5LBMA

The asymmetric tetrameric structure of the formaldehyde sensing transcriptional repressor frmr from escherichia coli
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
83
structure length
83
Chain Sequence
KKVLTRVRRIRGQIDALERSLEGDAECRAILQQIAAVRGAANGLMAEVLESHIRETFDRNDCYSREVSQSVDDTIELVRAYLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional repressor FrmR
publication title The mechanism of a formaldehyde-sensing transcriptional regulator.
pubmed doi rcsb
source organism Escherichia coli o157:h7
molecule tags Transcription
total genus 33
structure length 83
sequence length 83
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02583 Trns_repr_metal Metal-sensitive transcriptional repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1000 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5lbmA00
5LBMA 2HH7A 5LCYA 4ADZA 3AAIA 4M1PA 4UIGA 5FMNA
chains in the Genus database with same CATH superfamily
4U74A 3I0QA 2LSGA 2BBJA 3IA3A 2V8SV 4DR3T 4DO0A 2E5LT 3AAEB 2V5CA 2UXNB 2WQYA 4EYYR 4P0BA 3K3OA 4CXYA 3HKCE 4U31A 5IYZE 2ZLYA 2KMFA 5LJMA 4PJLA 3Q5EA 5TAOA 3CX6B 2XQ5A 1LVKA 3PE0A 2PTFA 3P7IA 2C5JA 1UURA 4U33A 3AE5A 2KSRA 5KX5E 5ABFB 4DVDA 5IWAT 4DR6T 2CRBA 2E9XD 4Z91A 2N2NA 3B5MA 2KZ7B 2CMRA 1O3XA 1MIVA 2LSIA 1FMWA 4YJ2E 3O9XA 1YKEB 2YOEA 3RRWA 4QXCB 2I6HA 3AA6B 4IL4A 3AA1B 3FHNA 2LE8A 4PK4A 2V6YB 2WU2A 2XM1A 1HX8A 3HR0A 3CMLA 4ZZCA 3UU4A 3ZT5A 4YSYA 3PUAA 4WBOA 4DR4T 2WZIA 5ADXL 3P4RA 2XAQB 2X0LB 4GIWA 2XAFB 3LFMA 1B7TA 2YKSA 2IC6A 4LF5T 4H9RC 2W63A 1J5WA 5LOVE 3C98B 4DR1T 4U2ZA 1HNWT 3TLTA 3P4PA 2YINA 3PUXF 4EXTA 3ETUA 5AQHB 1XZYA 1MIWA 3A7MA 3ZMTB 3FZMB 3EI0A 3UQ4A 4ZOLE 1MNEA 4H9SE 4U7IA 4JI5T 4LF4T 3KVAA 3E0ZA 5AQUB 3ZSTA 1WLXA 2WDVA 2CCQA 5LG3A 4KUMB 4WZXA 3GMIA 5LYJE 2NW8A 3RIUC 4QXHB 4JI4T 2OA5A 4H9PC 5AQLB 2EHOD 1Z0PA 4I0UA 5AQIB 2Q9QC 2VKHA 3VR9A 4TWFA 2DCFA 4X1IE 2V7KA 3IBPA 5HCMA 4K0UA 3AEBA 2CBIA 2PBIA 2H89A 3KV4A 4GOUA 1XDPA 5L2LA 4UV9B 2XSAA 2WZHA 3I9YA 4I43B 3OJAA 4ZEYA 4CN1A 5JREA 3B13A 5H6RB 2ZM0A 3RLFF 4AKLA 5CA0E 1XWMA 4PJNA 3AAAB 4UIGA 4JBWF 4X66T 2VL0A 3FZLB 5JDGA 2D5UA 2LM2A 5F5WA 5J2UE 2LRLA 3ZYKA 2IHR1 2F4VT 2D2SA 4EAHA 4U2YA 4YT0A 3RC8A 1Y64B 2C5IT 1JNRA 1U5PA 3CX7B 4AKGA 1DU2A 3ZT6A 3C50A 2L8KA 3CQXC 3R84B 4FI5A 4YHJA 1G73A 2XQ3A 2XZEA 1U4QA 1FJGT 2BG9A 4DV5T 5FYMA 1HG5A 3HL6A 2W2UA 4OFZA 4P09A 3C51A 3AE3A 2DHRA 2X9YA 3V5SA 4ADZA 4IL9A 4DR5T 1WR6A 4HWDA 2KXPB 3OPCA 1GQEA 4MLKA 4PK6A 3K1SA 3JC6D 3ZCJA 3ZJ2A 5L3DB 2VASA 3MKDA 2W66A 4L5GA 4LFAT 2FJBA 2A3DA 3QUJA 4I55E 5L4HA 5LCYA 3R6NA 3X1DA 1E2AA 2BVLA 2NR4A 1NWMX 4WBNE 3P8CD 5JDQA 3C4WA 2WP9A 4IE0A 2PG8A 2AXDS 2FJDA 3ESLA 3A8YC 4HFEA 5CB4E 1HNXT 2XY8B 2X68A 2K3WA 3OKQA 5IUXA 1HX1B 1HG2A 5JH7E 2A9UA 2JJ9A 3PU8A 5LXTE 3LBXB 2WCAA 3PTRB 4JUYA 4B6XA 2FBWA 4TV9E 4OHFA 5AQRB 3AXJA 3AE8A 3RRCA 2NW9A 1XMOT 2UXBT 4CI3B 1WR0A 3E22E 1NENA 4ZI2C 4UEMA 1BR0A 3IF8B 3CX8B 2XAJB 3LK3B 2IIUA 4DMVA 3C64A 2CXFA 3N9MA 2W0GA 1J1JA 3OBVE 5ABFA 4KI0F 1XNQT 5HWYA 5JR9B 2JQQA 3NZQA 4UVBB 3AE2A 2I59A 1HR0T 2CHOA 4HWIB 5L3GB 2RA1A 3CK6A 1KNPA 4UV8B 4PJMA 4AISA 2JMHA 3MZKB 4HN9A 5AQPB 3PUGA 2CPTA 2FJAA 4ILBA 4QX8B 3ZLIA 4HKAA 4DBRA 5H6QB 4ZI3D 2DWKA 2XASB 3TKLB 5J1GA 2V6YA 3AEDA 5GONE 1SE7A 2NOXA 4Z90A 5KXJA 3PUQA 4KBMB 2UUAT 1XMQT 3HA4A 4KHZF 4JEHB 4JV5T 2H7OA 2ZM8A 4IDOA 2PFVA 2CHNA 2JIWA 2XTLA 2BG9C 2CBJA 3BK9A 1Y01A 1YKHB 5AFUL 2A2FX 5FKYA 2WY2A 5HXHA 3NBXX 3QOFA 4GKJT 3LG7A 1HNZT 2V26A 1FEWA 2DWGA 1N33T 3UULA 2Z6EA 1W0AA 2VURA 4P0AA 2X66A 3P4SA 2YK0A 4JLEA 4DMWA 4MHCA 5ABGA 2XM2A 3CQCB 4J2CA 5JQGE 3ZMUB 2XQAA 3RQUA 2KT9A 5C8YE 2IW5B 5AQKB 5CFBA 1VCSA 2B76A 2UXXB 3U3IA 2NWBA 4HFIA 3OTOT 4U7YA 1WYBA 1HF8A 3WI3A 1X9BA 2X0HA 5M4YA 3N9PA 3G06A 3FBZA 5FP3A 1IAPA 2WBLA 5DABA 3TLWA 3AXJB 5LHHB 3AEFA 2ACZA 5LBQB 1YQ4A 2XQ6A 3AAIA 4V1Av 1X79A 2BBHA 2E5VA 3FZFB 2XQ7A 4X1KE 3B57A 1D1AA 4ZXLA 4QH1A 4M1PA 5JRCB 2W00A 3VRBA 1US7B 3N5LA 4EB6E 2BDEA 1FMVA 3EABA 3HI2A 4YHHT 2WMNA 1S35A 3RKGA 3BQIA 2LEHA 2CM0A 4LF6T 2IAKA 1R8IA 2R6GF 2H88A 3ZN0B 2NTXA 3SFEA 3T8OA 3PUVF 3MACA 2KINB 2VQFT 3M65A 3KBTA 5LGTB 1OEDE 4JI7T 4EV6A 4X5TA 2OLTA 1N34T 3FZKB 3RQWA 4HWCA 3UU8A 4TN7B 1ZV4X 3KINB 1IBMT 2N9DA 5ABEA 3FBLA 2WS3A 5HEOA 3IHRA 3ZCIA 4L0RA 4O4IE 3ONXA 2KNDA 3WAJA 1UUSA 2JPFA 3UT5E 5LG4A 3AVSA 2MBGA 3FZHB 2X9XA 5L3BB 1HCIA 2G0UA 2UXCT 3NZPA 3UUNA 4ANJA 4DV1T 3O1JA 4LF9T 2K5BB 3S4UA 3CVRA 2LOPA 2CE7A 1OXZA 1J5ET 4IDZA 5AQOB 2X9HA 2VK9A 4DR2T 3Q9DA 3LBXA 3UUBA 2BZBA 4NPPA 3QNUA 3AEEA 3O4XE 3W15B 4HFVA 3D0TA 3ZN1B 2MTQA 1VOMA 3T1YT 2J1DG 3EAMA 3ZJ1A 4G2AA 3PU3A 4AKIA 3AE1A 3KDSE 2VVNA 4YXDA 2YDSA 2DLRA 4UVAB 1QSDA 4BJNA 5A1LA 3SOLA 4DBQA 2Y48B 2Q9QD 4XZCA 2VKOA 3UUMA 1MNDA 5L47A 5JR9A 4O8SA 3ZEFB 3CIRA 4C91A 4TV8E 5EK2A 5JDLA 3I1AA 4TUYE 3KV6A 2HH7A 3RYHE 4B3RT 1OEDA 3LDQB 3TLSA 2V5DA 3MK7C 1WRDA 3EVYA 1Z8UA 4L9IA 4ERRA 2LHRA 3PJAJ 4DV3T 5LHGB 5FVKA 3ZC0A 5HCJA 3ETVA 2WDQA 3ZMVB 4TWHA 2YN6A 4LFCT 3QC9A 2MAWA 3RYFE 4JYAT 3DTOA 2BS4A 3VHLA 4JI0T 2X0YA 1YXRA 4LMLA 4GKKT 2QYWA 1T7SA 3ZMZB 5HAXA 5L3CB 4DIDB 3T1HT 4DV0T 2YU1A 2XQ4A 2QA7A 4JEUB 3PUZF 4EEDA 4IGUA 3NVOA 4HE8A 3KV5A 3PDYA 1UGOA 4ZS2A 4O4HE 3RIFA 4TNWA 1HS7A 4AQGA 3JAFA 2M6IA 2VQET 4IDNA 3RYCE 3UU5A 4IE6A 3A5XA 1UX4A 4IE4A 2IC9A 2PJQA 3P4QA 3I9WA 5FVLA 2E9XA 3E08A 4COFA 3N2OA 1IZNB 4UVCB 4GK0E 4A56A 1W9RA 3ZT7A 3K3QC 3EHZA 2XQ8A 4DR7T 3HKDE 5HEUA 2LSJA 4BA9A 4DUZT 4LF8T 1T8BA 1SHZC 1AJ3A 2Y6XA 2HHHT 4I50E 4H63H 5FNVE 1MMDA 2H3RA 1VCTA 2SPCA 4K0KT 3ZSSA 4B3MT 3M3ZB 4U72A 3PUWF 3VR8A 2KWHA 3N9LA 2NTYA 4IDQA 5E0OA 5CJ5A 2X67A 4QH5A 2D9DA 1IBLT 3OVUA 4AKHA 3F57A 5JRCA 4OYJA 3N9NA 4PAGA 4E7ZA 4HFCA 5AQGB 2K48A 1T98A 5AQMB 1QLBA 4EYUA 3AA0B 3H3MA 5JDHA 5LNKA 1D0YA 4YTMA 4U3CA 1OEDB 4KHPT 2N1GA 2HN2A 3CWZB 4G63A 4BAYB 5C2TA 4LFBT 2CLYB 3RKOA 4ZI2D 5FY7A 4O4JE 5F3JA 5J2TE 4ZI7E 5JR9C 3K3NA 3ZMSB 2VWAA 5AQTB 3AVRA 4CXXA 1LKXA 1MMGA 4ILAA 4KMCA 2LKHA 2LHNA 2XQ9A 5FXZA 3FXEB 4EZ4A 4ISSA 4A97A 5IHYA 4IREA 3IEEA 2X9WA 2YU2A 2CLYC 4UF0B 3KFWX 1YD8G 2IMLA 2VL8A 2BS3A 3AEGA 5ABHA 5KDMC 2CA5A 3KV9A 2UUBT 3PURA 4YFSA 2EHOA 4UELA 1CUNA 2OV9A 4NUUA 4MFRA 3N2GE 3MA9A 3RPUA 2BKOA 4H9NC 1E1HB 3U78A 4TZ4C 3UU6A 4NIQA 2UXDT 2E8IA 3RIAA 4Q25A 3RX6A 1KEYA 1IJ6A 1G8XA 4H9QC 3RC3A 3UUXB 4ILUA 2JQKA 5LBMA 4HFDA 2K9AA 3EDUA 2KLQA 2NP9A 2DL1A 1NAFA 2QRXA 3OYXA 3UTKA 2JMKA 3KVBA 4O2AE 2CEAA 2V7IA 1QUUA 3AE7A 2E9XB 1BR1A 4UXNB 5FY1A 1ZP0A 3SS1A 4WYVA 4X1YE 2LLYA 2XAHB 5CGMA 1BR2A 1S94A 4HWHA 4TWDA 2ODUA 2WDRA 3LJCA 4PFPA 2BVMA 2E9XC 5LJNA 4HFBA 4QH4A 4AKRB 2V7JA 3OYZA 4F8HA 4H9OC 5LGUB 3AB3B 4YSZA 2IDOB 4LMJA 4YTPA 3C4XA 4IIJE 4ZHQE 4NXMT 1HTJF 2XSBA 1HFAA 5FXXA 2W67A 5AQNB 2XHEB 3VKHA 4X62T 3Q2MA 2WB5A 2FUPA 5FMNA 5JDMA 2JRKA 4DV6T 5JDFA 4CZZB 2DNXA 3RH3A 1ZHCA 3ZKRA 3O1IA 2NW7A 5HYAA 1UX5A 3ANWA 4PNIA 4BJMA 1UK5A 3L8RA 4B3TT 1KNZA 4AXPA 3NRXA 2D0TA 3SWHA 1V9DA 1BR4A 5DQVA 4JI1T 4QHOA 3JCFA 1IBKT 2HPJA 5C3JA 3ONJA 3SFDA 4OK0A 4PFOA 2EHOB 2BS2A 2L3LA 2WAUA 3AE9A 3RGLA 1JNZA 2W61A 3UFEA 2Y8DA 3MXZA 1D1BA 4KX6A 2VKJA 1VRBA 1WYCA 2FJEA 2C0SA 5AQSB 2E2AA 2BKPA 2YEVC 2EHOC 3L3PA 3DJBA 1N36T 5HEJA 2UUCT 4DNDA 3RF1A 2BG9E 4B3ST 2X51A 1CHUA 5BR8T 1OWAA 2Q9QB 5HEGA 4O4LE 2JQHA 5L3FB 1MIYA 3GN5B 3GWHA 4CN6A 3H37A 4YSXA 4FJOA 2V6XA 2ES0A 1LVFA 3N9QA 5DQWA 1M7KA 4EOZB 4A5XA 5JTGA 4QX7B 2WM9A 2YDQA 2J62A 3AA7B 3C4ZA 3UFGA 4IT4A 3AE4A 2YDRA 2V7LA 4IE5A 5KMGP 4JI3T 4EEBA 2P9BA 3Q5WA 2ZM2A 4XAXB 2LRKA 5LHIB 2WU5A 4AQFA 5EK3A 5FXVA 4WW0A 2J4GA 4PJJA 5LMUT 2CWYA 4HGAA 2RPAA 3QK6A 4TX5A 3TLUA 4P1NA 4EIWA 2V7MA 3V5UA 2ZM6T 5LA6E 3PJAA 4N78D 2BKNA 2KWIB 4LF7T 3O1HA 5AQVB 1D0ZA 2QGSA 1WCRA 3ANWB 3ONLC 2K24A 1I6ZA 3NKZA 4AQYT 5AQQB 3JC6C 3HKBE 5FY0A 2LM9A 4CI2B 4UF0A 1WFDA 2AE9A 2HN1A 4HFHA 5L3EB 3J9X1 5HXCA 2B1EA 3EUHA 2LKGA 3JADA 2LSKA 4WNKA 4AI6A 5FL0A 2JQ9A 3VU7H 4LMKA 3TLVA 5FXWA 2WMOA 5LP6E 3NRYA 4ASKA 5J0ZA 2C5KT 5JDNA 5HEHA 3AE6A 1N32T 4NXNT 5HWXA 2MPKA 4CN4A 2W4XA 4IE7A 2W62A 3BQKA 4X65T 4X64T 3FXDB 3BQLA 4HTEA 3NWIA 5CA1E 3LK42 3L39A 3PUSA 4MALA 3SRZA 3CPZA 3MJXA 4IHJE 3EDVA 3LK2B 3RYIE 1M62A 4ZZBA 4EGWA 1MMNA 3LSVA 2GK9A 2MOZA 4QKNA 2M6BA 2IUBA 3QB5K 3F31A 3UU3A 3N9OA 5AQFB 5HXSA 3KBUA 5ETWA 5HXEA 4PW8A 4JI2T 2L9QA 3J7Yq 2CXLA 1IJ5A 3ABVA 2UU9T 1SA0E 4YY3T 1D0XA 3WAKA 2DI4A 4E7SA 1I94T 1LRZA 1XNRT 5EK4A 1W0BA 4OX9T 1ZKEA 5LGNB 5F8PA 1KFYA 4GK5E 5HXRA 4OYKA 2XQYA 1YW0A 3P50A 4ZI3C 5AQJB 2LT3A 4PK5A 3K8PC 1SUMB 1KF6A 2XUEA 2M67A 2VB6A 3ZYMA 4IDPA 1L0VA 4AQFC 1W09A 2VKDA 3DP7A 3VKGA 4MBQA 5LB7B 4XBFB 4YTNA 4GYSA 2LSYA 4A98A 3ZPOA 2XPKA 4YJ3E 1KNRA 4ZS3A 4QXBB 1OEDC 4GYRA 3AEAA 4KP3C 1ZEEA 5LMNT 2LOSA 2V1DB 4H63V 3PUYF 2XJ7A 4HWFA 3ZYLA 1KK7A 4F6RC 4I4TE 4TNVA 2RP4A 4UR9A 2XAGB 3GA8A 2BG9B 5L4EA 2CWOA 2A72A 2ACXA 3I0OA 3CKDA 1ZOYA 2D0UA 1YQ3A 3HKEE 2WWUA 3UQ7A 1MMAA 2WSSV 3Q5XA 3VRAA 3N2KE 4CI1B 4AIUA 5EZYE 3CQGB 2HPLA 1H7CA 2ODVA 3FB2A 5JVDE 2CXDA 2QVAA 4Z8XA 2H7VC 1XDOA 2MYSA 3ZC1A 3H3AA 4JI8T 2WWVA 4DUYT 1FIOA 4NUVA 1UCUA 1D1CA 3L09A 4CQIA 4CXWA 3RHWA 2LJLA 4C90A 2I0MA 3RIUA 3RI5A 2ZMAA 3QB5A 1NEKA 2Q9QA 3AECA 3P4WA 2J47A 3JAEA 4EZHA 4DV2T 4DV4T 4YLHA 3Q5DA 5DJQC 3GN5A 4O2BE 4JI6T 1T72A 3PV0F 4DV7T 1E7PA 5BMVE 5FL1A 4X20E 4QWNB 3F2EA 4HEAA 4ISTA 1EZ3A 2VVSA 4ILCA
chains in the Genus database with same CATH topology
2JQQA 3NZQA 3VHLA 4U74A 4UVBB 3I0QA 2LSGA 2I59A 2X51A 5L3GB 2RA1A 3ZMZB 4UV8B 5HAXA 4DO0A 5L3CB 4PJMA 3AAEB 1OWAA 2JMHA 2Q9QB 2UXNB 4O4LE 4EYYR 3MZKB 4P0BA 3K3OA 4HN9A 4CXYA 3PUGA 2YU1A 5L3FB 3HKCE 2QA7A 1MIYA 3GN5B 4JEUB 5IYZE 2ZLYA 2KMFA 4QX8B 3ZLIA 4HKAA 3GWHA 5LJMA 4PJLA 4DBRA 5H6QB 4ZI3D 2DWKA 2XASB 5TAOA 4IGUA 4HE8A 3CX6B 3H37A 3TKLB 1LVKA 5J1GA 3KV5A 3PE0A 5GONE 3P7IA 4FJOA 2C5JA 3PDYA 2ES0A 2NOXA 1LVFA 3PUQA 4KBMB 4ZS2A 4O4HE 3N9QA 5DQWA 5KX5E 4DVDA 4EOZB 3HA4A 1HS7A 4AQGA 2E9XD 2N2NA 4JEHB 2H7OA 2ZM8A 4QX7B 2WM9A 2PFVA 3AA7B 3C4ZA 2KZ7B 2CMRA 1O3XA 3RYCE 1MIVA 2LSIA 4IE6A 1FMWA 4YJ2E 2V7LA 3A5XA 1UX4A 4IE5A 4IE4A 5KMGP 2P9BA 2IC9A 2PJQA 3O9XA 3Q5WA 2ZM2A 2XTLA 4XAXB 1YKEB 3BK9A 3I9WA 1YKHB 5LHIB 3RRWA 4QXCB 5AFUL 2A2FX 3AA6B 4AQFA 2E9XA 5HXHA 3NBXX 5EK3A 5FXVA 3E08A 4WW0A 3LG7A 4PJJA 2V26A 3N2OA 1IZNB 4UVCB 3AA1B 4GK0E 2CWYA 3FHNA 4A56A 1FEWA 4HGAA 2LE8A 4PK4A 3QK6A 2DWGA 4TX5A 4EIWA 3K3QC 2V7MA 1HX8A 3HR0A 3HKDE 2LSJA 3CMLA 3UULA 2Z6EA 3V5UA 4BA9A 1SHZC 1AJ3A 5LA6E 3PUAA 4P0AA 2Y6XA 4I50E 4N78D 2X66A 4H63H 4WBOA 2YK0A 5FNVE 2KWIB 4JLEA 3O1HA 4DMWA 4MHCA 1MMDA 2H3RA 1D0ZA 2QGSA 2SPCA 3ANWB 3CQCB 4J2CA 4U72A 5JQGE 5ADXL 3ZMUB 2XAQB 2X0LB 4GIWA 5C8YE 2KT9A 2K24A 2IW5B 2XAFB 3LFMA 2KWHA 3N9LA 2NTYA 5E0OA 3JC6C 2UXXB 3HKBE 1B7TA 5FY0A 2LM9A 4CI2B 2IC6A 2X67A 4H9RC 2W63A 3U3IA 2NWBA 4AKHA 3F57A 4UF0A 5LOVE 5JRCA 3C98B 4OYJA 3N9NA 1WYBA 4PAGA 1HF8A 3WI3A 4E7ZA 5L3EB 2K48A 3J9X1 1T98A 2YINA 5M4YA 5HXCA 4EXTA 2B1EA 3EUHA 3N9PA 3AA0B 4EYUA 5JDHA 3FBZA 3ETUA 1D0YA 5LNKA 1MIWA 5FP3A 1IAPA 2WBLA 5DABA 2LSKA 3ZMTB 5LHHB 4WNKA 2N1GA 4AI6A 4ZOLE 3CWZB 4G63A 4BAYB 5LBQB 1MNEA 2CLYB 3RKOA 4H9SE 3VU7H 3AAIA 4ZI2D 3KVAA 5FY7A 3E0ZA 4O4JE 5FXWA 5F3JA 5J2TE 4V1Av 4ZI7E 2WMOA 5JR9C 3K3NA 5LP6E 3ZMSB 1WLXA 1X79A 3NRYA 2VWAA 2CCQA 4KUMB 4ASKA 3AVRA 3GMIA 4CXXA 5LYJE 1LKXA 2NW8A 1MMGA 4KMCA 4QXHB 2C5KT 2OA5A 4H9PC 4X1KE 3B57A 5JDNA 2LHNA 2EHOD 1Z0PA 5HWXA 5FXZA 3FXEB 4EZ4A 1D1AA 2Q9QC 2VKHA 4ISSA 4IE7A 4M1PA 5IHYA 2W62A 2DCFA 3BQKA 3IEEA 2X9WA 2YU2A 2CLYC 3FXDB 4UF0B 3KFWX 2W00A 4X1IE 5JRCB 3BQLA 1YD8G 4HTEA 2VL8A 2V7KA 3IBPA 5CA1E 1US7B 3N5LA 4EB6E 3LK42 3PUSA 4K0UA 4MALA 3SRZA 5KDMC 2CA5A 3KV9A 3CPZA 3MJXA 2BDEA 2PBIA 3PURA 1FMVA 3KV4A 4IHJE 4YFSA 2EHOA 4UELA 4GOUA 5L2LA 3EDVA 3LK2B 1CUNA 3RYIE 3HI2A 4UV9B 3I9YA 4I43B 4NUUA 2WMNA 4MFRA 3OJAA 1S35A 3BQIA 2LEHA 3N2GE 3B13A 3MA9A 1MMNA 2CM0A 5H6RB 3RPUA 5JREA 2ZM0A 1E1HB 4H9NC 3U78A 4AKLA 5CA0E 2GK9A 2IAKA 2MOZA 3AAAB 4PJNA 4TZ4C 4UIGA 4QKNA 3ZN0B 2E8IA 3F31A 2NTXA 3N9OA 3RX6A 5JDGA 1IJ6A 3T8OA 1G8XA 3MACA 5HXSA 2D5UA 3KBUA 4H9QC 5ETWA 3RC3A 3UUXB 5HXEA 4PW8A 2KINB 2L9QA 4ILUA 5LBMA 3J7Yq 2K9AA 5J2UE 3ZYKA 3EDUA 2CXLA 3M65A 1IJ5A 1SA0E 3KBTA 2KLQA 2NP9A 5LGTB 1D0XA 2D2SA 1NAFA 4EAHA 3WAKA 3RC8A 1Y64B 2DI4A 4E7SA 3OYXA 2C5IT 1U5PA 3UTKA 1LRZA 2JMKA 3CX7B 5EK4A 4TN7B 3KVBA 1ZV4X 4AKGA 4O2AE 3KINB 1ZKEA 2N9DA 2CEAA 5LGNB 2V7IA 5F8PA 3FBLA 1QUUA 2E9XB 4GK5E 3C50A 2L8KA 3CQXC 1BR1A 4UXNB 5HXRA 3R84B 4OYKA 3IHRA 2XQYA 1YW0A 4FI5A 4ZI3C 5FY1A 3ZCIA 4L0RA 4O4IE 4YHJA 1G73A 2LT3A 3ONXA 2KNDA 1U4QA 4PK5A 3SS1A 3K8PC 3WAJA 2JPFA 4X1YE 3UT5E 2XAHB 1BR2A 2XUEA 1S94A 5FYMA 2M67A 2VB6A 3ZYMA 1HG5A 2ODUA 3AVSA 2MBGA 5LG4A 3HL6A 3LJCA 4OFZA 4PFPA 2X9XA 4P09A 3C51A 2BVMA 4AQFC 2VKDA 5L3BB 3DP7A 2E9XC 3VKGA 1HCIA 2DHRA 4MBQA 5LJNA 2X9YA 2G0UA 4XBFB 3V5SA 3NZPA 3UUNA 4ADZA 4ANJA 4GYSA 1WR6A 4AKRB 3O1JA 2KXPB 2K5BB 2LSYA 3S4UA 4MLKA 2V7JA 3OYZA 4PK6A 3ZPOA 3CVRA 4YJ3E 3JC6D 4H9OC 2LOPA 2CE7A 3ZCJA 3ZJ2A 2VASA 3AB3B 1OXZA 3MKDA 4ZS3A 4QXBB 5L3DB 5LGUB 4GYRA 4L5GA 4IDZA 2X9HA 2VK9A 4KP3C 2A3DA 3QUJA 1ZEEA 3C4XA 3Q9DA 3LBXA 4I55E 4IIJE 4ZHQE 2LOSA 2V1DB 4H63V 1HTJF 2BZBA 5LCYA 3R6NA 3ZYLA 2BVLA 1HFAA 1KK7A 4F6RC 5FXXA 4I4TE 2RP4A 1NWMX 2XHEB 2XAGB 3GA8A 3O4XE 3VKHA 3W15B 3Q2MA 4WBNE 2CWOA 5FMNA 3P8CD 5JDMA 2JRKA 5JDQA 2A72A 2ACXA 4HFVA 3C4WA 5JDFA 3I0OA 2DNXA 3RH3A 4CZZB 1ZHCA 3D0TA 3ZN1B 3CKDA 2MTQA 1VOMA 4IE0A 2D0UA 2PG8A 3HKEE 3O1IA 2WWUA 2J1DG 1MMAA 2WSSV 3Q5XA 2NW7A 5HYAA 1UX5A 3ANWA 3N2KE 4G2AA 3ZJ1A 3ESLA 3PU3A 4CI1B 4AKIA 4PNIA 3KDSE 4BJMA 5CB4E 5EZYE 3CQGB 2HPLA 1KNZA 1H7CA 2ODVA 3FB2A 2X68A 5JVDE 4AXPA 2CXDA 2DLRA 1QSDA 3NRXA 2D0TA 4UVAB 3SWHA 4BJNA 3OKQA 5A1LA 1V9DA 3SOLA 4DBQA 2Y48B 4Z8XA 2Q9QD 2H7VC 4XZCA 1HG2A 2VKOA 3UUMA 1BR4A 1MNDA 2MYSA 5DQVA 3ZC1A 3H3AA 5JH7E 2JJ9A 3PU8A 4QHOA 5LXTE 3LBXB 1FIOA 5JR9A 4NUVA 2HPJA 4O8SA 3ZEFB 1UCUA 1D1CA 3L09A 4C91A 4TV8E 5EK2A 4CQIA 4CXWA 3PTRB 4JUYA 2LJLA 4C90A 5JDLA 3I1AA 4B6XA 4OK0A 2ZMAA 4TUYE 3KV6A 4TV9E 4PFOA 2HH7A 4OHFA 3RYHE 2EHOB 2L3LA 2WAUA 2Q9QA 3RRCA 2NW9A 4EZHA 2W61A 3UFEA 4YLHA 4CI3B 3E22E 2Y8DA 3MXZA 5DJQC 4ZI2C 3GN5A 1D1BA 3MK7C 1WRDA 3EVYA 4O2BE 4UEMA 2VKJA 1VRBA 1BR0A 4L9IA 4ERRA 1WYCA 2C0SA 3IF8B 2LHRA 3CX8B 2XAJB 3LK3B 5BMVE 4DMVA 5LHGB 2YEVC 4X20E 4QWNB 3ZC0A 3C64A 2CXFA 3N9MA 2W0GA 2EHOC 3ETVA 3F2EA 4HEAA 4ISTA 3ZMVB 3L3PA 3DJBA 3OBVE 1EZ3A 3QC9A 4DNDA 5HWYA 3RYFE 5JR9B 3DTOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LBM A;  2HH7 A;  5LCY A;  4ADZ A;  3AAI A;  4M1P A;  4UIG A;  5FMN A; 
#chains in the Genus database with same CATH topology
 4U74 A;  3I0Q A;  2LSG A;  2BBJ A;  3IA3 A;  2V8S V;  4DR3 T;  4DO0 A;  2E5L T;  3AAE B;  2V5C A;  2UXN B;  2WQY A;  4EYY R;  4P0B A;  3K3O A;  4CXY A;  3HKC E;  4U31 A;  5IYZ E;  2ZLY A;  2KMF A;  5LJM A;  4PJL A;  3Q5E A;  5TAO A;  3CX6 B;  2XQ5 A;  1LVK A;  3PE0 A;  2PTF A;  3P7I A;  2C5J A;  1UUR A;  4U33 A;  3AE5 A;  2KSR A;  5KX5 E;  5ABF B;  4DVD A;  5IWA T;  4DR6 T;  2CRB A;  2E9X D;  4Z91 A;  2N2N A;  3B5M A;  2KZ7 B;  2CMR A;  1O3X A;  1MIV A;  2LSI A;  1FMW A;  4YJ2 E;  3O9X A;  1YKE B;  2YOE A;  3RRW A;  4QXC B;  2I6H A;  3AA6 B;  4IL4 A;  3AA1 B;  3FHN A;  2LE8 A;  4PK4 A;  2V6Y B;  2WU2 A;  2XM1 A;  1HX8 A;  3HR0 A;  3CML A;  4ZZC A;  3UU4 A;  3ZT5 A;  4YSY A;  3PUA A;  4WBO A;  4DR4 T;  2WZI A;  5ADX L;  3P4R A;  2XAQ B;  2X0L B;  4GIW A;  2XAF B;  3LFM A;  1B7T A;  2YKS A;  2IC6 A;  4LF5 T;  4H9R C;  2W63 A;  1J5W A;  5LOV E;  3C98 B;  4DR1 T;  4U2Z A;  1HNW T;  3TLT A;  3P4P A;  2YIN A;  3PUX F;  4EXT A;  3ETU A;  5AQH B;  1XZY A;  1MIW A;  3A7M A;  3ZMT B;  3FZM B;  3EI0 A;  3UQ4 A;  4ZOL E;  1MNE A;  4H9S E;  4U7I A;  4JI5 T;  4LF4 T;  3KVA A;  3E0Z A;  5AQU B;  3ZST A;  1WLX A;  2WDV A;  2CCQ A;  5LG3 A;  4KUM B;  4WZX A;  3GMI A;  5LYJ E;  2NW8 A;  3RIU C;  4QXH B;  4JI4 T;  2OA5 A;  4H9P C;  5AQL B;  2EHO D;  1Z0P A;  4I0U A;  5AQI B;  2Q9Q C;  2VKH A;  3VR9 A;  4TWF A;  2DCF A;  4X1I E;  2V7K A;  3IBP A;  5HCM A;  4K0U A;  3AEB A;  2CBI A;  2PBI A;  2H89 A;  3KV4 A;  4GOU A;  1XDP A;  5L2L A;  4UV9 B;  2XSA A;  2WZH A;  3I9Y A;  4I43 B;  3OJA A;  4ZEY A;  4CN1 A;  5JRE A;  3B13 A;  5H6R B;  2ZM0 A;  3RLF F;  4AKL A;  5CA0 E;  1XWM A;  4PJN A;  3AAA B;  4UIG A;  4JBW F;  4X66 T;  2VL0 A;  3FZL B;  5JDG A;  2D5U A;  2LM2 A;  5F5W A;  5J2U E;  2LRL A;  3ZYK A;  2IHR 1;  2F4V T;  2D2S A;  4EAH A;  4U2Y A;  4YT0 A;  3RC8 A;  1Y64 B;  2C5I T;  1JNR A;  1U5P A;  3CX7 B;  4AKG A;  1DU2 A;  3ZT6 A;  3C50 A;  2L8K A;  3CQX C;  3R84 B;  4FI5 A;  4YHJ A;  1G73 A;  2XQ3 A;  2XZE A;  1U4Q A;  1FJG T;  2BG9 A;  4DV5 T;  5FYM A;  1HG5 A;  3HL6 A;  2W2U A;  4OFZ A;  4P09 A;  3C51 A;  3AE3 A;  2DHR A;  2X9Y A;  3V5S A;  4ADZ A;  4IL9 A;  4DR5 T;  1WR6 A;  4HWD A;  2KXP B;  3OPC A;  1GQE A;  4MLK A;  4PK6 A;  3K1S A;  3JC6 D;  3ZCJ A;  3ZJ2 A;  5L3D B;  2VAS A;  3MKD A;  2W66 A;  4L5G A;  4LFA T;  2FJB A;  2A3D A;  3QUJ A;  4I55 E;  5L4H A;  5LCY A;  3R6N A;  3X1D A;  1E2A A;  2BVL A;  2NR4 A;  1NWM X;  4WBN E;  3P8C D;  5JDQ A;  3C4W A;  2WP9 A;  4IE0 A;  2PG8 A;  2AXD S;  2FJD A;  3ESL A;  3A8Y C;  4HFE A;  5CB4 E;  1HNX T;  2XY8 B;  2X68 A;  2K3W A;  3OKQ A;  5IUX A;  1HX1 B;  1HG2 A;  5JH7 E;  2A9U A;  2JJ9 A;  3PU8 A;  5LXT E;  3LBX B;  2WCA A;  3PTR B;  4JUY A;  4B6X A;  2FBW A;  4TV9 E;  4OHF A;  5AQR B;  3AXJ A;  3AE8 A;  3RRC A;  2NW9 A;  1XMO T;  2UXB T;  4CI3 B;  1WR0 A;  3E22 E;  1NEN A;  4ZI2 C;  4UEM A;  1BR0 A;  3IF8 B;  3CX8 B;  2XAJ B;  3LK3 B;  2IIU A;  4DMV A;  3C64 A;  2CXF A;  3N9M A;  2W0G A;  1J1J A;  3OBV E;  5ABF A;  4KI0 F;  1XNQ T;  5HWY A;  5JR9 B;  2JQQ A;  3NZQ A;  4UVB B;  3AE2 A;  2I59 A;  1HR0 T;  2CHO A;  4HWI B;  5L3G B;  2RA1 A;  3CK6 A;  1KNP A;  4UV8 B;  4PJM A;  4AIS A;  2JMH A;  3MZK B;  4HN9 A;  5AQP B;  3PUG A;  2CPT A;  2FJA A;  4ILB A;  4QX8 B;  3ZLI A;  4HKA A;  4DBR A;  5H6Q B;  4ZI3 D;  2DWK A;  2XAS B;  3TKL B;  5J1G A;  2V6Y A;  3AED A;  5GON E;  1SE7 A;  2NOX A;  4Z90 A;  5KXJ A;  3PUQ A;  4KBM B;  2UUA T;  1XMQ T;  3HA4 A;  4KHZ F;  4JEH B;  4JV5 T;  2H7O A;  2ZM8 A;  4IDO A;  2PFV A;  2CHN A;  2JIW A;  2XTL A;  2BG9 C;  2CBJ A;  3BK9 A;  1Y01 A;  1YKH B;  5AFU L;  2A2F X;  5FKY A;  2WY2 A;  5HXH A;  3NBX X;  3QOF A;  4GKJ T;  3LG7 A;  1HNZ T;  2V26 A;  1FEW A;  2DWG A;  1N33 T;  3UUL A;  2Z6E A;  1W0A A;  2VUR A;  4P0A A;  2X66 A;  3P4S A;  2YK0 A;  4JLE A;  4DMW A;  4MHC A;  5ABG A;  2XM2 A;  3CQC B;  4J2C A;  5JQG E;  3ZMU B;  2XQA A;  3RQU A;  2KT9 A;  5C8Y E;  2IW5 B;  5AQK B;  5CFB A;  1VCS A;  2B76 A;  2UXX B;  3U3I A;  2NWB A;  4HFI A;  3OTO T;  4U7Y A;  1WYB A;  1HF8 A;  3WI3 A;  1X9B A;  2X0H A;  5M4Y A;  3N9P A;  3G06 A;  3FBZ A;  5FP3 A;  1IAP A;  2WBL A;  5DAB A;  3TLW A;  3AXJ B;  5LHH B;  3AEF A;  2ACZ A;  5LBQ B;  1YQ4 A;  2XQ6 A;  3AAI A;  4V1A v;  1X79 A;  2BBH A;  2E5V A;  3FZF B;  2XQ7 A;  4X1K E;  3B57 A;  1D1A A;  4ZXL A;  4QH1 A;  4M1P A;  5JRC B;  2W00 A;  3VRB A;  1US7 B;  3N5L A;  4EB6 E;  2BDE A;  1FMV A;  3EAB A;  3HI2 A;  4YHH T;  2WMN A;  1S35 A;  3RKG A;  3BQI A;  2LEH A;  2CM0 A;  4LF6 T;  2IAK A;  1R8I A;  2R6G F;  2H88 A;  3ZN0 B;  2NTX A;  3SFE A;  3T8O A;  3PUV F;  3MAC A;  2KIN B;  2VQF T;  3M65 A;  3KBT A;  5LGT B;  1OED E;  4JI7 T;  4EV6 A;  4X5T A;  2OLT A;  1N34 T;  3FZK B;  3RQW A;  4HWC A;  3UU8 A;  4TN7 B;  1ZV4 X;  3KIN B;  1IBM T;  2N9D A;  5ABE A;  3FBL A;  2WS3 A;  5HEO A;  3IHR A;  3ZCI A;  4L0R A;  4O4I E;  3ONX A;  2KND A;  3WAJ A;  1UUS A;  2JPF A;  3UT5 E;  5LG4 A;  3AVS A;  2MBG A;  3FZH B;  2X9X A;  5L3B B;  1HCI A;  2G0U A;  2UXC T;  3NZP A;  3UUN A;  4ANJ A;  4DV1 T;  3O1J A;  4LF9 T;  2K5B B;  3S4U A;  3CVR A;  2LOP A;  2CE7 A;  1OXZ A;  1J5E T;  4IDZ A;  5AQO B;  2X9H A;  2VK9 A;  4DR2 T;  3Q9D A;  3LBX A;  3UUB A;  2BZB A;  4NPP A;  3QNU A;  3AEE A;  3O4X E;  3W15 B;  4HFV A;  3D0T A;  3ZN1 B;  2MTQ A;  1VOM A;  3T1Y T;  2J1D G;  3EAM A;  3ZJ1 A;  4G2A A;  3PU3 A;  4AKI A;  3AE1 A;  3KDS E;  2VVN A;  4YXD A;  2YDS A;  2DLR A;  4UVA B;  1QSD A;  4BJN A;  5A1L A;  3SOL A;  4DBQ A;  2Y48 B;  2Q9Q D;  4XZC A;  2VKO A;  3UUM A;  1MND A;  5L47 A;  5JR9 A;  4O8S A;  3ZEF B;  3CIR A;  4C91 A;  4TV8 E;  5EK2 A;  5JDL A;  3I1A A;  4TUY E;  3KV6 A;  2HH7 A;  3RYH E;  4B3R T;  1OED A;  3LDQ B;  3TLS A;  2V5D A;  3MK7 C;  1WRD A;  3EVY A;  1Z8U A;  4L9I A;  4ERR A;  2LHR A;  3PJA J;  4DV3 T;  5LHG B;  5FVK A;  3ZC0 A;  5HCJ A;  3ETV A;  2WDQ A;  3ZMV B;  4TWH A;  2YN6 A;  4LFC T;  3QC9 A;  2MAW A;  3RYF E;  4JYA T;  3DTO A;  2BS4 A;  3VHL A;  4JI0 T;  2X0Y A;  1YXR A;  4LML A;  4GKK T;  2QYW A;  1T7S A;  3ZMZ B;  5HAX A;  5L3C B;  4DID B;  3T1H T;  4DV0 T;  2YU1 A;  2XQ4 A;  2QA7 A;  4JEU B;  3PUZ F;  4EED A;  4IGU A;  3NVO A;  4HE8 A;  3KV5 A;  3PDY A;  1UGO A;  4ZS2 A;  4O4H E;  3RIF A;  4TNW A;  1HS7 A;  4AQG A;  3JAF A;  2M6I A;  2VQE T;  4IDN A;  3RYC E;  3UU5 A;  4IE6 A;  3A5X A;  1UX4 A;  4IE4 A;  2IC9 A;  2PJQ A;  3P4Q A;  3I9W A;  5FVL A;  2E9X A;  3E08 A;  4COF A;  3N2O A;  1IZN B;  4UVC B;  4GK0 E;  4A56 A;  1W9R A;  3ZT7 A;  3K3Q C;  3EHZ A;  2XQ8 A;  4DR7 T;  3HKD E;  5HEU A;  2LSJ A;  4BA9 A;  4DUZ T;  4LF8 T;  1T8B A;  1SHZ C;  1AJ3 A;  2Y6X A;  2HHH T;  4I50 E;  4H63 H;  5FNV E;  1MMD A;  2H3R A;  1VCT A;  2SPC A;  4K0K T;  3ZSS A;  4B3M T;  3M3Z B;  4U72 A;  3PUW F;  3VR8 A;  2KWH A;  3N9L A;  2NTY A;  4IDQ A;  5E0O A;  5CJ5 A;  2X67 A;  4QH5 A;  2D9D A;  1IBL T;  3OVU A;  4AKH A;  3F57 A;  5JRC A;  4OYJ A;  3N9N A;  4PAG A;  4E7Z A;  4HFC A;  5AQG B;  2K48 A;  1T98 A;  5AQM B;  1QLB A;  4EYU A;  3AA0 B;  3H3M A;  5JDH A;  5LNK A;  1D0Y A;  4YTM A;  4U3C A;  1OED B;  4KHP T;  2N1G A;  2HN2 A;  3CWZ B;  4G63 A;  4BAY B;  5C2T A;  4LFB T;  2CLY B;  3RKO A;  4ZI2 D;  5FY7 A;  4O4J E;  5F3J A;  5J2T E;  4ZI7 E;  5JR9 C;  3K3N A;  3ZMS B;  2VWA A;  5AQT B;  3AVR A;  4CXX A;  1LKX A;  1MMG A;  4ILA A;  4KMC A;  2LKH A;  2LHN A;  2XQ9 A;  5FXZ A;  3FXE B;  4EZ4 A;  4ISS A;  4A97 A;  5IHY A;  4IRE A;  3IEE A;  2X9W A;  2YU2 A;  2CLY C;  4UF0 B;  3KFW X;  1YD8 G;  2IML A;  2VL8 A;  2BS3 A;  3AEG A;  5ABH A;  5KDM C;  2CA5 A;  3KV9 A;  2UUB T;  3PUR A;  4YFS A;  2EHO A;  4UEL A;  1CUN A;  2OV9 A;  4NUU A;  4MFR A;  3N2G E;  3MA9 A;  3RPU A;  2BKO A;  4H9N C;  1E1H B;  3U78 A;  4TZ4 C;  3UU6 A;  4NIQ A;  2UXD T;  2E8I A;  3RIA A;  4Q25 A;  3RX6 A;  1KEY A;  1IJ6 A;  1G8X A;  4H9Q C;  3RC3 A;  3UUX B;  4ILU A;  2JQK A;  5LBM A;  4HFD A;  2K9A A;  3EDU A;  2KLQ A;  2NP9 A;  2DL1 A;  1NAF A;  2QRX A;  3OYX A;  3UTK A;  2JMK A;  3KVB A;  4O2A E;  2CEA A;  2V7I A;  1QUU A;  3AE7 A;  2E9X B;  1BR1 A;  4UXN B;  5FY1 A;  1ZP0 A;  3SS1 A;  4WYV A;  4X1Y E;  2LLY A;  2XAH B;  5CGM A;  1BR2 A;  1S94 A;  4HWH A;  4TWD A;  2ODU A;  2WDR A;  3LJC A;  4PFP A;  2BVM A;  2E9X C;  5LJN A;  4HFB A;  4QH4 A;  4AKR B;  2V7J A;  3OYZ A;  4F8H A;  4H9O C;  5LGU B;  3AB3 B;  4YSZ A;  2IDO B;  4LMJ A;  4YTP A;  3C4X A;  4IIJ E;  4ZHQ E;  4NXM T;  1HTJ F;  2XSB A;  1HFA A;  5FXX A;  2W67 A;  5AQN B;  2XHE B;  3VKH A;  4X62 T;  3Q2M A;  2WB5 A;  2FUP A;  5FMN A;  5JDM A;  2JRK A;  4DV6 T;  5JDF A;  4CZZ B;  2DNX A;  3RH3 A;  1ZHC A;  3ZKR A;  3O1I A;  2NW7 A;  5HYA A;  1UX5 A;  3ANW A;  4PNI A;  4BJM A;  1UK5 A;  3L8R A;  4B3T T;  1KNZ A;  4AXP A;  3NRX A;  2D0T A;  3SWH A;  1V9D A;  1BR4 A;  5DQV A;  4JI1 T;  4QHO A;  3JCF A;  1IBK T;  2HPJ A;  5C3J A;  3ONJ A;  3SFD A;  4OK0 A;  4PFO A;  2EHO B;  2BS2 A;  2L3L A;  2WAU A;  3AE9 A;  3RGL A;  1JNZ A;  2W61 A;  3UFE A;  2Y8D A;  3MXZ A;  1D1B A;  4KX6 A;  2VKJ A;  1VRB A;  1WYC A;  2FJE A;  2C0S A;  5AQS B;  2E2A A;  2BKP A;  2YEV C;  2EHO C;  3L3P A;  3DJB A;  1N36 T;  5HEJ A;  2UUC T;  4DND A;  3RF1 A;  2BG9 E;  4B3S T;  2X51 A;  1CHU A;  5BR8 T;  1OWA A;  2Q9Q B;  5HEG A;  4O4L E;  2JQH A;  5L3F B;  1MIY A;  3GN5 B;  3GWH A;  4CN6 A;  3H37 A;  4YSX A;  4FJO A;  2V6X A;  2ES0 A;  1LVF A;  3N9Q A;  5DQW A;  1M7K A;  4EOZ B;  4A5X A;  5JTG A;  4QX7 B;  2WM9 A;  2YDQ A;  2J62 A;  3AA7 B;  3C4Z A;  3UFG A;  4IT4 A;  3AE4 A;  2YDR A;  2V7L A;  4IE5 A;  5KMG P;  4JI3 T;  4EEB A;  2P9B A;  3Q5W A;  2ZM2 A;  4XAX B;  2LRK A;  5LHI B;  2WU5 A;  4AQF A;  5EK3 A;  5FXV A;  4WW0 A;  2J4G A;  4PJJ A;  5LMU T;  2CWY A;  4HGA A;  2RPA A;  3QK6 A;  4TX5 A;  3TLU A;  4P1N A;  4EIW A;  2V7M A;  3V5U A;  2ZM6 T;  5LA6 E;  3PJA A;  4N78 D;  2BKN A;  2KWI B;  4LF7 T;  3O1H A;  5AQV B;  1D0Z A;  2QGS A;  1WCR A;  3ANW B;  3ONL C;  2K24 A;  1I6Z A;  3NKZ A;  4AQY T;  5AQQ B;  3JC6 C;  3HKB E;  5FY0 A;  2LM9 A;  4CI2 B;  4UF0 A;  1WFD A;  2AE9 A;  2HN1 A;  4HFH A;  5L3E B;  3J9X 1;  5HXC A;  2B1E A;  3EUH A;  2LKG A;  3JAD A;  2LSK A;  4WNK A;  4AI6 A;  5FL0 A;  2JQ9 A;  3VU7 H;  4LMK A;  3TLV A;  5FXW A;  2WMO A;  5LP6 E;  3NRY A;  4ASK A;  5J0Z A;  2C5K T;  5JDN A;  5HEH A;  3AE6 A;  1N32 T;  4NXN T;  5HWX A;  2MPK A;  4CN4 A;  2W4X A;  4IE7 A;  2W62 A;  3BQK A;  4X65 T;  4X64 T;  3FXD B;  3BQL A;  4HTE A;  3NWI A;  5CA1 E;  3LK4 2;  3L39 A;  3PUS A;  4MAL A;  3SRZ A;  3CPZ A;  3MJX A;  4IHJ E;  3EDV A;  3LK2 B;  3RYI E;  1M62 A;  4ZZB A;  4EGW A;  1MMN A;  3LSV A;  2GK9 A;  2MOZ A;  4QKN A;  2M6B A;  2IUB A;  3QB5 K;  3F31 A;  3UU3 A;  3N9O A;  5AQF B;  5HXS A;  3KBU A;  5ETW A;  5HXE A;  4PW8 A;  4JI2 T;  2L9Q A;  3J7Y q;  2CXL A;  1IJ5 A;  3ABV A;  2UU9 T;  1SA0 E;  4YY3 T;  1D0X A;  3WAK A;  2DI4 A;  4E7S A;  1I94 T;  1LRZ A;  1XNR T;  5EK4 A;  1W0B A;  4OX9 T;  1ZKE A;  5LGN B;  5F8P A;  1KFY A;  4GK5 E;  5HXR A;  4OYK A;  2XQY A;  1YW0 A;  3P50 A;  4ZI3 C;  5AQJ B;  2LT3 A;  4PK5 A;  3K8P C;  1SUM B;  1KF6 A;  2XUE A;  2M67 A;  2VB6 A;  3ZYM A;  4IDP A;  1L0V A;  4AQF C;  1W09 A;  2VKD A;  3DP7 A;  3VKG A;  4MBQ A;  5LB7 B;  4XBF B;  4YTN A;  4GYS A;  2LSY A;  4A98 A;  3ZPO A;  2XPK A;  4YJ3 E;  1KNR A;  4ZS3 A;  4QXB B;  1OED C;  4GYR A;  3AEA A;  4KP3 C;  1ZEE A;  5LMN T;  2LOS A;  2V1D B;  4H63 V;  3PUY F;  2XJ7 A;  4HWF A;  3ZYL A;  1KK7 A;  4F6R C;  4I4T E;  4TNV A;  2RP4 A;  4UR9 A;  2XAG B;  3GA8 A;  2BG9 B;  5L4E A;  2CWO A;  2A72 A;  2ACX A;  3I0O A;  3CKD A;  1ZOY A;  2D0U A;  1YQ3 A;  3HKE E;  2WWU A;  3UQ7 A;  1MMA A;  2WSS V;  3Q5X A;  3VRA A;  3N2K E;  4CI1 B;  4AIU A;  5EZY E;  3CQG B;  2HPL A;  1H7C A;  2ODV A;  3FB2 A;  5JVD E;  2CXD A;  2QVA A;  4Z8X A;  2H7V C;  1XDO A;  2MYS A;  3ZC1 A;  3H3A A;  4JI8 T;  2WWV A;  4DUY T;  1FIO A;  4NUV A;  1UCU A;  1D1C A;  3L09 A;  4CQI A;  4CXW A;  3RHW A;  2LJL A;  4C90 A;  2I0M A;  3RIU A;  3RI5 A;  2ZMA A;  3QB5 A;  1NEK A;  2Q9Q A;  3AEC A;  3P4W A;  2J47 A;  3JAE A;  4EZH A;  4DV2 T;  4DV4 T;  4YLH A;  3Q5D A;  5DJQ C;  3GN5 A;  4O2B E;  4JI6 T;  1T72 A;  3PV0 F;  4DV7 T;  1E7P A;  5BMV E;  5FL1 A;  4X20 E;  4QWN B;  3F2E A;  4HEA A;  4IST A;  1EZ3 A;  2VVS A;  4ILC A; 
#chains in the Genus database with same CATH homology
 2JQQ A;  3NZQ A;  3VHL A;  4U74 A;  4UVB B;  3I0Q A;  2LSG A;  2I59 A;  2X51 A;  5L3G B;  2RA1 A;  3ZMZ B;  4UV8 B;  5HAX A;  4DO0 A;  5L3C B;  4PJM A;  3AAE B;  1OWA A;  2JMH A;  2Q9Q B;  2UXN B;  4O4L E;  4EYY R;  3MZK B;  4P0B A;  3K3O A;  4HN9 A;  4CXY A;  3PUG A;  2YU1 A;  5L3F B;  3HKC E;  2QA7 A;  1MIY A;  3GN5 B;  4JEU B;  5IYZ E;  2ZLY A;  2KMF A;  4QX8 B;  3ZLI A;  4HKA A;  3GWH A;  5LJM A;  4PJL A;  4DBR A;  5H6Q B;  4ZI3 D;  2DWK A;  2XAS B;  5TAO A;  4IGU A;  4HE8 A;  3CX6 B;  3H37 A;  3TKL B;  1LVK A;  5J1G A;  3KV5 A;  3PE0 A;  5GON E;  3P7I A;  4FJO A;  2C5J A;  3PDY A;  2ES0 A;  2NOX A;  1LVF A;  3PUQ A;  4KBM B;  4ZS2 A;  4O4H E;  3N9Q A;  5DQW A;  5KX5 E;  4DVD A;  4EOZ B;  3HA4 A;  1HS7 A;  4AQG A;  2E9X D;  2N2N A;  4JEH B;  2H7O A;  2ZM8 A;  4QX7 B;  2WM9 A;  2PFV A;  3AA7 B;  3C4Z A;  2KZ7 B;  2CMR A;  1O3X A;  3RYC E;  1MIV A;  2LSI A;  4IE6 A;  1FMW A;  4YJ2 E;  2V7L A;  3A5X A;  1UX4 A;  4IE5 A;  4IE4 A;  5KMG P;  2P9B A;  2IC9 A;  2PJQ A;  3O9X A;  3Q5W A;  2ZM2 A;  2XTL A;  4XAX B;  1YKE B;  3BK9 A;  3I9W A;  1YKH B;  5LHI B;  3RRW A;  4QXC B;  5AFU L;  2A2F X;  3AA6 B;  4AQF A;  2E9X A;  5HXH A;  3NBX X;  5EK3 A;  5FXV A;  3E08 A;  4WW0 A;  3LG7 A;  4PJJ A;  2V26 A;  3N2O A;  1IZN B;  4UVC B;  3AA1 B;  4GK0 E;  2CWY A;  3FHN A;  4A56 A;  1FEW A;  4HGA A;  2LE8 A;  4PK4 A;  3QK6 A;  2DWG A;  4TX5 A;  4EIW A;  3K3Q C;  2V7M A;  1HX8 A;  3HR0 A;  3HKD E;  2LSJ A;  3CML A;  3UUL A;  2Z6E A;  3V5U A;  4BA9 A;  1SHZ C;  1AJ3 A;  5LA6 E;  3PUA A;  4P0A A;  2Y6X A;  4I50 E;  4N78 D;  2X66 A;  4H63 H;  4WBO A;  2YK0 A;  5FNV E;  2KWI B;  4JLE A;  3O1H A;  4DMW A;  4MHC A;  1MMD A;  2H3R A;  1D0Z A;  2QGS A;  2SPC A;  3ANW B;  3CQC B;  4J2C A;  4U72 A;  5JQG E;  5ADX L;  3ZMU B;  2XAQ B;  2X0L B;  4GIW A;  5C8Y E;  2KT9 A;  2K24 A;  2IW5 B;  2XAF B;  3LFM A;  2KWH A;  3N9L A;  2NTY A;  5E0O A;  3JC6 C;  2UXX B;  3HKB E;  1B7T A;  5FY0 A;  2LM9 A;  4CI2 B;  2IC6 A;  2X67 A;  4H9R C;  2W63 A;  3U3I A;  2NWB A;  4AKH A;  3F57 A;  4UF0 A;  5LOV E;  5JRC A;  3C98 B;  4OYJ A;  3N9N A;  1WYB A;  4PAG A;  1HF8 A;  3WI3 A;  4E7Z A;  5L3E B;  2K48 A;  3J9X 1;  1T98 A;  2YIN A;  5M4Y A;  5HXC A;  4EXT A;  2B1E A;  3EUH A;  3N9P A;  3AA0 B;  4EYU A;  5JDH A;  3FBZ A;  3ETU A;  1D0Y A;  5LNK A;  1MIW A;  5FP3 A;  1IAP A;  2WBL A;  5DAB A;  2LSK A;  3ZMT B;  5LHH B;  4WNK A;  2N1G A;  4AI6 A;  4ZOL E;  3CWZ B;  4G63 A;  4BAY B;  5LBQ B;  1MNE A;  2CLY B;  3RKO A;  4H9S E;  3VU7 H;  3AAI A;  4ZI2 D;  3KVA A;  5FY7 A;  3E0Z A;  4O4J E;  5FXW A;  5F3J A;  5J2T E;  4V1A v;  4ZI7 E;  2WMO A;  5JR9 C;  3K3N A;  5LP6 E;  3ZMS B;  1WLX A;  1X79 A;  3NRY A;  2VWA A;  2CCQ A;  4KUM B;  4ASK A;  3AVR A;  3GMI A;  4CXX A;  5LYJ E;  1LKX A;  2NW8 A;  1MMG A;  4KMC A;  4QXH B;  2C5K T;  2OA5 A;  4H9P C;  4X1K E;  3B57 A;  5JDN A;  2LHN A;  2EHO D;  1Z0P A;  5HWX A;  5FXZ A;  3FXE B;  4EZ4 A;  1D1A A;  2Q9Q C;  2VKH A;  4ISS A;  4IE7 A;  4M1P A;  5IHY A;  2W62 A;  2DCF A;  3BQK A;  3IEE A;  2X9W A;  2YU2 A;  2CLY C;  3FXD B;  4UF0 B;  3KFW X;  2W00 A;  4X1I E;  5JRC B;  3BQL A;  1YD8 G;  4HTE A;  2VL8 A;  2V7K A;  3IBP A;  5CA1 E;  1US7 B;  3N5L A;  4EB6 E;  3LK4 2;  3PUS A;  4K0U A;  4MAL A;  3SRZ A;  5KDM C;  2CA5 A;  3KV9 A;  3CPZ A;  3MJX A;  2BDE A;  2PBI A;  3PUR A;  1FMV A;  3KV4 A;  4IHJ E;  4YFS A;  2EHO A;  4UEL A;  4GOU A;  5L2L A;  3EDV A;  3LK2 B;  1CUN A;  3RYI E;  3HI2 A;  4UV9 B;  3I9Y A;  4I43 B;  4NUU A;  2WMN A;  4MFR A;  3OJA A;  1S35 A;  3BQI A;  2LEH A;  3N2G E;  3B13 A;  3MA9 A;  1MMN A;  2CM0 A;  5H6R B;  3RPU A;  5JRE A;  2ZM0 A;  1E1H B;  4H9N C;  3U78 A;  4AKL A;  5CA0 E;  2GK9 A;  2IAK A;  2MOZ A;  3AAA B;  4PJN A;  4TZ4 C;  4UIG A;  4QKN A;  3ZN0 B;  2E8I A;  3F31 A;  2NTX A;  3N9O A;  3RX6 A;  5JDG A;  1IJ6 A;  3T8O A;  1G8X A;  3MAC A;  5HXS A;  2D5U A;  3KBU A;  4H9Q C;  5ETW A;  3RC3 A;  3UUX B;  5HXE A;  4PW8 A;  2KIN B;  2L9Q A;  4ILU A;  5LBM A;  3J7Y q;  2K9A A;  5J2U E;  3ZYK A;  3EDU A;  2CXL A;  3M65 A;  1IJ5 A;  1SA0 E;  3KBT A;  2KLQ A;  2NP9 A;  5LGT B;  1D0X A;  2D2S A;  1NAF A;  4EAH A;  3WAK A;  3RC8 A;  1Y64 B;  2DI4 A;  4E7S A;  3OYX A;  2C5I T;  1U5P A;  3UTK A;  1LRZ A;  2JMK A;  3CX7 B;  5EK4 A;  4TN7 B;  3KVB A;  1ZV4 X;  4AKG A;  4O2A E;  3KIN B;  1ZKE A;  2N9D A;  2CEA A;  5LGN B;  2V7I A;  5F8P A;  3FBL A;  1QUU A;  2E9X B;  4GK5 E;  3C50 A;  2L8K A;  3CQX C;  1BR1 A;  4UXN B;  5HXR A;  3R84 B;  4OYK A;  3IHR A;  2XQY A;  1YW0 A;  4FI5 A;  4ZI3 C;  5FY1 A;  3ZCI A;  4L0R A;  4O4I E;  4YHJ A;  1G73 A;  2LT3 A;  3ONX A;  2KND A;  1U4Q A;  4PK5 A;  3SS1 A;  3K8P C;  3WAJ A;  2JPF A;  4X1Y E;  3UT5 E;  2XAH B;  1BR2 A;  2XUE A;  1S94 A;  5FYM A;  2M67 A;  2VB6 A;  3ZYM A;  1HG5 A;  2ODU A;  3AVS A;  2MBG A;  5LG4 A;  3HL6 A;  3LJC A;  4OFZ A;  4PFP A;  2X9X A;  4P09 A;  3C51 A;  2BVM A;  4AQF C;  2VKD A;  5L3B B;  3DP7 A;  2E9X C;  3VKG A;  1HCI A;  2DHR A;  4MBQ A;  5LJN A;  2X9Y A;  2G0U A;  4XBF B;  3V5S A;  3NZP A;  3UUN A;  4ADZ A;  4ANJ A;  4GYS A;  1WR6 A;  4AKR B;  3O1J A;  2KXP B;  2K5B B;  2LSY A;  3S4U A;  4MLK A;  2V7J A;  3OYZ A;  4PK6 A;  3ZPO A;  3CVR A;  4YJ3 E;  3JC6 D;  4H9O C;  2LOP A;  2CE7 A;  3ZCJ A;  3ZJ2 A;  2VAS A;  3AB3 B;  1OXZ A;  3MKD A;  4ZS3 A;  4QXB B;  5L3D B;  5LGU B;  4GYR A;  4L5G A;  4IDZ A;  2X9H A;  2VK9 A;  4KP3 C;  2A3D A;  3QUJ A;  1ZEE A;  3C4X A;  3Q9D A;  3LBX A;  4I55 E;  4IIJ E;  4ZHQ E;  2LOS A;  2V1D B;  4H63 V;  1HTJ F;  2BZB A;  5LCY A;  3R6N A;  3ZYL A;  2BVL A;  1HFA A;  1KK7 A;  4F6R C;  5FXX A;  4I4T E;  2RP4 A;  1NWM X;  2XHE B;  2XAG B;  3GA8 A;  3O4X E;  3VKH A;  3W15 B;  3Q2M A;  4WBN E;  2CWO A;  5FMN A;  3P8C D;  5JDM A;  2JRK A;  5JDQ A;  2A72 A;  2ACX A;  4HFV A;  3C4W A;  5JDF A;  3I0O A;  2DNX A;  3RH3 A;  4CZZ B;  1ZHC A;  3D0T A;  3ZN1 B;  3CKD A;  2MTQ A;  1VOM A;  4IE0 A;  2D0U A;  2PG8 A;  3HKE E;  3O1I A;  2WWU A;  2J1D G;  1MMA A;  2WSS V;  3Q5X A;  2NW7 A;  5HYA A;  1UX5 A;  3ANW A;  3N2K E;  4G2A A;  3ZJ1 A;  3ESL A;  3PU3 A;  4CI1 B;  4AKI A;  4PNI A;  3KDS E;  4BJM A;  5CB4 E;  5EZY E;  3CQG B;  2HPL A;  1KNZ A;  1H7C A;  2ODV A;  3FB2 A;  2X68 A;  5JVD E;  4AXP A;  2CXD A;  2DLR A;  1QSD A;  3NRX A;  2D0T A;  4UVA B;  3SWH A;  4BJN A;  3OKQ A;  5A1L A;  1V9D A;  3SOL A;  4DBQ A;  2Y48 B;  4Z8X A;  2Q9Q D;  2H7V C;  4XZC A;  1HG2 A;  2VKO A;  3UUM A;  1BR4 A;  1MND A;  2MYS A;  5DQV A;  3ZC1 A;  3H3A A;  5JH7 E;  2JJ9 A;  3PU8 A;  4QHO A;  5LXT E;  3LBX B;  1FIO A;  5JR9 A;  4NUV A;  2HPJ A;  4O8S A;  3ZEF B;  1UCU A;  1D1C A;  3L09 A;  4C91 A;  4TV8 E;  5EK2 A;  4CQI A;  4CXW A;  3PTR B;  4JUY A;  2LJL A;  4C90 A;  5JDL A;  3I1A A;  4B6X A;  4OK0 A;  2ZMA A;  4TUY E;  3KV6 A;  4TV9 E;  4PFO A;  2HH7 A;  4OHF A;  3RYH E;  2EHO B;  2L3L A;  2WAU A;  2Q9Q A;  3RRC A;  2NW9 A;  4EZH A;  2W61 A;  3UFE A;  4YLH A;  4CI3 B;  3E22 E;  2Y8D A;  3MXZ A;  5DJQ C;  4ZI2 C;  3GN5 A;  1D1B A;  3MK7 C;  1WRD A;  3EVY A;  4O2B E;  4UEM A;  2VKJ A;  1VRB A;  1BR0 A;  4L9I A;  4ERR A;  1WYC A;  2C0S A;  3IF8 B;  2LHR A;  3CX8 B;  2XAJ B;  3LK3 B;  5BMV E;  4DMV A;  5LHG B;  2YEV C;  4X20 E;  4QWN B;  3ZC0 A;  3C64 A;  2CXF A;  3N9M A;  2W0G A;  2EHO C;  3ETV A;  3F2E A;  4HEA A;  4IST A;  3ZMV B;  3L3P A;  3DJB A;  3OBV E;  1EZ3 A;  3QC9 A;  4DND A;  5HWY A;  3RYF E;  5JR9 B;  3DTO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...