4KMCA

Structure analysis of m. tuberculosis rrna transcriptional regulator card and its interaction with t. aquaticus rna polymerase-beta1 domain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
79
structure length
79
Chain Sequence
TNWSRRYKANLEKLASGDVNKVAEVVRDLWRRDQERGLSAGEKRMLAKARQILVGELALAESTDDAKAETILDEVLAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA polymerase-binding transcription factor CarD
publication title Structure of the carboxy-terminal domain of Mycobacterium tuberculosis CarD protein: an essential rRNA transcriptional regulator
doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
total genus 34
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2013-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1290 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4kmcA00
2LT3A 4ILUA 4KBMB 4XAXB 4KMCA 4L5GA 4MFRA
chains in the Genus database with same CATH superfamily
3A8YC 5FVLA 1T8BA 3AEAA 3HKEE 1ZEEA 4TN7B 2EHOA 3ZLIA 4JEHB 3OVUA 3CKDA 1XWMA 5HWXA 3N9LA 5HEUA 2OV9A 3AE7A 5HEGA 4QH1A 2X0YA 4HFDA 2DL1A 3PDYA 4AKRB 1HNWT 3SS1A 1BR1A 4F6RC 5LBQB 4X5TA 4AIUA 4P1NA 1T72A 2M67A 4TX5A 2HN1A 3X1DA 3VRAA 4IIJE 4IE6A 1QLBA 2VL0A 2WY2A 3ZMVB 3ETVA 5LGUB 3N5LA 2C5IT 3CPZA 1YQ4A 3T1YT 2UXDT 1SHZC 4EAHA 4DNDA 4YSZA 3ZMZB 3N9OA 3Q5DA 2JIWA 2YDRA 2MTQA 4UV9B 3AAAB 4V1Av 3SWHA 5FVKA 2I59A 2BG9A 5LBMA 2V8SV 2WDQA 2CXDA 5AQRB 4C91A 3ZC1A 3N2KE 3EAMA 4M1PA 2X9XA 1YW0A 1XDPA 3AECA 5FP3A 3ZSSA 3IHRA 3F57A 4YY3T 1WR0A 5L3GB 3EHZA 4NXNT 1SUMB 4AXPA 5LCYA 3P8CD 4B3ST 2JMHA 4NPPA 3E22E 1IJ6A 2M6IA 3C51A 4ZEYA 1KEYA 1D0ZA 4WNKA 3GN5B 3O1JA 2EHOB 2M6BA 3M65A 2KWHA 4WZXA 3N2OA 4YJ2E 1XZYA 2WB5A 2QA7A 2DCFA 4IE4A 4QXHB 1VRBA 3RRWA 4MLKA 4GYRA 4DO0A 4X65T 3T8OA 2KINB 2HPJA 2JRKA 3JCFA 1QSDA 5FY0A 4WBNE 5LJMA 4I55E 1HX8A 5GONE 2V5CA 3C98B 1MIVA 3A7MA 5HXCA 1E1HB 3VHLA 4EEDA 2XZEA 3ZYKA 3C64A 2XQ5A 4HEAA 4H9NC 3N2GE 1IBLT 2VWAA 3HR0A 4B6XA 1HCIA 4H9PC 1HFAA 4H9RC 2K9AA 3V5SA 4ILBA 4JI6T 1KNPA 3FZMB 4ZI2C 3TLSA 4AKGA 5EK4A 3PE0A 2YDSA 4I50E 3AEBA 4UVAB 4JI7T 4EOZB 5F8PA 1KNZA 3Q9DA 4AQYT 1HR0T 2C5JA 4EIWA 3RQWA 4BJNA 4XBFB 5LHIB 3RF1A 3ZEFB 3OYZA 3ZN1B 4QH4A 3IBPA 3JC6C 3KBTA 4U31A 1E7PA 3EDVA 2JJ9A 3VR8A 3EDUA 3MXZA 3U3IA 3ZCIA 1VOMA 2DHRA 5LYJE 3KV6A 1Z8UA 3ZN0B 2WZIA 5L4HA 4TNWA 3M3ZB 5HAXA 3OPCA 3SOLA 4XAXB 3PUWF 2KMFA 2H7OA 4JYAT 5ABGA 5C3JA 5J2UE 1OEDA 4C90A 4PFOA 5JQGE 3ABVA 2DWGA 1WCRA 4U3CA 4YXDA 5AQVB 2D5UA 2A9UA 1L0VA 2YINA 2CPTA 4PK6A 2MOZA 5AQUB 3NBXX 2XAHB 4YHHT 4HN9A 3NRYA 3AAIA 5LB7B 2FJDA 2N1GA 5LP6E 4L0RA 4BAYB 5JR9B 3QOFA 2CHOA 3AE1A 3VU7H 3PU8A 4GKKT 4GK5E 4QKNA 2UXBT 2V6XA 3NWIA 5L3EB 3IA3A 4PK4A 4LF9T 1XMOT 4ILAA 2W00A 2H3RA 4HWIB 4H9SE 2BS3A 4DV1T 1IBKT 5L4EA 3ZMTB 3L8RA 4Z90A 5DQVA 1X79A 2XJ7A 5L47A 2XAQB 3CX7B 2X51A 4O4IE 3ZT7A 1J5WA 4A97A 4JBWF 3UQ4A 4AQFA 5L3CB 2PJQA 3QK6A 4U74A 3EVYA 2W2UA 4U2YA 2JQKA 4IE7A 3UUNA 3ZYLA 4GKJT 2LM9A 5FYMA 3ZT6A 4H9OC 2A2FX 1W0AA 2E9XD 2XQ8A 4GYSA 1VCSA 2VQFT 4KX6A 5KDMC 4ADZA 2CLYB 2LHNA 3JAEA 4JI4T 1W9RA 3HL6A 4MALA 4G2AA 2XY8B 2W4XA 4L5GA 5JTGA 2XSBA 4LFAT 4JI3T 4UXNB 3KV4A 3ZKRA 2UU9T 3NZPA 3FZHB 3RKGA 5JDNA 1MIWA 1YD8G 3AA1B 2X67A 1T7SA 4EGWA 4DBRA 2Q9QB 3KFWX 2JQQA 4CXWA 2IHR1 1ZOYA 3QNUA 3PURA 3AA7B 3ESLA 4I43B 3AE5A 3GA8A 1E2AA 3Q5WA 2KWIB 3I1AA 4DV0T 2LOPA 3AEEA 2XASB 2W0GA 5CB4E 4YTNA 3HKDE 4B3RT 1BR0A 5J2TE 1NEKA 2VK9A 2VVNA 2V26A 5AQSB 2K48A 3R6NA 3AE2A 2ZMAA 3AA0B 2N2NA 3OBVE 3UU6A 1NWMX 3O1HA 3LG7A 4CN1A 5KMGP 3PUXF 2NTYA 2QVAA 2E9XC 4GIWA 4O2BE 5IHYA 1CUNA 2LSGA 5AQNB 3RLFF 4EZ4A 4O4HE 2CA5A 3CQXC 1LVKA 5EK3A 2UXXB 4IL4A 2X0HA 5L3BB 3PUSA 3RC3A 2HPLA 4LFCT 1XDOA 4CI2B 4OK0A 3AE6A 3LK2B 2VB6A 2CBIA 5LJNA 2VKHA 3AAEB 3L39A 1HG2A 1MNEA 4LF7T 4YFSA 2W66A 4GOUA 1N33T 3AE3A 3KVBA 3W15B 4HTEA 1J5ET 4AQGA 2ACZA 1N36T 3B57A 3VKGA 4U72A 4DIDB 3FZFB 4XZCA 5TAOA 5LMUT 2SPCA 3AVRA 3QC9A 2IDOB 2LRLA 3PJAJ 4IL9A 2A72A 3ZYMA 2CWOA 4PJNA 3RHWA 2LRKA 2G0UA 4K0KT 4NUVA 2RA1A 1WYCA 2UUBT 1DU2A 4IDPA 5JDLA 4X62T 2FBWA 4L9IA 4CXXA 3RYIE 2LEHA 4FI5A 5IUXA 2CRBA 3BQLA 5AFUL 2ZM0A 3SFEA 3N9NA 5AQPB 5LGTB 2YKSA 3EABA 4LMJA 5JR9C 3RKOA 1IBMT 4TV8E 2V7MA 4DV5T 3KDSE 3HI2A 4IT4A 4OHFA 2ZLYA 2YU1A 4ZI2D 3AXJA 4Q25A 2AXDS 4IDZA 4X1IE 3RIUA 1WFDA 4QHOA 2V1DB 4EV6A 1UX5A 4ZHQE 3UFEA 1N32T 3JC6D 2WDVA 3UFGA 2IMLA 3ZSTA 3LFMA 2N9DA 4X1KE 2LKGA 2K3WA 2NR4A 4DV3T 4ANJA 4UF0A 3P7IA 4ZOLE 2UXCT 5KX5E 3PUYF 4HFEA 3NVOA 2AE9A 2XM1A 1OWAA 3VRBA 5FNVE 1Z0PA 2QRXA 4OYKA 4PW8A 4DV4T 2WU2A 2NW8A 2XQ3A 5HXEA 1GQEA 5HEJA 3Q2MA 2XQ7A 2WDRA 2XQ4A 2XAFB 4K0UA 3P4RA 3P50A 4JI2T 4MBQA 5M4YA 3QB5A 5LG3A 2H7VC 3TLUA 4O4JE 1YXRA 4ERRA 4I4TE 4ZZBA 2Y8DA 4CI1B 2WCAA 4PAGA 4DBQA 3AVSA 1FMVA 4IE0A 2CXFA 1FJGT 3I9YA 3G06A 3EI0A 5LA6E 2BG9B 1WYBA 4DMVA 2ZM2A 2DWKA 4OX9T 3U78A 2IC9A 3PUAA 5ABFA 1ZHCA 5L3FB 3FZLB 2D2SA 2XQYA 4A56A 2V7KA 4N78D 5BR8T 1MIYA 1UK5A 3ZMSB 4X1YE 4BA9A 4KBMB 1HTJF 1QUUA 2BS4A 2K5BB 3MKDA 3LK3B 4YT0A 2PG8A 5CJ5A 4EB6E 2XPKA 3MACA 4DMWA 4JV5T 2W61A 3LJCA 5BMVE 2X66A 5JRCA 4WBOA 1KK7A 1UX4A 1M62A 3O1IA 2ZM8A 4IDNA 1LRZA 2X9WA 2E5VA 2H89A 3N9PA 3JADA 3FXDB 3UU8A 4IDQA 3D0TA 4PJLA 2LHRA 1IJ5A 5AQMB 3UUXB 4AISA 1M7KA 2XQ9A 4PJJA 4A5XA 4UV8B 5DABA 3QB5K 2UXNB 1HS7A 4IHJE 4ZXLA 4ASKA 2KZ7B 2J1DG 4ILUA 5HEOA 1KFYA 1ZP0A 2EHOD 2H88A 1O3XA 4DR2T 3UULA 4Z91A 5J1GA 3FZKB 1SE7A 4CN6A 4NUUA 3KINB 3C50A 2X9HA 2KSRA 2LJLA 1MMDA 3FHNA 4QX7B 1MMGA 3S4UA 4YSXA 3ZT5A 5ABFB 2WSSV 3K3OA 3LBXA 5LMNT 3RX6A 4KHPT 4AI6A 1US7B 5F5WA 3IF8B 5HCMA 2ODUA 3ANWA 5J0ZA 5C8YE 1IAPA 4P09A 3MJXA 1J1JA 3HA4A 3BQIA 4F8HA 3CVRA 3UT5E 2HHHT 1XNQT 4P0AA 4IREA 2XHEB 2XUEA 1G8XA 5LG4A 2LT3A 1HNZT 3H3AA 4YHJA 1Y64B 2VURA 2XAGB 4WW0A 3CWZB 4DVDA 1WLXA 3TKLB 1UCUA 2D0UA 1YKHB 3RI5A 1OEDB 5FY7A 5AQTB 2E8IA 3AA6B 2WM9A 4DR4T 1KNRA 3OJAA 4DUZT 4QXBB 2JQHA 5HXHA 2F4VT 3FBLA 4B3MT 4KP3C 5F3JA 2VL8A 5H6QB 5LHGB 4HWFA 4DR6T 3PUGA 5CA1E 4IE5A 2JPFA 2EHOC 5LXTE 2CHNA 5HEHA 4NIQA 1NAFA 2FUPA 5DQWA 2YDQA 3ZCJA 4TUYE 4JUYA 3P4QA 1ZKEA 2WU5A 1UUSA 4UVCB 4HE8A 3F2EA 1IZNB 2LSKA 3Q5EA 2D9DA 4QWNB 5HCJA 2WP9A 2UUAT 4LMLA 2PBIA 2XAJB 2MAWA 1W0BA 5CGMA 4FJOA 3L3PA 2E2AA 2ZM6T 3AB3B 3C4XA 4OFZA 4ISSA 4UR9A 2C5KT 2J47A 4LF6T 4GK0E 4HFBA 5LNKA 4ISTA 1UGOA 2W67A 4X66T 4JLEA 1S94A 4CZZB 2NOXA 2WWUA 3ZC0A 3IEEA 1N34T 3FXEB 3ONLC 3ZMUB 4YLHA 4LFBT 4HFIA 2LSYA 5IWAT 4ILCA 4EXTA 3P4SA 4DV2T 3AE4A 2FJEA 2MYSA 5FXXA 2WZHA 1I94T 2ES0A 4G63A 5ABEA 2IW5B 3C4WA 2NP9A 2J62A 2KXPB 4UIGA 2CXLA 3SFDA 3KV5A 2B1EA 2BKOA 2LSJA 3GN5A 2VVSA 2Y6XA 3B13A 3E08A 4CQIA 3CQCB 1OXZA 2WBLA 2CM0A 3HKCE 3O4XE 4UVBB 2V5DA 3EUHA 3RYFE 5CA0E 4YTPA 4CXYA 3GWHA 1MNDA 2IUBA 4I0UA 3TLTA 4AKIA 3K8PC 4YJ3E 4EZHA 1YKEB 1V9DA 2L8KA 4DR1T 1MMAA 4Z8XA 1H7CA 3V5UA 1Y01A 5IYZE 2A3DA 2XQAA 4HFVA 2IAKA 4PJMA 3UU5A 5AQKB 5HXSA 1LVFA 2R6GF 4U7YA 2NWBA 2E9XA 3I0QA 4JI8T 3RPUA 4ZZCA 2CE7A 1D1AA 5HYAA 3TLWA 4B3TT 2V6YA 4JI0T 2NTXA 2Q9QD 1XNRT 1HNXT 4O4LE 2CWYA 5HXRA 5ETWA 1G73A 5L3DB 1UURA 4H9QC 3VKHA 3OYXA 3RH3A 4HGAA 5AQJB 4P0BA 3J9X1 2C0SA 4X20E 4DR5T 2BVMA 1SA0E 4E7ZA 2OLTA 1CHUA 1XMQT 4O2AE 5FL0A 2HN2A 3J7Yq 1WRDA 3Q5XA 4H63H 4EEBA 2RPAA 3CX6B 3PTRB 1HX1B 5JDHA 2WWVA 2W62A 2XTLA 3ETUA 4LF4T 4TWDA 2BDEA 3WI3A 4DV7T 1HG5A 2LM2A 4QXCB 4ZI3D 2VASA 2CLYC 3UUMA 3PUZF 2B76A 1OEDC 4KI0F 4BJMA 5C2TA 4IDOA 3MZKB 3ZJ1A 3FBZA 2V7LA 3AEDA 1YQ3A 3JAFA 2WS3A 2UUCT 2I6HA 3LDQB 3HKBE 5EZYE 4IGUA 1LKXA 5EK2A 3UU4A 2IIUA 3KBUA 2Q9QC 3E0ZA 2BBHA 1I6ZA 5L2LA 4PK5A 4HFCA 5AQOB 1FEWA 5JR9A 3SRZA 5FKYA 2L3LA 2E9XB 2VKDA 4HFHA 5FL1A 4TNVA 4O8SA 2CEAA 2V6YB 1D0YA 4U33A 3N9QA 3T1HT 3PUQA 5FXWA 2QYWA 3AXJB 4UEMA 2LE8A 4DR3T 2BS2A 3NKZA 5HWYA 5FMNA 3L09A 2XSAA 4J2CA 4KMCA 3P4WA 4HWHA 1BR2A 1EZ3A 1T98A 1NENA 2WQYA 5H6RB 1U4QA 3K3QC 3NRXA 5AQIB 3RRCA 2FJBA 3UUBA 1WR6A 3UTKA 4ZI3C 4AQFC 3RYCE 2ACXA 2P9BA 2NW9A 2WAUA 3NZQA 3WAKA 3K1SA 5AQGB 2JMKA 3TLVA 4UF0B 5JDGA 3H3MA 4JI1T 2Y48B 3CIRA 3GMIA 3UU3A 3UQ7A 2YU2A 3F31A 2KNDA 5A1LA 5FXVA 2BBJA 4U7IA 3RIAA 5JVDE 2X68A 4COFA 2CCQA 2V7JA 1FIOA 4TV9E 3MA9A 4TWFA 2LLYA 5AQLB 4QX8B 1U5PA 5FY1A 4HKAA 2RP4A 5LOVE 2V7IA 2Q9QA 1JNRA 2IC6A 2QGSA 2Z6EA 2JQ9A 3KV9A 1D0XA 4UELA 1D1CA 2BKNA 3WAJA 2WMNA 3DP7A 2YEVC 4AKHA 4MFRA 4MHCA 2LKHA 3RGLA 2DI4A 2BG9E 4PNIA 2ODVA 3O9XA 4TWHA 2VKOA 3PUVF 5DJQC 4YTMA 3LK42 1BR4A 5JDFA 1S35A 5LHHB 3ZJ2A 5ADXL 5FXZA 4ZS3A 3R84B 4DV6T 3ONXA 3AEFA 4JI5T 2YK0A 4JEUB 4PFPA 4YSYA 2W63A 5JRCB 3AE8A 2MBGA 4KUMB 4LF5T 4CI3B 3PJAA 2NW7A 2VQET 2YOEA 5ABHA 2BKPA 4U2ZA 2X0LB 2BVLA 3ONJA 5JREA 2LOSA 2DLRA 3PU3A 2YN6A 5JDQA 3DJBA 3RQUA 2CMRA 3FB2A 2KLQA 4WYVA 5KXJA 3N9MA 4ZS2A 2GK9A 3RIFA 1JNZA 4KHZF 4H63V 1HF8A 3B5MA 3LSVA 2I0MA 2PFVA 3PV0F 2E5LT 2XQ6A 4LMKA 5CFBA 1R8IA 2J4GA 5LGNB 2X9YA 3QUJA 3ZPOA 4HWDA 2XM2A 3BK9A 2OA5A 3OKQA 4EYUA 2D0TA 3LBXB 4OYJA 1MMNA 2BZBA 4DR7T 4NXMT 5AQHB 2VKJA 3CK6A 4LF8T 2DNXA 5JH7E 4QH5A 5AQFB 3RC8A 3ANWB 3CQGB 4CN4A 1D1BA 4A98A 2PTFA 3CMLA 3C4ZA 3RYHE 2MPKA 3H37A 4DUYT 2HH7A 3I0OA 1W09A 4E7SA 2BG9C 3DTOA 5AQQB 2KT9A 2L9QA 1B7TA 3KVAA 5E0OA 4AKLA 2K24A 2CBJA 3OTOT 1VCTA 3K3NA 4HWCA 4X64T 4TZ4C 3A5XA 1FMWA 3AE9A 2WMOA 1ZV4X 3BQKA 3VR9A 3RIUC 4ZI7E 3MK7C 1KF6A 1X9BA 3P4PA 3CX8B 1AJ3A 3I9WA 2LSIA 5JDMA 3AEGA 1OEDE 2FJAA 4EYYR
chains in the Genus database with same CATH topology
3WI3A 2X9WA 3HKEE 4L5GA 1ZEEA 4TN7B 2EHOA 3ZLIA 4JEHB 3N9PA 1HG5A 3CKDA 3FXDB 4QXCB 4ZI3D 5HWXA 4UXNB 3KV4A 3N9LA 3D0TA 4PJLA 2LHRA 1IJ5A 2VASA 2CLYC 3NZPA 3UUMA 3UUXB 5JDNA 1MIWA 3PDYA 4AKRB 4PJJA 3SS1A 1YD8G 1BR1A 3AA1B 4F6RC 2X67A 4UV8B 5LBQB 4BJMA 4DBRA 3MZKB 5DABA 2Q9QB 3ZJ1A 3FBZA 2UXNB 2V7LA 1HS7A 3KFWX 2JQQA 4IHJE 4CXWA 4ASKA 2M67A 4TX5A 2KZ7B 3HKBE 3PURA 3AA7B 5EZYE 4IGUA 2J1DG 1LKXA 5EK2A 4IIJE 3ESLA 4I43B 4ILUA 4IE6A 3KBUA 3ZMVB 3GA8A 2Q9QC 3ETVA 3E0ZA 2EHOD 5LGUB 5L2LA 3N5LA 4PK5A 1O3XA 3Q5WA 3UULA 2KWIB 2C5IT 3I1AA 5J1GA 3CPZA 2LOPA 2XASB 1FEWA 2W0GA 4NUUA 5CB4E 3KINB 5JR9A 3SRZA 3C50A 1SHZC 2X9HA 3HKDE 4EAHA 1BR0A 2L3LA 4DNDA 2E9XB 2VKDA 5J2TE 2LJLA 1MMDA 2VK9A 3ZMZB 4O8SA 3FHNA 4QX7B 3N9OA 1MMGA 2CEAA 3S4UA 1D0YA 2V26A 2K48A 2WSSV 3K3OA 3R6NA 2MTQA 2ZMAA 3LBXA 3N9QA 3AA0B 2N2NA 4UV9B 3AAAB 3RX6A 3PUQA 4V1Av 5FXWA 4AI6A 3OBVE 3SWHA 1US7B 1NWMX 4UEMA 3O1HA 2I59A 3LG7A 2LE8A 3IF8B 5KMGP 2NTYA 2ODUA 5LBMA 5HWYA 3ANWA 2CXDA 2E9XC 5FMNA 3L09A 4C91A 4J2CA 1IAPA 3ZC1A 4KMCA 3N2KE 4P09A 4GIWA 5C8YE 3MJXA 4O2BE 4M1PA 5IHYA 1BR2A 3BQIA 3HA4A 1EZ3A 1CUNA 2X9XA 3CVRA 3UT5E 1YW0A 1T98A 2LSGA 5FP3A 5H6RB 3IHRA 3F57A 1U4QA 3K3QC 4P0AA 4EZ4A 3NRXA 4O4HE 2XHEB 5L3GB 2XUEA 1G8XA 3RRCA 2CA5A 5LG4A 3CQXC 1LVKA 1WR6A 5EK3A 4AXPA 2UXXB 3UTKA 5L3BB 5LCYA 3P8CD 4ZI3C 2LT3A 3PUSA 2JMHA 4AQFC 3RC3A 2HPLA 3H3AA 3E22E 4YHJA 1Y64B 3RYCE 1IJ6A 4CI2B 2ACXA 2P9BA 2NW9A 2WAUA 2XAGB 4OK0A 4WW0A 3NZQA 3CWZB 3C51A 3WAKA 4DVDA 1WLXA 3TKLB 3LK2B 1UCUA 2VB6A 2JMKA 1D0ZA 2D0UA 5LJNA 4WNKA 3GN5B 4UF0B 1YKHB 5JDGA 5FY7A 2VKHA 3AAEB 2E8IA 3AA6B 3O1JA 2EHOB 2WM9A 3M65A 1HG2A 2KWHA 2Y48B 3GMIA 1MNEA 4YFSA 3N2OA 4YJ2E 2YU2A 3F31A 3OJAA 2KNDA 4GOUA 5A1LA 5FXVA 4QXBB 5HXHA 2QA7A 3KVBA 4HTEA 3W15B 4AQGA 2DCFA 4IE4A 4QXHB 1VRBA 3RRWA 3FBLA 4MLKA 4GYRA 4KP3C 4DO0A 5F3JA 2VL8A 5JVDE 2X68A 5H6QB 3B57A 3VKGA 2CCQA 5LHGB 2V7JA 1FIOA 4U72A 3T8OA 2KINB 3PUGA 4XZCA 4IE5A 5CA1E 4TV9E 5TAOA 2HPJA 2JRKA 2JPFA 3MA9A 2EHOC 5LXTE 1QSDA 3AVRA 2SPCA 5FY0A 3QC9A 1NAFA 4WBNE 5DQWA 5LJMA 3ZCJA 4QX8B 4TUYE 4JUYA 1U5PA 2A72A 3ZYMA 1ZKEA 4I55E 2CWOA 5FY1A 1HX8A 4HKAA 5GONE 3C98B 1MIVA 2RP4A 5LOVE 2V7IA 2Q9QA 4PJNA 4UVCB 5HXCA 4HE8A 3F2EA 1E1HB 3VHLA 1IZNB 2G0UA 2LSKA 4QWNB 4NUVA 2RA1A 1WYCA 2IC6A 3ZYKA 3C64A 2PBIA 2QGSA 2Z6EA 5JDLA 2XAJB 4HEAA 3KV9A 4H9NC 4L9IA 1D0XA 3N2GE 4CXXA 3RYIE 2VWAA 3HR0A 4FJOA 2LEHA 4UELA 4B6XA 1HCIA 1D1CA 3L3PA 4FI5A 4H9PC 3WAJA 3BQLA 3AB3B 2WMNA 3DP7A 5AFUL 2YEVC 4AKHA 1HFAA 3C4XA 2ZM0A 4H9RC 2K9AA 4OFZA 4ISSA 4MFRA 2C5KT 4MHCA 3V5SA 3N9NA 2DI4A 4GK0E 4ZI2C 4PNIA 5LGTB 5LNKA 2ODVA 4AKGA 5EK4A 4ISTA 3O9XA 3PE0A 5JR9C 4I50E 2VKOA 3RKOA 4JLEA 5DJQC 4UVAB 3LK42 4TV8E 4EOZB 1S94A 4CZZB 5F8PA 2V7MA 2NOXA 1BR4A 3KDSE 1KNZA 3HI2A 2WWUA 3Q9DA 4OHFA 2ZLYA 5JDFA 1S35A 2YU1A 2C5JA 3ZC0A 5LHHB 3IEEA 4EIWA 3FXEB 3ZMUB 4BJNA 4ZI2D 4YLHA 3ZJ2A 5ADXL 4XBFB 5LHIB 2LSYA 3ZEFB 5FXZA 3OYZA 4ZS3A 3ZN1B 3R84B 3IBPA 3ONXA 4IDZA 3JC6C 3KBTA 4X1IE 2YK0A 4JEUB 3EDVA 4PFPA 2JJ9A 2W63A 5JRCB 4EXTA 4QHOA 2V1DB 2MBGA 3EDUA 3MXZA 4KUMB 3U3IA 2MYSA 3ZCIA 1VOMA 2DHRA 5FXXA 4CI3B 5LYJE 1UX5A 2NW7A 2ES0A 4G63A 4ZHQE 3KV6A 2IW5B 3ZN0B 3C4WA 3UFEA 2NP9A 2KXPB 3JC6D 5HAXA 2X0LB 4UIGA 2CXLA 2BVLA 5JREA 2LOSA 2DLRA 3LFMA 2N9DA 3KV5A 3PU3A 4X1KE 4XAXB 3SOLA 5JDQA 2B1EA 2KMFA 3DJBA 2CMRA 2H7OA 2LSJA 5J2UE 3FB2A 4ANJA 3GN5A 4UF0A 4C90A 2KLQA 2Y6XA 3B13A 3E08A 3P7IA 4ZOLE 5KX5E 4PFOA 4CQIA 5JQGE 2DWGA 3CQCB 1OXZA 2WBLA 1OWAA 2CM0A 3HKCE 3O4XE 5FNVE 1Z0PA 4UVBB 4OYKA 3N9MA 2D5UA 3EUHA 4ZS2A 2GK9A 4PW8A 3RYFE 5CA0E 4H63V 1HF8A 2YINA 2NW8A 5HXEA 4CXYA 4PK6A 2MOZA 3GWHA 1MNDA 3NBXX 2PFVA 2XAHB 4AKIA 3K8PC 4YJ3E 3Q2MA 4HN9A 3NRYA 4EZHA 3AAIA 2XAFB 4K0UA 1YKEB 4MBQA 5M4YA 2N1GA 5LP6E 1V9DA 4L0RA 2L8KA 4BAYB 5LGNB 2X9YA 3QUJA 3ZPOA 2H7VC 5JR9B 1MMAA 4O4JE 4ERRA 4Z8XA 3BK9A 4I4TE 1H7CA 3VU7H 3PU8A 2OA5A 3OKQA 3V5UA 4EYUA 2Y8DA 5IYZE 4CI1B 2D0TA 2A3DA 4GK5E 4QKNA 4HFVA 2IAKA 4PJMA 3LBXB 4PAGA 4OYJA 1MMNA 4DBQA 2BZBA 3AVSA 5L3EB 1FMVA 4IE0A 2CXFA 4PK4A 5HXSA 3I9YA 2VKJA 1LVFA 2W00A 2H3RA 5LA6E 2NWBA 2DNXA 5JH7E 1WYBA 4DMVA 2ZM2A 2E9XA 3RC8A 3ANWB 3I0QA 4H9SE 3RPUA 2CE7A 3CQGB 1D1AA 5HYAA 2DWKA 1D1BA 2NTXA 3U78A 2IC9A 2Q9QD 3PUAA 3ZMTB 3CMLA 3C4ZA 1ZHCA 5L3FB 3RYHE 2D2SA 2XQYA 4A56A 2V7KA 4O4LE 4N78D 5DQVA 1X79A 2CWYA 5HXRA 1MIYA 3H37A 5ETWA 3ZMSB 2XAQB 2HH7A 3I0OA 4E7SA 1G73A 3CX7B 4X1YE 4BA9A 2X51A 4KBMB 4O4IE 5L3DB 3DTOA 1HTJF 2KT9A 4H9QC 2L9QA 1QUUA 3VKHA 1B7TA 3KVAA 3OYXA 5E0OA 4HGAA 3RH3A 2K5BB 3MKDA 4AKLA 2K24A 2PJQA 3QK6A 4AQFA 4P0BA 5L3CB 3LK3B 2PG8A 3J9X1 2C0SA 4U74A 3K3NA 3EVYA 4X20E 2BVMA 1SA0E 4E7ZA 4TZ4C 3A5XA 4EB6E 4O2AE 1FMWA 3MACA 4IE7A 3UUNA 4DMWA 3ZYLA 2LM9A 3J7Yq 1WRDA 5FYMA 3Q5XA 2WMOA 1ZV4X 2W61A 4H63H 4H9OC 3BQKA 2A2FX 3LJCA 2E9XD 4GYSA 5BMVE 4ZI7E 2X66A 3CX6B 3MK7C 3PTRB 5JRCA 5KDMC 4WBOA 1KK7A 4ADZA 1UX4A 5JDHA 2CLYB 3CX8B 2LHNA 3O1IA 1AJ3A 3I9WA 2LSIA 2ZM8A 5JDMA 2W62A 2XTLA 3ETUA 1LRZA 3HL6A 2BDEA 4EYYR 4MALA 4G2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LT3 A;  4ILU A;  4KBM B;  4XAX B;  4KMC A;  4L5G A;  4MFR A; 
#chains in the Genus database with same CATH topology
 3A8Y C;  5FVL A;  1T8B A;  3AEA A;  3HKE E;  1ZEE A;  4TN7 B;  2EHO A;  3ZLI A;  4JEH B;  3OVU A;  3CKD A;  1XWM A;  5HWX A;  3N9L A;  5HEU A;  2OV9 A;  3AE7 A;  5HEG A;  4QH1 A;  2X0Y A;  4HFD A;  2DL1 A;  3PDY A;  4AKR B;  1HNW T;  3SS1 A;  1BR1 A;  4F6R C;  5LBQ B;  4X5T A;  4AIU A;  4P1N A;  1T72 A;  2M67 A;  4TX5 A;  2HN1 A;  3X1D A;  3VRA A;  4IIJ E;  4IE6 A;  1QLB A;  2VL0 A;  2WY2 A;  3ZMV B;  3ETV A;  5LGU B;  3N5L A;  2C5I T;  3CPZ A;  1YQ4 A;  3T1Y T;  2UXD T;  1SHZ C;  4EAH A;  4DND A;  4YSZ A;  3ZMZ B;  3N9O A;  3Q5D A;  2JIW A;  2YDR A;  2MTQ A;  4UV9 B;  3AAA B;  4V1A v;  3SWH A;  5FVK A;  2I59 A;  2BG9 A;  5LBM A;  2V8S V;  2WDQ A;  2CXD A;  5AQR B;  4C91 A;  3ZC1 A;  3N2K E;  3EAM A;  4M1P A;  2X9X A;  1YW0 A;  1XDP A;  3AEC A;  5FP3 A;  3ZSS A;  3IHR A;  3F57 A;  4YY3 T;  1WR0 A;  5L3G B;  3EHZ A;  4NXN T;  1SUM B;  4AXP A;  5LCY A;  3P8C D;  4B3S T;  2JMH A;  4NPP A;  3E22 E;  1IJ6 A;  2M6I A;  3C51 A;  4ZEY A;  1KEY A;  1D0Z A;  4WNK A;  3GN5 B;  3O1J A;  2EHO B;  2M6B A;  3M65 A;  2KWH A;  4WZX A;  3N2O A;  4YJ2 E;  1XZY A;  2WB5 A;  2QA7 A;  2DCF A;  4IE4 A;  4QXH B;  1VRB A;  3RRW A;  4MLK A;  4GYR A;  4DO0 A;  4X65 T;  3T8O A;  2KIN B;  2HPJ A;  2JRK A;  3JCF A;  1QSD A;  5FY0 A;  4WBN E;  5LJM A;  4I55 E;  1HX8 A;  5GON E;  2V5C A;  3C98 B;  1MIV A;  3A7M A;  5HXC A;  1E1H B;  3VHL A;  4EED A;  2XZE A;  3ZYK A;  3C64 A;  2XQ5 A;  4HEA A;  4H9N C;  3N2G E;  1IBL T;  2VWA A;  3HR0 A;  4B6X A;  1HCI A;  4H9P C;  1HFA A;  4H9R C;  2K9A A;  3V5S A;  4ILB A;  4JI6 T;  1KNP A;  3FZM B;  4ZI2 C;  3TLS A;  4AKG A;  5EK4 A;  3PE0 A;  2YDS A;  4I50 E;  3AEB A;  4UVA B;  4JI7 T;  4EOZ B;  5F8P A;  1KNZ A;  3Q9D A;  4AQY T;  1HR0 T;  2C5J A;  4EIW A;  3RQW A;  4BJN A;  4XBF B;  5LHI B;  3RF1 A;  3ZEF B;  3OYZ A;  3ZN1 B;  4QH4 A;  3IBP A;  3JC6 C;  3KBT A;  4U31 A;  1E7P A;  3EDV A;  2JJ9 A;  3VR8 A;  3EDU A;  3MXZ A;  3U3I A;  3ZCI A;  1VOM A;  2DHR A;  5LYJ E;  3KV6 A;  1Z8U A;  3ZN0 B;  2WZI A;  5L4H A;  4TNW A;  3M3Z B;  5HAX A;  3OPC A;  3SOL A;  4XAX B;  3PUW F;  2KMF A;  2H7O A;  4JYA T;  5ABG A;  5C3J A;  5J2U E;  1OED A;  4C90 A;  4PFO A;  5JQG E;  3ABV A;  2DWG A;  1WCR A;  4U3C A;  4YXD A;  5AQV B;  2D5U A;  2A9U A;  1L0V A;  2YIN A;  2CPT A;  4PK6 A;  2MOZ A;  5AQU B;  3NBX X;  2XAH B;  4YHH T;  4HN9 A;  3NRY A;  3AAI A;  5LB7 B;  2FJD A;  2N1G A;  5LP6 E;  4L0R A;  4BAY B;  5JR9 B;  3QOF A;  2CHO A;  3AE1 A;  3VU7 H;  3PU8 A;  4GKK T;  4GK5 E;  4QKN A;  2UXB T;  2V6X A;  3NWI A;  5L3E B;  3IA3 A;  4PK4 A;  4LF9 T;  1XMO T;  4ILA A;  2W00 A;  2H3R A;  4HWI B;  4H9S E;  2BS3 A;  4DV1 T;  1IBK T;  5L4E A;  3ZMT B;  3L8R A;  4Z90 A;  5DQV A;  1X79 A;  2XJ7 A;  5L47 A;  2XAQ B;  3CX7 B;  2X51 A;  4O4I E;  3ZT7 A;  1J5W A;  4A97 A;  4JBW F;  3UQ4 A;  4AQF A;  5L3C B;  2PJQ A;  3QK6 A;  4U74 A;  3EVY A;  2W2U A;  4U2Y A;  2JQK A;  4IE7 A;  3UUN A;  3ZYL A;  4GKJ T;  2LM9 A;  5FYM A;  3ZT6 A;  4H9O C;  2A2F X;  1W0A A;  2E9X D;  2XQ8 A;  4GYS A;  1VCS A;  2VQF T;  4KX6 A;  5KDM C;  4ADZ A;  2CLY B;  2LHN A;  3JAE A;  4JI4 T;  1W9R A;  3HL6 A;  4MAL A;  4G2A A;  2XY8 B;  2W4X A;  4L5G A;  5JTG A;  2XSB A;  4LFA T;  4JI3 T;  4UXN B;  3KV4 A;  3ZKR A;  2UU9 T;  3NZP A;  3FZH B;  3RKG A;  5JDN A;  1MIW A;  1YD8 G;  3AA1 B;  2X67 A;  1T7S A;  4EGW A;  4DBR A;  2Q9Q B;  3KFW X;  2JQQ A;  4CXW A;  2IHR 1;  1ZOY A;  3QNU A;  3PUR A;  3AA7 B;  3ESL A;  4I43 B;  3AE5 A;  3GA8 A;  1E2A A;  3Q5W A;  2KWI B;  3I1A A;  4DV0 T;  2LOP A;  3AEE A;  2XAS B;  2W0G A;  5CB4 E;  4YTN A;  3HKD E;  4B3R T;  1BR0 A;  5J2T E;  1NEK A;  2VK9 A;  2VVN A;  2V26 A;  5AQS B;  2K48 A;  3R6N A;  3AE2 A;  2ZMA A;  3AA0 B;  2N2N A;  3OBV E;  3UU6 A;  1NWM X;  3O1H A;  3LG7 A;  4CN1 A;  5KMG P;  3PUX F;  2NTY A;  2QVA A;  2E9X C;  4GIW A;  4O2B E;  5IHY A;  1CUN A;  2LSG A;  5AQN B;  3RLF F;  4EZ4 A;  4O4H E;  2CA5 A;  3CQX C;  1LVK A;  5EK3 A;  2UXX B;  4IL4 A;  2X0H A;  5L3B B;  3PUS A;  3RC3 A;  2HPL A;  4LFC T;  1XDO A;  4CI2 B;  4OK0 A;  3AE6 A;  3LK2 B;  2VB6 A;  2CBI A;  5LJN A;  2VKH A;  3AAE B;  3L39 A;  1HG2 A;  1MNE A;  4LF7 T;  4YFS A;  2W66 A;  4GOU A;  1N33 T;  3AE3 A;  3KVB A;  3W15 B;  4HTE A;  1J5E T;  4AQG A;  2ACZ A;  1N36 T;  3B57 A;  3VKG A;  4U72 A;  4DID B;  3FZF B;  4XZC A;  5TAO A;  5LMU T;  2SPC A;  3AVR A;  3QC9 A;  2IDO B;  2LRL A;  3PJA J;  4IL9 A;  2A72 A;  3ZYM A;  2CWO A;  4PJN A;  3RHW A;  2LRK A;  2G0U A;  4K0K T;  4NUV A;  2RA1 A;  1WYC A;  2UUB T;  1DU2 A;  4IDP A;  5JDL A;  4X62 T;  2FBW A;  4L9I A;  4CXX A;  3RYI E;  2LEH A;  4FI5 A;  5IUX A;  2CRB A;  3BQL A;  5AFU L;  2ZM0 A;  3SFE A;  3N9N A;  5AQP B;  5LGT B;  2YKS A;  3EAB A;  4LMJ A;  5JR9 C;  3RKO A;  1IBM T;  4TV8 E;  2V7M A;  4DV5 T;  3KDS E;  3HI2 A;  4IT4 A;  4OHF A;  2ZLY A;  2YU1 A;  4ZI2 D;  3AXJ A;  4Q25 A;  2AXD S;  4IDZ A;  4X1I E;  3RIU A;  1WFD A;  4QHO A;  2V1D B;  4EV6 A;  1UX5 A;  4ZHQ E;  3UFE A;  1N32 T;  3JC6 D;  2WDV A;  3UFG A;  2IML A;  3ZST A;  3LFM A;  2N9D A;  4X1K E;  2LKG A;  2K3W A;  2NR4 A;  4DV3 T;  4ANJ A;  4UF0 A;  3P7I A;  4ZOL E;  2UXC T;  5KX5 E;  3PUY F;  4HFE A;  3NVO A;  2AE9 A;  2XM1 A;  1OWA A;  3VRB A;  5FNV E;  1Z0P A;  2QRX A;  4OYK A;  4PW8 A;  4DV4 T;  2WU2 A;  2NW8 A;  2XQ3 A;  5HXE A;  1GQE A;  5HEJ A;  3Q2M A;  2XQ7 A;  2WDR A;  2XQ4 A;  2XAF B;  4K0U A;  3P4R A;  3P50 A;  4JI2 T;  4MBQ A;  5M4Y A;  3QB5 A;  5LG3 A;  2H7V C;  3TLU A;  4O4J E;  1YXR A;  4ERR A;  4I4T E;  4ZZB A;  2Y8D A;  4CI1 B;  2WCA A;  4PAG A;  4DBQ A;  3AVS A;  1FMV A;  4IE0 A;  2CXF A;  1FJG T;  3I9Y A;  3G06 A;  3EI0 A;  5LA6 E;  2BG9 B;  1WYB A;  4DMV A;  2ZM2 A;  2DWK A;  4OX9 T;  3U78 A;  2IC9 A;  3PUA A;  5ABF A;  1ZHC A;  5L3F B;  3FZL B;  2D2S A;  2XQY A;  4A56 A;  2V7K A;  4N78 D;  5BR8 T;  1MIY A;  1UK5 A;  3ZMS B;  4X1Y E;  4BA9 A;  4KBM B;  1HTJ F;  1QUU A;  2BS4 A;  2K5B B;  3MKD A;  3LK3 B;  4YT0 A;  2PG8 A;  5CJ5 A;  4EB6 E;  2XPK A;  3MAC A;  4DMW A;  4JV5 T;  2W61 A;  3LJC A;  5BMV E;  2X66 A;  5JRC A;  4WBO A;  1KK7 A;  1UX4 A;  1M62 A;  3O1I A;  2ZM8 A;  4IDN A;  1LRZ A;  2X9W A;  2E5V A;  2H89 A;  3N9P A;  3JAD A;  3FXD B;  3UU8 A;  4IDQ A;  3D0T A;  4PJL A;  2LHR A;  1IJ5 A;  5AQM B;  3UUX B;  4AIS A;  1M7K A;  2XQ9 A;  4PJJ A;  4A5X A;  4UV8 B;  5DAB A;  3QB5 K;  2UXN B;  1HS7 A;  4IHJ E;  4ZXL A;  4ASK A;  2KZ7 B;  2J1D G;  4ILU A;  5HEO A;  1KFY A;  1ZP0 A;  2EHO D;  2H88 A;  1O3X A;  4DR2 T;  3UUL A;  4Z91 A;  5J1G A;  3FZK B;  1SE7 A;  4CN6 A;  4NUU A;  3KIN B;  3C50 A;  2X9H A;  2KSR A;  2LJL A;  1MMD A;  3FHN A;  4QX7 B;  1MMG A;  3S4U A;  4YSX A;  3ZT5 A;  5ABF B;  2WSS V;  3K3O A;  3LBX A;  5LMN T;  3RX6 A;  4KHP T;  4AI6 A;  1US7 B;  5F5W A;  3IF8 B;  5HCM A;  2ODU A;  3ANW A;  5J0Z A;  5C8Y E;  1IAP A;  4P09 A;  3MJX A;  1J1J A;  3HA4 A;  3BQI A;  4F8H A;  3CVR A;  3UT5 E;  2HHH T;  1XNQ T;  4P0A A;  4IRE A;  2XHE B;  2XUE A;  1G8X A;  5LG4 A;  2LT3 A;  1HNZ T;  3H3A A;  4YHJ A;  1Y64 B;  2VUR A;  2XAG B;  4WW0 A;  3CWZ B;  4DVD A;  1WLX A;  3TKL B;  1UCU A;  2D0U A;  1YKH B;  3RI5 A;  1OED B;  5FY7 A;  5AQT B;  2E8I A;  3AA6 B;  2WM9 A;  4DR4 T;  1KNR A;  3OJA A;  4DUZ T;  4QXB B;  2JQH A;  5HXH A;  2F4V T;  3FBL A;  4B3M T;  4KP3 C;  5F3J A;  2VL8 A;  5H6Q B;  5LHG B;  4HWF A;  4DR6 T;  3PUG A;  5CA1 E;  4IE5 A;  2JPF A;  2EHO C;  5LXT E;  2CHN A;  5HEH A;  4NIQ A;  1NAF A;  2FUP A;  5DQW A;  2YDQ A;  3ZCJ A;  4TUY E;  4JUY A;  3P4Q A;  1ZKE A;  2WU5 A;  1UUS A;  4UVC B;  4HE8 A;  3F2E A;  1IZN B;  2LSK A;  3Q5E A;  2D9D A;  4QWN B;  5HCJ A;  2WP9 A;  2UUA T;  4LML A;  2PBI A;  2XAJ B;  2MAW A;  1W0B A;  5CGM A;  4FJO A;  3L3P A;  2E2A A;  2ZM6 T;  3AB3 B;  3C4X A;  4OFZ A;  4ISS A;  4UR9 A;  2C5K T;  2J47 A;  4LF6 T;  4GK0 E;  4HFB A;  5LNK A;  4IST A;  1UGO A;  2W67 A;  4X66 T;  4JLE A;  1S94 A;  4CZZ B;  2NOX A;  2WWU A;  3ZC0 A;  3IEE A;  1N34 T;  3FXE B;  3ONL C;  3ZMU B;  4YLH A;  4LFB T;  4HFI A;  2LSY A;  5IWA T;  4ILC A;  4EXT A;  3P4S A;  4DV2 T;  3AE4 A;  2FJE A;  2MYS A;  5FXX A;  2WZH A;  1I94 T;  2ES0 A;  4G63 A;  5ABE A;  2IW5 B;  3C4W A;  2NP9 A;  2J62 A;  2KXP B;  4UIG A;  2CXL A;  3SFD A;  3KV5 A;  2B1E A;  2BKO A;  2LSJ A;  3GN5 A;  2VVS A;  2Y6X A;  3B13 A;  3E08 A;  4CQI A;  3CQC B;  1OXZ A;  2WBL A;  2CM0 A;  3HKC E;  3O4X E;  4UVB B;  2V5D A;  3EUH A;  3RYF E;  5CA0 E;  4YTP A;  4CXY A;  3GWH A;  1MND A;  2IUB A;  4I0U A;  3TLT A;  4AKI A;  3K8P C;  4YJ3 E;  4EZH A;  1YKE B;  1V9D A;  2L8K A;  4DR1 T;  1MMA A;  4Z8X A;  1H7C A;  3V5U A;  1Y01 A;  5IYZ E;  2A3D A;  2XQA A;  4HFV A;  2IAK A;  4PJM A;  3UU5 A;  5AQK B;  5HXS A;  1LVF A;  2R6G F;  4U7Y A;  2NWB A;  2E9X A;  3I0Q A;  4JI8 T;  3RPU A;  4ZZC A;  2CE7 A;  1D1A A;  5HYA A;  3TLW A;  4B3T T;  2V6Y A;  4JI0 T;  2NTX A;  2Q9Q D;  1XNR T;  1HNX T;  4O4L E;  2CWY A;  5HXR A;  5ETW A;  1G73 A;  5L3D B;  1UUR A;  4H9Q C;  3VKH A;  3OYX A;  3RH3 A;  4HGA A;  5AQJ B;  4P0B A;  3J9X 1;  2C0S A;  4X20 E;  4DR5 T;  2BVM A;  1SA0 E;  4E7Z A;  2OLT A;  1CHU A;  1XMQ T;  4O2A E;  5FL0 A;  2HN2 A;  3J7Y q;  1WRD A;  3Q5X A;  4H63 H;  4EEB A;  2RPA A;  3CX6 B;  3PTR B;  1HX1 B;  5JDH A;  2WWV A;  2W62 A;  2XTL A;  3ETU A;  4LF4 T;  4TWD A;  2BDE A;  3WI3 A;  4DV7 T;  1HG5 A;  2LM2 A;  4QXC B;  4ZI3 D;  2VAS A;  2CLY C;  3UUM A;  3PUZ F;  2B76 A;  1OED C;  4KI0 F;  4BJM A;  5C2T A;  4IDO A;  3MZK B;  3ZJ1 A;  3FBZ A;  2V7L A;  3AED A;  1YQ3 A;  3JAF A;  2WS3 A;  2UUC T;  2I6H A;  3LDQ B;  3HKB E;  5EZY E;  4IGU A;  1LKX A;  5EK2 A;  3UU4 A;  2IIU A;  3KBU A;  2Q9Q C;  3E0Z A;  2BBH A;  1I6Z A;  5L2L A;  4PK5 A;  4HFC A;  5AQO B;  1FEW A;  5JR9 A;  3SRZ A;  5FKY A;  2L3L A;  2E9X B;  2VKD A;  4HFH A;  5FL1 A;  4TNV A;  4O8S A;  2CEA A;  2V6Y B;  1D0Y A;  4U33 A;  3N9Q A;  3T1H T;  3PUQ A;  5FXW A;  2QYW A;  3AXJ B;  4UEM A;  2LE8 A;  4DR3 T;  2BS2 A;  3NKZ A;  5HWY A;  5FMN A;  3L09 A;  2XSA A;  4J2C A;  4KMC A;  3P4W A;  4HWH A;  1BR2 A;  1EZ3 A;  1T98 A;  1NEN A;  2WQY A;  5H6R B;  1U4Q A;  3K3Q C;  3NRX A;  5AQI B;  3RRC A;  2FJB A;  3UUB A;  1WR6 A;  3UTK A;  4ZI3 C;  4AQF C;  3RYC E;  2ACX A;  2P9B A;  2NW9 A;  2WAU A;  3NZQ A;  3WAK A;  3K1S A;  5AQG B;  2JMK A;  3TLV A;  4UF0 B;  5JDG A;  3H3M A;  4JI1 T;  2Y48 B;  3CIR A;  3GMI A;  3UU3 A;  3UQ7 A;  2YU2 A;  3F31 A;  2KND A;  5A1L A;  5FXV A;  2BBJ A;  4U7I A;  3RIA A;  5JVD E;  2X68 A;  4COF A;  2CCQ A;  2V7J A;  1FIO A;  4TV9 E;  3MA9 A;  4TWF A;  2LLY A;  5AQL B;  4QX8 B;  1U5P A;  5FY1 A;  4HKA A;  2RP4 A;  5LOV E;  2V7I A;  2Q9Q A;  1JNR A;  2IC6 A;  2QGS A;  2Z6E A;  2JQ9 A;  3KV9 A;  1D0X A;  4UEL A;  1D1C A;  2BKN A;  3WAJ A;  2WMN A;  3DP7 A;  2YEV C;  4AKH A;  4MFR A;  4MHC A;  2LKH A;  3RGL A;  2DI4 A;  2BG9 E;  4PNI A;  2ODV A;  3O9X A;  4TWH A;  2VKO A;  3PUV F;  5DJQ C;  4YTM A;  3LK4 2;  1BR4 A;  5JDF A;  1S35 A;  5LHH B;  3ZJ2 A;  5ADX L;  5FXZ A;  4ZS3 A;  3R84 B;  4DV6 T;  3ONX A;  3AEF A;  4JI5 T;  2YK0 A;  4JEU B;  4PFP A;  4YSY A;  2W63 A;  5JRC B;  3AE8 A;  2MBG A;  4KUM B;  4LF5 T;  4CI3 B;  3PJA A;  2NW7 A;  2VQE T;  2YOE A;  5ABH A;  2BKP A;  4U2Z A;  2X0L B;  2BVL A;  3ONJ A;  5JRE A;  2LOS A;  2DLR A;  3PU3 A;  2YN6 A;  5JDQ A;  3DJB A;  3RQU A;  2CMR A;  3FB2 A;  2KLQ A;  4WYV A;  5KXJ A;  3N9M A;  4ZS2 A;  2GK9 A;  3RIF A;  1JNZ A;  4KHZ F;  4H63 V;  1HF8 A;  3B5M A;  3LSV A;  2I0M A;  2PFV A;  3PV0 F;  2E5L T;  2XQ6 A;  4LMK A;  5CFB A;  1R8I A;  2J4G A;  5LGN B;  2X9Y A;  3QUJ A;  3ZPO A;  4HWD A;  2XM2 A;  3BK9 A;  2OA5 A;  3OKQ A;  4EYU A;  2D0T A;  3LBX B;  4OYJ A;  1MMN A;  2BZB A;  4DR7 T;  4NXM T;  5AQH B;  2VKJ A;  3CK6 A;  4LF8 T;  2DNX A;  5JH7 E;  4QH5 A;  5AQF B;  3RC8 A;  3ANW B;  3CQG B;  4CN4 A;  1D1B A;  4A98 A;  2PTF A;  3CML A;  3C4Z A;  3RYH E;  2MPK A;  3H37 A;  4DUY T;  2HH7 A;  3I0O A;  1W09 A;  4E7S A;  2BG9 C;  3DTO A;  5AQQ B;  2KT9 A;  2L9Q A;  1B7T A;  3KVA A;  5E0O A;  4AKL A;  2K24 A;  2CBJ A;  3OTO T;  1VCT A;  3K3N A;  4HWC A;  4X64 T;  4TZ4 C;  3A5X A;  1FMW A;  3AE9 A;  2WMO A;  1ZV4 X;  3BQK A;  3VR9 A;  3RIU C;  4ZI7 E;  3MK7 C;  1KF6 A;  1X9B A;  3P4P A;  3CX8 B;  1AJ3 A;  3I9W A;  2LSI A;  5JDM A;  3AEG A;  1OED E;  2FJA A;  4EYY R; 
#chains in the Genus database with same CATH homology
 3WI3 A;  2X9W A;  3HKE E;  4L5G A;  1ZEE A;  4TN7 B;  2EHO A;  3ZLI A;  4JEH B;  3N9P A;  1HG5 A;  3CKD A;  3FXD B;  4QXC B;  4ZI3 D;  5HWX A;  4UXN B;  3KV4 A;  3N9L A;  3D0T A;  4PJL A;  2LHR A;  1IJ5 A;  2VAS A;  2CLY C;  3NZP A;  3UUM A;  3UUX B;  5JDN A;  1MIW A;  3PDY A;  4AKR B;  4PJJ A;  3SS1 A;  1YD8 G;  1BR1 A;  3AA1 B;  4F6R C;  2X67 A;  4UV8 B;  5LBQ B;  4BJM A;  4DBR A;  3MZK B;  5DAB A;  2Q9Q B;  3ZJ1 A;  3FBZ A;  2UXN B;  2V7L A;  1HS7 A;  3KFW X;  2JQQ A;  4IHJ E;  4CXW A;  4ASK A;  2M67 A;  4TX5 A;  2KZ7 B;  3HKB E;  3PUR A;  3AA7 B;  5EZY E;  4IGU A;  2J1D G;  1LKX A;  5EK2 A;  4IIJ E;  3ESL A;  4I43 B;  4ILU A;  4IE6 A;  3KBU A;  3ZMV B;  3GA8 A;  2Q9Q C;  3ETV A;  3E0Z A;  2EHO D;  5LGU B;  5L2L A;  3N5L A;  4PK5 A;  1O3X A;  3Q5W A;  3UUL A;  2KWI B;  2C5I T;  3I1A A;  5J1G A;  3CPZ A;  2LOP A;  2XAS B;  1FEW A;  2W0G A;  4NUU A;  5CB4 E;  3KIN B;  5JR9 A;  3SRZ A;  3C50 A;  1SHZ C;  2X9H A;  3HKD E;  4EAH A;  1BR0 A;  2L3L A;  4DND A;  2E9X B;  2VKD A;  5J2T E;  2LJL A;  1MMD A;  2VK9 A;  3ZMZ B;  4O8S A;  3FHN A;  4QX7 B;  3N9O A;  1MMG A;  2CEA A;  3S4U A;  1D0Y A;  2V26 A;  2K48 A;  2WSS V;  3K3O A;  3R6N A;  2MTQ A;  2ZMA A;  3LBX A;  3N9Q A;  3AA0 B;  2N2N A;  4UV9 B;  3AAA B;  3RX6 A;  3PUQ A;  4V1A v;  5FXW A;  4AI6 A;  3OBV E;  3SWH A;  1US7 B;  1NWM X;  4UEM A;  3O1H A;  2I59 A;  3LG7 A;  2LE8 A;  3IF8 B;  5KMG P;  2NTY A;  2ODU A;  5LBM A;  5HWY A;  3ANW A;  2CXD A;  2E9X C;  5FMN A;  3L09 A;  4C91 A;  4J2C A;  1IAP A;  3ZC1 A;  4KMC A;  3N2K E;  4P09 A;  4GIW A;  5C8Y E;  3MJX A;  4O2B E;  4M1P A;  5IHY A;  1BR2 A;  3BQI A;  3HA4 A;  1EZ3 A;  1CUN A;  2X9X A;  3CVR A;  3UT5 E;  1YW0 A;  1T98 A;  2LSG A;  5FP3 A;  5H6R B;  3IHR A;  3F57 A;  1U4Q A;  3K3Q C;  4P0A A;  4EZ4 A;  3NRX A;  4O4H E;  2XHE B;  5L3G B;  2XUE A;  1G8X A;  3RRC A;  2CA5 A;  5LG4 A;  3CQX C;  1LVK A;  1WR6 A;  5EK3 A;  4AXP A;  2UXX B;  3UTK A;  5L3B B;  5LCY A;  3P8C D;  4ZI3 C;  2LT3 A;  3PUS A;  2JMH A;  4AQF C;  3RC3 A;  2HPL A;  3H3A A;  3E22 E;  4YHJ A;  1Y64 B;  3RYC E;  1IJ6 A;  4CI2 B;  2ACX A;  2P9B A;  2NW9 A;  2WAU A;  2XAG B;  4OK0 A;  4WW0 A;  3NZQ A;  3CWZ B;  3C51 A;  3WAK A;  4DVD A;  1WLX A;  3TKL B;  3LK2 B;  1UCU A;  2VB6 A;  2JMK A;  1D0Z A;  2D0U A;  5LJN A;  4WNK A;  3GN5 B;  4UF0 B;  1YKH B;  5JDG A;  5FY7 A;  2VKH A;  3AAE B;  2E8I A;  3AA6 B;  3O1J A;  2EHO B;  2WM9 A;  3M65 A;  1HG2 A;  2KWH A;  2Y48 B;  3GMI A;  1MNE A;  4YFS A;  3N2O A;  4YJ2 E;  2YU2 A;  3F31 A;  3OJA A;  2KND A;  4GOU A;  5A1L A;  5FXV A;  4QXB B;  5HXH A;  2QA7 A;  3KVB A;  4HTE A;  3W15 B;  4AQG A;  2DCF A;  4IE4 A;  4QXH B;  1VRB A;  3RRW A;  3FBL A;  4MLK A;  4GYR A;  4KP3 C;  4DO0 A;  5F3J A;  2VL8 A;  5JVD E;  2X68 A;  5H6Q B;  3B57 A;  3VKG A;  2CCQ A;  5LHG B;  2V7J A;  1FIO A;  4U72 A;  3T8O A;  2KIN B;  3PUG A;  4XZC A;  4IE5 A;  5CA1 E;  4TV9 E;  5TAO A;  2HPJ A;  2JRK A;  2JPF A;  3MA9 A;  2EHO C;  5LXT E;  1QSD A;  3AVR A;  2SPC A;  5FY0 A;  3QC9 A;  1NAF A;  4WBN E;  5DQW A;  5LJM A;  3ZCJ A;  4QX8 B;  4TUY E;  4JUY A;  1U5P A;  2A72 A;  3ZYM A;  1ZKE A;  4I55 E;  2CWO A;  5FY1 A;  1HX8 A;  4HKA A;  5GON E;  3C98 B;  1MIV A;  2RP4 A;  5LOV E;  2V7I A;  2Q9Q A;  4PJN A;  4UVC B;  5HXC A;  4HE8 A;  3F2E A;  1E1H B;  3VHL A;  1IZN B;  2G0U A;  2LSK A;  4QWN B;  4NUV A;  2RA1 A;  1WYC A;  2IC6 A;  3ZYK A;  3C64 A;  2PBI A;  2QGS A;  2Z6E A;  5JDL A;  2XAJ B;  4HEA A;  3KV9 A;  4H9N C;  4L9I A;  1D0X A;  3N2G E;  4CXX A;  3RYI E;  2VWA A;  3HR0 A;  4FJO A;  2LEH A;  4UEL A;  4B6X A;  1HCI A;  1D1C A;  3L3P A;  4FI5 A;  4H9P C;  3WAJ A;  3BQL A;  3AB3 B;  2WMN A;  3DP7 A;  5AFU L;  2YEV C;  4AKH A;  1HFA A;  3C4X A;  2ZM0 A;  4H9R C;  2K9A A;  4OFZ A;  4ISS A;  4MFR A;  2C5K T;  4MHC A;  3V5S A;  3N9N A;  2DI4 A;  4GK0 E;  4ZI2 C;  4PNI A;  5LGT B;  5LNK A;  2ODV A;  4AKG A;  5EK4 A;  4IST A;  3O9X A;  3PE0 A;  5JR9 C;  4I50 E;  2VKO A;  3RKO A;  4JLE A;  5DJQ C;  4UVA B;  3LK4 2;  4TV8 E;  4EOZ B;  1S94 A;  4CZZ B;  5F8P A;  2V7M A;  2NOX A;  1BR4 A;  3KDS E;  1KNZ A;  3HI2 A;  2WWU A;  3Q9D A;  4OHF A;  2ZLY A;  5JDF A;  1S35 A;  2YU1 A;  2C5J A;  3ZC0 A;  5LHH B;  3IEE A;  4EIW A;  3FXE B;  3ZMU B;  4BJN A;  4ZI2 D;  4YLH A;  3ZJ2 A;  5ADX L;  4XBF B;  5LHI B;  2LSY A;  3ZEF B;  5FXZ A;  3OYZ A;  4ZS3 A;  3ZN1 B;  3R84 B;  3IBP A;  3ONX A;  4IDZ A;  3JC6 C;  3KBT A;  4X1I E;  2YK0 A;  4JEU B;  3EDV A;  4PFP A;  2JJ9 A;  2W63 A;  5JRC B;  4EXT A;  4QHO A;  2V1D B;  2MBG A;  3EDU A;  3MXZ A;  4KUM B;  3U3I A;  2MYS A;  3ZCI A;  1VOM A;  2DHR A;  5FXX A;  4CI3 B;  5LYJ E;  1UX5 A;  2NW7 A;  2ES0 A;  4G63 A;  4ZHQ E;  3KV6 A;  2IW5 B;  3ZN0 B;  3C4W A;  3UFE A;  2NP9 A;  2KXP B;  3JC6 D;  5HAX A;  2X0L B;  4UIG A;  2CXL A;  2BVL A;  5JRE A;  2LOS A;  2DLR A;  3LFM A;  2N9D A;  3KV5 A;  3PU3 A;  4X1K E;  4XAX B;  3SOL A;  5JDQ A;  2B1E A;  2KMF A;  3DJB A;  2CMR A;  2H7O A;  2LSJ A;  5J2U E;  3FB2 A;  4ANJ A;  3GN5 A;  4UF0 A;  4C90 A;  2KLQ A;  2Y6X A;  3B13 A;  3E08 A;  3P7I A;  4ZOL E;  5KX5 E;  4PFO A;  4CQI A;  5JQG E;  2DWG A;  3CQC B;  1OXZ A;  2WBL A;  1OWA A;  2CM0 A;  3HKC E;  3O4X E;  5FNV E;  1Z0P A;  4UVB B;  4OYK A;  3N9M A;  2D5U A;  3EUH A;  4ZS2 A;  2GK9 A;  4PW8 A;  3RYF E;  5CA0 E;  4H63 V;  1HF8 A;  2YIN A;  2NW8 A;  5HXE A;  4CXY A;  4PK6 A;  2MOZ A;  3GWH A;  1MND A;  3NBX X;  2PFV A;  2XAH B;  4AKI A;  3K8P C;  4YJ3 E;  3Q2M A;  4HN9 A;  3NRY A;  4EZH A;  3AAI A;  2XAF B;  4K0U A;  1YKE B;  4MBQ A;  5M4Y A;  2N1G A;  5LP6 E;  1V9D A;  4L0R A;  2L8K A;  4BAY B;  5LGN B;  2X9Y A;  3QUJ A;  3ZPO A;  2H7V C;  5JR9 B;  1MMA A;  4O4J E;  4ERR A;  4Z8X A;  3BK9 A;  4I4T E;  1H7C A;  3VU7 H;  3PU8 A;  2OA5 A;  3OKQ A;  3V5U A;  4EYU A;  2Y8D A;  5IYZ E;  4CI1 B;  2D0T A;  2A3D A;  4GK5 E;  4QKN A;  4HFV A;  2IAK A;  4PJM A;  3LBX B;  4PAG A;  4OYJ A;  1MMN A;  4DBQ A;  2BZB A;  3AVS A;  5L3E B;  1FMV A;  4IE0 A;  2CXF A;  4PK4 A;  5HXS A;  3I9Y A;  2VKJ A;  1LVF A;  2W00 A;  2H3R A;  5LA6 E;  2NWB A;  2DNX A;  5JH7 E;  1WYB A;  4DMV A;  2ZM2 A;  2E9X A;  3RC8 A;  3ANW B;  3I0Q A;  4H9S E;  3RPU A;  2CE7 A;  3CQG B;  1D1A A;  5HYA A;  2DWK A;  1D1B A;  2NTX A;  3U78 A;  2IC9 A;  2Q9Q D;  3PUA A;  3ZMT B;  3CML A;  3C4Z A;  1ZHC A;  5L3F B;  3RYH E;  2D2S A;  2XQY A;  4A56 A;  2V7K A;  4O4L E;  4N78 D;  5DQV A;  1X79 A;  2CWY A;  5HXR A;  1MIY A;  3H37 A;  5ETW A;  3ZMS B;  2XAQ B;  2HH7 A;  3I0O A;  4E7S A;  1G73 A;  3CX7 B;  4X1Y E;  4BA9 A;  2X51 A;  4KBM B;  4O4I E;  5L3D B;  3DTO A;  1HTJ F;  2KT9 A;  4H9Q C;  2L9Q A;  1QUU A;  3VKH A;  1B7T A;  3KVA A;  3OYX A;  5E0O A;  4HGA A;  3RH3 A;  2K5B B;  3MKD A;  4AKL A;  2K24 A;  2PJQ A;  3QK6 A;  4AQF A;  4P0B A;  5L3C B;  3LK3 B;  2PG8 A;  3J9X 1;  2C0S A;  4U74 A;  3K3N A;  3EVY A;  4X20 E;  2BVM A;  1SA0 E;  4E7Z A;  4TZ4 C;  3A5X A;  4EB6 E;  4O2A E;  1FMW A;  3MAC A;  4IE7 A;  3UUN A;  4DMW A;  3ZYL A;  2LM9 A;  3J7Y q;  1WRD A;  5FYM A;  3Q5X A;  2WMO A;  1ZV4 X;  2W61 A;  4H63 H;  4H9O C;  3BQK A;  2A2F X;  3LJC A;  2E9X D;  4GYS A;  5BMV E;  4ZI7 E;  2X66 A;  3CX6 B;  3MK7 C;  3PTR B;  5JRC A;  5KDM C;  4WBO A;  1KK7 A;  4ADZ A;  1UX4 A;  5JDH A;  2CLY B;  3CX8 B;  2LHN A;  3O1I A;  1AJ3 A;  3I9W A;  2LSI A;  2ZM8 A;  5JDM A;  2W62 A;  2XTL A;  3ETU A;  1LRZ A;  3HL6 A;  2BDE A;  4EYY R;  4MAL A;  4G2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...