5LBMA

The asymmetric tetrameric structure of the formaldehyde sensing transcriptional repressor frmr from escherichia coli
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
83
structure length
83
Chain Sequence
KKVLTRVRRIRGQIDALERSLEGDAECRAILQQIAAVRGAANGLMAEVLESHIRETFDRNDCYSREVSQSVDDTIELVRAYLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcriptional repressor FrmR
publication title The mechanism of a formaldehyde-sensing transcriptional regulator.
pubmed doi rcsb
source organism Escherichia coli o157:h7
total genus 33
structure length 83
sequence length 83
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02583 Trns_repr_metal Metal-sensitive transcriptional repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1000 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5lbmA00
5FMNA 3AAIA 4ADZA 4UIGA 2HH7A 4M1PA 5LCYA 5LBMA
chains in the Genus database with same CATH superfamily
3U3IA 3ZT5A 4KMCA 4M1PA 3QOFA 5IYZE 5LHIB 2BG9C 2A2FX 3P4RA 2L8KA 2X66A 3FXEB 3ZJ1A 5FMNA 3K8PC 3BQKA 4QWNB 2XM2A 3Q5EA 1WR6A 4JI0T 4LF9T 3PURA 3RIAA 5AQTB 2IMLA 2XQ6A 3UU5A 3UUNA 3SFDA 1HNWT 3VU7H 3J9X1 3UU3A 5BR8T 4GOUA 5FXZA 3FBLA 1ZKEA 3RYIE 3WI3A 3AXJB 2LSIA 3C4XA 3O4XE 4IIJE 2LSGA 2RA1A 4WW0A 2K24A 4IL4A 1YKEB 3C50A 5LJNA 2IHR1 4B3ST 2E9XD 4QH5A 2XZEA 2CCQA 5KX5E 2HN1A 3CX6B 4ERRA 4X1KE 2KNDA 2W0GA 3P4QA 2BG9E 2B1EA 2HH7A 2RP4A 2VVNA 3A7MA 3S4UA 4AQFC 2ES0A 2MTQA 3MA9A 4EZHA 3K3NA 2Q9QC 4GKKT 3ZT6A 1KNZA 4V1Av 5FXXA 4PJMA 5E0OA 1MMGA 4ISTA 2BS2A 4WBNE 5AQKB 4KHPT 5FXWA 4PJLA 3SRZA 4DVDA 3NRYA 4YSYA 1MNDA 4PK6A 3LBXB 4AKIA 2W63A 5ABEA 5HYAA 2R6GF 2KINB 1UX5A 3I1AA 4IE4A 2NR4A 2XY8B 3KBUA 3O1JA 1LVKA 4ILCA 4OFZA 4LFAT 3NWIA 3RH3A 3RRCA 1ZEEA 4P0BA 3JCFA 2DWGA 5FL1A 3AE6A 3OYZA 3N9LA 4JEHB 5AQQB 1XMOT 3PUYF 4YTMA 1SE7A 2XQ3A 3VRBA 2E9XA 5M4YA 2IDOB 2XTLA 5L2LA 1KFYA 3AE9A 3PUQA 5KMGP 2A9UA 2X9HA 3SOLA 4DR2T 4WZXA 2X0HA 3UQ4A 3RIFA 4DR5T 3AEBA 4UF0B 3N9QA 5L3CB 1E1HB 5HEGA 1OWAA 5LB7B 1W0BA 4JI5T 4IDZA 3D0TA 1Y64B 3T1YT 3N2OA 3AE1A 2BBJA 2QA7A 4JEUB 3HR0A 1WCRA 4CI2B 2W61A 3MK7C 3RPUA 4UVCB 3AE3A 5AQHB 2M67A 3FZFB 3KV9A 3JADA 1I94T 2QRXA 4B6XA 3PUVF 2E8IA 3FHNA 4I43B 3N9MA 1HG2A 2LHRA 1UCUA 5JDMA 3FZLB 3NRXA 2L9QA 5LP6E 1XNRT 1ZHCA 4CXXA 2CM0A 2CRBA 2UUAT 3UQ7A 2WY2A 3PUXF 1MIYA 1U4QA 2IW5B 4QX8B 3A8YC 4YHHT 3M3ZB 2C5JA 5EK3A 4U7IA 2UXXB 4LMLA 3N2KE 3UUXB 2RPAA 2V26A 5JRCB 3UU8A 2N9DA 4IHJE 2K3WA 2YEVC 4A97A 3UULA 2UXCT 4AKGA 4B3TT 4DUYT 2ACXA 3F2EA 3RX6A 2VKDA 2J62A 3KFWX 4MLKA 4UV9B 3CKDA 3G06A 2VQFT 4FJOA 4YLHA 3AAEB 1IBMT 3C51A 3GN5B 2W00A 3ZMSB 2I0MA 5DJQC 3UUBA 3OBVE 4U7YA 2VL0A 3AE8A 3ANWB 1OEDA 3FXDB 1J5WA 4ZI3D 3LBXA 5LXTE 3OJAA 4XBFB 1T98A 5HCJA 1N36T 4ZXLA 4EEBA 2H88A 4HWIB 1X79A 2JJ9A 5LGUB 3E0ZA 3DP7A 1YW0A 4H9PC 4PFOA 3AE5A 3IA3A 4X20E 3CX7B 4TZ4C 2LT3A 3C64A 3KBTA 4IREA 4EZ4A 4HFHA 3EHZA 2N1GA 2V1DB 2XQ5A 4DR6T 4LFCT 3AA1B 2BBHA 2X68A 3CVRA 1MMAA 4CXWA 4YJ3E 3CWZB 2WZHA 2IAKA 3B13A 3UT5E 2UUBT 1XDOA 5HXHA 4QXHB 4A5XA 2J47A 4YHJA 1YD8G 3UFGA 3E22E 2KT9A 5ETWA 2D2SA 3O9XA 5AQVB 4GKJT 3CMLA 3NKZA 1Y01A 3AA7B 5EK4A 3Q5DA 4X64T 1W09A 2JQKA 3Q5XA 4KHZF 4EYUA 1B7TA 3UFEA 4ZI2C 2KWHA 5AQNB 3CIRA 3KVBA 2W66A 2EHOC 5HAXA 2IC9A 2W4XA 4U2YA 2MAWA 5J1GA 2WDRA 4AXPA 4TWFA 4BJMA 4LF6T 3AA0B 5FL0A 4IGUA 1BR0A 4LF4T 5CJ5A 2Q9QD 4ILBA 1BR2A 2CPTA 1WYCA 5FKYA 1KEYA 4JI8T 1N32T 3RGLA 1IAPA 4BAYB 2X9XA 1Z8UA 4ZI7E 4PW8A 3AEFA 3ZYMA 5LCYA 3RQWA 4PFPA 4UR9A 5HXRA 5JRCA 4WBOA 3HKCE 1T72A 4N78D 5ADXL 3ZYKA 3LFMA 5JR9A 2E9XB 3HA4A 2XASB 2PBIA 5L3EB 1ZV4X 4X1YE 3RLFF 4GK5E 1WFDA 2DL1A 2W2UA 4L0RA 4ASKA 4QKNA 4H9OC 2XAQB 2Z6EA 3KINB 5IUXA 1MNEA 2LRKA 4TNWA 2ODVA 3A5XA 4O4IE 4AI6A 1N33T 2LM9A 3ANWA 2X67A 1NAFA 2WZIA 3ZKRA 4IE5A 3RIUA 2PJQA 3K3QC 4AKRB 2XQAA 4TN7B 5J2TE 2PFVA 4U3CA 4YY3T 1FIOA 2NWBA 5J0ZA 3NZQA 5HWXA 3PUGA 4WNKA 1MMDA 3UUMA 1E2AA 1WLXA 1GQEA 4C90A 2BZBA 3JC6D 3I9WA 3MJXA 1YKHB 3F57A 2V7IA 4HFIA 2ZM8A 1UGOA 1YQ3A 4MBQA 4X1IE 4ZS2A 3LK2B 1MIVA 4X66T 4F6RC 3PTRB 2X9YA 4HKAA 4I55E 2HPLA 5A1LA 5LA6E 4ZHQE 3PUSA 3TLWA 2KWIB 4DV4T 2YDQA 5C8YE 3GMIA 3HI2A 5AQSB 5JDNA 4I4TE 3JAFA 5HXCA 1FEWA 5FY0A 4YTNA 1D1BA 4L9IA 4MALA 2NW7A 1KF6A 4EXTA 2JQ9A 4OK0A 2LOPA 4DR3T 3ZYLA 2UU9T 5LG3A 4H9QC 3HKBE 5H6QB 4YSXA 1T7SA 4GIWA 4UVBB 4EEDA 4AQYT 2D0TA 2JMHA 3P4PA 3ONLC 4DV5T 2MYSA 1X9BA 3LDQB 4JYAT 4H63V 4DBRA 5CB4E 4NXNT 1OEDB 3ESLA 3RRWA 1D1AA 3MACA 3J7Yq 2NP9A 4QH1A 3LK3B 5L47A 2JQQA 4E7SA 4KX6A 2QVAA 3AEDA 3ZMTB 3N9PA 3P4WA 3ZC0A 2BKOA 2DLRA 2NTXA 3U78A 2H89A 4JBWF 2C5IT 1D1CA 2V8SV 3PUZF 4JI1T 2CXDA 2YDSA 2AE9A 2YK0A 4DV6T 2WSSV 2CHNA 3OPCA 1VCSA 1HNXT 3EAMA 1UURA 5L3DB 5AQFB 3B57A 3P7IA 4NUUA 2VKJA 4U31A 4Z90A 4MHCA 4NIQA 2KLQA 1KK7A 4LMJA 1L0VA 2LJLA 2WWVA 2WDQA 4QXCB 3E08A 2D5UA 2UXBT 4GYSA 2F4VT 2E5LT 5TAOA 4QX7B 2MOZA 4Z91A 4OX9T 3ZSSA 2DNXA 4CXYA 3AB3B 2UUCT 2ODUA 3C4WA 4HWCA 5EZYE 4U74A 5CGMA 4JI7T 5LOVE 4JUYA 3KVAA 4EOZB 2WQYA 4G2AA 4HFVA 4TV8E 2OLTA 3SS1A 1VRBA 3JAEA 4CN6A 5FY1A 5JDFA 3ZSTA 4UEMA 3N9NA 3HKDE 1XDPA 2FJEA 4ZI2D 2VL8A 3CX8B 1NEKA 3GWHA 4TWDA 2YINA 4TUYE 4HFDA 4BJNA 2EHOD 2LLYA 3ZLIA 5JTGA 4EIWA 2WS3A 4EAHA 3ZCIA 3H37A 3ONXA 2NW9A 2E9XC 4HFCA 1M62A 4B3RT 5JH7E 3PJAA 4JI6T 3NZPA 5HCMA 2CBIA 3PDYA 2JIWA 4A56A 5JR9B 3AECA 4I50E 4ILAA 3ZEFB 4QH4A 1J5ET 2LHNA 2WB5A 4YFSA 1AJ3A 4HEAA 2WMNA 2Y48B 3TKLB 4J2CA 4HE8A 4YSZA 5LJMA 5F3JA 2VKHA 3IEEA 4PK5A 5L4HA 2LSKA 2LE8A 3FZMB 3K3OA 4EGWA 3QNUA 1KNRA 4U33A 2CLYB 3ONJA 1G8XA 1HR0T 1T8BA 2DI4A 4ZZCA 2Q9QB 3CK6A 3TLUA 4LMKA 3T8OA 2OA5A 1IJ6A 2KSRA 3H3AA 4LFBT 3RI5A 1VOMA 4PJNA 4IDQA 2BVMA 4QHOA 4H9NC 2XUEA 1W0AA 1N34T 2OV9A 3I9YA 4C91A 2XSBA 3BQLA 1IBKT 1D0ZA 2QYWA 4NPPA 4HFBA 4GYRA 1CHUA 3PE0A 3QK6A 5LBQB 4G63A 2C0SA 2H7OA 2FJDA 2NW8A 5LYJE 5FY7A 2XQ7A 4DO0A 1FJGT 3WAJA 1D0YA 4JI4T 3EDUA 2LM2A 4PNIA 5AQIB 4L5GA 4P09A 3L39A 1OEDC 3MXZA 5AQJB 3ZT7A 2E5VA 3W15B 1H7CA 4XAXB 1US7B 2H3RA 3OVUA 3L8RA 1SA0E 2WU5A 5LG4A 3R84B 3ZC1A 4BA9A 3RYCE 3ZMVB 1XMQT 3LG7A 5AQMB 4DV3T 5JDHA 3AE4A 2MBGA 2BG9A 4HWHA 4PAGA 2N2NA 4EB6E 5EK2A 2YKSA 4X65T 3ZMUB 2ZM6T 3C98B 3EVYA 4OYKA 3Q5WA 5JVDE 4NUVA 3H3MA 5GONE 3UU6A 3C4ZA 2V7KA 4U72A 4H9SE 4DV0T 1QUUA 2FBWA 1J1JA 3AVRA 3IF8B 4DMWA 2YN6A 3LSVA 4TWHA 1XZYA 2I6HA 3AAIA 3RF1A 3VR9A 2YDRA 4HWDA 2IUBA 3RC8A 2WP9A 3T1HT 3EI0A 2XM1A 3AE2A 1G73A 1FMVA 3RKGA 2X51A 4AQFA 4P1NA 4IDOA 4X5TA 4XZCA 1M7KA 4O2BE 4JLEA 4UVAB 2Q9QA 4X62T 2XPKA 3VRAA 5L3FB 4TX5A 4CN4A 1W9RA 2XAGB 2XQYA 4GK0E 1DU2A 5FXVA 5JREA 4IDNA 4CQIA 2SPCA 3RHWA 2CE7A 3QC9A 2CXLA 2PG8A 3PV0F 2WMOA 2AXDS 2L3LA 4YT0A 1UK5A 3ETUA 5DQVA 2ZM2A 2MPKA 3KDSE 5FYMA 5LNKA 4KUMB 5JR9C 1KNPA 4TNVA 1IBLT 4UXNB 1I6ZA 2E2AA 4Z8XA 4WYVA 2XSAA 2DWKA 2V7JA 3HL6A 2V5CA 5DABA 2B76A 4DIDB 2WWUA 4YTPA 4EV6A 2W67A 4EYYR 2YOEA 1S94A 2BKNA 4UELA 1WR0A 3QB5K 5LMNT 1OXZA 3AVSA 3UU4A 2ZMAA 2VK9A 2BS3A 3NVOA 5H6RB 2V6YA 2CMRA 2ZM0A 3RIUC 4DV7T 1R8IA 3EDVA 2CLYC 4LF8T 3AEEA 5FNVE 2BKPA 5ABFA 2V5DA 4P0AA 2V7LA 4PJJA 2K48A 3V5SA 1UUSA 2XAHB 4CI1B 1MMNA 3PUAA 3NBXX 3ZN1B 3PU8A 5JQGE 2A3DA 2LKHA 3TLTA 3UTKA 4DUZT 3FB2A 2CBJA 4O4HE 2M6BA 4MFRA 4B3MT 1IZNB 5HEJA 1NWMX 1BR4A 2EHOB 5J2UE 3DTOA 2JRKA 3RYHE 5FVKA 3AAAB 4TV9E 4H63H 1HX8A 5JDGA 2K5BB 5L4EA 4IL9A 1MIWA 1WRDA 2LKGA 4COFA 4E7ZA 1WYBA 5AQUB 3PU3A 2PTFA 4DNDA 5FVLA 1YQ4A 1UX4A 3OKQA 3P50A 1XWMA 3EUHA 3KV4A 2YU1A 4AIUA 5L3BB 4HFEA 5HXSA 4IE6A 4AKLA 1NENA 5AQGB 3ZJ2A 2GK9A 4O4JE 2J1DG 4O4LE 3BQIA 5AQRB 1YXRA 2HPJA 1VCTA 3L3PA 5BMVE 3AEGA 1FMWA 4DMVA 4YXDA 4DR7T 5HWYA 2ACZA 1HTJF 2XQ8A 4DR4T 3RYFE 2IC6A 4KBMB 2NTYA 3ZN0B 2VURA 3MKDA 5HEUA 3AA6B 3JC6C 4AISA 3VHLA 4HN9A 2KZ7B 2XHEB 4KI0F 2BVLA 4OYJA 4ISSA 2FUPA 5HXEA 4ANJA 3N2GE 4JI2T 5CA1E 2Y6XA 2WDVA 3BK9A 3FZHB 3K1SA 3KV5A 2QGSA 3L09A 2WU2A 2BG9B 1SHZC 5AFUL 2VKOA 4AQGA 5AQPB 3O1HA 4IDPA 5F5WA 3TLSA 2LSJA 2C5KT 2WBLA 5KXJA 3KV6A 1SUMB 2WAUA 3AXJA 2FJBA 3ETVA 1XNQT 3QUJA 2ZLYA 1CUNA 4UIGA 5CFBA 4CZZB 3ABVA 5F8PA 2W62A 3Q2MA 4DR1T 2A72A 3SFEA 2JQHA 1QSDA 3DJBA 5IWAT 4HTEA 4UV8B 3F31A 5ABGA 5FP3A 2HHHT 1JNZA 3V5UA 2LEHA 1HS7A 3P4SA 4JV5T 5C3JA 2WCAA 4Q25A 2V7MA 5ABHA 2HN2A 2I59A 1LRZA 2CXFA 1QLBA 5KDMC 5CA0E 4A98A 3OYXA 5LHGB 4KP3C 3HKEE 4QXBB 3SWHA 4DV1T 2EHOA 5AQLB 3I0QA 3WAKA 5DQWA 3AE7A 2JPFA 3N9OA 3EABA 5IHYA 2DCFA 1JNRA 3RKOA 5LGTB 2CWYA 2LSYA 2M6IA 1EZ3A 5HEHA 2UXNB 2XQ4A 3AEAA 4ZS3A 3OTOT 3QB5A 2XAFB 3IHRA 4I0UA 2XQ9A 3FBZA 2V6XA 2KXPB 3PJAJ 2G0UA 1IJ5A 2WM9A 3Q9DA 4JI3T 4CI3B 4UF0A 2BS4A 4ILUA 3IBPA 2LOSA 3ZMZB 3CQXC 4F8HA 3O1IA 1HCIA 1HG5A 2K9AA 4HGAA 4DBQA 1S35A 2XJ7A 4IE7A 2UXDT 1O3XA 2CHOA 4LF7T 2VB6A 3TLVA 4OHFA 5LMUT 4FI5A 1ZOYA 2V6YB 2X9WA 2J4GA 3LJCA 3ZCJA 3FZKB 4O2AE 4DV2T 4ADZA 2Y8DA 4HWFA 2H7VC 5ABFB 3ZPOA 3GA8A 3B5MA 2D0UA 3CPZA 3PUWF 5C2TA 2NOXA 2LRLA 5JDLA 1BR1A 4ZOLE 2DHRA 5L3GB 5AQOB 2FJAA 5LBMA 3M65A 2CA5A 4O8SA 4K0KT 2P9BA 3X1DA 2CEAA 5LGNB 2VQET 4ZEYA 2JMKA 2VASA 3VKGA 5JDQA 5LHHB 3CQGB 2CWOA 3RC3A 4AKHA 2X0YA 1OEDE 2IIUA 3LK42 4CN1A 3VR8A 3P8CD 2VVSA 3N5LA 4H9RC 2D9DA 4LF5T 4YJ2E 2X0LB 1D0XA 1HF8A 4U2ZA 2KMFA 1HX1B 2VWAA 1LKXA 4ZZBA 3VKHA 2YU2A 3RQUA 5HEOA 3CQCB 3I0OA 3R6NA 4ZI3C 3MZKB 1E7PA 1ZP0A 3GN5A 4IT4A 2BDEA 1V9DA 1HNZT 4K0UA 2XAJB 1U5PA 1Z0PA 1LVFA 4IE0A 1HFAA 4NXMT 4PK4A
chains in the Genus database with same CATH topology
3DTOA 5ETWA 2D2SA 3U3IA 2JRKA 3O9XA 3NZPA 3RYHE 4KMCA 3AAAB 3CMLA 3PDYA 4TV9E 3AA7B 5EK4A 4H63H 4M1PA 5IYZE 5LHIB 1HX8A 4A56A 5JDGA 2K5BB 5JR9B 4I50E 3Q5XA 1MIWA 4EYUA 3ZEFB 1B7TA 3UFEA 1WRDA 4ZI2C 2KWHA 2A2FX 2LHNA 4E7ZA 1WYBA 2L8KA 2X66A 3PU3A 3FXEB 3KVBA 3ZJ1A 4DNDA 5FMNA 3K8PC 3BQKA 4QWNB 2EHOC 4YFSA 1UX4A 5HAXA 1AJ3A 4HEAA 3OKQA 2IC9A 2WMNA 2Y48B 1WR6A 5J1GA 3PURA 3EUHA 3KV4A 2YU1A 3TKLB 4AXPA 4BJMA 5L3BB 3AA0B 3UUNA 5HXSA 4IE6A 4IGUA 4AKLA 4J2CA 3ZJ2A 4HE8A 1BR0A 2GK9A 4O4JE 3VU7H 3J9X1 2J1DG 2Q9QD 4GOUA 5FXZA 5LJMA 5F3JA 3FBLA 1ZKEA 2VKHA 3IEEA 1BR2A 4PK5A 1WYCA 4O4LE 2LSKA 3RYIE 2LE8A 1IAPA 3BQIA 3WI3A 2HPJA 4BAYB 2X9XA 3K3OA 3L3PA 5BMVE 3C4XA 2LSIA 3O4XE 4IIJE 2CLYB 2LSGA 2RA1A 1FMWA 4WW0A 4DMVA 5HWYA 2K24A 4ZI7E 4PW8A 1G8XA 1HTJF 1YKEB 3C50A 2DI4A 3RYFE 3ZYMA 5LJNA 2Q9QB 2E9XD 5LCYA 2IC6A 4PFPA 4KBMB 2NTYA 3ZN0B 3MKDA 5HXRA 5JRCA 2CCQA 4WBOA 5KX5E 3AA6B 3HKCE 3JC6C 3T8OA 3CX6B 2OA5A 1IJ6A 4ERRA 4N78D 3VHLA 4HN9A 2KZ7B 3H3AA 5ADXL 4X1KE 2XHEB 2KNDA 3ZYKA 2W0GA 2B1EA 2HH7A 1VOMA 2BVLA 2RP4A 3LFMA 4PJNA 5JR9A 2E9XB 3HA4A 2XASB 4OYJA 2PBIA 3S4UA 5L3EB 1ZV4X 4ISSA 4AQFC 2BVMA 4QHOA 4H9NC 5HXEA 2ES0A 4X1YE 2XUEA 2MTQA 4ANJA 4GK5E 3MA9A 4EZHA 3N2GE 3K3NA 2Q9QC 5CA1E 3I9YA 4L0RA 2Y6XA 4ASKA 4C91A 4QKNA 1KNZA 3BQLA 4V1Av 1D0ZA 3BK9A 5FXXA 4PJMA 5E0OA 4GYRA 1MMGA 4H9OC 2XAQB 2Z6EA 3KV5A 3PE0A 3KINB 2QGSA 4ISTA 3L09A 3QK6A 1MNEA 5LBQB 4G63A 4WBNE 2ODVA 1SHZC 3A5XA 2VKOA 4O4IE 5AFUL 4AI6A 2C0SA 2LM9A 4AQGA 5FXWA 3ANWA 2H7OA 4PJLA 3SRZA 4DVDA 3NRYA 5JH7E 2NW8A 3O1HA 1MNDA 2X67A 3LBXB 4PK6A 4AKIA 2LSJA 5LYJE 2C5KT 2W63A 2WBLA 1NAFA 5FY7A 3KV6A 2WAUA 4IE5A 4DO0A 5HYAA 2PJQA 3K3QC 4AKRB 3ETVA 4TN7B 2KINB 1UX5A 3WAJA 5J2TE 3QUJA 2PFVA 1D0YA 3EDUA 3I1AA 1FIOA 2NWBA 4IE4A 4PNIA 2ZLYA 4L5GA 1CUNA 3NZQA 4UIGA 4P09A 4CZZB 5HWXA 3KBUA 3O1JA 3PUGA 1LVKA 5F8PA 2W62A 4WNKA 4OFZA 1MMDA 3UUMA 1WLXA 3Q2MA 3MXZA 3RH3A 3RRCA 4C90A 2A72A 2BZBA 1ZEEA 3I9WA 3JC6D 2DWGA 3MJXA 1YKHB 4P0BA 1QSDA 3W15B 1H7CA 3F57A 2V7IA 3DJBA 4XAXB 1US7B 3N9LA 3OYZA 4JEHB 2H3RA 1SA0E 5LG4A 2ZM8A 3R84B 3ZC1A 2E9XA 4HTEA 4UV8B 5M4YA 3F31A 4MBQA 4BA9A 3RYCE 4X1IE 2XTLA 4ZS2A 5L2LA 5FP3A 3LK2B 1MIVA 4F6RC 3PUQA 3PTRB 2LEHA 3V5UA 3ZMVB 2X9YA 5KMGP 1HS7A 2X9HA 3SOLA 3LG7A 4HKAA 4I55E 2V7MA 2HPLA 4UF0B 5A1LA 3N9QA 5L3CB 1E1HB 5JDHA 1OWAA 5LA6E 2I59A 4ZHQE 3PUSA 4IDZA 1LRZA 2MBGA 2CXFA 3D0TA 5KDMC 5CA0E 1Y64B 2KWIB 3N2OA 3OYXA 5LHGB 4KP3C 2QA7A 3GMIA 3HI2A 4JEUB 2N2NA 4PAGA 4EB6E 5C8YE 3HKEE 5JDNA 3HR0A 4I4TE 5EK2A 4QXBB 3ZMUB 5HXCA 1FEWA 5FY0A 3SWHA 4CI2B 2EHOA 2W61A 1D1BA 4L9IA 3MK7C 3RPUA 3I0QA 4UVCB 3C98B 3EVYA 3WAKA 4OYKA 5DQWA 3Q5WA 4MALA 2JPFA 2M67A 2NW7A 3N9OA 5JVDE 3KV9A 5IHYA 4EXTA 4NUVA 4OK0A 2LOPA 5GONE 3ZYLA 3C4ZA 4B6XA 2DCFA 2V7KA 4H9QC 4U72A 3HKBE 3RKOA 2E8IA 5LGTB 5H6QB 4H9SE 2CWYA 4GIWA 4UVBB 2LSYA 1QUUA 2D0TA 3FHNA 2JMHA 4I43B 3N9MA 1HG2A 2LHRA 1EZ3A 3AVRA 1UCUA 5JDMA 2UXNB 2MYSA 3NRXA 3IF8B 4DMWA 4ZS3A 4H63V 2L9QA 4DBRA 5LP6E 1ZHCA 2XAFB 3AAIA 3IHRA 4CXXA 2CM0A 5CB4E 3FBZA 3ESLA 3RRWA 3RC8A 1MIYA 2KXPB 1U4QA 2IW5B 2G0UA 1IJ5A 4QX8B 1D1AA 3MACA 2WM9A 1G73A 3Q9DA 4CI3B 3J7Yq 2NP9A 2C5JA 1FMVA 4UF0A 5EK3A 4ILUA 3LK3B 3IBPA 2UXXB 2LOSA 2JQQA 3ZMZB 2X51A 3N2KE 3CQXC 4E7SA 4AQFA 3ZMTB 3N9PA 4XZCA 3O1IA 3UUXB 3ZC0A 1HCIA 1HG5A 4O2BE 2K9AA 4HGAA 2Q9QA 4JLEA 4UVAB 4DBQA 1S35A 2DLRA 2NTXA 4IE7A 3U78A 2V26A 5JRCB 5L3FB 4TX5A 1O3XA 2VB6A 2XAGB 2XQYA 4GK0E 4OHFA 2C5IT 4FI5A 1D1CA 5FXVA 2N9DA 5JREA 2X9WA 3LJCA 4IHJE 3ZCJA 4CQIA 2SPCA 4O2AE 4ADZA 2CXDA 2YEVC 2CE7A 3QC9A 2Y8DA 3UULA 2CXLA 4AKGA 2YK0A 2H7VC 2PG8A 2WSSV 2ACXA 3F2EA 3ZPOA 3GA8A 3RX6A 2VKDA 2WMOA 2L3LA 3KFWX 4MLKA 5L3DB 4UV9B 3B57A 3CKDA 3P7IA 2D0UA 4NUUA 3CPZA 2VKJA 4FJOA 4YLHA 3ETUA 4MHCA 3AAEB 2KLQA 3C51A 1KK7A 3GN5B 2W00A 5DQVA 3ZMSB 2LJLA 2NOXA 2ZM2A 5JDLA 4QXCB 5DJQC 1BR1A 3E08A 2D5UA 4ZOLE 3OBVE 3KDSE 5FYMA 2DHRA 5LNKA 4GYSA 4KUMB 5L3GB 5JR9C 3ANWB 5LBMA 3M65A 2CA5A 3FXDB 4O8SA 4UXNB 2P9BA 2CEAA 4Z8XA 5LGNB 5TAOA 4ZI3D 3LBXA 5LXTE 3OJAA 4QX7B 2MOZA 2DWKA 2V7JA 3HL6A 4XBFB 1T98A 2JMKA 5DABA 2DNXA 2VASA 2WWUA 3VKGA 5JDQA 1X79A 5LHHB 2JJ9A 4CXYA 3AB3B 3CQGB 5LGUB 4EYYR 3E0ZA 3DP7A 2ODUA 3C4WA 5EZYE 1YW0A 2CWOA 3RC3A 1S94A 4AKHA 4U74A 4H9PC 4UELA 4PFOA 3LK42 5LOVE 4X20E 4JUYA 3CX7B 3KVAA 1OXZA 3AVSA 4EOZB 3P8CD 4G2AA 4TZ4C 2ZMAA 3N5LA 4H9RC 2VK9A 2LT3A 3C64A 4HFVA 3KBTA 4TV8E 4EZ4A 5H6RB 1VRBA 3SS1A 4YJ2E 2X0LB 1D0XA 2CMRA 1HF8A 5FY1A 2KMFA 2ZM0A 5JDFA 2N1GA 2V1DB 2VWAA 3EDVA 3AA1B 1LKXA 4UEMA 2CLYC 2X68A 3CVRA 3N9NA 3HKDE 4ZI2D 3VKHA 1MMAA 2VL8A 5FNVE 4CXWA 2YU2A 4YJ3E 2V7LA 3CX8B 4PJJA 4P0AA 2K48A 3V5SA 3GWHA 2YINA 2XAHB 3CWZB 4TUYE 3CQCB 4CI1B 1MMNA 3I0OA 3PUAA 3NBXX 3ZN1B 3PU8A 5JQGE 3R6NA 2IAKA 4ZI3C 2A3DA 3MZKB 4BJNA 2EHOD 3UTKA 3ZLIA 3FB2A 3GN5A 4EIWA 3B13A 3UT5E 2BDEA 4O4HE 1V9DA 4MFRA 4EAHA 3ZCIA 4K0UA 3H37A 2XAJB 3ONXA 1U5PA 5HXHA 4QXHB 1IZNB 1Z0PA 1LVFA 4IE0A 2NW9A 1HFAA 2E9XC 1NWMX 4YHJA 1YD8G 4PK4A 1BR4A 2EHOB 5J2UE 3E22E 2KT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FMN A;  3AAI A;  4ADZ A;  4UIG A;  2HH7 A;  4M1P A;  5LCY A;  5LBM A; 
#chains in the Genus database with same CATH topology
 3U3I A;  3ZT5 A;  4KMC A;  4M1P A;  3QOF A;  5IYZ E;  5LHI B;  2BG9 C;  2A2F X;  3P4R A;  2L8K A;  2X66 A;  3FXE B;  3ZJ1 A;  5FMN A;  3K8P C;  3BQK A;  4QWN B;  2XM2 A;  3Q5E A;  1WR6 A;  4JI0 T;  4LF9 T;  3PUR A;  3RIA A;  5AQT B;  2IML A;  2XQ6 A;  3UU5 A;  3UUN A;  3SFD A;  1HNW T;  3VU7 H;  3J9X 1;  3UU3 A;  5BR8 T;  4GOU A;  5FXZ A;  3FBL A;  1ZKE A;  3RYI E;  3WI3 A;  3AXJ B;  2LSI A;  3C4X A;  3O4X E;  4IIJ E;  2LSG A;  2RA1 A;  4WW0 A;  2K24 A;  4IL4 A;  1YKE B;  3C50 A;  5LJN A;  2IHR 1;  4B3S T;  2E9X D;  4QH5 A;  2XZE A;  2CCQ A;  5KX5 E;  2HN1 A;  3CX6 B;  4ERR A;  4X1K E;  2KND A;  2W0G A;  3P4Q A;  2BG9 E;  2B1E A;  2HH7 A;  2RP4 A;  2VVN A;  3A7M A;  3S4U A;  4AQF C;  2ES0 A;  2MTQ A;  3MA9 A;  4EZH A;  3K3N A;  2Q9Q C;  4GKK T;  3ZT6 A;  1KNZ A;  4V1A v;  5FXX A;  4PJM A;  5E0O A;  1MMG A;  4IST A;  2BS2 A;  4WBN E;  5AQK B;  4KHP T;  5FXW A;  4PJL A;  3SRZ A;  4DVD A;  3NRY A;  4YSY A;  1MND A;  4PK6 A;  3LBX B;  4AKI A;  2W63 A;  5ABE A;  5HYA A;  2R6G F;  2KIN B;  1UX5 A;  3I1A A;  4IE4 A;  2NR4 A;  2XY8 B;  3KBU A;  3O1J A;  1LVK A;  4ILC A;  4OFZ A;  4LFA T;  3NWI A;  3RH3 A;  3RRC A;  1ZEE A;  4P0B A;  3JCF A;  2DWG A;  5FL1 A;  3AE6 A;  3OYZ A;  3N9L A;  4JEH B;  5AQQ B;  1XMO T;  3PUY F;  4YTM A;  1SE7 A;  2XQ3 A;  3VRB A;  2E9X A;  5M4Y A;  2IDO B;  2XTL A;  5L2L A;  1KFY A;  3AE9 A;  3PUQ A;  5KMG P;  2A9U A;  2X9H A;  3SOL A;  4DR2 T;  4WZX A;  2X0H A;  3UQ4 A;  3RIF A;  4DR5 T;  3AEB A;  4UF0 B;  3N9Q A;  5L3C B;  1E1H B;  5HEG A;  1OWA A;  5LB7 B;  1W0B A;  4JI5 T;  4IDZ A;  3D0T A;  1Y64 B;  3T1Y T;  3N2O A;  3AE1 A;  2BBJ A;  2QA7 A;  4JEU B;  3HR0 A;  1WCR A;  4CI2 B;  2W61 A;  3MK7 C;  3RPU A;  4UVC B;  3AE3 A;  5AQH B;  2M67 A;  3FZF B;  3KV9 A;  3JAD A;  1I94 T;  2QRX A;  4B6X A;  3PUV F;  2E8I A;  3FHN A;  4I43 B;  3N9M A;  1HG2 A;  2LHR A;  1UCU A;  5JDM A;  3FZL B;  3NRX A;  2L9Q A;  5LP6 E;  1XNR T;  1ZHC A;  4CXX A;  2CM0 A;  2CRB A;  2UUA T;  3UQ7 A;  2WY2 A;  3PUX F;  1MIY A;  1U4Q A;  2IW5 B;  4QX8 B;  3A8Y C;  4YHH T;  3M3Z B;  2C5J A;  5EK3 A;  4U7I A;  2UXX B;  4LML A;  3N2K E;  3UUX B;  2RPA A;  2V26 A;  5JRC B;  3UU8 A;  2N9D A;  4IHJ E;  2K3W A;  2YEV C;  4A97 A;  3UUL A;  2UXC T;  4AKG A;  4B3T T;  4DUY T;  2ACX A;  3F2E A;  3RX6 A;  2VKD A;  2J62 A;  3KFW X;  4MLK A;  4UV9 B;  3CKD A;  3G06 A;  2VQF T;  4FJO A;  4YLH A;  3AAE B;  1IBM T;  3C51 A;  3GN5 B;  2W00 A;  3ZMS B;  2I0M A;  5DJQ C;  3UUB A;  3OBV E;  4U7Y A;  2VL0 A;  3AE8 A;  3ANW B;  1OED A;  3FXD B;  1J5W A;  4ZI3 D;  3LBX A;  5LXT E;  3OJA A;  4XBF B;  1T98 A;  5HCJ A;  1N36 T;  4ZXL A;  4EEB A;  2H88 A;  4HWI B;  1X79 A;  2JJ9 A;  5LGU B;  3E0Z A;  3DP7 A;  1YW0 A;  4H9P C;  4PFO A;  3AE5 A;  3IA3 A;  4X20 E;  3CX7 B;  4TZ4 C;  2LT3 A;  3C64 A;  3KBT A;  4IRE A;  4EZ4 A;  4HFH A;  3EHZ A;  2N1G A;  2V1D B;  2XQ5 A;  4DR6 T;  4LFC T;  3AA1 B;  2BBH A;  2X68 A;  3CVR A;  1MMA A;  4CXW A;  4YJ3 E;  3CWZ B;  2WZH A;  2IAK A;  3B13 A;  3UT5 E;  2UUB T;  1XDO A;  5HXH A;  4QXH B;  4A5X A;  2J47 A;  4YHJ A;  1YD8 G;  3UFG A;  3E22 E;  2KT9 A;  5ETW A;  2D2S A;  3O9X A;  5AQV B;  4GKJ T;  3CML A;  3NKZ A;  1Y01 A;  3AA7 B;  5EK4 A;  3Q5D A;  4X64 T;  1W09 A;  2JQK A;  3Q5X A;  4KHZ F;  4EYU A;  1B7T A;  3UFE A;  4ZI2 C;  2KWH A;  5AQN B;  3CIR A;  3KVB A;  2W66 A;  2EHO C;  5HAX A;  2IC9 A;  2W4X A;  4U2Y A;  2MAW A;  5J1G A;  2WDR A;  4AXP A;  4TWF A;  4BJM A;  4LF6 T;  3AA0 B;  5FL0 A;  4IGU A;  1BR0 A;  4LF4 T;  5CJ5 A;  2Q9Q D;  4ILB A;  1BR2 A;  2CPT A;  1WYC A;  5FKY A;  1KEY A;  4JI8 T;  1N32 T;  3RGL A;  1IAP A;  4BAY B;  2X9X A;  1Z8U A;  4ZI7 E;  4PW8 A;  3AEF A;  3ZYM A;  5LCY A;  3RQW A;  4PFP A;  4UR9 A;  5HXR A;  5JRC A;  4WBO A;  3HKC E;  1T72 A;  4N78 D;  5ADX L;  3ZYK A;  3LFM A;  5JR9 A;  2E9X B;  3HA4 A;  2XAS B;  2PBI A;  5L3E B;  1ZV4 X;  4X1Y E;  3RLF F;  4GK5 E;  1WFD A;  2DL1 A;  2W2U A;  4L0R A;  4ASK A;  4QKN A;  4H9O C;  2XAQ B;  2Z6E A;  3KIN B;  5IUX A;  1MNE A;  2LRK A;  4TNW A;  2ODV A;  3A5X A;  4O4I E;  4AI6 A;  1N33 T;  2LM9 A;  3ANW A;  2X67 A;  1NAF A;  2WZI A;  3ZKR A;  4IE5 A;  3RIU A;  2PJQ A;  3K3Q C;  4AKR B;  2XQA A;  4TN7 B;  5J2T E;  2PFV A;  4U3C A;  4YY3 T;  1FIO A;  2NWB A;  5J0Z A;  3NZQ A;  5HWX A;  3PUG A;  4WNK A;  1MMD A;  3UUM A;  1E2A A;  1WLX A;  1GQE A;  4C90 A;  2BZB A;  3JC6 D;  3I9W A;  3MJX A;  1YKH B;  3F57 A;  2V7I A;  4HFI A;  2ZM8 A;  1UGO A;  1YQ3 A;  4MBQ A;  4X1I E;  4ZS2 A;  3LK2 B;  1MIV A;  4X66 T;  4F6R C;  3PTR B;  2X9Y A;  4HKA A;  4I55 E;  2HPL A;  5A1L A;  5LA6 E;  4ZHQ E;  3PUS A;  3TLW A;  2KWI B;  4DV4 T;  2YDQ A;  5C8Y E;  3GMI A;  3HI2 A;  5AQS B;  5JDN A;  4I4T E;  3JAF A;  5HXC A;  1FEW A;  5FY0 A;  4YTN A;  1D1B A;  4L9I A;  4MAL A;  2NW7 A;  1KF6 A;  4EXT A;  2JQ9 A;  4OK0 A;  2LOP A;  4DR3 T;  3ZYL A;  2UU9 T;  5LG3 A;  4H9Q C;  3HKB E;  5H6Q B;  4YSX A;  1T7S A;  4GIW A;  4UVB B;  4EED A;  4AQY T;  2D0T A;  2JMH A;  3P4P A;  3ONL C;  4DV5 T;  2MYS A;  1X9B A;  3LDQ B;  4JYA T;  4H63 V;  4DBR A;  5CB4 E;  4NXN T;  1OED B;  3ESL A;  3RRW A;  1D1A A;  3MAC A;  3J7Y q;  2NP9 A;  4QH1 A;  3LK3 B;  5L47 A;  2JQQ A;  4E7S A;  4KX6 A;  2QVA A;  3AED A;  3ZMT B;  3N9P A;  3P4W A;  3ZC0 A;  2BKO A;  2DLR A;  2NTX A;  3U78 A;  2H89 A;  4JBW F;  2C5I T;  1D1C A;  2V8S V;  3PUZ F;  4JI1 T;  2CXD A;  2YDS A;  2AE9 A;  2YK0 A;  4DV6 T;  2WSS V;  2CHN A;  3OPC A;  1VCS A;  1HNX T;  3EAM A;  1UUR A;  5L3D B;  5AQF B;  3B57 A;  3P7I A;  4NUU A;  2VKJ A;  4U31 A;  4Z90 A;  4MHC A;  4NIQ A;  2KLQ A;  1KK7 A;  4LMJ A;  1L0V A;  2LJL A;  2WWV A;  2WDQ A;  4QXC B;  3E08 A;  2D5U A;  2UXB T;  4GYS A;  2F4V T;  2E5L T;  5TAO A;  4QX7 B;  2MOZ A;  4Z91 A;  4OX9 T;  3ZSS A;  2DNX A;  4CXY A;  3AB3 B;  2UUC T;  2ODU A;  3C4W A;  4HWC A;  5EZY E;  4U74 A;  5CGM A;  4JI7 T;  5LOV E;  4JUY A;  3KVA A;  4EOZ B;  2WQY A;  4G2A A;  4HFV A;  4TV8 E;  2OLT A;  3SS1 A;  1VRB A;  3JAE A;  4CN6 A;  5FY1 A;  5JDF A;  3ZST A;  4UEM A;  3N9N A;  3HKD E;  1XDP A;  2FJE A;  4ZI2 D;  2VL8 A;  3CX8 B;  1NEK A;  3GWH A;  4TWD A;  2YIN A;  4TUY E;  4HFD A;  4BJN A;  2EHO D;  2LLY A;  3ZLI A;  5JTG A;  4EIW A;  2WS3 A;  4EAH A;  3ZCI A;  3H37 A;  3ONX A;  2NW9 A;  2E9X C;  4HFC A;  1M62 A;  4B3R T;  5JH7 E;  3PJA A;  4JI6 T;  3NZP A;  5HCM A;  2CBI A;  3PDY A;  2JIW A;  4A56 A;  5JR9 B;  3AEC A;  4I50 E;  4ILA A;  3ZEF B;  4QH4 A;  1J5E T;  2LHN A;  2WB5 A;  4YFS A;  1AJ3 A;  4HEA A;  2WMN A;  2Y48 B;  3TKL B;  4J2C A;  4HE8 A;  4YSZ A;  5LJM A;  5F3J A;  2VKH A;  3IEE A;  4PK5 A;  5L4H A;  2LSK A;  2LE8 A;  3FZM B;  3K3O A;  4EGW A;  3QNU A;  1KNR A;  4U33 A;  2CLY B;  3ONJ A;  1G8X A;  1HR0 T;  1T8B A;  2DI4 A;  4ZZC A;  2Q9Q B;  3CK6 A;  3TLU A;  4LMK A;  3T8O A;  2OA5 A;  1IJ6 A;  2KSR A;  3H3A A;  4LFB T;  3RI5 A;  1VOM A;  4PJN A;  4IDQ A;  2BVM A;  4QHO A;  4H9N C;  2XUE A;  1W0A A;  1N34 T;  2OV9 A;  3I9Y A;  4C91 A;  2XSB A;  3BQL A;  1IBK T;  1D0Z A;  2QYW A;  4NPP A;  4HFB A;  4GYR A;  1CHU A;  3PE0 A;  3QK6 A;  5LBQ B;  4G63 A;  2C0S A;  2H7O A;  2FJD A;  2NW8 A;  5LYJ E;  5FY7 A;  2XQ7 A;  4DO0 A;  1FJG T;  3WAJ A;  1D0Y A;  4JI4 T;  3EDU A;  2LM2 A;  4PNI A;  5AQI B;  4L5G A;  4P09 A;  3L39 A;  1OED C;  3MXZ A;  5AQJ B;  3ZT7 A;  2E5V A;  3W15 B;  1H7C A;  4XAX B;  1US7 B;  2H3R A;  3OVU A;  3L8R A;  1SA0 E;  2WU5 A;  5LG4 A;  3R84 B;  3ZC1 A;  4BA9 A;  3RYC E;  3ZMV B;  1XMQ T;  3LG7 A;  5AQM B;  4DV3 T;  5JDH A;  3AE4 A;  2MBG A;  2BG9 A;  4HWH A;  4PAG A;  2N2N A;  4EB6 E;  5EK2 A;  2YKS A;  4X65 T;  3ZMU B;  2ZM6 T;  3C98 B;  3EVY A;  4OYK A;  3Q5W A;  5JVD E;  4NUV A;  3H3M A;  5GON E;  3UU6 A;  3C4Z A;  2V7K A;  4U72 A;  4H9S E;  4DV0 T;  1QUU A;  2FBW A;  1J1J A;  3AVR A;  3IF8 B;  4DMW A;  2YN6 A;  3LSV A;  4TWH A;  1XZY A;  2I6H A;  3AAI A;  3RF1 A;  3VR9 A;  2YDR A;  4HWD A;  2IUB A;  3RC8 A;  2WP9 A;  3T1H T;  3EI0 A;  2XM1 A;  3AE2 A;  1G73 A;  1FMV A;  3RKG A;  2X51 A;  4AQF A;  4P1N A;  4IDO A;  4X5T A;  4XZC A;  1M7K A;  4O2B E;  4JLE A;  4UVA B;  2Q9Q A;  4X62 T;  2XPK A;  3VRA A;  5L3F B;  4TX5 A;  4CN4 A;  1W9R A;  2XAG B;  2XQY A;  4GK0 E;  1DU2 A;  5FXV A;  5JRE A;  4IDN A;  4CQI A;  2SPC A;  3RHW A;  2CE7 A;  3QC9 A;  2CXL A;  2PG8 A;  3PV0 F;  2WMO A;  2AXD S;  2L3L A;  4YT0 A;  1UK5 A;  3ETU A;  5DQV A;  2ZM2 A;  2MPK A;  3KDS E;  5FYM A;  5LNK A;  4KUM B;  5JR9 C;  1KNP A;  4TNV A;  1IBL T;  4UXN B;  1I6Z A;  2E2A A;  4Z8X A;  4WYV A;  2XSA A;  2DWK A;  2V7J A;  3HL6 A;  2V5C A;  5DAB A;  2B76 A;  4DID B;  2WWU A;  4YTP A;  4EV6 A;  2W67 A;  4EYY R;  2YOE A;  1S94 A;  2BKN A;  4UEL A;  1WR0 A;  3QB5 K;  5LMN T;  1OXZ A;  3AVS A;  3UU4 A;  2ZMA A;  2VK9 A;  2BS3 A;  3NVO A;  5H6R B;  2V6Y A;  2CMR A;  2ZM0 A;  3RIU C;  4DV7 T;  1R8I A;  3EDV A;  2CLY C;  4LF8 T;  3AEE A;  5FNV E;  2BKP A;  5ABF A;  2V5D A;  4P0A A;  2V7L A;  4PJJ A;  2K48 A;  3V5S A;  1UUS A;  2XAH B;  4CI1 B;  1MMN A;  3PUA A;  3NBX X;  3ZN1 B;  3PU8 A;  5JQG E;  2A3D A;  2LKH A;  3TLT A;  3UTK A;  4DUZ T;  3FB2 A;  2CBJ A;  4O4H E;  2M6B A;  4MFR A;  4B3M T;  1IZN B;  5HEJ A;  1NWM X;  1BR4 A;  2EHO B;  5J2U E;  3DTO A;  2JRK A;  3RYH E;  5FVK A;  3AAA B;  4TV9 E;  4H63 H;  1HX8 A;  5JDG A;  2K5B B;  5L4E A;  4IL9 A;  1MIW A;  1WRD A;  2LKG A;  4COF A;  4E7Z A;  1WYB A;  5AQU B;  3PU3 A;  2PTF A;  4DND A;  5FVL A;  1YQ4 A;  1UX4 A;  3OKQ A;  3P50 A;  1XWM A;  3EUH A;  3KV4 A;  2YU1 A;  4AIU A;  5L3B B;  4HFE A;  5HXS A;  4IE6 A;  4AKL A;  1NEN A;  5AQG B;  3ZJ2 A;  2GK9 A;  4O4J E;  2J1D G;  4O4L E;  3BQI A;  5AQR B;  1YXR A;  2HPJ A;  1VCT A;  3L3P A;  5BMV E;  3AEG A;  1FMW A;  4DMV A;  4YXD A;  4DR7 T;  5HWY A;  2ACZ A;  1HTJ F;  2XQ8 A;  4DR4 T;  3RYF E;  2IC6 A;  4KBM B;  2NTY A;  3ZN0 B;  2VUR A;  3MKD A;  5HEU A;  3AA6 B;  3JC6 C;  4AIS A;  3VHL A;  4HN9 A;  2KZ7 B;  2XHE B;  4KI0 F;  2BVL A;  4OYJ A;  4ISS A;  2FUP A;  5HXE A;  4ANJ A;  3N2G E;  4JI2 T;  5CA1 E;  2Y6X A;  2WDV A;  3BK9 A;  3FZH B;  3K1S A;  3KV5 A;  2QGS A;  3L09 A;  2WU2 A;  2BG9 B;  1SHZ C;  5AFU L;  2VKO A;  4AQG A;  5AQP B;  3O1H A;  4IDP A;  5F5W A;  3TLS A;  2LSJ A;  2C5K T;  2WBL A;  5KXJ A;  3KV6 A;  1SUM B;  2WAU A;  3AXJ A;  2FJB A;  3ETV A;  1XNQ T;  3QUJ A;  2ZLY A;  1CUN A;  4UIG A;  5CFB A;  4CZZ B;  3ABV A;  5F8P A;  2W62 A;  3Q2M A;  4DR1 T;  2A72 A;  3SFE A;  2JQH A;  1QSD A;  3DJB A;  5IWA T;  4HTE A;  4UV8 B;  3F31 A;  5ABG A;  5FP3 A;  2HHH T;  1JNZ A;  3V5U A;  2LEH A;  1HS7 A;  3P4S A;  4JV5 T;  5C3J A;  2WCA A;  4Q25 A;  2V7M A;  5ABH A;  2HN2 A;  2I59 A;  1LRZ A;  2CXF A;  1QLB A;  5KDM C;  5CA0 E;  4A98 A;  3OYX A;  5LHG B;  4KP3 C;  3HKE E;  4QXB B;  3SWH A;  4DV1 T;  2EHO A;  5AQL B;  3I0Q A;  3WAK A;  5DQW A;  3AE7 A;  2JPF A;  3N9O A;  3EAB A;  5IHY A;  2DCF A;  1JNR A;  3RKO A;  5LGT B;  2CWY A;  2LSY A;  2M6I A;  1EZ3 A;  5HEH A;  2UXN B;  2XQ4 A;  3AEA A;  4ZS3 A;  3OTO T;  3QB5 A;  2XAF B;  3IHR A;  4I0U A;  2XQ9 A;  3FBZ A;  2V6X A;  2KXP B;  3PJA J;  2G0U A;  1IJ5 A;  2WM9 A;  3Q9D A;  4JI3 T;  4CI3 B;  4UF0 A;  2BS4 A;  4ILU A;  3IBP A;  2LOS A;  3ZMZ B;  3CQX C;  4F8H A;  3O1I A;  1HCI A;  1HG5 A;  2K9A A;  4HGA A;  4DBQ A;  1S35 A;  2XJ7 A;  4IE7 A;  2UXD T;  1O3X A;  2CHO A;  4LF7 T;  2VB6 A;  3TLV A;  4OHF A;  5LMU T;  4FI5 A;  1ZOY A;  2V6Y B;  2X9W A;  2J4G A;  3LJC A;  3ZCJ A;  3FZK B;  4O2A E;  4DV2 T;  4ADZ A;  2Y8D A;  4HWF A;  2H7V C;  5ABF B;  3ZPO A;  3GA8 A;  3B5M A;  2D0U A;  3CPZ A;  3PUW F;  5C2T A;  2NOX A;  2LRL A;  5JDL A;  1BR1 A;  4ZOL E;  2DHR A;  5L3G B;  5AQO B;  2FJA A;  5LBM A;  3M65 A;  2CA5 A;  4O8S A;  4K0K T;  2P9B A;  3X1D A;  2CEA A;  5LGN B;  2VQE T;  4ZEY A;  2JMK A;  2VAS A;  3VKG A;  5JDQ A;  5LHH B;  3CQG B;  2CWO A;  3RC3 A;  4AKH A;  2X0Y A;  1OED E;  2IIU A;  3LK4 2;  4CN1 A;  3VR8 A;  3P8C D;  2VVS A;  3N5L A;  4H9R C;  2D9D A;  4LF5 T;  4YJ2 E;  2X0L B;  1D0X A;  1HF8 A;  4U2Z A;  2KMF A;  1HX1 B;  2VWA A;  1LKX A;  4ZZB A;  3VKH A;  2YU2 A;  3RQU A;  5HEO A;  3CQC B;  3I0O A;  3R6N A;  4ZI3 C;  3MZK B;  1E7P A;  1ZP0 A;  3GN5 A;  4IT4 A;  2BDE A;  1V9D A;  1HNZ T;  4K0U A;  2XAJ B;  1U5P A;  1Z0P A;  1LVF A;  4IE0 A;  1HFA A;  4NXM T;  4PK4 A; 
#chains in the Genus database with same CATH homology
 3DTO A;  5ETW A;  2D2S A;  3U3I A;  2JRK A;  3O9X A;  3NZP A;  3RYH E;  4KMC A;  3AAA B;  3CML A;  3PDY A;  4TV9 E;  3AA7 B;  5EK4 A;  4H63 H;  4M1P A;  5IYZ E;  5LHI B;  1HX8 A;  4A56 A;  5JDG A;  2K5B B;  5JR9 B;  4I50 E;  3Q5X A;  1MIW A;  4EYU A;  3ZEF B;  1B7T A;  3UFE A;  1WRD A;  4ZI2 C;  2KWH A;  2A2F X;  2LHN A;  4E7Z A;  1WYB A;  2L8K A;  2X66 A;  3PU3 A;  3FXE B;  3KVB A;  3ZJ1 A;  4DND A;  5FMN A;  3K8P C;  3BQK A;  4QWN B;  2EHO C;  4YFS A;  1UX4 A;  5HAX A;  1AJ3 A;  4HEA A;  3OKQ A;  2IC9 A;  2WMN A;  2Y48 B;  1WR6 A;  5J1G A;  3PUR A;  3EUH A;  3KV4 A;  2YU1 A;  3TKL B;  4AXP A;  4BJM A;  5L3B B;  3AA0 B;  3UUN A;  5HXS A;  4IE6 A;  4IGU A;  4AKL A;  4J2C A;  3ZJ2 A;  4HE8 A;  1BR0 A;  2GK9 A;  4O4J E;  3VU7 H;  3J9X 1;  2J1D G;  2Q9Q D;  4GOU A;  5FXZ A;  5LJM A;  5F3J A;  3FBL A;  1ZKE A;  2VKH A;  3IEE A;  1BR2 A;  4PK5 A;  1WYC A;  4O4L E;  2LSK A;  3RYI E;  2LE8 A;  1IAP A;  3BQI A;  3WI3 A;  2HPJ A;  4BAY B;  2X9X A;  3K3O A;  3L3P A;  5BMV E;  3C4X A;  2LSI A;  3O4X E;  4IIJ E;  2CLY B;  2LSG A;  2RA1 A;  1FMW A;  4WW0 A;  4DMV A;  5HWY A;  2K24 A;  4ZI7 E;  4PW8 A;  1G8X A;  1HTJ F;  1YKE B;  3C50 A;  2DI4 A;  3RYF E;  3ZYM A;  5LJN A;  2Q9Q B;  2E9X D;  5LCY A;  2IC6 A;  4PFP A;  4KBM B;  2NTY A;  3ZN0 B;  3MKD A;  5HXR A;  5JRC A;  2CCQ A;  4WBO A;  5KX5 E;  3AA6 B;  3HKC E;  3JC6 C;  3T8O A;  3CX6 B;  2OA5 A;  1IJ6 A;  4ERR A;  4N78 D;  3VHL A;  4HN9 A;  2KZ7 B;  3H3A A;  5ADX L;  4X1K E;  2XHE B;  2KND A;  3ZYK A;  2W0G A;  2B1E A;  2HH7 A;  1VOM A;  2BVL A;  2RP4 A;  3LFM A;  4PJN A;  5JR9 A;  2E9X B;  3HA4 A;  2XAS B;  4OYJ A;  2PBI A;  3S4U A;  5L3E B;  1ZV4 X;  4ISS A;  4AQF C;  2BVM A;  4QHO A;  4H9N C;  5HXE A;  2ES0 A;  4X1Y E;  2XUE A;  2MTQ A;  4ANJ A;  4GK5 E;  3MA9 A;  4EZH A;  3N2G E;  3K3N A;  2Q9Q C;  5CA1 E;  3I9Y A;  4L0R A;  2Y6X A;  4ASK A;  4C91 A;  4QKN A;  1KNZ A;  3BQL A;  4V1A v;  1D0Z A;  3BK9 A;  5FXX A;  4PJM A;  5E0O A;  4GYR A;  1MMG A;  4H9O C;  2XAQ B;  2Z6E A;  3KV5 A;  3PE0 A;  3KIN B;  2QGS A;  4IST A;  3L09 A;  3QK6 A;  1MNE A;  5LBQ B;  4G63 A;  4WBN E;  2ODV A;  1SHZ C;  3A5X A;  2VKO A;  4O4I E;  5AFU L;  4AI6 A;  2C0S A;  2LM9 A;  4AQG A;  5FXW A;  3ANW A;  2H7O A;  4PJL A;  3SRZ A;  4DVD A;  3NRY A;  5JH7 E;  2NW8 A;  3O1H A;  1MND A;  2X67 A;  3LBX B;  4PK6 A;  4AKI A;  2LSJ A;  5LYJ E;  2C5K T;  2W63 A;  2WBL A;  1NAF A;  5FY7 A;  3KV6 A;  2WAU A;  4IE5 A;  4DO0 A;  5HYA A;  2PJQ A;  3K3Q C;  4AKR B;  3ETV A;  4TN7 B;  2KIN B;  1UX5 A;  3WAJ A;  5J2T E;  3QUJ A;  2PFV A;  1D0Y A;  3EDU A;  3I1A A;  1FIO A;  2NWB A;  4IE4 A;  4PNI A;  2ZLY A;  4L5G A;  1CUN A;  3NZQ A;  4UIG A;  4P09 A;  4CZZ B;  5HWX A;  3KBU A;  3O1J A;  3PUG A;  1LVK A;  5F8P A;  2W62 A;  4WNK A;  4OFZ A;  1MMD A;  3UUM A;  1WLX A;  3Q2M A;  3MXZ A;  3RH3 A;  3RRC A;  4C90 A;  2A72 A;  2BZB A;  1ZEE A;  3I9W A;  3JC6 D;  2DWG A;  3MJX A;  1YKH B;  4P0B A;  1QSD A;  3W15 B;  1H7C A;  3F57 A;  2V7I A;  3DJB A;  4XAX B;  1US7 B;  3N9L A;  3OYZ A;  4JEH B;  2H3R A;  1SA0 E;  5LG4 A;  2ZM8 A;  3R84 B;  3ZC1 A;  2E9X A;  4HTE A;  4UV8 B;  5M4Y A;  3F31 A;  4MBQ A;  4BA9 A;  3RYC E;  4X1I E;  2XTL A;  4ZS2 A;  5L2L A;  5FP3 A;  3LK2 B;  1MIV A;  4F6R C;  3PUQ A;  3PTR B;  2LEH A;  3V5U A;  3ZMV B;  2X9Y A;  5KMG P;  1HS7 A;  2X9H A;  3SOL A;  3LG7 A;  4HKA A;  4I55 E;  2V7M A;  2HPL A;  4UF0 B;  5A1L A;  3N9Q A;  5L3C B;  1E1H B;  5JDH A;  1OWA A;  5LA6 E;  2I59 A;  4ZHQ E;  3PUS A;  4IDZ A;  1LRZ A;  2MBG A;  2CXF A;  3D0T A;  5KDM C;  5CA0 E;  1Y64 B;  2KWI B;  3N2O A;  3OYX A;  5LHG B;  4KP3 C;  2QA7 A;  3GMI A;  3HI2 A;  4JEU B;  2N2N A;  4PAG A;  4EB6 E;  5C8Y E;  3HKE E;  5JDN A;  3HR0 A;  4I4T E;  5EK2 A;  4QXB B;  3ZMU B;  5HXC A;  1FEW A;  5FY0 A;  3SWH A;  4CI2 B;  2EHO A;  2W61 A;  1D1B A;  4L9I A;  3MK7 C;  3RPU A;  3I0Q A;  4UVC B;  3C98 B;  3EVY A;  3WAK A;  4OYK A;  5DQW A;  3Q5W A;  4MAL A;  2JPF A;  2M67 A;  2NW7 A;  3N9O A;  5JVD E;  3KV9 A;  5IHY A;  4EXT A;  4NUV A;  4OK0 A;  2LOP A;  5GON E;  3ZYL A;  3C4Z A;  4B6X A;  2DCF A;  2V7K A;  4H9Q C;  4U72 A;  3HKB E;  3RKO A;  2E8I A;  5LGT B;  5H6Q B;  4H9S E;  2CWY A;  4GIW A;  4UVB B;  2LSY A;  1QUU A;  2D0T A;  3FHN A;  2JMH A;  4I43 B;  3N9M A;  1HG2 A;  2LHR A;  1EZ3 A;  3AVR A;  1UCU A;  5JDM A;  2UXN B;  2MYS A;  3NRX A;  3IF8 B;  4DMW A;  4ZS3 A;  4H63 V;  2L9Q A;  4DBR A;  5LP6 E;  1ZHC A;  2XAF B;  3AAI A;  3IHR A;  4CXX A;  2CM0 A;  5CB4 E;  3FBZ A;  3ESL A;  3RRW A;  3RC8 A;  1MIY A;  2KXP B;  1U4Q A;  2IW5 B;  2G0U A;  1IJ5 A;  4QX8 B;  1D1A A;  3MAC A;  2WM9 A;  1G73 A;  3Q9D A;  4CI3 B;  3J7Y q;  2NP9 A;  2C5J A;  1FMV A;  4UF0 A;  5EK3 A;  4ILU A;  3LK3 B;  3IBP A;  2UXX B;  2LOS A;  2JQQ A;  3ZMZ B;  2X51 A;  3N2K E;  3CQX C;  4E7S A;  4AQF A;  3ZMT B;  3N9P A;  4XZC A;  3O1I A;  3UUX B;  3ZC0 A;  1HCI A;  1HG5 A;  4O2B E;  2K9A A;  4HGA A;  2Q9Q A;  4JLE A;  4UVA B;  4DBQ A;  1S35 A;  2DLR A;  2NTX A;  4IE7 A;  3U78 A;  2V26 A;  5JRC B;  5L3F B;  4TX5 A;  1O3X A;  2VB6 A;  2XAG B;  2XQY A;  4GK0 E;  4OHF A;  2C5I T;  4FI5 A;  1D1C A;  5FXV A;  2N9D A;  5JRE A;  2X9W A;  3LJC A;  4IHJ E;  3ZCJ A;  4CQI A;  2SPC A;  4O2A E;  4ADZ A;  2CXD A;  2YEV C;  2CE7 A;  3QC9 A;  2Y8D A;  3UUL A;  2CXL A;  4AKG A;  2YK0 A;  2H7V C;  2PG8 A;  2WSS V;  2ACX A;  3F2E A;  3ZPO A;  3GA8 A;  3RX6 A;  2VKD A;  2WMO A;  2L3L A;  3KFW X;  4MLK A;  5L3D B;  4UV9 B;  3B57 A;  3CKD A;  3P7I A;  2D0U A;  4NUU A;  3CPZ A;  2VKJ A;  4FJO A;  4YLH A;  3ETU A;  4MHC A;  3AAE B;  2KLQ A;  3C51 A;  1KK7 A;  3GN5 B;  2W00 A;  5DQV A;  3ZMS B;  2LJL A;  2NOX A;  2ZM2 A;  5JDL A;  4QXC B;  5DJQ C;  1BR1 A;  3E08 A;  2D5U A;  4ZOL E;  3OBV E;  3KDS E;  5FYM A;  2DHR A;  5LNK A;  4GYS A;  4KUM B;  5L3G B;  5JR9 C;  3ANW B;  5LBM A;  3M65 A;  2CA5 A;  3FXD B;  4O8S A;  4UXN B;  2P9B A;  2CEA A;  4Z8X A;  5LGN B;  5TAO A;  4ZI3 D;  3LBX A;  5LXT E;  3OJA A;  4QX7 B;  2MOZ A;  2DWK A;  2V7J A;  3HL6 A;  4XBF B;  1T98 A;  2JMK A;  5DAB A;  2DNX A;  2VAS A;  2WWU A;  3VKG A;  5JDQ A;  1X79 A;  5LHH B;  2JJ9 A;  4CXY A;  3AB3 B;  3CQG B;  5LGU B;  4EYY R;  3E0Z A;  3DP7 A;  2ODU A;  3C4W A;  5EZY E;  1YW0 A;  2CWO A;  3RC3 A;  1S94 A;  4AKH A;  4U74 A;  4H9P C;  4UEL A;  4PFO A;  3LK4 2;  5LOV E;  4X20 E;  4JUY A;  3CX7 B;  3KVA A;  1OXZ A;  3AVS A;  4EOZ B;  3P8C D;  4G2A A;  4TZ4 C;  2ZMA A;  3N5L A;  4H9R C;  2VK9 A;  2LT3 A;  3C64 A;  4HFV A;  3KBT A;  4TV8 E;  4EZ4 A;  5H6R B;  1VRB A;  3SS1 A;  4YJ2 E;  2X0L B;  1D0X A;  2CMR A;  1HF8 A;  5FY1 A;  2KMF A;  2ZM0 A;  5JDF A;  2N1G A;  2V1D B;  2VWA A;  3EDV A;  3AA1 B;  1LKX A;  4UEM A;  2CLY C;  2X68 A;  3CVR A;  3N9N A;  3HKD E;  4ZI2 D;  3VKH A;  1MMA A;  2VL8 A;  5FNV E;  4CXW A;  2YU2 A;  4YJ3 E;  2V7L A;  3CX8 B;  4PJJ A;  4P0A A;  2K48 A;  3V5S A;  3GWH A;  2YIN A;  2XAH B;  3CWZ B;  4TUY E;  3CQC B;  4CI1 B;  1MMN A;  3I0O A;  3PUA A;  3NBX X;  3ZN1 B;  3PU8 A;  5JQG E;  3R6N A;  2IAK A;  4ZI3 C;  2A3D A;  3MZK B;  4BJN A;  2EHO D;  3UTK A;  3ZLI A;  3FB2 A;  3GN5 A;  4EIW A;  3B13 A;  3UT5 E;  2BDE A;  4O4H E;  1V9D A;  4MFR A;  4EAH A;  3ZCI A;  4K0U A;  3H37 A;  2XAJ B;  3ONX A;  1U5P A;  5HXH A;  4QXH B;  1IZN B;  1Z0P A;  1LVF A;  4IE0 A;  2NW9 A;  1HFA A;  2E9X C;  1NWM X;  4YHJ A;  1YD8 G;  4PK4 A;  1BR4 A;  2EHO B;  5J2U E;  3E22 E;  2KT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...