3HI2A

Structure of the n-terminal domain of the e. coli antitoxin mqsa (ygit/b3021) in complex with the e. coli toxin mqsr (ygiu/b3022)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
70
structure length
70
Chain Sequence
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three dimensional structure of the MqsR:MqsA complex: a novel TA pair comprised of a toxin homologous to RelE and an antitoxin with unique properties.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Dna binding protein/toxin
molecule keywords HTH-type transcriptional regulator mqsA(ygiT)
total genus 14
structure length 70
sequence length 70
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.720 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3hi2A00
3O9XA 3GA8A 3GN5A 3GN5B 3HI2A
chains in the Genus database with same CATH superfamily
4AQFA 3T1YT 5LHGB 3FHNA 1FIOA 3KV6A 2WB5A 2LT3A 3D0TA 1VRBA 2LRLA 2XQ3A 3NRXA 2IUBA 4JI5T 4LFAT 2VKHA 1JNZA 4KI0F 4IT4A 4EB6E 1VCTA 5FXXA 5HXSA 2JQ9A 2YK0A 3HA4A 4GIWA 4QXCB 3K1SA 1LVFA 2P9BA 3NKZA 3Q2MA 3NZPA 3PUZF 5HEGA 1IBMT 2CRBA 2LOSA 2N9DA 2PFVA 4DR3T 5FY1A 4P0AA 5LNKA 3AB3B 2NP9A 4ISTA 1FJGT 4OYJA 3KBUA 2XSAA 4IDPA 2FJEA 1T8BA 2OV9A 3ZJ1A 4Q25A 5J2UE 2WU2A 4DUZT 1HG2A 2WSSV 2WP9A 5EZYE 3CK6A 2NW9A 2M6BA 4A56A 2LHRA 3KBTA 2UU9T 2BBJA 4PAGA 2MTQA 1D1BA 2BG9B 3OBVE 2DNXA 4JI2T 5L3BB 4U2YA 4AQYT 3HKCE 4QXHB 1KF6A 1HG5A 1WFDA 3E22E 4YT0A 1S94A 5JH7E 1ZKEA 1J5ET 2ACXA 3I9WA 4XZCA 2H3RA 3LJCA 5LP6E 1U5PA 3TLTA 4DV5T 4NXNT 3AEGA 3X1DA 5JDQA 3FZKB 2NW7A 3C4XA 4YLHA 4QH1A 4I0UA 3RHWA 2V26A 4A98A 4F8HA 3J9X1 1XDOA 2JRKA 4PW8A 3C98B 1HF8A 2ZM8A 4GK0E 4JBWF 2BS2A 2D5UA 2D0TA 2K5BB 3DTOA 2DCFA 3H37A 2WAUA 3MXZA 1D0XA 3N9NA 3MKDA 5KDMC 1IAPA 4KUMB 2YKSA 4HEAA 4KMCA 2C5KT 3M3ZB 5EK3A 4CZZB 5ABGA 4YSYA 5LHIB 2CA5A 2V5DA 2WS3A 2XAJB 1KFYA 2ES0A 2X0HA 5LGNB 4JEHB 4ANJA 2X66A 3O1IA 2DWGA 3IEEA 3RIAA 3HR0A 2K9AA 4GYRA 4LMKA 2VL8A 2CXFA 2H88A 2VWAA 4V1Av 4EOZB 5TAOA 5JR9A 2H7OA 4OFZA 2JIWA 3PUWF 3RC3A 4X62T 1CUNA 3EHZA 4U2ZA 4MBQA 3UUMA 3UUBA 3ONXA 1N36T 4CXXA 5H6RB 4NPPA 4CN1A 3UU3A 4JI6T 5L3EB 4PFOA 1EZ3A 4ZOLE 2Z6EA 2X51A 3AA0B 3KFWX 4GKJT 4HFBA 2MYSA 2XQ7A 1QLBA 4HWDA 3RYFE 3SOLA 2ZM2A 5JREA 3UU6A 4JI7T 2KZ7B 3ESLA 4KHZF 3UFEA 3AA1B 2V7KA 4PNIA 5J2TE 2SPCA 3PURA 2V7IA 4ZZBA 3AXJB 1W9RA 2V7LA 4O8SA 4EZHA 5LB7B 5LGTB 3AVRA 3L8RA 3PUXF 5DABA 4CN4A 3F31A 4YTPA 2XJ7A 1ZV4X 4PK6A 3ZKRA 4CXYA 2YDSA 4NIQA 5J0ZA 4BJMA 3IBPA 1QUUA 1T7SA 4IE7A 3VRBA 3UQ7A 4AISA 3UTKA 1NWMX 3U78A 3JC6D 2QA7A 3HKEE 4IE5A 2BKPA 4QX8B 3E08A 4PJNA 4P1NA 4LF6T 2PTFA 3ZCJA 2WDVA 3H3AA 3U3IA 2WDRA 4YJ2E 4YSXA 5A1LA 2HHHT 4B3MT 4IL9A 4UV9B 5JQGE 4CN6A 2JMKA 3N2OA 3ANWA 3DJBA 3ZCIA 4LF4T 4GKKT 3LSVA 1T72A 1X9BA 3RQWA 1XDPA 2HN2A 1E1HB 2YN6A 4L9IA 3T8OA 4X66T 3ZYMA 5BR8T 4JI3T 2JMHA 4Z90A 5JDMA 2X0YA 2VQET 4XBFB 2QGSA 3A5XA 3EAMA 4IGUA 5L4HA 1XWMA 4ZI3C 1NENA 1Y01A 3AE8A 1HX8A 3OJAA 3P4RA 3PUAA 3ZMTB 2LJLA 4HGAA 4U31A 5LOVE 2V7MA 5LXTE 3EDVA 2VQFT 4U7YA 2J47A 3O1JA 4PJMA 5LHHB 2CWYA 3KV9A 2A9UA 2XM1A 1N32T 1M62A 3F2EA 1AJ3A 5HCMA 2Q9QB 3PDYA 4KBMB 4LFCT 1SA0E 4LF8T 4B3RT 3MZKB 2XQ5A 2I6HA 2MBGA 5EK2A 4WBOA 2IAKA 2L9QA 2V5CA 2VVNA 1HCIA 2LM2A 4H9OC 4ILBA 5FXWA 5FXZA 1HR0T 2WM9A 5HXHA 2V1DB 2M67A 3ETVA 4UF0B 3QK6A 2IC6A 2WCAA 3GN5A 4F6RC 2BKNA 5AQHB 4HFIA 4U3CA 3UU4A 1WR6A 2W61A 2KWHA 3NWIA 2XHEB 4EGWA 5FVLA 2XASB 5L2LA 4C90A 1WCRA 2B76A 3ZT7A 4U72A 2V6YB 1MIYA 3PJAA 4L0RA 3ZN1B 3N2KE 4E7SA 1MMGA 2V7JA 2PG8A 3RLFF 1FMWA 1BR1A 3OYZA 3BK9A 3QOFA 4ADZA 2H89A 4EEDA 4CXWA 4UF0A 2CXLA 2WZIA 5LBQB 4X64T 4O4IE 1KNZA 3MJXA 2X9WA 4AXPA 3CPZA 3I0OA 2Q9QA 4UV8B 5HCJA 4EYUA 4ERRA 3ZSSA 3AVSA 4HKAA 3P50A 4AQGA 1E2AA 3ANWB 4MLKA 2BKOA 2C0SA 5L3CB 2NR4A 4UVCB 3VKHA 4G63A 5L3FB 2WMOA 4J2CA 4ZHQE 3AE7A 3E0ZA 5BMVE 3T1HT 5LBMA 2VASA 3RQUA 4ZZCA 4UELA 2YU2A 1UCUA 4EIWA 5F8PA 4ILCA 5CJ5A 2K24A 3RH3A 1WRDA 3UUNA 2YDRA 4H9RC 3N9LA 2Q9QD 4JV5T 1FMVA 2ACZA 4WZXA 2H7VC 4CI2B 4FI5A 3AAAB 4TX5A 2V6YA 2XAHB 1W0AA 1YD8G 4P0BA 5IWAT 4DBQA 5ABEA 2J62A 3K3NA 1LKXA 2LEHA 2UXXB 3RC8A 2V8SV 4QWNB 5KXJA 5FKYA 2IIUA 1MMDA 1YQ3A 4Z8XA 4DR2T 3EUHA 3AECA 1YKHB 1SUMB 2D0UA 3OVUA 4QH4A 4E7ZA 3UU8A 3RIUA 3TLSA 3HKDE 1WR0A 2WZHA 2LM9A 4OK0A 4PK4A 1SE7A 1OEDC 1IBLT 3AEBA 3RYIE 3P4PA 3PUGA 3FXDB 1UURA 5AQIB 1Y64B 5FY7A 4WW0A 3SFDA 2LSJA 5F3JA 3KINB 2Y6XA 4HE8A 4NXMT 3ZJ2A 4JI8T 4WBNE 2D2SA 2WDQA 3RRWA 4ZI3D 3RRCA 3PUSA 4YHHT 3VR9A 4C91A 4YHJA 2XQAA 1HNXT 2LSYA 4DIDB 2UXNB 3FZHB 5L4EA 3Q5DA 4EZ4A 2W2UA 4X1IE 2CHNA 2KLQA 4TWFA 5HEUA 4ZS3A 3RYHE 3PV0F 2YDQA 5CA0E 5LG4A 4DR1T 3O4XE 2UXBT 2VKJA 3ZN0B 5F5WA 4AIUA 2BZBA 3GA8A 3I1AA 3RX6A 1IZNB 4O2BE 2PJQA 2AE9A 3C64A 3JC6C 5AQQB 3NBXX 1DU2A 3KV4A 3RIUC 3UQ4A 3AAIA 2NW8A 4QXBB 3CQXC 1HFAA 4PJJA 2BG9C 3EABA 2XQ8A 2XSBA 3HKBE 2EHOB 3PJAJ 3CX6B 4QX7B 2ODVA 3GMIA 3MK7C 1S35A 2X68A 4IE4A 2L8KA 2YU1A 4UR9A 3RKOA 5ABHA 3Q5XA 2XUEA 3B57A 2E5VA 4DV4T 3MA9A 4TZ4C 2CXDA 3CX8B 4Z91A 5KMGP 1OWAA 2CE7A 2HN1A 2W62A 1U4QA 3LK3B 2XY8B 2VURA 2W63A 3A7MA 5FMNA 4JEUB 5ABFA 3N9OA 3Q9DA 2E8IA 5FVKA 2XZEA 2E9XC 2YINA 4DV3T 5DQWA 2E9XA 2VB6A 2NTYA 3RGLA 4LF5T 4DV1T 3JAEA 4QHOA 4AKHA 2CCQA 2WU5A 3LG7A 2DWKA 2KNDA 4HFVA 3OTOT 3BQIA 5EK4A 3IA3A 1M7KA 5AQPB 4A5XA 3PU8A 2E9XB 5ADXL 3AEDA 1IJ5A 2AXDS 4NUVA 2UUAT 4U74A 4DVDA 1HNZT 2VVSA 3AE6A 1X79A 2OLTA 1D1AA 2Q9QC 4AI6A 1Z0PA 3L39A 2HH7A 4UEMA 4DR7T 2DI4A 2HPJA 2IMLA 2BG9A 2OA5A 3AE9A 3N9PA 4HWCA 4IREA 3OPCA 4HFHA 4KP3C 3K3QC 3QNUA 5GONE 5AQVB 3BQLA 3P8CD 5HYAA 3K3OA 5AQJB 4ZI7E 4U7IA 2A3DA 4MHCA 4TWHA 3RI5A 4ZEYA 2LSKA 1HS7A 2R6GF 2BS4A 4IDNA 5IYZE 5L3GB 3PU3A 2JPFA 4IE0A 4LFBT 2KMFA 3AE3A 3IHRA 4AQFC 2A2FX 2RP4A 4H9PC 3R6NA 3H3MA 3VRAA 5JDLA 4XAXB 2M6IA 4HWFA 3GN5B 4HFCA 3UFGA 4YY3T 3I0QA 2UUBT 4X5TA 1H7CA 2Y8DA 2LE8A 1HTJF 4AKIA 4FJOA 5FNVE 3ZSTA 4DV7T 2FJAA 1L0VA 4JI1T 4HFEA 3KV5A 4DMWA 3VU7H 4KHPT 2HPLA 3G06A 3W15B 4DR6T 2LSIA 3NVOA 2YEVC 4LF7T 3AE1A 4JI4T 4ILUA 4O4LE 3RIFA 3ZPOA 5FY0A 3B13A 3QUJA 4IE6A 4BAYB 4DR4T 1OEDA 2VK9A 2XQYA 4H63V 4PJLA 4TWDA 2MAWA 3ONJA 3B5MA 3ZT6A 4HN9A 4O2AE 4CI1B 1I94T 3OYXA 5HEJA 3AE2A 1WYBA 3LK42 1J1JA 1OEDB 4TV9E 1CHUA 1VCSA 1ZP0A 5JTGA 1YQ4A 3CKDA 3GWHA 2XAQB 3WAJA 4CQIA 3O1HA 1FEWA 3P4SA 3FZFB 4AKGA 3JCFA 3C50A 4LMJA 4AKLA 3ZYLA 4TNVA 1XMQT 4EYYR 1LRZA 1O3XA 2C5JA 2FJBA 2E5LT 3KVBA 1B7TA 3NZQA 1BR2A 4GOUA 3AEEA 3ZMVB 5LCYA 2CM0A 4DBRA 1G73A 2BDEA 3WAKA 3L09A 3ZLIA 3ZC1A 5C8YE 4ISSA 4DUYT 4I55E 4TV8E 4IL4A 5LG3A 1J5WA 2LKHA 3LFMA 5ABFB 1OXZA 2LOPA 2KWIB 4IIJE 3M65A 3RPUA 5AQLB 1OEDE 4ASKA 4EXTA 3AEAA 4DV0T 2QRXA 1Z8UA 1I6ZA 1NAFA 1XMOT 2W00A 3QB5K 3A8YC 2FJDA 5HXRA 3F57A 2WY2A 5FP3A 5CB4E 1YW0A 3C4WA 3Q5WA 3N9MA 3N2GE 5HAXA 3VR8A 4X65T 2FBWA 1GQEA 3AE5A 3L3PA 5AQKB 1IBKT 3LBXB 1IJ6A 2CWOA 2UUCT 4H9QC 3O9XA 2XM2A 3AA6B 3AE4A 3TKLB 4UXNB 4COFA 1SHZC 3LBXA 3UUXB 4BA9A 3P7IA 3AAEB 3FBZA 4EEBA 4IDOA 2JJ9A 4YXDA 1KEYA 2W67A 4YTMA 1MNEA 3ZMZB 2F4VT 5IHYA 1UGOA 3CMLA 3ETUA 5AQFB 1XZYA 5JR9B 2J4GA 1YXRA 4K0UA 2IC9A 3AXJA 3Q5EA 4AKRB 2EHOA 2VKOA 5CGMA 2BG9E 5IUXA 3RKGA 4ZI2C 3S4UA 1XNQT 4YTNA 2ZM6T 2I0MA 1MIWA 1V9DA 1WYCA 3UU5A 2NOXA 4CI3B 5LA6E 2XQ9A 4EAHA 5LJNA 3KVAA 5DJQC 2CBIA 2K48A 2NTXA 3V5SA 3QC9A 5C2TA 1KK7A 1LVKA 4HWIB 2MOZA 3CQCB 3I9YA 4DO0A 2E9XD 2E2AA 5AFUL 4P09A 5HEOA 4GYSA 3RF1A 2EHOD 4X1YE 2QVAA 5AQMB 2ZLYA 3BQKA 1T98A 3V5UA 3ZYKA 1D0YA 3HI2A 4OHFA 4WNKA 5HXCA 4DNDA 4YSZA 5LGUB 3C51A 4B3ST 3ZMUB 1UX5A 2VKDA 1YKEB 3SWHA 1KNPA 3PUVF 4X20E 4LMLA 2DLRA 2QYWA 4IDZA 3TLVA 3SS1A 4H9SE 1QSDA 5JR9C 4OYKA 3CVRA 3TLWA 2BS3A 2CPTA 5AQGB 4PK5A 3SFEA 4G2AA 5M4YA 5LJMA 3ONLC 5L47A 5LMNT 1HX1B 1BR4A 4IHJE 4O4JE 2LSGA 3JAFA 2JQQA 5AQUB 2DL1A 2W0GA 3VHLA 4EV6A 2CLYC 4KX6A 3CWZB 5CFBA 2EHOC 1UUSA 2KINB 4YFSA 3ABVA 2RA1A 1D0ZA 4QH5A 4UVBB 2X9HA 4ILAA 3IF8B 4B3TT 2IHR1 2NWBA 2XPKA 3FXEB 4ZXLA 5HWXA 2UXDT 3AA7B 4N78D 3ZT5A 2W4XA 1XNRT 3CX7B 3NRYA 4I43B 2XQ6A 2B1EA 5AQRB 3N9QA 1BR0A 2G0UA 2LHNA 3UT5E 2K3WA 2BBHA 5CA1E 4YJ3E 5JDHA 3LDQB 1D1CA 2KXPB 4H63H 2YOEA 4NUUA 1E7PA 1UK5A 1MMNA 2PBIA 4U33A 4WYVA 4JYAT 3FB2A 2Y48B 4QKNA 1ZEEA 5JRCB 4X1KE 2IW5B 5AQTB 1VOMA 1W0BA 4HFDA 2BVMA 2BVLA 1UX4A 3CIRA 5FXVA 3ZC0A 4UIGA 5L3DB 4BJNA 1MIVA 3LK2B 5JRCA 2ZM0A 3P4QA 2GK9A 2UXCT 2CBJA 2XAFB 5FYMA 2N1GA 3EVYA 3FBLA 5HXEA 3RYCE 4A97A 4MALA 2IDOB 3CQGB 4GK5E 5ETWA 2CHOA 2L3LA 1KNRA 5LYJE 4UVAB 2WMNA 5HEHA 2JQKA 3R84B 2ZMAA 1N34T 5E0OA 3PE0A 4DV2T 5JVDE 4DV6T 3TLUA 2DHRA 1ZHCA 2LLYA 5C3JA 2D9DA 2V6XA 1ZOYA 4LF9T 4ZI2D 2N2NA 3HL6A 1JNRA 3C4ZA 3FZLB 4ZS2A 1W09A 3EDUA 2W66A 3OKQA 2XTLA 3PUQA 4JUYA 4L5GA 5DQVA 2WQYA 5HWYA 5FL1A 2KT9A 4TUYE 1N33T 1R8IA 4O4HE 2RPAA 4HWHA 5JDNA 2X67A 4I4TE 1MNDA 2A72A 3FZMB 4JLEA 4H9NC 2KSRA 4PFPA 3DP7A 2WWVA 3WI3A 2X9XA 2ODUA 5AQNB 5KX5E 2X0LB 3EI0A 3QB5A 5H6QB 2X9YA 3MACA 3ZMSB 5JDGA 1NEKA 2C5IT 4B6XA 3ZEFB 5JDFA 4JI0T 3VKGA 3K8PC 3AEFA 4TNWA 3J7Yq 2I59A 4HTEA 3PTRB 2XQ4A 4M1PA 2MPKA 4IDQA 5J1GA 2WWUA 3N5LA 5LMUT 2VL0A 4MFRA 2JQHA 4OX9T 5FL0A 3UULA 2XAGB 4TN7B 4I50E 2CLYB 3SRZA 3PUYF 1G8XA 1MMAA 2CMRA 5AQOB 5AQSB 4DMVA 1US7B 1WLXA 3P4WA 2LKGA 4K0KT 3JADA 2FUPA 2WBLA 3KDSE 4DR5T 1HNWT 2LRKA 2J1DG 2CEAA
chains in the Genus database with same CATH topology
4AQFA 5LHGB 3FHNA 1FIOA 3KV6A 2LT3A 3D0TA 1VRBA 3NRXA 2VKHA 4EB6E 5HXSA 5FXXA 2YK0A 3HA4A 4GIWA 4QXCB 1LVFA 2P9BA 3Q2MA 3NZPA 2LOSA 2N9DA 2PFVA 4P0AA 5FY1A 5LNKA 3AB3B 2NP9A 4ISTA 4OYJA 3KBUA 3ZJ1A 5J2UE 1HG2A 2WSSV 5EZYE 2NW9A 4A56A 2LHRA 3KBTA 4PAGA 2MTQA 1D1BA 3OBVE 5L3BB 2DNXA 3HKCE 4QXHB 1HG5A 3E22E 1S94A 5JH7E 1ZKEA 2ACXA 3I9WA 4XZCA 2H3RA 3LJCA 5LP6E 1U5PA 5JDQA 2NW7A 3C4XA 4YLHA 2V26A 3J9X1 4PW8A 2JRKA 3C98B 1HF8A 2ZM8A 4GK0E 2D5UA 3DTOA 2D0TA 2K5BB 2DCFA 3H37A 2WAUA 3MXZA 1D0XA 3N9NA 3MKDA 4AKGA 1IAPA 4KUMB 4CZZB 4HEAA 4KMCA 2C5KT 5EK3A 2CA5A 2XAJB 2ES0A 5LGNB 4JEHB 4ANJA 2X66A 3O1IA 2DWGA 3IEEA 3HR0A 2K9AA 4GYRA 4V1Av 2VL8A 2CXFA 2VWAA 4EOZB 5TAOA 5JR9A 2H7OA 4OFZA 3RC3A 1CUNA 4MBQA 3UUMA 3ONXA 4CXXA 5H6RB 5L3EB 4PFOA 1EZ3A 4ZOLE 2Z6EA 2X51A 3AA0B 3KFWX 2MYSA 3SOLA 3RYFE 5JREA 2ZM2A 2KZ7B 3ESLA 3UFEA 3AA1B 2V7KA 4PNIA 5J2TE 2SPCA 3PURA 2V7IA 4O8SA 2V7LA 4EZHA 5LGTB 3AVRA 5DABA 3F31A 4PK6A 1ZV4X 4CXYA 4BJMA 3IBPA 1QUUA 4IE7A 3UTKA 1NWMX 3U78A 3JC6D 2QA7A 3HKEE 4IE5A 4QX8B 3E08A 4PJNA 3ZCJA 3U3IA 3H3AA 4YJ2E 5A1LA 4UV9B 5JQGE 2JMKA 3N2OA 3ANWA 3DJBA 3ZCIA 1E1HB 3T8OA 4L9IA 3ZYMA 2JMHA 5JDMA 4XBFB 3A5XA 2QGSA 4IGUA 4ZI3C 1HX8A 3OJAA 3PUAA 3ZMTB 2LJLA 4HGAA 5LOVE 2V7MA 5LXTE 3EDVA 3O1JA 4PJMA 5LHHB 2CWYA 3KV9A 3F2EA 1AJ3A 2Q9QB 3PDYA 4KBMB 1SA0E 3MZKB 2MBGA 5EK2A 4WBOA 2IAKA 2L9QA 5FXZA 4H9OC 1HCIA 5FXWA 2WM9A 5HXHA 2V1DB 2M67A 3ETVA 4UF0B 3QK6A 2IC6A 3GN5A 4F6RC 1WR6A 2W61A 2KWHA 2XHEB 2XASB 5L2LA 4C90A 4U72A 1MIYA 4L0RA 3ZN1B 3N2KE 4E7SA 1MMGA 2V7JA 2PG8A 1FMWA 1BR1A 3OYZA 3BK9A 4ADZA 4CXWA 4UF0A 2CXLA 5LBQB 4O4IE 1KNZA 3MJXA 2X9WA 4AXPA 3CPZA 3I0OA 2Q9QA 4UV8B 4EYUA 4ERRA 3AVSA 4HKAA 4AQGA 3ANWB 4MLKA 2C0SA 5L3CB 4UVCB 3VKHA 4G63A 5L3FB 2WMOA 4J2CA 4ZHQE 3E0ZA 5BMVE 5LBMA 2VASA 4UELA 2YU2A 1UCUA 4EIWA 5F8PA 2K24A 3RH3A 1WRDA 3UUNA 4H9RC 3N9LA 2Q9QD 1FMVA 2H7VC 4CI2B 4FI5A 3AAAB 4TX5A 2XAHB 1YD8G 4P0BA 4DBQA 3K3NA 1LKXA 2LEHA 2UXXB 3RC8A 4QWNB 1MMDA 4Z8XA 3EUHA 1YKHB 2D0UA 4E7ZA 3HKDE 2LM9A 4OK0A 4PK4A 3RYIE 3PUGA 3FXDB 1Y64B 5FY7A 4WW0A 5F3JA 2LSJA 3KINB 2Y6XA 4HE8A 3ZJ2A 4WBNE 2D2SA 3RRWA 4ZI3D 3RRCA 3PUSA 4C91A 4YHJA 2LSYA 2UXNB 4EZ4A 4X1IE 2KLQA 4ZS3A 3RYHE 5CA0E 5LG4A 3O4XE 2VKJA 3ZN0B 2BZBA 3GA8A 3I1AA 3RX6A 1IZNB 4O2BE 2PJQA 3C64A 3JC6C 3NBXX 3KV4A 3AAIA 2NW8A 4QXBB 3CQXC 1HFAA 4PJJA 3HKBE 2EHOB 4QX7B 3CX6B 3GMIA 2ODVA 3MK7C 1S35A 2X68A 4IE4A 2L8KA 2YU1A 3RKOA 3Q5XA 2XUEA 3B57A 3MA9A 4TZ4C 2CXDA 3CX8B 5KMGP 1OWAA 2CE7A 2W62A 1U4QA 3LK3B 2W63A 5FMNA 4JEUB 3N9OA 3Q9DA 2E8IA 2E9XC 2YINA 5DQWA 2E9XA 2VB6A 2NTYA 4QHOA 4AKHA 2CCQA 4HFVA 3LG7A 2DWKA 2KNDA 3BQIA 5EK4A 3PU8A 2E9XB 5ADXL 1IJ5A 4NUVA 4U74A 4DVDA 1X79A 1D1AA 2Q9QC 4AI6A 1Z0PA 2HH7A 4UEMA 2DI4A 2HPJA 2OA5A 3N9PA 5CA1E 5KX5E 4KP3C 5GONE 3K3QC 5HYAA 5KDMC 3BQLA 3P8CD 3K3OA 4ZI7E 2A3DA 4MHCA 2LSKA 1HS7A 5IYZE 5L3GB 3PU3A 2JPFA 4IE0A 2KMFA 4AQFC 3IHRA 2A2FX 2RP4A 4H9PC 3R6NA 5JDLA 4XAXB 3GN5B 3I0QA 1H7CA 2Y8DA 2LE8A 1HTJF 4AKIA 4FJOA 5FNVE 3KV5A 4DMWA 3VU7H 2HPLA 3W15B 2LSIA 2YEVC 4ILUA 4O4LE 3ZPOA 4BAYB 5FY0A 3B13A 3QUJA 2XQYA 2VK9A 4H63V 4PJLA 4HN9A 4O2AE 4CI1B 3OYXA 1WYBA 3LK42 4TV9E 3CKDA 3GWHA 2XAQB 3WAJA 4CQIA 3O1HA 1FEWA 3C50A 4AKLA 3ZYLA 4EYYR 1LRZA 1O3XA 2C5JA 3KVBA 1B7TA 3NZQA 1BR2A 4GOUA 3ZMVB 4DBRA 5LCYA 2CM0A 5C8YE 1G73A 2BDEA 3WAKA 3L09A 3ZLIA 3ZC1A 4ISSA 4I55E 4TV8E 3LFMA 1OXZA 2LOPA 2KWIB 4IIJE 3M65A 3RPUA 4ASKA 4EXTA 1NAFA 2W00A 5HXRA 3F57A 5FP3A 5CB4E 1YW0A 3C4WA 3Q5WA 3N9MA 3N2GE 5HAXA 3L3PA 3LBXB 1IJ6A 2CWOA 4H9QC 3O9XA 3AA6B 3TKLB 4UXNB 1SHZC 3LBXA 3UUXB 4BA9A 3P7IA 3AAEB 3FBZA 2JJ9A 1MNEA 3ZMZB 5IHYA 3CMLA 3ETUA 5JR9B 4K0UA 2IC9A 4AKRB 2EHOA 2VKOA 4ZI2C 3S4UA 1MIWA 1V9DA 1WYCA 4CI3B 2NOXA 5LA6E 4EAHA 5LJNA 3KVAA 5DJQC 2K48A 2NTXA 3V5SA 3QC9A 1KK7A 1LVKA 4DO0A 2MOZA 3CQCB 3I9YA 5AFUL 2E9XD 4P09A 4GYSA 2EHOD 4X1YE 2ZLYA 3BQKA 1T98A 3V5UA 3ZYKA 1D0YA 3HI2A 4OHFA 4WNKA 5HXCA 4DNDA 5LGUB 3C51A 3ZMUB 1UX5A 2VKDA 1YKEB 3SWHA 4X20E 2DLRA 4IDZA 3SS1A 4H9SE 1QSDA 5JR9C 4OYKA 3CVRA 4PK5A 4G2AA 5M4YA 5LJMA 1BR4A 4IHJE 4O4JE 2LSGA 2JQQA 2W0GA 3VHLA 2CLYC 3CWZB 2EHOC 2KINB 4YFSA 2RA1A 1D0ZA 4UVBB 2X9HA 3IF8B 2NWBA 3FXEB 5HWXA 3AA7B 4N78D 3CX7B 3NRYA 4I43B 2B1EA 3N9QA 1BR0A 2G0UA 2LHNA 3UT5E 4YJ3E 5JDHA 1D1CA 2KXPB 4H63H 4NUUA 2PBIA 1MMNA 3FB2A 2Y48B 4QKNA 1ZEEA 5JRCB 4X1KE 2IW5B 1VOMA 2BVMA 2BVLA 1UX4A 5FXVA 3ZC0A 4UIGA 5L3DB 4BJNA 1MIVA 3LK2B 5JRCA 2ZM0A 2GK9A 2XAFB 5FYMA 2N1GA 3EVYA 3FBLA 5HXEA 3RYCE 4MALA 3CQGB 4GK5E 5ETWA 2L3LA 5LYJE 4UVAB 2WMNA 3R84B 2ZMAA 5E0OA 3PE0A 5JVDE 2DHRA 1ZHCA 4ZI2D 2N2NA 3HL6A 3C4ZA 4ZS2A 3EDUA 3PUQA 4L5GA 3OKQA 2XTLA 5DQVA 4JUYA 5HWYA 2KT9A 4TUYE 4O4HE 5JDNA 2X67A 4I4TE 1MNDA 2A72A 4JLEA 4H9NC 4PFPA 3DP7A 3WI3A 2X9XA 2ODUA 2X0LB 5H6QB 2X9YA 3MACA 3ZMSB 5JDGA 2C5IT 4B6XA 3ZEFB 5JDFA 3VKGA 3K8PC 3J7Yq 2I59A 4HTEA 3PTRB 4M1PA 5J1GA 2WWUA 3N5LA 4MFRA 3UULA 2XAGB 4TN7B 4I50E 2CLYB 3SRZA 5LHIB 1G8XA 1MMAA 2CMRA 4DMVA 1US7B 1WLXA 2WBLA 3KDSE 4IE6A 2J1DG 2CEAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O9X A;  3GA8 A;  3GN5 A;  3GN5 B;  3HI2 A; 
#chains in the Genus database with same CATH topology
 4AQF A;  3T1Y T;  5LHG B;  3FHN A;  1FIO A;  3KV6 A;  2WB5 A;  2LT3 A;  3D0T A;  1VRB A;  2LRL A;  2XQ3 A;  3NRX A;  2IUB A;  4JI5 T;  4LFA T;  2VKH A;  1JNZ A;  4KI0 F;  4IT4 A;  4EB6 E;  1VCT A;  5FXX A;  5HXS A;  2JQ9 A;  2YK0 A;  3HA4 A;  4GIW A;  4QXC B;  3K1S A;  1LVF A;  2P9B A;  3NKZ A;  3Q2M A;  3NZP A;  3PUZ F;  5HEG A;  1IBM T;  2CRB A;  2LOS A;  2N9D A;  2PFV A;  4DR3 T;  5FY1 A;  4P0A A;  5LNK A;  3AB3 B;  2NP9 A;  4IST A;  1FJG T;  4OYJ A;  3KBU A;  2XSA A;  4IDP A;  2FJE A;  1T8B A;  2OV9 A;  3ZJ1 A;  4Q25 A;  5J2U E;  2WU2 A;  4DUZ T;  1HG2 A;  2WSS V;  2WP9 A;  5EZY E;  3CK6 A;  2NW9 A;  2M6B A;  4A56 A;  2LHR A;  3KBT A;  2UU9 T;  2BBJ A;  4PAG A;  2MTQ A;  1D1B A;  2BG9 B;  3OBV E;  2DNX A;  4JI2 T;  5L3B B;  4U2Y A;  4AQY T;  3HKC E;  4QXH B;  1KF6 A;  1HG5 A;  1WFD A;  3E22 E;  4YT0 A;  1S94 A;  5JH7 E;  1ZKE A;  1J5E T;  2ACX A;  3I9W A;  4XZC A;  2H3R A;  3LJC A;  5LP6 E;  1U5P A;  3TLT A;  4DV5 T;  4NXN T;  3AEG A;  3X1D A;  5JDQ A;  3FZK B;  2NW7 A;  3C4X A;  4YLH A;  4QH1 A;  4I0U A;  3RHW A;  2V26 A;  4A98 A;  4F8H A;  3J9X 1;  1XDO A;  2JRK A;  4PW8 A;  3C98 B;  1HF8 A;  2ZM8 A;  4GK0 E;  4JBW F;  2BS2 A;  2D5U A;  2D0T A;  2K5B B;  3DTO A;  2DCF A;  3H37 A;  2WAU A;  3MXZ A;  1D0X A;  3N9N A;  3MKD A;  5KDM C;  1IAP A;  4KUM B;  2YKS A;  4HEA A;  4KMC A;  2C5K T;  3M3Z B;  5EK3 A;  4CZZ B;  5ABG A;  4YSY A;  5LHI B;  2CA5 A;  2V5D A;  2WS3 A;  2XAJ B;  1KFY A;  2ES0 A;  2X0H A;  5LGN B;  4JEH B;  4ANJ A;  2X66 A;  3O1I A;  2DWG A;  3IEE A;  3RIA A;  3HR0 A;  2K9A A;  4GYR A;  4LMK A;  2VL8 A;  2CXF A;  2H88 A;  2VWA A;  4V1A v;  4EOZ B;  5TAO A;  5JR9 A;  2H7O A;  4OFZ A;  2JIW A;  3PUW F;  3RC3 A;  4X62 T;  1CUN A;  3EHZ A;  4U2Z A;  4MBQ A;  3UUM A;  3UUB A;  3ONX A;  1N36 T;  4CXX A;  5H6R B;  4NPP A;  4CN1 A;  3UU3 A;  4JI6 T;  5L3E B;  4PFO A;  1EZ3 A;  4ZOL E;  2Z6E A;  2X51 A;  3AA0 B;  3KFW X;  4GKJ T;  4HFB A;  2MYS A;  2XQ7 A;  1QLB A;  4HWD A;  3RYF E;  3SOL A;  2ZM2 A;  5JRE A;  3UU6 A;  4JI7 T;  2KZ7 B;  3ESL A;  4KHZ F;  3UFE A;  3AA1 B;  2V7K A;  4PNI A;  5J2T E;  2SPC A;  3PUR A;  2V7I A;  4ZZB A;  3AXJ B;  1W9R A;  2V7L A;  4O8S A;  4EZH A;  5LB7 B;  5LGT B;  3AVR A;  3L8R A;  3PUX F;  5DAB A;  4CN4 A;  3F31 A;  4YTP A;  2XJ7 A;  1ZV4 X;  4PK6 A;  3ZKR A;  4CXY A;  2YDS A;  4NIQ A;  5J0Z A;  4BJM A;  3IBP A;  1QUU A;  1T7S A;  4IE7 A;  3VRB A;  3UQ7 A;  4AIS A;  3UTK A;  1NWM X;  3U78 A;  3JC6 D;  2QA7 A;  3HKE E;  4IE5 A;  2BKP A;  4QX8 B;  3E08 A;  4PJN A;  4P1N A;  4LF6 T;  2PTF A;  3ZCJ A;  2WDV A;  3H3A A;  3U3I A;  2WDR A;  4YJ2 E;  4YSX A;  5A1L A;  2HHH T;  4B3M T;  4IL9 A;  4UV9 B;  5JQG E;  4CN6 A;  2JMK A;  3N2O A;  3ANW A;  3DJB A;  3ZCI A;  4LF4 T;  4GKK T;  3LSV A;  1T72 A;  1X9B A;  3RQW A;  1XDP A;  2HN2 A;  1E1H B;  2YN6 A;  4L9I A;  3T8O A;  4X66 T;  3ZYM A;  5BR8 T;  4JI3 T;  2JMH A;  4Z90 A;  5JDM A;  2X0Y A;  2VQE T;  4XBF B;  2QGS A;  3A5X A;  3EAM A;  4IGU A;  5L4H A;  1XWM A;  4ZI3 C;  1NEN A;  1Y01 A;  3AE8 A;  1HX8 A;  3OJA A;  3P4R A;  3PUA A;  3ZMT B;  2LJL A;  4HGA A;  4U31 A;  5LOV E;  2V7M A;  5LXT E;  3EDV A;  2VQF T;  4U7Y A;  2J47 A;  3O1J A;  4PJM A;  5LHH B;  2CWY A;  3KV9 A;  2A9U A;  2XM1 A;  1N32 T;  1M62 A;  3F2E A;  1AJ3 A;  5HCM A;  2Q9Q B;  3PDY A;  4KBM B;  4LFC T;  1SA0 E;  4LF8 T;  4B3R T;  3MZK B;  2XQ5 A;  2I6H A;  2MBG A;  5EK2 A;  4WBO A;  2IAK A;  2L9Q A;  2V5C A;  2VVN A;  1HCI A;  2LM2 A;  4H9O C;  4ILB A;  5FXW A;  5FXZ A;  1HR0 T;  2WM9 A;  5HXH A;  2V1D B;  2M67 A;  3ETV A;  4UF0 B;  3QK6 A;  2IC6 A;  2WCA A;  3GN5 A;  4F6R C;  2BKN A;  5AQH B;  4HFI A;  4U3C A;  3UU4 A;  1WR6 A;  2W61 A;  2KWH A;  3NWI A;  2XHE B;  4EGW A;  5FVL A;  2XAS B;  5L2L A;  4C90 A;  1WCR A;  2B76 A;  3ZT7 A;  4U72 A;  2V6Y B;  1MIY A;  3PJA A;  4L0R A;  3ZN1 B;  3N2K E;  4E7S A;  1MMG A;  2V7J A;  2PG8 A;  3RLF F;  1FMW A;  1BR1 A;  3OYZ A;  3BK9 A;  3QOF A;  4ADZ A;  2H89 A;  4EED A;  4CXW A;  4UF0 A;  2CXL A;  2WZI A;  5LBQ B;  4X64 T;  4O4I E;  1KNZ A;  3MJX A;  2X9W A;  4AXP A;  3CPZ A;  3I0O A;  2Q9Q A;  4UV8 B;  5HCJ A;  4EYU A;  4ERR A;  3ZSS A;  3AVS A;  4HKA A;  3P50 A;  4AQG A;  1E2A A;  3ANW B;  4MLK A;  2BKO A;  2C0S A;  5L3C B;  2NR4 A;  4UVC B;  3VKH A;  4G63 A;  5L3F B;  2WMO A;  4J2C A;  4ZHQ E;  3AE7 A;  3E0Z A;  5BMV E;  3T1H T;  5LBM A;  2VAS A;  3RQU A;  4ZZC A;  4UEL A;  2YU2 A;  1UCU A;  4EIW A;  5F8P A;  4ILC A;  5CJ5 A;  2K24 A;  3RH3 A;  1WRD A;  3UUN A;  2YDR A;  4H9R C;  3N9L A;  2Q9Q D;  4JV5 T;  1FMV A;  2ACZ A;  4WZX A;  2H7V C;  4CI2 B;  4FI5 A;  3AAA B;  4TX5 A;  2V6Y A;  2XAH B;  1W0A A;  1YD8 G;  4P0B A;  5IWA T;  4DBQ A;  5ABE A;  2J62 A;  3K3N A;  1LKX A;  2LEH A;  2UXX B;  3RC8 A;  2V8S V;  4QWN B;  5KXJ A;  5FKY A;  2IIU A;  1MMD A;  1YQ3 A;  4Z8X A;  4DR2 T;  3EUH A;  3AEC A;  1YKH B;  1SUM B;  2D0U A;  3OVU A;  4QH4 A;  4E7Z A;  3UU8 A;  3RIU A;  3TLS A;  3HKD E;  1WR0 A;  2WZH A;  2LM9 A;  4OK0 A;  4PK4 A;  1SE7 A;  1OED C;  1IBL T;  3AEB A;  3RYI E;  3P4P A;  3PUG A;  3FXD B;  1UUR A;  5AQI B;  1Y64 B;  5FY7 A;  4WW0 A;  3SFD A;  2LSJ A;  5F3J A;  3KIN B;  2Y6X A;  4HE8 A;  4NXM T;  3ZJ2 A;  4JI8 T;  4WBN E;  2D2S A;  2WDQ A;  3RRW A;  4ZI3 D;  3RRC A;  3PUS A;  4YHH T;  3VR9 A;  4C91 A;  4YHJ A;  2XQA A;  1HNX T;  2LSY A;  4DID B;  2UXN B;  3FZH B;  5L4E A;  3Q5D A;  4EZ4 A;  2W2U A;  4X1I E;  2CHN A;  2KLQ A;  4TWF A;  5HEU A;  4ZS3 A;  3RYH E;  3PV0 F;  2YDQ A;  5CA0 E;  5LG4 A;  4DR1 T;  3O4X E;  2UXB T;  2VKJ A;  3ZN0 B;  5F5W A;  4AIU A;  2BZB A;  3GA8 A;  3I1A A;  3RX6 A;  1IZN B;  4O2B E;  2PJQ A;  2AE9 A;  3C64 A;  3JC6 C;  5AQQ B;  3NBX X;  1DU2 A;  3KV4 A;  3RIU C;  3UQ4 A;  3AAI A;  2NW8 A;  4QXB B;  3CQX C;  1HFA A;  4PJJ A;  2BG9 C;  3EAB A;  2XQ8 A;  2XSB A;  3HKB E;  2EHO B;  3PJA J;  3CX6 B;  4QX7 B;  2ODV A;  3GMI A;  3MK7 C;  1S35 A;  2X68 A;  4IE4 A;  2L8K A;  2YU1 A;  4UR9 A;  3RKO A;  5ABH A;  3Q5X A;  2XUE A;  3B57 A;  2E5V A;  4DV4 T;  3MA9 A;  4TZ4 C;  2CXD A;  3CX8 B;  4Z91 A;  5KMG P;  1OWA A;  2CE7 A;  2HN1 A;  2W62 A;  1U4Q A;  3LK3 B;  2XY8 B;  2VUR A;  2W63 A;  3A7M A;  5FMN A;  4JEU B;  5ABF A;  3N9O A;  3Q9D A;  2E8I A;  5FVK A;  2XZE A;  2E9X C;  2YIN A;  4DV3 T;  5DQW A;  2E9X A;  2VB6 A;  2NTY A;  3RGL A;  4LF5 T;  4DV1 T;  3JAE A;  4QHO A;  4AKH A;  2CCQ A;  2WU5 A;  3LG7 A;  2DWK A;  2KND A;  4HFV A;  3OTO T;  3BQI A;  5EK4 A;  3IA3 A;  1M7K A;  5AQP B;  4A5X A;  3PU8 A;  2E9X B;  5ADX L;  3AED A;  1IJ5 A;  2AXD S;  4NUV A;  2UUA T;  4U74 A;  4DVD A;  1HNZ T;  2VVS A;  3AE6 A;  1X79 A;  2OLT A;  1D1A A;  2Q9Q C;  4AI6 A;  1Z0P A;  3L39 A;  2HH7 A;  4UEM A;  4DR7 T;  2DI4 A;  2HPJ A;  2IML A;  2BG9 A;  2OA5 A;  3AE9 A;  3N9P A;  4HWC A;  4IRE A;  3OPC A;  4HFH A;  4KP3 C;  3K3Q C;  3QNU A;  5GON E;  5AQV B;  3BQL A;  3P8C D;  5HYA A;  3K3O A;  5AQJ B;  4ZI7 E;  4U7I A;  2A3D A;  4MHC A;  4TWH A;  3RI5 A;  4ZEY A;  2LSK A;  1HS7 A;  2R6G F;  2BS4 A;  4IDN A;  5IYZ E;  5L3G B;  3PU3 A;  2JPF A;  4IE0 A;  4LFB T;  2KMF A;  3AE3 A;  3IHR A;  4AQF C;  2A2F X;  2RP4 A;  4H9P C;  3R6N A;  3H3M A;  3VRA A;  5JDL A;  4XAX B;  2M6I A;  4HWF A;  3GN5 B;  4HFC A;  3UFG A;  4YY3 T;  3I0Q A;  2UUB T;  4X5T A;  1H7C A;  2Y8D A;  2LE8 A;  1HTJ F;  4AKI A;  4FJO A;  5FNV E;  3ZST A;  4DV7 T;  2FJA A;  1L0V A;  4JI1 T;  4HFE A;  3KV5 A;  4DMW A;  3VU7 H;  4KHP T;  2HPL A;  3G06 A;  3W15 B;  4DR6 T;  2LSI A;  3NVO A;  2YEV C;  4LF7 T;  3AE1 A;  4JI4 T;  4ILU A;  4O4L E;  3RIF A;  3ZPO A;  5FY0 A;  3B13 A;  3QUJ A;  4IE6 A;  4BAY B;  4DR4 T;  1OED A;  2VK9 A;  2XQY A;  4H63 V;  4PJL A;  4TWD A;  2MAW A;  3ONJ A;  3B5M A;  3ZT6 A;  4HN9 A;  4O2A E;  4CI1 B;  1I94 T;  3OYX A;  5HEJ A;  3AE2 A;  1WYB A;  3LK4 2;  1J1J A;  1OED B;  4TV9 E;  1CHU A;  1VCS A;  1ZP0 A;  5JTG A;  1YQ4 A;  3CKD A;  3GWH A;  2XAQ B;  3WAJ A;  4CQI A;  3O1H A;  1FEW A;  3P4S A;  3FZF B;  4AKG A;  3JCF A;  3C50 A;  4LMJ A;  4AKL A;  3ZYL A;  4TNV A;  1XMQ T;  4EYY R;  1LRZ A;  1O3X A;  2C5J A;  2FJB A;  2E5L T;  3KVB A;  1B7T A;  3NZQ A;  1BR2 A;  4GOU A;  3AEE A;  3ZMV B;  5LCY A;  2CM0 A;  4DBR A;  1G73 A;  2BDE A;  3WAK A;  3L09 A;  3ZLI A;  3ZC1 A;  5C8Y E;  4ISS A;  4DUY T;  4I55 E;  4TV8 E;  4IL4 A;  5LG3 A;  1J5W A;  2LKH A;  3LFM A;  5ABF B;  1OXZ A;  2LOP A;  2KWI B;  4IIJ E;  3M65 A;  3RPU A;  5AQL B;  1OED E;  4ASK A;  4EXT A;  3AEA A;  4DV0 T;  2QRX A;  1Z8U A;  1I6Z A;  1NAF A;  1XMO T;  2W00 A;  3QB5 K;  3A8Y C;  2FJD A;  5HXR A;  3F57 A;  2WY2 A;  5FP3 A;  5CB4 E;  1YW0 A;  3C4W A;  3Q5W A;  3N9M A;  3N2G E;  5HAX A;  3VR8 A;  4X65 T;  2FBW A;  1GQE A;  3AE5 A;  3L3P A;  5AQK B;  1IBK T;  3LBX B;  1IJ6 A;  2CWO A;  2UUC T;  4H9Q C;  3O9X A;  2XM2 A;  3AA6 B;  3AE4 A;  3TKL B;  4UXN B;  4COF A;  1SHZ C;  3LBX A;  3UUX B;  4BA9 A;  3P7I A;  3AAE B;  3FBZ A;  4EEB A;  4IDO A;  2JJ9 A;  4YXD A;  1KEY A;  2W67 A;  4YTM A;  1MNE A;  3ZMZ B;  2F4V T;  5IHY A;  1UGO A;  3CML A;  3ETU A;  5AQF B;  1XZY A;  5JR9 B;  2J4G A;  1YXR A;  4K0U A;  2IC9 A;  3AXJ A;  3Q5E A;  4AKR B;  2EHO A;  2VKO A;  5CGM A;  2BG9 E;  5IUX A;  3RKG A;  4ZI2 C;  3S4U A;  1XNQ T;  4YTN A;  2ZM6 T;  2I0M A;  1MIW A;  1V9D A;  1WYC A;  3UU5 A;  2NOX A;  4CI3 B;  5LA6 E;  2XQ9 A;  4EAH A;  5LJN A;  3KVA A;  5DJQ C;  2CBI A;  2K48 A;  2NTX A;  3V5S A;  3QC9 A;  5C2T A;  1KK7 A;  1LVK A;  4HWI B;  2MOZ A;  3CQC B;  3I9Y A;  4DO0 A;  2E9X D;  2E2A A;  5AFU L;  4P09 A;  5HEO A;  4GYS A;  3RF1 A;  2EHO D;  4X1Y E;  2QVA A;  5AQM B;  2ZLY A;  3BQK A;  1T98 A;  3V5U A;  3ZYK A;  1D0Y A;  3HI2 A;  4OHF A;  4WNK A;  5HXC A;  4DND A;  4YSZ A;  5LGU B;  3C51 A;  4B3S T;  3ZMU B;  1UX5 A;  2VKD A;  1YKE B;  3SWH A;  1KNP A;  3PUV F;  4X20 E;  4LML A;  2DLR A;  2QYW A;  4IDZ A;  3TLV A;  3SS1 A;  4H9S E;  1QSD A;  5JR9 C;  4OYK A;  3CVR A;  3TLW A;  2BS3 A;  2CPT A;  5AQG B;  4PK5 A;  3SFE A;  4G2A A;  5M4Y A;  5LJM A;  3ONL C;  5L47 A;  5LMN T;  1HX1 B;  1BR4 A;  4IHJ E;  4O4J E;  2LSG A;  3JAF A;  2JQQ A;  5AQU B;  2DL1 A;  2W0G A;  3VHL A;  4EV6 A;  2CLY C;  4KX6 A;  3CWZ B;  5CFB A;  2EHO C;  1UUS A;  2KIN B;  4YFS A;  3ABV A;  2RA1 A;  1D0Z A;  4QH5 A;  4UVB B;  2X9H A;  4ILA A;  3IF8 B;  4B3T T;  2IHR 1;  2NWB A;  2XPK A;  3FXE B;  4ZXL A;  5HWX A;  2UXD T;  3AA7 B;  4N78 D;  3ZT5 A;  2W4X A;  1XNR T;  3CX7 B;  3NRY A;  4I43 B;  2XQ6 A;  2B1E A;  5AQR B;  3N9Q A;  1BR0 A;  2G0U A;  2LHN A;  3UT5 E;  2K3W A;  2BBH A;  5CA1 E;  4YJ3 E;  5JDH A;  3LDQ B;  1D1C A;  2KXP B;  4H63 H;  2YOE A;  4NUU A;  1E7P A;  1UK5 A;  1MMN A;  2PBI A;  4U33 A;  4WYV A;  4JYA T;  3FB2 A;  2Y48 B;  4QKN A;  1ZEE A;  5JRC B;  4X1K E;  2IW5 B;  5AQT B;  1VOM A;  1W0B A;  4HFD A;  2BVM A;  2BVL A;  1UX4 A;  3CIR A;  5FXV A;  3ZC0 A;  4UIG A;  5L3D B;  4BJN A;  1MIV A;  3LK2 B;  5JRC A;  2ZM0 A;  3P4Q A;  2GK9 A;  2UXC T;  2CBJ A;  2XAF B;  5FYM A;  2N1G A;  3EVY A;  3FBL A;  5HXE A;  3RYC E;  4A97 A;  4MAL A;  2IDO B;  3CQG B;  4GK5 E;  5ETW A;  2CHO A;  2L3L A;  1KNR A;  5LYJ E;  4UVA B;  2WMN A;  5HEH A;  2JQK A;  3R84 B;  2ZMA A;  1N34 T;  5E0O A;  3PE0 A;  4DV2 T;  5JVD E;  4DV6 T;  3TLU A;  2DHR A;  1ZHC A;  2LLY A;  5C3J A;  2D9D A;  2V6X A;  1ZOY A;  4LF9 T;  4ZI2 D;  2N2N A;  3HL6 A;  1JNR A;  3C4Z A;  3FZL B;  4ZS2 A;  1W09 A;  3EDU A;  2W66 A;  3OKQ A;  2XTL A;  3PUQ A;  4JUY A;  4L5G A;  5DQV A;  2WQY A;  5HWY A;  5FL1 A;  2KT9 A;  4TUY E;  1N33 T;  1R8I A;  4O4H E;  2RPA A;  4HWH A;  5JDN A;  2X67 A;  4I4T E;  1MND A;  2A72 A;  3FZM B;  4JLE A;  4H9N C;  2KSR A;  4PFP A;  3DP7 A;  2WWV A;  3WI3 A;  2X9X A;  2ODU A;  5AQN B;  5KX5 E;  2X0L B;  3EI0 A;  3QB5 A;  5H6Q B;  2X9Y A;  3MAC A;  3ZMS B;  5JDG A;  1NEK A;  2C5I T;  4B6X A;  3ZEF B;  5JDF A;  4JI0 T;  3VKG A;  3K8P C;  3AEF A;  4TNW A;  3J7Y q;  2I59 A;  4HTE A;  3PTR B;  2XQ4 A;  4M1P A;  2MPK A;  4IDQ A;  5J1G A;  2WWU A;  3N5L A;  5LMU T;  2VL0 A;  4MFR A;  2JQH A;  4OX9 T;  5FL0 A;  3UUL A;  2XAG B;  4TN7 B;  4I50 E;  2CLY B;  3SRZ A;  3PUY F;  1G8X A;  1MMA A;  2CMR A;  5AQO B;  5AQS B;  4DMV A;  1US7 B;  1WLX A;  3P4W A;  2LKG A;  4K0K T;  3JAD A;  2FUP A;  2WBL A;  3KDS E;  4DR5 T;  1HNW T;  2LRK A;  2J1D G;  2CEA A; 
#chains in the Genus database with same CATH homology
 4AQF A;  5LHG B;  3FHN A;  1FIO A;  3KV6 A;  2LT3 A;  3D0T A;  1VRB A;  3NRX A;  2VKH A;  4EB6 E;  5HXS A;  5FXX A;  2YK0 A;  3HA4 A;  4GIW A;  4QXC B;  1LVF A;  2P9B A;  3Q2M A;  3NZP A;  2LOS A;  2N9D A;  2PFV A;  4P0A A;  5FY1 A;  5LNK A;  3AB3 B;  2NP9 A;  4IST A;  4OYJ A;  3KBU A;  3ZJ1 A;  5J2U E;  1HG2 A;  2WSS V;  5EZY E;  2NW9 A;  4A56 A;  2LHR A;  3KBT A;  4PAG A;  2MTQ A;  1D1B A;  3OBV E;  5L3B B;  2DNX A;  3HKC E;  4QXH B;  1HG5 A;  3E22 E;  1S94 A;  5JH7 E;  1ZKE A;  2ACX A;  3I9W A;  4XZC A;  2H3R A;  3LJC A;  5LP6 E;  1U5P A;  5JDQ A;  2NW7 A;  3C4X A;  4YLH A;  2V26 A;  3J9X 1;  4PW8 A;  2JRK A;  3C98 B;  1HF8 A;  2ZM8 A;  4GK0 E;  2D5U A;  3DTO A;  2D0T A;  2K5B B;  2DCF A;  3H37 A;  2WAU A;  3MXZ A;  1D0X A;  3N9N A;  3MKD A;  4AKG A;  1IAP A;  4KUM B;  4CZZ B;  4HEA A;  4KMC A;  2C5K T;  5EK3 A;  2CA5 A;  2XAJ B;  2ES0 A;  5LGN B;  4JEH B;  4ANJ A;  2X66 A;  3O1I A;  2DWG A;  3IEE A;  3HR0 A;  2K9A A;  4GYR A;  4V1A v;  2VL8 A;  2CXF A;  2VWA A;  4EOZ B;  5TAO A;  5JR9 A;  2H7O A;  4OFZ A;  3RC3 A;  1CUN A;  4MBQ A;  3UUM A;  3ONX A;  4CXX A;  5H6R B;  5L3E B;  4PFO A;  1EZ3 A;  4ZOL E;  2Z6E A;  2X51 A;  3AA0 B;  3KFW X;  2MYS A;  3SOL A;  3RYF E;  5JRE A;  2ZM2 A;  2KZ7 B;  3ESL A;  3UFE A;  3AA1 B;  2V7K A;  4PNI A;  5J2T E;  2SPC A;  3PUR A;  2V7I A;  4O8S A;  2V7L A;  4EZH A;  5LGT B;  3AVR A;  5DAB A;  3F31 A;  4PK6 A;  1ZV4 X;  4CXY A;  4BJM A;  3IBP A;  1QUU A;  4IE7 A;  3UTK A;  1NWM X;  3U78 A;  3JC6 D;  2QA7 A;  3HKE E;  4IE5 A;  4QX8 B;  3E08 A;  4PJN A;  3ZCJ A;  3U3I A;  3H3A A;  4YJ2 E;  5A1L A;  4UV9 B;  5JQG E;  2JMK A;  3N2O A;  3ANW A;  3DJB A;  3ZCI A;  1E1H B;  3T8O A;  4L9I A;  3ZYM A;  2JMH A;  5JDM A;  4XBF B;  3A5X A;  2QGS A;  4IGU A;  4ZI3 C;  1HX8 A;  3OJA A;  3PUA A;  3ZMT B;  2LJL A;  4HGA A;  5LOV E;  2V7M A;  5LXT E;  3EDV A;  3O1J A;  4PJM A;  5LHH B;  2CWY A;  3KV9 A;  3F2E A;  1AJ3 A;  2Q9Q B;  3PDY A;  4KBM B;  1SA0 E;  3MZK B;  2MBG A;  5EK2 A;  4WBO A;  2IAK A;  2L9Q A;  5FXZ A;  4H9O C;  1HCI A;  5FXW A;  2WM9 A;  5HXH A;  2V1D B;  2M67 A;  3ETV A;  4UF0 B;  3QK6 A;  2IC6 A;  3GN5 A;  4F6R C;  1WR6 A;  2W61 A;  2KWH A;  2XHE B;  2XAS B;  5L2L A;  4C90 A;  4U72 A;  1MIY A;  4L0R A;  3ZN1 B;  3N2K E;  4E7S A;  1MMG A;  2V7J A;  2PG8 A;  1FMW A;  1BR1 A;  3OYZ A;  3BK9 A;  4ADZ A;  4CXW A;  4UF0 A;  2CXL A;  5LBQ B;  4O4I E;  1KNZ A;  3MJX A;  2X9W A;  4AXP A;  3CPZ A;  3I0O A;  2Q9Q A;  4UV8 B;  4EYU A;  4ERR A;  3AVS A;  4HKA A;  4AQG A;  3ANW B;  4MLK A;  2C0S A;  5L3C B;  4UVC B;  3VKH A;  4G63 A;  5L3F B;  2WMO A;  4J2C A;  4ZHQ E;  3E0Z A;  5BMV E;  5LBM A;  2VAS A;  4UEL A;  2YU2 A;  1UCU A;  4EIW A;  5F8P A;  2K24 A;  3RH3 A;  1WRD A;  3UUN A;  4H9R C;  3N9L A;  2Q9Q D;  1FMV A;  2H7V C;  4CI2 B;  4FI5 A;  3AAA B;  4TX5 A;  2XAH B;  1YD8 G;  4P0B A;  4DBQ A;  3K3N A;  1LKX A;  2LEH A;  2UXX B;  3RC8 A;  4QWN B;  1MMD A;  4Z8X A;  3EUH A;  1YKH B;  2D0U A;  4E7Z A;  3HKD E;  2LM9 A;  4OK0 A;  4PK4 A;  3RYI E;  3PUG A;  3FXD B;  1Y64 B;  5FY7 A;  4WW0 A;  5F3J A;  2LSJ A;  3KIN B;  2Y6X A;  4HE8 A;  3ZJ2 A;  4WBN E;  2D2S A;  3RRW A;  4ZI3 D;  3RRC A;  3PUS A;  4C91 A;  4YHJ A;  2LSY A;  2UXN B;  4EZ4 A;  4X1I E;  2KLQ A;  4ZS3 A;  3RYH E;  5CA0 E;  5LG4 A;  3O4X E;  2VKJ A;  3ZN0 B;  2BZB A;  3GA8 A;  3I1A A;  3RX6 A;  1IZN B;  4O2B E;  2PJQ A;  3C64 A;  3JC6 C;  3NBX X;  3KV4 A;  3AAI A;  2NW8 A;  4QXB B;  3CQX C;  1HFA A;  4PJJ A;  3HKB E;  2EHO B;  4QX7 B;  3CX6 B;  3GMI A;  2ODV A;  3MK7 C;  1S35 A;  2X68 A;  4IE4 A;  2L8K A;  2YU1 A;  3RKO A;  3Q5X A;  2XUE A;  3B57 A;  3MA9 A;  4TZ4 C;  2CXD A;  3CX8 B;  5KMG P;  1OWA A;  2CE7 A;  2W62 A;  1U4Q A;  3LK3 B;  2W63 A;  5FMN A;  4JEU B;  3N9O A;  3Q9D A;  2E8I A;  2E9X C;  2YIN A;  5DQW A;  2E9X A;  2VB6 A;  2NTY A;  4QHO A;  4AKH A;  2CCQ A;  4HFV A;  3LG7 A;  2DWK A;  2KND A;  3BQI A;  5EK4 A;  3PU8 A;  2E9X B;  5ADX L;  1IJ5 A;  4NUV A;  4U74 A;  4DVD A;  1X79 A;  1D1A A;  2Q9Q C;  4AI6 A;  1Z0P A;  2HH7 A;  4UEM A;  2DI4 A;  2HPJ A;  2OA5 A;  3N9P A;  5CA1 E;  5KX5 E;  4KP3 C;  5GON E;  3K3Q C;  5HYA A;  5KDM C;  3BQL A;  3P8C D;  3K3O A;  4ZI7 E;  2A3D A;  4MHC A;  2LSK A;  1HS7 A;  5IYZ E;  5L3G B;  3PU3 A;  2JPF A;  4IE0 A;  2KMF A;  4AQF C;  3IHR A;  2A2F X;  2RP4 A;  4H9P C;  3R6N A;  5JDL A;  4XAX B;  3GN5 B;  3I0Q A;  1H7C A;  2Y8D A;  2LE8 A;  1HTJ F;  4AKI A;  4FJO A;  5FNV E;  3KV5 A;  4DMW A;  3VU7 H;  2HPL A;  3W15 B;  2LSI A;  2YEV C;  4ILU A;  4O4L E;  3ZPO A;  4BAY B;  5FY0 A;  3B13 A;  3QUJ A;  2XQY A;  2VK9 A;  4H63 V;  4PJL A;  4HN9 A;  4O2A E;  4CI1 B;  3OYX A;  1WYB A;  3LK4 2;  4TV9 E;  3CKD A;  3GWH A;  2XAQ B;  3WAJ A;  4CQI A;  3O1H A;  1FEW A;  3C50 A;  4AKL A;  3ZYL A;  4EYY R;  1LRZ A;  1O3X A;  2C5J A;  3KVB A;  1B7T A;  3NZQ A;  1BR2 A;  4GOU A;  3ZMV B;  4DBR A;  5LCY A;  2CM0 A;  5C8Y E;  1G73 A;  2BDE A;  3WAK A;  3L09 A;  3ZLI A;  3ZC1 A;  4ISS A;  4I55 E;  4TV8 E;  3LFM A;  1OXZ A;  2LOP A;  2KWI B;  4IIJ E;  3M65 A;  3RPU A;  4ASK A;  4EXT A;  1NAF A;  2W00 A;  5HXR A;  3F57 A;  5FP3 A;  5CB4 E;  1YW0 A;  3C4W A;  3Q5W A;  3N9M A;  3N2G E;  5HAX A;  3L3P A;  3LBX B;  1IJ6 A;  2CWO A;  4H9Q C;  3O9X A;  3AA6 B;  3TKL B;  4UXN B;  1SHZ C;  3LBX A;  3UUX B;  4BA9 A;  3P7I A;  3AAE B;  3FBZ A;  2JJ9 A;  1MNE A;  3ZMZ B;  5IHY A;  3CML A;  3ETU A;  5JR9 B;  4K0U A;  2IC9 A;  4AKR B;  2EHO A;  2VKO A;  4ZI2 C;  3S4U A;  1MIW A;  1V9D A;  1WYC A;  4CI3 B;  2NOX A;  5LA6 E;  4EAH A;  5LJN A;  3KVA A;  5DJQ C;  2K48 A;  2NTX A;  3V5S A;  3QC9 A;  1KK7 A;  1LVK A;  4DO0 A;  2MOZ A;  3CQC B;  3I9Y A;  5AFU L;  2E9X D;  4P09 A;  4GYS A;  2EHO D;  4X1Y E;  2ZLY A;  3BQK A;  1T98 A;  3V5U A;  3ZYK A;  1D0Y A;  3HI2 A;  4OHF A;  4WNK A;  5HXC A;  4DND A;  5LGU B;  3C51 A;  3ZMU B;  1UX5 A;  2VKD A;  1YKE B;  3SWH A;  4X20 E;  2DLR A;  4IDZ A;  3SS1 A;  4H9S E;  1QSD A;  5JR9 C;  4OYK A;  3CVR A;  4PK5 A;  4G2A A;  5M4Y A;  5LJM A;  1BR4 A;  4IHJ E;  4O4J E;  2LSG A;  2JQQ A;  2W0G A;  3VHL A;  2CLY C;  3CWZ B;  2EHO C;  2KIN B;  4YFS A;  2RA1 A;  1D0Z A;  4UVB B;  2X9H A;  3IF8 B;  2NWB A;  3FXE B;  5HWX A;  3AA7 B;  4N78 D;  3CX7 B;  3NRY A;  4I43 B;  2B1E A;  3N9Q A;  1BR0 A;  2G0U A;  2LHN A;  3UT5 E;  4YJ3 E;  5JDH A;  1D1C A;  2KXP B;  4H63 H;  4NUU A;  2PBI A;  1MMN A;  3FB2 A;  2Y48 B;  4QKN A;  1ZEE A;  5JRC B;  4X1K E;  2IW5 B;  1VOM A;  2BVM A;  2BVL A;  1UX4 A;  5FXV A;  3ZC0 A;  4UIG A;  5L3D B;  4BJN A;  1MIV A;  3LK2 B;  5JRC A;  2ZM0 A;  2GK9 A;  2XAF B;  5FYM A;  2N1G A;  3EVY A;  3FBL A;  5HXE A;  3RYC E;  4MAL A;  3CQG B;  4GK5 E;  5ETW A;  2L3L A;  5LYJ E;  4UVA B;  2WMN A;  3R84 B;  2ZMA A;  5E0O A;  3PE0 A;  5JVD E;  2DHR A;  1ZHC A;  4ZI2 D;  2N2N A;  3HL6 A;  3C4Z A;  4ZS2 A;  3EDU A;  3PUQ A;  4L5G A;  3OKQ A;  2XTL A;  5DQV A;  4JUY A;  5HWY A;  2KT9 A;  4TUY E;  4O4H E;  5JDN A;  2X67 A;  4I4T E;  1MND A;  2A72 A;  4JLE A;  4H9N C;  4PFP A;  3DP7 A;  3WI3 A;  2X9X A;  2ODU A;  2X0L B;  5H6Q B;  2X9Y A;  3MAC A;  3ZMS B;  5JDG A;  2C5I T;  4B6X A;  3ZEF B;  5JDF A;  3VKG A;  3K8P C;  3J7Y q;  2I59 A;  4HTE A;  3PTR B;  4M1P A;  5J1G A;  2WWU A;  3N5L A;  4MFR A;  3UUL A;  2XAG B;  4TN7 B;  4I50 E;  2CLY B;  3SRZ A;  5LHI B;  1G8X A;  1MMA A;  2CMR A;  4DMV A;  1US7 B;  1WLX A;  2WBL A;  3KDS E;  4IE6 A;  2J1D G;  2CEA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...