4KMCA

Structure analysis of m. tuberculosis rrna transcriptional regulator card and its interaction with t. aquaticus rna polymerase-beta1 domain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
79
structure length
79
Chain Sequence
b'TNWSRRYKANLEKLASGDVNKVAEVVRDLWRRDQERGLSAGEKRMLAKARQILVGELALAESTDDAKAETILDEVLAAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA polymerase-binding transcription factor CarD
publication title Structure of the carboxy-terminal domain of Mycobacterium tuberculosis CarD protein: an essential rRNA transcriptional regulator
doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
total genus 34
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2013-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1290 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4kmcA00
4KMCA 4XAXB 4KBMB 4MFRA 4L5GA 4ILUA 2LT3A
chains in the Genus database with same CATH superfamily
3TLWA 2LOPA 5EK4A 3FZLB 4YJ3E 4KHZF 5L3DB 4JEUB 5C8YE 5JRCB 1L0VA 4CZZB 3ZMUB 3P4RA 4YSZA 3K3OA 4EEDA 1XNQT 2L3LA 2IUBA 1HS7A 2LRKA 4PJMA 3K3NA 1KK7A 2V7JA 2X9HA 5LJNA 4YHHT 3AAIA 3I0OA 1HF8A 2CLYB 4IL4A 3N9OA 4ILBA 1E2AA 2W0GA 3PV0F 4NUVA 2PFVA 2CMRA 3PUQA 5F8PA 2WQYA 3NRYA 3B13A 3KBTA 5JVDE 3AE8A 4O8SA 2M6IA 3ZMVB 4ILUA 4U31A 2GK9A 4X1KE 3VR9A 2XM2A 3O1HA 4HFVA 2X51A 3AEBA 1MMNA 4EB6E 3ZMZB 4WW0A 4GK0E 2LOSA 4JI4T 4ZI7E 4EZ4A 1V9DA 3NZPA 3KV9A 4I0UA 2V26A 4JI8T 2X67A 2XAHB 4F8HA 5LJMA 4TUYE 1CHUA 5ETWA 1S94A 4JI3T 3FBZA 3FXDB 5JDGA 3MJXA 1VCSA 2W62A 2BG9A 3GN5B 1LVKA 3FZHB 3ZYMA 2WY2A 5LG3A 3DTOA 4U7YA 3O1IA 3AVSA 5KX5E 2JMKA 1CUNA 4ADZA 2OLTA 5ABGA 4H9QC 2NTYA 3AE5A 1AJ3A 2BVLA 2QRXA 2A72A 2W2UA 4NXNT 4ANJA 2W66A 3IEEA 5FYMA 2W4XA 4WBOA 3ZC0A 2HHHT 2DNXA 4ZOLE 3NVOA 4LFBT 3P7IA 2K3WA 4NXMT 2XAFB 2V7KA 5AQJB 3EUHA 2VVNA 2W00A 4B6XA 3RRCA 5AQQB 4GKJT 5J1GA 4DIDB 4EOZB 1KNPA 3TKLB 3OJAA 4UVAB 2H88A 3ZJ2A 2XQ7A 4HWHA 4F6RC 4LF9T 1NAFA 3IBPA 4XBFB 4M1PA 3PUXF 4ZS2A 2DWKA 4AKLA 4U2ZA 1UCUA 1E7PA 2AXDS 1HFAA 3MXZA 1J5WA 3K8PC 4OHFA 4ISSA 4G63A 4H9PC 4UR9A 3EHZA 4LMJA 2K24A 3GWHA 1J1JA 5C2TA 4CXWA 3UUXB 2LM9A 2PJQA 4TN7B 1FJGT 3FB2A 3ANWA 2XHEB 4V1Av 2K9AA 2LEHA 5FVKA 2YINA 4B3RT 2IC9A 4ISTA 5BMVE 3P4SA 1QSDA 4FI5A 2WSSV 4IE0A 4ERRA 2UXCT 2ODUA 2WMOA 5IYZE 4PJNA 3MK7C 2E9XB 4H9NC 4HFBA 2CXDA 5HEUA 4JYAT 4MBQA 4EXTA 4DR5T 5FXWA 3ZMSB 4JI0T 3AA7B 4CN6A 2CHOA 3KV6A 2XQ5A 2XTLA 3CX8B 4DR2T 2WB5A 2DCFA 3Q5DA 4MALA 2LRLA 4HTEA 5JTGA 3MZKB 2MBGA 2J1DG 2IDOB 3PUGA 3QK6A 4ZEYA 2YKSA 2M67A 3L09A 4I43B 3H3MA 5AQGB 4O4JE 1WR6A 3MKDA 5FXVA 3UUBA 1YD8G 4DR3T 2BS4A 3PDYA 2CWYA 1W0AA 1X9BA 2KINB 4YFSA 4IDPA 3UQ4A 5ABFA 3RKGA 2WMNA 2VKOA 5IUXA 4EIWA 3LG7A 2XZEA 3P4QA 1B7TA 2KLQA 3KVBA 4ZS3A 2XUEA 4TNVA 4IT4A 1YQ4A 5FL1A 2FJEA 4CXXA 3A5XA 2X9XA 1HG2A 2H7VC 2H3RA 4TV8E 5AQFB 2BKNA 1FIOA 2VKJA 3ZCIA 2WWUA 4JEHB 3CX6B 3NWIA 5LBQB 4L5GA 1XNRT 5EZYE 2D9DA 5CGMA 2OV9A 2D0TA 4ZZCA 4EZHA 2LKHA 3AB3B 4I4TE 3UT5E 2ZM8A 4IDNA 4XZCA 3IF8B 3RC3A 2WU5A 3UTKA 2KWHA 2DL1A 1NENA 5KDMC 2UUCT 2C0SA 3T1YT 1JNZA 1ZP0A 5L4HA 4COFA 5LHGB 3J7Yq 5KMGP 5AQTB 1D0XA 2XQ9A 4UVCB 1J5ET 2EHOB 2L9QA 5HEHA 2KT9A 1UURA 3F2EA 3AEDA 4AI6A 3AEAA 5LMUT 5JDQA 5HEJA 4U7IA 2YK0A 2KWIB 4ILCA 4X64T 3AE6A 3ETVA 2UXDT 3V5UA 3AECA 1U4QA 4HFIA 3LK2B 2V5DA 5CFBA 1UK5A 3WAJA 3AE7A 4DV0T 5HXSA 5HXCA 1IBMT 3AE1A 5AQLB 1H7CA 1D0ZA 1SHZC 2HPLA 1R8IA 2JQQA 4GYSA 3TLVA 1N32T 3FHNA 5DJQC 4UEMA 2CRBA 4DV1T 3RGLA 5IHYA 4C90A 3C4XA 5LP6E 1O3XA 1IZNB 4WNKA 3UU5A 2EHOC 4TZ4C 1OWAA 4L9IA 2WZIA 1Z8UA 2JRKA 2Y6XA 4PAGA 1M7KA 4H9OC 1YW0A 1XMOT 3UFEA 3SRZA 3M3ZB 1FMWA 4GIWA 1U5PA 4DV3T 3C50A 2NOXA 3RQUA 4DNDA 5LCYA 3DP7A 2LHRA 2X0LB 3L8RA 4A5XA 4DV2T 3Q5WA 3VU7H 3OTOT 3RIUC 4PK4A 5AQVB 3SFEA 4HFDA 5H6QB 4HWFA 3S4UA 1OEDB 4DO0A 4LF8T 4P0BA 2VK9A 3QB5K 4DR6T 4Z91A 4OFZA 2CBJA 2LKGA 2LLYA 4H9RC 3H37A 3VRBA 2LM2A 4X20E 1OEDA 1NEKA 3SFDA 4KX6A 2EHOD 3JC6C 2KXPB 2V8SV 1W09A 4GOUA 2XAGB 3MA9A 5HXHA 2X68A 3VR8A 5LGTB 3PUAA 4CN1A 1UX4A 2BS3A 1HCIA 4TWHA 5LBMA 3VHLA 4P0AA 1LRZA 3KVAA 4O4LE 2BG9B 2VB6A 5HCMA 3RHWA 1OEDC 3P50A 1HX8A 1SA0E 2E2AA 4ASKA 4LMLA 5FL0A 2I6HA 3KV5A 2WDVA 1I6ZA 5FXXA 3P4WA 2Y8DA 4DUZT 3AA1B 2K48A 2X0YA 3N5LA 2DLRA 3VKHA 1BR4A 3UQ7A 3CVRA 4IE6A 4LF7T 1NWMX 4EV6A 2WU2A 3U78A 2F4VT 3JC6D 4DR7T 5FP3A 2YOEA 2VKHA 3OBVE 5CB4E 5AFUL 2HN2A 2E5LT 3Q9DA 2ACXA 2WZHA 4O4IE 3B57A 4BJMA 2LT3A 4OYJA 3RLFF 3UU8A 3ONJA 2VQFT 2Q9QA 3FZMB 2DHRA 5LG4A 2YEVC 2FJBA 1WR0A 3ZPOA 2BG9C 5LNKA 4U2YA 3CQXC 2PBIA 3OVUA 4QH5A 2KMFA 2UUBT 1MMDA 2WWVA 3LJCA 3AE9A 3PTRB 4JI5T 3SS1A 4DV4T 2YU2A 4IE7A 4X62T 4YTNA 2XQ4A 1D1CA 4AISA 3HI2A 2Q9QC 3CK6A 2J47A 4CQIA 2Y48B 2BS2A 4TX5A 4WZXA 3BQLA 3ANWB 3AEGA 4UV8B 1M62A 2HN1A 4IREA 2R6GF 3ESLA 4JI6T 2NP9A 4CI1B 4PNIA 5HXEA 3T8OA 4EYYR 2WAUA 2MAWA 3X1DA 4PFPA 3RKOA 2IIUA 3CWZB 2B1EA 2CE7A 3ZLIA 4DBRA 4KP3C 5L2LA 2BVMA 4JUYA 3ZT6A 2MOZA 3R84B 1IJ6A 5LXTE 2IC6A 4YSXA 3AE4A 4JLEA 4LMKA 1BR0A 1YQ3A 3HA4A 3RQWA 3JCFA 3KFWX 3Q5EA 2LE8A 1T8BA 2XPKA 4UIGA 3N9PA 2JIWA 5EK2A 3RYFE 5J2TE 2IW5B 4OK0A 3KINB 3HKBE 2Q9QD 3EABA 3LFMA 2PTFA 3L39A 3DJBA 4BAYB 4AXPA 2A2FX 3PE0A 4JI2T 4EEBA 3IA3A 1MIYA 2ODVA 4C91A 2NTXA 2VASA 3VRAA 2XY8B 1KNRA 4HWCA 4CXYA 1XDPA 1HG5A 4AQFA 2I0MA 2HPJA 3C4WA 2N9DA 4IIJE 2YDRA 4E7SA 4QH1A 2FJAA 4Z8XA 5ABFB 2SPCA 4HN9A 3C4ZA 5JR9A 2V7LA 4UXNB 3RYIE 3UU6A 4UF0A 3F31A 1Y64B 5BR8T 5HCJA 2XQAA 5L47A 1ZOYA 2CWOA 4DMVA 2CPTA 5FY1A 5DQWA 4IDZA 3I1AA 3J9X1 4PW8A 1MIVA 2VKDA 1EZ3A 3AEEA 3RX6A 4AQFC 3V5SA 4KHPT 3ZYKA 4B3TT 4PJJA 5C3JA 3PJAA 2H7OA 4MFRA 1OEDE 3EI0A 4N78D 4DBQA 3Q5XA 1IBKT 3D0TA 2MTQA 3RF1A 3PJAJ 4YY3T 2CHNA 3PUVF 5HWYA 4U72A 2VL0A 3AE2A 4WBNE 5LA6E 4GK5E 3AVRA 1WYBA 1XDOA 2VURA 4YSYA 2CXFA 4DUYT 2JPFA 4LFAT 2ZM6T 2XAQB 1LVFA 3OPCA 4AKRB 4PK5A 3ZEFB 4IDOA 2J4GA 4PFOA 5F5WA 5AQPB 3LK42 3BQIA 4AKGA 2BKPA 3N2KE 2FBWA 2NWBA 3CIRA 5LGNB 2E5VA 4UELA 4B3MT 2BG9E 3FXEB 5LGUB 2VL8A 3WAKA 3CKDA 5JDFA 1S35A 4IHJE 2NR4A 3PUZF 2W67A 5L3CB 1YKEB 4K0KT 5JDMA 5AQIB 4QXBB 5M4YA 3RIAA 3QNUA 5LHHB 3KBUA 3QC9A 4KI0F 5KXJA 2DI4A 3ZYLA 1IJ5A 4U74A 4X1YE 2DWGA 3ZCJA 3PUWF 2YU1A 5DQVA 2V6XA 3B5MA 3AA0B 2XM1A 4DR1T 3N9NA 3FZFB 5FNVE 1YXRA 4QX7B 1T7SA 4DV5T 5DABA 2NW8A 2ZMAA 4GKKT 4ZXLA 2FJDA 3UUMA 2B76A 4EAHA 5FVLA 1UGOA 5LYJE 1MNDA 2XAJB 3BK9A 3UFGA 2KZ7B 2KSRA 3ZT7A 3E22E 4IDQA 3LBXA 3NRXA 2XJ7A 1QLBA 4HFEA 4QXCB 2X0HA 3T1HT 2V7IA 3N2OA 5FMNA 5ADXL 2LHNA 4QWNB 3QOFA 4X5TA 3RI5A 3LK3B 4HGAA 4WYVA 3GA8A 3JADA 3CMLA 4PK6A 3GMIA 5JDLA 4A97A 4ZZBA 2YDSA 5AQKB 5LMNT 1IAPA 2X66A 3VKGA 3ZSTA 1SE7A 4CI3B 3ZSSA 1OXZA 3AXJA 5AQNB 4X65T 3KV4A 1XZYA 5AQSB 4A56A 4IE5A 3G06A 3K1SA 2WCAA 4GYRA 5FY7A 4K0UA 5JRCA 1SUMB 4JV5T 5FY0A 1Y01A 4U33A 1N36T 2LJLA 5L3FB 2E8IA 4IL9A 5EK3A 4AIUA 2XQYA 2K5BB 1WLXA 2D5UA 1T98A 2BDEA 5AQMB 2V6YB 4YLHA 4ZI3C 3W15B 4CN4A 4OYKA 3PU3A 4TV9E 5J2UE 3ZMTB 2UXXB 1BR1A 4LF5T 2W63A 1KEYA 3TLUA 4Z90A 4TWFA 5CA1E 3M65A 3PUSA 4DMWA 1MNEA 4Q25A 3CQGB 3P4PA 2V6YA 4EGWA 3C64A 3BQKA 2Q9QB 1WCRA 2LSGA 2CLYC 3AA6B 3F57A 4BA9A 1X79A 3HR0A 4X1IE 2BBHA 3ZKRA 5JQGE 3UULA 5FXZA 2BBJA 4TNWA 3N9QA 5L3EB 5JDHA 2XSAA 3FBLA 3RH3A 3PU8A 2A9UA 2BZBA 2QVAA 4EYUA 2V1DB 4DVDA 3MACA 4ZI3D 2V5CA 3GN5A 2CXLA 3E0ZA 2QA7A 3IHRA 4QH4A 3L3PA 4P1NA 2L8KA 2I59A 5HEOA 3HL6A 3RYHE 4O2AE 3A7MA 4IE4A 5FKYA 1MIWA 1HTJF 2NW7A 3ABVA 2HH7A 1G73A 3U3IA 3AEFA 2CM0A 1E1HB 4FJOA 5AQUB 4G2AA 4X66T 2P9BA 4NPPA 2KNDA 5JH7E 2UU9T 5AQOB 2ZM2A 4L0RA 1FMVA 4A98A 4CI2B 4NUUA 1WFDA 3PUYF 4J2CA 3P8CD 5JREA 3ONXA 5ABHA 4HKAA 1WRDA 4MHCA 2LSKA 2CCQA 2WM9A 2Z6EA 2JJ9A 3I9YA 2G0UA 2V7MA 3EAMA 2C5JA 3UUNA 2VVSA 5L4EA 1W0BA 2JQKA 4TWDA 3JAFA 3OYZA 2XASB 4ILAA 2VQET 1VRBA 2IHR1 2WBLA 2BKOA 4ZI2C 5J0ZA 2LSYA 3UU3A 4AKIA 4BJNA 2IMLA 3I0QA 3RRWA 5HYAA 5F3JA 2W61A 2UXBT 2CA5A 3I9WA 5LB7B 2YDQA 3OYXA 4YXDA 3EVYA 2X9YA 4IGUA 4DV6T 5JR9B 3HKDE 4U3CA 3N9LA 5LHIB 3RC8A 1BR2A 3E08A 1FEWA 2MYSA 3C51A 1W9RA 4UF0B 2XQ3A 1UUSA 2N1GA 5ABEA 3A8YC 3O1JA 1VCTA 1I94T 2E9XA 2C5KT 3ZN0B 5CJ5A 1JNRA 1D0YA 5IWAT 5AQRB 2JQHA 2UXNB 3JAEA 4LF6T 4QX8B 4YTPA 4ZI2D 3CPZA 4HWIB 4AQYT 2WP9A 4PJLA 2NW9A 2RA1A 5L3GB 3ZJ1A 3PURA 1LKXA 1ZHCA 2E9XC 4JI7T 4HE8A 4HEAA 4LFCT 1HNZT 1WYCA 3SOLA 3OKQA 5JR9C 2FUPA 1KF6A 3K3QC 3N2GE 1N33T 4JI1T 4H9SE 1HNXT 1KFYA 1DU2A 1MMGA 3HKEE 5JDNA 4YT0A 2VWAA 3ETUA 3O4XE 4NIQA 2CBIA 2LSJA 3C98B 2LSIA 4YHJA 5HEGA 3WI3A 2QGSA 5L3BB 3ZN1B 3CQCB 4UVBB 1D1AA 1XMQT 3EDVA 4XAXB 4YTMA 3FZKB 3AAEB 1QUUA 2ZM0A 2JQ9A 2ES0A 3QB5A 3ZT5A 2UUAT 5HWXA 4QHOA 5CA0E 4H63H 5HXRA 1GQEA 1UX5A 3NKZA 3TLSA 2XQ8A 2RPAA 3NZQA 4JBWF 3RYCE 4HWDA 4UV9B 3TLTA 4DV7T 1HX1B 2X9WA 4H63V 5GONE 2WDRA 1HR0T 2E9XD 2M6BA 4HFCA 1ZKEA 1YKHB 3SWHA 1VOMA 3O9XA 2XSBA 2WS3A 3ONLC 4I55E 3ZC1A 1HNWT 2QYWA 1Z0PA 5H6RB 3UU4A 2D2SA 2A3DA 1US7B 4O4HE 4OX9T 4QKNA 2CEAA 4QXHB 3N9MA 5TAOA 3RIFA 5AQHB 4B3ST 1D1BA 2C5IT 2YN6A 4LF4T 2MPKA 4AQGA 5E0OA 3QUJA 3LDQB 2EHOA 2RP4A 4ZHQE 1MMAA 1T72A 4I50E 3KDSE 1XWMA 2IAKA 3LBXB 1G8XA 4MLKA 1KNZA 4KMCA 2AE9A 3AE3A 4O2BE 1ZEEA 3NBXX 3R6NA 1ZV4X 3LSVA 2OA5A 3AAAB 1N34T 2ZLYA 3Q2MA 2J62A 4AKHA 4HFHA 2PG8A 5A1LA 3RIUA 2D0UA 3CX7B 3H3AA 2WDQA 2XQ6A 2N2NA 4KBMB 4E7ZA 3EDUA 3RPUA 3HKCE 4KUMB 1IBLT 4P09A 4YJ2E 4DR4T 2H89A 2JMHA 2ACZA 5LOVE 3AXJB 5HAXA
chains in the Genus database with same CATH topology
3KINB 4EZHA 5JQGE 3UULA 3HKBE 2LOPA 5FXZA 5EK4A 2Q9QD 3N9QA 3LFMA 5L3EB 4YJ3E 5JDHA 5L3DB 4JEUB 3AB3B 3DJBA 4I4TE 3UT5E 5C8YE 2ZM8A 3FBLA 3RH3A 4BAYB 5JRCB 4AXPA 4XZCA 2A2FX 3IF8B 3PU8A 3RC3A 2BZBA 4CZZB 3PE0A 3ZMUB 3UTKA 2KWHA 4EYUA 3K3OA 2V1DB 4DVDA 3MACA 2L3LA 1MIYA 4ZI3D 2ODVA 4C91A 5KDMC 2NTXA 2VASA 3GN5A 2C0SA 2CXLA 3E0ZA 1HS7A 2QA7A 5LHGB 3J7Yq 5KMGP 3IHRA 4PJMA 4CXYA 3K3NA 1HG5A 3L3PA 1KK7A 1D0XA 4AQFA 4UVCB 2L8KA 2I59A 2V7JA 2X9HA 2EHOB 2HPJA 2L9QA 3C4WA 5LJNA 2KT9A 2N9DA 3F2EA 4IIJE 3HL6A 3RYHE 4E7SA 4AI6A 3AAIA 4O2AE 4Z8XA 5JDQA 3I0OA 1HF8A 4IE4A 2SPCA 1MIWA 2CLYB 4HN9A 2YK0A 3C4ZA 1HTJF 3N9OA 5JR9A 2KWIB 3ETVA 2NW7A 3V5UA 2HH7A 2V7LA 1U4QA 2W0GA 4UXNB 3LK2B 1G73A 3U3IA 4NUVA 3RYIE 3WAJA 2CM0A 1E1HB 2PFVA 4UF0A 2CMRA 1Y64B 3F31A 4FJOA 3PUQA 5F8PA 4G2AA 3NRYA 5HXSA 2P9BA 3B13A 2KNDA 3KBTA 5JH7E 5HXCA 2CWOA 5JVDE 4DMVA 4O8SA 2ZM2A 5FY1A 5DQWA 4IDZA 3I1AA 3J9X1 3ZMVB 4ILUA 4L0RA 1FMVA 2GK9A 4PW8A 4X1KE 1MIVA 2VKDA 1EZ3A 1H7CA 3RX6A 4AQFC 3V5SA 4CI2B 3O1HA 4NUUA 1D0ZA 1SHZC 4HFVA 3ZYKA 2X51A 2HPLA 1MMNA 4J2CA 3P8CD 5JREA 3ONXA 4EB6E 4PJJA 4HKAA 2JQQA 1WRDA 4MHCA 2H7OA 3ZMZB 4WW0A 2LSKA 4GK0E 2CCQA 4GYSA 2LOSA 4ZI7E 4MFRA 2WM9A 2Z6EA 3FHNA 5DJQC 4N78D 4DBQA 3Q5XA 2JJ9A 4EZ4A 1V9DA 4UEMA 3I9YA 3NZPA 5HAXA 2G0UA 2V7MA 3KV9A 3D0TA 2MTQA 2V26A 2C5JA 2X67A 3UUNA 5IHYA 4C90A 3C4XA 5HWYA 4U72A 5LP6E 1O3XA 2XAHB 3OYZA 1IZNB 2XASB 5LJMA 4TUYE 4WNKA 4WBNE 2EHOC 5LA6E 4GK5E 3AVRA 4TZ4C 5ETWA 1VRBA 1OWAA 1S94A 4L9IA 1WYBA 3FBZA 2JRKA 2Y6XA 3FXDB 4PAGA 2WBLA 4H9OC 3MJXA 1YW0A 5JDGA 2W62A 4ZI2C 2LSYA 2CXFA 3UFEA 3SRZA 1FMWA 3GN5B 4GIWA 1U5PA 1LVKA 2JPFA 3C50A 4AKIA 2NOXA 4BJNA 2XAQB 1LVFA 3I0QA 3RRWA 3ZYMA 5LCYA 3DP7A 4DNDA 5HYAA 5F3JA 3DTOA 2W61A 3AVSA 3O1IA 5KX5E 4AKRB 2CA5A 2JMKA 1CUNA 4PK5A 3I9WA 4ADZA 3ZEFB 4H9QC 2NTYA 1AJ3A 4PFOA 2LHRA 2X0LB 2BVLA 2A72A 3Q5WA 3OYXA 4ANJA 3VU7H 3EVYA 4PK4A 2X9YA 3LK42 3IEEA 4IGUA 5FYMA 4WBOA 5JR9B 3ZC0A 3BQIA 3HKDE 4AKGA 5H6QB 3N2KE 3S4UA 2DNXA 4ZOLE 3P7IA 2NWBA 3N9LA 4DO0A 4P0BA 5LGNB 5LHIB 3RC8A 1BR2A 2VK9A 3E08A 1FEWA 2MYSA 4UELA 3C51A 4UF0B 3FXEB 5LGUB 2N1GA 2VL8A 3WAKA 3O1JA 3CKDA 5JDFA 1S35A 2XAFB 2V7KA 4IHJE 4OFZA 2E9XA 5L3CB 3EUHA 1YKEB 2W00A 2C5KT 4H9RC 4B6XA 3RRCA 3H37A 4X20E 5J1GA 3ZN0B 5JDMA 4EOZB 4QXBB 3TKLB 5M4YA 3OJAA 4UVAB 3ZJ2A 1D0YA 2EHOD 3JC6C 5LHHB 4F6RC 2KXPB 2UXNB 1NAFA 3KBUA 3QC9A 3IBPA 4QX8B 4XBFB 4M1PA 4ZS2A 4ZI2D 3CPZA 4GOUA 2XAGB 3MA9A 2DI4A 2DWKA 4AKLA 1UCUA 3ZYLA 5HXHA 2X68A 1IJ5A 4PJLA 4U74A 2NW9A 2RA1A 5L3GB 5LGTB 1HFAA 3PUAA 3ZJ1A 4X1YE 1UX4A 3MXZA 1HCIA 2DWGA 3ZCJA 2YU1A 1LKXA 3PURA 5LBMA 1ZHCA 5DQVA 3K8PC 2E9XC 3VHLA 4OHFA 4HE8A 4HEAA 4ISSA 4P0AA 3AA0B 4G63A 4H9PC 1LRZA 3KVAA 4O4LE 1WYCA 3SOLA 3OKQA 5JR9C 3N9NA 2VB6A 2K24A 5FNVE 3GWHA 3K3QC 3N2GE 4QX7B 4CXWA 1HX8A 5DABA 4H9SE 3UUXB 2LM9A 1SA0E 2NW8A 2PJQA 1MMGA 2ZMAA 3HKEE 4TN7B 5JDNA 2VWAA 3UUMA 4ASKA 3FB2A 3ETUA 4EAHA 3ANWA 3O4XE 5LYJE 2XHEB 3KV5A 1MNDA 2XAJB 4V1Av 3BK9A 2LSJA 2K9AA 2LEHA 3C98B 5FXXA 2KZ7B 2LSIA 2Y8DA 4YHJA 3AA1B 3WI3A 2K48A 2YINA 3N5LA 2DLRA 3E22E 5L3BB 3ZN1B 2IC9A 3VKHA 4ISTA 1BR4A 3CQCB 4UVBB 3CVRA 5BMVE 1D1AA 3LBXA 3NRXA 4IE6A 3EDVA 1NWMX 1QSDA 4XAXB 4FI5A 4QXCB 2WSSV 4IE0A 4ERRA 2ODUA 2V7IA 2WMOA 3N2OA 5FMNA 2LHNA 3AAEB 4QWNB 5IYZE 1QUUA 5ADXL 4PJNA 3U78A 2ZM0A 3LK3B 3MK7C 2ES0A 4HGAA 3GA8A 3JC6D 5FP3A 3CMLA 4PK6A 2E9XB 4H9NC 2VKHA 3GMIA 3OBVE 5CB4E 5AFUL 5HWXA 5JDLA 4QHOA 3Q9DA 5CA0E 2CXDA 4H63H 5HXRA 2ACXA 4MBQA 1UX5A 4O4IE 4EXTA 3B57A 4BJMA 2LT3A 5FXWA 3ZMSB 3NZQA 4OYJA 3AA7B 3RYCE 4UV9B 2Q9QA 2X9WA 1IAPA 4H63V 2DHRA 2X66A 5GONE 5LG4A 2YEVC 3KV6A 3VKGA 3ZPOA 5LNKA 2E9XD 2XTLA 3CQXC 4CI3B 3CX8B 2PBIA 1OXZA 2DCFA 4MALA 2KMFA 1MMDA 3LJCA 3KV4A 4HTEA 1ZKEA 1YKHB 3MZKB 3SWHA 3PTRB 4A56A 4IE5A 1VOMA 2MBGA 3SS1A 3O9XA 4GYRA 5FY7A 4I55E 4K0UA 5JRCA 2J1DG 3ZC1A 2YU2A 1Z0PA 4IE7A 5FY0A 5H6RB 2D2SA 3PUGA 3QK6A 2A3DA 1D1CA 2LJLA 5L3FB 1US7B 3HI2A 2E8IA 2Q9QC 4O4HE 4QKNA 2CEAA 5EK3A 2M67A 4CQIA 4QXHB 3N9MA 3L09A 2Y48B 5TAOA 2XQYA 4TX5A 4I43B 2K5BB 1WLXA 3BQLA 2D5UA 3ANWB 1D1BA 4O4JE 1WR6A 3MKDA 5FXVA 2C5IT 1T98A 1YD8G 2BDEA 3PDYA 4UV8B 4AQGA 2CWYA 3QUJA 5E0OA 2EHOA 2RP4A 4YLHA 2KINB 4YFSA 1MMAA 3ESLA 4ZI3C 4ZHQE 3W15B 4I50E 2NP9A 3KDSE 2WMNA 4CI1B 2IAKA 2VKOA 4OYKA 4PNIA 5HXEA 3LBXB 4EIWA 3T8OA 3PU3A 1G8XA 3LG7A 4MLKA 4TV9E 4EYYR 1B7TA 2WAUA 4KMCA 5J2UE 1KNZA 2KLQA 3KVBA 4PFPA 3ZMTB 2UXXB 4O2BE 1BR1A 4ZS3A 2XUEA 2W63A 1ZEEA 3RKOA 3CWZB 3NBXX 2B1EA 4CXXA 3R6NA 2CE7A 3A5XA 3ZLIA 1ZV4X 4DBRA 2OA5A 3AAAB 4KP3C 5L2LA 2BVMA 5CA1E 2X9XA 3M65A 2ZLYA 3PUSA 4JUYA 3Q2MA 1HG2A 4DMWA 2H7VC 1MNEA 2H3RA 4TV8E 2MOZA 3R84B 3CQGB 1IJ6A 5LXTE 4AKHA 4OK0A 2IC6A 1FIOA 2VKJA 2PG8A 3ZCIA 2WWUA 4JEHB 3CX6B 4JLEA 5A1LA 1BR0A 2D0UA 3C64A 3CX7B 5LBQB 3H3AA 3HA4A 2N2NA 4KBMB 3BQKA 2Q9QB 4L5GA 4E7ZA 3EDUA 3RPUA 3HKCE 3KFWX 2LSGA 4KUMB 5EZYE 4P09A 4YJ2E 2LE8A 4UIGA 3N9PA 2CLYC 2JMHA 5EK2A 3RYFE 3AA6B 5J2TE 3F57A 5LOVE 2D0TA 4BA9A 1X79A 3HR0A 4X1IE 2IW5B 2QGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KMC A;  4XAX B;  4KBM B;  4MFR A;  4L5G A;  4ILU A;  2LT3 A; 
#chains in the Genus database with same CATH topology
 3TLW A;  2LOP A;  5EK4 A;  3FZL B;  4YJ3 E;  4KHZ F;  5L3D B;  4JEU B;  5C8Y E;  5JRC B;  1L0V A;  4CZZ B;  3ZMU B;  3P4R A;  4YSZ A;  3K3O A;  4EED A;  1XNQ T;  2L3L A;  2IUB A;  1HS7 A;  2LRK A;  4PJM A;  3K3N A;  1KK7 A;  2V7J A;  2X9H A;  5LJN A;  4YHH T;  3AAI A;  3I0O A;  1HF8 A;  2CLY B;  4IL4 A;  3N9O A;  4ILB A;  1E2A A;  2W0G A;  3PV0 F;  4NUV A;  2PFV A;  2CMR A;  3PUQ A;  5F8P A;  2WQY A;  3NRY A;  3B13 A;  3KBT A;  5JVD E;  3AE8 A;  4O8S A;  2M6I A;  3ZMV B;  4ILU A;  4U31 A;  2GK9 A;  4X1K E;  3VR9 A;  2XM2 A;  3O1H A;  4HFV A;  2X51 A;  3AEB A;  1MMN A;  4EB6 E;  3ZMZ B;  4WW0 A;  4GK0 E;  2LOS A;  4JI4 T;  4ZI7 E;  4EZ4 A;  1V9D A;  3NZP A;  3KV9 A;  4I0U A;  2V26 A;  4JI8 T;  2X67 A;  2XAH B;  4F8H A;  5LJM A;  4TUY E;  1CHU A;  5ETW A;  1S94 A;  4JI3 T;  3FBZ A;  3FXD B;  5JDG A;  3MJX A;  1VCS A;  2W62 A;  2BG9 A;  3GN5 B;  1LVK A;  3FZH B;  3ZYM A;  2WY2 A;  5LG3 A;  3DTO A;  4U7Y A;  3O1I A;  3AVS A;  5KX5 E;  2JMK A;  1CUN A;  4ADZ A;  2OLT A;  5ABG A;  4H9Q C;  2NTY A;  3AE5 A;  1AJ3 A;  2BVL A;  2QRX A;  2A72 A;  2W2U A;  4NXN T;  4ANJ A;  2W66 A;  3IEE A;  5FYM A;  2W4X A;  4WBO A;  3ZC0 A;  2HHH T;  2DNX A;  4ZOL E;  3NVO A;  4LFB T;  3P7I A;  2K3W A;  4NXM T;  2XAF B;  2V7K A;  5AQJ B;  3EUH A;  2VVN A;  2W00 A;  4B6X A;  3RRC A;  5AQQ B;  4GKJ T;  5J1G A;  4DID B;  4EOZ B;  1KNP A;  3TKL B;  3OJA A;  4UVA B;  2H88 A;  3ZJ2 A;  2XQ7 A;  4HWH A;  4F6R C;  4LF9 T;  1NAF A;  3IBP A;  4XBF B;  4M1P A;  3PUX F;  4ZS2 A;  2DWK A;  4AKL A;  4U2Z A;  1UCU A;  1E7P A;  2AXD S;  1HFA A;  3MXZ A;  1J5W A;  3K8P C;  4OHF A;  4ISS A;  4G63 A;  4H9P C;  4UR9 A;  3EHZ A;  4LMJ A;  2K24 A;  3GWH A;  1J1J A;  5C2T A;  4CXW A;  3UUX B;  2LM9 A;  2PJQ A;  4TN7 B;  1FJG T;  3FB2 A;  3ANW A;  2XHE B;  4V1A v;  2K9A A;  2LEH A;  5FVK A;  2YIN A;  4B3R T;  2IC9 A;  4IST A;  5BMV E;  3P4S A;  1QSD A;  4FI5 A;  2WSS V;  4IE0 A;  4ERR A;  2UXC T;  2ODU A;  2WMO A;  5IYZ E;  4PJN A;  3MK7 C;  2E9X B;  4H9N C;  4HFB A;  2CXD A;  5HEU A;  4JYA T;  4MBQ A;  4EXT A;  4DR5 T;  5FXW A;  3ZMS B;  4JI0 T;  3AA7 B;  4CN6 A;  2CHO A;  3KV6 A;  2XQ5 A;  2XTL A;  3CX8 B;  4DR2 T;  2WB5 A;  2DCF A;  3Q5D A;  4MAL A;  2LRL A;  4HTE A;  5JTG A;  3MZK B;  2MBG A;  2J1D G;  2IDO B;  3PUG A;  3QK6 A;  4ZEY A;  2YKS A;  2M67 A;  3L09 A;  4I43 B;  3H3M A;  5AQG B;  4O4J E;  1WR6 A;  3MKD A;  5FXV A;  3UUB A;  1YD8 G;  4DR3 T;  2BS4 A;  3PDY A;  2CWY A;  1W0A A;  1X9B A;  2KIN B;  4YFS A;  4IDP A;  3UQ4 A;  5ABF A;  3RKG A;  2WMN A;  2VKO A;  5IUX A;  4EIW A;  3LG7 A;  2XZE A;  3P4Q A;  1B7T A;  2KLQ A;  3KVB A;  4ZS3 A;  2XUE A;  4TNV A;  4IT4 A;  1YQ4 A;  5FL1 A;  2FJE A;  4CXX A;  3A5X A;  2X9X A;  1HG2 A;  2H7V C;  2H3R A;  4TV8 E;  5AQF B;  2BKN A;  1FIO A;  2VKJ A;  3ZCI A;  2WWU A;  4JEH B;  3CX6 B;  3NWI A;  5LBQ B;  4L5G A;  1XNR T;  5EZY E;  2D9D A;  5CGM A;  2OV9 A;  2D0T A;  4ZZC A;  4EZH A;  2LKH A;  3AB3 B;  4I4T E;  3UT5 E;  2ZM8 A;  4IDN A;  4XZC A;  3IF8 B;  3RC3 A;  2WU5 A;  3UTK A;  2KWH A;  2DL1 A;  1NEN A;  5KDM C;  2UUC T;  2C0S A;  3T1Y T;  1JNZ A;  1ZP0 A;  5L4H A;  4COF A;  5LHG B;  3J7Y q;  5KMG P;  5AQT B;  1D0X A;  2XQ9 A;  4UVC B;  1J5E T;  2EHO B;  2L9Q A;  5HEH A;  2KT9 A;  1UUR A;  3F2E A;  3AED A;  4AI6 A;  3AEA A;  5LMU T;  5JDQ A;  5HEJ A;  4U7I A;  2YK0 A;  2KWI B;  4ILC A;  4X64 T;  3AE6 A;  3ETV A;  2UXD T;  3V5U A;  3AEC A;  1U4Q A;  4HFI A;  3LK2 B;  2V5D A;  5CFB A;  1UK5 A;  3WAJ A;  3AE7 A;  4DV0 T;  5HXS A;  5HXC A;  1IBM T;  3AE1 A;  5AQL B;  1H7C A;  1D0Z A;  1SHZ C;  2HPL A;  1R8I A;  2JQQ A;  4GYS A;  3TLV A;  1N32 T;  3FHN A;  5DJQ C;  4UEM A;  2CRB A;  4DV1 T;  3RGL A;  5IHY A;  4C90 A;  3C4X A;  5LP6 E;  1O3X A;  1IZN B;  4WNK A;  3UU5 A;  2EHO C;  4TZ4 C;  1OWA A;  4L9I A;  2WZI A;  1Z8U A;  2JRK A;  2Y6X A;  4PAG A;  1M7K A;  4H9O C;  1YW0 A;  1XMO T;  3UFE A;  3SRZ A;  3M3Z B;  1FMW A;  4GIW A;  1U5P A;  4DV3 T;  3C50 A;  2NOX A;  3RQU A;  4DND A;  5LCY A;  3DP7 A;  2LHR A;  2X0L B;  3L8R A;  4A5X A;  4DV2 T;  3Q5W A;  3VU7 H;  3OTO T;  3RIU C;  4PK4 A;  5AQV B;  3SFE A;  4HFD A;  5H6Q B;  4HWF A;  3S4U A;  1OED B;  4DO0 A;  4LF8 T;  4P0B A;  2VK9 A;  3QB5 K;  4DR6 T;  4Z91 A;  4OFZ A;  2CBJ A;  2LKG A;  2LLY A;  4H9R C;  3H37 A;  3VRB A;  2LM2 A;  4X20 E;  1OED A;  1NEK A;  3SFD A;  4KX6 A;  2EHO D;  3JC6 C;  2KXP B;  2V8S V;  1W09 A;  4GOU A;  2XAG B;  3MA9 A;  5HXH A;  2X68 A;  3VR8 A;  5LGT B;  3PUA A;  4CN1 A;  1UX4 A;  2BS3 A;  1HCI A;  4TWH A;  5LBM A;  3VHL A;  4P0A A;  1LRZ A;  3KVA A;  4O4L E;  2BG9 B;  2VB6 A;  5HCM A;  3RHW A;  1OED C;  3P50 A;  1HX8 A;  1SA0 E;  2E2A A;  4ASK A;  4LML A;  5FL0 A;  2I6H A;  3KV5 A;  2WDV A;  1I6Z A;  5FXX A;  3P4W A;  2Y8D A;  4DUZ T;  3AA1 B;  2K48 A;  2X0Y A;  3N5L A;  2DLR A;  3VKH A;  1BR4 A;  3UQ7 A;  3CVR A;  4IE6 A;  4LF7 T;  1NWM X;  4EV6 A;  2WU2 A;  3U78 A;  2F4V T;  3JC6 D;  4DR7 T;  5FP3 A;  2YOE A;  2VKH A;  3OBV E;  5CB4 E;  5AFU L;  2HN2 A;  2E5L T;  3Q9D A;  2ACX A;  2WZH A;  4O4I E;  3B57 A;  4BJM A;  2LT3 A;  4OYJ A;  3RLF F;  3UU8 A;  3ONJ A;  2VQF T;  2Q9Q A;  3FZM B;  2DHR A;  5LG4 A;  2YEV C;  2FJB A;  1WR0 A;  3ZPO A;  2BG9 C;  5LNK A;  4U2Y A;  3CQX C;  2PBI A;  3OVU A;  4QH5 A;  2KMF A;  2UUB T;  1MMD A;  2WWV A;  3LJC A;  3AE9 A;  3PTR B;  4JI5 T;  3SS1 A;  4DV4 T;  2YU2 A;  4IE7 A;  4X62 T;  4YTN A;  2XQ4 A;  1D1C A;  4AIS A;  3HI2 A;  2Q9Q C;  3CK6 A;  2J47 A;  4CQI A;  2Y48 B;  2BS2 A;  4TX5 A;  4WZX A;  3BQL A;  3ANW B;  3AEG A;  4UV8 B;  1M62 A;  2HN1 A;  4IRE A;  2R6G F;  3ESL A;  4JI6 T;  2NP9 A;  4CI1 B;  4PNI A;  5HXE A;  3T8O A;  4EYY R;  2WAU A;  2MAW A;  3X1D A;  4PFP A;  3RKO A;  2IIU A;  3CWZ B;  2B1E A;  2CE7 A;  3ZLI A;  4DBR A;  4KP3 C;  5L2L A;  2BVM A;  4JUY A;  3ZT6 A;  2MOZ A;  3R84 B;  1IJ6 A;  5LXT E;  2IC6 A;  4YSX A;  3AE4 A;  4JLE A;  4LMK A;  1BR0 A;  1YQ3 A;  3HA4 A;  3RQW A;  3JCF A;  3KFW X;  3Q5E A;  2LE8 A;  1T8B A;  2XPK A;  4UIG A;  3N9P A;  2JIW A;  5EK2 A;  3RYF E;  5J2T E;  2IW5 B;  4OK0 A;  3KIN B;  3HKB E;  2Q9Q D;  3EAB A;  3LFM A;  2PTF A;  3L39 A;  3DJB A;  4BAY B;  4AXP A;  2A2F X;  3PE0 A;  4JI2 T;  4EEB A;  3IA3 A;  1MIY A;  2ODV A;  4C91 A;  2NTX A;  2VAS A;  3VRA A;  2XY8 B;  1KNR A;  4HWC A;  4CXY A;  1XDP A;  1HG5 A;  4AQF A;  2I0M A;  2HPJ A;  3C4W A;  2N9D A;  4IIJ E;  2YDR A;  4E7S A;  4QH1 A;  2FJA A;  4Z8X A;  5ABF B;  2SPC A;  4HN9 A;  3C4Z A;  5JR9 A;  2V7L A;  4UXN B;  3RYI E;  3UU6 A;  4UF0 A;  3F31 A;  1Y64 B;  5BR8 T;  5HCJ A;  2XQA A;  5L47 A;  1ZOY A;  2CWO A;  4DMV A;  2CPT A;  5FY1 A;  5DQW A;  4IDZ A;  3I1A A;  3J9X 1;  4PW8 A;  1MIV A;  2VKD A;  1EZ3 A;  3AEE A;  3RX6 A;  4AQF C;  3V5S A;  4KHP T;  3ZYK A;  4B3T T;  4PJJ A;  5C3J A;  3PJA A;  2H7O A;  4MFR A;  1OED E;  3EI0 A;  4N78 D;  4DBQ A;  3Q5X A;  1IBK T;  3D0T A;  2MTQ A;  3RF1 A;  3PJA J;  4YY3 T;  2CHN A;  3PUV F;  5HWY A;  4U72 A;  2VL0 A;  3AE2 A;  4WBN E;  5LA6 E;  4GK5 E;  3AVR A;  1WYB A;  1XDO A;  2VUR A;  4YSY A;  2CXF A;  4DUY T;  2JPF A;  4LFA T;  2ZM6 T;  2XAQ B;  1LVF A;  3OPC A;  4AKR B;  4PK5 A;  3ZEF B;  4IDO A;  2J4G A;  4PFO A;  5F5W A;  5AQP B;  3LK4 2;  3BQI A;  4AKG A;  2BKP A;  3N2K E;  2FBW A;  2NWB A;  3CIR A;  5LGN B;  2E5V A;  4UEL A;  4B3M T;  2BG9 E;  3FXE B;  5LGU B;  2VL8 A;  3WAK A;  3CKD A;  5JDF A;  1S35 A;  4IHJ E;  2NR4 A;  3PUZ F;  2W67 A;  5L3C B;  1YKE B;  4K0K T;  5JDM A;  5AQI B;  4QXB B;  5M4Y A;  3RIA A;  3QNU A;  5LHH B;  3KBU A;  3QC9 A;  4KI0 F;  5KXJ A;  2DI4 A;  3ZYL A;  1IJ5 A;  4U74 A;  4X1Y E;  2DWG A;  3ZCJ A;  3PUW F;  2YU1 A;  5DQV A;  2V6X A;  3B5M A;  3AA0 B;  2XM1 A;  4DR1 T;  3N9N A;  3FZF B;  5FNV E;  1YXR A;  4QX7 B;  1T7S A;  4DV5 T;  5DAB A;  2NW8 A;  2ZMA A;  4GKK T;  4ZXL A;  2FJD A;  3UUM A;  2B76 A;  4EAH A;  5FVL A;  1UGO A;  5LYJ E;  1MND A;  2XAJ B;  3BK9 A;  3UFG A;  2KZ7 B;  2KSR A;  3ZT7 A;  3E22 E;  4IDQ A;  3LBX A;  3NRX A;  2XJ7 A;  1QLB A;  4HFE A;  4QXC B;  2X0H A;  3T1H T;  2V7I A;  3N2O A;  5FMN A;  5ADX L;  2LHN A;  4QWN B;  3QOF A;  4X5T A;  3RI5 A;  3LK3 B;  4HGA A;  4WYV A;  3GA8 A;  3JAD A;  3CML A;  4PK6 A;  3GMI A;  5JDL A;  4A97 A;  4ZZB A;  2YDS A;  5AQK B;  5LMN T;  1IAP A;  2X66 A;  3VKG A;  3ZST A;  1SE7 A;  4CI3 B;  3ZSS A;  1OXZ A;  3AXJ A;  5AQN B;  4X65 T;  3KV4 A;  1XZY A;  5AQS B;  4A56 A;  4IE5 A;  3G06 A;  3K1S A;  2WCA A;  4GYR A;  5FY7 A;  4K0U A;  5JRC A;  1SUM B;  4JV5 T;  5FY0 A;  1Y01 A;  4U33 A;  1N36 T;  2LJL A;  5L3F B;  2E8I A;  4IL9 A;  5EK3 A;  4AIU A;  2XQY A;  2K5B B;  1WLX A;  2D5U A;  1T98 A;  2BDE A;  5AQM B;  2V6Y B;  4YLH A;  4ZI3 C;  3W15 B;  4CN4 A;  4OYK A;  3PU3 A;  4TV9 E;  5J2U E;  3ZMT B;  2UXX B;  1BR1 A;  4LF5 T;  2W63 A;  1KEY A;  3TLU A;  4Z90 A;  4TWF A;  5CA1 E;  3M65 A;  3PUS A;  4DMW A;  1MNE A;  4Q25 A;  3CQG B;  3P4P A;  2V6Y A;  4EGW A;  3C64 A;  3BQK A;  2Q9Q B;  1WCR A;  2LSG A;  2CLY C;  3AA6 B;  3F57 A;  4BA9 A;  1X79 A;  3HR0 A;  4X1I E;  2BBH A;  3ZKR A;  5JQG E;  3UUL A;  5FXZ A;  2BBJ A;  4TNW A;  3N9Q A;  5L3E B;  5JDH A;  2XSA A;  3FBL A;  3RH3 A;  3PU8 A;  2A9U A;  2BZB A;  2QVA A;  4EYU A;  2V1D B;  4DVD A;  3MAC A;  4ZI3 D;  2V5C A;  3GN5 A;  2CXL A;  3E0Z A;  2QA7 A;  3IHR A;  4QH4 A;  3L3P A;  4P1N A;  2L8K A;  2I59 A;  5HEO A;  3HL6 A;  3RYH E;  4O2A E;  3A7M A;  4IE4 A;  5FKY A;  1MIW A;  1HTJ F;  2NW7 A;  3ABV A;  2HH7 A;  1G73 A;  3U3I A;  3AEF A;  2CM0 A;  1E1H B;  4FJO A;  5AQU B;  4G2A A;  4X66 T;  2P9B A;  4NPP A;  2KND A;  5JH7 E;  2UU9 T;  5AQO B;  2ZM2 A;  4L0R A;  1FMV A;  4A98 A;  4CI2 B;  4NUU A;  1WFD A;  3PUY F;  4J2C A;  3P8C D;  5JRE A;  3ONX A;  5ABH A;  4HKA A;  1WRD A;  4MHC A;  2LSK A;  2CCQ A;  2WM9 A;  2Z6E A;  2JJ9 A;  3I9Y A;  2G0U A;  2V7M A;  3EAM A;  2C5J A;  3UUN A;  2VVS A;  5L4E A;  1W0B A;  2JQK A;  4TWD A;  3JAF A;  3OYZ A;  2XAS B;  4ILA A;  2VQE T;  1VRB A;  2IHR 1;  2WBL A;  2BKO A;  4ZI2 C;  5J0Z A;  2LSY A;  3UU3 A;  4AKI A;  4BJN A;  2IML A;  3I0Q A;  3RRW A;  5HYA A;  5F3J A;  2W61 A;  2UXB T;  2CA5 A;  3I9W A;  5LB7 B;  2YDQ A;  3OYX A;  4YXD A;  3EVY A;  2X9Y A;  4IGU A;  4DV6 T;  5JR9 B;  3HKD E;  4U3C A;  3N9L A;  5LHI B;  3RC8 A;  1BR2 A;  3E08 A;  1FEW A;  2MYS A;  3C51 A;  1W9R A;  4UF0 B;  2XQ3 A;  1UUS A;  2N1G A;  5ABE A;  3A8Y C;  3O1J A;  1VCT A;  1I94 T;  2E9X A;  2C5K T;  3ZN0 B;  5CJ5 A;  1JNR A;  1D0Y A;  5IWA T;  5AQR B;  2JQH A;  2UXN B;  3JAE A;  4LF6 T;  4QX8 B;  4YTP A;  4ZI2 D;  3CPZ A;  4HWI B;  4AQY T;  2WP9 A;  4PJL A;  2NW9 A;  2RA1 A;  5L3G B;  3ZJ1 A;  3PUR A;  1LKX A;  1ZHC A;  2E9X C;  4JI7 T;  4HE8 A;  4HEA A;  4LFC T;  1HNZ T;  1WYC A;  3SOL A;  3OKQ A;  5JR9 C;  2FUP A;  1KF6 A;  3K3Q C;  3N2G E;  1N33 T;  4JI1 T;  4H9S E;  1HNX T;  1KFY A;  1DU2 A;  1MMG A;  3HKE E;  5JDN A;  4YT0 A;  2VWA A;  3ETU A;  3O4X E;  4NIQ A;  2CBI A;  2LSJ A;  3C98 B;  2LSI A;  4YHJ A;  5HEG A;  3WI3 A;  2QGS A;  5L3B B;  3ZN1 B;  3CQC B;  4UVB B;  1D1A A;  1XMQ T;  3EDV A;  4XAX B;  4YTM A;  3FZK B;  3AAE B;  1QUU A;  2ZM0 A;  2JQ9 A;  2ES0 A;  3QB5 A;  3ZT5 A;  2UUA T;  5HWX A;  4QHO A;  5CA0 E;  4H63 H;  5HXR A;  1GQE A;  1UX5 A;  3NKZ A;  3TLS A;  2XQ8 A;  2RPA A;  3NZQ A;  4JBW F;  3RYC E;  4HWD A;  4UV9 B;  3TLT A;  4DV7 T;  1HX1 B;  2X9W A;  4H63 V;  5GON E;  2WDR A;  1HR0 T;  2E9X D;  2M6B A;  4HFC A;  1ZKE A;  1YKH B;  3SWH A;  1VOM A;  3O9X A;  2XSB A;  2WS3 A;  3ONL C;  4I55 E;  3ZC1 A;  1HNW T;  2QYW A;  1Z0P A;  5H6R B;  3UU4 A;  2D2S A;  2A3D A;  1US7 B;  4O4H E;  4OX9 T;  4QKN A;  2CEA A;  4QXH B;  3N9M A;  5TAO A;  3RIF A;  5AQH B;  4B3S T;  1D1B A;  2C5I T;  2YN6 A;  4LF4 T;  2MPK A;  4AQG A;  5E0O A;  3QUJ A;  3LDQ B;  2EHO A;  2RP4 A;  4ZHQ E;  1MMA A;  1T72 A;  4I50 E;  3KDS E;  1XWM A;  2IAK A;  3LBX B;  1G8X A;  4MLK A;  1KNZ A;  4KMC A;  2AE9 A;  3AE3 A;  4O2B E;  1ZEE A;  3NBX X;  3R6N A;  1ZV4 X;  3LSV A;  2OA5 A;  3AAA B;  1N34 T;  2ZLY A;  3Q2M A;  2J62 A;  4AKH A;  4HFH A;  2PG8 A;  5A1L A;  3RIU A;  2D0U A;  3CX7 B;  3H3A A;  2WDQ A;  2XQ6 A;  2N2N A;  4KBM B;  4E7Z A;  3EDU A;  3RPU A;  3HKC E;  4KUM B;  1IBL T;  4P09 A;  4YJ2 E;  4DR4 T;  2H89 A;  2JMH A;  2ACZ A;  5LOV E;  3AXJ B;  5HAX A; 
#chains in the Genus database with same CATH homology
 3KIN B;  4EZH A;  5JQG E;  3UUL A;  3HKB E;  2LOP A;  5FXZ A;  5EK4 A;  2Q9Q D;  3N9Q A;  3LFM A;  5L3E B;  4YJ3 E;  5JDH A;  5L3D B;  4JEU B;  3AB3 B;  3DJB A;  4I4T E;  3UT5 E;  5C8Y E;  2ZM8 A;  3FBL A;  3RH3 A;  4BAY B;  5JRC B;  4AXP A;  4XZC A;  2A2F X;  3IF8 B;  3PU8 A;  3RC3 A;  2BZB A;  4CZZ B;  3PE0 A;  3ZMU B;  3UTK A;  2KWH A;  4EYU A;  3K3O A;  2V1D B;  4DVD A;  3MAC A;  2L3L A;  1MIY A;  4ZI3 D;  2ODV A;  4C91 A;  5KDM C;  2NTX A;  2VAS A;  3GN5 A;  2C0S A;  2CXL A;  3E0Z A;  1HS7 A;  2QA7 A;  5LHG B;  3J7Y q;  5KMG P;  3IHR A;  4PJM A;  4CXY A;  3K3N A;  1HG5 A;  3L3P A;  1KK7 A;  1D0X A;  4AQF A;  4UVC B;  2L8K A;  2I59 A;  2V7J A;  2X9H A;  2EHO B;  2HPJ A;  2L9Q A;  3C4W A;  5LJN A;  2KT9 A;  2N9D A;  3F2E A;  4IIJ E;  3HL6 A;  3RYH E;  4E7S A;  4AI6 A;  3AAI A;  4O2A E;  4Z8X A;  5JDQ A;  3I0O A;  1HF8 A;  4IE4 A;  2SPC A;  1MIW A;  2CLY B;  4HN9 A;  2YK0 A;  3C4Z A;  1HTJ F;  3N9O A;  5JR9 A;  2KWI B;  3ETV A;  2NW7 A;  3V5U A;  2HH7 A;  2V7L A;  1U4Q A;  2W0G A;  4UXN B;  3LK2 B;  1G73 A;  3U3I A;  4NUV A;  3RYI E;  3WAJ A;  2CM0 A;  1E1H B;  2PFV A;  4UF0 A;  2CMR A;  1Y64 B;  3F31 A;  4FJO A;  3PUQ A;  5F8P A;  4G2A A;  3NRY A;  5HXS A;  2P9B A;  3B13 A;  2KND A;  3KBT A;  5JH7 E;  5HXC A;  2CWO A;  5JVD E;  4DMV A;  4O8S A;  2ZM2 A;  5FY1 A;  5DQW A;  4IDZ A;  3I1A A;  3J9X 1;  3ZMV B;  4ILU A;  4L0R A;  1FMV A;  2GK9 A;  4PW8 A;  4X1K E;  1MIV A;  2VKD A;  1EZ3 A;  1H7C A;  3RX6 A;  4AQF C;  3V5S A;  4CI2 B;  3O1H A;  4NUU A;  1D0Z A;  1SHZ C;  4HFV A;  3ZYK A;  2X51 A;  2HPL A;  1MMN A;  4J2C A;  3P8C D;  5JRE A;  3ONX A;  4EB6 E;  4PJJ A;  4HKA A;  2JQQ A;  1WRD A;  4MHC A;  2H7O A;  3ZMZ B;  4WW0 A;  2LSK A;  4GK0 E;  2CCQ A;  4GYS A;  2LOS A;  4ZI7 E;  4MFR A;  2WM9 A;  2Z6E A;  3FHN A;  5DJQ C;  4N78 D;  4DBQ A;  3Q5X A;  2JJ9 A;  4EZ4 A;  1V9D A;  4UEM A;  3I9Y A;  3NZP A;  5HAX A;  2G0U A;  2V7M A;  3KV9 A;  3D0T A;  2MTQ A;  2V26 A;  2C5J A;  2X67 A;  3UUN A;  5IHY A;  4C90 A;  3C4X A;  5HWY A;  4U72 A;  5LP6 E;  1O3X A;  2XAH B;  3OYZ A;  1IZN B;  2XAS B;  5LJM A;  4TUY E;  4WNK A;  4WBN E;  2EHO C;  5LA6 E;  4GK5 E;  3AVR A;  4TZ4 C;  5ETW A;  1VRB A;  1OWA A;  1S94 A;  4L9I A;  1WYB A;  3FBZ A;  2JRK A;  2Y6X A;  3FXD B;  4PAG A;  2WBL A;  4H9O C;  3MJX A;  1YW0 A;  5JDG A;  2W62 A;  4ZI2 C;  2LSY A;  2CXF A;  3UFE A;  3SRZ A;  1FMW A;  3GN5 B;  4GIW A;  1U5P A;  1LVK A;  2JPF A;  3C50 A;  4AKI A;  2NOX A;  4BJN A;  2XAQ B;  1LVF A;  3I0Q A;  3RRW A;  3ZYM A;  5LCY A;  3DP7 A;  4DND A;  5HYA A;  5F3J A;  3DTO A;  2W61 A;  3AVS A;  3O1I A;  5KX5 E;  4AKR B;  2CA5 A;  2JMK A;  1CUN A;  4PK5 A;  3I9W A;  4ADZ A;  3ZEF B;  4H9Q C;  2NTY A;  1AJ3 A;  4PFO A;  2LHR A;  2X0L B;  2BVL A;  2A72 A;  3Q5W A;  3OYX A;  4ANJ A;  3VU7 H;  3EVY A;  4PK4 A;  2X9Y A;  3LK4 2;  3IEE A;  4IGU A;  5FYM A;  4WBO A;  5JR9 B;  3ZC0 A;  3BQI A;  3HKD E;  4AKG A;  5H6Q B;  3N2K E;  3S4U A;  2DNX A;  4ZOL E;  3P7I A;  2NWB A;  3N9L A;  4DO0 A;  4P0B A;  5LGN B;  5LHI B;  3RC8 A;  1BR2 A;  2VK9 A;  3E08 A;  1FEW A;  2MYS A;  4UEL A;  3C51 A;  4UF0 B;  3FXE B;  5LGU B;  2N1G A;  2VL8 A;  3WAK A;  3O1J A;  3CKD A;  5JDF A;  1S35 A;  2XAF B;  2V7K A;  4IHJ E;  4OFZ A;  2E9X A;  5L3C B;  3EUH A;  1YKE B;  2W00 A;  2C5K T;  4H9R C;  4B6X A;  3RRC A;  3H37 A;  4X20 E;  5J1G A;  3ZN0 B;  5JDM A;  4EOZ B;  4QXB B;  3TKL B;  5M4Y A;  3OJA A;  4UVA B;  3ZJ2 A;  1D0Y A;  2EHO D;  3JC6 C;  5LHH B;  4F6R C;  2KXP B;  2UXN B;  1NAF A;  3KBU A;  3QC9 A;  3IBP A;  4QX8 B;  4XBF B;  4M1P A;  4ZS2 A;  4ZI2 D;  3CPZ A;  4GOU A;  2XAG B;  3MA9 A;  2DI4 A;  2DWK A;  4AKL A;  1UCU A;  3ZYL A;  5HXH A;  2X68 A;  1IJ5 A;  4PJL A;  4U74 A;  2NW9 A;  2RA1 A;  5L3G B;  5LGT B;  1HFA A;  3PUA A;  3ZJ1 A;  4X1Y E;  1UX4 A;  3MXZ A;  1HCI A;  2DWG A;  3ZCJ A;  2YU1 A;  1LKX A;  3PUR A;  5LBM A;  1ZHC A;  5DQV A;  3K8P C;  2E9X C;  3VHL A;  4OHF A;  4HE8 A;  4HEA A;  4ISS A;  4P0A A;  3AA0 B;  4G63 A;  4H9P C;  1LRZ A;  3KVA A;  4O4L E;  1WYC A;  3SOL A;  3OKQ A;  5JR9 C;  3N9N A;  2VB6 A;  2K24 A;  5FNV E;  3GWH A;  3K3Q C;  3N2G E;  4QX7 B;  4CXW A;  1HX8 A;  5DAB A;  4H9S E;  3UUX B;  2LM9 A;  1SA0 E;  2NW8 A;  2PJQ A;  1MMG A;  2ZMA A;  3HKE E;  4TN7 B;  5JDN A;  2VWA A;  3UUM A;  4ASK A;  3FB2 A;  3ETU A;  4EAH A;  3ANW A;  3O4X E;  5LYJ E;  2XHE B;  3KV5 A;  1MND A;  2XAJ B;  4V1A v;  3BK9 A;  2LSJ A;  2K9A A;  2LEH A;  3C98 B;  5FXX A;  2KZ7 B;  2LSI A;  2Y8D A;  4YHJ A;  3AA1 B;  3WI3 A;  2K48 A;  2YIN A;  3N5L A;  2DLR A;  3E22 E;  5L3B B;  3ZN1 B;  2IC9 A;  3VKH A;  4IST A;  1BR4 A;  3CQC B;  4UVB B;  3CVR A;  5BMV E;  1D1A A;  3LBX A;  3NRX A;  4IE6 A;  3EDV A;  1NWM X;  1QSD A;  4XAX B;  4FI5 A;  4QXC B;  2WSS V;  4IE0 A;  4ERR A;  2ODU A;  2V7I A;  2WMO A;  3N2O A;  5FMN A;  2LHN A;  3AAE B;  4QWN B;  5IYZ E;  1QUU A;  5ADX L;  4PJN A;  3U78 A;  2ZM0 A;  3LK3 B;  3MK7 C;  2ES0 A;  4HGA A;  3GA8 A;  3JC6 D;  5FP3 A;  3CML A;  4PK6 A;  2E9X B;  4H9N C;  2VKH A;  3GMI A;  3OBV E;  5CB4 E;  5AFU L;  5HWX A;  5JDL A;  4QHO A;  3Q9D A;  5CA0 E;  2CXD A;  4H63 H;  5HXR A;  2ACX A;  4MBQ A;  1UX5 A;  4O4I E;  4EXT A;  3B57 A;  4BJM A;  2LT3 A;  5FXW A;  3ZMS B;  3NZQ A;  4OYJ A;  3AA7 B;  3RYC E;  4UV9 B;  2Q9Q A;  2X9W A;  1IAP A;  4H63 V;  2DHR A;  2X66 A;  5GON E;  5LG4 A;  2YEV C;  3KV6 A;  3VKG A;  3ZPO A;  5LNK A;  2E9X D;  2XTL A;  3CQX C;  4CI3 B;  3CX8 B;  2PBI A;  1OXZ A;  2DCF A;  4MAL A;  2KMF A;  1MMD A;  3LJC A;  3KV4 A;  4HTE A;  1ZKE A;  1YKH B;  3MZK B;  3SWH A;  3PTR B;  4A56 A;  4IE5 A;  1VOM A;  2MBG A;  3SS1 A;  3O9X A;  4GYR A;  5FY7 A;  4I55 E;  4K0U A;  5JRC A;  2J1D G;  3ZC1 A;  2YU2 A;  1Z0P A;  4IE7 A;  5FY0 A;  5H6R B;  2D2S A;  3PUG A;  3QK6 A;  2A3D A;  1D1C A;  2LJL A;  5L3F B;  1US7 B;  3HI2 A;  2E8I A;  2Q9Q C;  4O4H E;  4QKN A;  2CEA A;  5EK3 A;  2M67 A;  4CQI A;  4QXH B;  3N9M A;  3L09 A;  2Y48 B;  5TAO A;  2XQY A;  4TX5 A;  4I43 B;  2K5B B;  1WLX A;  3BQL A;  2D5U A;  3ANW B;  1D1B A;  4O4J E;  1WR6 A;  3MKD A;  5FXV A;  2C5I T;  1T98 A;  1YD8 G;  2BDE A;  3PDY A;  4UV8 B;  4AQG A;  2CWY A;  3QUJ A;  5E0O A;  2EHO A;  2RP4 A;  4YLH A;  2KIN B;  4YFS A;  1MMA A;  3ESL A;  4ZI3 C;  4ZHQ E;  3W15 B;  4I50 E;  2NP9 A;  3KDS E;  2WMN A;  4CI1 B;  2IAK A;  2VKO A;  4OYK A;  4PNI A;  5HXE A;  3LBX B;  4EIW A;  3T8O A;  3PU3 A;  1G8X A;  3LG7 A;  4MLK A;  4TV9 E;  4EYY R;  1B7T A;  2WAU A;  4KMC A;  5J2U E;  1KNZ A;  2KLQ A;  3KVB A;  4PFP A;  3ZMT B;  2UXX B;  4O2B E;  1BR1 A;  4ZS3 A;  2XUE A;  2W63 A;  1ZEE A;  3RKO A;  3CWZ B;  3NBX X;  2B1E A;  4CXX A;  3R6N A;  2CE7 A;  3A5X A;  3ZLI A;  1ZV4 X;  4DBR A;  2OA5 A;  3AAA B;  4KP3 C;  5L2L A;  2BVM A;  5CA1 E;  2X9X A;  3M65 A;  2ZLY A;  3PUS A;  4JUY A;  3Q2M A;  1HG2 A;  4DMW A;  2H7V C;  1MNE A;  2H3R A;  4TV8 E;  2MOZ A;  3R84 B;  3CQG B;  1IJ6 A;  5LXT E;  4AKH A;  4OK0 A;  2IC6 A;  1FIO A;  2VKJ A;  2PG8 A;  3ZCI A;  2WWU A;  4JEH B;  3CX6 B;  4JLE A;  5A1L A;  1BR0 A;  2D0U A;  3C64 A;  3CX7 B;  5LBQ B;  3H3A A;  3HA4 A;  2N2N A;  4KBM B;  3BQK A;  2Q9Q B;  4L5G A;  4E7Z A;  3EDU A;  3RPU A;  3HKC E;  3KFW X;  2LSG A;  4KUM B;  5EZY E;  4P09 A;  4YJ2 E;  2LE8 A;  4UIG A;  3N9P A;  2CLY C;  2JMH A;  5EK2 A;  3RYF E;  3AA6 B;  5J2T E;  3F57 A;  5LOV E;  2D0T A;  4BA9 A;  1X79 A;  3HR0 A;  4X1I E;  2IW5 B;  2QGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...