5LBMA

The asymmetric tetrameric structure of the formaldehyde sensing transcriptional repressor frmr from escherichia coli
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
83
structure length
83
Chain Sequence
KKVLTRVRRIRGQIDALERSLEGDAECRAILQQIAAVRGAANGLMAEVLESHIRETFDRNDCYSREVSQSVDDTIELVRAYLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The mechanism of a formaldehyde-sensing transcriptional regulator.
pubmed doi rcsb
source organism Escherichia coli o157:h7
molecule tags Transcription
molecule keywords Transcriptional repressor FrmR
total genus 33
structure length 83
sequence length 83
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02583 Trns_repr_metal Metal-sensitive transcriptional repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1000 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5lbmA00
5FMNA 4UIGA 4M1PA 4ADZA 3AAIA 5LCYA 2HH7A 5LBMA
chains in the Genus database with same CATH superfamily
5AQRB 5FYMA 2BG9A 2IMLA 2V6XA 4PNIA 4EAHA 5L3DB 4X1IE 4GK5E 2FJDA 2FUPA 4UVBB 2CXDA 2MTQA 2BG9E 3QUJA 4JI8T 4X64T 1KFYA 4X5TA 4GOUA 2CMRA 4O4JE 4BJNA 3ZJ1A 4UF0A 5L3GB 1S35A 2C5IT 3BQIA 3RGLA 3KINB 3OBVE 4AKIA 3N9LA 1HG5A 2HN1A 3VR9A 4JI3T 4ZEYA 3B5MA 2EHOB 2XQ7A 1KNRA 2ODVA 3IA3A 1HX8A 2CE7A 3MJXA 3AE3A 3WAJA 1LVFA 2CLYC 3C51A 2YEVC 2V8SV 2H3RA 2K9AA 4IE4A 4IE0A 4NXMT 2J4GA 1E2AA 3KV5A 3ZSSA 2C5KT 2LE8A 2ZMAA 4HFHA 5JDLA 3S4UA 1W0BA 4U7IA 2M67A 3C64A 5CA0E 4O4LE 4KHPT 1NAFA 2LM9A 1M7KA 2XQ8A 2LLYA 2ZM8A 4WNKA 3RLFF 2CBJA 4YTPA 3VKGA 4JI7T 5FP3A 4PJMA 5ABHA 3U3IA 4MFRA 5L3BB 4YLHA 1CUNA 4HFVA 3AE5A 4QWNB 2LOSA 3UU8A 2XJ7A 2W61A 4LF7T 2VKOA 5LG3A 5IUXA 2YU1A 3AEEA 5DQWA 2V6YB 4F6RC 1S94A 1T8BA 4YT0A 5IWAT 4EYYR 5HYAA 2AE9A 3R84B 3ETVA 2NOXA 3TLTA 3X1DA 2UXNB 1XDOA 4I4TE 3K3NA 4DV1T 2H7VC 2JPFA 1HNZT 4JI4T 4DV0T 3Q5XA 4ERRA 3PUXF 1I94T 1UX4A 3AB3B 5L3EB 2YN6A 1WCRA 3RQWA 3UT5E 4CI2B 2A9UA 1NWMX 1HS7A 2QYWA 3FZLB 3D0TA 4YHJA 1WRDA 4OHFA 4JEHB 3NZQA 1J5ET 4DV5T 3OPCA 1Y64B 3ZPOA 5FL1A 3ZN0B 1B7TA 2KLQA 4DVDA 4HKAA 3KV4A 4GIWA 5FNVE 2XAGB 3UTKA 2DCFA 1MMNA 2CHOA 3C98B 2MAWA 3CX6B 4UELA 4Z90A 4CXWA 4O4IE 3DTOA 5AQHB 5HCMA 4ZI3C 3Q5EA 2IHR1 2VQET 4H63H 5AQMB 4KBMB 2E8IA 4GKKT 2DI4A 2D5UA 4HWIB 1WYCA 4O2AE 5ETWA 4DR7T 2Z6EA 3Q2MA 1BR2A 4EGWA 3HKBE 3O4XE 2X67A 3PUYF 4IE7A 3RHWA 1HR0T 3E22E 3E0ZA 2JMHA 2WP9A 2Y6XA 1XWMA 1LVKA 1OWAA 2WCAA 3Q9DA 4GK0E 4IHJE 5LGUB 3NBXX 4K0UA 4TZ4C 5JRCA 5HXRA 1MMAA 2CM0A 2IIUA 2KT9A 2UXXB 2X0LB 3CKDA 2H7OA 3H3AA 1IJ5A 4M1PA 4PJNA 2XY8B 3WAKA 4DO0A 5JH7E 5L47A 2PTFA 4JI1T 3RYFE 4COFA 2V7JA 4DR2T 2EHOC 2WSSV 2D0UA 2H89A 1X79A 2XQAA 2JIWA 2W00A 3LSVA 2ZM6T 1XMOT 3MACA 1W0AA 3AE7A 3CX8B 1QUUA 1YKHB 2KNDA 2OA5A 2FJAA 5DQVA 3O1JA 4EZ4A 5HEJA 1N33T 3ZEFB 1HNXT 4EZHA 1ZOYA 4ADZA 3CK6A 4JI2T 3AEAA 3FXEB 2BBHA 3HL6A 2WMOA 2BG9B 3M65A 2BKOA 2J1DG 3RIUC 4E7ZA 2QVAA 4YXDA 2BS4A 2KWHA 2PG8A 1W9RA 2X68A 4Q25A 4JI5T 4CI3B 2UUBT 2RPAA 4GKJT 2JQKA 3C4ZA 2J47A 3GMIA 2WB5A 1EZ3A 3PJAJ 2I0MA 3AXJB 4C90A 4DV7T 3UUBA 3N9QA 3GN5A 5EK3A 2JQQA 4JYAT 5HEOA 4PK6A 3MZKB 4DV4T 2XPKA 4PJJA 2M6IA 4ZZCA 5KX5E 4ZI3D 2V26A 2A2FX 2CRBA 3AEBA 3N9PA 3RPUA 1N34T 3KVBA 1D1AA 3ANWB 1ZEEA 4LMLA 3JCFA 3PU3A 1IJ6A 4H9RC 4UIGA 1NEKA 1YD8G 2GK9A 3J9X1 4UF0B 5J2TE 3CQGB 3KVAA 2LSGA 3LK3B 4YTNA 4B3RT 5J1GA 5KDMC 2XAQB 5LXTE 5LGTB 1XNQT 1MMDA 2BKPA 2FBWA 2LSYA 2XSBA 4AQYT 3IF8B 5AQOB 4ZHQE 4LF8T 4ZS2A 4TNWA 5CA1E 4H9SE 4IDOA 1WFDA 2XQ6A 3ABVA 3A5XA 5JDQA 2B1EA 4DMVA 4B6XA 1N32T 2E9XB 3ONJA 5LNKA 4ANJA 1U5PA 5L4EA 4AXPA 2X0HA 2CLYB 2JJ9A 2MOZA 3EAMA 2E5LT 1UK5A 3T8OA 4IREA 3FBZA 2ACZA 2LKGA 2W63A 2XAHB 5TAOA 3PUVF 4ZZBA 4Z91A 2MPKA 3F57A 4UR9A 2DL1A 2N9DA 3ZN1B 4AI6A 4MALA 3NVOA 3MA9A 1Z0PA 3C4WA 3F31A 1IAPA 4KI0F 4TV9E 4UEMA 2UXDT 2W67A 3HR0A 3TLUA 2W2UA 4DNDA 5KXJA 3ZMUB 1LRZA 2D9DA 2E2AA 3K8PC 3PUAA 5FKYA 3GA8A 3KDSE 2WU5A 3SS1A 4BA9A 3U78A 2WS3A 5AQFB 5LP6E 2NTYA 3I1AA 4I50E 5BMVE 2X9YA 3AA0B 2XAJB 1ZHCA 2L3LA 4KMCA 5FXZA 4L0RA 4CZZB 4UXNB 2W62A 5GONE 3RC3A 1M62A 3ESLA 4TN7B 3SFDA 2VKHA 5FY1A 2R6GF 3EI0A 4TWDA 3RC8A 4BAYB 1FMWA 2LSIA 4G2AA 4UV9B 1HX1B 1MNEA 4IDQA 3RH3A 3P50A 2QRXA 2HH7A 2XQ3A 3JADA 3P4PA 3VRBA 3FBLA 3PURA 3NRXA 4N78D 3UU5A 3IBPA 3P4WA 4HFEA 3IHRA 3CWZB 1HF8A 2W66A 3KV6A 3UFEA 5JQGE 5JDFA 3RYCE 2Q9QA 4KUMB 5F3JA 2V7MA 3B57A 3UU6A 4ZI2C 3KBTA 3ZKRA 5LG4A 5LHHB 1HG2A 4JV5T 2HPJA 1HFAA 2PBIA 4IL4A 4E7SA 2NW7A 1LKXA 4QXHB 2IC9A 5HCJA 4EEBA 4EXTA 4C91A 4V1Av 3LK42 5L4HA 2WWVA 2BVMA 3NKZA 1U4QA 4FI5A 4OX9T 3MK7C 3G06A 3I0OA 5F8PA 5KMGP 1Y01A 4DR3T 2LHNA 2YU2A 3Q5WA 3P4QA 1QLBA 2YOEA 2G0UA 1FJGT 3DP7A 4HEAA 4OFZA 3N9OA 1L0VA 3PE0A 3LK2B 4U33A 3TLSA 2WZIA 3QB5A 2BKNA 4I0UA 4DV3T 3RRWA 3A8YC 2X9WA 5JDGA 1UUSA 3AEGA 2K48A 4X66T 1D0XA 4H9QC 1KK7A 3SOLA 1G73A 3I0QA 5EK2A 2LSJA 3O1IA 3BQLA 3AE9A 5JR9B 2XQYA 2CCQA 4I55E 2EHOD 2VVSA 5JDMA 2F4VT 4DR5T 1XDPA 5LJMA 4LF5T 4K0KT 2WWUA 4EEDA 2EHOA 1G8XA 1W09A 2A72A 1JNZA 2VVNA 2XSAA 2ZM0A 3EVYA 3N2KE 3RRCA 3E08A 5J2UE 3PUGA 1WYBA 3M3ZB 2NW8A 2WDVA 2WZHA 3K3OA 2ACXA 2MYSA 4KP3C 2BDEA 3PUZF 2KMFA 4Z8XA 2WDQA 5EK4A 3FZMB 3RI5A 5HAXA 3RQUA 2DWKA 4ZI2D 5HWXA 4IGUA 4EV6A 5AQKB 2NTXA 4AQFA 1MIWA 4IIJE 4H9NC 2C5JA 2XHEB 1CHUA 5LYJE 1E1HB 4ILBA 3NWIA 2W4XA 3CX7B 4HFDA 4NPPA 4TV8E 3QK6A 4NXNT 4DV6T 4B3MT 1FIOA 4LF6T 2LKHA 4IE6A 2YK0A 2V5DA 5JR9A 3JAEA 4NUUA 2CXFA 4U2YA 4UVAB 5HXCA 5LA6E 1I6ZA 3OYZA 4B3ST 4AKHA 1KNPA 3CVRA 4IDPA 5JR9C 2XQ4A 1OEDB 3AA6B 3CQCB 3LBXA 5HEUA 3QC9A 1YKEB 2LSKA 3AAAB 4EIWA 3O9XA 4DUYT 3RIUA 1IBMT 4AISA 4H9PC 4CXXA 3GWHA 3PDYA 4YTMA 4YSZA 1AJ3A 4YJ3E 2HPLA 3QB5K 3CQXC 3OJAA 3ZMTB 2Y48B 4ASKA 1T7SA 3EABA 3AVSA 3T1YT 3VU7H 5LOVE 4CQIA 2DLRA 2SPCA 3HA4A 3HKEE 4U31A 4HFIA 2CWOA 2VKDA 3ETUA 1MIYA 3RF1A 1N36T 4UVCB 5AQSB 3AE2A 3SRZA 2VB6A 1T98A 4PJLA 4CN6A 4QHOA 4U3CA 4HWHA 5IYZE 3ONLC 3PV0F 2VURA 3OKQA 4YSXA 4NIQA 4LF4T 2K3WA 3AECA 1D0ZA 4LMJA 2AXDS 3KFWX 1FEWA 3AVRA 4G63A 2Y8DA 4A97A 4AIUA 1XZYA 3HKDE 4CXYA 2KSRA 4A56A 4XZCA 3C50A 2BZBA 2L8KA 4LMKA 2XAFB 4J2CA 2VQFT 5LHGB 2N1GA 3CPZA 1ZP0A 2NW9A 2DHRA 3ZT7A 4QXCB 3VHLA 4AKRB 3FZHB 2KXPB 4ILUA 3L39A 2VK9A 3N2OA 3ZSTA 2XM2A 3LG7A 1KEYA 4WW0A 3RIAA 1IBKT 4IDZA 1GQEA 5FXXA 3IEEA 5JTGA 4AKGA 2BS2A 5C8YE 3ZC1A 4U2ZA 3PUSA 1QSDA 2ODUA 3ZJ2A 3JC6D 4PAGA 1YW0A 2BG9C 2IDOB 4QX8B 2PFVA 5FY0A 4WBOA 3ZT5A 2ZM2A 5AQQB 4A98A 3CMLA 5ABFA 1MIVA 2BVLA 1E7PA 2HN2A 2WM9A 2WBLA 4U72A 5AQGB 2WU2A 3AE4A 5HWYA 4ISTA 3TLVA 3EDUA 5LMNT 3QNUA 4OK0A 2K24A 1KF6A 1XMQT 1WLXA 5H6RB 5ABGA 4HWDA 5HXEA 2WY2A 4WZXA 2IAKA 5HEGA 5CGMA 4LF9T 1IBLT 4HTEA 3K3QC 3O1HA 4L9IA 4O8SA 4EB6E 1O3XA 3FB2A 2VWAA 5FMNA 5C2TA 4AQGA 4DBRA 3T1HT 2JMKA 1IZNB 3OTOT 1D0YA 2XTLA 3P8CD 3UULA 4CN1A 5ABEA 4CN4A 2LEHA 5DABA 2E9XD 4QKNA 4L5GA 2UXBT 1YXRA 3SWHA 5BR8T 4AKLA 3I9YA 3ZYMA 4DV2T 5ADXL 2CBIA 3ZLIA 1UCUA 2MBGA 3UUMA 5HXSA 1Z8UA 3UQ7A 5L2LA 2YDRA 1HTJF 3AA7B 4LFAT 2UU9T 2V7LA 4YJ2E 5A1LA 4ZXLA 2IC6A 2YDQA 3EHZA 3DJBA 2PJQA 2Q9QB 3ZYLA 4TX5A 3RYIE 3ZT6A 4AQFC 5J0ZA 4P0AA 2WDRA 3HKCE 3JC6C 2V7KA 4JLEA 2P9BA 5LGNB 2I6HA 3L09A 2Q9QC 4H9OC 4EOZB 4MHCA 2WMNA 3UUNA 2E9XA 4ILCA 4U7YA 3B13A 2BBJA 2E5VA 3L3PA 2B76A 5FY7A 5LJNA 1ZV4X 2LRKA 2W0GA 1X9BA 3FXDB 4B3TT 3CIRA 3FZFB 3RKGA 4MLKA 4BJMA 5AQNB 1FMVA 3ZC0A 2NWBA 3N5LA 4NUVA 4PK4A 3FZKB 3LDQB 1VCTA 4H63V 4PFOA 1SE7A 2V5CA 2XM1A 5FVKA 5FVLA 4DR4T 1ZKEA 2XQ9A 2CEAA 3H3MA 3N9NA 3C4XA 2UUAT 2KZ7B 2LT3A 4X65T 4DR6T 2X66A 4IT4A 1WR0A 3FHNA 5AQLB 2CWYA 3LFMA 4ZI7E 2I59A 3J7Yq 4ZOLE 2E9XC 2NP9A 2V1DB 3HI2A 1H7CA 4I43B 1BR0A 4HWCA 3AEDA 1VOMA 2WAUA 3UFGA 5LCYA 4YY3T 2JQ9A 4YSYA 4TWFA 1OEDC 2H88A 3BK9A 1YQ4A 5FXWA 3GN5B 1BR1A 2OLTA 4UV8B 4X1KE 5H6QB 3LJCA 4KHZF 3R6NA 1UGOA 1OEDA 1UURA 2ZLYA 3ONXA 5FL0A 2YINA 2LJLA 2JQHA 4X20E 4XAXB 3RYHE 3V5SA 2D2SA 3PTRB 3VR8A 4DIDB 4F8HA 2J62A 2RP4A 2QA7A 1KNZA 1OEDE 2FJEA 3L8RA 4JUYA 1DU2A 5JDHA 4HGAA 1J1JA 1VRBA 2Q9QD 3AE1A 3Q5DA 5AQTB 1V9DA 5HXHA 3AEFA 5AQVB 3PUWF 1HCIA 4IDNA 4DUZT 2LHRA 4QH1A 5ABFB 3TLWA 4KX6A 4PK5A 4LFCT 1XNRT 3SFEA 4JI0T 2WQYA 1JNRA 2CA5A 3AE8A 4O2BE 4HFBA 2N2NA 3UQ4A 3VKHA 3MXZA 4DBQA 4PFPA 1UX5A 4OYKA 1WR6A 1MMGA 2UXCT 5CB4E 4TUYE 2LRLA 3KV9A 3NRYA 5F5WA 3AAIA 4YFSA 3W15B 1MNDA 3ZCIA 2LM2A 4HN9A 2YKSA 2XUEA 5FXVA 2LOPA 1SHZC 3UU4A 3JAFA 1SA0E 2JRKA 3KBUA 4IE5A 2VKJA 2CXLA 3AAEB 4P1NA 4ISSA 2ES0A 4JEUB 4HWFA 3PU8A 3ZYKA 1SUMB 2VL8A 5L3FB 3AXJA 2BS3A 2X0YA 5AQIB 1US7B 2M6BA 3P4SA 4X1YE 2OV9A 5EZYE 4ILAA 5AFUL 5CFBA 5M4YA 1D1CA 5HEHA 3BQKA 3P7IA 3ZCJA 2IW5B 2XZEA 5AQJB 3I9WA 4YHHT 4P0BA 4XBFB 4FJOA 5CJ5A 4HE8A 3RKOA 4EYUA 3A7MA 5LB7B 4WBNE 3PUQA 5L3CB 3EUHA 4A5XA 1HNWT 3UUXB 4U74A 4JI6T 4JBWF 2NR4A 2RA1A 3RX6A 4DR1T 2VASA 3AE6A 1OXZA 4O4HE 3N9MA 4DMWA 3MKDA 5LBMA 1YQ3A 3H37A 3K1SA 3QOFA 2X51A 3ZMSB 5JVDE 5LBQB 2X9HA 4GYRA 2FJBA 4QXBB 4TWHA 2CPTA 2UUCT 4CI1B 2K5BB 4WYVA 2DWGA 5C3JA 5JDNA 3ANWA 3EDVA 5LHIB 2QGSA 3F2EA 2V7IA 4TNVA 2V6YA 3V5UA 5DJQC 4ZS3A 2C0SA 2IUBA 2KINB 2YDSA 3OYXA 4QH5A 3PJAA 3P4RA 3WI3A 4LFBT 2XQ5A 5JRCB 3ZMVB 1NENA 5AQUB 3OVUA 4PW8A 5IHYA 3AA1B 1J5WA 2VL0A 2A3DA 2CHNA 2DNXA 1VCSA 3LBXB 4QH4A 3RIFA 3N2GE 4MBQA 2X9XA 4OYJA 5JREA 3VRAA 1BR4A 1T72A 5AQPB 5LMUT 2L9QA 3TKLB 2KWIB 4IL9A 3NZPA 2HHHT 3ZMZB 4X62T 2XASB 2D0TA 5E0OA 4GYSA 1R8IA 3UU3A 1D1BA 4HFCA 4QX7B 4P09A
chains in the Genus database with same CATH topology
5FYMA 5L3DB 4PNIA 4EAHA 4X1IE 4GK5E 4UVBB 2CXDA 2MTQA 3QUJA 4GOUA 2CMRA 4O4JE 4BJNA 3ZJ1A 4UF0A 5L3GB 1S35A 2C5IT 3BQIA 3KINB 3OBVE 4AKIA 3N9LA 1HG5A 2EHOB 2ODVA 1HX8A 2CE7A 3MJXA 1LVFA 2CLYC 3C51A 2YEVC 2H3RA 2K9AA 4IE4A 4IE0A 5JDLA 3KV5A 2C5KT 2LE8A 2ZMAA 3S4UA 2M67A 3C64A 5CA0E 4O4LE 1NAFA 2LM9A 2ZM8A 4WNKA 3VKGA 5FP3A 4PJMA 3U3IA 4MFRA 5L3BB 4YLHA 1CUNA 4HFVA 4QWNB 2LOSA 2W61A 2VKOA 2YU1A 5DQWA 4F6RC 1S94A 4EYYR 5HYAA 3R84B 3ETVA 2NOXA 2UXNB 4I4TE 3K3NA 2H7VC 2JPFA 3Q5XA 4ERRA 1UX4A 3AB3B 5L3EB 3UT5E 4CI2B 1NWMX 1HS7A 3D0TA 4YHJA 1WRDA 4OHFA 4JEHB 3NZQA 3ZPOA 1Y64B 3ZN0B 1B7TA 2KLQA 4DVDA 4HKAA 3KV4A 4GIWA 5FNVE 2XAGB 3UTKA 2DCFA 1MMNA 3C98B 3CX6B 4UELA 4CXWA 4O4IE 3DTOA 4ZI3C 4H63H 4KBMB 2E8IA 2DI4A 2D5UA 1WYCA 4O2AE 5ETWA 2Z6EA 3Q2MA 1BR2A 3HKBE 3O4XE 2X67A 4IE7A 3E22E 3E0ZA 2JMHA 2Y6XA 3Q9DA 4GK0E 1LVKA 1OWAA 4IHJE 3RKOA 5LGUB 5JRCA 3NBXX 4K0UA 4TZ4C 5HXRA 1MMAA 2CM0A 2KT9A 2UXXB 2X0LB 3CKDA 4M1PA 2H7OA 3H3AA 1IJ5A 4PJNA 4DO0A 3WAKA 5JH7E 3RYFE 2V7JA 2EHOC 2WSSV 2D0UA 1X79A 2W00A 3MACA 3CX8B 1QUUA 1YKHB 2KNDA 2OA5A 5DQVA 3O1JA 4EZ4A 3ZEFB 4EZHA 4ADZA 3FXEB 3HL6A 3M65A 2WMOA 4E7ZA 5EK2A 2J1DG 2KWHA 2PG8A 2X68A 4CI3B 3C4ZA 3GMIA 4C90A 1EZ3A 3N9QA 3GN5A 5EK3A 2JQQA 4PK6A 3MZKB 4PJJA 5KX5E 4ZI3D 2V26A 2A2FX 3N9PA 3RPUA 3KVBA 1D1AA 3ANWB 1ZEEA 3PU3A 1IJ6A 4H9RC 4UIGA 1YD8G 2GK9A 3J9X1 4UF0B 5J2TE 3CQGB 3KVAA 2LSGA 3LK3B 5J1GA 2XAQB 5LXTE 5LGTB 1MMDA 2LSYA 3IF8B 4ZHQE 4ZS2A 5CA1E 4H9SE 3A5XA 5JDQA 2B1EA 4DMVA 4B6XA 2E9XB 5LNKA 4ANJA 1U5PA 4AXPA 2CLYB 2JJ9A 2MOZA 3T8OA 3FBZA 2W63A 2XAHB 5TAOA 3F57A 2N9DA 3ZN1B 4AI6A 4MALA 3MA9A 1Z0PA 3C4WA 3F31A 1IAPA 4TV9E 4UEMA 4DNDA 3HR0A 3ZMUB 1LRZA 3PUAA 3K8PC 5LP6E 3GA8A 3KDSE 3SS1A 4BA9A 3U78A 2NTYA 3I1AA 4I50E 5BMVE 2X9YA 3AA0B 2XAJB 1ZHCA 2L3LA 4KMCA 5FXZA 4L0RA 4CZZB 4UXNB 2W62A 5GONE 3RC3A 4TN7B 3ESLA 2VKHA 5FY1A 3RC8A 4BAYB 1FMWA 2LSIA 4G2AA 4UV9B 3RH3A 1MNEA 3WAJA 2HH7A 3FBLA 3PURA 3NRXA 4N78D 3IBPA 3IHRA 3CWZB 1HF8A 3KV6A 3UFEA 5JQGE 5JDFA 3RYCE 2Q9QA 4KUMB 5F3JA 3B57A 2V7MA 4ZI2C 5LG4A 3KBTA 5LHHB 1HG2A 2HPJA 1HFAA 2PBIA 4E7SA 2NW7A 1LKXA 4QXHB 2IC9A 4EXTA 4C91A 4V1Av 3LK42 2BVMA 4FI5A 1U4QA 3MK7C 3I0OA 5F8PA 5KMGP 2LHNA 2YU2A 3Q5WA 2G0UA 3DP7A 4HEAA 4OFZA 3N9OA 3PE0A 3LK2B 3RRWA 5JDGA 2X9WA 2K48A 1D0XA 4H9QC 1KK7A 3SOLA 1G73A 3I0QA 2LSJA 3O1IA 3BQLA 5JR9B 2XQYA 2CCQA 4I55E 2EHOD 5JDMA 5LJMA 2WWUA 2EHOA 1G8XA 3N2KE 2A72A 3RRCA 5KDMC 2ZM0A 3EVYA 3E08A 3PUGA 1WYBA 4KP3C 2NW8A 3K3OA 2ACXA 2MYSA 2BDEA 2KMFA 4Z8XA 5EK4A 5HAXA 5HWXA 2DWKA 4ZI2D 4IGUA 4AQFA 2NTXA 1MIWA 4IIJE 4H9NC 2C5JA 2XHEB 5LYJE 1E1HB 3CX7B 4TV8E 3QK6A 1FIOA 4IE6A 2YK0A 5JR9A 4NUUA 2CXFA 4UVAB 5HXCA 5LA6E 3OYZA 4AKHA 3CVRA 5JR9C 3CQCB 3AA6B 3LBXA 5J2UE 4EIWA 3QC9A 1YKEB 2LSKA 3AAAB 3O9XA 4H9PC 4CXXA 3GWHA 3PDYA 1AJ3A 4YJ3E 2HPLA 3CQXC 3OJAA 3ZMTB 2Y48B 3AVSA 3VU7H 5LOVE 4CQIA 2DLRA 2SPCA 3HA4A 3HKEE 2CWOA 2VKDA 3ETUA 1MIYA 4UVCB 3SRZA 2VB6A 1T98A 4PJLA 4QHOA 5IYZE 3OKQA 1D0ZA 3KFWX 4G63A 1FEWA 3AVRA 2Y8DA 4CXYA 3HKDE 4A56A 4XZCA 3C50A 2BZBA 2L8KA 2XAFB 4J2CA 5LHGB 2N1GA 3CPZA 2NW9A 2DHRA 4QXCB 3VHLA 4AKRB 2KXPB 4ILUA 2VK9A 3N2OA 3LG7A 4WW0A 4IDZA 5FXXA 4AKGA 3IEEA 5C8YE 3ZC1A 3PUSA 1QSDA 2ODUA 3ZJ2A 3JC6D 4PAGA 1YW0A 4QX8B 2PFVA 5FY0A 4WBOA 2ZM2A 3CMLA 1MIVA 2BVLA 2WM9A 2WBLA 4U72A 5HWYA 4ISTA 3EDUA 4OK0A 2K24A 1WLXA 5H6RB 5HXEA 2IAKA 4HTEA 3K3QC 3O1HA 4L9IA 4O8SA 4EB6E 1O3XA 3FB2A 2VWAA 5FMNA 4AQGA 4DBRA 2JMKA 1IZNB 1D0YA 2XTLA 3P8CD 3UULA 2LEHA 5DABA 2E9XD 4QKNA 4L5GA 3SWHA 4AKLA 3I9YA 3ZYMA 5ADXL 3ZLIA 1UCUA 2MBGA 3UUMA 5HXSA 5L2LA 1HTJF 3AA7B 2V7LA 4YJ2E 5A1LA 2IC6A 3DJBA 2PJQA 2Q9QB 3ZYLA 4TX5A 3RYIE 4AQFC 4P0AA 3HKCE 3JC6C 2V7KA 4JLEA 2P9BA 5LGNB 3L09A 2Q9QC 4H9OC 4EOZB 4MHCA 2WMNA 3UUNA 2E9XA 3B13A 3L3PA 5FY7A 5LJNA 1ZV4X 2W0GA 3FXDB 4MLKA 4BJMA 1FMVA 3ZC0A 2NWBA 3N5LA 4NUVA 4PK4A 4PFOA 4H63V 1ZKEA 2CEAA 3N9NA 3C4XA 2KZ7B 2LT3A 2X66A 3FHNA 2CWYA 3LFMA 4ZI7E 2I59A 3J7Yq 4ZOLE 2E9XC 2NP9A 2V1DB 3HI2A 1H7CA 4I43B 1BR0A 1VOMA 2WAUA 5LCYA 3BK9A 5FXWA 5JREA 3GN5B 1BR1A 4UV8B 5H6QB 4X1KE 4ASKA 3LJCA 3R6NA 2ZLYA 3ONXA 2YINA 2LJLA 3V5SA 4X20E 4XAXB 3RYHE 2D2SA 3PTRB 2RP4A 2QA7A 1KNZA 4JUYA 5JDHA 4HGAA 1VRBA 2Q9QD 1V9DA 5HXHA 1HCIA 2LHRA 4PK5A 2CA5A 4O2BE 2N2NA 3VKHA 3MXZA 4DBQA 4PFPA 1UX5A 4OYKA 1WR6A 1MMGA 5CB4E 4TUYE 3KV9A 3NRYA 3AAIA 4YFSA 3W15B 1MNDA 3ZCIA 4HN9A 2XUEA 5FXVA 2LOPA 1SHZC 1SA0E 2JRKA 3KBUA 4IE5A 3AAEB 2CXLA 2VKJA 4ISSA 2ES0A 4JEUB 3PU8A 3ZYKA 2VL8A 5L3FB 1US7B 4X1YE 5EZYE 5AFUL 5M4YA 1D1CA 3BQKA 3P7IA 3ZCJA 2IW5B 4XBFB 3I9WA 4P0BA 4FJOA 4HE8A 4EYUA 4WBNE 3PUQA 5L3CB 3EUHA 3UUXB 4U74A 2RA1A 3RX6A 2VASA 4O4HE 1OXZA 3N9MA 4DMWA 3MKDA 5LBMA 3H37A 3ZMSB 2X51A 5JVDE 5LBQB 2X9HA 4GYRA 4QXBB 4CI1B 2K5BB 2DWGA 5JDNA 5LHIB 3ANWA 3EDVA 2QGSA 3F2EA 2V7IA 3V5UA 5DJQC 4ZS3A 2C0SA 2KINB 3OYXA 3WI3A 5JRCB 3ZMVB 5IHYA 4PW8A 3AA1B 2A3DA 2DNXA 3LBXB 3N2GE 4MBQA 2X9XA 4OYJA 1BR4A 2L9QA 3TKLB 2KWIB 3NZPA 3ZMZB 2XASB 2D0TA 5E0OA 4GYSA 1D1BA 4QX7B 4P09A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FMN A;  4UIG A;  4M1P A;  4ADZ A;  3AAI A;  5LCY A;  2HH7 A;  5LBM A; 
#chains in the Genus database with same CATH topology
 5AQR B;  5FYM A;  2BG9 A;  2IML A;  2V6X A;  4PNI A;  4EAH A;  5L3D B;  4X1I E;  4GK5 E;  2FJD A;  2FUP A;  4UVB B;  2CXD A;  2MTQ A;  2BG9 E;  3QUJ A;  4JI8 T;  4X64 T;  1KFY A;  4X5T A;  4GOU A;  2CMR A;  4O4J E;  4BJN A;  3ZJ1 A;  4UF0 A;  5L3G B;  1S35 A;  2C5I T;  3BQI A;  3RGL A;  3KIN B;  3OBV E;  4AKI A;  3N9L A;  1HG5 A;  2HN1 A;  3VR9 A;  4JI3 T;  4ZEY A;  3B5M A;  2EHO B;  2XQ7 A;  1KNR A;  2ODV A;  3IA3 A;  1HX8 A;  2CE7 A;  3MJX A;  3AE3 A;  3WAJ A;  1LVF A;  2CLY C;  3C51 A;  2YEV C;  2V8S V;  2H3R A;  2K9A A;  4IE4 A;  4IE0 A;  4NXM T;  2J4G A;  1E2A A;  3KV5 A;  3ZSS A;  2C5K T;  2LE8 A;  2ZMA A;  4HFH A;  5JDL A;  3S4U A;  1W0B A;  4U7I A;  2M67 A;  3C64 A;  5CA0 E;  4O4L E;  4KHP T;  1NAF A;  2LM9 A;  1M7K A;  2XQ8 A;  2LLY A;  2ZM8 A;  4WNK A;  3RLF F;  2CBJ A;  4YTP A;  3VKG A;  4JI7 T;  5FP3 A;  4PJM A;  5ABH A;  3U3I A;  4MFR A;  5L3B B;  4YLH A;  1CUN A;  4HFV A;  3AE5 A;  4QWN B;  2LOS A;  3UU8 A;  2XJ7 A;  2W61 A;  4LF7 T;  2VKO A;  5LG3 A;  5IUX A;  2YU1 A;  3AEE A;  5DQW A;  2V6Y B;  4F6R C;  1S94 A;  1T8B A;  4YT0 A;  5IWA T;  4EYY R;  5HYA A;  2AE9 A;  3R84 B;  3ETV A;  2NOX A;  3TLT A;  3X1D A;  2UXN B;  1XDO A;  4I4T E;  3K3N A;  4DV1 T;  2H7V C;  2JPF A;  1HNZ T;  4JI4 T;  4DV0 T;  3Q5X A;  4ERR A;  3PUX F;  1I94 T;  1UX4 A;  3AB3 B;  5L3E B;  2YN6 A;  1WCR A;  3RQW A;  3UT5 E;  4CI2 B;  2A9U A;  1NWM X;  1HS7 A;  2QYW A;  3FZL B;  3D0T A;  4YHJ A;  1WRD A;  4OHF A;  4JEH B;  3NZQ A;  1J5E T;  4DV5 T;  3OPC A;  1Y64 B;  3ZPO A;  5FL1 A;  3ZN0 B;  1B7T A;  2KLQ A;  4DVD A;  4HKA A;  3KV4 A;  4GIW A;  5FNV E;  2XAG B;  3UTK A;  2DCF A;  1MMN A;  2CHO A;  3C98 B;  2MAW A;  3CX6 B;  4UEL A;  4Z90 A;  4CXW A;  4O4I E;  3DTO A;  5AQH B;  5HCM A;  4ZI3 C;  3Q5E A;  2IHR 1;  2VQE T;  4H63 H;  5AQM B;  4KBM B;  2E8I A;  4GKK T;  2DI4 A;  2D5U A;  4HWI B;  1WYC A;  4O2A E;  5ETW A;  4DR7 T;  2Z6E A;  3Q2M A;  1BR2 A;  4EGW A;  3HKB E;  3O4X E;  2X67 A;  3PUY F;  4IE7 A;  3RHW A;  1HR0 T;  3E22 E;  3E0Z A;  2JMH A;  2WP9 A;  2Y6X A;  1XWM A;  1LVK A;  1OWA A;  2WCA A;  3Q9D A;  4GK0 E;  4IHJ E;  5LGU B;  3NBX X;  4K0U A;  4TZ4 C;  5JRC A;  5HXR A;  1MMA A;  2CM0 A;  2IIU A;  2KT9 A;  2UXX B;  2X0L B;  3CKD A;  2H7O A;  3H3A A;  1IJ5 A;  4M1P A;  4PJN A;  2XY8 B;  3WAK A;  4DO0 A;  5JH7 E;  5L47 A;  2PTF A;  4JI1 T;  3RYF E;  4COF A;  2V7J A;  4DR2 T;  2EHO C;  2WSS V;  2D0U A;  2H89 A;  1X79 A;  2XQA A;  2JIW A;  2W00 A;  3LSV A;  2ZM6 T;  1XMO T;  3MAC A;  1W0A A;  3AE7 A;  3CX8 B;  1QUU A;  1YKH B;  2KND A;  2OA5 A;  2FJA A;  5DQV A;  3O1J A;  4EZ4 A;  5HEJ A;  1N33 T;  3ZEF B;  1HNX T;  4EZH A;  1ZOY A;  4ADZ A;  3CK6 A;  4JI2 T;  3AEA A;  3FXE B;  2BBH A;  3HL6 A;  2WMO A;  2BG9 B;  3M65 A;  2BKO A;  2J1D G;  3RIU C;  4E7Z A;  2QVA A;  4YXD A;  2BS4 A;  2KWH A;  2PG8 A;  1W9R A;  2X68 A;  4Q25 A;  4JI5 T;  4CI3 B;  2UUB T;  2RPA A;  4GKJ T;  2JQK A;  3C4Z A;  2J47 A;  3GMI A;  2WB5 A;  1EZ3 A;  3PJA J;  2I0M A;  3AXJ B;  4C90 A;  4DV7 T;  3UUB A;  3N9Q A;  3GN5 A;  5EK3 A;  2JQQ A;  4JYA T;  5HEO A;  4PK6 A;  3MZK B;  4DV4 T;  2XPK A;  4PJJ A;  2M6I A;  4ZZC A;  5KX5 E;  4ZI3 D;  2V26 A;  2A2F X;  2CRB A;  3AEB A;  3N9P A;  3RPU A;  1N34 T;  3KVB A;  1D1A A;  3ANW B;  1ZEE A;  4LML A;  3JCF A;  3PU3 A;  1IJ6 A;  4H9R C;  4UIG A;  1NEK A;  1YD8 G;  2GK9 A;  3J9X 1;  4UF0 B;  5J2T E;  3CQG B;  3KVA A;  2LSG A;  3LK3 B;  4YTN A;  4B3R T;  5J1G A;  5KDM C;  2XAQ B;  5LXT E;  5LGT B;  1XNQ T;  1MMD A;  2BKP A;  2FBW A;  2LSY A;  2XSB A;  4AQY T;  3IF8 B;  5AQO B;  4ZHQ E;  4LF8 T;  4ZS2 A;  4TNW A;  5CA1 E;  4H9S E;  4IDO A;  1WFD A;  2XQ6 A;  3ABV A;  3A5X A;  5JDQ A;  2B1E A;  4DMV A;  4B6X A;  1N32 T;  2E9X B;  3ONJ A;  5LNK A;  4ANJ A;  1U5P A;  5L4E A;  4AXP A;  2X0H A;  2CLY B;  2JJ9 A;  2MOZ A;  3EAM A;  2E5L T;  1UK5 A;  3T8O A;  4IRE A;  3FBZ A;  2ACZ A;  2LKG A;  2W63 A;  2XAH B;  5TAO A;  3PUV F;  4ZZB A;  4Z91 A;  2MPK A;  3F57 A;  4UR9 A;  2DL1 A;  2N9D A;  3ZN1 B;  4AI6 A;  4MAL A;  3NVO A;  3MA9 A;  1Z0P A;  3C4W A;  3F31 A;  1IAP A;  4KI0 F;  4TV9 E;  4UEM A;  2UXD T;  2W67 A;  3HR0 A;  3TLU A;  2W2U A;  4DND A;  5KXJ A;  3ZMU B;  1LRZ A;  2D9D A;  2E2A A;  3K8P C;  3PUA A;  5FKY A;  3GA8 A;  3KDS E;  2WU5 A;  3SS1 A;  4BA9 A;  3U78 A;  2WS3 A;  5AQF B;  5LP6 E;  2NTY A;  3I1A A;  4I50 E;  5BMV E;  2X9Y A;  3AA0 B;  2XAJ B;  1ZHC A;  2L3L A;  4KMC A;  5FXZ A;  4L0R A;  4CZZ B;  4UXN B;  2W62 A;  5GON E;  3RC3 A;  1M62 A;  3ESL A;  4TN7 B;  3SFD A;  2VKH A;  5FY1 A;  2R6G F;  3EI0 A;  4TWD A;  3RC8 A;  4BAY B;  1FMW A;  2LSI A;  4G2A A;  4UV9 B;  1HX1 B;  1MNE A;  4IDQ A;  3RH3 A;  3P50 A;  2QRX A;  2HH7 A;  2XQ3 A;  3JAD A;  3P4P A;  3VRB A;  3FBL A;  3PUR A;  3NRX A;  4N78 D;  3UU5 A;  3IBP A;  3P4W A;  4HFE A;  3IHR A;  3CWZ B;  1HF8 A;  2W66 A;  3KV6 A;  3UFE A;  5JQG E;  5JDF A;  3RYC E;  2Q9Q A;  4KUM B;  5F3J A;  2V7M A;  3B57 A;  3UU6 A;  4ZI2 C;  3KBT A;  3ZKR A;  5LG4 A;  5LHH B;  1HG2 A;  4JV5 T;  2HPJ A;  1HFA A;  2PBI A;  4IL4 A;  4E7S A;  2NW7 A;  1LKX A;  4QXH B;  2IC9 A;  5HCJ A;  4EEB A;  4EXT A;  4C91 A;  4V1A v;  3LK4 2;  5L4H A;  2WWV A;  2BVM A;  3NKZ A;  1U4Q A;  4FI5 A;  4OX9 T;  3MK7 C;  3G06 A;  3I0O A;  5F8P A;  5KMG P;  1Y01 A;  4DR3 T;  2LHN A;  2YU2 A;  3Q5W A;  3P4Q A;  1QLB A;  2YOE A;  2G0U A;  1FJG T;  3DP7 A;  4HEA A;  4OFZ A;  3N9O A;  1L0V A;  3PE0 A;  3LK2 B;  4U33 A;  3TLS A;  2WZI A;  3QB5 A;  2BKN A;  4I0U A;  4DV3 T;  3RRW A;  3A8Y C;  2X9W A;  5JDG A;  1UUS A;  3AEG A;  2K48 A;  4X66 T;  1D0X A;  4H9Q C;  1KK7 A;  3SOL A;  1G73 A;  3I0Q A;  5EK2 A;  2LSJ A;  3O1I A;  3BQL A;  3AE9 A;  5JR9 B;  2XQY A;  2CCQ A;  4I55 E;  2EHO D;  2VVS A;  5JDM A;  2F4V T;  4DR5 T;  1XDP A;  5LJM A;  4LF5 T;  4K0K T;  2WWU A;  4EED A;  2EHO A;  1G8X A;  1W09 A;  2A72 A;  1JNZ A;  2VVN A;  2XSA A;  2ZM0 A;  3EVY A;  3N2K E;  3RRC A;  3E08 A;  5J2U E;  3PUG A;  1WYB A;  3M3Z B;  2NW8 A;  2WDV A;  2WZH A;  3K3O A;  2ACX A;  2MYS A;  4KP3 C;  2BDE A;  3PUZ F;  2KMF A;  4Z8X A;  2WDQ A;  5EK4 A;  3FZM B;  3RI5 A;  5HAX A;  3RQU A;  2DWK A;  4ZI2 D;  5HWX A;  4IGU A;  4EV6 A;  5AQK B;  2NTX A;  4AQF A;  1MIW A;  4IIJ E;  4H9N C;  2C5J A;  2XHE B;  1CHU A;  5LYJ E;  1E1H B;  4ILB A;  3NWI A;  2W4X A;  3CX7 B;  4HFD A;  4NPP A;  4TV8 E;  3QK6 A;  4NXN T;  4DV6 T;  4B3M T;  1FIO A;  4LF6 T;  2LKH A;  4IE6 A;  2YK0 A;  2V5D A;  5JR9 A;  3JAE A;  4NUU A;  2CXF A;  4U2Y A;  4UVA B;  5HXC A;  5LA6 E;  1I6Z A;  3OYZ A;  4B3S T;  4AKH A;  1KNP A;  3CVR A;  4IDP A;  5JR9 C;  2XQ4 A;  1OED B;  3AA6 B;  3CQC B;  3LBX A;  5HEU A;  3QC9 A;  1YKE B;  2LSK A;  3AAA B;  4EIW A;  3O9X A;  4DUY T;  3RIU A;  1IBM T;  4AIS A;  4H9P C;  4CXX A;  3GWH A;  3PDY A;  4YTM A;  4YSZ A;  1AJ3 A;  4YJ3 E;  2HPL A;  3QB5 K;  3CQX C;  3OJA A;  3ZMT B;  2Y48 B;  4ASK A;  1T7S A;  3EAB A;  3AVS A;  3T1Y T;  3VU7 H;  5LOV E;  4CQI A;  2DLR A;  2SPC A;  3HA4 A;  3HKE E;  4U31 A;  4HFI A;  2CWO A;  2VKD A;  3ETU A;  1MIY A;  3RF1 A;  1N36 T;  4UVC B;  5AQS B;  3AE2 A;  3SRZ A;  2VB6 A;  1T98 A;  4PJL A;  4CN6 A;  4QHO A;  4U3C A;  4HWH A;  5IYZ E;  3ONL C;  3PV0 F;  2VUR A;  3OKQ A;  4YSX A;  4NIQ A;  4LF4 T;  2K3W A;  3AEC A;  1D0Z A;  4LMJ A;  2AXD S;  3KFW X;  1FEW A;  3AVR A;  4G63 A;  2Y8D A;  4A97 A;  4AIU A;  1XZY A;  3HKD E;  4CXY A;  2KSR A;  4A56 A;  4XZC A;  3C50 A;  2BZB A;  2L8K A;  4LMK A;  2XAF B;  4J2C A;  2VQF T;  5LHG B;  2N1G A;  3CPZ A;  1ZP0 A;  2NW9 A;  2DHR A;  3ZT7 A;  4QXC B;  3VHL A;  4AKR B;  3FZH B;  2KXP B;  4ILU A;  3L39 A;  2VK9 A;  3N2O A;  3ZST A;  2XM2 A;  3LG7 A;  1KEY A;  4WW0 A;  3RIA A;  1IBK T;  4IDZ A;  1GQE A;  5FXX A;  3IEE A;  5JTG A;  4AKG A;  2BS2 A;  5C8Y E;  3ZC1 A;  4U2Z A;  3PUS A;  1QSD A;  2ODU A;  3ZJ2 A;  3JC6 D;  4PAG A;  1YW0 A;  2BG9 C;  2IDO B;  4QX8 B;  2PFV A;  5FY0 A;  4WBO A;  3ZT5 A;  2ZM2 A;  5AQQ B;  4A98 A;  3CML A;  5ABF A;  1MIV A;  2BVL A;  1E7P A;  2HN2 A;  2WM9 A;  2WBL A;  4U72 A;  5AQG B;  2WU2 A;  3AE4 A;  5HWY A;  4IST A;  3TLV A;  3EDU A;  5LMN T;  3QNU A;  4OK0 A;  2K24 A;  1KF6 A;  1XMQ T;  1WLX A;  5H6R B;  5ABG A;  4HWD A;  5HXE A;  2WY2 A;  4WZX A;  2IAK A;  5HEG A;  5CGM A;  4LF9 T;  1IBL T;  4HTE A;  3K3Q C;  3O1H A;  4L9I A;  4O8S A;  4EB6 E;  1O3X A;  3FB2 A;  2VWA A;  5FMN A;  5C2T A;  4AQG A;  4DBR A;  3T1H T;  2JMK A;  1IZN B;  3OTO T;  1D0Y A;  2XTL A;  3P8C D;  3UUL A;  4CN1 A;  5ABE A;  4CN4 A;  2LEH A;  5DAB A;  2E9X D;  4QKN A;  4L5G A;  2UXB T;  1YXR A;  3SWH A;  5BR8 T;  4AKL A;  3I9Y A;  3ZYM A;  4DV2 T;  5ADX L;  2CBI A;  3ZLI A;  1UCU A;  2MBG A;  3UUM A;  5HXS A;  1Z8U A;  3UQ7 A;  5L2L A;  2YDR A;  1HTJ F;  3AA7 B;  4LFA T;  2UU9 T;  2V7L A;  4YJ2 E;  5A1L A;  4ZXL A;  2IC6 A;  2YDQ A;  3EHZ A;  3DJB A;  2PJQ A;  2Q9Q B;  3ZYL A;  4TX5 A;  3RYI E;  3ZT6 A;  4AQF C;  5J0Z A;  4P0A A;  2WDR A;  3HKC E;  3JC6 C;  2V7K A;  4JLE A;  2P9B A;  5LGN B;  2I6H A;  3L09 A;  2Q9Q C;  4H9O C;  4EOZ B;  4MHC A;  2WMN A;  3UUN A;  2E9X A;  4ILC A;  4U7Y A;  3B13 A;  2BBJ A;  2E5V A;  3L3P A;  2B76 A;  5FY7 A;  5LJN A;  1ZV4 X;  2LRK A;  2W0G A;  1X9B A;  3FXD B;  4B3T T;  3CIR A;  3FZF B;  3RKG A;  4MLK A;  4BJM A;  5AQN B;  1FMV A;  3ZC0 A;  2NWB A;  3N5L A;  4NUV A;  4PK4 A;  3FZK B;  3LDQ B;  1VCT A;  4H63 V;  4PFO A;  1SE7 A;  2V5C A;  2XM1 A;  5FVK A;  5FVL A;  4DR4 T;  1ZKE A;  2XQ9 A;  2CEA A;  3H3M A;  3N9N A;  3C4X A;  2UUA T;  2KZ7 B;  2LT3 A;  4X65 T;  4DR6 T;  2X66 A;  4IT4 A;  1WR0 A;  3FHN A;  5AQL B;  2CWY A;  3LFM A;  4ZI7 E;  2I59 A;  3J7Y q;  4ZOL E;  2E9X C;  2NP9 A;  2V1D B;  3HI2 A;  1H7C A;  4I43 B;  1BR0 A;  4HWC A;  3AED A;  1VOM A;  2WAU A;  3UFG A;  5LCY A;  4YY3 T;  2JQ9 A;  4YSY A;  4TWF A;  1OED C;  2H88 A;  3BK9 A;  1YQ4 A;  5FXW A;  3GN5 B;  1BR1 A;  2OLT A;  4UV8 B;  4X1K E;  5H6Q B;  3LJC A;  4KHZ F;  3R6N A;  1UGO A;  1OED A;  1UUR A;  2ZLY A;  3ONX A;  5FL0 A;  2YIN A;  2LJL A;  2JQH A;  4X20 E;  4XAX B;  3RYH E;  3V5S A;  2D2S A;  3PTR B;  3VR8 A;  4DID B;  4F8H A;  2J62 A;  2RP4 A;  2QA7 A;  1KNZ A;  1OED E;  2FJE A;  3L8R A;  4JUY A;  1DU2 A;  5JDH A;  4HGA A;  1J1J A;  1VRB A;  2Q9Q D;  3AE1 A;  3Q5D A;  5AQT B;  1V9D A;  5HXH A;  3AEF A;  5AQV B;  3PUW F;  1HCI A;  4IDN A;  4DUZ T;  2LHR A;  4QH1 A;  5ABF B;  3TLW A;  4KX6 A;  4PK5 A;  4LFC T;  1XNR T;  3SFE A;  4JI0 T;  2WQY A;  1JNR A;  2CA5 A;  3AE8 A;  4O2B E;  4HFB A;  2N2N A;  3UQ4 A;  3VKH A;  3MXZ A;  4DBQ A;  4PFP A;  1UX5 A;  4OYK A;  1WR6 A;  1MMG A;  2UXC T;  5CB4 E;  4TUY E;  2LRL A;  3KV9 A;  3NRY A;  5F5W A;  3AAI A;  4YFS A;  3W15 B;  1MND A;  3ZCI A;  2LM2 A;  4HN9 A;  2YKS A;  2XUE A;  5FXV A;  2LOP A;  1SHZ C;  3UU4 A;  3JAF A;  1SA0 E;  2JRK A;  3KBU A;  4IE5 A;  2VKJ A;  2CXL A;  3AAE B;  4P1N A;  4ISS A;  2ES0 A;  4JEU B;  4HWF A;  3PU8 A;  3ZYK A;  1SUM B;  2VL8 A;  5L3F B;  3AXJ A;  2BS3 A;  2X0Y A;  5AQI B;  1US7 B;  2M6B A;  3P4S A;  4X1Y E;  2OV9 A;  5EZY E;  4ILA A;  5AFU L;  5CFB A;  5M4Y A;  1D1C A;  5HEH A;  3BQK A;  3P7I A;  3ZCJ A;  2IW5 B;  2XZE A;  5AQJ B;  3I9W A;  4YHH T;  4P0B A;  4XBF B;  4FJO A;  5CJ5 A;  4HE8 A;  3RKO A;  4EYU A;  3A7M A;  5LB7 B;  4WBN E;  3PUQ A;  5L3C B;  3EUH A;  4A5X A;  1HNW T;  3UUX B;  4U74 A;  4JI6 T;  4JBW F;  2NR4 A;  2RA1 A;  3RX6 A;  4DR1 T;  2VAS A;  3AE6 A;  1OXZ A;  4O4H E;  3N9M A;  4DMW A;  3MKD A;  5LBM A;  1YQ3 A;  3H37 A;  3K1S A;  3QOF A;  2X51 A;  3ZMS B;  5JVD E;  5LBQ B;  2X9H A;  4GYR A;  2FJB A;  4QXB B;  4TWH A;  2CPT A;  2UUC T;  4CI1 B;  2K5B B;  4WYV A;  2DWG A;  5C3J A;  5JDN A;  3ANW A;  3EDV A;  5LHI B;  2QGS A;  3F2E A;  2V7I A;  4TNV A;  2V6Y A;  3V5U A;  5DJQ C;  4ZS3 A;  2C0S A;  2IUB A;  2KIN B;  2YDS A;  3OYX A;  4QH5 A;  3PJA A;  3P4R A;  3WI3 A;  4LFB T;  2XQ5 A;  5JRC B;  3ZMV B;  1NEN A;  5AQU B;  3OVU A;  4PW8 A;  5IHY A;  3AA1 B;  1J5W A;  2VL0 A;  2A3D A;  2CHN A;  2DNX A;  1VCS A;  3LBX B;  4QH4 A;  3RIF A;  3N2G E;  4MBQ A;  2X9X A;  4OYJ A;  5JRE A;  3VRA A;  1BR4 A;  1T72 A;  5AQP B;  5LMU T;  2L9Q A;  3TKL B;  2KWI B;  4IL9 A;  3NZP A;  2HHH T;  3ZMZ B;  4X62 T;  2XAS B;  2D0T A;  5E0O A;  4GYS A;  1R8I A;  3UU3 A;  1D1B A;  4HFC A;  4QX7 B;  4P09 A; 
#chains in the Genus database with same CATH homology
 5FYM A;  5L3D B;  4PNI A;  4EAH A;  4X1I E;  4GK5 E;  4UVB B;  2CXD A;  2MTQ A;  3QUJ A;  4GOU A;  2CMR A;  4O4J E;  4BJN A;  3ZJ1 A;  4UF0 A;  5L3G B;  1S35 A;  2C5I T;  3BQI A;  3KIN B;  3OBV E;  4AKI A;  3N9L A;  1HG5 A;  2EHO B;  2ODV A;  1HX8 A;  2CE7 A;  3MJX A;  1LVF A;  2CLY C;  3C51 A;  2YEV C;  2H3R A;  2K9A A;  4IE4 A;  4IE0 A;  5JDL A;  3KV5 A;  2C5K T;  2LE8 A;  2ZMA A;  3S4U A;  2M67 A;  3C64 A;  5CA0 E;  4O4L E;  1NAF A;  2LM9 A;  2ZM8 A;  4WNK A;  3VKG A;  5FP3 A;  4PJM A;  3U3I A;  4MFR A;  5L3B B;  4YLH A;  1CUN A;  4HFV A;  4QWN B;  2LOS A;  2W61 A;  2VKO A;  2YU1 A;  5DQW A;  4F6R C;  1S94 A;  4EYY R;  5HYA A;  3R84 B;  3ETV A;  2NOX A;  2UXN B;  4I4T E;  3K3N A;  2H7V C;  2JPF A;  3Q5X A;  4ERR A;  1UX4 A;  3AB3 B;  5L3E B;  3UT5 E;  4CI2 B;  1NWM X;  1HS7 A;  3D0T A;  4YHJ A;  1WRD A;  4OHF A;  4JEH B;  3NZQ A;  3ZPO A;  1Y64 B;  3ZN0 B;  1B7T A;  2KLQ A;  4DVD A;  4HKA A;  3KV4 A;  4GIW A;  5FNV E;  2XAG B;  3UTK A;  2DCF A;  1MMN A;  3C98 B;  3CX6 B;  4UEL A;  4CXW A;  4O4I E;  3DTO A;  4ZI3 C;  4H63 H;  4KBM B;  2E8I A;  2DI4 A;  2D5U A;  1WYC A;  4O2A E;  5ETW A;  2Z6E A;  3Q2M A;  1BR2 A;  3HKB E;  3O4X E;  2X67 A;  4IE7 A;  3E22 E;  3E0Z A;  2JMH A;  2Y6X A;  3Q9D A;  4GK0 E;  1LVK A;  1OWA A;  4IHJ E;  3RKO A;  5LGU B;  5JRC A;  3NBX X;  4K0U A;  4TZ4 C;  5HXR A;  1MMA A;  2CM0 A;  2KT9 A;  2UXX B;  2X0L B;  3CKD A;  4M1P A;  2H7O A;  3H3A A;  1IJ5 A;  4PJN A;  4DO0 A;  3WAK A;  5JH7 E;  3RYF E;  2V7J A;  2EHO C;  2WSS V;  2D0U A;  1X79 A;  2W00 A;  3MAC A;  3CX8 B;  1QUU A;  1YKH B;  2KND A;  2OA5 A;  5DQV A;  3O1J A;  4EZ4 A;  3ZEF B;  4EZH A;  4ADZ A;  3FXE B;  3HL6 A;  3M65 A;  2WMO A;  4E7Z A;  5EK2 A;  2J1D G;  2KWH A;  2PG8 A;  2X68 A;  4CI3 B;  3C4Z A;  3GMI A;  4C90 A;  1EZ3 A;  3N9Q A;  3GN5 A;  5EK3 A;  2JQQ A;  4PK6 A;  3MZK B;  4PJJ A;  5KX5 E;  4ZI3 D;  2V26 A;  2A2F X;  3N9P A;  3RPU A;  3KVB A;  1D1A A;  3ANW B;  1ZEE A;  3PU3 A;  1IJ6 A;  4H9R C;  4UIG A;  1YD8 G;  2GK9 A;  3J9X 1;  4UF0 B;  5J2T E;  3CQG B;  3KVA A;  2LSG A;  3LK3 B;  5J1G A;  2XAQ B;  5LXT E;  5LGT B;  1MMD A;  2LSY A;  3IF8 B;  4ZHQ E;  4ZS2 A;  5CA1 E;  4H9S E;  3A5X A;  5JDQ A;  2B1E A;  4DMV A;  4B6X A;  2E9X B;  5LNK A;  4ANJ A;  1U5P A;  4AXP A;  2CLY B;  2JJ9 A;  2MOZ A;  3T8O A;  3FBZ A;  2W63 A;  2XAH B;  5TAO A;  3F57 A;  2N9D A;  3ZN1 B;  4AI6 A;  4MAL A;  3MA9 A;  1Z0P A;  3C4W A;  3F31 A;  1IAP A;  4TV9 E;  4UEM A;  4DND A;  3HR0 A;  3ZMU B;  1LRZ A;  3PUA A;  3K8P C;  5LP6 E;  3GA8 A;  3KDS E;  3SS1 A;  4BA9 A;  3U78 A;  2NTY A;  3I1A A;  4I50 E;  5BMV E;  2X9Y A;  3AA0 B;  2XAJ B;  1ZHC A;  2L3L A;  4KMC A;  5FXZ A;  4L0R A;  4CZZ B;  4UXN B;  2W62 A;  5GON E;  3RC3 A;  4TN7 B;  3ESL A;  2VKH A;  5FY1 A;  3RC8 A;  4BAY B;  1FMW A;  2LSI A;  4G2A A;  4UV9 B;  3RH3 A;  1MNE A;  3WAJ A;  2HH7 A;  3FBL A;  3PUR A;  3NRX A;  4N78 D;  3IBP A;  3IHR A;  3CWZ B;  1HF8 A;  3KV6 A;  3UFE A;  5JQG E;  5JDF A;  3RYC E;  2Q9Q A;  4KUM B;  5F3J A;  3B57 A;  2V7M A;  4ZI2 C;  5LG4 A;  3KBT A;  5LHH B;  1HG2 A;  2HPJ A;  1HFA A;  2PBI A;  4E7S A;  2NW7 A;  1LKX A;  4QXH B;  2IC9 A;  4EXT A;  4C91 A;  4V1A v;  3LK4 2;  2BVM A;  4FI5 A;  1U4Q A;  3MK7 C;  3I0O A;  5F8P A;  5KMG P;  2LHN A;  2YU2 A;  3Q5W A;  2G0U A;  3DP7 A;  4HEA A;  4OFZ A;  3N9O A;  3PE0 A;  3LK2 B;  3RRW A;  5JDG A;  2X9W A;  2K48 A;  1D0X A;  4H9Q C;  1KK7 A;  3SOL A;  1G73 A;  3I0Q A;  2LSJ A;  3O1I A;  3BQL A;  5JR9 B;  2XQY A;  2CCQ A;  4I55 E;  2EHO D;  5JDM A;  5LJM A;  2WWU A;  2EHO A;  1G8X A;  3N2K E;  2A72 A;  3RRC A;  5KDM C;  2ZM0 A;  3EVY A;  3E08 A;  3PUG A;  1WYB A;  4KP3 C;  2NW8 A;  3K3O A;  2ACX A;  2MYS A;  2BDE A;  2KMF A;  4Z8X A;  5EK4 A;  5HAX A;  5HWX A;  2DWK A;  4ZI2 D;  4IGU A;  4AQF A;  2NTX A;  1MIW A;  4IIJ E;  4H9N C;  2C5J A;  2XHE B;  5LYJ E;  1E1H B;  3CX7 B;  4TV8 E;  3QK6 A;  1FIO A;  4IE6 A;  2YK0 A;  5JR9 A;  4NUU A;  2CXF A;  4UVA B;  5HXC A;  5LA6 E;  3OYZ A;  4AKH A;  3CVR A;  5JR9 C;  3CQC B;  3AA6 B;  3LBX A;  5J2U E;  4EIW A;  3QC9 A;  1YKE B;  2LSK A;  3AAA B;  3O9X A;  4H9P C;  4CXX A;  3GWH A;  3PDY A;  1AJ3 A;  4YJ3 E;  2HPL A;  3CQX C;  3OJA A;  3ZMT B;  2Y48 B;  3AVS A;  3VU7 H;  5LOV E;  4CQI A;  2DLR A;  2SPC A;  3HA4 A;  3HKE E;  2CWO A;  2VKD A;  3ETU A;  1MIY A;  4UVC B;  3SRZ A;  2VB6 A;  1T98 A;  4PJL A;  4QHO A;  5IYZ E;  3OKQ A;  1D0Z A;  3KFW X;  4G63 A;  1FEW A;  3AVR A;  2Y8D A;  4CXY A;  3HKD E;  4A56 A;  4XZC A;  3C50 A;  2BZB A;  2L8K A;  2XAF B;  4J2C A;  5LHG B;  2N1G A;  3CPZ A;  2NW9 A;  2DHR A;  4QXC B;  3VHL A;  4AKR B;  2KXP B;  4ILU A;  2VK9 A;  3N2O A;  3LG7 A;  4WW0 A;  4IDZ A;  5FXX A;  4AKG A;  3IEE A;  5C8Y E;  3ZC1 A;  3PUS A;  1QSD A;  2ODU A;  3ZJ2 A;  3JC6 D;  4PAG A;  1YW0 A;  4QX8 B;  2PFV A;  5FY0 A;  4WBO A;  2ZM2 A;  3CML A;  1MIV A;  2BVL A;  2WM9 A;  2WBL A;  4U72 A;  5HWY A;  4IST A;  3EDU A;  4OK0 A;  2K24 A;  1WLX A;  5H6R B;  5HXE A;  2IAK A;  4HTE A;  3K3Q C;  3O1H A;  4L9I A;  4O8S A;  4EB6 E;  1O3X A;  3FB2 A;  2VWA A;  5FMN A;  4AQG A;  4DBR A;  2JMK A;  1IZN B;  1D0Y A;  2XTL A;  3P8C D;  3UUL A;  2LEH A;  5DAB A;  2E9X D;  4QKN A;  4L5G A;  3SWH A;  4AKL A;  3I9Y A;  3ZYM A;  5ADX L;  3ZLI A;  1UCU A;  2MBG A;  3UUM A;  5HXS A;  5L2L A;  1HTJ F;  3AA7 B;  2V7L A;  4YJ2 E;  5A1L A;  2IC6 A;  3DJB A;  2PJQ A;  2Q9Q B;  3ZYL A;  4TX5 A;  3RYI E;  4AQF C;  4P0A A;  3HKC E;  3JC6 C;  2V7K A;  4JLE A;  2P9B A;  5LGN B;  3L09 A;  2Q9Q C;  4H9O C;  4EOZ B;  4MHC A;  2WMN A;  3UUN A;  2E9X A;  3B13 A;  3L3P A;  5FY7 A;  5LJN A;  1ZV4 X;  2W0G A;  3FXD B;  4MLK A;  4BJM A;  1FMV A;  3ZC0 A;  2NWB A;  3N5L A;  4NUV A;  4PK4 A;  4PFO A;  4H63 V;  1ZKE A;  2CEA A;  3N9N A;  3C4X A;  2KZ7 B;  2LT3 A;  2X66 A;  3FHN A;  2CWY A;  3LFM A;  4ZI7 E;  2I59 A;  3J7Y q;  4ZOL E;  2E9X C;  2NP9 A;  2V1D B;  3HI2 A;  1H7C A;  4I43 B;  1BR0 A;  1VOM A;  2WAU A;  5LCY A;  3BK9 A;  5FXW A;  5JRE A;  3GN5 B;  1BR1 A;  4UV8 B;  5H6Q B;  4X1K E;  4ASK A;  3LJC A;  3R6N A;  2ZLY A;  3ONX A;  2YIN A;  2LJL A;  3V5S A;  4X20 E;  4XAX B;  3RYH E;  2D2S A;  3PTR B;  2RP4 A;  2QA7 A;  1KNZ A;  4JUY A;  5JDH A;  4HGA A;  1VRB A;  2Q9Q D;  1V9D A;  5HXH A;  1HCI A;  2LHR A;  4PK5 A;  2CA5 A;  4O2B E;  2N2N A;  3VKH A;  3MXZ A;  4DBQ A;  4PFP A;  1UX5 A;  4OYK A;  1WR6 A;  1MMG A;  5CB4 E;  4TUY E;  3KV9 A;  3NRY A;  3AAI A;  4YFS A;  3W15 B;  1MND A;  3ZCI A;  4HN9 A;  2XUE A;  5FXV A;  2LOP A;  1SHZ C;  1SA0 E;  2JRK A;  3KBU A;  4IE5 A;  3AAE B;  2CXL A;  2VKJ A;  4ISS A;  2ES0 A;  4JEU B;  3PU8 A;  3ZYK A;  2VL8 A;  5L3F B;  1US7 B;  4X1Y E;  5EZY E;  5AFU L;  5M4Y A;  1D1C A;  3BQK A;  3P7I A;  3ZCJ A;  2IW5 B;  4XBF B;  3I9W A;  4P0B A;  4FJO A;  4HE8 A;  4EYU A;  4WBN E;  3PUQ A;  5L3C B;  3EUH A;  3UUX B;  4U74 A;  2RA1 A;  3RX6 A;  2VAS A;  4O4H E;  1OXZ A;  3N9M A;  4DMW A;  3MKD A;  5LBM A;  3H37 A;  3ZMS B;  2X51 A;  5JVD E;  5LBQ B;  2X9H A;  4GYR A;  4QXB B;  4CI1 B;  2K5B B;  2DWG A;  5JDN A;  5LHI B;  3ANW A;  3EDV A;  2QGS A;  3F2E A;  2V7I A;  3V5U A;  5DJQ C;  4ZS3 A;  2C0S A;  2KIN B;  3OYX A;  3WI3 A;  5JRC B;  3ZMV B;  5IHY A;  4PW8 A;  3AA1 B;  2A3D A;  2DNX A;  3LBX B;  3N2G E;  4MBQ A;  2X9X A;  4OYJ A;  1BR4 A;  2L9Q A;  3TKL B;  2KWI B;  3NZP A;  3ZMZ B;  2XAS B;  2D0T A;  5E0O A;  4GYS A;  1D1B A;  4QX7 B;  4P09 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...