WU2 A;  4IRE A;  3ZCI A;  1JNR A;  5KXJ A;  3KVA A;  1OED C;  2C0S A;  4IIJ E;  3PJA A;  4GKJ T;  2X9W A;  3PUR A;  3C51 A;  1MMN A;  5FL0 A;  3IEE A;  4A5X A;  5JR9 B;  1VRB A;  5JDN A;  1J1J A;  4DV7 T;  1HNW T;  1MNE A;  3CKD A;  5M4Y A;  2ZLY A;  2J4G A;  1YW0 A;  3Q5D A;  5CFB A;  4COF A;  4YSZ A;  2V5D A;  2UXD T;  1NAF A;  4DUZ T;  2V6Y B;  4ISS A;  1XWM A;  1ZP0 A;  2V5C A;  4YLH A;  1R8I A;  2NW7 A;  4TX5 A;  2RPA A;  5LMN T;  2H7V C;  2KLQ A;  5HEG A;  4QXH B;  2XZE A;  2CA5 A;  2BG9 B;  5L4H A;  3PUS A;  3Q5W A;  4HN9 A;  4AKI A;  3PJA J;  3TLT A;  4NIQ A;  2KZ7 B;  2MPK A;  3RI5 A;  2W63 A;  2EHO D;  2YKS A;  4H9Q C;  2XJ7 A;  4LF7 T;  5ADX L;  1ZV4 X;  4UVC B;  4O8S A;  3UUX B;  2K5B B;  4HKA A;  1I94 T;  3LBX B;  4X1I E;  4V1A v;  3UU6 A;  1YQ4 A;  2NWB A;  5AQI B;  5IYZ E;  5KX5 E;  1HX8 A;  4C91 A;  2BS2 A;  4QH4 A;  4JI4 T;  4KX6 A;  4DR7 T;  2CLY B;  4U7Y A;  1D0Z A;  1ZOY A;  2W0G A;  1O3X A;  5L3E B;  4IDP A;  4YJ3 E;  2LSG A;  4A97 A;  1WYB A;  4KI0 F;  3ZMZ B;  3CVR A;  4X20 E;  4CN1 A;  1M7K A;  3AE1 A;  4A98 A;  3JC6 D;  3LG7 A;  2LSI A;  5JR9 C;  3U3I A;  3UU4 A;  3RIF A;  5ABH A;  2DNX A;  3RKG A;  1J5W A;  5AQR B;  5KDM C;  4ILU A;  2C5J A;  4HWH A;  3OTO T;  1N32 T;  5EK2 A;  4DV0 T;  3AAI A;  3ZKR A;  3NRY A;  2MYS A;  1UX5 A;  2GK9 A;  4XZC A;  3EI0 A;  4IL4 A;  4U7I A;  1HF8 A;  3ZCJ A;  3OVU A;  5L4E A;  5C3J A;  5LJM A;  1XMO T;  1YKH B;  4WW0 A;  5JR9 A;  3N2O A;  3N9P A;  1XZY A;  3PV0 F;  2VQF T;  3N9N A;  3E08 A;  2OA5 A;  3PUY F;  4IST A;  3V5U A;  4F8H A;  2A2F X;  3M3Z B;  3FB2 A;  4NUV A;  2IHR 1;  3EAB A;  3R84 B;  2DCF A;  5CA0 E;  4AI6 A;  2X66 A;  4IL9 A;  4HE8 A;  2ZM8 A;  3ESL A;  4K0U A;  2NW8 A;  2V7K A;  5J2T E;  3AEA A;  3VU7 H;  2NTY A;  3RGL A;  5EK3 A;  3RLF F;  4DR1 T;  3AAE B;  1NWM X;  5CB4 E;  2PJQ A;  3AE5 A;  3FZF B;  3P4Q A;  1BR4 A;  4B6X A;  5FL1 A;  5LG4 A;  1ZKE A;  2V1D B;  2LLY A;  4ILC A;  1KK7 A;  2BKN A;  2J62 A;  2WMO A;  1Z0P A;  2FJE A;  2V7J A;  4ZI3 D;  4ZZC A;  5HXE A;  3KBU A;  2VKJ A;  2CRB A;  3NZP A;  4HWC A;  4UIG A;  2XAJ B;  3X1D A;  1IZN B;  2X68 A;  5H6Q B;  4EED A;  4F6R C;  3UUM A;  5L3F B;  4CN4 A;  4AKL A;  4EEB A;  4WBN E;  4BJM A;  3E22 E;  2BKP A;  2HPL A;  3ZMT B;  2SPC A;  2W66 A;  2A72 A;  3ABV A;  2FJB A;  3BK9 A;  3H3A A;  2WSS V;  5AQK B;  3ZT6 A;  5LXT E;  2AE9 A;  1UUS A;  2OV9 A;  2FJD A;  2Y8D A;  4KUM B;  4ZS3 A;  4UXN B;  5ABG A;  2L8K A;  4QX8 B;  4EZ4 A;  1UX4 A;  5J2U E;  3FZM B;  4H9P C;  2VQE T;  2Y48 B;  2ZMA A;  4ZI7 E;  4IDQ A;  4UEM A;  3KV6 A;  2ACX A;  2LKH A;  2VWA A;  3GN5 A;  3PUZ F;  3QB5 K;  1Y01 A;  4GK5 E;  5HEU A;  2F4V T;  3FZK B;  3OYZ A;  3IHR A;  5L2L A;  3PDY A;  1X79 A;  2ACZ A;  3LK4 2;  3OYX A;  1YKE B;  2JRK A;  3C4W A;  2DWG A;  4H63 H;  3ZYL A;  4TUY E;  4DMV A;  5LG3 A;  2ZM6 T;  5AFU L;  4UVB B;  2X9Y A;  4YTN A;  4FJO A;  3R6N A;  3EHZ A;  5AQO B;  5FVK A;  3L8R A;  3MAC A;  4MHC A;  3ZSS A;  2VAS A;  1D0Y A;  4O2A E;  4BAY B;  2MBG A;  4L0R A;  1OXZ A;  5LB7 B;  4YSX A;  4JI3 T;  4YJ2 E;  3NKZ A;  4G63 A;  3UU5 A;  2H3R A;  3K3O A;  3P7I A;  3PE0 A;  3KBT A;  2XPK A;  3UU8 A;  4PJN A;  5L3C B;  3WAJ A;  4LFC T;  2J47 A;  1KF6 A;  1MMG A;  2DI4 A;  4PNI A;  5AQH B;  3S4U A;  3PTR B;  3RIA A;  3RRC A;  2CCQ A;  3RX6 A;  2D0T A;  3ZJ1 A;  2E2A A;  4TZ4 C;  4AXP A;  4UF0 A;  4JEU B;  4CXW A;  2ODU A;  2JQQ A;  2LHN A;  5ABF A;  3VR8 A;  2VL8 A;  4Z90 A;  3Q9D A;  4MFR A;  4QKN A;  4EGW A;  3WI3 A;  3EAM A;  2NW9 A;  4DR2 T;  3VHL A;  4KHZ F;  3KDS E;  4UV9 B;  2PTF A;  3AEG A;  2N9D A;  2AXD S;  3TLV A;  4ADZ A;  1N33 T;  1IBM T;  3ONL C;  3NZQ A;  4X64 T;  2QGS A;  3LK3 B;  3N5L A;  4FI5 A;  3VKG A;  5JRC A;  2VKO A;  3UT5 E;  4EXT A;  1XMQ T;  3RYH E;  1NEK A;  4BA9 A;  3I9W A;  2HN2 A;  4JI5 T;  2B1E A;  4LMJ A;  1W9R A;  4H9R C;  4U2Y A;  1U5P A;  5AQL B;  5ETW A;  4ZXL A;  3RQW A;  2WM9 A;  1IJ6 A;  3CX8 B;  1HG5 A;  5FXV A;  3HR0 A;  1T98 A;  2IC9 A;  3C98 B;  4IE4 A;  2E9X D;  4JEH B;  5JDH A;  5L47 A;  2WDV A;  3EDV A;  5A1L A;  4AIU A;  2WBL A;  1SE7 A;  1W09 A;  2LKG A;  2Q9Q A;  4HGA A;  4O4L E;  3ETV A;  2J1D G;  4PK6 A;  4WZX A;  3ZT5 A;  3ZYK A;  4JBW F;  3ZMU B;  3CK6 A;  3LJC A;  4LF5 T;  2YIN A;  3ANW B;  3RPU A;  3GMI A;  5FVL A;  2JQH A;  3C4Z A;  4ANJ A;  5LYJ E;  2A9U A;  2N1G A;  5IUX A;  3FZL B;  3UFG A;  2QA7 A;  2XQ9 A;  4HFI A;  3RYC E;  2D9D A;  4HFH A;  3CML A;  5AQN B;  3I9Y A;  3AA1 B;  3IBP A;  4O4I E;  4H9O C;  4IE0 A;  5LBQ B;  3N9O A;  1L0V A;  3ZLI A;  4HWD A;  4C90 A;  1VOM A;  2BDE A;  3AAA B;  3ZPO A;  3LDQ B;  1QSD A;  5TAO A;  2XQ8 A;  3DTO A;  4OYK A;  3PUW F;  4G2A A;  4QWN B;  4PK4 A;  5HEH A;  3N9M A;  1XDP A;  3MK7 C;  4DMW A;  2WB5 A;  2XAH B;  4P09 A;  5J0Z A;  1BR2 A;  2CXD A;  1T72 A;  3SOL A;  4CN6 A;  4AIS A;  4IHJ E;  4DBQ A;  3P4W A;  4U74 A;  2IW5 B;  1BR0 A;  1VCS A;  4HFD A;  3SS1 A;  5C2T A;  4MBQ A;  1UCU A;  3UUB A;  4EAH A;  3AVS A;  2ZM2 A;  5CGM A;  3ONX A;  4YHJ A;  1H7C A;  5AQT B;  1OED E;  5F5W A;  5LGT B;  2KXP B;  4YSY A;  5LGU B;  2I0M A;  2W62 A;  5AQU B;  3T1Y T;  1Z8U A;  2N2N A;  4KHP T;  1CUN A;  1CHU A;  2XAG B;  3MXZ A;  3MZK B;  4Q25 A;  2WZH A;  5FYM A;  3T1H T;  2IC6 A;  2WQY A;  1D1C A;  2XM1 A;  4I4T E;  2BS4 A;  1MMD A;  3H37 A;  4IDN A;  4TWH A;  3W15 B;  2YOE A;  1WRD A;  2YK0 A;  3BQL A;  5HCJ A;  2XQ4 A;  2BG9 C;  2JIW A;  5AQV B;  2HPJ A;  2V6Y A;  1NEN A;  3A7M A;  2YU2 A;  3AED A;  2MOZ A;  4JI2 T;  3UTK A;  4M1P A;  3RC8 A;  1KNP A;  3RYI E;  2D0U A;  4KBM B;  4CXY A;  3MKD A;  4B3R T;  4IDZ A;  2WY2 A;  3P50 A;  5LMU T;  4YTP A;  2P9B A;  2X0Y A;  3AXJ B;  2FJA A;  3AEB A;  2CPT A;  2VK9 A;  3B13 A;  1JNZ A;  3L09 A;  3NWI A;  4Z8X A;  2XAF B;  4HTE A;  2CHN A;  4DND A;  2L3L A;  5JRC B;  3AB3 B;  5LBM A;  1I6Z A;  4N78 D;  5HXH A;  3ANW A;  4B3M T;  4ILB A;  5J1G A;  2YDQ A;  3UFE A;  2LM2 A;  2LRK A;  4MLK A;  2UUB T;  2BBJ A;  4EZH A;  2NTX A;  2EHO B;  3NRX A;  3C64 A;  5LHI B;  3JCF A;  1SHZ C;  2DHR A;  2B76 A;  3B5M A;  3TLU A;  5IWA T;  3K1S A;  4YY3 T;  3N9L A;  4U33 A;  1N36 T;  2IUB A;  1S94 A;  1YQ3 A;  2WWU A;  4LMK A;  5AQM B;  5L3D B;  4PW8 A;  4GYS A;  2V6X A;  4PFO A;  3ZC1 A;  3AE8 A;  2BKO A;  3F2E A;  4DV1 T;  2VB6 A;  2PBI A;  4I43 B;  1J5E T;  2XUE A;  3LFM A;  2FUP A;  4TNV A;  5JQG E;  4EYY R;  1IJ5 A;  3I0O A;  3RKO A;  1D0X A;  2BG9 A;  4B3T T;  1YD8 G;  2OLT A;  5AQP B;  1QUU A;  3AVR A;  1U4Q A;  3MJX A;  3JAD A;  2KWI B;  3M65 A;  5AQG B;  2JQ9 A;  3ZYM A;  4ZI2 C;  1HS7 A;  1T8B A;  1E2A A;  2C5I T;  5HWY A;  3L39 A;  3N9Q A;  3QK6 A;  5GON E;  2HHH T;  1ZEE A;  3HKC E;  4JI0 T;  5LOV E;  4X62 T;  2K24 A;  4PJJ A;  3ZST A;  3KIN B;  4TN7 B;  4X1K E;  5LHH B;  2MTQ A;  1E7P A;  2X0H A;  3O1J A;  3V5S A;  3EUH A;  2UXC T;  3FXE B;  3QC9 A;  2ES0 A;  2VVS A;  2WDQ A;  3C50 A;  1E1H B;  2LM9 A;  4OFZ A;  1N34 T;  3SFE A;  4JI6 T;  2DWK A;  4QX7 B;  5AQJ B;  2WP9 A;  3AE3 A;  4CQI A;  1GQE A;  5L3G B;  4DV4 T;  4QXC B;  4ASK A;  2BS3 A;  3O4X E;  4HFE A;  4ILA A;  1W0B A;  2RP4 A;  3AA7 B;  1WFD A;  5H6R B;  2YDR A;  3QB5 A;  4HWF A;  4UVA B;  3NBX X;  2H7O A;  2X51 A;  2K3W A;  3E0Z A;  1B7T A;  1UGO A;  3AE4 A;  3AEE A;  4LF8 T;  3SWH A;  5HEJ A;  2WZI A;  4DR3 T;  5LA6 E;  4JI8 T;  2CLY C;  3RQU A;  2PFV A;  4QHO A;  3AXJ A;  2H88 A;  2BVM A;  3UUL A;  2YDS A;  3Q2M A;  1G8X A;  2CE7 A;  3PU3 A;  2EHO A;  4UEL A;  5AQQ B;  2G0U A;  2JPF A;  2HH7 A;  3HKE E;  4KP3 C;  1HFA A;  1T7S A;  5ABE A;  1SA0 E;  1VCT A;  2XQ3 A;  5LJN A;  1SUM B;  2BVL A;  4ZS2 A;  4CZZ B;  5FMN A;  5JDF A;  4CI1 B;  5AQF B;  2LOP A;  4ZI3 C;  3ZN1 B;  4DR5 T;  1WR0 A;  1UUR A;  3K3N A;  2C5K T;  2MAW A;  4HFV A;  3A8Y C;  3ZN0 B;  4EOZ B;  5FNV E;  4X5T A;  5JTG A;  3FXD B;  4O2B E;  3UQ4 A;  5HCM A;  5CJ5 A;  1V9D A;  2X9H A;  1WYC A;  2KMF A;  3F31 A;  2XQ5 A;  2LE8 A;  2W4X A;  4IE7 A;  4WBO A;  2L9Q A;  2LEH A;  1BR1 A;  3Q5E A;  5CA1 E;  4LML A;  4TNW A;  1S35 A;  2XQY A;  1W0A A;  2E8I A;  3C4X A;  4OX9 T;  3O1H A;  1FIO A;  3JC6 C;  1WR6 A;  4QH5 A;  3QNU A;  3RIU C;  3CX6 B;  3IA3 A;  4DID B;  4Z91 A;  4NPP A;  4DR4 T;  5C8Y E;  3OJA A;  1WCR A;  1KNZ A;  2VUR A; 
#chains in the Genus database with same CATH homology
 1IAP A;  4J2C A;  1MMA A;  5JH7 E;  2CM0 A;  2X9X A;  4EIW A;  5FXW A;  2LJL A;  2M67 A;  1HG2 A;  1US7 B;  2RA1 A;  3K3Q C;  2CWO A;  2Y6X A;  3KV5 A;  4UF0 B;  3ZMS B;  2LHR A;  3CQC B;  4ZI2 D;  4TV9 E;  2PG8 A;  2V7L A;  4BJN A;  3T8O A;  3QUJ A;  2CEA A;  5HXC A;  5FP3 A;  5HYA A;  2D2S A;  2V7I A;  2NP9 A;  4PK5 A;  2NOX A;  4CXX A;  4L9I A;  4IGU A;  3B57 A;  4PAG A;  2ODV A;  1MND A;  5KMG P;  5FXZ A;  3KVB A;  3LBX A;  4O4J E;  2Q9Q C;  3PU8 A;  2CWY A;  4XAX B;  3UUN A;  5LNK A;  2WAU A;  4DBR A;  2LSJ A;  3GA8 A;  5FY0 A;  4XBF B;  3PUA A;  2KIN B;  3I0Q A;  2E9X A;  3EVY A;  3D0T A;  3KFW X;  2XTL A;  4AQF A;  2VKD A;  1HCI A;  2V7M A;  5DQV A;  1LVK A;  5LP6 E;  3J7Y q;  2YU1 A;  3BQI A;  1HTJ F;  2IAK A;  4A56 A;  3BQK A;  3ZMV B;  2JMH A;  1FMV A;  2XHE B;  2VKH A;  3TKL B;  2X67 A;  3AA0 B;  3RC3 A;  4IE6 A;  3ZC0 A;  1FEW A;  2EHO C;  4AKR B;  3CWZ B;  5LGN B;  2KND A;  2BZB A;  2JJ9 A;  5JRE A;  4AQF C;  4JLE A;  5FY7 A;  1EZ3 A;  2DLR A;  4JUY A;  4TV8 E;  2E9X C;  3L3P A;  1D1B A;  1LRZ A;  3N2G E;  3K8P C;  4ZHQ E;  1MIW A;  4UV8 B;  2Q9Q B;  5HXS A;  2KWH A;  5LHG B;  1D1A A;  2V26 A;  1G73 A;  4I55 E;  4MAL A;  4QKN A;  5H6R B;  3IF8 B;  3CQG B;  3ETU A;  3HA4 A;  4ZOL E;  4QXB B;  3FBL A;  4L5G A;  3LK2 B;  2K48 A;  5HWX A;  5JDM A;  4HEA A;  4WNK A;  2K9A A;  2CMR A;  1OWA A;  3OBV E;  2LSK A;  2W61 A;  2JMK A;  2X0L B;  4CI3 B;  4E7Z A;  1Y64 B;  4H9S E;  5DJQ C;  1WLX A;  3PUG A;  2UXN B;  2XAS B;  2CXL A;  4IE5 A;  3A5X A;  4H9N C;  3GWH A;  4PJM A;  4ERR A;  4GIW A;  2ZM0 A;  1LVF A;  5HXR A;  4I50 E;  3FBZ A;  4OHF A;  2Z6E A;  2D5U A;  2LT3 A;  3KV9 A;  2I59 A;  3P8C D;  3VKH A;  3EDU A;  3GN5 B;  3U78 A;  2KT9 A;  3CPZ A;  5JVD E;  4H63 V;  3CX7 B;  4KMC A;  2Q9Q D;  2E9X B;  5DAB A;  4GOU A;  1AJ3 A;  2LOS A;  5JDL A;  3HKB E;  4PFP A;  3J9X 1;  3HKD E;  3RYF E;  4AKH A;  4EYU A;  5LCY A;  1FMW A;  4P0B A;  3AA6 B;  3F57 A;  4U72 A;  3DJB A;  4GK0 E;  2UXX B;  5F8P A;  4DVD A;  4AQG A;  4NUU A;  1MIY A;  3N2K E;  4OK0 A;  4AKG A;  5FY1 A;  4GYR A;  5EZY E;  4EB6 E;  2LSY A;  5HAX A;  3WAK A;  4E7S A;  4YFS A;  4PJL A;  3Q5X A;  3MA9 A;  4DO0 A;  3PUQ A;  1LKX A;  3FHN A;  5FXX A;  5IHY A;  4P0A A;  3CQX C;  3SRZ A;  5EK4 A;  1ZHC A;  3RH3 A;  5J2U E;  2W00 A;  2CXF A;  4X1Y E;  3RRW A;  3I1A A;  5E0O A;  5BMV E;  5JDG A;  3O9X A;  4CI2 B;  2YEV C;  3HI2 A;  4OYJ A;  3HL6 A;  3KV4 A;  2WMN A;  3DP7 A;  3OKQ A;  2XAQ B;  5DQW A;  4O4H E;  5F3J A;  3O1I A;  2A3D A;  1MIV A;  3ZCI A;  3KVA A;  2C0S A;  4IIJ E;  2X9W A;  3PUR A;  3C51 A;  1MMN A;  5JR9 B;  3IEE A;  1VRB A;  5JDN A;  1MNE A;  3CKD A;  5M4Y A;  2ZLY A;  1YW0 A;  1NAF A;  4ISS A;  4YLH A;  2NW7 A;  4TX5 A;  2H7V C;  2KLQ A;  4QXH B;  2CA5 A;  3PUS A;  3Q5W A;  4HN9 A;  4AKI A;  2KZ7 B;  2W63 A;  2EHO D;  4H9Q C;  5ADX L;  1ZV4 X;  4UVC B;  4O8S A;  3UUX B;  2K5B B;  4HKA A;  3LBX B;  4X1I E;  4V1A v;  2NWB A;  5IYZ E;  5KX5 E;  1HX8 A;  4C91 A;  2CLY B;  1D0Z A;  2W0G A;  1O3X A;  5L3E B;  4YJ3 E;  5LJN A;  2LSG A;  1WYB A;  3ZMZ B;  3CVR A;  4X20 E;  5JR9 C;  3JC6 D;  3LG7 A;  2LSI A;  3U3I A;  2DNX A;  5KDM C;  4ILU A;  2C5J A;  5EK2 A;  3AAI A;  3NRY A;  2MYS A;  1UX5 A;  2GK9 A;  4XZC A;  3ZCJ A;  1HF8 A;  5LJM A;  1YKH B;  4WW0 A;  5JR9 A;  3N2O A;  3N9P A;  3N9N A;  3E08 A;  2OA5 A;  4IST A;  3V5U A;  2A2F X;  3FB2 A;  4NUV A;  3R84 B;  2DCF A;  5CA0 E;  4AI6 A;  2X66 A;  4HE8 A;  2ZM8 A;  3ESL A;  4K0U A;  2NW8 A;  2V7K A;  5J2T E;  3VU7 H;  2NTY A;  5EK3 A;  3AAE B;  1NWM X;  5CB4 E;  2PJQ A;  1BR4 A;  4B6X A;  5LG4 A;  1ZKE A;  2V1D B;  1KK7 A;  2WMO A;  5HXE A;  1Z0P A;  2V7J A;  4ZI3 D;  3KBU A;  2VKJ A;  3NZP A;  4UIG A;  2XAJ B;  1IZN B;  2X68 A;  5H6Q B;  4F6R C;  3UUM A;  5L3F B;  4AKL A;  4WBN E;  4BJM A;  3E22 E;  2HPL A;  3ZMT B;  2SPC A;  3H3A A;  2A72 A;  5JDQ A;  3BK9 A;  5LXT E;  5JRC B;  2WSS V;  4ZS3 A;  2Y8D A;  5L3B B;  4KUM B;  5LHI B;  4UXN B;  2L8K A;  4QX8 B;  4EZ4 A;  1UX4 A;  4H9P C;  2Y48 B;  2ZMA A;  4ZI7 E;  4UEM A;  3KV6 A;  2ACX A;  2VWA A;  3GN5 A;  4GK5 E;  3OYZ A;  3IHR A;  5L2L A;  3PDY A;  1X79 A;  3LK4 2;  3OYX A;  1YKE B;  2JRK A;  3C4W A;  2DWG A;  4H63 H;  3ZYL A;  4TUY E;  4DMV A;  5AFU L;  4UVB B;  2X9Y A;  4FJO A;  3R6N A;  3MAC A;  4MHC A;  4BAY B;  2VAS A;  1D0Y A;  4O2A E;  2MBG A;  4L0R A;  1OXZ A;  4YJ2 E;  4G63 A;  2H3R A;  3K3O A;  3P7I A;  3PE0 A;  3KBT A;  5L3C B;  4PJN A;  3WAJ A;  4PNI A;  1MMG A;  2DI4 A;  3S4U A;  3PTR B;  3RRC A;  2CCQ A;  3RX6 A;  2D0T A;  3ZJ1 A;  4TZ4 C;  4AXP A;  4UF0 A;  4JEU B;  4CXW A;  2ODU A;  2JQQ A;  2LHN A;  2VL8 A;  3Q9D A;  4MFR A;  3WI3 A;  2NW9 A;  3VHL A;  3KDS E;  4UV9 B;  4ADZ A;  2N9D A;  3NZQ A;  3VKG A;  2QGS A;  3LK3 B;  3N5L A;  4FI5 A;  5JRC A;  2VKO A;  3UT5 E;  4EXT A;  3RYH E;  4BA9 A;  3ZEF B;  3I9W A;  2B1E A;  4H9R C;  1U5P A;  5ETW A;  2WM9 A;  1IJ6 A;  3CX8 B;  1HG5 A;  5FXV A;  3HR0 A;  1T98 A;  2IC9 A;  3C98 B;  4IE4 A;  2E9X D;  4JEH B;  5JDH A;  3EDV A;  5A1L A;  2WBL A;  4HGA A;  2Q9Q A;  4O4L E;  3ETV A;  2J1D G;  4PK6 A;  3ZYK A;  3ZMU B;  3LJC A;  2YIN A;  3ANW B;  3RPU A;  3GMI A;  3C4Z A;  4ANJ A;  5LYJ E;  2N1G A;  2QA7 A;  3RYC E;  3CML A;  3I9Y A;  3AA1 B;  3IBP A;  4O4I E;  4H9O C;  4IE0 A;  5LBQ B;  3N9O A;  3ZLI A;  4C90 A;  3AAA B;  1VOM A;  2BDE A;  3ZPO A;  5TAO A;  1QSD A;  3DTO A;  4OYK A;  4QWN B;  4G2A A;  4PK4 A;  4DMW A;  3N9M A;  3MK7 C;  2XAH B;  4P09 A;  1BR2 A;  2CXD A;  3SOL A;  4IHJ E;  4DBQ A;  4U74 A;  2IW5 B;  1BR0 A;  3SS1 A;  4MBQ A;  1UCU A;  4EAH A;  3AVS A;  2ZM2 A;  3ONX A;  4YHJ A;  1H7C A;  5LGT B;  2KXP B;  5LGU B;  2W62 A;  2N2N A;  1CUN A;  2XAG B;  3MXZ A;  3MZK B;  5FYM A;  2IC6 A;  4I4T E;  1D1C A;  1MMD A;  3H37 A;  3W15 B;  1WRD A;  2YK0 A;  3BQL A;  2HPJ A;  3RC8 A;  2YU2 A;  3UTK A;  2MOZ A;  4M1P A;  3RYI E;  2D0U A;  4KBM B;  4CXY A;  3MKD A;  4IDZ A;  2P9B A;  2VK9 A;  3B13 A;  3L09 A;  4Z8X A;  2XAF B;  4HTE A;  4DND A;  2L3L A;  3AB3 B;  5LBM A;  4N78 D;  5HXH A;  3ANW A;  5J1G A;  3UFE A;  4MLK A;  4EZH A;  2NTX A;  2EHO B;  3NRX A;  3C64 A;  1SHZ C;  2DHR A;  3N9L A;  1S94 A;  2WWU A;  5L3D B;  4PW8 A;  4GYS A;  4PFO A;  3ZC1 A;  3F2E A;  2VB6 A;  2PBI A;  4I43 B;  2XUE A;  3LFM A;  5JQG E;  4EYY R;  1IJ5 A;  3I0O A;  3RKO A;  1D0X A;  1YD8 G;  1QUU A;  3AVR A;  1U4Q A;  3MJX A;  2KWI B;  3M65 A;  3ZYM A;  4ZI2 C;  1HS7 A;  2C5I T;  5HWY A;  3N9Q A;  3QK6 A;  5GON E;  1ZEE A;  3HKC E;  5LOV E;  2K24 A;  4PJJ A;  3KIN B;  4TN7 B;  4X1K E;  5LHH B;  2MTQ A;  3O1J A;  3V5S A;  3EUH A;  3FXE B;  3QC9 A;  2ES0 A;  3C50 A;  1E1H B;  2LM9 A;  4OFZ A;  2DWK A;  4QX7 B;  4CQI A;  5L3G B;  4QXC B;  4ASK A;  3O4X E;  3ZJ2 A;  2RP4 A;  3AA7 B;  4UVA B;  3NBX X;  2H7O A;  2X51 A;  3E0Z A;  1B7T A;  3SWH A;  5LA6 E;  2CLY C;  2PFV A;  4QHO A;  2BVM A;  3UUL A;  3Q2M A;  1G8X A;  2CE7 A;  3PU3 A;  2EHO A;  4UEL A;  2G0U A;  2JPF A;  2HH7 A;  3HKE E;  4KP3 C;  1HFA A;  1SA0 E;  2BVL A;  4ZS2 A;  4CZZ B;  5FMN A;  5JDF A;  4CI1 B;  2LOP A;  4ZI3 C;  3ZN1 B;  3K3N A;  2C5K T;  4HFV A;  4EOZ B;  3ZN0 B;  5FNV E;  3FXD B;  4O2B E;  1V9D A;  2X9H A;  1WYC A;  2KMF A;  3F31 A;  2LE8 A;  4IE7 A;  4WBO A;  2L9Q A;  2LEH A;  1BR1 A;  5CA1 E;  1S35 A;  2XQY A;  2E8I A;  3C4X A;  3O1H A;  1FIO A;  3JC6 C;  1WR6 A;  3CX6 B;  5C8Y E;  3OJA A;  1KNZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...