3HI2A

Structure of the n-terminal domain of the e. coli antitoxin mqsa (ygit/b3021) in complex with the e. coli toxin mqsr (ygiu/b3022)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
70
structure length
70
Chain Sequence
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/toxin
molecule keywords HTH-type transcriptional regulator mqsA(ygiT)
publication title Three dimensional structure of the MqsR:MqsA complex: a novel TA pair comprised of a toxin homologous to RelE and an antitoxin with unique properties.
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 14
structure length 70
sequence length 70
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.720 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3hi2A00
3O9XA 3GN5B 3HI2A 3GN5A 3GA8A
chains in the Genus database with same CATH superfamily
4C90A 3P4RA 2BDEA 2V8SV 5AQJB 5HXSA 1N34T 4UF0A 1LVFA 5FXXA 4DR6T 2DL1A 2XQYA 5HCJA 5JR9B 3AB3B 5L4EA 3JC6D 2K24A 4X62T 3UTKA 3LSVA 3ZYMA 4LFCT 1QSDA 2LHRA 3ZN1B 3UU4A 3AXJA 2CRBA 2L9QA 3ONJA 5FL0A 4EEBA 2D9DA 3RIUA 1MIWA 3VR9A 4XBFB 3AE8A 5HCMA 2XTLA 4HFIA 3K8PC 3N9LA 2IC9A 3AECA 1U4QA 3LK42 4IHJE 4YHHT 1JNZA 3MK7C 4XZCA 5FP3A 4DR7T 2CMRA 1I6ZA 3B13A 3FXEB 1MIVA 2BS3A 4LFAT 5HEUA 4EEDA 3KBTA 4I55E 1YKHB 2FJDA 5AQSB 2NP9A 5CB4E 3PUGA 2HHHT 4X1KE 4JEUB 4X66T 1UX4A 1I94T 4LF9T 4AKRB 5LJNA 4PW8A 2FJBA 3EHZA 2ZM8A 5JR9C 2V7LA 5FY7A 3AA0B 4EZHA 4G2AA 3ZYLA 3IHRA 2W4XA 1IBMT 4DR1T 3F31A 2NW8A 2DLRA 5HWXA 5HWYA 2CE7A 2WWUA 3EDVA 2V7IA 2CBIA 4H9QC 4EAHA 2XQ3A 3AA1B 1Y64B 2JMHA 2LKGA 2XAGB 2XUEA 4WBNE 3H3MA 5FXVA 1MMDA 5JTGA 2CCQA 4P0AA 1CHUA 2RP4A 4FJOA 2BKPA 2BVMA 2NR4A 2M6BA 4KHZF 1W0BA 3OTOT 2IMLA 4L9IA 4LFBT 4U72A 3TLTA 2JJ9A 4OYJA 2K9AA 3PURA 1OWAA 4YTNA 5L47A 5J2UE 2V1DB 5LXTE 4H63V 2E9XC 2JMKA 4IE5A 3LK2B 3DJBA 5DQVA 4C91A 3ZKRA 4HN9A 1OEDE 4A97A 4AKIA 1ZV4X 4H9PC 2JQHA 4MBQA 2D5UA 3AVSA 3CKDA 4O8SA 2W66A 5JREA 3RH3A 2XAJB 3FHNA 2XZEA 2MTQA 5DABA 3DTOA 2YDRA 2WWVA 3RF1A 2N1GA 3T1HT 1MMGA 4DV3T 4U31A 5IWAT 4L0RA 4U2ZA 3I1AA 4X5TA 3N2OA 5IHYA 5HAXA 4CXWA 2D0TA 3PUWF 5HEOA 5JQGE 3ZMVB 3E08A 3VRAA 1OEDB 2XJ7A 1S35A 4TX5A 4CQIA 2BG9A 5AQVB 2SPCA 3TLVA 4AIUA 3PUQA 5L3GB 3ZT5A 3AAIA 4TUYE 4LF4T 2W67A 3TLWA 2NW7A 2XQ6A 2DCFA 3KV9A 5TAOA 3CMLA 4HFEA 4J2CA 4WBOA 1MMNA 3N2KE 4HWFA 4ISSA 1SA0E 3PTRB 1WYBA 2VWAA 3UUNA 2EHOB 4GOUA 5FMNA 2YEVC 3V5UA 2KWHA 4CXYA 4AISA 1XWMA 4DO0A 4F6RC 3AEBA 3RYIE 1HFAA 4JLEA 3NRYA 1XNRT 4B6XA 5JRCB 2WDQA 3AVRA 4TWHA 4DV5T 2E8IA 3L8RA 2ES0A 4IDQA 1M7KA 3ETVA 2UXDT 5C8YE 1OEDC 4ZZBA 2ACXA 1KFYA 1WLXA 2BG9E 4IE6A 2WM9A 4TZ4C 5LOVE 2M67A 2DI4A 2E9XD 4DR5T 3LJCA 1B7TA 1GQEA 1BR2A 3PUSA 5JDGA 3MKDA 3HKDE 3RKGA 3JAFA 2PJQA 3ANWA 1W09A 3F2EA 3FZKB 4EXTA 3AEFA 1UURA 5HXCA 3UQ7A 1M62A 4OHFA 4JI8T 2LJLA 1KF6A 1QLBA 1UX5A 5AQLB 3C98B 2D0UA 5LHHB 4A5XA 1BR0A 4YJ3E 4PJJA 5AQGB 4HWCA 4O4LE 4YJ2E 2WB5A 2BBHA 1HX8A 1UUSA 2LKHA 4ISTA 3AEDA 3BK9A 1N33T 2BS2A 4COFA 5LP6E 2WP9A 2RPAA 1J5ET 2YINA 5L3DB 2XAQB 4DV1T 3AAAB 4ZS2A 3HI2A 5AQUB 1X9BA 4KUMB 3Q5EA 1HX1B 2CWOA 5E0OA 3RYCE 5JR9A 3ESLA 4QWNB 2MAWA 1SHZC 2MBGA 4H9RC 3O1HA 5FL1A 3PE0A 4MALA 4UVCB 2LT3A 2YKSA 2KSRA 4ANJA 5AQTB 1WR0A 4JUYA 3JAEA 2A9UA 2L8KA 4GK0E 1NEKA 4DV2T 2YOEA 5EK2A 4U7IA 4JI5T 2IIUA 4JEHB 5CFBA 1HNWT 3Q2MA 4DVDA 2C5JA 2V7JA 2XM2A 3AE2A 2VVSA 5H6RB 5HXEA 1YQ4A 4O2BE 4I50E 4EV6A 5LB7B 4TV9E 1XDOA 1ZOYA 3CX8B 4EYYR 1O3XA 4IGUA 2Q9QB 2HH7A 1L0VA 3B57A 1XDPA 4YXDA 4ADZA 2MYSA 3Q5WA 2BS4A 4UEMA 3J9X1 1U5PA 1R8IA 2H89A 3S4UA 1MIYA 4QH5A 5CJ5A 4IDPA 4X1YE 1IBLT 2XQ8A 3FXDB 4ZHQE 2W00A 3NZPA 4P0BA 3PUVF 5AQQB 4QX7B 1D0ZA 3CVRA 4A98A 1VRBA 3SOLA 5ABHA 3ZSSA 4QKNA 4UVAB 2LM9A 5AQHB 1CUNA 4PJLA 1UCUA 4CN1A 4OFZA 4DR2T 1BR1A 5AQOB 2WAUA 4GK5E 5LGNB 5FKYA 4LF8T 1G73A 2W2UA 2J47A 2XQ9A 4PK5A 2LLYA 4YLHA 1SE7A 3PV0F 3EAMA 3WAKA 3UUBA 4K0KT 2DNXA 1VCSA 4QXBB 5F5WA 4CI2B 5LBMA 4UIGA 2CBJA 3U78A 5ABGA 1HNXT 3ZC0A 2CWYA 5LCYA 4IE0A 3L09A 3PUYF 3N2GE 4YSZA 3PDYA 4YFSA 4IREA 1Z8UA 1NENA 4BA9A 4X1IE 3GN5B 4MHCA 4B3MT 1IAPA 3RRCA 4ERRA 2UXXB 3P7IA 2JIWA 3ETUA 4O4JE 2CLYB 3CWZB 3FBZA 3A7MA 4Z90A 2LOSA 2RA1A 4PJNA 2LRLA 3UU5A 1US7B 1Y01A 2LSKA 2LSYA 2HPJA 2I0MA 4GKKT 1FJGT 2AE9A 2JQKA 3OKQA 4DNDA 1OEDA 1KK7A 4O4IE 4DR3T 5AFUL 4YTMA 2WU5A 3ZPOA 3A8YC 2DWKA 3NVOA 1WRDA 2NOXA 3CX7B 4LF7T 3DP7A 3N9MA 2XAHB 4EYUA 4YTPA 5LGUB 4IDNA 3UT5E 1KEYA 1AJ3A 4UV9B 5ADXL 4OYKA 4KMCA 2QGSA 2X51A 3JCFA 3RI5A 5IUXA 1V9DA 4O2AE 2EHOA 2XQ7A 1FMWA 2A3DA 3P4SA 4WZXA 5KX5E 3OYXA 3AE4A 2VB6A 3CQXC 3VKGA 5CGMA 2CLYC 4DV0T 3AEGA 4KX6A 3ONXA 3FZHB 3ZCIA 2C0SA 4YY3T 4JI3T 2W0GA 3RC3A 2Q9QD 2YK0A 1ZKEA 4AKHA 5JRCA 5J1GA 3I9WA 3M65A 2W61A 4MFRA 1HR0T 3EDUA 5FXZA 5HXRA 1VCTA 3SWHA 1IBKT 3KVBA 2Y8DA 3ABVA 5HEGA 4JI6T 3JADA 5LG4A 5KDMC 2XSAA 3ZC1A 1E1HB 3KINB 2X0HA 3QC9A 3C4XA 2XM1A 3CIRA 3LBXA 4HFBA 2N9DA 1E7PA 3AEEA 3O4XE 1D1BA 3OJAA 4AQGA 4KHPT 5JDFA 1T98A 4O4HE 4Q25A 2WS3A 5JVDE 3X1DA 4ILBA 3CX6B 4AQFC 3RYFE 3AE3A 2H7VC 2WDVA 4YHJA 5JDHA 3KBUA 4BJMA 1W0AA 5F8PA 5LNKA 2YN6A 1YKEB 2X9HA 4U3CA 3MA9A 5M4YA 4CI1B 2B76A 2VVNA 4F8HA 4HTEA 4ZEYA 3UULA 3QK6A 2ZM6T 2CXDA 4OK0A 3T8OA 2LRKA 2LE8A 2VURA 4EZ4A 3KDSE 3P4WA 5HEJA 3PJAJ 2BZBA 1HF8A 1VOMA 2ZLYA 3I0QA 4Z8XA 4TWFA 2PBIA 3V5SA 3A5XA 4I0UA 2Y48B 4PK6A 4N78D 2MPKA 2PG8A 2NW9A 5FY0A 5JH7E 4DMWA 3ZLIA 2N2NA 4DMVA 4JYAT 4ZI3C 4HEAA 1FIOA 3HL6A 4UXNB 1XMOT 3H37A 1T7SA 4JI7T 2IDOB 2UU9T 4JI2T 2CHOA 4LF6T 2H3RA 2R6GF 3SFEA 3CQGB 2V6YB 1SUMB 4TN7B 2J4GA 2JQQA 4IE7A 5C2TA 2Q9QA 2KNDA 4ZOLE 3U3IA 3ZEFB 3BQKA 2X67A 4DV6T 3QB5A 4U2YA 4EOZB 3LG7A 4GYRA 2EHOC 4OX9T 2IUBA 3EI0A 3E0ZA 3RC8A 3C51A 4PJMA 4DBQA 4YT0A 5L3CB 3VKHA 4QH4A 2IAKA 4B3ST 4KI0F 2X68A 3OYZA 1T8BA 2WY2A 2WCAA 3RHWA 3N9QA 2K5BB 4PAGA 2Y6XA 2E2AA 2WU2A 4IDZA 2YU2A 4H9NC 4PNIA 4JI1T 2VL8A 4NPPA 3P4PA 5BMVE 1ZP0A 3UQ4A 5LA6E 3K3QC 2BKOA 4IIJE 4AKGA 3NBXX 4CXXA 2VKDA 2QA7A 3AE7A 1YD8G 5LMNT 3AE1A 3CPZA 3OPCA 3KVAA 3RIFA 2A72A 4H9SE 2W63A 1KNRA 2LOPA 2VQET 5JDNA 2CHNA 4YSYA 3C4ZA 3C50A 5GONE 2LSJA 4ILUA 2KMFA 2V26A 3AAEB 1LRZA 2WMNA 4QXHB 1OXZA 4ZI3D 3LK3B 5ETWA 1LVKA 4B3TT 3GN5A 4ASKA 2D2SA 3T1YT 3N5LA 1T72A 4L5GA 2BVLA 2LHNA 3I0OA 4Z91A 4ZI2C 5L4HA 2UUBT 4PK4A 4NUUA 4E7ZA 2WQYA 2ODVA 3WAJA 3I9YA 1D0XA 4AI6A 1G8XA 1BR4A 1X79A 4HKAA 1FMVA 4ZZCA 3KV4A 3OVUA 4X65T 2V6XA 2B1EA 1MNEA 3O1IA 2L3LA 2XQAA 2JQ9A 1JNRA 5H6QB 3F57A 2X0YA 2JRKA 3AA7B 3HKBE 2X0LB 2EHOD 5HYAA 2KT9A 3ZMZB 2UXBT 3ZT6A 3ZMSB 3P50A 3GWHA 2GK9A 3UFGA 1D1CA 2C5IT 5FYMA 4CN4A 4NUVA 4HE8A 2NTYA 4FI5A 2KXPB 5JDLA 5LJMA 2UXCT 2I6HA 5CA1E 4HFVA 4GYSA 1HG5A 4M1PA 2WMOA 2LSGA 5LG3A 5LHIB 4DV7T 2Q9QC 2WZIA 3QOFA 5JDMA 4AQFA 3L39A 2QVAA 2K48A 5EK4A 3QB5K 4QH1A 5AQKB 3RKOA 4H63H 3G06A 5AQRB 3TLUA 4AXPA 4K0UA 3UFEA 2HPLA 3LFMA 3KV5A 3D0TA 3K1SA 4GIWA 3LDQB 4JI4T 5ABEA 1J1JA 3AE6A 3HA4A 2KWIB 2NTXA 5FY1A 5ABFB 3MXZA 5EK3A 2YU1A 1WFDA 1H7CA 3PUZF 2E5LT 2QRXA 4ZI2D 4U7YA 3MZKB 2VL0A 1UK5A 1XMQT 3K3NA 4I43B 5BR8T 4JI0T 3FZFB 1N32T 5FXWA 3GMIA 3HKEE 3ZYKA 3NWIA 4H9OC 2OA5A 2LEHA 4X20E 2XAFB 2E9XB 4QX8B 3PU3A 2VKJA 2Z6EA 4DBRA 2J62A 2PTFA 1KNPA 3RQUA 2I59A 1WCRA 5AQNB 5FVKA 1LKXA 4UF0B 4DIDB 2LM2A 2OV9A 3PJAA 3UUMA 3ZCJA 3RIAA 5LGTB 3HKCE 4TV8E 4MLKA 4YSXA 4UELA 3AXJB 2VASA 4ZS3A 2ZM0A 3SS1A 1Z0PA 2UUCT 3UUXB 4HFHA 2CXLA 2IW5B 3PUAA 3EVYA 5AQFB 2A2FX 3ZT7A 3IEEA 2V6YA 4HFDA 4AKLA 3O1JA 3Q5XA 4E7SA 3L3PA 3IA3A 3K3OA 3RYHE 3OBVE 3IF8B 3QUJA 2DWGA 2MOZA 2V7MA 2XQ5A 4G63A 5L3EB 3BQIA 2HN2A 4IT4A 3KFWX 3M3ZB 5J0ZA 4JV5T 4IL9A 5L3FB 2X66A 3FZLB 5AQPB 4ZXLA 2V7KA 3R84B 5DQWA 4TNWA 2CA5A 3FZMB 1ZHCA 4U74A 1NWMX 3RQWA 4GKJT 2CM0A 2ACZA 1HCIA 5DJQC 4ZI7E 4EGWA 1EZ3A 3AE9A 3RIUC 2X9WA 3SFDA 2V5CA 5JDQA 2VK9A 3NKZA 4UR9A 3ONLC 3Q9DA 3CK6A 2BBJA 4NXMT 5L2LA 4WNKA 3WI3A 4P09A 4DV4T 3KV6A 4X64T 1WR6A 1DU2A 3RRWA 2WZHA 2ODUA 2X9YA 1IJ5A 5HEHA 5LMUT 1NAFA 3N9NA 4IL4A 2DHRA 3AA6B 3C64A 3NRXA 1IZNB 5F3JA 5KXJA 3B5MA 2VQFT 1YQ3A 3VHLA 1QUUA 2FJAA 3ZMTB 5LYJE 4HGAA 1UGOA 2UXNB 4XAXB 5J2TE 2XY8B 2FUPA 2IHR1 2KLQA 4HFCA 1MMAA 3UU6A 1N36T 2W62A 4WW0A 2NWBA 4QHOA 5L3BB 3TKLB 2C5KT 1MNDA 1S94A 3R6NA 1HNZT 4NXNT 1XZYA 5AQIB 1YW0A 1YXRA 4BAYB 4UV8B 2V5DA 1E2AA 3W15B 2AXDS 4EB6E 4EIWA 2BKNA 1WYCA 5C3JA 3ZJ1A 5AQMB 4DR4T 3LBXB 1J5WA 3AEAA 4PFOA 3E22E 2J1DG 2ZM2A 4IDOA 2XASB 3ZJ2A 4DUZT 2ZMAA 3EUHA 1XNQT 3EABA 2WSSV 1ZEEA 3RPUA 1HG2A 4NIQA 4KBMB 5KMGP 4JBWF 4HWHA 2P9BA 3UU8A 2BG9B 3O9XA 4QXCB 2H88A 2YDQA 3TLSA 3Q5DA 5FVLA 4CN6A 3MJXA 2XQ4A 3H3AA 3JC6C 2XHEB 4A56A 5HXHA 4LMJA 3CQCB 4CI3B 4LMKA 3RLFF 2VKHA 2XSBA 5LHGB 2G0UA 5FNVE 4ILCA 2X9XA 2LSIA 4LF5T 2K3WA 4V1Av 5IYZE 2OLTA 3FBLA 3PU8A 2PFVA 3RX6A 3NZQA 2IC6A 2H7OA 4ILAA 2CXFA 2QYWA 3MACA 2VKOA 2F4VT 4CZZB 3IBPA 4P1NA 3RGLA 1KNZA 4I4TE 3C4WA 2BG9C 5ABFA 4WYVA 2E5VA 3FB2A 3N9PA 4KP3C 3SRZA 3BQLA 3VR8A 2HN1A 4TWDA 2XPKA 1HTJF 3QNUA 4HWIB 5EZYE 3VU7H 2CEAA 3ANWB 3PUXF 2WBLA 3ZN0B 1HS7A 3N9OA 4DUYT 2FBWA 1IJ6A 2UUAT 2CPTA 2WDRA 1W9RA 4PFPA 3J7Yq 1D0YA 2JPFA 3ZMUB 1FEWA 4HWDA 2KZ7B 4IE4A 3GA8A 4AQYT 5LBQB 2KINB 4LMLA 5A1LA 2M6IA 1D1AA 3P4QA 2E9XA 5CA0E 3P8CD 3HR0A 2YDSA 4UVBB 3ZSTA 4TNVA 3AE5A 4B3RT 4U33A 3VRBA 3UU3A 4BJNA 2FJEA
chains in the Genus database with same CATH topology
3QK6A 3AAAB 4C90A 4ZS2A 2BDEA 3HI2A 2CXDA 4OK0A 2I59A 3T8OA 2LE8A 4EZ4A 4KUMB 3KDSE 5HXSA 1LKXA 4UF0A 1LVFA 2CWOA 5E0OA 5FXXA 4UF0B 3RYCE 2BZBA 2XQYA 5JR9A 1HF8A 1VOMA 2ZLYA 3ESLA 5JR9B 3I0QA 4QWNB 4Z8XA 2PBIA 3V5SA 3A5XA 3AB3B 1SHZC 2Y48B 4PK6A 2MBGA 4N78D 4H9RC 3O1HA 2PG8A 2NW9A 3JC6D 2K24A 3UUMA 3ZCJA 5LGTB 3UTKA 3HKCE 4TV8E 3ZYMA 4MLKA 5FY0A 1QSDA 5JH7E 3PE0A 2LHRA 4MALA 2LT3A 4UELA 4UVCB 4DMWA 3ZLIA 2N2NA 3ZN1B 4DMVA 2L9QA 2VASA 4ANJA 4ZI3C 1MIWA 4HEAA 4ZS3A 4JUYA 2ZM0A 3SS1A 1FIOA 3HL6A 4UXNB 4GK0E 4XBFB 2L8KA 2XTLA 3H37A 3K8PC 1Z0PA 3N9LA 2IC9A 5EK2A 1U4QA 3LK42 4IHJE 3MK7C 4XZCA 4JEHB 5FP3A 3UUXB 3Q2MA 4DVDA 2CXLA 2IW5B 2C5JA 2V7JA 3PUAA 2CMRA 3EVYA 3B13A 3FXEB 5H6RB 2H3RA 2A2FX 5HXEA 3IEEA 1MIVA 4O2BE 4I50E 3CQGB 4AKLA 4TV9E 3O1JA 3Q5XA 4E7SA 3KBTA 4TN7B 3CX8B 2JQQA 4I55E 4IE7A 3L3PA 2Q9QA 3K3OA 1YKHB 1O3XA 4IGUA 3RYHE 4EYYR 3OBVE 2Q9QB 2KNDA 2HH7A 4ZOLE 3IF8B 3U3IA 3ZEFB 3BQKA 3QUJA 3B57A 2X67A 2NP9A 2DWGA 5CB4E 4ADZA 2MYSA 4EOZB 3Q5WA 2MOZA 4UEMA 3PUGA 2V7MA 3LG7A 4X1KE 1U5PA 4G63A 3J9X1 4JEUB 1UX4A 4GYRA 2EHOC 3S4UA 5L3EB 1MIYA 3BQIA 4AKRB 5LJNA 4PW8A 3E0ZA 3RC8A 3KFWX 3C51A 2ZM8A 4X1YE 4PJMA 4DBQA 5JR9C 5L3FB 2X66A 3FXDB 5L3CB 2V7LA 3VKHA 5FY7A 4ZHQE 2W00A 3AA0B 2V7KA 3NZPA 3R84B 2IAKA 5DQWA 4EZHA 4P0BA 2X68A 3OYZA 2CA5A 4G2AA 3ZYLA 3IHRA 1ZHCA 4U74A 3N9QA 1NWMX 2K5BB 2CM0A 4PAGA 1HCIA 4QX7B 5DJQC 1D0ZA 2Y6XA 3CVRA 4ZI7E 3F31A 4IDZA 2NW8A 2DLRA 2YU2A 4H9NC 1VRBA 5HWXA 3SOLA 1EZ3A 4PNIA 4QKNA 2VL8A 2X9WA 5BMVE 4UVAB 5HWYA 2CE7A 2LM9A 1CUNA 5LA6E 2VK9A 4PJLA 5JDQA 3K3QC 1UCUA 2WWUA 3EDVA 2V7IA 4IIJE 4H9QC 4OFZA 4AKGA 4EAHA 1BR1A 2WAUA 4GK5E 3AA1B 1Y64B 3NBXX 2JMHA 3Q9DA 5LGNB 4CXXA 5L2LA 2VKDA 2QA7A 1G73A 1YD8G 4WNKA 3WI3A 4P09A 2XAGB 4PK5A 3KV6A 1WR6A 4YLHA 3RRWA 2XUEA 4WBNE 5FXVA 1MMDA 3CPZA 2ODUA 2X9YA 1IJ5A 2CCQA 4P0AA 3WAKA 3KVAA 1NAFA 3N9NA 2RP4A 4FJOA 2DHRA 2DNXA 2BVMA 2A72A 3AA6B 4H9SE 4QXBB 2W63A 4CI2B 3C64A 3NRXA 5LBMA 4UIGA 3U78A 1IZNB 2LOPA 5F3JA 3ZC0A 5JDNA 3VHLA 2CWYA 5LCYA 1QUUA 3C4ZA 4IE0A 3ZMTB 3L09A 5LYJE 4HGAA 3C50A 4L9IA 3N2GE 4U72A 2UXNB 4XAXB 5GONE 5J2TE 2LSJA 2JJ9A 4ILUA 4OYJA 2K9AA 3PURA 3PDYA 1OWAA 2KLQA 2KMFA 4YFSA 1MMAA 2V26A 3AAEB 1LRZA 2WMNA 4QXHB 1OXZA 4ZI3D 5J2UE 2W62A 2V1DB 3LK3B 4WW0A 5ETWA 5LXTE 1LVKA 4H63V 2NWBA 2E9XC 4QHOA 3GN5A 5L3BB 2JMKA 4IE5A 3TKLB 3LK2B 4ASKA 4BA9A 4X1IE 3DJBA 3GN5B 2D2SA 4MHCA 2C5KT 5DQVA 3N5LA 4C91A 4L5GA 1MNDA 2BVLA 2LHNA 1S94A 3I0OA 1IAPA 3R6NA 4HN9A 4ZI2C 3RRCA 4ERRA 2UXXB 4PK4A 3P7IA 4AKIA 1YW0A 4NUUA 4BAYB 1ZV4X 4H9PC 4E7ZA 4UV8B 2ODVA 3WAJA 3I9YA 3ETUA 3W15B 1D0XA 4MBQA 2D5UA 3AVSA 3CKDA 4O8SA 4AI6A 4O4JE 1G8XA 1BR4A 1X79A 2CLYB 4HKAA 4EB6E 1FMVA 4EIWA 3CWZB 1WYCA 3FBZA 3ZJ1A 3KV4A 3LBXB 3RH3A 5JREA 2B1EA 2XAJB 4PFOA 3FHNA 1MNEA 2LOSA 2RA1A 2MTQA 3E22E 4PJNA 3DTOA 2J1DG 3O1IA 2L3LA 5DABA 1US7B 2N1GA 2ZM2A 2XASB 5H6QB 3ZJ2A 1MMGA 2ZMAA 4L0RA 2LSKA 2LSYA 3EUHA 2JRKA 3F57A 3AA7B 3HKBE 3I1AA 2X0LB 3N2OA 5IHYA 2EHOD 2HPJA 5HAXA 4CXWA 2D0TA 5JQGE 2WSSV 5HYAA 3ZMVB 1ZEEA 3RPUA 2KT9A 3ZMZB 3OKQA 3E08A 3ZMSB 4DNDA 1HG2A 5KMGP 4KBMB 1KK7A 4O4IE 3GWHA 2P9BA 1S35A 5AFUL 2GK9A 4TX5A 1D1CA 2C5IT 5FYMA 4CQIA 4NUVA 4HE8A 3ZPOA 2SPCA 3O9XA 2NTYA 2DWKA 4FI5A 3PUQA 2KXPB 5L3GB 1WRDA 3AAIA 4QXCB 5JDLA 4TUYE 2NOXA 5LJMA 2NW7A 2DCFA 3CX7B 5CA1E 3DP7A 4HFVA 3N9MA 2XAHB 3KV9A 4EYUA 5LGUB 4GYSA 1HG5A 5TAOA 3UT5E 4M1PA 3CMLA 1AJ3A 4UV9B 2WMOA 5ADXL 2LSGA 4J2CA 4WBOA 4OYKA 3MJXA 1MMNA 4KMCA 2QGSA 3N2KE 2X51A 5LHIB 4ISSA 1SA0E 1V9DA 1WYBA 3H3AA 3PTRB 2VWAA 2EHOA 2Q9QC 4O2AE 3UUNA 2EHOB 1FMWA 2A3DA 3JC6C 4GOUA 2XHEB 4A56A 5HXHA 5KX5E 3OYXA 5FMNA 4AQFA 5JDMA 2YEVC 2VB6A 3CQXC 2KWHA 3CQCB 3V5UA 2CLYC 3VKGA 4CI3B 4CXYA 3ONXA 2VKHA 5LHGB 2G0UA 5FNVE 3ZCIA 4DO0A 2C0SA 2K48A 5EK4A 2X9XA 4F6RC 2W0GA 2LSIA 3RYIE 3RC3A 2Q9QD 1HFAA 4JLEA 3RKOA 3NRYA 2YK0A 1ZKEA 4H63H 4AKHA 4V1Av 4B6XA 5IYZE 3FBLA 3PU8A 5JRCA 5J1GA 2PFVA 5JRCB 3I9WA 3M65A 3RX6A 4AXPA 2W61A 4MFRA 4K0UA 3UFEA 3NZQA 3AVRA 2HPLA 3EDUA 2IC6A 5FXZA 2H7OA 5HXRA 2E8IA 2ES0A 3LFMA 3KV5A 3ETVA 2CXFA 3D0TA 3SWHA 4GIWA 3MACA 2VKOA 5C8YE 3KVBA 2Y8DA 4CZZB 3IBPA 1KNZA 4I4TE 2ACXA 3C4WA 1WLXA 3HA4A 5LG4A 2KWIB 2NTXA 5KDMC 3ZC1A 4IE6A 2WM9A 4TZ4C 1E1HB 3FB2A 5FY1A 5LOVE 2M67A 3N9PA 2DI4A 3KINB 3MXZA 5EK3A 2E9XD 4KP3C 2YU1A 3QC9A 3C4XA 3SRZA 3LJCA 3LBXA 1B7TA 1H7CA 2N9DA 1BR2A 3PUSA 3BQLA 3O4XE 1D1BA 4ZI2D 5JDGA 3MKDA 1HTJF 3HKDE 3MZKB 3OJAA 4AQGA 2PJQA 3ANWA 5EZYE 3VU7H 2CEAA 3ANWB 3F2EA 5JDFA 1T98A 3K3NA 4O4HE 4I43B 4EXTA 2WBLA 3ZN0B 1HS7A 5JVDE 3N9OA 5HXCA 1IJ6A 3CX6B 4AQFC 5FXWA 4OHFA 4PFPA 3RYFE 3GMIA 3J7Yq 1D0YA 2JPFA 3ZMUB 1FEWA 2H7VC 2KZ7B 4IE4A 4YHJA 2LJLA 3GA8A 5LBQB 2KINB 3HKEE 1UX5A 3C98B 2D0UA 5LHHB 5JDHA 3ZYKA 3KBUA 4BJMA 5A1LA 1BR0A 4YJ3E 4PJJA 1D1AA 4H9OC 4O4LE 2OA5A 4YJ2E 2E9XA 2LEHA 5CA0E 4X20E 1HX8A 2XAFB 3P8CD 2E9XB 5F8PA 3HR0A 4ISTA 5LNKA 4UVBB 4QX8B 3BK9A 1YKEB 5LP6E 2X9HA 3PU3A 2VKJA 3MA9A 5M4YA 4CI1B 2Z6EA 4DBRA 4HTEA 2YINA 5L3DB 4BJNA 2XAQB 3UULA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O9X A;  3GN5 B;  3HI2 A;  3GN5 A;  3GA8 A; 
#chains in the Genus database with same CATH topology
 4C90 A;  3P4R A;  2BDE A;  2V8S V;  5AQJ B;  5HXS A;  1N34 T;  4UF0 A;  1LVF A;  5FXX A;  4DR6 T;  2DL1 A;  2XQY A;  5HCJ A;  5JR9 B;  3AB3 B;  5L4E A;  3JC6 D;  2K24 A;  4X62 T;  3UTK A;  3LSV A;  3ZYM A;  4LFC T;  1QSD A;  2LHR A;  3ZN1 B;  3UU4 A;  3AXJ A;  2CRB A;  2L9Q A;  3ONJ A;  5FL0 A;  4EEB A;  2D9D A;  3RIU A;  1MIW A;  3VR9 A;  4XBF B;  3AE8 A;  5HCM A;  2XTL A;  4HFI A;  3K8P C;  3N9L A;  2IC9 A;  3AEC A;  1U4Q A;  3LK4 2;  4IHJ E;  4YHH T;  1JNZ A;  3MK7 C;  4XZC A;  5FP3 A;  4DR7 T;  2CMR A;  1I6Z A;  3B13 A;  3FXE B;  1MIV A;  2BS3 A;  4LFA T;  5HEU A;  4EED A;  3KBT A;  4I55 E;  1YKH B;  2FJD A;  5AQS B;  2NP9 A;  5CB4 E;  3PUG A;  2HHH T;  4X1K E;  4JEU B;  4X66 T;  1UX4 A;  1I94 T;  4LF9 T;  4AKR B;  5LJN A;  4PW8 A;  2FJB A;  3EHZ A;  2ZM8 A;  5JR9 C;  2V7L A;  5FY7 A;  3AA0 B;  4EZH A;  4G2A A;  3ZYL A;  3IHR A;  2W4X A;  1IBM T;  4DR1 T;  3F31 A;  2NW8 A;  2DLR A;  5HWX A;  5HWY A;  2CE7 A;  2WWU A;  3EDV A;  2V7I A;  2CBI A;  4H9Q C;  4EAH A;  2XQ3 A;  3AA1 B;  1Y64 B;  2JMH A;  2LKG A;  2XAG B;  2XUE A;  4WBN E;  3H3M A;  5FXV A;  1MMD A;  5JTG A;  2CCQ A;  4P0A A;  1CHU A;  2RP4 A;  4FJO A;  2BKP A;  2BVM A;  2NR4 A;  2M6B A;  4KHZ F;  1W0B A;  3OTO T;  2IML A;  4L9I A;  4LFB T;  4U72 A;  3TLT A;  2JJ9 A;  4OYJ A;  2K9A A;  3PUR A;  1OWA A;  4YTN A;  5L47 A;  5J2U E;  2V1D B;  5LXT E;  4H63 V;  2E9X C;  2JMK A;  4IE5 A;  3LK2 B;  3DJB A;  5DQV A;  4C91 A;  3ZKR A;  4HN9 A;  1OED E;  4A97 A;  4AKI A;  1ZV4 X;  4H9P C;  2JQH A;  4MBQ A;  2D5U A;  3AVS A;  3CKD A;  4O8S A;  2W66 A;  5JRE A;  3RH3 A;  2XAJ B;  3FHN A;  2XZE A;  2MTQ A;  5DAB A;  3DTO A;  2YDR A;  2WWV A;  3RF1 A;  2N1G A;  3T1H T;  1MMG A;  4DV3 T;  4U31 A;  5IWA T;  4L0R A;  4U2Z A;  3I1A A;  4X5T A;  3N2O A;  5IHY A;  5HAX A;  4CXW A;  2D0T A;  3PUW F;  5HEO A;  5JQG E;  3ZMV B;  3E08 A;  3VRA A;  1OED B;  2XJ7 A;  1S35 A;  4TX5 A;  4CQI A;  2BG9 A;  5AQV B;  2SPC A;  3TLV A;  4AIU A;  3PUQ A;  5L3G B;  3ZT5 A;  3AAI A;  4TUY E;  4LF4 T;  2W67 A;  3TLW A;  2NW7 A;  2XQ6 A;  2DCF A;  3KV9 A;  5TAO A;  3CML A;  4HFE A;  4J2C A;  4WBO A;  1MMN A;  3N2K E;  4HWF A;  4ISS A;  1SA0 E;  3PTR B;  1WYB A;  2VWA A;  3UUN A;  2EHO B;  4GOU A;  5FMN A;  2YEV C;  3V5U A;  2KWH A;  4CXY A;  4AIS A;  1XWM A;  4DO0 A;  4F6R C;  3AEB A;  3RYI E;  1HFA A;  4JLE A;  3NRY A;  1XNR T;  4B6X A;  5JRC B;  2WDQ A;  3AVR A;  4TWH A;  4DV5 T;  2E8I A;  3L8R A;  2ES0 A;  4IDQ A;  1M7K A;  3ETV A;  2UXD T;  5C8Y E;  1OED C;  4ZZB A;  2ACX A;  1KFY A;  1WLX A;  2BG9 E;  4IE6 A;  2WM9 A;  4TZ4 C;  5LOV E;  2M67 A;  2DI4 A;  2E9X D;  4DR5 T;  3LJC A;  1B7T A;  1GQE A;  1BR2 A;  3PUS A;  5JDG A;  3MKD A;  3HKD E;  3RKG A;  3JAF A;  2PJQ A;  3ANW A;  1W09 A;  3F2E A;  3FZK B;  4EXT A;  3AEF A;  1UUR A;  5HXC A;  3UQ7 A;  1M62 A;  4OHF A;  4JI8 T;  2LJL A;  1KF6 A;  1QLB A;  1UX5 A;  5AQL B;  3C98 B;  2D0U A;  5LHH B;  4A5X A;  1BR0 A;  4YJ3 E;  4PJJ A;  5AQG B;  4HWC A;  4O4L E;  4YJ2 E;  2WB5 A;  2BBH A;  1HX8 A;  1UUS A;  2LKH A;  4IST A;  3AED A;  3BK9 A;  1N33 T;  2BS2 A;  4COF A;  5LP6 E;  2WP9 A;  2RPA A;  1J5E T;  2YIN A;  5L3D B;  2XAQ B;  4DV1 T;  3AAA B;  4ZS2 A;  3HI2 A;  5AQU B;  1X9B A;  4KUM B;  3Q5E A;  1HX1 B;  2CWO A;  5E0O A;  3RYC E;  5JR9 A;  3ESL A;  4QWN B;  2MAW A;  1SHZ C;  2MBG A;  4H9R C;  3O1H A;  5FL1 A;  3PE0 A;  4MAL A;  4UVC B;  2LT3 A;  2YKS A;  2KSR A;  4ANJ A;  5AQT B;  1WR0 A;  4JUY A;  3JAE A;  2A9U A;  2L8K A;  4GK0 E;  1NEK A;  4DV2 T;  2YOE A;  5EK2 A;  4U7I A;  4JI5 T;  2IIU A;  4JEH B;  5CFB A;  1HNW T;  3Q2M A;  4DVD A;  2C5J A;  2V7J A;  2XM2 A;  3AE2 A;  2VVS A;  5H6R B;  5HXE A;  1YQ4 A;  4O2B E;  4I50 E;  4EV6 A;  5LB7 B;  4TV9 E;  1XDO A;  1ZOY A;  3CX8 B;  4EYY R;  1O3X A;  4IGU A;  2Q9Q B;  2HH7 A;  1L0V A;  3B57 A;  1XDP A;  4YXD A;  4ADZ A;  2MYS A;  3Q5W A;  2BS4 A;  4UEM A;  3J9X 1;  1U5P A;  1R8I A;  2H89 A;  3S4U A;  1MIY A;  4QH5 A;  5CJ5 A;  4IDP A;  4X1Y E;  1IBL T;  2XQ8 A;  3FXD B;  4ZHQ E;  2W00 A;  3NZP A;  4P0B A;  3PUV F;  5AQQ B;  4QX7 B;  1D0Z A;  3CVR A;  4A98 A;  1VRB A;  3SOL A;  5ABH A;  3ZSS A;  4QKN A;  4UVA B;  2LM9 A;  5AQH B;  1CUN A;  4PJL A;  1UCU A;  4CN1 A;  4OFZ A;  4DR2 T;  1BR1 A;  5AQO B;  2WAU A;  4GK5 E;  5LGN B;  5FKY A;  4LF8 T;  1G73 A;  2W2U A;  2J47 A;  2XQ9 A;  4PK5 A;  2LLY A;  4YLH A;  1SE7 A;  3PV0 F;  3EAM A;  3WAK A;  3UUB A;  4K0K T;  2DNX A;  1VCS A;  4QXB B;  5F5W A;  4CI2 B;  5LBM A;  4UIG A;  2CBJ A;  3U78 A;  5ABG A;  1HNX T;  3ZC0 A;  2CWY A;  5LCY A;  4IE0 A;  3L09 A;  3PUY F;  3N2G E;  4YSZ A;  3PDY A;  4YFS A;  4IRE A;  1Z8U A;  1NEN A;  4BA9 A;  4X1I E;  3GN5 B;  4MHC A;  4B3M T;  1IAP A;  3RRC A;  4ERR A;  2UXX B;  3P7I A;  2JIW A;  3ETU A;  4O4J E;  2CLY B;  3CWZ B;  3FBZ A;  3A7M A;  4Z90 A;  2LOS A;  2RA1 A;  4PJN A;  2LRL A;  3UU5 A;  1US7 B;  1Y01 A;  2LSK A;  2LSY A;  2HPJ A;  2I0M A;  4GKK T;  1FJG T;  2AE9 A;  2JQK A;  3OKQ A;  4DND A;  1OED A;  1KK7 A;  4O4I E;  4DR3 T;  5AFU L;  4YTM A;  2WU5 A;  3ZPO A;  3A8Y C;  2DWK A;  3NVO A;  1WRD A;  2NOX A;  3CX7 B;  4LF7 T;  3DP7 A;  3N9M A;  2XAH B;  4EYU A;  4YTP A;  5LGU B;  4IDN A;  3UT5 E;  1KEY A;  1AJ3 A;  4UV9 B;  5ADX L;  4OYK A;  4KMC A;  2QGS A;  2X51 A;  3JCF A;  3RI5 A;  5IUX A;  1V9D A;  4O2A E;  2EHO A;  2XQ7 A;  1FMW A;  2A3D A;  3P4S A;  4WZX A;  5KX5 E;  3OYX A;  3AE4 A;  2VB6 A;  3CQX C;  3VKG A;  5CGM A;  2CLY C;  4DV0 T;  3AEG A;  4KX6 A;  3ONX A;  3FZH B;  3ZCI A;  2C0S A;  4YY3 T;  4JI3 T;  2W0G A;  3RC3 A;  2Q9Q D;  2YK0 A;  1ZKE A;  4AKH A;  5JRC A;  5J1G A;  3I9W A;  3M65 A;  2W61 A;  4MFR A;  1HR0 T;  3EDU A;  5FXZ A;  5HXR A;  1VCT A;  3SWH A;  1IBK T;  3KVB A;  2Y8D A;  3ABV A;  5HEG A;  4JI6 T;  3JAD A;  5LG4 A;  5KDM C;  2XSA A;  3ZC1 A;  1E1H B;  3KIN B;  2X0H A;  3QC9 A;  3C4X A;  2XM1 A;  3CIR A;  3LBX A;  4HFB A;  2N9D A;  1E7P A;  3AEE A;  3O4X E;  1D1B A;  3OJA A;  4AQG A;  4KHP T;  5JDF A;  1T98 A;  4O4H E;  4Q25 A;  2WS3 A;  5JVD E;  3X1D A;  4ILB A;  3CX6 B;  4AQF C;  3RYF E;  3AE3 A;  2H7V C;  2WDV A;  4YHJ A;  5JDH A;  3KBU A;  4BJM A;  1W0A A;  5F8P A;  5LNK A;  2YN6 A;  1YKE B;  2X9H A;  4U3C A;  3MA9 A;  5M4Y A;  4CI1 B;  2B76 A;  2VVN A;  4F8H A;  4HTE A;  4ZEY A;  3UUL A;  3QK6 A;  2ZM6 T;  2CXD A;  4OK0 A;  3T8O A;  2LRK A;  2LE8 A;  2VUR A;  4EZ4 A;  3KDS E;  3P4W A;  5HEJ A;  3PJA J;  2BZB A;  1HF8 A;  1VOM A;  2ZLY A;  3I0Q A;  4Z8X A;  4TWF A;  2PBI A;  3V5S A;  3A5X A;  4I0U A;  2Y48 B;  4PK6 A;  4N78 D;  2MPK A;  2PG8 A;  2NW9 A;  5FY0 A;  5JH7 E;  4DMW A;  3ZLI A;  2N2N A;  4DMV A;  4JYA T;  4ZI3 C;  4HEA A;  1FIO A;  3HL6 A;  4UXN B;  1XMO T;  3H37 A;  1T7S A;  4JI7 T;  2IDO B;  2UU9 T;  4JI2 T;  2CHO A;  4LF6 T;  2H3R A;  2R6G F;  3SFE A;  3CQG B;  2V6Y B;  1SUM B;  4TN7 B;  2J4G A;  2JQQ A;  4IE7 A;  5C2T A;  2Q9Q A;  2KND A;  4ZOL E;  3U3I A;  3ZEF B;  3BQK A;  2X67 A;  4DV6 T;  3QB5 A;  4U2Y A;  4EOZ B;  3LG7 A;  4GYR A;  2EHO C;  4OX9 T;  2IUB A;  3EI0 A;  3E0Z A;  3RC8 A;  3C51 A;  4PJM A;  4DBQ A;  4YT0 A;  5L3C B;  3VKH A;  4QH4 A;  2IAK A;  4B3S T;  4KI0 F;  2X68 A;  3OYZ A;  1T8B A;  2WY2 A;  2WCA A;  3RHW A;  3N9Q A;  2K5B B;  4PAG A;  2Y6X A;  2E2A A;  2WU2 A;  4IDZ A;  2YU2 A;  4H9N C;  4PNI A;  4JI1 T;  2VL8 A;  4NPP A;  3P4P A;  5BMV E;  1ZP0 A;  3UQ4 A;  5LA6 E;  3K3Q C;  2BKO A;  4IIJ E;  4AKG A;  3NBX X;  4CXX A;  2VKD A;  2QA7 A;  3AE7 A;  1YD8 G;  5LMN T;  3AE1 A;  3CPZ A;  3OPC A;  3KVA A;  3RIF A;  2A72 A;  4H9S E;  2W63 A;  1KNR A;  2LOP A;  2VQE T;  5JDN A;  2CHN A;  4YSY A;  3C4Z A;  3C50 A;  5GON E;  2LSJ A;  4ILU A;  2KMF A;  2V26 A;  3AAE B;  1LRZ A;  2WMN A;  4QXH B;  1OXZ A;  4ZI3 D;  3LK3 B;  5ETW A;  1LVK A;  4B3T T;  3GN5 A;  4ASK A;  2D2S A;  3T1Y T;  3N5L A;  1T72 A;  4L5G A;  2BVL A;  2LHN A;  3I0O A;  4Z91 A;  4ZI2 C;  5L4H A;  2UUB T;  4PK4 A;  4NUU A;  4E7Z A;  2WQY A;  2ODV A;  3WAJ A;  3I9Y A;  1D0X A;  4AI6 A;  1G8X A;  1BR4 A;  1X79 A;  4HKA A;  1FMV A;  4ZZC A;  3KV4 A;  3OVU A;  4X65 T;  2V6X A;  2B1E A;  1MNE A;  3O1I A;  2L3L A;  2XQA A;  2JQ9 A;  1JNR A;  5H6Q B;  3F57 A;  2X0Y A;  2JRK A;  3AA7 B;  3HKB E;  2X0L B;  2EHO D;  5HYA A;  2KT9 A;  3ZMZ B;  2UXB T;  3ZT6 A;  3ZMS B;  3P50 A;  3GWH A;  2GK9 A;  3UFG A;  1D1C A;  2C5I T;  5FYM A;  4CN4 A;  4NUV A;  4HE8 A;  2NTY A;  4FI5 A;  2KXP B;  5JDL A;  5LJM A;  2UXC T;  2I6H A;  5CA1 E;  4HFV A;  4GYS A;  1HG5 A;  4M1P A;  2WMO A;  2LSG A;  5LG3 A;  5LHI B;  4DV7 T;  2Q9Q C;  2WZI A;  3QOF A;  5JDM A;  4AQF A;  3L39 A;  2QVA A;  2K48 A;  5EK4 A;  3QB5 K;  4QH1 A;  5AQK B;  3RKO A;  4H63 H;  3G06 A;  5AQR B;  3TLU A;  4AXP A;  4K0U A;  3UFE A;  2HPL A;  3LFM A;  3KV5 A;  3D0T A;  3K1S A;  4GIW A;  3LDQ B;  4JI4 T;  5ABE A;  1J1J A;  3AE6 A;  3HA4 A;  2KWI B;  2NTX A;  5FY1 A;  5ABF B;  3MXZ A;  5EK3 A;  2YU1 A;  1WFD A;  1H7C A;  3PUZ F;  2E5L T;  2QRX A;  4ZI2 D;  4U7Y A;  3MZK B;  2VL0 A;  1UK5 A;  1XMQ T;  3K3N A;  4I43 B;  5BR8 T;  4JI0 T;  3FZF B;  1N32 T;  5FXW A;  3GMI A;  3HKE E;  3ZYK A;  3NWI A;  4H9O C;  2OA5 A;  2LEH A;  4X20 E;  2XAF B;  2E9X B;  4QX8 B;  3PU3 A;  2VKJ A;  2Z6E A;  4DBR A;  2J62 A;  2PTF A;  1KNP A;  3RQU A;  2I59 A;  1WCR A;  5AQN B;  5FVK A;  1LKX A;  4UF0 B;  4DID B;  2LM2 A;  2OV9 A;  3PJA A;  3UUM A;  3ZCJ A;  3RIA A;  5LGT B;  3HKC E;  4TV8 E;  4MLK A;  4YSX A;  4UEL A;  3AXJ B;  2VAS A;  4ZS3 A;  2ZM0 A;  3SS1 A;  1Z0P A;  2UUC T;  3UUX B;  4HFH A;  2CXL A;  2IW5 B;  3PUA A;  3EVY A;  5AQF B;  2A2F X;  3ZT7 A;  3IEE A;  2V6Y A;  4HFD A;  4AKL A;  3O1J A;  3Q5X A;  4E7S A;  3L3P A;  3IA3 A;  3K3O A;  3RYH E;  3OBV E;  3IF8 B;  3QUJ A;  2DWG A;  2MOZ A;  2V7M A;  2XQ5 A;  4G63 A;  5L3E B;  3BQI A;  2HN2 A;  4IT4 A;  3KFW X;  3M3Z B;  5J0Z A;  4JV5 T;  4IL9 A;  5L3F B;  2X66 A;  3FZL B;  5AQP B;  4ZXL A;  2V7K A;  3R84 B;  5DQW A;  4TNW A;  2CA5 A;  3FZM B;  1ZHC A;  4U74 A;  1NWM X;  3RQW A;  4GKJ T;  2CM0 A;  2ACZ A;  1HCI A;  5DJQ C;  4ZI7 E;  4EGW A;  1EZ3 A;  3AE9 A;  3RIU C;  2X9W A;  3SFD A;  2V5C A;  5JDQ A;  2VK9 A;  3NKZ A;  4UR9 A;  3ONL C;  3Q9D A;  3CK6 A;  2BBJ A;  4NXM T;  5L2L A;  4WNK A;  3WI3 A;  4P09 A;  4DV4 T;  3KV6 A;  4X64 T;  1WR6 A;  1DU2 A;  3RRW A;  2WZH A;  2ODU A;  2X9Y A;  1IJ5 A;  5HEH A;  5LMU T;  1NAF A;  3N9N A;  4IL4 A;  2DHR A;  3AA6 B;  3C64 A;  3NRX A;  1IZN B;  5F3J A;  5KXJ A;  3B5M A;  2VQF T;  1YQ3 A;  3VHL A;  1QUU A;  2FJA A;  3ZMT B;  5LYJ E;  4HGA A;  1UGO A;  2UXN B;  4XAX B;  5J2T E;  2XY8 B;  2FUP A;  2IHR 1;  2KLQ A;  4HFC A;  1MMA A;  3UU6 A;  1N36 T;  2W62 A;  4WW0 A;  2NWB A;  4QHO A;  5L3B B;  3TKL B;  2C5K T;  1MND A;  1S94 A;  3R6N A;  1HNZ T;  4NXN T;  1XZY A;  5AQI B;  1YW0 A;  1YXR A;  4BAY B;  4UV8 B;  2V5D A;  1E2A A;  3W15 B;  2AXD S;  4EB6 E;  4EIW A;  2BKN A;  1WYC A;  5C3J A;  3ZJ1 A;  5AQM B;  4DR4 T;  3LBX B;  1J5W A;  3AEA A;  4PFO A;  3E22 E;  2J1D G;  2ZM2 A;  4IDO A;  2XAS B;  3ZJ2 A;  4DUZ T;  2ZMA A;  3EUH A;  1XNQ T;  3EAB A;  2WSS V;  1ZEE A;  3RPU A;  1HG2 A;  4NIQ A;  4KBM B;  5KMG P;  4JBW F;  4HWH A;  2P9B A;  3UU8 A;  2BG9 B;  3O9X A;  4QXC B;  2H88 A;  2YDQ A;  3TLS A;  3Q5D A;  5FVL A;  4CN6 A;  3MJX A;  2XQ4 A;  3H3A A;  3JC6 C;  2XHE B;  4A56 A;  5HXH A;  4LMJ A;  3CQC B;  4CI3 B;  4LMK A;  3RLF F;  2VKH A;  2XSB A;  5LHG B;  2G0U A;  5FNV E;  4ILC A;  2X9X A;  2LSI A;  4LF5 T;  2K3W A;  4V1A v;  5IYZ E;  2OLT A;  3FBL A;  3PU8 A;  2PFV A;  3RX6 A;  3NZQ A;  2IC6 A;  2H7O A;  4ILA A;  2CXF A;  2QYW A;  3MAC A;  2VKO A;  2F4V T;  4CZZ B;  3IBP A;  4P1N A;  3RGL A;  1KNZ A;  4I4T E;  3C4W A;  2BG9 C;  5ABF A;  4WYV A;  2E5V A;  3FB2 A;  3N9P A;  4KP3 C;  3SRZ A;  3BQL A;  3VR8 A;  2HN1 A;  4TWD A;  2XPK A;  1HTJ F;  3QNU A;  4HWI B;  5EZY E;  3VU7 H;  2CEA A;  3ANW B;  3PUX F;  2WBL A;  3ZN0 B;  1HS7 A;  3N9O A;  4DUY T;  2FBW A;  1IJ6 A;  2UUA T;  2CPT A;  2WDR A;  1W9R A;  4PFP A;  3J7Y q;  1D0Y A;  2JPF A;  3ZMU B;  1FEW A;  4HWD A;  2KZ7 B;  4IE4 A;  3GA8 A;  4AQY T;  5LBQ B;  2KIN B;  4LML A;  5A1L A;  2M6I A;  1D1A A;  3P4Q A;  2E9X A;  5CA0 E;  3P8C D;  3HR0 A;  2YDS A;  4UVB B;  3ZST A;  4TNV A;  3AE5 A;  4B3R T;  4U33 A;  3VRB A;  3UU3 A;  4BJN A;  2FJE A; 
#chains in the Genus database with same CATH homology
 3QK6 A;  3AAA B;  4C90 A;  4ZS2 A;  2BDE A;  3HI2 A;  2CXD A;  4OK0 A;  2I59 A;  3T8O A;  2LE8 A;  4EZ4 A;  4KUM B;  3KDS E;  5HXS A;  1LKX A;  4UF0 A;  1LVF A;  2CWO A;  5E0O A;  5FXX A;  4UF0 B;  3RYC E;  2BZB A;  2XQY A;  5JR9 A;  1HF8 A;  1VOM A;  2ZLY A;  3ESL A;  5JR9 B;  3I0Q A;  4QWN B;  4Z8X A;  2PBI A;  3V5S A;  3A5X A;  3AB3 B;  1SHZ C;  2Y48 B;  4PK6 A;  2MBG A;  4N78 D;  4H9R C;  3O1H A;  2PG8 A;  2NW9 A;  3JC6 D;  2K24 A;  3UUM A;  3ZCJ A;  5LGT B;  3UTK A;  3HKC E;  4TV8 E;  3ZYM A;  4MLK A;  5FY0 A;  1QSD A;  5JH7 E;  3PE0 A;  2LHR A;  4MAL A;  2LT3 A;  4UEL A;  4UVC B;  4DMW A;  3ZLI A;  2N2N A;  3ZN1 B;  4DMV A;  2L9Q A;  2VAS A;  4ANJ A;  4ZI3 C;  1MIW A;  4HEA A;  4ZS3 A;  4JUY A;  2ZM0 A;  3SS1 A;  1FIO A;  3HL6 A;  4UXN B;  4GK0 E;  4XBF B;  2L8K A;  2XTL A;  3H37 A;  3K8P C;  1Z0P A;  3N9L A;  2IC9 A;  5EK2 A;  1U4Q A;  3LK4 2;  4IHJ E;  3MK7 C;  4XZC A;  4JEH B;  5FP3 A;  3UUX B;  3Q2M A;  4DVD A;  2CXL A;  2IW5 B;  2C5J A;  2V7J A;  3PUA A;  2CMR A;  3EVY A;  3B13 A;  3FXE B;  5H6R B;  2H3R A;  2A2F X;  5HXE A;  3IEE A;  1MIV A;  4O2B E;  4I50 E;  3CQG B;  4AKL A;  4TV9 E;  3O1J A;  3Q5X A;  4E7S A;  3KBT A;  4TN7 B;  3CX8 B;  2JQQ A;  4I55 E;  4IE7 A;  3L3P A;  2Q9Q A;  3K3O A;  1YKH B;  1O3X A;  4IGU A;  3RYH E;  4EYY R;  3OBV E;  2Q9Q B;  2KND A;  2HH7 A;  4ZOL E;  3IF8 B;  3U3I A;  3ZEF B;  3BQK A;  3QUJ A;  3B57 A;  2X67 A;  2NP9 A;  2DWG A;  5CB4 E;  4ADZ A;  2MYS A;  4EOZ B;  3Q5W A;  2MOZ A;  4UEM A;  3PUG A;  2V7M A;  3LG7 A;  4X1K E;  1U5P A;  4G63 A;  3J9X 1;  4JEU B;  1UX4 A;  4GYR A;  2EHO C;  3S4U A;  5L3E B;  1MIY A;  3BQI A;  4AKR B;  5LJN A;  4PW8 A;  3E0Z A;  3RC8 A;  3KFW X;  3C51 A;  2ZM8 A;  4X1Y E;  4PJM A;  4DBQ A;  5JR9 C;  5L3F B;  2X66 A;  3FXD B;  5L3C B;  2V7L A;  3VKH A;  5FY7 A;  4ZHQ E;  2W00 A;  3AA0 B;  2V7K A;  3NZP A;  3R84 B;  2IAK A;  5DQW A;  4EZH A;  4P0B A;  2X68 A;  3OYZ A;  2CA5 A;  4G2A A;  3ZYL A;  3IHR A;  1ZHC A;  4U74 A;  3N9Q A;  1NWM X;  2K5B B;  2CM0 A;  4PAG A;  1HCI A;  4QX7 B;  5DJQ C;  1D0Z A;  2Y6X A;  3CVR A;  4ZI7 E;  3F31 A;  4IDZ A;  2NW8 A;  2DLR A;  2YU2 A;  4H9N C;  1VRB A;  5HWX A;  3SOL A;  1EZ3 A;  4PNI A;  4QKN A;  2VL8 A;  2X9W A;  5BMV E;  4UVA B;  5HWY A;  2CE7 A;  2LM9 A;  1CUN A;  5LA6 E;  2VK9 A;  4PJL A;  5JDQ A;  3K3Q C;  1UCU A;  2WWU A;  3EDV A;  2V7I A;  4IIJ E;  4H9Q C;  4OFZ A;  4AKG A;  4EAH A;  1BR1 A;  2WAU A;  4GK5 E;  3AA1 B;  1Y64 B;  3NBX X;  2JMH A;  3Q9D A;  5LGN B;  4CXX A;  5L2L A;  2VKD A;  2QA7 A;  1G73 A;  1YD8 G;  4WNK A;  3WI3 A;  4P09 A;  2XAG B;  4PK5 A;  3KV6 A;  1WR6 A;  4YLH A;  3RRW A;  2XUE A;  4WBN E;  5FXV A;  1MMD A;  3CPZ A;  2ODU A;  2X9Y A;  1IJ5 A;  2CCQ A;  4P0A A;  3WAK A;  3KVA A;  1NAF A;  3N9N A;  2RP4 A;  4FJO A;  2DHR A;  2DNX A;  2BVM A;  2A72 A;  3AA6 B;  4H9S E;  4QXB B;  2W63 A;  4CI2 B;  3C64 A;  3NRX A;  5LBM A;  4UIG A;  3U78 A;  1IZN B;  2LOP A;  5F3J A;  3ZC0 A;  5JDN A;  3VHL A;  2CWY A;  5LCY A;  1QUU A;  3C4Z A;  4IE0 A;  3ZMT B;  3L09 A;  5LYJ E;  4HGA A;  3C50 A;  4L9I A;  3N2G E;  4U72 A;  2UXN B;  4XAX B;  5GON E;  5J2T E;  2LSJ A;  2JJ9 A;  4ILU A;  4OYJ A;  2K9A A;  3PUR A;  3PDY A;  1OWA A;  2KLQ A;  2KMF A;  4YFS A;  1MMA A;  2V26 A;  3AAE B;  1LRZ A;  2WMN A;  4QXH B;  1OXZ A;  4ZI3 D;  5J2U E;  2W62 A;  2V1D B;  3LK3 B;  4WW0 A;  5ETW A;  5LXT E;  1LVK A;  4H63 V;  2NWB A;  2E9X C;  4QHO A;  3GN5 A;  5L3B B;  2JMK A;  4IE5 A;  3TKL B;  3LK2 B;  4ASK A;  4BA9 A;  4X1I E;  3DJB A;  3GN5 B;  2D2S A;  4MHC A;  2C5K T;  5DQV A;  3N5L A;  4C91 A;  4L5G A;  1MND A;  2BVL A;  2LHN A;  1S94 A;  3I0O A;  1IAP A;  3R6N A;  4HN9 A;  4ZI2 C;  3RRC A;  4ERR A;  2UXX B;  4PK4 A;  3P7I A;  4AKI A;  1YW0 A;  4NUU A;  4BAY B;  1ZV4 X;  4H9P C;  4E7Z A;  4UV8 B;  2ODV A;  3WAJ A;  3I9Y A;  3ETU A;  3W15 B;  1D0X A;  4MBQ A;  2D5U A;  3AVS A;  3CKD A;  4O8S A;  4AI6 A;  4O4J E;  1G8X A;  1BR4 A;  1X79 A;  2CLY B;  4HKA A;  4EB6 E;  1FMV A;  4EIW A;  3CWZ B;  1WYC A;  3FBZ A;  3ZJ1 A;  3KV4 A;  3LBX B;  3RH3 A;  5JRE A;  2B1E A;  2XAJ B;  4PFO A;  3FHN A;  1MNE A;  2LOS A;  2RA1 A;  2MTQ A;  3E22 E;  4PJN A;  3DTO A;  2J1D G;  3O1I A;  2L3L A;  5DAB A;  1US7 B;  2N1G A;  2ZM2 A;  2XAS B;  5H6Q B;  3ZJ2 A;  1MMG A;  2ZMA A;  4L0R A;  2LSK A;  2LSY A;  3EUH A;  2JRK A;  3F57 A;  3AA7 B;  3HKB E;  3I1A A;  2X0L B;  3N2O A;  5IHY A;  2EHO D;  2HPJ A;  5HAX A;  4CXW A;  2D0T A;  5JQG E;  2WSS V;  5HYA A;  3ZMV B;  1ZEE A;  3RPU A;  2KT9 A;  3ZMZ B;  3OKQ A;  3E08 A;  3ZMS B;  4DND A;  1HG2 A;  5KMG P;  4KBM B;  1KK7 A;  4O4I E;  3GWH A;  2P9B A;  1S35 A;  5AFU L;  2GK9 A;  4TX5 A;  1D1C A;  2C5I T;  5FYM A;  4CQI A;  4NUV A;  4HE8 A;  3ZPO A;  2SPC A;  3O9X A;  2NTY A;  2DWK A;  4FI5 A;  3PUQ A;  2KXP B;  5L3G B;  1WRD A;  3AAI A;  4QXC B;  5JDL A;  4TUY E;  2NOX A;  5LJM A;  2NW7 A;  2DCF A;  3CX7 B;  5CA1 E;  3DP7 A;  4HFV A;  3N9M A;  2XAH B;  3KV9 A;  4EYU A;  5LGU B;  4GYS A;  1HG5 A;  5TAO A;  3UT5 E;  4M1P A;  3CML A;  1AJ3 A;  4UV9 B;  2WMO A;  5ADX L;  2LSG A;  4J2C A;  4WBO A;  4OYK A;  3MJX A;  1MMN A;  4KMC A;  2QGS A;  3N2K E;  2X51 A;  5LHI B;  4ISS A;  1SA0 E;  1V9D A;  1WYB A;  3H3A A;  3PTR B;  2VWA A;  2EHO A;  2Q9Q C;  4O2A E;  3UUN A;  2EHO B;  1FMW A;  2A3D A;  3JC6 C;  4GOU A;  2XHE B;  4A56 A;  5HXH A;  5KX5 E;  3OYX A;  5FMN A;  4AQF A;  5JDM A;  2YEV C;  2VB6 A;  3CQX C;  2KWH A;  3CQC B;  3V5U A;  2CLY C;  3VKG A;  4CI3 B;  4CXY A;  3ONX A;  2VKH A;  5LHG B;  2G0U A;  5FNV E;  3ZCI A;  4DO0 A;  2C0S A;  2K48 A;  5EK4 A;  2X9X A;  4F6R C;  2W0G A;  2LSI A;  3RYI E;  3RC3 A;  2Q9Q D;  1HFA A;  4JLE A;  3RKO A;  3NRY A;  2YK0 A;  1ZKE A;  4H63 H;  4AKH A;  4V1A v;  4B6X A;  5IYZ E;  3FBL A;  3PU8 A;  5JRC A;  5J1G A;  2PFV A;  5JRC B;  3I9W A;  3M65 A;  3RX6 A;  4AXP A;  2W61 A;  4MFR A;  4K0U A;  3UFE A;  3NZQ A;  3AVR A;  2HPL A;  3EDU A;  2IC6 A;  5FXZ A;  2H7O A;  5HXR A;  2E8I A;  2ES0 A;  3LFM A;  3KV5 A;  3ETV A;  2CXF A;  3D0T A;  3SWH A;  4GIW A;  3MAC A;  2VKO A;  5C8Y E;  3KVB A;  2Y8D A;  4CZZ B;  3IBP A;  1KNZ A;  4I4T E;  2ACX A;  3C4W A;  1WLX A;  3HA4 A;  5LG4 A;  2KWI B;  2NTX A;  5KDM C;  3ZC1 A;  4IE6 A;  2WM9 A;  4TZ4 C;  1E1H B;  3FB2 A;  5FY1 A;  5LOV E;  2M67 A;  3N9P A;  2DI4 A;  3KIN B;  3MXZ A;  5EK3 A;  2E9X D;  4KP3 C;  2YU1 A;  3QC9 A;  3C4X A;  3SRZ A;  3LJC A;  3LBX A;  1B7T A;  1H7C A;  2N9D A;  1BR2 A;  3PUS A;  3BQL A;  3O4X E;  1D1B A;  4ZI2 D;  5JDG A;  3MKD A;  1HTJ F;  3HKD E;  3MZK B;  3OJA A;  4AQG A;  2PJQ A;  3ANW A;  5EZY E;  3VU7 H;  2CEA A;  3ANW B;  3F2E A;  5JDF A;  1T98 A;  3K3N A;  4O4H E;  4I43 B;  4EXT A;  2WBL A;  3ZN0 B;  1HS7 A;  5JVD E;  3N9O A;  5HXC A;  1IJ6 A;  3CX6 B;  4AQF C;  5FXW A;  4OHF A;  4PFP A;  3RYF E;  3GMI A;  3J7Y q;  1D0Y A;  2JPF A;  3ZMU B;  1FEW A;  2H7V C;  2KZ7 B;  4IE4 A;  4YHJ A;  2LJL A;  3GA8 A;  5LBQ B;  2KIN B;  3HKE E;  1UX5 A;  3C98 B;  2D0U A;  5LHH B;  5JDH A;  3ZYK A;  3KBU A;  4BJM A;  5A1L A;  1BR0 A;  4YJ3 E;  4PJJ A;  1D1A A;  4H9O C;  4O4L E;  2OA5 A;  4YJ2 E;  2E9X A;  2LEH A;  5CA0 E;  4X20 E;  1HX8 A;  2XAF B;  3P8C D;  2E9X B;  5F8P A;  3HR0 A;  4IST A;  5LNK A;  4UVB B;  4QX8 B;  3BK9 A;  1YKE B;  5LP6 E;  2X9H A;  3PU3 A;  2VKJ A;  3MA9 A;  5M4Y A;  4CI1 B;  2Z6E A;  4DBR A;  4HTE A;  2YIN A;  5L3D B;  4BJN A;  2XAQ B;  3UUL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...