3HI2A

Structure of the n-terminal domain of the e. coli antitoxin mqsa (ygit/b3021) in complex with the e. coli toxin mqsr (ygiu/b3022)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
70
structure length
70
Chain Sequence
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator mqsA(ygiT)
publication title Three dimensional structure of the MqsR:MqsA complex: a novel TA pair comprised of a toxin homologous to RelE and an antitoxin with unique properties.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Dna binding protein/toxin
total genus 14
structure length 70
sequence length 70
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.720 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3hi2A00
3GN5B 3GN5A 3O9XA 3HI2A 3GA8A
chains in the Genus database with same CATH superfamily
4EV6A 1HG5A 3AE9A 4ZEYA 4HFBA 4OHFA 4DNDA 4JI4T 4JI6T 2E2AA 5JDHA 3AA6B 1JNZA 4YJ2E 3AA0B 4TZ4C 4I4TE 3AE6A 2X67A 3MA9A 2WU5A 1NEKA 3EI0A 2EHOD 5L47A 1W9RA 3NBXX 3L8RA 3I9YA 5L4HA 1YKHB 3P4QA 1E7PA 3AVSA 5LHHB 4ZI3C 2VL0A 5KDMC 4IIJE 3DJBA 5AQPB 2PFVA 4QHOA 2W66A 3VHLA 2C5KT 1J5WA 4DO0A 4HKAA 4CN6A 2WDRA 5DJQC 3KVAA 2WAUA 1OXZA 2B1EA 3ZT5A 4UIGA 3WAJA 2DHRA 1Z0PA 5LHGB 4JI1T 4DIDB 2KNDA 2OV9A 3QK6A 3IA3A 2KSRA 3C4ZA 3CPZA 4KI0F 2X9YA 4ZI7E 2DCFA 4MFRA 2DLRA 2CRBA 4H9RC 3KBTA 3FXDB 3U78A 1Y01A 3KFWX 5HCJA 2LT3A 2E9XB 2IMLA 5L4EA 4DV3T 1E1HB 5HEUA 5CGMA 4DR3T 2Y6XA 4IE0A 4JI2T 2BBHA 4JUYA 5CB4E 3RC8A 1ZHCA 5AQHB 2P9BA 1N33T 4HFDA 2XAFB 5E0OA 2R6GF 3ZMTB 5FL1A 1MNEA 2BS2A 4CI2B 4EB6E 1UURA 3RLFF 2WM9A 3HKEE 4CZZB 1XDPA 2V7LA 2NOXA 2XQ8A 4HFHA 1KNZA 2WMOA 2FUPA 5ABHA 4HGAA 4YSZA 2V1DB 4UVAB 2B76A 3EDVA 3E08A 2KXPB 4ZZBA 2JMHA 4X20E 4PK4A 5FYMA 4EZ4A 5C8YE 5ABEA 1N36T 3LDQB 4QH5A 3RIUC 2EHOB 3Q5WA 3AE8A 2OA5A 3VR8A 4YHJA 4GK5E 2I0MA 1US7B 2XPKA 4MHCA 2UUBT 1MMDA 2RP4A 3ZN0B 3ANWB 4K0KT 2W63A 3FBLA 4F6RC 3R84B 5CA0E 1MMGA 5J0ZA 5FNVE 3OYXA 2YU1A 5HXRA 4U31A 2DNXA 2W62A 4ZHQE 3CQGB 3N9NA 4PJNA 2CXDA 4QXCB 1UK5A 4LF7T 3N9PA 3RC3A 1NWMX 4YLHA 5BMVE 4X64T 1G8XA 1HS7A 2V6XA 2XSAA 4JV5T 4UXNB 5DABA 4TWDA 5EK4A 1D1BA 4AXPA 2YU2A 2BG9C 4ZS3A 4A56A 4CXXA 5JDLA 3E22E 2WU2A 5H6RB 4IHJE 1HNXT 5M4YA 3CQCB 4DMWA 3TLTA 3JC6D 1HG2A 4Z91A 2CE7A 4NXNT 4NUVA 2IUBA 3O9XA 2M6IA 1G73A 4K0UA 2JQ9A 4OYKA 3RIAA 4PW8A 3GMIA 2XJ7A 5ABFB 3QB5K 4F8HA 4UELA 5IWAT 2J4GA 3CK6A 3KV6A 4Z90A 2WCAA 1OEDE 2XZEA 3UFGA 3HKCE 4U3CA 5CJ5A 5F3JA 2UUCT 2H7VC 3ZYKA 3AA7B 3I0OA 2XUEA 3HL6A 3FZKB 3ETVA 3JAEA 4TX5A 3VU7H 4U74A 4QH4A 3M65A 4UVBB 1UGOA 3OJAA 2QGSA 1HF8A 3F31A 3AE3A 2E9XC 2JPFA 4H63V 4E7ZA 3H3MA 2JJ9A 5L3GB 3QB5A 3ONLC 3T1YT 5JRCA 1HTJF 2DL1A 3B57A 2XAQB 1MMAA 2VKDA 2CEAA 3AXJA 3IBPA 4LMJA 3WI3A 4BA9A 2BVMA 1HR0T 3N9OA 4GK0E 2FJBA 3UU4A 4PNIA 4BJNA 4OK0A 2YKSA 5HXHA 4EYYR 1E2AA 2ODVA 3FHNA 3B13A 2LSKA 4C90A 3P4SA 2W4XA 5LG4A 3P4WA 5AQVB 2CBJA 2BDEA 3K3QC 3ZKRA 1HCIA 1QLBA 2RA1A 2WWVA 4ANJA 3I0QA 4IE4A 2EHOC 4H63H 2W61A 4AI6A 2N2NA 3ZMVB 2XSBA 2XQ5A 3ONJA 1LVKA 3QUJA 5IHYA 4V1Av 3KV9A 5C2TA 3PUVF 5AQUB 4LMLA 2WBLA 1YXRA 1I94T 4G63A 4O2AE 4HWHA 2UXNB 4UR9A 1XMQT 4EZHA 1UUSA 1SA0E 5LJMA 1WLXA 3UU6A 2I6HA 2Q9QA 2XM1A 4X1KE 1UX5A 2YEVC 1YQ4A 4A98A 2NP9A 3NKZA 3AAEB 3Q2MA 3OPCA 5JR9A 3G06A 3UT5E 1MMNA 3JAFA 1D0XA 5LOVE 3RYHE 4DR7T 3O1HA 3RGLA 4ERRA 3DP7A 1SUMB 4HWDA 5ADXL 3UUBA 3RIFA 2E5LT 3LK2B 5FVKA 2YINA 1HNWT 5CA1E 2V7KA 1VOMA 4MBQA 3I1AA 3S4UA 3LK42 4EGWA 2VB6A 2HHHT 2XHEB 4PJLA 4DV0T 3N5LA 4L9IA 1VCTA 5JDMA 4L5GA 5CFBA 5LMUT 2XQ6A 2Q9QD 2FBWA 2L8KA 4FI5A 3N9MA 3LBXA 3P7IA 1JNRA 5IYZE 1D1AA 2BG9B 3L3PA 4IGUA 4IDZA 4HN9A 2VVNA 3PUZF 2VKHA 4U33A 5L3EB 2Z6EA 4IDQA 4UF0B 3X1DA 1MIYA 1ZEEA 3PJAJ 2X0HA 1O3XA 2NTYA 2ODUA 4MLKA 3AEBA 2UXCT 3ZPOA 4O2BE 2E5VA 3LK3B 3T8OA 3PUGA 3RKGA 4AKHA 4L0RA 3ZT6A 2N9DA 2NW9A 1HNZT 5HWXA 1YW0A 1FMVA 2WZIA 4DMVA 3PURA 1XNQT 2BVLA 2LRKA 3VR9A 3MZKB 5BR8T 2A2FX 3O4XE 2WZHA 3C4WA 4HWFA 3K1SA 1OEDA 4YSXA 4TUYE 2C5JA 3ZCIA 5JDFA 5F8PA 3IEEA 3KINB 3EUHA 3EABA 1WR0A 5HEOA 2WB5A 4JI7T 4WZXA 4J2CA 4IE5A 3SS1A 2QYWA 4O8SA 2IAKA 4P0AA 1KF6A 1M62A 2A3DA 2Y48B 2VQET 1V9DA 3ZC1A 2BS3A 2VVSA 1KFYA 3UU3A 5TAOA 2I59A 2W00A 4EAHA 2PG8A 2NWBA 4LF6T 1M7KA 2CHOA 2RPAA 2V6YB 3RRCA 3UQ4A 1CHUA 3AB3B 2AE9A 3L39A 2CCQA 4IREA 2LM2A 1XDOA 3CX7B 4HFVA 5JTGA 1XMOT 2J62A 2M6BA 3JC6C 5LA6E 2D0UA 2V7IA 3AAIA 3ETUA 3KV5A 2W0GA 4YTPA 5AQGB 2V5CA 2CLYC 3UUMA 3P50A 1FMWA 4TNWA 4ZS2A 3NRYA 3O1JA 4X66T 5J1GA 2VASA 1R8IA 4ILUA 2WS3A 2CPTA 1S94A 1D0ZA 3ESLA 3ONXA 2UXXB 3KV4A 4HE8A 5LYJE 2W67A 5HAXA 1N34T 2XAHB 5KX5E 2UU9T 2WDQA 3PUSA 4AQFA 2IW5B 4P09A 4ZI2D 4Q25A 4GIWA 3KDSE 1KK7A 4M1PA 4ZOLE 2IC9A 4GKJT 5DQVA 3PUWF 4LMKA 2DI4A 4AQGA 1LVFA 2AXDS 1VRBA 3VKHA 2VKJA 4H9NC 2H88A 2BBJA 4DV6T 3SFDA 3PDYA 1FEWA 5JDQA 4B3MT 2X66A 2V8SV 1WCRA 2MOZA 4AKGA 2UXBT 2X0YA 2LSIA 4ILBA 3SFEA 3NZQA 3C4XA 5LB7B 3N2OA 4KMCA 1KNPA 2HN2A 4PK6A 4ILAA 4I55E 5EK3A 4X5TA 1GQEA 4WW0A 3NZPA 2W2UA 1S35A 1L0VA 4NUUA 2ACXA 4U72A 2FJEA 4WNKA 5KXJA 3WAKA 3CQXC 5L3FB 4DV4T 3MJXA 4GOUA 4TN7B 5LBMA 4HWIB 4UV9B 3HI2A 1IJ5A 2QRXA 2PTFA 5AQFB 5LNKA 2A72A 4OYJA 4TNVA 1N32T 4ZZCA 1W0AA 3VRBA 3VRAA 4DVDA 2KWIB 5HEGA 1MIWA 1XWMA 4CI3B 1IZNB 2WWUA 3AVRA 1X9BA 3UFEA 2ZMAA 1WRDA 3PU8A 4HWCA 1J5ET 3ZMZB 4A97A 3A5XA 3N2KE 2LSGA 4QX8B 1H7CA 4B3RT 5DQWA 3RF1A 3N9QA 4ADZA 5AQTB 5AQLB 4QH1A 4IL9A 1XZYA 2MTQA 1T98A 2A9UA 4CN4A 5LBQB 3PE0A 3Q5XA 2LLYA 4YT0A 3EDUA 4PK5A 3Q5DA 4XZCA 2ACZA 3OKQA 3ZT7A 3UUNA 1KEYA 2XQ7A 2HPLA 3ZMSB 4HTEA 4GYRA 4QKNA 3ZJ2A 3RYCE 3CX8B 2LRLA 2MBGA 3F2EA 2XTLA 3KBUA 3Q5EA 2VK9A 1FIOA 2K9AA 2Q9QC 3TLUA 2X0LB 1EZ3A 3AA1B 4IDPA 5AQKB 2ES0A 3B5MA 1FJGT 4GYSA 3JADA 5JR9C 1WYBA 3CMLA 3K3OA 5J2UE 1OWAA 4PJJA 5FY7A 4CQIA 1WR6A 2WMNA 4TWHA 2L3LA 2LHRA 1Y64B 2VURA 4U2ZA 2CHNA 4YY3T 1XNRT 1X79A 4P0BA 4ISSA 3SOLA 1ZKEA 3ZLIA 3HKDE 2KMFA 2CLYB 4I50E 1IAPA 4P1NA 2XAJB 3AE5A 3NVOA 3L09A 4IT4A 1Z8UA 2LJLA 5H6QB 3CVRA 4O4JE 4PFOA 2CXLA 3PTRB 5HXEA 3AE4A 3UULA 4O4IE 3C51A 3CKDA 3PUQA 4U7IA 4EOZB 4LF8T 3TKLB 2SPCA 3K8PC 2NTXA 3UUXB 3GN5A 2XASB 5ABGA 2QA7A 3HA4A 3OTOT 2H3RA 3TLSA 4ASKA 1LKXA 4DV5T 3I9WA 3PUYF 5AQSB 4YXDA 3RQUA 3ZEFB 3R6NA 3OVUA 3MACA 2JQHA 3RI5A 3CX6B 4TV8E 3D0TA 4JI3T 2UXDT 2CXFA 2MAWA 2MPKA 5HXSA 2WY2A 2PJQA 2XAGB 3AE2A 3H37A 2BS4A 2EHOA 5HWYA 2E8IA 2K5BB 1T72A 2XQYA 1YQ3A 4H9SE 4OFZA 4UV8B 1OEDC 5FXZA 3GA8A 2X9WA 3ANWA 2YOEA 4QX7B 3ABVA 2CM0A 4O4LE 3H3AA 4EXTA 4AQYT 1IBLT 3T1HT 1NENA 2N1GA 4U7YA 2LKHA 3V5UA 2VQFT 4HEAA 2KLQA 3CWZB 3SRZA 4QXHB 5LJNA 3UU8A 4NIQA 2WDVA 2BG9E 4KX6A 3RYIE 4PJMA 3J9X1 5GONE 3SWHA 4DV7T 2YN6A 2NR4A 3RKOA 4E7SA 3HKBE 5JRCB 2LHNA 4DR2T 3AXJB 4LF9T 4ZI2C 2HH7A 1WFDA 4C91A 4UEMA 3MXZA 5LMNT 4WBOA 1D0YA 2YK0A 2IC6A 2NW8A 4CXWA 2WP9A 1HX8A 2VWAA 3RQWA 3PUXF 2ZM2A 2LE8A 2HPJA 5ABFA 2XY8B 4H9QC 4PFPA 4I0UA 1J1JA 1UX4A 2VKOA 5L3BB 1HX1B 3RPUA 3FBZA 5AQNB 4HFIA 3TLVA 2JMKA 4YTNA 4H9OC 1KNRA 2FJAA 5JH7E 1MNDA 4DBQA 3AE1A 4AQFC 3A8YC 4GKKT 5AQIB 4B3TT 2IDOB 2BKOA 3IHRA 3MKDA 1W0BA 1U5PA 3PU3A 5HYAA 5FL0A 4IL4A 4X1IE 3ZC0A 2J47A 4QXBB 2YDQA 4DUZT 4MALA 4X65T 5AQMB 1B7TA 5FXXA 3UTKA 4JI0T 4WBNE 1AJ3A 1U4QA 1BR1A 3F57A 3GN5B 3C64A 2WSSV 2Q9QB 4EEBA 4CN1A 2CWYA 4YFSA 2JQKA 2KWHA 4AIUA 3AEEA 4EYUA 3AEDA 5JR9B 3QC9A 4IDNA 3ZMUB 4LF5T 3E0ZA 2XM2A 4COFA 3C50A 4AKIA 4EIWA 3PUAA 5AQJB 4B3ST 2FJDA 2K3WA 2YDRA 1CUNA 3P4PA 5HEJA 4X62T 3M3ZB 2ZM0A 2BZBA 5JVDE 4ZI3D 2K48A 3IF8B 2IHR1 3OBVE 4HFCA 3FXEB 1HFAA 2NW7A 1T7SA 3NWIA 1ZOYA 4BJMA 4ZXLA 2OLTA 2LEHA 3ZCJA 3BQIA 3LBXB 4KBMB 2LKGA 1LRZA 3AEFA 5LCYA 2HN1A 2V7MA 3U3IA 2XQ4A 3UQ7A 3QNUA 3BQLA 5LGUB 5ETWA 2LSJA 4Z8XA 2YDSA 4NXMT 3AECA 2ZM6T 5FXVA 3EHZA 5FY1A 2XQ3A 2H7OA 4FJOA 2LOPA 4X1YE 2CA5A 5EK2A 4YJ3E 4JI8T 4YHHT 2CMRA 5FVLA 5L3CB 3RRWA 5JDNA 4YSYA 3TLWA 4KHZF 3EAMA 3FZLB 3NRXA 2J1DG 3RIUA 2KINB 4PAGA 1OEDB 2C0SA 2DWGA 4XAXB 3FB2A 4B6XA 4LFAT 4KHPT 2H89A 4I43B 5L2LA 5FXWA 5JQGE 4DR4T 4HFEA 5LG3A 3GWHA 3AEGA 4DBRA 3O1IA 3J7Yq 5KMGP 5AFUL 3ZN1B 5HCMA 3P4RA 5C3JA 1SE7A 1BR4A 2D5UA 4H9PC 2BG9A 2M67A 3LSVA 5JREA 2WQYA 4CI1B 4UF0A 5LP6E 3RYFE 2XQ9A 4CXYA 4IE7A 4O4HE 5F5WA 2X51A 5LHIB 3P8CD 1DU2A 2G0UA 3ZYLA 3HR0A 3QOFA 4DUYT 4UVCB 5AQOB 5AQRB 2Y8DA 2D2SA 3PV0F 2LSYA 4G2AA 4IE6A 4U2YA 2V26A 3LG7A 1IJ6A 3LJCA 4DR5T 2V7JA 1VCSA 2CWOA 2F4VT 1D1CA 2D0TA 2BKNA 4NPPA 4DR1T 3RHWA 1YKEB 2DWKA 4DV2T 2BKPA 4OX9T 5FMNA 3FZFB 4JI5T 2JIWA 5J2TE 1MIVA 4JBWF 3ZYMA 3A7MA 2GK9A 1WYCA 5EZYE 1BR0A 3VKGA 4IDOA 3N9LA 3DTOA 5LGNB 1IBMT 3BQKA 1T8BA 3AEAA 2L9QA 5AQQB 1QSDA 4XBFB 4TWFA 4LFBT 2MYSA 2CBIA 4JYAT 1I6ZA 5L3DB 3PJAA 3JCFA 2PBIA 2C5IT 3BK9A 3W15B 5HXCA 2E9XA 2LOSA 2V6YA 4JLEA 3ZSTA 2K24A 3Q9DA 2QVAA 2KT9A 1YD8G 4KUMB 2V5DA 2XQAA 1IBKT 5IUXA 4AKRB 5LXTE 4BAYB 2JRKA 1UCUA 1SHZC 2KZ7B 2X9XA 5JDGA 2LM9A 5FP3A 2X9HA 3AAAB 3FZHB 4A5XA 3FZMB 5HEHA 5LGTB 3RH3A 1NAFA 4WYVA 2UUAT 3CIRA 4DR6T 3AE7A 3OYZA 4JEHB 5FY0A 2IIUA 4AKLA 4QWNB 2E9XD 4YTMA 4LF4T 2VL8A 4ISTA 4KP3C 3UU5A 1ZV4X 3KVBA 1W09A 4N78D 3C98B 4TV9E 5A1LA 3MK7C 3N2GE 3K3NA 2JQQA 4LFCT 3V5SA 4DV1T 3LFMA 2D9DA 3ZJ1A 2X68A 4EEDA 1QUUA 4AISA 4JEUB 3RX6A 2ZM8A 3EVYA 5FKYA 1ZP0A 1BR2A 2ZLYA 3ZSSA 4ILCA
chains in the Genus database with same CATH topology
3N2OA 1U5PA 4KMCA 3PU3A 5HXHA 5HYAA 4EYYR 2ODVA 4PK6A 4X1IE 3ZC0A 4I55E 1HG5A 5EK3A 3FHNA 4WW0A 4QXBB 3NZPA 4BJNA 3B13A 1S35A 2LSKA 4C90A 4NUUA 4OHFA 4DNDA 2ACXA 4U72A 4WNKA 5LG4A 3WAKA 2BDEA 4MALA 3CQXC 5L3FB 3MJXA 3K3QC 1B7TA 4GOUA 4TN7B 5FXXA 3UTKA 5JDHA 1HCIA 5LBMA 4WBNE 3AA6B 1AJ3A 1U4QA 1BR1A 4UV9B 3HI2A 4YJ2E 1IJ5A 3AA0B 3F57A 4TZ4C 3GN5B 2RA1A 3C64A 2WSSV 2Q9QB 5LNKA 2A72A 2CWYA 4OYJA 4YFSA 4ANJA 2KWHA 3I0QA 4I4TE 4IE4A 4EYUA 2X67A 3MA9A 4DVDA 2EHOC 4H63H 5JR9B 2KWIB 2W61A 3QC9A 3ZMUB 4AI6A 3E0ZA 2EHOD 3NBXX 1MIWA 2N2NA 4CI3B 1IZNB 3ZMVB 3C50A 2WWUA 3AVRA 4AKIA 4EIWA 1LVKA 3QUJA 3PUAA 3UFEA 3I9YA 2ZMAA 5IHYA 1WRDA 3PU8A 4V1Av 1YKHB 3KV9A 2WBLA 3ZMZB 3A5XA 3N2KE 2LSGA 3AVSA 1CUNA 4G63A 5LHHB 4ZI3C 4QX8B 4O2AE 5KDMC 4IIJE 1H7CA 3DJBA 2ZM0A 2BZBA 2UXNB 5JVDE 5DQWA 2PFVA 4ZI3D 4EZHA 3N9QA 4ADZA 4QHOA 1SA0E 3VHLA 2C5KT 5LJMA 1WLXA 4DO0A 2K48A 4HKAA 2Q9QA 3IF8B 5DJQC 3KVAA 4X1KE 1UX5A 2WAUA 3OBVE 3FXEB 1HFAA 2NW7A 1OXZA 2YEVC 2B1EA 4UIGA 4BJMA 2MTQA 3WAJA 1T98A 2LEHA 3ZCJA 2NP9A 3BQIA 3AAEB 2DHRA 3Q2MA 5LBQB 3LBXB 1Z0PA 4KBMB 5LHGB 3PE0A 5JR9A 5LCYA 1LRZA 3Q5XA 2KNDA 2V7MA 3EDUA 3QK6A 3UT5E 4PK5A 4XZCA 3U3IA 1MMNA 3C4ZA 3CPZA 1D0XA 5LOVE 3BQLA 5LGUB 5ETWA 2LSJA 4Z8XA 3RYHE 3OKQA 3O1HA 2X9YA 4ERRA 4ZI7E 3DP7A 2DCFA 4MFRA 5ADXL 5FXVA 3UUNA 2DLRA 2HPLA 3LK2B 3ZMSB 4H9RC 2YINA 3KBTA 4HTEA 4GYRA 3FXDB 5FY1A 3U78A 5CA1E 2V7KA 3KFWX 4QKNA 1VOMA 2H7OA 4MBQA 4FJOA 2LOPA 4X1YE 2LT3A 3ZJ2A 3RYCE 2E9XB 3I1AA 3S4UA 3LK42 2CA5A 2VB6A 1E1HB 2XHEB 5EK2A 4PJLA 3CX8B 4YJ3E 2MBGA 3N5LA 3F2EA 4L9IA 2CMRA 2XTLA 3KBUA 2Y6XA 2VK9A 5JDMA 1FIOA 5L3CB 3RRWA 2K9AA 4IE0A 4L5GA 5JDNA 2Q9QC 2X0LB 4JUYA 1EZ3A 5CB4E 2Q9QD 3AA1B 3RC8A 1ZHCA 3NRXA 2L8KA 2ES0A 2J1DG 2P9BA 4FI5A 4GYSA 2KINB 3N9MA 3LBXA 2XAFB 3P7IA 5IYZE 5JR9C 1D1AA 1WYBA 3CMLA 3K3OA 3L3PA 4PAGA 5E0OA 4IGUA 4IDZA 5J2UE 1OWAA 4PJJA 5FY7A 4HN9A 2VKHA 3ZMTB 2C0SA 4CQIA 5L3EB 1WR6A 2WMNA 1MNEA 2DWGA 2Z6EA 4UF0B 1MIYA 4XAXB 3FB2A 1ZEEA 2L3LA 2LHRA 4CI2B 4EB6E 1O3XA 4B6XA 1Y64B 2NTYA 2ODUA 2WM9A 4MLKA 4I43B 3HKEE 4CZZB 5L2LA 1X79A 4P0BA 2V7LA 2NOXA 5FXWA 5JQGE 3ZPOA 4ISSA 4O2BE 3SOLA 1ZKEA 3LK3B 1KNZA 3T8OA 2WMOA 3PUGA 3GWHA 4HGAA 3HKDE 2V1DB 3ZLIA 2CLYB 2KMFA 4I50E 1IAPA 4L0RA 4AKHA 2N9DA 4UVAB 2NW9A 4DBRA 3O1IA 3J7Yq 5KMGP 3EDVA 3E08A 5AFUL 5HWXA 1YW0A 2KXPB 2XAJB 3L09A 2JMHA 1FMVA 2LJLA 5H6QB 3ZN1B 4X20E 3CVRA 4PK4A 4O4JE 4PFOA 5FYMA 4DMVA 3PURA 2CXLA 3PTRB 5HXEA 4EZ4A 5C8YE 3UULA 4O4IE 2BVLA 3C51A 3CKDA 3PUQA 4EOZB 1BR4A 3MZKB 3TKLB 2D5UA 2SPCA 2A2FX 3O4XE 2EHOB 2NTXA 3K8PC 3UUXB 3Q5WA 3GN5A 2XASB 4H9PC 2OA5A 3C4WA 4YHJA 4GK5E 2M67A 2QA7A 3HA4A 5JREA 1US7B 2H3RA 4ASKA 4CI1B 4MHCA 1LKXA 4UF0A 1MMDA 5LP6E 4TUYE 2C5JA 2RP4A 3RYFE 3ZCIA 4CXYA 3ZN0B 3ANWB 5JDFA 4IE7A 4O4HE 5F8PA 3I9WA 3IEEA 3KINB 2W63A 2X51A 5LHIB 3FBLA 3EUHA 3P8CD 4F6RC 3ZEFB 3R6NA 2G0UA 3MACA 3R84B 3ZYLA 5CA0E 3CX6B 1MMGA 3HR0A 4UVCB 5FNVE 4TV8E 2Y8DA 2YU1A 3OYXA 5HXRA 2D2SA 3D0TA 2LSYA 4J2CA 4IE5A 3SS1A 4G2AA 2DNXA 4IE6A 4O8SA 2IAKA 2V26A 2W62A 4ZHQE 4P0AA 3CQGB 3LG7A 1IJ6A 3N9NA 2CXFA 3LJCA 5HXSA 2V7JA 4PJNA 2A3DA 2CXDA 2Y48B 4QXCB 1V9DA 2PJQA 2XAGB 3ZC1A 2CWOA 5TAOA 3N9PA 2I59A 3RC3A 1D1CA 1NWMX 2D0TA 4YLHA 5BMVE 2W00A 4EAHA 2PG8A 2NWBA 3RRCA 1YKEB 1G8XA 2DWKA 1HS7A 3H37A 4UXNB 5DABA 3AB3B 2EHOA 5EK4A 5HWYA 2CCQA 1D1BA 5FMNA 4AXPA 2E8IA 2YU2A 5J2TE 1MIVA 3ZYMA 2K5BB 4ZS3A 4A56A 4UV8B 2XQYA 3CX7B 4H9SE 4HFVA 2GK9A 4OFZA 5FXZA 1WYCA 3GA8A 4CXXA 5JDLA 3E22E 5H6RB 4IHJE 5M4YA 3CQCB 5EZYE 2X9WA 1BR0A 3ANWA 4DMWA 3JC6C 3VKGA 4QX7B 5LA6E 2CM0A 3N9LA 3DTOA 5LGNB 2D0UA 4O4LE 3JC6D 1HG2A 2V7IA 3AAIA 3ETUA 3KV5A 3BQKA 2W0GA 3H3AA 2CE7A 4EXTA 4NUVA 2L9QA 1QSDA 4XBFB 2CLYC 3UUMA 3O9XA 1G73A 2MYSA 4K0UA 2N1GA 1FMWA 4ZS2A 4OYKA 3V5UA 3NRYA 4HEAA 5L3DB 3O1JA 2PBIA 2C5IT 3BK9A 2KLQA 3W15B 3CWZB 4PW8A 5HXCA 5J1GA 3GMIA 3SRZA 2VASA 4ILUA 2E9XA 2LOSA 4UELA 4QXHB 1S94A 5LJNA 4JLEA 1D0ZA 3ESLA 3KV6A 2K24A 3ONXA 3RYIE 2UXXB 3KV4A 4HE8A 4PJMA 5LYJE 3J9X1 5GONE 3HKCE 3Q9DA 3SWHA 5HAXA 2XAHB 5KX5E 3RKOA 2KT9A 1YD8G 4E7SA 3HKBE 4KUMB 5JRCB 4AKRB 5F3JA 5LXTE 4BAYB 2H7VC 2JRKA 1UCUA 1SHZC 2LHNA 2KZ7B 2X9XA 5JDGA 3PUSA 3ZYKA 4ZI2C 3AA7B 4AQFA 3I0OA 2XUEA 2IW5B 2HH7A 2LM9A 5FP3A 4P09A 4ZI2D 2X9HA 4GIWA 3AAAB 3KDSE 1KK7A 3HL6A 4M1PA 4UEMA 4C91A 4ZOLE 3MXZA 3ETVA 5LGTB 4WBOA 4TX5A 1D0YA 2IC9A 3VU7H 3RH3A 2YK0A 2IC6A 4U74A 2NW8A 4CXWA 1HX8A 3M65A 5DQVA 4UVBB 2VWAA 1NAFA 3OJAA 2QGSA 3OYZA 1HF8A 2ZM2A 2LE8A 2HPJA 3F31A 4JEHB 5FY0A 2DI4A 4H9QC 2E9XC 2JPFA 4H63V 4AKLA 4PFPA 4AQGA 4E7ZA 1LVFA 4QWNB 2E9XD 2JJ9A 2VL8A 1VRBA 3VKHA 4ISTA 4KP3C 2VKJA 4H9NC 1ZV4X 5L3GB 1UX4A 2VKOA 3KVBA 5L3BB 4N78D 3C98B 4TV9E 5A1LA 3RPUA 3FBZA 3MK7C 5JRCA 3PDYA 1HTJF 1FEWA 3B57A 5JDQA 2JMKA 2X66A 3K3NA 2JQQA 2XAQB 1MMAA 3N2GE 4H9OC 3V5SA 3LFMA 2VKDA 5JH7E 3ZJ1A 2CEAA 2MOZA 4AKGA 2X68A 1MNDA 3IBPA 3WI3A 4BA9A 4DBQA 1QUUA 2LSIA 4AQFC 4JEUB 2BVMA 3RX6A 2ZM8A 3EVYA 3NZQA 3N9OA 4GK0E 1BR2A 4PNIA 3IHRA 2ZLYA 3C4XA 3MKDA 4OK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GN5 B;  3GN5 A;  3O9X A;  3HI2 A;  3GA8 A; 
#chains in the Genus database with same CATH topology
 4EV6 A;  1HG5 A;  3AE9 A;  4ZEY A;  4HFB A;  4OHF A;  4DND A;  4JI4 T;  4JI6 T;  2E2A A;  5JDH A;  3AA6 B;  1JNZ A;  4YJ2 E;  3AA0 B;  4TZ4 C;  4I4T E;  3AE6 A;  2X67 A;  3MA9 A;  2WU5 A;  1NEK A;  3EI0 A;  2EHO D;  5L47 A;  1W9R A;  3NBX X;  3L8R A;  3I9Y A;  5L4H A;  1YKH B;  3P4Q A;  1E7P A;  3AVS A;  5LHH B;  4ZI3 C;  2VL0 A;  5KDM C;  4IIJ E;  3DJB A;  5AQP B;  2PFV A;  4QHO A;  2W66 A;  3VHL A;  2C5K T;  1J5W A;  4DO0 A;  4HKA A;  4CN6 A;  2WDR A;  5DJQ C;  3KVA A;  2WAU A;  1OXZ A;  2B1E A;  3ZT5 A;  4UIG A;  3WAJ A;  2DHR A;  1Z0P A;  5LHG B;  4JI1 T;  4DID B;  2KND A;  2OV9 A;  3QK6 A;  3IA3 A;  2KSR A;  3C4Z A;  3CPZ A;  4KI0 F;  2X9Y A;  4ZI7 E;  2DCF A;  4MFR A;  2DLR A;  2CRB A;  4H9R C;  3KBT A;  3FXD B;  3U78 A;  1Y01 A;  3KFW X;  5HCJ A;  2LT3 A;  2E9X B;  2IML A;  5L4E A;  4DV3 T;  1E1H B;  5HEU A;  5CGM A;  4DR3 T;  2Y6X A;  4IE0 A;  4JI2 T;  2BBH A;  4JUY A;  5CB4 E;  3RC8 A;  1ZHC A;  5AQH B;  2P9B A;  1N33 T;  4HFD A;  2XAF B;  5E0O A;  2R6G F;  3ZMT B;  5FL1 A;  1MNE A;  2BS2 A;  4CI2 B;  4EB6 E;  1UUR A;  3RLF F;  2WM9 A;  3HKE E;  4CZZ B;  1XDP A;  2V7L A;  2NOX A;  2XQ8 A;  4HFH A;  1KNZ A;  2WMO A;  2FUP A;  5ABH A;  4HGA A;  4YSZ A;  2V1D B;  4UVA B;  2B76 A;  3EDV A;  3E08 A;  2KXP B;  4ZZB A;  2JMH A;  4X20 E;  4PK4 A;  5FYM A;  4EZ4 A;  5C8Y E;  5ABE A;  1N36 T;  3LDQ B;  4QH5 A;  3RIU C;  2EHO B;  3Q5W A;  3AE8 A;  2OA5 A;  3VR8 A;  4YHJ A;  4GK5 E;  2I0M A;  1US7 B;  2XPK A;  4MHC A;  2UUB T;  1MMD A;  2RP4 A;  3ZN0 B;  3ANW B;  4K0K T;  2W63 A;  3FBL A;  4F6R C;  3R84 B;  5CA0 E;  1MMG A;  5J0Z A;  5FNV E;  3OYX A;  2YU1 A;  5HXR A;  4U31 A;  2DNX A;  2W62 A;  4ZHQ E;  3CQG B;  3N9N A;  4PJN A;  2CXD A;  4QXC B;  1UK5 A;  4LF7 T;  3N9P A;  3RC3 A;  1NWM X;  4YLH A;  5BMV E;  4X64 T;  1G8X A;  1HS7 A;  2V6X A;  2XSA A;  4JV5 T;  4UXN B;  5DAB A;  4TWD A;  5EK4 A;  1D1B A;  4AXP A;  2YU2 A;  2BG9 C;  4ZS3 A;  4A56 A;  4CXX A;  5JDL A;  3E22 E;  2WU2 A;  5H6R B;  4IHJ E;  1HNX T;  5M4Y A;  3CQC B;  4DMW A;  3TLT A;  3JC6 D;  1HG2 A;  4Z91 A;  2CE7 A;  4NXN T;  4NUV A;  2IUB A;  3O9X A;  2M6I A;  1G73 A;  4K0U A;  2JQ9 A;  4OYK A;  3RIA A;  4PW8 A;  3GMI A;  2XJ7 A;  5ABF B;  3QB5 K;  4F8H A;  4UEL A;  5IWA T;  2J4G A;  3CK6 A;  3KV6 A;  4Z90 A;  2WCA A;  1OED E;  2XZE A;  3UFG A;  3HKC E;  4U3C A;  5CJ5 A;  5F3J A;  2UUC T;  2H7V C;  3ZYK A;  3AA7 B;  3I0O A;  2XUE A;  3HL6 A;  3FZK B;  3ETV A;  3JAE A;  4TX5 A;  3VU7 H;  4U74 A;  4QH4 A;  3M65 A;  4UVB B;  1UGO A;  3OJA A;  2QGS A;  1HF8 A;  3F31 A;  3AE3 A;  2E9X C;  2JPF A;  4H63 V;  4E7Z A;  3H3M A;  2JJ9 A;  5L3G B;  3QB5 A;  3ONL C;  3T1Y T;  5JRC A;  1HTJ F;  2DL1 A;  3B57 A;  2XAQ B;  1MMA A;  2VKD A;  2CEA A;  3AXJ A;  3IBP A;  4LMJ A;  3WI3 A;  4BA9 A;  2BVM A;  1HR0 T;  3N9O A;  4GK0 E;  2FJB A;  3UU4 A;  4PNI A;  4BJN A;  4OK0 A;  2YKS A;  5HXH A;  4EYY R;  1E2A A;  2ODV A;  3FHN A;  3B13 A;  2LSK A;  4C90 A;  3P4S A;  2W4X A;  5LG4 A;  3P4W A;  5AQV B;  2CBJ A;  2BDE A;  3K3Q C;  3ZKR A;  1HCI A;  1QLB A;  2RA1 A;  2WWV A;  4ANJ A;  3I0Q A;  4IE4 A;  2EHO C;  4H63 H;  2W61 A;  4AI6 A;  2N2N A;  3ZMV B;  2XSB A;  2XQ5 A;  3ONJ A;  1LVK A;  3QUJ A;  5IHY A;  4V1A v;  3KV9 A;  5C2T A;  3PUV F;  5AQU B;  4LML A;  2WBL A;  1YXR A;  1I94 T;  4G63 A;  4O2A E;  4HWH A;  2UXN B;  4UR9 A;  1XMQ T;  4EZH A;  1UUS A;  1SA0 E;  5LJM A;  1WLX A;  3UU6 A;  2I6H A;  2Q9Q A;  2XM1 A;  4X1K E;  1UX5 A;  2YEV C;  1YQ4 A;  4A98 A;  2NP9 A;  3NKZ A;  3AAE B;  3Q2M A;  3OPC A;  5JR9 A;  3G06 A;  3UT5 E;  1MMN A;  3JAF A;  1D0X A;  5LOV E;  3RYH E;  4DR7 T;  3O1H A;  3RGL A;  4ERR A;  3DP7 A;  1SUM B;  4HWD A;  5ADX L;  3UUB A;  3RIF A;  2E5L T;  3LK2 B;  5FVK A;  2YIN A;  1HNW T;  5CA1 E;  2V7K A;  1VOM A;  4MBQ A;  3I1A A;  3S4U A;  3LK4 2;  4EGW A;  2VB6 A;  2HHH T;  2XHE B;  4PJL A;  4DV0 T;  3N5L A;  4L9I A;  1VCT A;  5JDM A;  4L5G A;  5CFB A;  5LMU T;  2XQ6 A;  2Q9Q D;  2FBW A;  2L8K A;  4FI5 A;  3N9M A;  3LBX A;  3P7I A;  1JNR A;  5IYZ E;  1D1A A;  2BG9 B;  3L3P A;  4IGU A;  4IDZ A;  4HN9 A;  2VVN A;  3PUZ F;  2VKH A;  4U33 A;  5L3E B;  2Z6E A;  4IDQ A;  4UF0 B;  3X1D A;  1MIY A;  1ZEE A;  3PJA J;  2X0H A;  1O3X A;  2NTY A;  2ODU A;  4MLK A;  3AEB A;  2UXC T;  3ZPO A;  4O2B E;  2E5V A;  3LK3 B;  3T8O A;  3PUG A;  3RKG A;  4AKH A;  4L0R A;  3ZT6 A;  2N9D A;  2NW9 A;  1HNZ T;  5HWX A;  1YW0 A;  1FMV A;  2WZI A;  4DMV A;  3PUR A;  1XNQ T;  2BVL A;  2LRK A;  3VR9 A;  3MZK B;  5BR8 T;  2A2F X;  3O4X E;  2WZH A;  3C4W A;  4HWF A;  3K1S A;  1OED A;  4YSX A;  4TUY E;  2C5J A;  3ZCI A;  5JDF A;  5F8P A;  3IEE A;  3KIN B;  3EUH A;  3EAB A;  1WR0 A;  5HEO A;  2WB5 A;  4JI7 T;  4WZX A;  4J2C A;  4IE5 A;  3SS1 A;  2QYW A;  4O8S A;  2IAK A;  4P0A A;  1KF6 A;  1M62 A;  2A3D A;  2Y48 B;  2VQE T;  1V9D A;  3ZC1 A;  2BS3 A;  2VVS A;  1KFY A;  3UU3 A;  5TAO A;  2I59 A;  2W00 A;  4EAH A;  2PG8 A;  2NWB A;  4LF6 T;  1M7K A;  2CHO A;  2RPA A;  2V6Y B;  3RRC A;  3UQ4 A;  1CHU A;  3AB3 B;  2AE9 A;  3L39 A;  2CCQ A;  4IRE A;  2LM2 A;  1XDO A;  3CX7 B;  4HFV A;  5JTG A;  1XMO T;  2J62 A;  2M6B A;  3JC6 C;  5LA6 E;  2D0U A;  2V7I A;  3AAI A;  3ETU A;  3KV5 A;  2W0G A;  4YTP A;  5AQG B;  2V5C A;  2CLY C;  3UUM A;  3P50 A;  1FMW A;  4TNW A;  4ZS2 A;  3NRY A;  3O1J A;  4X66 T;  5J1G A;  2VAS A;  1R8I A;  4ILU A;  2WS3 A;  2CPT A;  1S94 A;  1D0Z A;  3ESL A;  3ONX A;  2UXX B;  3KV4 A;  4HE8 A;  5LYJ E;  2W67 A;  5HAX A;  1N34 T;  2XAH B;  5KX5 E;  2UU9 T;  2WDQ A;  3PUS A;  4AQF A;  2IW5 B;  4P09 A;  4ZI2 D;  4Q25 A;  4GIW A;  3KDS E;  1KK7 A;  4M1P A;  4ZOL E;  2IC9 A;  4GKJ T;  5DQV A;  3PUW F;  4LMK A;  2DI4 A;  4AQG A;  1LVF A;  2AXD S;  1VRB A;  3VKH A;  2VKJ A;  4H9N C;  2H88 A;  2BBJ A;  4DV6 T;  3SFD A;  3PDY A;  1FEW A;  5JDQ A;  4B3M T;  2X66 A;  2V8S V;  1WCR A;  2MOZ A;  4AKG A;  2UXB T;  2X0Y A;  2LSI A;  4ILB A;  3SFE A;  3NZQ A;  3C4X A;  5LB7 B;  3N2O A;  4KMC A;  1KNP A;  2HN2 A;  4PK6 A;  4ILA A;  4I55 E;  5EK3 A;  4X5T A;  1GQE A;  4WW0 A;  3NZP A;  2W2U A;  1S35 A;  1L0V A;  4NUU A;  2ACX A;  4U72 A;  2FJE A;  4WNK A;  5KXJ A;  3WAK A;  3CQX C;  5L3F B;  4DV4 T;  3MJX A;  4GOU A;  4TN7 B;  5LBM A;  4HWI B;  4UV9 B;  3HI2 A;  1IJ5 A;  2QRX A;  2PTF A;  5AQF B;  5LNK A;  2A72 A;  4OYJ A;  4TNV A;  1N32 T;  4ZZC A;  1W0A A;  3VRB A;  3VRA A;  4DVD A;  2KWI B;  5HEG A;  1MIW A;  1XWM A;  4CI3 B;  1IZN B;  2WWU A;  3AVR A;  1X9B A;  3UFE A;  2ZMA A;  1WRD A;  3PU8 A;  4HWC A;  1J5E T;  3ZMZ B;  4A97 A;  3A5X A;  3N2K E;  2LSG A;  4QX8 B;  1H7C A;  4B3R T;  5DQW A;  3RF1 A;  3N9Q A;  4ADZ A;  5AQT B;  5AQL B;  4QH1 A;  4IL9 A;  1XZY A;  2MTQ A;  1T98 A;  2A9U A;  4CN4 A;  5LBQ B;  3PE0 A;  3Q5X A;  2LLY A;  4YT0 A;  3EDU A;  4PK5 A;  3Q5D A;  4XZC A;  2ACZ A;  3OKQ A;  3ZT7 A;  3UUN A;  1KEY A;  2XQ7 A;  2HPL A;  3ZMS B;  4HTE A;  4GYR A;  4QKN A;  3ZJ2 A;  3RYC E;  3CX8 B;  2LRL A;  2MBG A;  3F2E A;  2XTL A;  3KBU A;  3Q5E A;  2VK9 A;  1FIO A;  2K9A A;  2Q9Q C;  3TLU A;  2X0L B;  1EZ3 A;  3AA1 B;  4IDP A;  5AQK B;  2ES0 A;  3B5M A;  1FJG T;  4GYS A;  3JAD A;  5JR9 C;  1WYB A;  3CML A;  3K3O A;  5J2U E;  1OWA A;  4PJJ A;  5FY7 A;  4CQI A;  1WR6 A;  2WMN A;  4TWH A;  2L3L A;  2LHR A;  1Y64 B;  2VUR A;  4U2Z A;  2CHN A;  4YY3 T;  1XNR T;  1X79 A;  4P0B A;  4ISS A;  3SOL A;  1ZKE A;  3ZLI A;  3HKD E;  2KMF A;  2CLY B;  4I50 E;  1IAP A;  4P1N A;  2XAJ B;  3AE5 A;  3NVO A;  3L09 A;  4IT4 A;  1Z8U A;  2LJL A;  5H6Q B;  3CVR A;  4O4J E;  4PFO A;  2CXL A;  3PTR B;  5HXE A;  3AE4 A;  3UUL A;  4O4I E;  3C51 A;  3CKD A;  3PUQ A;  4U7I A;  4EOZ B;  4LF8 T;  3TKL B;  2SPC A;  3K8P C;  2NTX A;  3UUX B;  3GN5 A;  2XAS B;  5ABG A;  2QA7 A;  3HA4 A;  3OTO T;  2H3R A;  3TLS A;  4ASK A;  1LKX A;  4DV5 T;  3I9W A;  3PUY F;  5AQS B;  4YXD A;  3RQU A;  3ZEF B;  3R6N A;  3OVU A;  3MAC A;  2JQH A;  3RI5 A;  3CX6 B;  4TV8 E;  3D0T A;  4JI3 T;  2UXD T;  2CXF A;  2MAW A;  2MPK A;  5HXS A;  2WY2 A;  2PJQ A;  2XAG B;  3AE2 A;  3H37 A;  2BS4 A;  2EHO A;  5HWY A;  2E8I A;  2K5B B;  1T72 A;  2XQY A;  1YQ3 A;  4H9S E;  4OFZ A;  4UV8 B;  1OED C;  5FXZ A;  3GA8 A;  2X9W A;  3ANW A;  2YOE A;  4QX7 B;  3ABV A;  2CM0 A;  4O4L E;  3H3A A;  4EXT A;  4AQY T;  1IBL T;  3T1H T;  1NEN A;  2N1G A;  4U7Y A;  2LKH A;  3V5U A;  2VQF T;  4HEA A;  2KLQ A;  3CWZ B;  3SRZ A;  4QXH B;  5LJN A;  3UU8 A;  4NIQ A;  2WDV A;  2BG9 E;  4KX6 A;  3RYI E;  4PJM A;  3J9X 1;  5GON E;  3SWH A;  4DV7 T;  2YN6 A;  2NR4 A;  3RKO A;  4E7S A;  3HKB E;  5JRC B;  2LHN A;  4DR2 T;  3AXJ B;  4LF9 T;  4ZI2 C;  2HH7 A;  1WFD A;  4C91 A;  4UEM A;  3MXZ A;  5LMN T;  4WBO A;  1D0Y A;  2YK0 A;  2IC6 A;  2NW8 A;  4CXW A;  2WP9 A;  1HX8 A;  2VWA A;  3RQW A;  3PUX F;  2ZM2 A;  2LE8 A;  2HPJ A;  5ABF A;  2XY8 B;  4H9Q C;  4PFP A;  4I0U A;  1J1J A;  1UX4 A;  2VKO A;  5L3B B;  1HX1 B;  3RPU A;  3FBZ A;  5AQN B;  4HFI A;  3TLV A;  2JMK A;  4YTN A;  4H9O C;  1KNR A;  2FJA A;  5JH7 E;  1MND A;  4DBQ A;  3AE1 A;  4AQF C;  3A8Y C;  4GKK T;  5AQI B;  4B3T T;  2IDO B;  2BKO A;  3IHR A;  3MKD A;  1W0B A;  1U5P A;  3PU3 A;  5HYA A;  5FL0 A;  4IL4 A;  4X1I E;  3ZC0 A;  2J47 A;  4QXB B;  2YDQ A;  4DUZ T;  4MAL A;  4X65 T;  5AQM B;  1B7T A;  5FXX A;  3UTK A;  4JI0 T;  4WBN E;  1AJ3 A;  1U4Q A;  1BR1 A;  3F57 A;  3GN5 B;  3C64 A;  2WSS V;  2Q9Q B;  4EEB A;  4CN1 A;  2CWY A;  4YFS A;  2JQK A;  2KWH A;  4AIU A;  3AEE A;  4EYU A;  3AED A;  5JR9 B;  3QC9 A;  4IDN A;  3ZMU B;  4LF5 T;  3E0Z A;  2XM2 A;  4COF A;  3C50 A;  4AKI A;  4EIW A;  3PUA A;  5AQJ B;  4B3S T;  2FJD A;  2K3W A;  2YDR A;  1CUN A;  3P4P A;  5HEJ A;  4X62 T;  3M3Z B;  2ZM0 A;  2BZB A;  5JVD E;  4ZI3 D;  2K48 A;  3IF8 B;  2IHR 1;  3OBV E;  4HFC A;  3FXE B;  1HFA A;  2NW7 A;  1T7S A;  3NWI A;  1ZOY A;  4BJM A;  4ZXL A;  2OLT A;  2LEH A;  3ZCJ A;  3BQI A;  3LBX B;  4KBM B;  2LKG A;  1LRZ A;  3AEF A;  5LCY A;  2HN1 A;  2V7M A;  3U3I A;  2XQ4 A;  3UQ7 A;  3QNU A;  3BQL A;  5LGU B;  5ETW A;  2LSJ A;  4Z8X A;  2YDS A;  4NXM T;  3AEC A;  2ZM6 T;  5FXV A;  3EHZ A;  5FY1 A;  2XQ3 A;  2H7O A;  4FJO A;  2LOP A;  4X1Y E;  2CA5 A;  5EK2 A;  4YJ3 E;  4JI8 T;  4YHH T;  2CMR A;  5FVL A;  5L3C B;  3RRW A;  5JDN A;  4YSY A;  3TLW A;  4KHZ F;  3EAM A;  3FZL B;  3NRX A;  2J1D G;  3RIU A;  2KIN B;  4PAG A;  1OED B;  2C0S A;  2DWG A;  4XAX B;  3FB2 A;  4B6X A;  4LFA T;  4KHP T;  2H89 A;  4I43 B;  5L2L A;  5FXW A;  5JQG E;  4DR4 T;  4HFE A;  5LG3 A;  3GWH A;  3AEG A;  4DBR A;  3O1I A;  3J7Y q;  5KMG P;  5AFU L;  3ZN1 B;  5HCM A;  3P4R A;  5C3J A;  1SE7 A;  1BR4 A;  2D5U A;  4H9P C;  2BG9 A;  2M67 A;  3LSV A;  5JRE A;  2WQY A;  4CI1 B;  4UF0 A;  5LP6 E;  3RYF E;  2XQ9 A;  4CXY A;  4IE7 A;  4O4H E;  5F5W A;  2X51 A;  5LHI B;  3P8C D;  1DU2 A;  2G0U A;  3ZYL A;  3HR0 A;  3QOF A;  4DUY T;  4UVC B;  5AQO B;  5AQR B;  2Y8D A;  2D2S A;  3PV0 F;  2LSY A;  4G2A A;  4IE6 A;  4U2Y A;  2V26 A;  3LG7 A;  1IJ6 A;  3LJC A;  4DR5 T;  2V7J A;  1VCS A;  2CWO A;  2F4V T;  1D1C A;  2D0T A;  2BKN A;  4NPP A;  4DR1 T;  3RHW A;  1YKE B;  2DWK A;  4DV2 T;  2BKP A;  4OX9 T;  5FMN A;  3FZF B;  4JI5 T;  2JIW A;  5J2T E;  1MIV A;  4JBW F;  3ZYM A;  3A7M A;  2GK9 A;  1WYC A;  5EZY E;  1BR0 A;  3VKG A;  4IDO A;  3N9L A;  3DTO A;  5LGN B;  1IBM T;  3BQK A;  1T8B A;  3AEA A;  2L9Q A;  5AQQ B;  1QSD A;  4XBF B;  4TWF A;  4LFB T;  2MYS A;  2CBI A;  4JYA T;  1I6Z A;  5L3D B;  3PJA A;  3JCF A;  2PBI A;  2C5I T;  3BK9 A;  3W15 B;  5HXC A;  2E9X A;  2LOS A;  2V6Y A;  4JLE A;  3ZST A;  2K24 A;  3Q9D A;  2QVA A;  2KT9 A;  1YD8 G;  4KUM B;  2V5D A;  2XQA A;  1IBK T;  5IUX A;  4AKR B;  5LXT E;  4BAY B;  2JRK A;  1UCU A;  1SHZ C;  2KZ7 B;  2X9X A;  5JDG A;  2LM9 A;  5FP3 A;  2X9H A;  3AAA B;  3FZH B;  4A5X A;  3FZM B;  5HEH A;  5LGT B;  3RH3 A;  1NAF A;  4WYV A;  2UUA T;  3CIR A;  4DR6 T;  3AE7 A;  3OYZ A;  4JEH B;  5FY0 A;  2IIU A;  4AKL A;  4QWN B;  2E9X D;  4YTM A;  4LF4 T;  2VL8 A;  4IST A;  4KP3 C;  3UU5 A;  1ZV4 X;  3KVB A;  1W09 A;  4N78 D;  3C98 B;  4TV9 E;  5A1L A;  3MK7 C;  3N2G E;  3K3N A;  2JQQ A;  4LFC T;  3V5S A;  4DV1 T;  3LFM A;  2D9D A;  3ZJ1 A;  2X68 A;  4EED A;  1QUU A;  4AIS A;  4JEU B;  3RX6 A;  2ZM8 A;  3EVY A;  5FKY A;  1ZP0 A;  1BR2 A;  2ZLY A;  3ZSS A;  4ILC A; 
#chains in the Genus database with same CATH homology
 3N2O A;  1U5P A;  4KMC A;  3PU3 A;  5HXH A;  5HYA A;  4EYY R;  2ODV A;  4PK6 A;  4X1I E;  3ZC0 A;  4I55 E;  1HG5 A;  5EK3 A;  3FHN A;  4WW0 A;  4QXB B;  3NZP A;  4BJN A;  3B13 A;  1S35 A;  2LSK A;  4C90 A;  4NUU A;  4OHF A;  4DND A;  2ACX A;  4U72 A;  4WNK A;  5LG4 A;  3WAK A;  2BDE A;  4MAL A;  3CQX C;  5L3F B;  3MJX A;  3K3Q C;  1B7T A;  4GOU A;  4TN7 B;  5FXX A;  3UTK A;  5JDH A;  1HCI A;  5LBM A;  4WBN E;  3AA6 B;  1AJ3 A;  1U4Q A;  1BR1 A;  4UV9 B;  3HI2 A;  4YJ2 E;  1IJ5 A;  3AA0 B;  3F57 A;  4TZ4 C;  3GN5 B;  2RA1 A;  3C64 A;  2WSS V;  2Q9Q B;  5LNK A;  2A72 A;  2CWY A;  4OYJ A;  4YFS A;  4ANJ A;  2KWH A;  3I0Q A;  4I4T E;  4IE4 A;  4EYU A;  2X67 A;  3MA9 A;  4DVD A;  2EHO C;  4H63 H;  5JR9 B;  2KWI B;  2W61 A;  3QC9 A;  3ZMU B;  4AI6 A;  3E0Z A;  2EHO D;  3NBX X;  1MIW A;  2N2N A;  4CI3 B;  1IZN B;  3ZMV B;  3C50 A;  2WWU A;  3AVR A;  4AKI A;  4EIW A;  1LVK A;  3QUJ A;  3PUA A;  3UFE A;  3I9Y A;  2ZMA A;  5IHY A;  1WRD A;  3PU8 A;  4V1A v;  1YKH B;  3KV9 A;  2WBL A;  3ZMZ B;  3A5X A;  3N2K E;  2LSG A;  3AVS A;  1CUN A;  4G63 A;  5LHH B;  4ZI3 C;  4QX8 B;  4O2A E;  5KDM C;  4IIJ E;  1H7C A;  3DJB A;  2ZM0 A;  2BZB A;  2UXN B;  5JVD E;  5DQW A;  2PFV A;  4ZI3 D;  4EZH A;  3N9Q A;  4ADZ A;  4QHO A;  1SA0 E;  3VHL A;  2C5K T;  5LJM A;  1WLX A;  4DO0 A;  2K48 A;  4HKA A;  2Q9Q A;  3IF8 B;  5DJQ C;  3KVA A;  4X1K E;  1UX5 A;  2WAU A;  3OBV E;  3FXE B;  1HFA A;  2NW7 A;  1OXZ A;  2YEV C;  2B1E A;  4UIG A;  4BJM A;  2MTQ A;  3WAJ A;  1T98 A;  2LEH A;  3ZCJ A;  2NP9 A;  3BQI A;  3AAE B;  2DHR A;  3Q2M A;  5LBQ B;  3LBX B;  1Z0P A;  4KBM B;  5LHG B;  3PE0 A;  5JR9 A;  5LCY A;  1LRZ A;  3Q5X A;  2KND A;  2V7M A;  3EDU A;  3QK6 A;  3UT5 E;  4PK5 A;  4XZC A;  3U3I A;  1MMN A;  3C4Z A;  3CPZ A;  1D0X A;  5LOV E;  3BQL A;  5LGU B;  5ETW A;  2LSJ A;  4Z8X A;  3RYH E;  3OKQ A;  3O1H A;  2X9Y A;  4ERR A;  4ZI7 E;  3DP7 A;  2DCF A;  4MFR A;  5ADX L;  5FXV A;  3UUN A;  2DLR A;  2HPL A;  3LK2 B;  3ZMS B;  4H9R C;  2YIN A;  3KBT A;  4HTE A;  4GYR A;  3FXD B;  5FY1 A;  3U78 A;  5CA1 E;  2V7K A;  3KFW X;  4QKN A;  1VOM A;  2H7O A;  4MBQ A;  4FJO A;  2LOP A;  4X1Y E;  2LT3 A;  3ZJ2 A;  3RYC E;  2E9X B;  3I1A A;  3S4U A;  3LK4 2;  2CA5 A;  2VB6 A;  1E1H B;  2XHE B;  5EK2 A;  4PJL A;  3CX8 B;  4YJ3 E;  2MBG A;  3N5L A;  3F2E A;  4L9I A;  2CMR A;  2XTL A;  3KBU A;  2Y6X A;  2VK9 A;  5JDM A;  1FIO A;  5L3C B;  3RRW A;  2K9A A;  4IE0 A;  4L5G A;  5JDN A;  2Q9Q C;  2X0L B;  4JUY A;  1EZ3 A;  5CB4 E;  2Q9Q D;  3AA1 B;  3RC8 A;  1ZHC A;  3NRX A;  2L8K A;  2ES0 A;  2J1D G;  2P9B A;  4FI5 A;  4GYS A;  2KIN B;  3N9M A;  3LBX A;  2XAF B;  3P7I A;  5IYZ E;  5JR9 C;  1D1A A;  1WYB A;  3CML A;  3K3O A;  3L3P A;  4PAG A;  5E0O A;  4IGU A;  4IDZ A;  5J2U E;  1OWA A;  4PJJ A;  5FY7 A;  4HN9 A;  2VKH A;  3ZMT B;  2C0S A;  4CQI A;  5L3E B;  1WR6 A;  2WMN A;  1MNE A;  2DWG A;  2Z6E A;  4UF0 B;  1MIY A;  4XAX B;  3FB2 A;  1ZEE A;  2L3L A;  2LHR A;  4CI2 B;  4EB6 E;  1O3X A;  4B6X A;  1Y64 B;  2NTY A;  2ODU A;  2WM9 A;  4MLK A;  4I43 B;  3HKE E;  4CZZ B;  5L2L A;  1X79 A;  4P0B A;  2V7L A;  2NOX A;  5FXW A;  5JQG E;  3ZPO A;  4ISS A;  4O2B E;  3SOL A;  1ZKE A;  3LK3 B;  1KNZ A;  3T8O A;  2WMO A;  3PUG A;  3GWH A;  4HGA A;  3HKD E;  2V1D B;  3ZLI A;  2CLY B;  2KMF A;  4I50 E;  1IAP A;  4L0R A;  4AKH A;  2N9D A;  4UVA B;  2NW9 A;  4DBR A;  3O1I A;  3J7Y q;  5KMG P;  3EDV A;  3E08 A;  5AFU L;  5HWX A;  1YW0 A;  2KXP B;  2XAJ B;  3L09 A;  2JMH A;  1FMV A;  2LJL A;  5H6Q B;  3ZN1 B;  4X20 E;  3CVR A;  4PK4 A;  4O4J E;  4PFO A;  5FYM A;  4DMV A;  3PUR A;  2CXL A;  3PTR B;  5HXE A;  4EZ4 A;  5C8Y E;  3UUL A;  4O4I E;  2BVL A;  3C51 A;  3CKD A;  3PUQ A;  4EOZ B;  1BR4 A;  3MZK B;  3TKL B;  2D5U A;  2SPC A;  2A2F X;  3O4X E;  2EHO B;  2NTX A;  3K8P C;  3UUX B;  3Q5W A;  3GN5 A;  2XAS B;  4H9P C;  2OA5 A;  3C4W A;  4YHJ A;  4GK5 E;  2M67 A;  2QA7 A;  3HA4 A;  5JRE A;  1US7 B;  2H3R A;  4ASK A;  4CI1 B;  4MHC A;  1LKX A;  4UF0 A;  1MMD A;  5LP6 E;  4TUY E;  2C5J A;  2RP4 A;  3RYF E;  3ZCI A;  4CXY A;  3ZN0 B;  3ANW B;  5JDF A;  4IE7 A;  4O4H E;  5F8P A;  3I9W A;  3IEE A;  3KIN B;  2W63 A;  2X51 A;  5LHI B;  3FBL A;  3EUH A;  3P8C D;  4F6R C;  3ZEF B;  3R6N A;  2G0U A;  3MAC A;  3R84 B;  3ZYL A;  5CA0 E;  3CX6 B;  1MMG A;  3HR0 A;  4UVC B;  5FNV E;  4TV8 E;  2Y8D A;  2YU1 A;  3OYX A;  5HXR A;  2D2S A;  3D0T A;  2LSY A;  4J2C A;  4IE5 A;  3SS1 A;  4G2A A;  2DNX A;  4IE6 A;  4O8S A;  2IAK A;  2V26 A;  2W62 A;  4ZHQ E;  4P0A A;  3CQG B;  3LG7 A;  1IJ6 A;  3N9N A;  2CXF A;  3LJC A;  5HXS A;  2V7J A;  4PJN A;  2A3D A;  2CXD A;  2Y48 B;  4QXC B;  1V9D A;  2PJQ A;  2XAG B;  3ZC1 A;  2CWO A;  5TAO A;  3N9P A;  2I59 A;  3RC3 A;  1D1C A;  1NWM X;  2D0T A;  4YLH A;  5BMV E;  2W00 A;  4EAH A;  2PG8 A;  2NWB A;  3RRC A;  1YKE B;  1G8X A;  2DWK A;  1HS7 A;  3H37 A;  4UXN B;  5DAB A;  3AB3 B;  2EHO A;  5EK4 A;  5HWY A;  2CCQ A;  1D1B A;  5FMN A;  4AXP A;  2E8I A;  2YU2 A;  5J2T E;  1MIV A;  3ZYM A;  2K5B B;  4ZS3 A;  4A56 A;  4UV8 B;  2XQY A;  3CX7 B;  4H9S E;  4HFV A;  2GK9 A;  4OFZ A;  5FXZ A;  1WYC A;  3GA8 A;  4CXX A;  5JDL A;  3E22 E;  5H6R B;  4IHJ E;  5M4Y A;  3CQC B;  5EZY E;  2X9W A;  1BR0 A;  3ANW A;  4DMW A;  3JC6 C;  3VKG A;  4QX7 B;  5LA6 E;  2CM0 A;  3N9L A;  3DTO A;  5LGN B;  2D0U A;  4O4L E;  3JC6 D;  1HG2 A;  2V7I A;  3AAI A;  3ETU A;  3KV5 A;  3BQK A;  2W0G A;  3H3A A;  2CE7 A;  4EXT A;  4NUV A;  2L9Q A;  1QSD A;  4XBF B;  2CLY C;  3UUM A;  3O9X A;  1G73 A;  2MYS A;  4K0U A;  2N1G A;  1FMW A;  4ZS2 A;  4OYK A;  3V5U A;  3NRY A;  4HEA A;  5L3D B;  3O1J A;  2PBI A;  2C5I T;  3BK9 A;  2KLQ A;  3W15 B;  3CWZ B;  4PW8 A;  5HXC A;  5J1G A;  3GMI A;  3SRZ A;  2VAS A;  4ILU A;  2E9X A;  2LOS A;  4UEL A;  4QXH B;  1S94 A;  5LJN A;  4JLE A;  1D0Z A;  3ESL A;  3KV6 A;  2K24 A;  3ONX A;  3RYI E;  2UXX B;  3KV4 A;  4HE8 A;  4PJM A;  5LYJ E;  3J9X 1;  5GON E;  3HKC E;  3Q9D A;  3SWH A;  5HAX A;  2XAH B;  5KX5 E;  3RKO A;  2KT9 A;  1YD8 G;  4E7S A;  3HKB E;  4KUM B;  5JRC B;  4AKR B;  5F3J A;  5LXT E;  4BAY B;  2H7V C;  2JRK A;  1UCU A;  1SHZ C;  2LHN A;  2KZ7 B;  2X9X A;  5JDG A;  3PUS A;  3ZYK A;  4ZI2 C;  3AA7 B;  4AQF A;  3I0O A;  2XUE A;  2IW5 B;  2HH7 A;  2LM9 A;  5FP3 A;  4P09 A;  4ZI2 D;  2X9H A;  4GIW A;  3AAA B;  3KDS E;  1KK7 A;  3HL6 A;  4M1P A;  4UEM A;  4C91 A;  4ZOL E;  3MXZ A;  3ETV A;  5LGT B;  4WBO A;  4TX5 A;  1D0Y A;  2IC9 A;  3VU7 H;  3RH3 A;  2YK0 A;  2IC6 A;  4U74 A;  2NW8 A;  4CXW A;  1HX8 A;  3M65 A;  5DQV A;  4UVB B;  2VWA A;  1NAF A;  3OJA A;  2QGS A;  3OYZ A;  1HF8 A;  2ZM2 A;  2LE8 A;  2HPJ A;  3F31 A;  4JEH B;  5FY0 A;  2DI4 A;  4H9Q C;  2E9X C;  2JPF A;  4H63 V;  4AKL A;  4PFP A;  4AQG A;  4E7Z A;  1LVF A;  4QWN B;  2E9X D;  2JJ9 A;  2VL8 A;  1VRB A;  3VKH A;  4IST A;  4KP3 C;  2VKJ A;  4H9N C;  1ZV4 X;  5L3G B;  1UX4 A;  2VKO A;  3KVB A;  5L3B B;  4N78 D;  3C98 B;  4TV9 E;  5A1L A;  3RPU A;  3FBZ A;  3MK7 C;  5JRC A;  3PDY A;  1HTJ F;  1FEW A;  3B57 A;  5JDQ A;  2JMK A;  2X66 A;  3K3N A;  2JQQ A;  2XAQ B;  1MMA A;  3N2G E;  4H9O C;  3V5S A;  3LFM A;  2VKD A;  5JH7 E;  3ZJ1 A;  2CEA A;  2MOZ A;  4AKG A;  2X68 A;  1MND A;  3IBP A;  3WI3 A;  4BA9 A;  4DBQ A;  1QUU A;  2LSI A;  4AQF C;  4JEU B;  2BVM A;  3RX6 A;  2ZM8 A;  3EVY A;  3NZQ A;  3N9O A;  4GK0 E;  1BR2 A;  4PNI A;  3IHR A;  2ZLY A;  3C4X A;  3MKD A;  4OK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...