3HI2A

Structure of the n-terminal domain of the e. coli antitoxin mqsa (ygit/b3021) in complex with the e. coli toxin mqsr (ygiu/b3022)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
70
structure length
70
Chain Sequence
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator mqsA(ygiT)
publication title Three dimensional structure of the MqsR:MqsA complex: a novel TA pair comprised of a toxin homologous to RelE and an antitoxin with unique properties.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Dna binding protein/toxin
total genus 14
structure length 70
sequence length 70
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.720 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3hi2A00
3O9XA 3GN5B 3HI2A 3GN5A 3GA8A
chains in the Genus database with same CATH superfamily
4ZEYA 2V7LA 2L9QA 2N9DA 3W15B 5ABHA 3EDUA 4OFZA 5ABGA 5AQRB 3V5SA 3KDSE 4H63V 4A5XA 5ABFB 3LFMA 1M7KA 2BG9A 3FBZA 4HWIB 5LMUT 3RF1A 3I0OA 2WU5A 2D0TA 2V7KA 4TNWA 4K0UA 2W63A 5FVKA 4AIUA 4DR1T 4MFRA 2ZMAA 5FKYA 3Q5WA 3C98B 3N2KE 3KV9A 4CXWA 4P1NA 1I6ZA 4B3TT 3RH3A 3IEEA 3P8CD 4FI5A 4CN4A 1T8BA 2XAJB 3H3MA 2IDOB 1WLXA 1GQEA 4QH5A 3AE4A 3O4XE 2X0YA 3KV4A 2MTQA 3DTOA 2WCAA 5L3GB 5JRCA 4JI1T 4HWFA 2N1GA 2XQ8A 3PE0A 4YTMA 3A5XA 3EAMA 2BS4A 2CWYA 2UUCT 4HWDA 4H9NC 3AE2A 4BJMA 3JCFA 3OKQA 5HEJA 5EK4A 4PK4A 1IBMT 4DV5T 1NEKA 2X9YA 2NTXA 4QHOA 2E5VA 2IAKA 3A7MA 3LK42 4EV6A 4DR6T 4B3RT 3UQ7A 4U7IA 3X1DA 2DI4A 3QB5K 4PW8A 4IGUA 3P4PA 2X9HA 4QKNA 2W61A 3FZHB 4JI2T 2JIWA 3SWHA 1XWMA 3UU3A 1IBKT 2Y8DA 5CJ5A 1UURA 5KMGP 1IJ6A 2JQQA 4MLKA 2D9DA 4HKAA 4U31A 5FMNA 3I1AA 5HEUA 3GN5B 3Q5DA 2K5BB 2CHNA 2XQAA 5M4YA 1YQ3A 2UUBT 3RYIE 2LE8A 3K3NA 2K24A 3NRXA 5F3JA 2KT9A 3UU4A 4KI0F 2KZ7B 1KNPA 2QYWA 1D0ZA 4TV9E 2WMNA 4HFEA 5A1LA 2LSIA 4I55E 4HWCA 4YT0A 4AISA 2XSAA 1MMAA 2JPFA 3PUSA 2R6GF 2V5DA 4X20E 4H9SE 3C64A 3VKGA 3U78A 1MNEA 4YXDA 5LB7B 4KBMB 5L4EA 4B6XA 4ILUA 3IBPA 2FJBA 5HEOA 4U3CA 4CXXA 1XMQT 2BBJA 1FMVA 2L3LA 3VHLA 4JI0T 4EYYR 1WYBA 5EK2A 3IA3A 1QLBA 3R6NA 5AQTB 1E1HB 3HR0A 2IUBA 3AE5A 1H7CA 3T1HT 3LSVA 5JDMA 5CFBA 1HF8A 4HTEA 3OJAA 3HKCE 4DR7T 4UVCB 4EEBA 3MKDA 3N2OA 4LF6T 3L8RA 3ZYMA 5E0OA 3QB5A 3NKZA 2HN1A 3EABA 2H88A 5AQFB 2C5IT 3AEFA 5F8PA 4O4HE 3GWHA 3AA6B 2V6YA 3I9WA 3RQWA 2Z6EA 2WB5A 4UEMA 1ZHCA 4WBNE 5JR9A 2JMKA 2UXCT 4IIJE 2XQ6A 4UVBB 2J62A 5DQVA 4YJ3E 5JDLA 3LBXA 2E8IA 5L4HA 2ZM8A 2XAQB 3ZSTA 2IC9A 2XSBA 5C8YE 2XZEA 2F4VT 2JQ9A 5IYZE 2B1EA 4DMVA 4YFSA 4LMLA 4UF0A 3CWZB 1SA0E 3N9LA 4O4LE 1UX5A 1VOMA 2LHNA 3QOFA 4B3MT 4V1Av 1WRDA 1XNQT 2NW8A 4X65T 4EGWA 5LG4A 3KVBA 3P50A 3RYFE 3O1HA 3FZKB 2X9WA 3Q5XA 3RLFF 3OTOT 5JDGA 1O3XA 5IWAT 2CE7A 4X5TA 3LDQB 1G73A 3NWIA 4UV9B 1J5WA 4QXBB 4UELA 4AKRB 4DV1T 4PJNA 5HWYA 1V9DA 1HX8A 2ZM6T 3KBTA 2CA5A 1R8IA 2NP9A 3AVSA 5FXXA 4DUYT 3MXZA 3OPCA 2D2SA 2EHOD 5JQGE 4CI3B 2VWAA 3WAKA 1FIOA 4JV5T 5JH7E 3A8YC 2MBGA 2JMHA 3AXJB 3NVOA 4A56A 4TNVA 1UUSA 1KF6A 2M6BA 4NPPA 2B76A 2V1DB 2J1DG 3TLVA 3TLTA 1T98A 3O1JA 2LLYA 2I6HA 4JEUB 5JTGA 2WAUA 4J2CA 1I94T 3FZFB 1S94A 3RIUA 4L9IA 4CN6A 1OWAA 4Z8XA 4XAXB 3RYHE 2DHRA 3WI3A 3EDVA 2W62A 2KSRA 2C5KT 1U4QA 5JDQA 3JC6D 2E9XA 3QC9A 3WAJA 4EAHA 2YINA 4IDQA 5EZYE 5HCJA 3VR9A 3RRWA 1WR0A 3PUXF 4QXCB 2CXFA 3KINB 4UVAB 1LRZA 4PFOA 4QH4A 2NR4A 1G8XA 4AKHA 5JREA 4DV2T 1W0BA 3C51A 3ZJ2A 3KV6A 4NIQA 4ZZCA 2VURA 1N33T 3FBLA 5CA1E 5ABEA 4X1IE 4ZS3A 2GK9A 2WM9A 4ZZBA 4AQFC 5HWXA 1FJGT 3RC3A 2XQ9A 3PUQA 1MMGA 4IE7A 2V5CA 4HFBA 1HX1B 4ILBA 1UGOA 4E7SA 3E0ZA 2XAHB 3HKBE 1Y64B 2MAWA 2ODUA 2K48A 4ERRA 2X51A 4U72A 1DU2A 5LBQB 5AFUL 2QRXA 2BKNA 5LNKA 5L3DB 4C91A 2CMRA 2EHOC 3FXDB 2YKSA 1UX4A 4EXTA 1XZYA 3E08A 2MYSA 4YSXA 1BR2A 1U5PA 2EHOB 3OYXA 3OVUA 2KINB 2QGSA 4PK6A 4EZ4A 4U74A 2DL1A 4H9PC 4GK0E 3AEBA 3H3AA 4IE0A 4LF9T 4X66T 3U3IA 3O1IA 5AQMB 2VQET 1D1BA 1SHZC 1HS7A 4WNKA 1YKHB 4IL9A 4LF5T 3ANWB 3ZMTB 4CQIA 3B13A 3F57A 5FXWA 2XM1A 4AI6A 2NOXA 5HEGA 3ETUA 3KBUA 3I9YA 4ZI7E 3JC6C 2XAGB 1OXZA 4M1PA 3P7IA 3FHNA 5AQPB 3L09A 3BQLA 3UQ4A 2LSGA 2H89A 4TZ4C 2G0UA 1WFDA 3HA4A 4FJOA 1OEDE 4P09A 3J7Yq 2MPKA 4BJNA 3RIFA 1HTJF 2XQ7A 2HHHT 2BDEA 2MOZA 4HWHA 1BR1A 3EUHA 1UCUA 1OEDA 4HE8A 4O4IE 3AE3A 3NBXX 4JI6T 2A72A 2UUAT 3C4WA 2XTLA 4PJJA 2YN6A 3ZYLA 3BQKA 1NAFA 4GKJT 5IHYA 1IBLT 2KWIB 3N2GE 2PFVA 3Q9DA 4QWNB 3AECA 4Z91A 1YW0A 3N9MA 3PUAA 1W9RA 2H3RA 4WBOA 2K3WA 1YQ4A 1E7PA 1MIYA 4YTPA 2LEHA 2A9UA 4ADZA 3AE6A 4F8HA 4ZI2D 2UXXB 5JVDE 2X0HA 1XMOT 3CX7B 3CQXC 2CXLA 2W0GA 3G06A 3KVAA 4OYJA 2AE9A 5CA0E 2J4GA 5LGUB 1E2AA 3AE8A 4AXPA 4TWFA 4K0KT 4N78D 3K8PC 2XQ3A 2W66A 3CQCB 4KHPT 3ZC1A 4HFIA 4DR4T 4I0UA 4DV3T 4CI1B 2LKHA 3UUMA 4GKKT 3C4ZA 4G2AA 1HNXT 5DJQC 4AKGA 4JEHB 3MK7C 4DV7T 5L3CB 4PJLA 3UUXB 5HXRA 3IHRA 1FEWA 3AE1A 4IHJE 2FJEA 4TV8E 5CB4E 4G63A 4GYSA 4O8SA 1HG5A 5AQOB 3TLUA 4TWDA 5KXJA 2X0LB 2Y48B 2UU9T 3AEEA 4DBQA 3FZLB 5LG3A 1JNRA 2Q9QA 4LMJA 2FBWA 2LM9A 4JUYA 2DCFA 2CXDA 4KX6A 3MA9A 3ZMSB 4XBFB 2ZLYA 4EEDA 2KWHA 5HCMA 2AXDS 3N9QA 2CHOA 5FL0A 3F2EA 5AQQB 2BG9C 1D1CA 2KLQA 1BR4A 2QVAA 2M6IA 2IHR1 4JBWF 3QK6A 1T7SA 4U33A 5L47A 2BG9B 3KFWX 4GYRA 2BVMA 3KV5A 5FVLA 5AQLB 3CKDA 3IF8B 3ZMVB 3AEAA 5F5WA 4P0BA 5ABFA 4YHHT 2YU1A 5CGMA 4ZI2C 4COFA 3UULA 2CBIA 5JRCB 3DP7A 5L3FB 4H9QC 4L5GA 2C0SA 1S35A 4DR3T 3CX6B 4EOZB 1ZKEA 2XASB 4UR9A 1N36T 4ZI3D 2UXBT 1JNZA 2WZHA 2E5LT 2J47A 1WYCA 1X9BA 4IE4A 1ZV4X 5KDMC 1LVFA 1MNDA 2XUEA 1KK7A 2WDRA 2VASA 2WS3A 1Z0PA 2E2AA 4GK5E 3B5MA 4ZS2A 3UU6A 4H9RC 3FXEB 3MACA 1FMWA 4GOUA 3O9XA 2IC6A 1EZ3A 1IJ5A 4CI2B 4YY3T 2X9XA 3NZPA 2PTFA 2V26A 5FXVA 3ZT5A 4ILAA 4TWHA 2VKDA 1HNZT 4ISSA 4YSYA 5JDHA 3H37A 2WWUA 2IMLA 4QX7B 5AQKB 2LSYA 2IW5B 3GN5A 4LFCT 2BVLA 2QA7A 4C90A 4ASKA 3LJCA 3HL6A 5FY1A 2ACZA 3RGLA 5HXHA 2LSKA 4DNDA 5AQVB 4O4JE 2YDSA 4DV6T 1NWMX 5JDFA 5DABA 3UFEA 1HFAA 3UU5A 2NWBA 3ONLC 4YLHA 4CN1A 1D0XA 5HXEA 2VVSA 4CZZB 3TLWA 3K1SA 3HKDE 3CVRA 3ZKRA 4WZXA 4F6RC 3N9PA 2I59A 1XDPA 3GA8A 4KUMB 3QNUA 5HXSA 4IDOA 1IZNB 2HPJA 3DJBA 5LCYA 4E7ZA 5L2LA 3CK6A 4HFHA 2LOPA 4PJMA 3N5LA 3PUYF 2V8SV 2V7JA 3L39A 2RPAA 4OK0A 4DR5T 3RC8A 1SE7A 4HFCA 4I4TE 4ZI3C 1YD8G 5LHGB 3LBXB 4PAGA 2N2NA 1VCSA 4JI7T 3GMIA 3RKGA 3ZT6A 5LGTB 4NUUA 2E9XD 3ZCIA 3B57A 5LYJE 2YDRA 3PURA 4AQYT 3EI0A 2WDQA 4QXHB 3RPUA 4IDPA 4UF0B 2KXPB 3CX8B 2VKHA 3LK2B 1ZP0A 1Z8UA 2C5JA 5J2TE 4CXYA 3P4QA 2NW7A 3VR8A 1AJ3A 5FP3A 4ISTA 3ZCJA 1US7B 3V5UA 1N32T 1CHUA 5ETWA 2XHEB 2BZBA 1J1JA 2HPLA 4ZXLA 2DNXA 1LVKA 4U2YA 5HAXA 1ZOYA 1D1AA 4O2BE 2WWVA 2RA1A 3VU7H 3AE7A 3FB2A 5J1GA 4DV0T 1QUUA 4HEAA 4PNIA 5AQNB 5ADXL 2KNDA 5LMNT 3JADA 3RQUA 4I43B 2HH7A 1ZEEA 3HKEE 3AE9A 4HFVA 4O2AE 4DIDB 2LT3A 1HG2A 2CPTA 2W00A 4IDNA 3RHWA 3SOLA 5GONE 2JRKA 3NZQA 4QX8B 2XQYA 1WCRA 3EHZA 3OYZA 2CRBA 2LOSA 2W2UA 3J9X1 4GIWA 4ZOLE 4DV4T 2LKGA 2XQ5A 2XY8B 4EB6E 3ETVA 5BMVE 3AB3B 3EVYA 2HN2A 3ZT7A 5LGNB 2XM2A 5L3EB 4B3ST 1VCTA 2CWOA 2XAFB 3PV0F 2WU2A 4AQGA 3VRBA 1UK5A 3AXJA 5EK3A 4A97A 2YOEA 4JYAT 4U7YA 5LJMA 3RYCE 3D0TA 3ONJA 2XPKA 3RKOA 3RIUC 3AAAB 5HXCA 5FY0A 3FZMB 3ZEFB 3ZN1B 2E9XC 3P4SA 3PU3A 3F31A 2WDVA 4PFPA 2VVNA 3I0QA 2ACXA 3ZC0A 2E9XB 3ZJ1A 3ZMUB 4BAYB 2ES0A 3ESLA 2VK9A 4ANJA 4ILCA 1Y01A 2YDQA 4MHCA 4IE6A 2A2FX 3AAIA 2L8KA 1M62A 5H6RB 2LRKA 3HI2A 3LG7A 3ZYKA 3PU8A 4X1KE 4OX9T 3AA7B 2VL8A 4IL4A 2FJAA 2FUPA 2H7VC 4X62T 4DO0A 1X79A 5C2TA 2W67A 4HN9A 2V7MA 5FNVE 5TAOA 2X66A 5FYMA 5H6QB 5LXTE 3Q2MA 4TX5A 1IAPA 4H9OC 3TKLB 3UUBA 4DUZT 3CQGB 4EIWA 3MJXA 4AQFA 4JLEA 4AKIA 3VKHA 2VKJA 3SFDA 2PBIA 2CEAA 5AQJB 2LJLA 2VB6A 3UU8A 3M3ZB 2WZIA 2X68A 4MALA 2DLRA 2ZM0A 3UTKA 3AVRA 4YSZA 2D5UA 5AQHB 4MBQA 1BR0A 4OHFA 1CUNA 5AQIB 2WY2A 4BA9A 4LF4T 5AQGB 3PDYA 1B7TA 2DWGA 2JQHA 3T8OA 2UXDT 4QH1A 2JQKA 3NRYA 3P4WA 2EHOA 5FY7A 1L0VA 2CLYC 2M67A 3R84B 5LOVE 2CLYB 1J5ET 2WQYA 2WP9A 2X67A 1KNZA 4TN7B 1XNRT 3S4UA 3PJAJ 1MMDA 4X64T 1QSDA 2VKOA 2V6XA 1LKXA 3M65A 3AEDA 4IREA 4ZHQE 2BS2A 3ANWA 2Q9QD 3SRZA 4HFDA 3BK9A 2JJ9A 3ZPOA 5C3JA 4LF7T 2CM0A 2IIUA 2BKOA 5LBMA 2PJQA 3ZMZB 3RIAA 4LMKA 4IT4A 1XDOA 3UUNA 3N9NA 2LSJA 4LFAT 3L3PA 4NXMT 3TLSA 4KMCA 5J0ZA 1MMNA 2A3DA 2BS3A 2SPCA 1OEDC 2LM2A 3AA1B 3AA0B 4KP3C 3VRAA 1OEDB 1VRBA 4NUVA 3RI5A 2NW9A 2LRLA 3RRCA 3ONXA 1W09A 4P0AA 4DMWA 3Q5EA 4UXNB 3ZLIA 1MIVA 4U2ZA 4PK5A 1SUMB 2I0MA 5AQUB 5L3BB 3UFGA 2NTYA 4WYVA 3ZSSA 2YEVC 5BR8T 4YJ2E 4EZHA 4DBRA 5HEHA 4TUYE 3CPZA 4YTNA 3QUJA 2VL0A 3T1YT 3MZKB 2VQFT 2LHRA 4XZCA 1KEYA 3P4RA 2CBJA 3K3OA 1HR0T 2ODVA 4DR2T 4JI8T 3OBVE 1MIWA 3LK3B 3PTRB 4Q25A 3PUWF 3JAFA 1N34T 1D0YA 2YK0A 2K9AA 1KNRA 3PUVF 3E22E 3ZN0B 3RX6A 1T72A 4EYUA 5LA6E 2V7IA 3C50A 5AQSB 4L0RA 4UIGA 1YXRA 2CCQA 5KX5E 4JI4T 5LHHB 3AAEB 1KFYA 3BQIA 4Z90A 4H63H 2RP4A 3K3QC 1HNWT 4LF8T 3SFEA 1WR6A 3PUZF 4JI3T 3CIRA 2BBHA 2Y6XA 2ZM2A 3SS1A 3C4XA 2H7OA 4IE5A 3JAEA 4A98A 1NENA 2XJ7A 1YKEB 5J2UE 1HCIA 5HYAA 2V6YB 2WMOA 5JR9C 2Q9QC 2UXNB 4AKLA 5JDNA 2OLTA 5FXZA 4JI5T 5LHIB 1W0AA 2XQ4A 3ABVA 5JR9B 2P9BA 3PUGA 4HGAA 2Q9QB 5IUXA 4LFBT 4IDZA 3CMLA 2YU2A 2FJDA 2WSSV 2PG8A 3N9OA 4NXNT 4UV8B 2D0UA 3PJAA 5FL1A 4X1YE 4KHZF 2W4XA 5LP6E 2BKPA 2KMFA 4WW0A 4I50E 3AEGA 3UT5E 2OA5A 2DWKA 5DQWA 4OYKA 4DVDA 4YHJA 5LJNA 2WBLA 2OV9A 2BG9E
chains in the Genus database with same CATH topology
3ZN1B 2E9XC 2V7LA 3QK6A 3PU3A 2L9QA 3F31A 2N9DA 1S94A 3W15B 3EDUA 4L9IA 4OFZA 4PFPA 3KFWX 1OWAA 3V5SA 3KDSE 2BVMA 3I0QA 3KV5A 4GYRA 4Z8XA 2ACXA 4H63V 3ZC0A 2E9XB 4XAXB 3RYHE 3CKDA 3IF8B 3ZJ1A 2DHRA 3ZMUB 3WI3A 3ZMVB 3LFMA 4BAYB 3FBZA 2ES0A 3ESLA 2VK9A 4ANJA 3EDVA 3I0OA 2W62A 4P0BA 4MHCA 2C5KT 1U4QA 5JDQA 3JC6D 2E9XA 2D0TA 2V7KA 4IE6A 2W63A 4K0UA 3QC9A 2A2FX 4MFRA 3WAJA 2YU1A 2ZMAA 3Q5WA 3C98B 3AAIA 2L8KA 3N2KE 4EAHA 2YINA 5EZYE 3RRWA 4ZI2C 5H6RB 3KV9A 2CXFA 4QXCB 4CXWA 3KINB 4UVAB 3IEEA 1LRZA 4PFOA 3RH3A 3P8CD 3HI2A 3UULA 3LG7A 4FI5A 3ZYKA 1G8XA 3PU8A 4X1KE 2XAJB 5JRCB 4AKHA 5JREA 1WLXA 3DP7A 3AA7B 5L3FB 2VL8A 3O4XE 4H9QC 4L5GA 3C51A 3KV4A 3ZJ2A 3KV6A 2MTQA 3DTOA 5L3GB 2C0SA 1S35A 5JRCA 2H7VC 3CX6B 4EOZB 1ZKEA 3FBLA 2N1GA 5CA1E 3PE0A 3A5XA 4DO0A 1X79A 2CWYA 2XASB 4HN9A 2V7MA 4H9NC 4X1IE 5FNVE 5TAOA 4BJMA 4ZS3A 2GK9A 2X66A 4ZI3D 2WM9A 5HWXA 4AQFC 3OKQA 5FYMA 1WYCA 5H6QB 5EK4A 4PK4A 3RC3A 4IE4A 5LXTE 1ZV4X 3PUQA 5KDMC 1MMGA 4IE7A 1LVFA 2X9YA 1MNDA 2XUEA 3Q2MA 4TX5A 2NTXA 1KK7A 2VASA 1Z0PA 1IAPA 4GK5E 4QHOA 4H9OC 3TKLB 4E7SA 2IAKA 4ZS2A 4H9RC 3FXEB 3CQGB 3LK42 3E0ZA 3MJXA 4EIWA 2XAHB 4AQFA 4JLEA 3HKBE 1Y64B 2ODUA 4AKIA 2K48A 3VKHA 2VKJA 4ERRA 2DI4A 4PW8A 4IGUA 2X51A 2X9HA 3MACA 2PBIA 1FMWA 4QKNA 2W61A 3SWHA 4GOUA 2CEAA 2IC6A 1EZ3A 4U72A 3O9XA 1IJ5A 4CI2B 5LBQB 2X9XA 2Y8DA 3NZPA 2LJLA 2V26A 5FXVA 5KMGP 1IJ6A 2JQQA 5AFUL 4MLKA 5LNKA 2VB6A 5L3DB 4C91A 4HKAA 2X68A 4MALA 5FMNA 2VKDA 2DLRA 2CMRA 3I1AA 2ZM0A 3UTKA 2EHOC 3AVRA 3FXDB 3GN5B 4ISSA 1UX4A 2D5UA 2K5BB 4EXTA 5JDHA 5M4YA 3H37A 2LE8A 3RYIE 2WWUA 3K3NA 4MBQA 4QX7B 1BR0A 2K24A 4OHFA 1CUNA 3NRXA 2LSYA 2KT9A 4BA9A 3E08A 5F3JA 2MYSA 2IW5B 3GN5A 3PDYA 1BR2A 1U5PA 2EHOB 2KZ7B 3OYXA 2BVLA 1B7TA 2QA7A 1D0ZA 2DWGA 4TV9E 4C90A 3T8OA 2WMNA 2KINB 2QGSA 4ASKA 4PK6A 5A1LA 4EZ4A 3NRYA 2EHOA 5FY7A 4U74A 3LJCA 2CLYC 2LSIA 2M67A 3HL6A 5FY1A 4I55E 4H9PC 3R84B 4GK0E 1MMAA 2JPFA 3PUSA 5HXHA 2LSKA 4DNDA 5LOVE 3H3AA 2CLYB 4IE0A 4X20E 4O4JE 1NWMX 3U3IA 2X67A 4H9SE 3O1IA 5JDFA 5DABA 3C64A 3UFEA 1HFAA 3VKGA 1D1BA 2NWBA 3U78A 1MNEA 1SHZC 4YLHA 1HS7A 1D0XA 1KNZA 4KBMB 4TN7B 5HXEA 4WNKA 4CZZB 1YKHB 4B6XA 3S4UA 4ILUA 3ANWB 3IBPA 3ZMTB 1MMDA 4CQIA 3B13A 4CXXA 3HKDE 1QSDA 3F57A 3CVRA 5FXWA 2VKOA 1LKXA 1FMVA 3M65A 4F6RC 2L3LA 3N9PA 3VHLA 4ZHQE 4AI6A 2NOXA 3ANWA 3ETUA 2I59A 3I9YA 3KBUA 3GA8A 4KUMB 4EYYR 4ZI7E 5HXSA 1WYBA 2Q9QD 3JC6C 3SRZA 5EK2A 3BK9A 2XAGB 2JJ9A 3R6NA 3ZPOA 1IZNB 1OXZA 1E1HB 2HPJA 3DJBA 3HR0A 2CM0A 3P7IA 3FHNA 4M1PA 3L09A 1H7CA 3BQLA 5JDMA 5LBMA 2PJQA 1HF8A 3ZMZB 4HTEA 5LCYA 2LSGA 3OJAA 4E7ZA 3HKCE 4TZ4C 4UVCB 3UUNA 3N9NA 2LSJA 3MKDA 5L2LA 2G0UA 3N2OA 3L3PA 3ZYMA 5E0OA 4KMCA 2LOPA 3HA4A 1MMNA 2A3DA 4PJMA 3N5LA 2SPCA 4FJOA 2C5IT 4P09A 3J7Yq 2V7JA 4BJNA 5F8PA 4O4HE 3AA1B 3GWHA 1HTJF 3AA0B 4KP3C 3AA6B 4OK0A 3I9WA 1VRBA 2Z6EA 4NUVA 3RC8A 4UEMA 2BDEA 2NW9A 4I4TE 4ZI3C 1YD8G 2MOZA 3RRCA 3ONXA 5LHGB 1BR1A 1ZHCA 3EUHA 4WBNE 3LBXB 4P0AA 1UCUA 4PAGA 4DMWA 2N2NA 5JR9A 4HE8A 4O4IE 2JMKA 3NBXX 4IIJE 2A72A 3GMIA 4UVBB 5DQVA 3C4WA 4UXNB 2XTLA 4NUUA 4YJ3E 1MIVA 3ZLIA 5JDLA 5LGTB 4PK5A 3LBXA 2E8IA 4PJJA 3ZYLA 2E9XD 2ZM8A 3BQKA 3ZCIA 3B57A 1NAFA 5L3BB 2XAQB 5LYJE 2NTYA 2IC9A 5IHYA 5C8YE 2YEVC 3PURA 4EZHA 4YJ2E 2KWIB 5IYZE 4DBRA 3N2GE 4QXHB 2PFVA 3RPUA 3Q9DA 4TUYE 2KXPB 3CPZA 2B1EA 3QUJA 4QWNB 4UF0B 3CX8B 4DMVA 2VKHA 3MZKB 3LK2B 1YW0A 4YFSA 3N9MA 2C5JA 2LHRA 3PUAA 5J2TE 4XZCA 2H3RA 4WBOA 4UF0A 4CXYA 3K3OA 3CWZB 2NW7A 1AJ3A 1SA0E 1MIYA 2ODVA 3N9LA 2LEHA 4O4LE 1UX5A 4ADZA 1VOMA 2LHNA 5FP3A 4ZI2D 4ISTA 2UXXB 5JVDE 4V1Av 3OBVE 1MIWA 3ZCJA 3LK3B 1US7B 3PTRB 3V5UA 1D0YA 2YK0A 2K9AA 1WRDA 5ETWA 3CX7B 2NW8A 2XHEB 3CQXC 3E22E 3ZN0B 2CXLA 2BZBA 2W0GA 3RX6A 5LG4A 2HPLA 3KVBA 2DNXA 4EYUA 5LA6E 1LVKA 2V7IA 3C50A 3KVAA 4OYJA 3RYFE 4L0RA 5HAXA 4UIGA 3O1HA 2CCQA 1D1AA 5CA0E 5KX5E 4O2BE 5LGUB 5LHHB 2RA1A 4AXPA 3VU7H 2X9WA 3Q5XA 3FB2A 4N78D 5J1GA 3K8PC 3AAEB 1QUUA 3BQIA 3CQCB 4HEAA 4PNIA 5ADXL 4H63H 3ZC1A 2KNDA 2RP4A 3K3QC 5JDGA 1WR6A 4I43B 4CI1B 1O3XA 3UUMA 2HH7A 1ZEEA 2CE7A 2Y6XA 2ZM2A 3HKEE 1G73A 3C4ZA 4UV9B 3SS1A 4QXBB 4G2AA 4HFVA 4O2AE 4UELA 3C4XA 2H7OA 2LT3A 1HG2A 4IE5A 4AKRB 4PJNA 5HWYA 1V9DA 2W00A 5DJQC 4AKGA 1HX8A 4JEHB 1YKEB 5J2UE 1HCIA 3MK7C 3SOLA 5GONE 2JRKA 3NZQA 5L3CB 5HYAA 3KBTA 4QX8B 4PJLA 3UUXB 2CA5A 2XQYA 5HXRA 2WMOA 5JR9C 3IHRA 3OYZA 1FEWA 4IHJE 2LOSA 2Q9QC 4TV8E 2UXNB 3J9X1 5CB4E 4AKLA 4GIWA 4ZOLE 5JDNA 5FXZA 2NP9A 4G63A 5LHIB 3AVSA 4GYSA 4O8SA 1HG5A 5FXXA 5JR9B 2P9BA 3PUGA 3MXZA 4HGAA 4EB6E 2Q9QB 2X0LB 2Y48B 2D2SA 3ETVA 2EHOD 4DBQA 5BMVE 5JQGE 3AB3B 4IDZA 4CI3B 2VWAA 3EVYA 3WAKA 3CMLA 2YU2A 1FIOA 5JH7E 5LGNB 2WSSV 2Q9QA 2PG8A 3N9OA 2MBGA 5L3EB 2JMHA 4UV8B 2LM9A 2CWOA 2D0UA 4JUYA 2XAFB 4A56A 4AQGA 2DCFA 2CXDA 3MA9A 2V1DB 4X1YE 3ZMSB 4XBFB 5EK3A 2ZLYA 5LP6E 2J1DG 2KMFA 5LJMA 4WW0A 3RYCE 4I50E 2KWHA 3D0TA 3RKOA 3UT5E 1T98A 2OA5A 3O1JA 2DWKA 3N9QA 3AAAB 5DQWA 5HXCA 4OYKA 4JEUB 3F2EA 4DVDA 4YHJA 5FY0A 5LJNA 3ZEFB 1D1CA 2WAUA 2WBLA 2KLQA 1BR4A 4J2CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O9X A;  3GN5 B;  3HI2 A;  3GN5 A;  3GA8 A; 
#chains in the Genus database with same CATH topology
 4ZEY A;  2V7L A;  2L9Q A;  2N9D A;  3W15 B;  5ABH A;  3EDU A;  4OFZ A;  5ABG A;  5AQR B;  3V5S A;  3KDS E;  4H63 V;  4A5X A;  5ABF B;  3LFM A;  1M7K A;  2BG9 A;  3FBZ A;  4HWI B;  5LMU T;  3RF1 A;  3I0O A;  2WU5 A;  2D0T A;  2V7K A;  4TNW A;  4K0U A;  2W63 A;  5FVK A;  4AIU A;  4DR1 T;  4MFR A;  2ZMA A;  5FKY A;  3Q5W A;  3C98 B;  3N2K E;  3KV9 A;  4CXW A;  4P1N A;  1I6Z A;  4B3T T;  3RH3 A;  3IEE A;  3P8C D;  4FI5 A;  4CN4 A;  1T8B A;  2XAJ B;  3H3M A;  2IDO B;  1WLX A;  1GQE A;  4QH5 A;  3AE4 A;  3O4X E;  2X0Y A;  3KV4 A;  2MTQ A;  3DTO A;  2WCA A;  5L3G B;  5JRC A;  4JI1 T;  4HWF A;  2N1G A;  2XQ8 A;  3PE0 A;  4YTM A;  3A5X A;  3EAM A;  2BS4 A;  2CWY A;  2UUC T;  4HWD A;  4H9N C;  3AE2 A;  4BJM A;  3JCF A;  3OKQ A;  5HEJ A;  5EK4 A;  4PK4 A;  1IBM T;  4DV5 T;  1NEK A;  2X9Y A;  2NTX A;  4QHO A;  2E5V A;  2IAK A;  3A7M A;  3LK4 2;  4EV6 A;  4DR6 T;  4B3R T;  3UQ7 A;  4U7I A;  3X1D A;  2DI4 A;  3QB5 K;  4PW8 A;  4IGU A;  3P4P A;  2X9H A;  4QKN A;  2W61 A;  3FZH B;  4JI2 T;  2JIW A;  3SWH A;  1XWM A;  3UU3 A;  1IBK T;  2Y8D A;  5CJ5 A;  1UUR A;  5KMG P;  1IJ6 A;  2JQQ A;  4MLK A;  2D9D A;  4HKA A;  4U31 A;  5FMN A;  3I1A A;  5HEU A;  3GN5 B;  3Q5D A;  2K5B B;  2CHN A;  2XQA A;  5M4Y A;  1YQ3 A;  2UUB T;  3RYI E;  2LE8 A;  3K3N A;  2K24 A;  3NRX A;  5F3J A;  2KT9 A;  3UU4 A;  4KI0 F;  2KZ7 B;  1KNP A;  2QYW A;  1D0Z A;  4TV9 E;  2WMN A;  4HFE A;  5A1L A;  2LSI A;  4I55 E;  4HWC A;  4YT0 A;  4AIS A;  2XSA A;  1MMA A;  2JPF A;  3PUS A;  2R6G F;  2V5D A;  4X20 E;  4H9S E;  3C64 A;  3VKG A;  3U78 A;  1MNE A;  4YXD A;  5LB7 B;  4KBM B;  5L4E A;  4B6X A;  4ILU A;  3IBP A;  2FJB A;  5HEO A;  4U3C A;  4CXX A;  1XMQ T;  2BBJ A;  1FMV A;  2L3L A;  3VHL A;  4JI0 T;  4EYY R;  1WYB A;  5EK2 A;  3IA3 A;  1QLB A;  3R6N A;  5AQT B;  1E1H B;  3HR0 A;  2IUB A;  3AE5 A;  1H7C A;  3T1H T;  3LSV A;  5JDM A;  5CFB A;  1HF8 A;  4HTE A;  3OJA A;  3HKC E;  4DR7 T;  4UVC B;  4EEB A;  3MKD A;  3N2O A;  4LF6 T;  3L8R A;  3ZYM A;  5E0O A;  3QB5 A;  3NKZ A;  2HN1 A;  3EAB A;  2H88 A;  5AQF B;  2C5I T;  3AEF A;  5F8P A;  4O4H E;  3GWH A;  3AA6 B;  2V6Y A;  3I9W A;  3RQW A;  2Z6E A;  2WB5 A;  4UEM A;  1ZHC A;  4WBN E;  5JR9 A;  2JMK A;  2UXC T;  4IIJ E;  2XQ6 A;  4UVB B;  2J62 A;  5DQV A;  4YJ3 E;  5JDL A;  3LBX A;  2E8I A;  5L4H A;  2ZM8 A;  2XAQ B;  3ZST A;  2IC9 A;  2XSB A;  5C8Y E;  2XZE A;  2F4V T;  2JQ9 A;  5IYZ E;  2B1E A;  4DMV A;  4YFS A;  4LML A;  4UF0 A;  3CWZ B;  1SA0 E;  3N9L A;  4O4L E;  1UX5 A;  1VOM A;  2LHN A;  3QOF A;  4B3M T;  4V1A v;  1WRD A;  1XNQ T;  2NW8 A;  4X65 T;  4EGW A;  5LG4 A;  3KVB A;  3P50 A;  3RYF E;  3O1H A;  3FZK B;  2X9W A;  3Q5X A;  3RLF F;  3OTO T;  5JDG A;  1O3X A;  5IWA T;  2CE7 A;  4X5T A;  3LDQ B;  1G73 A;  3NWI A;  4UV9 B;  1J5W A;  4QXB B;  4UEL A;  4AKR B;  4DV1 T;  4PJN A;  5HWY A;  1V9D A;  1HX8 A;  2ZM6 T;  3KBT A;  2CA5 A;  1R8I A;  2NP9 A;  3AVS A;  5FXX A;  4DUY T;  3MXZ A;  3OPC A;  2D2S A;  2EHO D;  5JQG E;  4CI3 B;  2VWA A;  3WAK A;  1FIO A;  4JV5 T;  5JH7 E;  3A8Y C;  2MBG A;  2JMH A;  3AXJ B;  3NVO A;  4A56 A;  4TNV A;  1UUS A;  1KF6 A;  2M6B A;  4NPP A;  2B76 A;  2V1D B;  2J1D G;  3TLV A;  3TLT A;  1T98 A;  3O1J A;  2LLY A;  2I6H A;  4JEU B;  5JTG A;  2WAU A;  4J2C A;  1I94 T;  3FZF B;  1S94 A;  3RIU A;  4L9I A;  4CN6 A;  1OWA A;  4Z8X A;  4XAX B;  3RYH E;  2DHR A;  3WI3 A;  3EDV A;  2W62 A;  2KSR A;  2C5K T;  1U4Q A;  5JDQ A;  3JC6 D;  2E9X A;  3QC9 A;  3WAJ A;  4EAH A;  2YIN A;  4IDQ A;  5EZY E;  5HCJ A;  3VR9 A;  3RRW A;  1WR0 A;  3PUX F;  4QXC B;  2CXF A;  3KIN B;  4UVA B;  1LRZ A;  4PFO A;  4QH4 A;  2NR4 A;  1G8X A;  4AKH A;  5JRE A;  4DV2 T;  1W0B A;  3C51 A;  3ZJ2 A;  3KV6 A;  4NIQ A;  4ZZC A;  2VUR A;  1N33 T;  3FBL A;  5CA1 E;  5ABE A;  4X1I E;  4ZS3 A;  2GK9 A;  2WM9 A;  4ZZB A;  4AQF C;  5HWX A;  1FJG T;  3RC3 A;  2XQ9 A;  3PUQ A;  1MMG A;  4IE7 A;  2V5C A;  4HFB A;  1HX1 B;  4ILB A;  1UGO A;  4E7S A;  3E0Z A;  2XAH B;  3HKB E;  1Y64 B;  2MAW A;  2ODU A;  2K48 A;  4ERR A;  2X51 A;  4U72 A;  1DU2 A;  5LBQ B;  5AFU L;  2QRX A;  2BKN A;  5LNK A;  5L3D B;  4C91 A;  2CMR A;  2EHO C;  3FXD B;  2YKS A;  1UX4 A;  4EXT A;  1XZY A;  3E08 A;  2MYS A;  4YSX A;  1BR2 A;  1U5P A;  2EHO B;  3OYX A;  3OVU A;  2KIN B;  2QGS A;  4PK6 A;  4EZ4 A;  4U74 A;  2DL1 A;  4H9P C;  4GK0 E;  3AEB A;  3H3A A;  4IE0 A;  4LF9 T;  4X66 T;  3U3I A;  3O1I A;  5AQM B;  2VQE T;  1D1B A;  1SHZ C;  1HS7 A;  4WNK A;  1YKH B;  4IL9 A;  4LF5 T;  3ANW B;  3ZMT B;  4CQI A;  3B13 A;  3F57 A;  5FXW A;  2XM1 A;  4AI6 A;  2NOX A;  5HEG A;  3ETU A;  3KBU A;  3I9Y A;  4ZI7 E;  3JC6 C;  2XAG B;  1OXZ A;  4M1P A;  3P7I A;  3FHN A;  5AQP B;  3L09 A;  3BQL A;  3UQ4 A;  2LSG A;  2H89 A;  4TZ4 C;  2G0U A;  1WFD A;  3HA4 A;  4FJO A;  1OED E;  4P09 A;  3J7Y q;  2MPK A;  4BJN A;  3RIF A;  1HTJ F;  2XQ7 A;  2HHH T;  2BDE A;  2MOZ A;  4HWH A;  1BR1 A;  3EUH A;  1UCU A;  1OED A;  4HE8 A;  4O4I E;  3AE3 A;  3NBX X;  4JI6 T;  2A72 A;  2UUA T;  3C4W A;  2XTL A;  4PJJ A;  2YN6 A;  3ZYL A;  3BQK A;  1NAF A;  4GKJ T;  5IHY A;  1IBL T;  2KWI B;  3N2G E;  2PFV A;  3Q9D A;  4QWN B;  3AEC A;  4Z91 A;  1YW0 A;  3N9M A;  3PUA A;  1W9R A;  2H3R A;  4WBO A;  2K3W A;  1YQ4 A;  1E7P A;  1MIY A;  4YTP A;  2LEH A;  2A9U A;  4ADZ A;  3AE6 A;  4F8H A;  4ZI2 D;  2UXX B;  5JVD E;  2X0H A;  1XMO T;  3CX7 B;  3CQX C;  2CXL A;  2W0G A;  3G06 A;  3KVA A;  4OYJ A;  2AE9 A;  5CA0 E;  2J4G A;  5LGU B;  1E2A A;  3AE8 A;  4AXP A;  4TWF A;  4K0K T;  4N78 D;  3K8P C;  2XQ3 A;  2W66 A;  3CQC B;  4KHP T;  3ZC1 A;  4HFI A;  4DR4 T;  4I0U A;  4DV3 T;  4CI1 B;  2LKH A;  3UUM A;  4GKK T;  3C4Z A;  4G2A A;  1HNX T;  5DJQ C;  4AKG A;  4JEH B;  3MK7 C;  4DV7 T;  5L3C B;  4PJL A;  3UUX B;  5HXR A;  3IHR A;  1FEW A;  3AE1 A;  4IHJ E;  2FJE A;  4TV8 E;  5CB4 E;  4G63 A;  4GYS A;  4O8S A;  1HG5 A;  5AQO B;  3TLU A;  4TWD A;  5KXJ A;  2X0L B;  2Y48 B;  2UU9 T;  3AEE A;  4DBQ A;  3FZL B;  5LG3 A;  1JNR A;  2Q9Q A;  4LMJ A;  2FBW A;  2LM9 A;  4JUY A;  2DCF A;  2CXD A;  4KX6 A;  3MA9 A;  3ZMS B;  4XBF B;  2ZLY A;  4EED A;  2KWH A;  5HCM A;  2AXD S;  3N9Q A;  2CHO A;  5FL0 A;  3F2E A;  5AQQ B;  2BG9 C;  1D1C A;  2KLQ A;  1BR4 A;  2QVA A;  2M6I A;  2IHR 1;  4JBW F;  3QK6 A;  1T7S A;  4U33 A;  5L47 A;  2BG9 B;  3KFW X;  4GYR A;  2BVM A;  3KV5 A;  5FVL A;  5AQL B;  3CKD A;  3IF8 B;  3ZMV B;  3AEA A;  5F5W A;  4P0B A;  5ABF A;  4YHH T;  2YU1 A;  5CGM A;  4ZI2 C;  4COF A;  3UUL A;  2CBI A;  5JRC B;  3DP7 A;  5L3F B;  4H9Q C;  4L5G A;  2C0S A;  1S35 A;  4DR3 T;  3CX6 B;  4EOZ B;  1ZKE A;  2XAS B;  4UR9 A;  1N36 T;  4ZI3 D;  2UXB T;  1JNZ A;  2WZH A;  2E5L T;  2J47 A;  1WYC A;  1X9B A;  4IE4 A;  1ZV4 X;  5KDM C;  1LVF A;  1MND A;  2XUE A;  1KK7 A;  2WDR A;  2VAS A;  2WS3 A;  1Z0P A;  2E2A A;  4GK5 E;  3B5M A;  4ZS2 A;  3UU6 A;  4H9R C;  3FXE B;  3MAC A;  1FMW A;  4GOU A;  3O9X A;  2IC6 A;  1EZ3 A;  1IJ5 A;  4CI2 B;  4YY3 T;  2X9X A;  3NZP A;  2PTF A;  2V26 A;  5FXV A;  3ZT5 A;  4ILA A;  4TWH A;  2VKD A;  1HNZ T;  4ISS A;  4YSY A;  5JDH A;  3H37 A;  2WWU A;  2IML A;  4QX7 B;  5AQK B;  2LSY A;  2IW5 B;  3GN5 A;  4LFC T;  2BVL A;  2QA7 A;  4C90 A;  4ASK A;  3LJC A;  3HL6 A;  5FY1 A;  2ACZ A;  3RGL A;  5HXH A;  2LSK A;  4DND A;  5AQV B;  4O4J E;  2YDS A;  4DV6 T;  1NWM X;  5JDF A;  5DAB A;  3UFE A;  1HFA A;  3UU5 A;  2NWB A;  3ONL C;  4YLH A;  4CN1 A;  1D0X A;  5HXE A;  2VVS A;  4CZZ B;  3TLW A;  3K1S A;  3HKD E;  3CVR A;  3ZKR A;  4WZX A;  4F6R C;  3N9P A;  2I59 A;  1XDP A;  3GA8 A;  4KUM B;  3QNU A;  5HXS A;  4IDO A;  1IZN B;  2HPJ A;  3DJB A;  5LCY A;  4E7Z A;  5L2L A;  3CK6 A;  4HFH A;  2LOP A;  4PJM A;  3N5L A;  3PUY F;  2V8S V;  2V7J A;  3L39 A;  2RPA A;  4OK0 A;  4DR5 T;  3RC8 A;  1SE7 A;  4HFC A;  4I4T E;  4ZI3 C;  1YD8 G;  5LHG B;  3LBX B;  4PAG A;  2N2N A;  1VCS A;  4JI7 T;  3GMI A;  3RKG A;  3ZT6 A;  5LGT B;  4NUU A;  2E9X D;  3ZCI A;  3B57 A;  5LYJ E;  2YDR A;  3PUR A;  4AQY T;  3EI0 A;  2WDQ A;  4QXH B;  3RPU A;  4IDP A;  4UF0 B;  2KXP B;  3CX8 B;  2VKH A;  3LK2 B;  1ZP0 A;  1Z8U A;  2C5J A;  5J2T E;  4CXY A;  3P4Q A;  2NW7 A;  3VR8 A;  1AJ3 A;  5FP3 A;  4IST A;  3ZCJ A;  1US7 B;  3V5U A;  1N32 T;  1CHU A;  5ETW A;  2XHE B;  2BZB A;  1J1J A;  2HPL A;  4ZXL A;  2DNX A;  1LVK A;  4U2Y A;  5HAX A;  1ZOY A;  1D1A A;  4O2B E;  2WWV A;  2RA1 A;  3VU7 H;  3AE7 A;  3FB2 A;  5J1G A;  4DV0 T;  1QUU A;  4HEA A;  4PNI A;  5AQN B;  5ADX L;  2KND A;  5LMN T;  3JAD A;  3RQU A;  4I43 B;  2HH7 A;  1ZEE A;  3HKE E;  3AE9 A;  4HFV A;  4O2A E;  4DID B;  2LT3 A;  1HG2 A;  2CPT A;  2W00 A;  4IDN A;  3RHW A;  3SOL A;  5GON E;  2JRK A;  3NZQ A;  4QX8 B;  2XQY A;  1WCR A;  3EHZ A;  3OYZ A;  2CRB A;  2LOS A;  2W2U A;  3J9X 1;  4GIW A;  4ZOL E;  4DV4 T;  2LKG A;  2XQ5 A;  2XY8 B;  4EB6 E;  3ETV A;  5BMV E;  3AB3 B;  3EVY A;  2HN2 A;  3ZT7 A;  5LGN B;  2XM2 A;  5L3E B;  4B3S T;  1VCT A;  2CWO A;  2XAF B;  3PV0 F;  2WU2 A;  4AQG A;  3VRB A;  1UK5 A;  3AXJ A;  5EK3 A;  4A97 A;  2YOE A;  4JYA T;  4U7Y A;  5LJM A;  3RYC E;  3D0T A;  3ONJ A;  2XPK A;  3RKO A;  3RIU C;  3AAA B;  5HXC A;  5FY0 A;  3FZM B;  3ZEF B;  3ZN1 B;  2E9X C;  3P4S A;  3PU3 A;  3F31 A;  2WDV A;  4PFP A;  2VVN A;  3I0Q A;  2ACX A;  3ZC0 A;  2E9X B;  3ZJ1 A;  3ZMU B;  4BAY B;  2ES0 A;  3ESL A;  2VK9 A;  4ANJ A;  4ILC A;  1Y01 A;  2YDQ A;  4MHC A;  4IE6 A;  2A2F X;  3AAI A;  2L8K A;  1M62 A;  5H6R B;  2LRK A;  3HI2 A;  3LG7 A;  3ZYK A;  3PU8 A;  4X1K E;  4OX9 T;  3AA7 B;  2VL8 A;  4IL4 A;  2FJA A;  2FUP A;  2H7V C;  4X62 T;  4DO0 A;  1X79 A;  5C2T A;  2W67 A;  4HN9 A;  2V7M A;  5FNV E;  5TAO A;  2X66 A;  5FYM A;  5H6Q B;  5LXT E;  3Q2M A;  4TX5 A;  1IAP A;  4H9O C;  3TKL B;  3UUB A;  4DUZ T;  3CQG B;  4EIW A;  3MJX A;  4AQF A;  4JLE A;  4AKI A;  3VKH A;  2VKJ A;  3SFD A;  2PBI A;  2CEA A;  5AQJ B;  2LJL A;  2VB6 A;  3UU8 A;  3M3Z B;  2WZI A;  2X68 A;  4MAL A;  2DLR A;  2ZM0 A;  3UTK A;  3AVR A;  4YSZ A;  2D5U A;  5AQH B;  4MBQ A;  1BR0 A;  4OHF A;  1CUN A;  5AQI B;  2WY2 A;  4BA9 A;  4LF4 T;  5AQG B;  3PDY A;  1B7T A;  2DWG A;  2JQH A;  3T8O A;  2UXD T;  4QH1 A;  2JQK A;  3NRY A;  3P4W A;  2EHO A;  5FY7 A;  1L0V A;  2CLY C;  2M67 A;  3R84 B;  5LOV E;  2CLY B;  1J5E T;  2WQY A;  2WP9 A;  2X67 A;  1KNZ A;  4TN7 B;  1XNR T;  3S4U A;  3PJA J;  1MMD A;  4X64 T;  1QSD A;  2VKO A;  2V6X A;  1LKX A;  3M65 A;  3AED A;  4IRE A;  4ZHQ E;  2BS2 A;  3ANW A;  2Q9Q D;  3SRZ A;  4HFD A;  3BK9 A;  2JJ9 A;  3ZPO A;  5C3J A;  4LF7 T;  2CM0 A;  2IIU A;  2BKO A;  5LBM A;  2PJQ A;  3ZMZ B;  3RIA A;  4LMK A;  4IT4 A;  1XDO A;  3UUN A;  3N9N A;  2LSJ A;  4LFA T;  3L3P A;  4NXM T;  3TLS A;  4KMC A;  5J0Z A;  1MMN A;  2A3D A;  2BS3 A;  2SPC A;  1OED C;  2LM2 A;  3AA1 B;  3AA0 B;  4KP3 C;  3VRA A;  1OED B;  1VRB A;  4NUV A;  3RI5 A;  2NW9 A;  2LRL A;  3RRC A;  3ONX A;  1W09 A;  4P0A A;  4DMW A;  3Q5E A;  4UXN B;  3ZLI A;  1MIV A;  4U2Z A;  4PK5 A;  1SUM B;  2I0M A;  5AQU B;  5L3B B;  3UFG A;  2NTY A;  4WYV A;  3ZSS A;  2YEV C;  5BR8 T;  4YJ2 E;  4EZH A;  4DBR A;  5HEH A;  4TUY E;  3CPZ A;  4YTN A;  3QUJ A;  2VL0 A;  3T1Y T;  3MZK B;  2VQF T;  2LHR A;  4XZC A;  1KEY A;  3P4R A;  2CBJ A;  3K3O A;  1HR0 T;  2ODV A;  4DR2 T;  4JI8 T;  3OBV E;  1MIW A;  3LK3 B;  3PTR B;  4Q25 A;  3PUW F;  3JAF A;  1N34 T;  1D0Y A;  2YK0 A;  2K9A A;  1KNR A;  3PUV F;  3E22 E;  3ZN0 B;  3RX6 A;  1T72 A;  4EYU A;  5LA6 E;  2V7I A;  3C50 A;  5AQS B;  4L0R A;  4UIG A;  1YXR A;  2CCQ A;  5KX5 E;  4JI4 T;  5LHH B;  3AAE B;  1KFY A;  3BQI A;  4Z90 A;  4H63 H;  2RP4 A;  3K3Q C;  1HNW T;  4LF8 T;  3SFE A;  1WR6 A;  3PUZ F;  4JI3 T;  3CIR A;  2BBH A;  2Y6X A;  2ZM2 A;  3SS1 A;  3C4X A;  2H7O A;  4IE5 A;  3JAE A;  4A98 A;  1NEN A;  2XJ7 A;  1YKE B;  5J2U E;  1HCI A;  5HYA A;  2V6Y B;  2WMO A;  5JR9 C;  2Q9Q C;  2UXN B;  4AKL A;  5JDN A;  2OLT A;  5FXZ A;  4JI5 T;  5LHI B;  1W0A A;  2XQ4 A;  3ABV A;  5JR9 B;  2P9B A;  3PUG A;  4HGA A;  2Q9Q B;  5IUX A;  4LFB T;  4IDZ A;  3CML A;  2YU2 A;  2FJD A;  2WSS V;  2PG8 A;  3N9O A;  4NXN T;  4UV8 B;  2D0U A;  3PJA A;  5FL1 A;  4X1Y E;  4KHZ F;  2W4X A;  5LP6 E;  2BKP A;  2KMF A;  4WW0 A;  4I50 E;  3AEG A;  3UT5 E;  2OA5 A;  2DWK A;  5DQW A;  4OYK A;  4DVD A;  4YHJ A;  5LJN A;  2WBL A;  2OV9 A;  2BG9 E; 
#chains in the Genus database with same CATH homology
 3ZN1 B;  2E9X C;  2V7L A;  3QK6 A;  3PU3 A;  2L9Q A;  3F31 A;  2N9D A;  1S94 A;  3W15 B;  3EDU A;  4L9I A;  4OFZ A;  4PFP A;  3KFW X;  1OWA A;  3V5S A;  3KDS E;  2BVM A;  3I0Q A;  3KV5 A;  4GYR A;  4Z8X A;  2ACX A;  4H63 V;  3ZC0 A;  2E9X B;  4XAX B;  3RYH E;  3CKD A;  3IF8 B;  3ZJ1 A;  2DHR A;  3ZMU B;  3WI3 A;  3ZMV B;  3LFM A;  4BAY B;  3FBZ A;  2ES0 A;  3ESL A;  2VK9 A;  4ANJ A;  3EDV A;  3I0O A;  2W62 A;  4P0B A;  4MHC A;  2C5K T;  1U4Q A;  5JDQ A;  3JC6 D;  2E9X A;  2D0T A;  2V7K A;  4IE6 A;  2W63 A;  4K0U A;  3QC9 A;  2A2F X;  4MFR A;  3WAJ A;  2YU1 A;  2ZMA A;  3Q5W A;  3C98 B;  3AAI A;  2L8K A;  3N2K E;  4EAH A;  2YIN A;  5EZY E;  3RRW A;  4ZI2 C;  5H6R B;  3KV9 A;  2CXF A;  4QXC B;  4CXW A;  3KIN B;  4UVA B;  3IEE A;  1LRZ A;  4PFO A;  3RH3 A;  3P8C D;  3HI2 A;  3UUL A;  3LG7 A;  4FI5 A;  3ZYK A;  1G8X A;  3PU8 A;  4X1K E;  2XAJ B;  5JRC B;  4AKH A;  5JRE A;  1WLX A;  3DP7 A;  3AA7 B;  5L3F B;  2VL8 A;  3O4X E;  4H9Q C;  4L5G A;  3C51 A;  3KV4 A;  3ZJ2 A;  3KV6 A;  2MTQ A;  3DTO A;  5L3G B;  2C0S A;  1S35 A;  5JRC A;  2H7V C;  3CX6 B;  4EOZ B;  1ZKE A;  3FBL A;  2N1G A;  5CA1 E;  3PE0 A;  3A5X A;  4DO0 A;  1X79 A;  2CWY A;  2XAS B;  4HN9 A;  2V7M A;  4H9N C;  4X1I E;  5FNV E;  5TAO A;  4BJM A;  4ZS3 A;  2GK9 A;  2X66 A;  4ZI3 D;  2WM9 A;  5HWX A;  4AQF C;  3OKQ A;  5FYM A;  1WYC A;  5H6Q B;  5EK4 A;  4PK4 A;  3RC3 A;  4IE4 A;  5LXT E;  1ZV4 X;  3PUQ A;  5KDM C;  1MMG A;  4IE7 A;  1LVF A;  2X9Y A;  1MND A;  2XUE A;  3Q2M A;  4TX5 A;  2NTX A;  1KK7 A;  2VAS A;  1Z0P A;  1IAP A;  4GK5 E;  4QHO A;  4H9O C;  3TKL B;  4E7S A;  2IAK A;  4ZS2 A;  4H9R C;  3FXE B;  3CQG B;  3LK4 2;  3E0Z A;  3MJX A;  4EIW A;  2XAH B;  4AQF A;  4JLE A;  3HKB E;  1Y64 B;  2ODU A;  4AKI A;  2K48 A;  3VKH A;  2VKJ A;  4ERR A;  2DI4 A;  4PW8 A;  4IGU A;  2X51 A;  2X9H A;  3MAC A;  2PBI A;  1FMW A;  4QKN A;  2W61 A;  3SWH A;  4GOU A;  2CEA A;  2IC6 A;  1EZ3 A;  4U72 A;  3O9X A;  1IJ5 A;  4CI2 B;  5LBQ B;  2X9X A;  2Y8D A;  3NZP A;  2LJL A;  2V26 A;  5FXV A;  5KMG P;  1IJ6 A;  2JQQ A;  5AFU L;  4MLK A;  5LNK A;  2VB6 A;  5L3D B;  4C91 A;  4HKA A;  2X68 A;  4MAL A;  5FMN A;  2VKD A;  2DLR A;  2CMR A;  3I1A A;  2ZM0 A;  3UTK A;  2EHO C;  3AVR A;  3FXD B;  3GN5 B;  4ISS A;  1UX4 A;  2D5U A;  2K5B B;  4EXT A;  5JDH A;  5M4Y A;  3H37 A;  2LE8 A;  3RYI E;  2WWU A;  3K3N A;  4MBQ A;  4QX7 B;  1BR0 A;  2K24 A;  4OHF A;  1CUN A;  3NRX A;  2LSY A;  2KT9 A;  4BA9 A;  3E08 A;  5F3J A;  2MYS A;  2IW5 B;  3GN5 A;  3PDY A;  1BR2 A;  1U5P A;  2EHO B;  2KZ7 B;  3OYX A;  2BVL A;  1B7T A;  2QA7 A;  1D0Z A;  2DWG A;  4TV9 E;  4C90 A;  3T8O A;  2WMN A;  2KIN B;  2QGS A;  4ASK A;  4PK6 A;  5A1L A;  4EZ4 A;  3NRY A;  2EHO A;  5FY7 A;  4U74 A;  3LJC A;  2CLY C;  2LSI A;  2M67 A;  3HL6 A;  5FY1 A;  4I55 E;  4H9P C;  3R84 B;  4GK0 E;  1MMA A;  2JPF A;  3PUS A;  5HXH A;  2LSK A;  4DND A;  5LOV E;  3H3A A;  2CLY B;  4IE0 A;  4X20 E;  4O4J E;  1NWM X;  3U3I A;  2X67 A;  4H9S E;  3O1I A;  5JDF A;  5DAB A;  3C64 A;  3UFE A;  1HFA A;  3VKG A;  1D1B A;  2NWB A;  3U78 A;  1MNE A;  1SHZ C;  4YLH A;  1HS7 A;  1D0X A;  1KNZ A;  4KBM B;  4TN7 B;  5HXE A;  4WNK A;  4CZZ B;  1YKH B;  4B6X A;  3S4U A;  4ILU A;  3ANW B;  3IBP A;  3ZMT B;  1MMD A;  4CQI A;  3B13 A;  4CXX A;  3HKD E;  1QSD A;  3F57 A;  3CVR A;  5FXW A;  2VKO A;  1LKX A;  1FMV A;  3M65 A;  4F6R C;  2L3L A;  3N9P A;  3VHL A;  4ZHQ E;  4AI6 A;  2NOX A;  3ANW A;  3ETU A;  2I59 A;  3I9Y A;  3KBU A;  3GA8 A;  4KUM B;  4EYY R;  4ZI7 E;  5HXS A;  1WYB A;  2Q9Q D;  3JC6 C;  3SRZ A;  5EK2 A;  3BK9 A;  2XAG B;  2JJ9 A;  3R6N A;  3ZPO A;  1IZN B;  1OXZ A;  1E1H B;  2HPJ A;  3DJB A;  3HR0 A;  2CM0 A;  3P7I A;  3FHN A;  4M1P A;  3L09 A;  1H7C A;  3BQL A;  5JDM A;  5LBM A;  2PJQ A;  1HF8 A;  3ZMZ B;  4HTE A;  5LCY A;  2LSG A;  3OJA A;  4E7Z A;  3HKC E;  4TZ4 C;  4UVC B;  3UUN A;  3N9N A;  2LSJ A;  3MKD A;  5L2L A;  2G0U A;  3N2O A;  3L3P A;  3ZYM A;  5E0O A;  4KMC A;  2LOP A;  3HA4 A;  1MMN A;  2A3D A;  4PJM A;  3N5L A;  2SPC A;  4FJO A;  2C5I T;  4P09 A;  3J7Y q;  2V7J A;  4BJN A;  5F8P A;  4O4H E;  3AA1 B;  3GWH A;  1HTJ F;  3AA0 B;  4KP3 C;  3AA6 B;  4OK0 A;  3I9W A;  1VRB A;  2Z6E A;  4NUV A;  3RC8 A;  4UEM A;  2BDE A;  2NW9 A;  4I4T E;  4ZI3 C;  1YD8 G;  2MOZ A;  3RRC A;  3ONX A;  5LHG B;  1BR1 A;  1ZHC A;  3EUH A;  4WBN E;  3LBX B;  4P0A A;  1UCU A;  4PAG A;  4DMW A;  2N2N A;  5JR9 A;  4HE8 A;  4O4I E;  2JMK A;  3NBX X;  4IIJ E;  2A72 A;  3GMI A;  4UVB B;  5DQV A;  3C4W A;  4UXN B;  2XTL A;  4NUU A;  4YJ3 E;  1MIV A;  3ZLI A;  5JDL A;  5LGT B;  4PK5 A;  3LBX A;  2E8I A;  4PJJ A;  3ZYL A;  2E9X D;  2ZM8 A;  3BQK A;  3ZCI A;  3B57 A;  1NAF A;  5L3B B;  2XAQ B;  5LYJ E;  2NTY A;  2IC9 A;  5IHY A;  5C8Y E;  2YEV C;  3PUR A;  4EZH A;  4YJ2 E;  2KWI B;  5IYZ E;  4DBR A;  3N2G E;  4QXH B;  2PFV A;  3RPU A;  3Q9D A;  4TUY E;  2KXP B;  3CPZ A;  2B1E A;  3QUJ A;  4QWN B;  4UF0 B;  3CX8 B;  4DMV A;  2VKH A;  3MZK B;  3LK2 B;  1YW0 A;  4YFS A;  3N9M A;  2C5J A;  2LHR A;  3PUA A;  5J2T E;  4XZC A;  2H3R A;  4WBO A;  4UF0 A;  4CXY A;  3K3O A;  3CWZ B;  2NW7 A;  1AJ3 A;  1SA0 E;  1MIY A;  2ODV A;  3N9L A;  2LEH A;  4O4L E;  1UX5 A;  4ADZ A;  1VOM A;  2LHN A;  5FP3 A;  4ZI2 D;  4IST A;  2UXX B;  5JVD E;  4V1A v;  3OBV E;  1MIW A;  3ZCJ A;  3LK3 B;  1US7 B;  3PTR B;  3V5U A;  1D0Y A;  2YK0 A;  2K9A A;  1WRD A;  5ETW A;  3CX7 B;  2NW8 A;  2XHE B;  3CQX C;  3E22 E;  3ZN0 B;  2CXL A;  2BZB A;  2W0G A;  3RX6 A;  5LG4 A;  2HPL A;  3KVB A;  2DNX A;  4EYU A;  5LA6 E;  1LVK A;  2V7I A;  3C50 A;  3KVA A;  4OYJ A;  3RYF E;  4L0R A;  5HAX A;  4UIG A;  3O1H A;  2CCQ A;  1D1A A;  5CA0 E;  5KX5 E;  4O2B E;  5LGU B;  5LHH B;  2RA1 A;  4AXP A;  3VU7 H;  2X9W A;  3Q5X A;  3FB2 A;  4N78 D;  5J1G A;  3K8P C;  3AAE B;  1QUU A;  3BQI A;  3CQC B;  4HEA A;  4PNI A;  5ADX L;  4H63 H;  3ZC1 A;  2KND A;  2RP4 A;  3K3Q C;  5JDG A;  1WR6 A;  4I43 B;  4CI1 B;  1O3X A;  3UUM A;  2HH7 A;  1ZEE A;  2CE7 A;  2Y6X A;  2ZM2 A;  3HKE E;  1G73 A;  3C4Z A;  4UV9 B;  3SS1 A;  4QXB B;  4G2A A;  4HFV A;  4O2A E;  4UEL A;  3C4X A;  2H7O A;  2LT3 A;  1HG2 A;  4IE5 A;  4AKR B;  4PJN A;  5HWY A;  1V9D A;  2W00 A;  5DJQ C;  4AKG A;  1HX8 A;  4JEH B;  1YKE B;  5J2U E;  1HCI A;  3MK7 C;  3SOL A;  5GON E;  2JRK A;  3NZQ A;  5L3C B;  5HYA A;  3KBT A;  4QX8 B;  4PJL A;  3UUX B;  2CA5 A;  2XQY A;  5HXR A;  2WMO A;  5JR9 C;  3IHR A;  3OYZ A;  1FEW A;  4IHJ E;  2LOS A;  2Q9Q C;  4TV8 E;  2UXN B;  3J9X 1;  5CB4 E;  4AKL A;  4GIW A;  4ZOL E;  5JDN A;  5FXZ A;  2NP9 A;  4G63 A;  5LHI B;  3AVS A;  4GYS A;  4O8S A;  1HG5 A;  5FXX A;  5JR9 B;  2P9B A;  3PUG A;  3MXZ A;  4HGA A;  4EB6 E;  2Q9Q B;  2X0L B;  2Y48 B;  2D2S A;  3ETV A;  2EHO D;  4DBQ A;  5BMV E;  5JQG E;  3AB3 B;  4IDZ A;  4CI3 B;  2VWA A;  3EVY A;  3WAK A;  3CML A;  2YU2 A;  1FIO A;  5JH7 E;  5LGN B;  2WSS V;  2Q9Q A;  2PG8 A;  3N9O A;  2MBG A;  5L3E B;  2JMH A;  4UV8 B;  2LM9 A;  2CWO A;  2D0U A;  4JUY A;  2XAF B;  4A56 A;  4AQG A;  2DCF A;  2CXD A;  3MA9 A;  2V1D B;  4X1Y E;  3ZMS B;  4XBF B;  5EK3 A;  2ZLY A;  5LP6 E;  2J1D G;  2KMF A;  5LJM A;  4WW0 A;  3RYC E;  4I50 E;  2KWH A;  3D0T A;  3RKO A;  3UT5 E;  1T98 A;  2OA5 A;  3O1J A;  2DWK A;  3N9Q A;  3AAA B;  5DQW A;  5HXC A;  4OYK A;  4JEU B;  3F2E A;  4DVD A;  4YHJ A;  5FY0 A;  5LJN A;  3ZEF B;  1D1C A;  2WAU A;  2WBL A;  2KLQ A;  1BR4 A;  4J2C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...