4KMCA

Structure analysis of m. tuberculosis rrna transcriptional regulator card and its interaction with t. aquaticus rna polymerase-beta1 domain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
79
structure length
79
Chain Sequence
TNWSRRYKANLEKLASGDVNKVAEVVRDLWRRDQERGLSAGEKRMLAKARQILVGELALAESTDDAKAETILDEVLAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords RNA polymerase-binding transcription factor CarD
publication title Structure of the carboxy-terminal domain of Mycobacterium tuberculosis CarD protein: an essential rRNA transcriptional regulator
doi rcsb
source organism Mycobacterium tuberculosis
total genus 34
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2013-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1290 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4kmcA00
4ILUA 2LT3A 4KBMB 4MFRA 4XAXB 4L5GA 4KMCA
chains in the Genus database with same CATH superfamily
1EZ3A 3CX7B 1VCSA 2UXCT 4KUMB 2KXPB 3RKGA 4DV1T 5LJMA 4EB6E 4PJJA 3A5XA 3N9OA 1G73A 5KX5E 2X0HA 3FZFB 2JJ9A 1V9DA 3P7IA 1IBLT 1WFDA 2JRKA 2VB6A 4KP3C 4OX9T 3V5UA 4PK4A 1UCUA 4DMVA 4L0RA 4PK5A 3Q5WA 4HWHA 3ZCIA 3R84B 3O1HA 1IJ5A 2XSAA 4EXTA 3NRYA 3QB5A 3N5LA 3PURA 3S4UA 2IIUA 2JQKA 3PUSA 2ZM6T 4DR7T 2LJLA 5TAOA 5HXRA 3GMIA 3F31A 4CN6A 5FXVA 4EYUA 3UFEA 3RH3A 2E9XC 3PUZF 5JTGA 4GKKT 3TLSA 2J1DG 3AEAA 4N78D 3F2EA 4BJMA 4XBFB 1W9RA 2DCFA 4GIWA 1J1JA 3UQ7A 2V6XA 2CE7A 5E0OA 4UEMA 3BQIA 4AKRB 4MALA 3RIUA 3PDYA 2PFVA 5FYMA 1HF8A 3K1SA 5L4EA 5FY1A 5DABA 1XNQT 4IE4A 2LKGA 1HTJF 2VK9A 2LM2A 4HE8A 4UXNB 3ZMSB 3FXEB 3ZCJA 5LYJE 2XAJB 4PFPA 1BR0A 2CMRA 3SS1A 3C51A 5KMGP 2YOEA 3AE5A 4U74A 2ZM0A 2LSKA 2MTQA 4AQFA 3LSVA 2LSJA 2WDQA 3LK42 4UELA 2WBLA 4XZCA 3UU5A 3T1HT 2M6BA 2IC6A 4G63A 3MXZA 5FY7A 3A7MA 4G2AA 1BR2A 5CA0E 4IDOA 3N9QA 2YDRA 2XQ4A 1HX1B 5HAXA 5CGMA 2YINA 2KZ7B 4AI6A 3RYHE 4CZZB 4OK0A 3RI5A 2VKJA 4X1YE 4ZZCA 2FJEA 4YSYA 3FXDB 1YKHB 3UUMA 2HN2A 3CX6B 1T7SA 4IDZA 1SA0E 1Y64B 5J0ZA 1Z0PA 4JUYA 4YTNA 5FNVE 2CLYB 3RIAA 1OXZA 4B6XA 4O4IE 5IYZE 1DU2A 2I6HA 1HNWT 4A5XA 3PTRB 2DWKA 4HFCA 2JMHA 2XAGB 5IHYA 1BR4A 4UF0B 4U72A 5JH7E 2XPKA 5JR9A 2W0GA 2V5CA 3P4WA 2CXFA 1WCRA 1KNRA 2V7MA 3ZYLA 4ZI2C 1UK5A 3MKDA 2V7IA 2EHOD 2KSRA 3AEFA 2IC9A 4H9PC 5AQLB 1NEKA 5HEHA 1XMQT 2HH7A 3TLUA 3TLTA 4X1KE 1AJ3A 3ONXA 4JBWF 4NUVA 1LRZA 4PJMA 3AE4A 2XASB 2LHRA 4V1Av 2BG9A 2D5UA 4HFHA 4TV8E 3PUYF 2Q9QB 2WWVA 4AQGA 4NIQA 2C5KT 2A9UA 3AA1B 2V26A 1MNEA 2IDOB 2D2SA 2X9YA 1WRDA 3AXJA 2X51A 3G06A 4X62T 1E7PA 1GQEA 5JDQA 5FVKA 5AQPB 4UVCB 3SRZA 5L4HA 4COFA 1Y01A 5AQRB 1E1HB 3ZT7A 3KVAA 4YLHA 3N9NA 2V6YB 2WMNA 4I4TE 3KBUA 4LFBT 3RIUC 2EHOA 3WAJA 2CCQA 2CWOA 4JI6T 3AE9A 4YHJA 5LA6E 4O4HE 2H3RA 2V7LA 4LF7T 5HWYA 2WMOA 2LEHA 2A2FX 2YK0A 2UUBT 3GWHA 2P9BA 3IBPA 5FXZA 4UR9A 3KDSE 5JDFA 4O4LE 3O9XA 4UV9B 3GN5B 5J2TE 4AQFC 1XDOA 2WDRA 3NVOA 5LOVE 3HI2A 5DJQC 5JVDE 2UUAT 3EAMA 1J5WA 4BJNA 2YEVC 1KFYA 2CBJA 2MYSA 5LXTE 4PNIA 3J7Yq 2WZHA 3RGLA 2UXNB 3L8RA 3LK3B 3CWZB 4CN4A 4EYYR 3DTOA 1OEDE 4LF9T 5L3BB 2BBHA 3L09A 1W0AA 4HWCA 5A1LA 5JDLA 5LG4A 3F57A 3RQUA 4ZI3D 3RHWA 3ESLA 4HKAA 4LMLA 5ADXL 2XJ7A 1M62A 3N2KE 3UU8A 4O4JE 2UXBT 2YU2A 3T8OA 3UT5E 3JC6C 2BKNA 2VURA 4B3TT 4DV3T 4YY3T 1W0BA 4ZS3A 4DR2T 4DNDA 2WU5A 1FEWA 4AISA 5JRCA 4QHOA 2HPLA 3AB3B 3V5SA 5LCYA 3ZT6A 3C4WA 4CXWA 2A3DA 2VKDA 4KHZF 5JR9C 5FKYA 1MIYA 2LT3A 2K9AA 4HEAA 3P4PA 3AE3A 4DBRA 3PU3A 1LVKA 3CVRA 1HR0T 3FHNA 3ETUA 4JLEA 2KWHA 2PG8A 3AVSA 2BS3A 2X67A 4A97A 3AE2A 1J5ET 5FMNA 3SFEA 2DHRA 1R8IA 3A8YC 3KV5A 3UU6A 5EZYE 1HS7A 4GK5E 3CQXC 4MLKA 4CN1A 3NZQA 3PE0A 1MNDA 4QH1A 1QSDA 4CI1B 1M7KA 2BG9C 2WDVA 4IIJE 1HFAA 5JDGA 2Y48B 2BVLA 3HA4A 2J47A 2VL0A 4QKNA 2N1GA 3AEGA 2ZM2A 3CQGB 3LBXB 4WW0A 2Z6EA 3H3MA 3RRWA 4EEBA 2XM1A 1MIWA 1MMAA 3AAEB 1IBKT 2YKSA 3MACA 2NW7A 3P8CD 5CFBA 3RPUA 5JDMA 5KXJA 4PW8A 4E7SA 2EHOC 3ZSSA 2JPFA 4IHJE 3DJBA 5JRCB 2D0UA 3VRBA 4B3ST 2W66A 5BR8T 4Z91A 4JI8T 2X68A 1YW0A 3N9PA 4ASKA 1YD8G 4BA9A 1D1AA 5JQGE 1D0ZA 2XQ5A 4EGWA 1X9BA 3AA6B 3U78A 2CEAA 3HKCE 1OEDB 1L0VA 2X0LB 5CA1E 5EK4A 4HGAA 3R6NA 5ABFA 3JAFA 1FIOA 3JAEA 1D1CA 2OA5A 2FJBA 5L3GB 5L47A 4UIGA 3EABA 3N9MA 1CHUA 2LHNA 3PUAA 3EUHA 4CQIA 2CA5A 2Q9QD 1NWMX 5DQWA 2C5IT 1I94T 3HKDE 3L39A 2BVMA 1IZNB 2UXXB 1D0XA 3BK9A 4Z90A 1UUSA 2VL8A 2V7KA 2E5VA 5DQVA 3I0OA 2XQYA 3NRXA 2UU9T 3ZMZB 3LK2B 5J2UE 1KNPA 1WLXA 4UF0A 4P09A 2QYWA 1MIVA 2VKHA 1WR0A 1IBMT 4WBNE 5AQHB 3OJAA 2XUEA 1HCIA 2WU2A 3CMLA 3H37A 4CI3B 2ZMAA 5AQUB 3SWHA 5LB7B 4DBQA 2DWGA 2N9DA 3VKGA 4X64T 5LMNT 4YSZA 2XY8B 3FBZA 5M4YA 4ILAA 4A98A 4B3MT 4IREA 4JEUB 2Q9QA 2N2NA 2D9DA 4JI2T 4QXHB 5ABFB 3RYIE 4K0KT 1XDPA 3VRAA 2LM9A 5H6RB 1KEYA 3VKHA 4ZI3C 3AE7A 5BMVE 1YQ4A 2LKHA 5HXCA 3K3NA 5FXWA 5LHGB 4IE0A 2NP9A 1LKXA 2H89A 2BKOA 4NXNT 3NZPA 2E5LT 5LGNB 2V6YA 5GONE 2W61A 3U3IA 3N2GE 3SFDA 2KLQA 4I50E 4TX5A 2Y6XA 1XWMA 2HN1A 5AFUL 1MMNA 4P0BA 3D0TA 2PJQA 3SOLA 4EZ4A 4LF5T 3RLFF 3KBTA 3RF1A 5KDMC 2VQFT 4H9SE 3HKEE 4EEDA 4TWHA 5HXEA 3TKLB 3GN5A 2XSBA 1W09A 2W67A 4WYVA 4FJOA 2FJAA 3IEEA 2XQ8A 2WS3A 4ZS2A 3ONJA 4Q25A 5HCJA 3CQCB 5HEGA 2V8SV 4H9RC 1QUUA 3C50A 5AQVB 4JI5T 4GOUA 4PK6A 1SHZC 2KMFA 4NUUA 1T8BA 2E8IA 2J62A 1WYBA 4OYJA 3AAIA 3ZN1B 4WBOA 3ZLIA 2HHHT 3ABVA 5CJ5A 3AECA 3OBVE 5AQTB 4WZXA 4P0AA 1X79A 2CRBA 3ETVA 4AKIA 3I9WA 1CUNA 3KV9A 5C3JA 4MFRA 2CLYC 4H9NC 2E9XD 4K0UA 2VASA 2F4VT 3T1YT 3Q5XA 2K48A 1YXRA 4IDQA 2JMKA 4EV6A 4EZHA 5FP3A 4X1IE 5FXXA 2WB5A 4QH5A 3AEBA 3TLWA 4HFVA 3B13A 4JI4T 5AQIB 2KT9A 4IE7A 1ZHCA 2UXDT 3QC9A 4GK0E 3ZKRA 2OV9A 4HFIA 2BS2A 4YXDA 4IL4A 4ISSA 4LFCT 2V1DB 1MMDA 3WI3A 3UTKA 5LNKA 3O4XE 4AXPA 4YHHT 1XNRT 1SE7A 2VVNA 3PJAJ 2XAQB 3HL6A 4PFOA 4DV5T 4LF6T 4PJLA 3NWIA 3B5MA 5ABHA 5HWXA 4KMCA 4E7ZA 2ACXA 4TV9E 5EK2A 2CHOA 4IE6A 4HTEA 1ZEEA 1BR1A 2Q9QC 3MK7C 3PUQA 3AEDA 2M67A 4DV4T 1ZP0A 4JI7T 1KK7A 4TWFA 5LP6E 5L2LA 5FL1A 4H9QC 4CXYA 3LBXA 2WWUA 2UUCT 2ZLYA 2MBGA 4UV8B 4X20E 1HG5A 1VOMA 3ZPOA 1N32T 1N33T 4EIWA 1LVFA 4DV7T 3K3QC 2OLTA 4U2ZA 5H6QB 3Q5DA 2WCAA 3TLVA 2JQQA 2JIWA 4B3RT 1MMGA 1US7B 4QH4A 3RC8A 1S94A 4CXXA 5JDHA 3C98B 5L3CB 4IL9A 1N36T 2H7OA 4DIDB 5LG3A 3CIRA 1OEDA 2QRXA 4Z8XA 4U2YA 5ABEA 2K24A 2ODUA 3FBLA 4AIUA 3CPZA 3AVRA 5EK3A 2ES0A 2CWYA 4HFEA 5AQFB 2YDQA 4AKLA 4H63V 5ABGA 4GYSA 4IDNA 5LGUB 4ZI2D 5F5WA 2XM2A 4MBQA 1IAPA 3KINB 3QK6A 1OWAA 3PV0F 4OHFA 2E9XB 4IDPA 2KWIB 4QXCB 2CM0A 2WQYA 3C4ZA 3P4QA 4OFZA 3KFWX 2CBIA 3ZC1A 3OYZA 3I0QA 3I9YA 4P1NA 4EOZB 4U3CA 2BZBA 4ZZBA 3GA8A 2X66A 3EI0A 2B1EA 2K5BB 2XQAA 3OYXA 4UVAB 2LOSA 4ADZA 2IHR1 4DV2T 5HEOA 3MA9A 2LRKA 5HCMA 4AQYT 3P4SA 5AQJB 3C64A 2VQET 5FL0A 3AAAB 2NOXA 1YKEB 3X1DA 4QXBB 3PUWF 3PUVF 5AQMB 3RRCA 2V7JA 2E2AA 4U31A 1HG2A 3JCFA 1ZOYA 5LBQB 3DP7A 1JNRA 3E22E 4H9OC 2BS4A 3ZYMA 2KINB 3ANWB 3HR0A 4YJ3E 3UUBA 2RPAA 4HWDA 4U7YA 1HNZT 5HEUA 3RX6A 3Q2MA 2VWAA 2XQ9A 2W4XA 2NR4A 2AE9A 2FUPA 2NTYA 3AEEA 1KNZA 2WZIA 4KX6A 3EDVA 2DLRA 4DV6T 5LJNA 3RC3A 2YU1A 3PUGA 1U4QA 3MJXA 4UVBB 4WNKA 2X9WA 4ZEYA 2BDEA 3K8PC 3VR9A 2JQHA 4J2CA 4U7IA 2PTFA 4X5TA 1FMWA 1XZYA 4ILUA 2XAFB 1FMVA 4LF4T 2CXLA 1SUMB 4JYAT 4HFDA 3NKZA 1UURA 1UX5A 1G8XA 3P4RA 2MAWA 1N34T 2XHEB 5C2TA 3M65A 3JC6D 3UFGA 4HWIB 4I43B 2SPCA 2W63A 4NXMT 1QLBA 1OEDC 2ODVA 2RP4A 4LFAT 4IGUA 1UX4A 4EAHA 2FBWA 1U5PA 4TWDA 5AQOB 3CX8B 5LHIB 2LSIA 2VVSA 3EVYA 1H7CA 4PJNA 2BKPA 1WYCA 3FZMB 3K3OA 3UU4A 2DI4A 3VU7H 3ZMTB 2LE8A 4TUYE 4CI2B 3UUXB 4TN7B 2MOZA 2XTLA 5AQNB 3FZLB 5F3JA 2NTXA 3RYCE 1ZKEA 2WSSV 3KV4A 4NPPA 2MPKA 3NBXX 2YN6A 3PU8A 2QVAA 3ZT5A 4JEHB 2K3WA 4M1PA 4DO0A 4AKHA 5L3EB 3WAKA 2BG9E 2WM9A 5C8YE 3UU3A 2JQ9A 1D0YA 4IE5A 5AQQB 2IAKA 2RA1A 3N2OA 4GKJT 3AE6A 3L3PA 4YT0A 1I6ZA 3W15B 3MZKB 3ZN0B 3LJCA 5FY0A 3BQKA 1NAFA 2L8KA 3PJAA 4ERRA 4ILBA 2QGSA 4IT4A 2ACZA 3RIFA 4PAGA 2DNXA 3UQ4A 1KF6A 2NWBA 1Z8UA 1O3XA 4DR5T 4JI1T 3VHLA 4O2BE 2C5JA 4YSXA 3FB2A 2B76A 4DR3T 2CXDA 2A72A 4JI3T 5FVLA 2CPTA 4QX8B 3VR8A 3ZJ1A 4DUYT 2IW5B 3IHRA 4FI5A 4LMKA 4C90A 1B7TA 3UUNA 4LMJA 4KI0F 5LBMA 2GK9A 2W00A 4U33A 3AA0B 2I0MA 4QX7B 2FJDA 1E2AA 3AE1A 4ZHQE 3ZJ2A 5ETWA 1HNXT 2X9HA 2IUBA 2ZM8A 2NW8A 2BBJA 3HKBE 4X66T 3ZEFB 1HX8A 2LRLA 1T72A 4I0UA 3P50A 5IWAT 2L9QA 4GYRA 5JREA 2R6GF 3QNUA 4ILCA 3ZC0A 4DMWA 2Y8DA 4TZ4C 4YTPA 3E08A 2XZEA 4X65T 3ZMVB 3RYFE 4JV5T 4O8SA 5JR9B 1YQ3A 5L3DB 2G0UA 4HWFA 3EDUA 2L3LA 5L3FB 4HFBA 2I59A 4O2AE 3I1AA 2W62A 3ZMUB 4MHCA 2LSGA 3ZYKA 4OYKA 4KHPT 2YDSA 2X0YA 3IF8B 2E9XA 4F6RC 4QWNB 3KV6A 5LHHB 4HN9A 2IMLA 3QUJA 3AE8A 3O1JA 2BG9B 4DVDA 2X9XA 3OTOT 4I55E 2LSYA 3FZHB 3CK6A 3Q9DA 4ISTA 1JNZA 4A56A 2V5DA 3QB5K 3AXJB 3QOFA 4DUZT 4YTMA 3CKDA 5LMUT 3KVBA 5F8PA 5HEJA 4TNWA 4JI0T 5J1GA 2J4GA 2CHNA 4C91A 3OKQA 4LF8T 2LLYA 3RQWA 5HYAA 2H88A 2EHOB 1UGOA 2XQ3A 2C0SA 2XQ7A 4YFSA 4BAYB 2AXDS 1IJ6A 1XMOT 3OPCA 1D1BA 5JDNA 1VCTA 2DL1A 3LDQB 4ZXLA 4L5GA 2NW9A 3ZSTA 3N9LA 3PUXF 3ANWA 5AQKB 3UULA 3ONLC 5AQSB 3IA3A 2KNDA 2QA7A 4ZI7E 2WY2A 1VRBA 3E0ZA 2XQ6A 3B57A 5AQGB 3J9X1 2H7VC 2VKOA 2LOPA 3C4XA 1FJGT 1S35A 3Q5EA 5IUXA 4H63H 2D0TA 4TNVA 4DR1T 4AKGA 2M6IA 1NENA 3EHZA 5LGTB 4F8HA 2XAHB 3OVUA 2WAUA 5HXHA 3H3AA 4DR4T 4L9IA 1T98A 4XAXB 3RKOA 3BQLA 3M3ZB 4ZOLE 2PBIA 3JADA 3LG7A 2WP9A 2HPJA 4ANJA 1ZV4X 4KBMB 3LFMA 3FZKB 3O1IA 4YJ2E 1WR6A 4DR6T 2W2UA 3AA7B 5HXSA 4DV0T 5CB4E
chains in the Genus database with same CATH topology
1EZ3A 3CX7B 5JDLA 3M65A 3JC6D 4GOUA 5LG4A 3F57A 4KUMB 4PK6A 2KXPB 4ZI3D 3ESLA 4HKAA 4I43B 2SPCA 5LJMA 5ADXL 2W63A 4EB6E 1SHZC 4PJJA 2ODVA 3A5XA 2KMFA 3N9OA 1G73A 4NUUA 2RP4A 2E8IA 4IGUA 3N2KE 5KX5E 1WYBA 4OYJA 1UX4A 3AAIA 3ZN1B 4EAHA 2JJ9A 1U5PA 4WBOA 1V9DA 3ZLIA 4O4JE 3P7IA 3CX8B 5LHIB 2YU2A 3T8OA 2LSIA 3OBVE 2JRKA 3UT5E 3EVYA 4P0AA 1H7CA 2VB6A 4PJNA 3JC6C 4KP3C 3V5UA 4PK4A 1UCUA 4ZS3A 4DNDA 1WYCA 1X79A 3ETVA 3K3OA 4AKIA 1FEWA 4DMVA 4L0RA 4PK5A 3Q5WA 5JRCA 3I9WA 3R84B 2DI4A 4QHOA 3ZCIA 1CUNA 3KV9A 3O1HA 1IJ5A 3VU7H 2LE8A 3ZMTB 3NRYA 2CLYC 2HPLA 4MFRA 4TUYE 3AB3B 4H9NC 2E9XD 4EXTA 3N5LA 3PURA 3V5SA 4K0UA 2VASA 3S4UA 5LCYA 3C4WA 4CXWA 3Q5XA 4CI2B 2K48A 3UUXB 2A3DA 3PUSA 4TN7B 2MOZA 2VKDA 2JMKA 2XTLA 4EZHA 2LJLA 5TAOA 5F3JA 5HXRA 2NTXA 5FP3A 3RYCE 5JR9C 1MIYA 1ZKEA 4X1IE 2WSSV 3GMIA 5FXXA 2LT3A 2K9AA 3F31A 4HEAA 3KV4A 5FXVA 4EYUA 3NBXX 3UFEA 3PU8A 3RH3A 4JEHB 4DBRA 3PU3A 2E9XC 4M1PA 1LVKA 3CVRA 4DO0A 4AKHA 4HFVA 3B13A 3FHNA 2J1DG 3ETUA 5L3EB 4JLEA 2KT9A 3F2EA 4N78D 4BJMA 3WAKA 4XBFB 2KWHA 2DCFA 4GIWA 4IE7A 1ZHCA 2WM9A 2PG8A 3AVSA 2X67A 3QC9A 5C8YE 4GK0E 5FMNA 1D0YA 4IE5A 2CE7A 2DHRA 4ISSA 3KV5A 2V1DB 1MMDA 3WI3A 3UTKA 5LNKA 5EZYE 2IAKA 3O4XE 4AXPA 1HS7A 5E0OA 2RA1A 3N2OA 4UEMA 4GK5E 3BQIA 3CQXC 4MLKA 3L3PA 4AKRB 4MALA 2XAQB 3NZQA 3PE0A 3PDYA 1MNDA 2PFVA 3HL6A 4PFOA 1QSDA 4CI1B 3W15B 3MZKB 3ZN0B 5FYMA 4PJLA 4IIJE 1HFAA 5JDGA 3LJCA 1HF8A 5FY0A 3BQKA 1NAFA 2Y48B 2BVLA 2L8KA 5HWXA 5FY1A 3HA4A 4KMCA 4E7ZA 2ACXA 4ERRA 2QGSA 4TV9E 5DABA 5EK2A 4QKNA 4IE4A 1HTJF 2N1GA 2VK9A 4IE6A 2DNXA 4HE8A 4PAGA 4UXNB 3ZMSB 3FXEB 4HTEA 1ZEEA 1BR1A 2NWBA 2Q9QC 1O3XA 2ZM2A 3ZCJA 5LYJE 2XAJB 3MK7C 3CQGB 3VHLA 4O2BE 3PUQA 3LBXB 2M67A 2C5JA 4PFPA 4WW0A 1BR0A 1KK7A 3FB2A 2CMRA 2Z6EA 3RRWA 3SS1A 3C51A 5KMGP 2CXDA 5LP6E 4U74A 2ZM0A 1MIWA 1MMAA 3AAEB 3MACA 5L2LA 2A72A 2LSKA 4H9QC 2NW7A 4CXYA 2MTQA 3P8CD 3LBXA 4AQFA 4QX8B 2WWUA 2ZLYA 2MBGA 2LSJA 4UV8B 3O9XA 3ZJ1A 3RPUA 5JDMA 4PW8A 4X20E 4E7SA 2IW5B 3LK42 2EHOC 1HG5A 4UELA 2WBLA 2JPFA 1VOMA 3ZPOA 3IHRA 4FI5A 4IHJE 4XZCA 3DJBA 4C90A 4EIWA 1LVFA 5JRCB 1B7TA 3UUNA 2D0UA 2IC6A 3K3QC 4G63A 3MXZA 5H6QB 5LBMA 5FY7A 2GK9A 2W00A 3AA0B 2X68A 1YW0A 4QX7B 3N9PA 4ASKA 1YD8G 2JQQA 4BA9A 4G2AA 1BR2A 5CA0E 1D1AA 5JQGE 4ZHQE 3N9QA 1MMGA 1D0ZA 1US7B 3ZJ2A 5ETWA 3RC8A 1S94A 5HAXA 3AA6B 3U78A 2CEAA 3HKCE 2YINA 2X9HA 4CXXA 2KZ7B 4AI6A 5JDHA 3C98B 3RYHE 4CZZB 4OK0A 2ZM8A 2NW8A 3HKBE 2X0LB 5CA1E 5L3CB 3ZEFB 1HX8A 2VKJA 4X1YE 5EK4A 2H7OA 4HGAA 3FXDB 1YKHB 3R6NA 1FIOA 1D1CA 3UUMA 4Z8XA 2OA5A 3CX6B 2K24A 5L3GB 4IDZA 1SA0E 1Y64B 2ODUA 3FBLA 1Z0PA 2L9QA 4GYRA 5JREA 3CPZA 3AVRA 4JUYA 5EK3A 2ES0A 3ZC0A 4UIGA 5FNVE 4DMWA 2CLYB 2CWYA 2Y8DA 4TZ4C 4AKLA 3N9MA 4H63V 3E08A 1OXZA 4B6XA 4GYSA 2LHNA 3PUAA 3ZMVB 3EUHA 3RYFE 4CQIA 4O4IE 5LGUB 4ZI2D 5IYZE 2CA5A 4O8SA 2Q9QD 5JR9B 5L3DB 1NWMX 5DQWA 3PTRB 4MBQA 2G0UA 2C5IT 2DWKA 3EDUA 3HKDE 2JMHA 1IAPA 3KINB 3QK6A 1OWAA 2BVMA 1IZNB 2UXXB 2L3LA 2XAGB 5IHYA 5L3FB 1D0XA 1BR4A 4UF0B 2I59A 4U72A 4O2AE 5JH7E 3BK9A 3I1AA 2VL8A 2V7KA 4OHFA 2W62A 2E9XB 5DQVA 5JR9A 2W0GA 3I0OA 3ZMUB 2CXFA 2KWIB 2XQYA 3NRXA 4MHCA 4QXCB 2LSGA 2CM0A 2V7MA 3ZMZB 3LK2B 4OYKA 3ZYKA 3ZYLA 5J2UE 4ZI2C 1WLXA 3MKDA 4UF0A 2V7IA 2EHOD 3C4ZA 3IF8B 2IC9A 4H9PC 2E9XA 4P09A 4OFZA 4F6RC 3KFWX 1MIVA 2VKHA 4QWNB 3KV6A 5LHHB 4HN9A 2HH7A 4WBNE 3ZC1A 3OJAA 2XUEA 4X1KE 3OYZA 1AJ3A 3I0QA 3O1JA 3I9YA 3QUJA 3ONXA 4EOZB 1HCIA 3CMLA 3H37A 4NUVA 4CI3B 1LRZA 2ZMAA 2X9XA 4DVDA 2BZBA 3GA8A 2X66A 3SWHA 2B1EA 2K5BB 4PJMA 4DBQA 2DWGA 2XASB 2N9DA 3VKGA 2LHRA 3OYXA 4UVAB 4I55E 2LSYA 4V1Av 2LOSA 3Q9DA 2D5UA 4ISTA 4ADZA 4TV8E 4A56A 2Q9QB 3FBZA 3MA9A 4AQGA 5M4YA 2C5KT 3C64A 3AA1B 3AAAB 2V26A 1MNEA 2NOXA 2D2SA 3CKDA 3KVBA 5F8PA 2X9YA 1YKEB 4JEUB 1WRDA 2Q9QA 2N2NA 5J1GA 4QXBB 2X51A 4QXHB 3RYIE 4C91A 3OKQA 5HYAA 2LM9A 5H6RB 3VKHA 2EHOB 5JDQA 3RRCA 4ZI3C 4UVCB 2V7JA 3SRZA 5BMVE 1E1HB 3KVAA 3K3NA 4YLHA 5FXWA 1HG2A 2C0SA 3N9NA 2WMNA 5HXCA 5LHGB 5LBQB 3DP7A 4I4TE 3KBUA 4IE0A 3E22E 2NP9A 4H9OC 1LKXA 2EHOA 4YFSA 4BAYB 3ZYMA 2KINB 1IJ6A 3ANWB 3HR0A 1D1BA 4YJ3E 5JDNA 3WAJA 2CCQA 3NZPA 5LGNB 2CWOA 4L5GA 2NW9A 5GONE 4YHJA 5LA6E 3N9LA 4O4HE 2H3RA 3RX6A 2V7LA 2W61A 3Q2MA 2VWAA 3ANWA 5HWYA 3UULA 2WMOA 3U3IA 3N2GE 2LEHA 2A2FX 2KLQA 2KNDA 2YK0A 4I50E 2NTYA 4TX5A 3GWHA 2P9BA 2Y6XA 2QA7A 4ZI7E 3IBPA 5FXZA 1VRBA 3E0ZA 1KNZA 3KDSE 5JDFA 3B57A 4O4LE 5AFUL 3EDVA 1MMNA 2DLRA 3J9X1 4P0BA 2H7VC 2VKOA 2LOPA 4UV9B 3C4XA 3GN5B 5LJNA 3D0TA 5J2TE 2PJQA 4AQFC 3SOLA 4EZ4A 1S35A 3RC3A 2YU1A 3KBTA 5LOVE 5KDMC 3PUGA 3HI2A 4H63H 2D0TA 4H9SE 3HKEE 5DJQC 1U4QA 3MJXA 5JVDE 4UVBB 4AKGA 5HXEA 4WNKA 4BJNA 3TKLB 2X9WA 2YEVC 2BDEA 3GN5A 3K8PC 2MYSA 5LGTB 5LXTE 4PNIA 2XAHB 4FJOA 3J7Yq 4J2CA 3IEEA 2UXNB 2WAUA 3LK3B 3CWZB 5HXHA 3H3AA 1FMWA 4L9IA 4ZS2A 4ILUA 1T98A 2XAFB 4XAXB 3RKOA 1FMVA 3BQLA 2CXLA 4EYYR 4ZOLE 2PBIA 3LG7A 2HPJA 3DTOA 4ANJA 1ZV4X 3CQCB 4KBMB 3LFMA 3O1IA 5L3BB 3L09A 4H9RC 1QUUA 4YJ2E 1UX5A 1WR6A 3C50A 1G8XA 3AA7B 5A1LA 5HXSA 5CB4E 2XHEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ILU A;  2LT3 A;  4KBM B;  4MFR A;  4XAX B;  4L5G A;  4KMC A; 
#chains in the Genus database with same CATH topology
 1EZ3 A;  3CX7 B;  1VCS A;  2UXC T;  4KUM B;  2KXP B;  3RKG A;  4DV1 T;  5LJM A;  4EB6 E;  4PJJ A;  3A5X A;  3N9O A;  1G73 A;  5KX5 E;  2X0H A;  3FZF B;  2JJ9 A;  1V9D A;  3P7I A;  1IBL T;  1WFD A;  2JRK A;  2VB6 A;  4KP3 C;  4OX9 T;  3V5U A;  4PK4 A;  1UCU A;  4DMV A;  4L0R A;  4PK5 A;  3Q5W A;  4HWH A;  3ZCI A;  3R84 B;  3O1H A;  1IJ5 A;  2XSA A;  4EXT A;  3NRY A;  3QB5 A;  3N5L A;  3PUR A;  3S4U A;  2IIU A;  2JQK A;  3PUS A;  2ZM6 T;  4DR7 T;  2LJL A;  5TAO A;  5HXR A;  3GMI A;  3F31 A;  4CN6 A;  5FXV A;  4EYU A;  3UFE A;  3RH3 A;  2E9X C;  3PUZ F;  5JTG A;  4GKK T;  3TLS A;  2J1D G;  3AEA A;  4N78 D;  3F2E A;  4BJM A;  4XBF B;  1W9R A;  2DCF A;  4GIW A;  1J1J A;  3UQ7 A;  2V6X A;  2CE7 A;  5E0O A;  4UEM A;  3BQI A;  4AKR B;  4MAL A;  3RIU A;  3PDY A;  2PFV A;  5FYM A;  1HF8 A;  3K1S A;  5L4E A;  5FY1 A;  5DAB A;  1XNQ T;  4IE4 A;  2LKG A;  1HTJ F;  2VK9 A;  2LM2 A;  4HE8 A;  4UXN B;  3ZMS B;  3FXE B;  3ZCJ A;  5LYJ E;  2XAJ B;  4PFP A;  1BR0 A;  2CMR A;  3SS1 A;  3C51 A;  5KMG P;  2YOE A;  3AE5 A;  4U74 A;  2ZM0 A;  2LSK A;  2MTQ A;  4AQF A;  3LSV A;  2LSJ A;  2WDQ A;  3LK4 2;  4UEL A;  2WBL A;  4XZC A;  3UU5 A;  3T1H T;  2M6B A;  2IC6 A;  4G63 A;  3MXZ A;  5FY7 A;  3A7M A;  4G2A A;  1BR2 A;  5CA0 E;  4IDO A;  3N9Q A;  2YDR A;  2XQ4 A;  1HX1 B;  5HAX A;  5CGM A;  2YIN A;  2KZ7 B;  4AI6 A;  3RYH E;  4CZZ B;  4OK0 A;  3RI5 A;  2VKJ A;  4X1Y E;  4ZZC A;  2FJE A;  4YSY A;  3FXD B;  1YKH B;  3UUM A;  2HN2 A;  3CX6 B;  1T7S A;  4IDZ A;  1SA0 E;  1Y64 B;  5J0Z A;  1Z0P A;  4JUY A;  4YTN A;  5FNV E;  2CLY B;  3RIA A;  1OXZ A;  4B6X A;  4O4I E;  5IYZ E;  1DU2 A;  2I6H A;  1HNW T;  4A5X A;  3PTR B;  2DWK A;  4HFC A;  2JMH A;  2XAG B;  5IHY A;  1BR4 A;  4UF0 B;  4U72 A;  5JH7 E;  2XPK A;  5JR9 A;  2W0G A;  2V5C A;  3P4W A;  2CXF A;  1WCR A;  1KNR A;  2V7M A;  3ZYL A;  4ZI2 C;  1UK5 A;  3MKD A;  2V7I A;  2EHO D;  2KSR A;  3AEF A;  2IC9 A;  4H9P C;  5AQL B;  1NEK A;  5HEH A;  1XMQ T;  2HH7 A;  3TLU A;  3TLT A;  4X1K E;  1AJ3 A;  3ONX A;  4JBW F;  4NUV A;  1LRZ A;  4PJM A;  3AE4 A;  2XAS B;  2LHR A;  4V1A v;  2BG9 A;  2D5U A;  4HFH A;  4TV8 E;  3PUY F;  2Q9Q B;  2WWV A;  4AQG A;  4NIQ A;  2C5K T;  2A9U A;  3AA1 B;  2V26 A;  1MNE A;  2IDO B;  2D2S A;  2X9Y A;  1WRD A;  3AXJ A;  2X51 A;  3G06 A;  4X62 T;  1E7P A;  1GQE A;  5JDQ A;  5FVK A;  5AQP B;  4UVC B;  3SRZ A;  5L4H A;  4COF A;  1Y01 A;  5AQR B;  1E1H B;  3ZT7 A;  3KVA A;  4YLH A;  3N9N A;  2V6Y B;  2WMN A;  4I4T E;  3KBU A;  4LFB T;  3RIU C;  2EHO A;  3WAJ A;  2CCQ A;  2CWO A;  4JI6 T;  3AE9 A;  4YHJ A;  5LA6 E;  4O4H E;  2H3R A;  2V7L A;  4LF7 T;  5HWY A;  2WMO A;  2LEH A;  2A2F X;  2YK0 A;  2UUB T;  3GWH A;  2P9B A;  3IBP A;  5FXZ A;  4UR9 A;  3KDS E;  5JDF A;  4O4L E;  3O9X A;  4UV9 B;  3GN5 B;  5J2T E;  4AQF C;  1XDO A;  2WDR A;  3NVO A;  5LOV E;  3HI2 A;  5DJQ C;  5JVD E;  2UUA T;  3EAM A;  1J5W A;  4BJN A;  2YEV C;  1KFY A;  2CBJ A;  2MYS A;  5LXT E;  4PNI A;  3J7Y q;  2WZH A;  3RGL A;  2UXN B;  3L8R A;  3LK3 B;  3CWZ B;  4CN4 A;  4EYY R;  3DTO A;  1OED E;  4LF9 T;  5L3B B;  2BBH A;  3L09 A;  1W0A A;  4HWC A;  5A1L A;  5JDL A;  5LG4 A;  3F57 A;  3RQU A;  4ZI3 D;  3RHW A;  3ESL A;  4HKA A;  4LML A;  5ADX L;  2XJ7 A;  1M62 A;  3N2K E;  3UU8 A;  4O4J E;  2UXB T;  2YU2 A;  3T8O A;  3UT5 E;  3JC6 C;  2BKN A;  2VUR A;  4B3T T;  4DV3 T;  4YY3 T;  1W0B A;  4ZS3 A;  4DR2 T;  4DND A;  2WU5 A;  1FEW A;  4AIS A;  5JRC A;  4QHO A;  2HPL A;  3AB3 B;  3V5S A;  5LCY A;  3ZT6 A;  3C4W A;  4CXW A;  2A3D A;  2VKD A;  4KHZ F;  5JR9 C;  5FKY A;  1MIY A;  2LT3 A;  2K9A A;  4HEA A;  3P4P A;  3AE3 A;  4DBR A;  3PU3 A;  1LVK A;  3CVR A;  1HR0 T;  3FHN A;  3ETU A;  4JLE A;  2KWH A;  2PG8 A;  3AVS A;  2BS3 A;  2X67 A;  4A97 A;  3AE2 A;  1J5E T;  5FMN A;  3SFE A;  2DHR A;  1R8I A;  3A8Y C;  3KV5 A;  3UU6 A;  5EZY E;  1HS7 A;  4GK5 E;  3CQX C;  4MLK A;  4CN1 A;  3NZQ A;  3PE0 A;  1MND A;  4QH1 A;  1QSD A;  4CI1 B;  1M7K A;  2BG9 C;  2WDV A;  4IIJ E;  1HFA A;  5JDG A;  2Y48 B;  2BVL A;  3HA4 A;  2J47 A;  2VL0 A;  4QKN A;  2N1G A;  3AEG A;  2ZM2 A;  3CQG B;  3LBX B;  4WW0 A;  2Z6E A;  3H3M A;  3RRW A;  4EEB A;  2XM1 A;  1MIW A;  1MMA A;  3AAE B;  1IBK T;  2YKS A;  3MAC A;  2NW7 A;  3P8C D;  5CFB A;  3RPU A;  5JDM A;  5KXJ A;  4PW8 A;  4E7S A;  2EHO C;  3ZSS A;  2JPF A;  4IHJ E;  3DJB A;  5JRC B;  2D0U A;  3VRB A;  4B3S T;  2W66 A;  5BR8 T;  4Z91 A;  4JI8 T;  2X68 A;  1YW0 A;  3N9P A;  4ASK A;  1YD8 G;  4BA9 A;  1D1A A;  5JQG E;  1D0Z A;  2XQ5 A;  4EGW A;  1X9B A;  3AA6 B;  3U78 A;  2CEA A;  3HKC E;  1OED B;  1L0V A;  2X0L B;  5CA1 E;  5EK4 A;  4HGA A;  3R6N A;  5ABF A;  3JAF A;  1FIO A;  3JAE A;  1D1C A;  2OA5 A;  2FJB A;  5L3G B;  5L47 A;  4UIG A;  3EAB A;  3N9M A;  1CHU A;  2LHN A;  3PUA A;  3EUH A;  4CQI A;  2CA5 A;  2Q9Q D;  1NWM X;  5DQW A;  2C5I T;  1I94 T;  3HKD E;  3L39 A;  2BVM A;  1IZN B;  2UXX B;  1D0X A;  3BK9 A;  4Z90 A;  1UUS A;  2VL8 A;  2V7K A;  2E5V A;  5DQV A;  3I0O A;  2XQY A;  3NRX A;  2UU9 T;  3ZMZ B;  3LK2 B;  5J2U E;  1KNP A;  1WLX A;  4UF0 A;  4P09 A;  2QYW A;  1MIV A;  2VKH A;  1WR0 A;  1IBM T;  4WBN E;  5AQH B;  3OJA A;  2XUE A;  1HCI A;  2WU2 A;  3CML A;  3H37 A;  4CI3 B;  2ZMA A;  5AQU B;  3SWH A;  5LB7 B;  4DBQ A;  2DWG A;  2N9D A;  3VKG A;  4X64 T;  5LMN T;  4YSZ A;  2XY8 B;  3FBZ A;  5M4Y A;  4ILA A;  4A98 A;  4B3M T;  4IRE A;  4JEU B;  2Q9Q A;  2N2N A;  2D9D A;  4JI2 T;  4QXH B;  5ABF B;  3RYI E;  4K0K T;  1XDP A;  3VRA A;  2LM9 A;  5H6R B;  1KEY A;  3VKH A;  4ZI3 C;  3AE7 A;  5BMV E;  1YQ4 A;  2LKH A;  5HXC A;  3K3N A;  5FXW A;  5LHG B;  4IE0 A;  2NP9 A;  1LKX A;  2H89 A;  2BKO A;  4NXN T;  3NZP A;  2E5L T;  5LGN B;  2V6Y A;  5GON E;  2W61 A;  3U3I A;  3N2G E;  3SFD A;  2KLQ A;  4I50 E;  4TX5 A;  2Y6X A;  1XWM A;  2HN1 A;  5AFU L;  1MMN A;  4P0B A;  3D0T A;  2PJQ A;  3SOL A;  4EZ4 A;  4LF5 T;  3RLF F;  3KBT A;  3RF1 A;  5KDM C;  2VQF T;  4H9S E;  3HKE E;  4EED A;  4TWH A;  5HXE A;  3TKL B;  3GN5 A;  2XSB A;  1W09 A;  2W67 A;  4WYV A;  4FJO A;  2FJA A;  3IEE A;  2XQ8 A;  2WS3 A;  4ZS2 A;  3ONJ A;  4Q25 A;  5HCJ A;  3CQC B;  5HEG A;  2V8S V;  4H9R C;  1QUU A;  3C50 A;  5AQV B;  4JI5 T;  4GOU A;  4PK6 A;  1SHZ C;  2KMF A;  4NUU A;  1T8B A;  2E8I A;  2J62 A;  1WYB A;  4OYJ A;  3AAI A;  3ZN1 B;  4WBO A;  3ZLI A;  2HHH T;  3ABV A;  5CJ5 A;  3AEC A;  3OBV E;  5AQT B;  4WZX A;  4P0A A;  1X79 A;  2CRB A;  3ETV A;  4AKI A;  3I9W A;  1CUN A;  3KV9 A;  5C3J A;  4MFR A;  2CLY C;  4H9N C;  2E9X D;  4K0U A;  2VAS A;  2F4V T;  3T1Y T;  3Q5X A;  2K48 A;  1YXR A;  4IDQ A;  2JMK A;  4EV6 A;  4EZH A;  5FP3 A;  4X1I E;  5FXX A;  2WB5 A;  4QH5 A;  3AEB A;  3TLW A;  4HFV A;  3B13 A;  4JI4 T;  5AQI B;  2KT9 A;  4IE7 A;  1ZHC A;  2UXD T;  3QC9 A;  4GK0 E;  3ZKR A;  2OV9 A;  4HFI A;  2BS2 A;  4YXD A;  4IL4 A;  4ISS A;  4LFC T;  2V1D B;  1MMD A;  3WI3 A;  3UTK A;  5LNK A;  3O4X E;  4AXP A;  4YHH T;  1XNR T;  1SE7 A;  2VVN A;  3PJA J;  2XAQ B;  3HL6 A;  4PFO A;  4DV5 T;  4LF6 T;  4PJL A;  3NWI A;  3B5M A;  5ABH A;  5HWX A;  4KMC A;  4E7Z A;  2ACX A;  4TV9 E;  5EK2 A;  2CHO A;  4IE6 A;  4HTE A;  1ZEE A;  1BR1 A;  2Q9Q C;  3MK7 C;  3PUQ A;  3AED A;  2M67 A;  4DV4 T;  1ZP0 A;  4JI7 T;  1KK7 A;  4TWF A;  5LP6 E;  5L2L A;  5FL1 A;  4H9Q C;  4CXY A;  3LBX A;  2WWU A;  2UUC T;  2ZLY A;  2MBG A;  4UV8 B;  4X20 E;  1HG5 A;  1VOM A;  3ZPO A;  1N32 T;  1N33 T;  4EIW A;  1LVF A;  4DV7 T;  3K3Q C;  2OLT A;  4U2Z A;  5H6Q B;  3Q5D A;  2WCA A;  3TLV A;  2JQQ A;  2JIW A;  4B3R T;  1MMG A;  1US7 B;  4QH4 A;  3RC8 A;  1S94 A;  4CXX A;  5JDH A;  3C98 B;  5L3C B;  4IL9 A;  1N36 T;  2H7O A;  4DID B;  5LG3 A;  3CIR A;  1OED A;  2QRX A;  4Z8X A;  4U2Y A;  5ABE A;  2K24 A;  2ODU A;  3FBL A;  4AIU A;  3CPZ A;  3AVR A;  5EK3 A;  2ES0 A;  2CWY A;  4HFE A;  5AQF B;  2YDQ A;  4AKL A;  4H63 V;  5ABG A;  4GYS A;  4IDN A;  5LGU B;  4ZI2 D;  5F5W A;  2XM2 A;  4MBQ A;  1IAP A;  3KIN B;  3QK6 A;  1OWA A;  3PV0 F;  4OHF A;  2E9X B;  4IDP A;  2KWI B;  4QXC B;  2CM0 A;  2WQY A;  3C4Z A;  3P4Q A;  4OFZ A;  3KFW X;  2CBI A;  3ZC1 A;  3OYZ A;  3I0Q A;  3I9Y A;  4P1N A;  4EOZ B;  4U3C A;  2BZB A;  4ZZB A;  3GA8 A;  2X66 A;  3EI0 A;  2B1E A;  2K5B B;  2XQA A;  3OYX A;  4UVA B;  2LOS A;  4ADZ A;  2IHR 1;  4DV2 T;  5HEO A;  3MA9 A;  2LRK A;  5HCM A;  4AQY T;  3P4S A;  5AQJ B;  3C64 A;  2VQE T;  5FL0 A;  3AAA B;  2NOX A;  1YKE B;  3X1D A;  4QXB B;  3PUW F;  3PUV F;  5AQM B;  3RRC A;  2V7J A;  2E2A A;  4U31 A;  1HG2 A;  3JCF A;  1ZOY A;  5LBQ B;  3DP7 A;  1JNR A;  3E22 E;  4H9O C;  2BS4 A;  3ZYM A;  2KIN B;  3ANW B;  3HR0 A;  4YJ3 E;  3UUB A;  2RPA A;  4HWD A;  4U7Y A;  1HNZ T;  5HEU A;  3RX6 A;  3Q2M A;  2VWA A;  2XQ9 A;  2W4X A;  2NR4 A;  2AE9 A;  2FUP A;  2NTY A;  3AEE A;  1KNZ A;  2WZI A;  4KX6 A;  3EDV A;  2DLR A;  4DV6 T;  5LJN A;  3RC3 A;  2YU1 A;  3PUG A;  1U4Q A;  3MJX A;  4UVB B;  4WNK A;  2X9W A;  4ZEY A;  2BDE A;  3K8P C;  3VR9 A;  2JQH A;  4J2C A;  4U7I A;  2PTF A;  4X5T A;  1FMW A;  1XZY A;  4ILU A;  2XAF B;  1FMV A;  4LF4 T;  2CXL A;  1SUM B;  4JYA T;  4HFD A;  3NKZ A;  1UUR A;  1UX5 A;  1G8X A;  3P4R A;  2MAW A;  1N34 T;  2XHE B;  5C2T A;  3M65 A;  3JC6 D;  3UFG A;  4HWI B;  4I43 B;  2SPC A;  2W63 A;  4NXM T;  1QLB A;  1OED C;  2ODV A;  2RP4 A;  4LFA T;  4IGU A;  1UX4 A;  4EAH A;  2FBW A;  1U5P A;  4TWD A;  5AQO B;  3CX8 B;  5LHI B;  2LSI A;  2VVS A;  3EVY A;  1H7C A;  4PJN A;  2BKP A;  1WYC A;  3FZM B;  3K3O A;  3UU4 A;  2DI4 A;  3VU7 H;  3ZMT B;  2LE8 A;  4TUY E;  4CI2 B;  3UUX B;  4TN7 B;  2MOZ A;  2XTL A;  5AQN B;  3FZL B;  5F3J A;  2NTX A;  3RYC E;  1ZKE A;  2WSS V;  3KV4 A;  4NPP A;  2MPK A;  3NBX X;  2YN6 A;  3PU8 A;  2QVA A;  3ZT5 A;  4JEH B;  2K3W A;  4M1P A;  4DO0 A;  4AKH A;  5L3E B;  3WAK A;  2BG9 E;  2WM9 A;  5C8Y E;  3UU3 A;  2JQ9 A;  1D0Y A;  4IE5 A;  5AQQ B;  2IAK A;  2RA1 A;  3N2O A;  4GKJ T;  3AE6 A;  3L3P A;  4YT0 A;  1I6Z A;  3W15 B;  3MZK B;  3ZN0 B;  3LJC A;  5FY0 A;  3BQK A;  1NAF A;  2L8K A;  3PJA A;  4ERR A;  4ILB A;  2QGS A;  4IT4 A;  2ACZ A;  3RIF A;  4PAG A;  2DNX A;  3UQ4 A;  1KF6 A;  2NWB A;  1Z8U A;  1O3X A;  4DR5 T;  4JI1 T;  3VHL A;  4O2B E;  2C5J A;  4YSX A;  3FB2 A;  2B76 A;  4DR3 T;  2CXD A;  2A72 A;  4JI3 T;  5FVL A;  2CPT A;  4QX8 B;  3VR8 A;  3ZJ1 A;  4DUY T;  2IW5 B;  3IHR A;  4FI5 A;  4LMK A;  4C90 A;  1B7T A;  3UUN A;  4LMJ A;  4KI0 F;  5LBM A;  2GK9 A;  2W00 A;  4U33 A;  3AA0 B;  2I0M A;  4QX7 B;  2FJD A;  1E2A A;  3AE1 A;  4ZHQ E;  3ZJ2 A;  5ETW A;  1HNX T;  2X9H A;  2IUB A;  2ZM8 A;  2NW8 A;  2BBJ A;  3HKB E;  4X66 T;  3ZEF B;  1HX8 A;  2LRL A;  1T72 A;  4I0U A;  3P50 A;  5IWA T;  2L9Q A;  4GYR A;  5JRE A;  2R6G F;  3QNU A;  4ILC A;  3ZC0 A;  4DMW A;  2Y8D A;  4TZ4 C;  4YTP A;  3E08 A;  2XZE A;  4X65 T;  3ZMV B;  3RYF E;  4JV5 T;  4O8S A;  5JR9 B;  1YQ3 A;  5L3D B;  2G0U A;  4HWF A;  3EDU A;  2L3L A;  5L3F B;  4HFB A;  2I59 A;  4O2A E;  3I1A A;  2W62 A;  3ZMU B;  4MHC A;  2LSG A;  3ZYK A;  4OYK A;  4KHP T;  2YDS A;  2X0Y A;  3IF8 B;  2E9X A;  4F6R C;  4QWN B;  3KV6 A;  5LHH B;  4HN9 A;  2IML A;  3QUJ A;  3AE8 A;  3O1J A;  2BG9 B;  4DVD A;  2X9X A;  3OTO T;  4I55 E;  2LSY A;  3FZH B;  3CK6 A;  3Q9D A;  4IST A;  1JNZ A;  4A56 A;  2V5D A;  3QB5 K;  3AXJ B;  3QOF A;  4DUZ T;  4YTM A;  3CKD A;  5LMU T;  3KVB A;  5F8P A;  5HEJ A;  4TNW A;  4JI0 T;  5J1G A;  2J4G A;  2CHN A;  4C91 A;  3OKQ A;  4LF8 T;  2LLY A;  3RQW A;  5HYA A;  2H88 A;  2EHO B;  1UGO A;  2XQ3 A;  2C0S A;  2XQ7 A;  4YFS A;  4BAY B;  2AXD S;  1IJ6 A;  1XMO T;  3OPC A;  1D1B A;  5JDN A;  1VCT A;  2DL1 A;  3LDQ B;  4ZXL A;  4L5G A;  2NW9 A;  3ZST A;  3N9L A;  3PUX F;  3ANW A;  5AQK B;  3UUL A;  3ONL C;  5AQS B;  3IA3 A;  2KND A;  2QA7 A;  4ZI7 E;  2WY2 A;  1VRB A;  3E0Z A;  2XQ6 A;  3B57 A;  5AQG B;  3J9X 1;  2H7V C;  2VKO A;  2LOP A;  3C4X A;  1FJG T;  1S35 A;  3Q5E A;  5IUX A;  4H63 H;  2D0T A;  4TNV A;  4DR1 T;  4AKG A;  2M6I A;  1NEN A;  3EHZ A;  5LGT B;  4F8H A;  2XAH B;  3OVU A;  2WAU A;  5HXH A;  3H3A A;  4DR4 T;  4L9I A;  1T98 A;  4XAX B;  3RKO A;  3BQL A;  3M3Z B;  4ZOL E;  2PBI A;  3JAD A;  3LG7 A;  2WP9 A;  2HPJ A;  4ANJ A;  1ZV4 X;  4KBM B;  3LFM A;  3FZK B;  3O1I A;  4YJ2 E;  1WR6 A;  4DR6 T;  2W2U A;  3AA7 B;  5HXS A;  4DV0 T;  5CB4 E; 
#chains in the Genus database with same CATH homology
 1EZ3 A;  3CX7 B;  5JDL A;  3M65 A;  3JC6 D;  4GOU A;  5LG4 A;  3F57 A;  4KUM B;  4PK6 A;  2KXP B;  4ZI3 D;  3ESL A;  4HKA A;  4I43 B;  2SPC A;  5LJM A;  5ADX L;  2W63 A;  4EB6 E;  1SHZ C;  4PJJ A;  2ODV A;  3A5X A;  2KMF A;  3N9O A;  1G73 A;  4NUU A;  2RP4 A;  2E8I A;  4IGU A;  3N2K E;  5KX5 E;  1WYB A;  4OYJ A;  1UX4 A;  3AAI A;  3ZN1 B;  4EAH A;  2JJ9 A;  1U5P A;  4WBO A;  1V9D A;  3ZLI A;  4O4J E;  3P7I A;  3CX8 B;  5LHI B;  2YU2 A;  3T8O A;  2LSI A;  3OBV E;  2JRK A;  3UT5 E;  3EVY A;  4P0A A;  1H7C A;  2VB6 A;  4PJN A;  3JC6 C;  4KP3 C;  3V5U A;  4PK4 A;  1UCU A;  4ZS3 A;  4DND A;  1WYC A;  1X79 A;  3ETV A;  3K3O A;  4AKI A;  1FEW A;  4DMV A;  4L0R A;  4PK5 A;  3Q5W A;  5JRC A;  3I9W A;  3R84 B;  2DI4 A;  4QHO A;  3ZCI A;  1CUN A;  3KV9 A;  3O1H A;  1IJ5 A;  3VU7 H;  2LE8 A;  3ZMT B;  3NRY A;  2CLY C;  2HPL A;  4MFR A;  4TUY E;  3AB3 B;  4H9N C;  2E9X D;  4EXT A;  3N5L A;  3PUR A;  3V5S A;  4K0U A;  2VAS A;  3S4U A;  5LCY A;  3C4W A;  4CXW A;  3Q5X A;  4CI2 B;  2K48 A;  3UUX B;  2A3D A;  3PUS A;  4TN7 B;  2MOZ A;  2VKD A;  2JMK A;  2XTL A;  4EZH A;  2LJL A;  5TAO A;  5F3J A;  5HXR A;  2NTX A;  5FP3 A;  3RYC E;  5JR9 C;  1MIY A;  1ZKE A;  4X1I E;  2WSS V;  3GMI A;  5FXX A;  2LT3 A;  2K9A A;  3F31 A;  4HEA A;  3KV4 A;  5FXV A;  4EYU A;  3NBX X;  3UFE A;  3PU8 A;  3RH3 A;  4JEH B;  4DBR A;  3PU3 A;  2E9X C;  4M1P A;  1LVK A;  3CVR A;  4DO0 A;  4AKH A;  4HFV A;  3B13 A;  3FHN A;  2J1D G;  3ETU A;  5L3E B;  4JLE A;  2KT9 A;  3F2E A;  4N78 D;  4BJM A;  3WAK A;  4XBF B;  2KWH A;  2DCF A;  4GIW A;  4IE7 A;  1ZHC A;  2WM9 A;  2PG8 A;  3AVS A;  2X67 A;  3QC9 A;  5C8Y E;  4GK0 E;  5FMN A;  1D0Y A;  4IE5 A;  2CE7 A;  2DHR A;  4ISS A;  3KV5 A;  2V1D B;  1MMD A;  3WI3 A;  3UTK A;  5LNK A;  5EZY E;  2IAK A;  3O4X E;  4AXP A;  1HS7 A;  5E0O A;  2RA1 A;  3N2O A;  4UEM A;  4GK5 E;  3BQI A;  3CQX C;  4MLK A;  3L3P A;  4AKR B;  4MAL A;  2XAQ B;  3NZQ A;  3PE0 A;  3PDY A;  1MND A;  2PFV A;  3HL6 A;  4PFO A;  1QSD A;  4CI1 B;  3W15 B;  3MZK B;  3ZN0 B;  5FYM A;  4PJL A;  4IIJ E;  1HFA A;  5JDG A;  3LJC A;  1HF8 A;  5FY0 A;  3BQK A;  1NAF A;  2Y48 B;  2BVL A;  2L8K A;  5HWX A;  5FY1 A;  3HA4 A;  4KMC A;  4E7Z A;  2ACX A;  4ERR A;  2QGS A;  4TV9 E;  5DAB A;  5EK2 A;  4QKN A;  4IE4 A;  1HTJ F;  2N1G A;  2VK9 A;  4IE6 A;  2DNX A;  4HE8 A;  4PAG A;  4UXN B;  3ZMS B;  3FXE B;  4HTE A;  1ZEE A;  1BR1 A;  2NWB A;  2Q9Q C;  1O3X A;  2ZM2 A;  3ZCJ A;  5LYJ E;  2XAJ B;  3MK7 C;  3CQG B;  3VHL A;  4O2B E;  3PUQ A;  3LBX B;  2M67 A;  2C5J A;  4PFP A;  4WW0 A;  1BR0 A;  1KK7 A;  3FB2 A;  2CMR A;  2Z6E A;  3RRW A;  3SS1 A;  3C51 A;  5KMG P;  2CXD A;  5LP6 E;  4U74 A;  2ZM0 A;  1MIW A;  1MMA A;  3AAE B;  3MAC A;  5L2L A;  2A72 A;  2LSK A;  4H9Q C;  2NW7 A;  4CXY A;  2MTQ A;  3P8C D;  3LBX A;  4AQF A;  4QX8 B;  2WWU A;  2ZLY A;  2MBG A;  2LSJ A;  4UV8 B;  3O9X A;  3ZJ1 A;  3RPU A;  5JDM A;  4PW8 A;  4X20 E;  4E7S A;  2IW5 B;  3LK4 2;  2EHO C;  1HG5 A;  4UEL A;  2WBL A;  2JPF A;  1VOM A;  3ZPO A;  3IHR A;  4FI5 A;  4IHJ E;  4XZC A;  3DJB A;  4C90 A;  4EIW A;  1LVF A;  5JRC B;  1B7T A;  3UUN A;  2D0U A;  2IC6 A;  3K3Q C;  4G63 A;  3MXZ A;  5H6Q B;  5LBM A;  5FY7 A;  2GK9 A;  2W00 A;  3AA0 B;  2X68 A;  1YW0 A;  4QX7 B;  3N9P A;  4ASK A;  1YD8 G;  2JQQ A;  4BA9 A;  4G2A A;  1BR2 A;  5CA0 E;  1D1A A;  5JQG E;  4ZHQ E;  3N9Q A;  1MMG A;  1D0Z A;  1US7 B;  3ZJ2 A;  5ETW A;  3RC8 A;  1S94 A;  5HAX A;  3AA6 B;  3U78 A;  2CEA A;  3HKC E;  2YIN A;  2X9H A;  4CXX A;  2KZ7 B;  4AI6 A;  5JDH A;  3C98 B;  3RYH E;  4CZZ B;  4OK0 A;  2ZM8 A;  2NW8 A;  3HKB E;  2X0L B;  5CA1 E;  5L3C B;  3ZEF B;  1HX8 A;  2VKJ A;  4X1Y E;  5EK4 A;  2H7O A;  4HGA A;  3FXD B;  1YKH B;  3R6N A;  1FIO A;  1D1C A;  3UUM A;  4Z8X A;  2OA5 A;  3CX6 B;  2K24 A;  5L3G B;  4IDZ A;  1SA0 E;  1Y64 B;  2ODU A;  3FBL A;  1Z0P A;  2L9Q A;  4GYR A;  5JRE A;  3CPZ A;  3AVR A;  4JUY A;  5EK3 A;  2ES0 A;  3ZC0 A;  4UIG A;  5FNV E;  4DMW A;  2CLY B;  2CWY A;  2Y8D A;  4TZ4 C;  4AKL A;  3N9M A;  4H63 V;  3E08 A;  1OXZ A;  4B6X A;  4GYS A;  2LHN A;  3PUA A;  3ZMV B;  3EUH A;  3RYF E;  4CQI A;  4O4I E;  5LGU B;  4ZI2 D;  5IYZ E;  2CA5 A;  4O8S A;  2Q9Q D;  5JR9 B;  5L3D B;  1NWM X;  5DQW A;  3PTR B;  4MBQ A;  2G0U A;  2C5I T;  2DWK A;  3EDU A;  3HKD E;  2JMH A;  1IAP A;  3KIN B;  3QK6 A;  1OWA A;  2BVM A;  1IZN B;  2UXX B;  2L3L A;  2XAG B;  5IHY A;  5L3F B;  1D0X A;  1BR4 A;  4UF0 B;  2I59 A;  4U72 A;  4O2A E;  5JH7 E;  3BK9 A;  3I1A A;  2VL8 A;  2V7K A;  4OHF A;  2W62 A;  2E9X B;  5DQV A;  5JR9 A;  2W0G A;  3I0O A;  3ZMU B;  2CXF A;  2KWI B;  2XQY A;  3NRX A;  4MHC A;  4QXC B;  2LSG A;  2CM0 A;  2V7M A;  3ZMZ B;  3LK2 B;  4OYK A;  3ZYK A;  3ZYL A;  5J2U E;  4ZI2 C;  1WLX A;  3MKD A;  4UF0 A;  2V7I A;  2EHO D;  3C4Z A;  3IF8 B;  2IC9 A;  4H9P C;  2E9X A;  4P09 A;  4OFZ A;  4F6R C;  3KFW X;  1MIV A;  2VKH A;  4QWN B;  3KV6 A;  5LHH B;  4HN9 A;  2HH7 A;  4WBN E;  3ZC1 A;  3OJA A;  2XUE A;  4X1K E;  3OYZ A;  1AJ3 A;  3I0Q A;  3O1J A;  3I9Y A;  3QUJ A;  3ONX A;  4EOZ B;  1HCI A;  3CML A;  3H37 A;  4NUV A;  4CI3 B;  1LRZ A;  2ZMA A;  2X9X A;  4DVD A;  2BZB A;  3GA8 A;  2X66 A;  3SWH A;  2B1E A;  2K5B B;  4PJM A;  4DBQ A;  2DWG A;  2XAS B;  2N9D A;  3VKG A;  2LHR A;  3OYX A;  4UVA B;  4I55 E;  2LSY A;  4V1A v;  2LOS A;  3Q9D A;  2D5U A;  4IST A;  4ADZ A;  4TV8 E;  4A56 A;  2Q9Q B;  3FBZ A;  3MA9 A;  4AQG A;  5M4Y A;  2C5K T;  3C64 A;  3AA1 B;  3AAA B;  2V26 A;  1MNE A;  2NOX A;  2D2S A;  3CKD A;  3KVB A;  5F8P A;  2X9Y A;  1YKE B;  4JEU B;  1WRD A;  2Q9Q A;  2N2N A;  5J1G A;  4QXB B;  2X51 A;  4QXH B;  3RYI E;  4C91 A;  3OKQ A;  5HYA A;  2LM9 A;  5H6R B;  3VKH A;  2EHO B;  5JDQ A;  3RRC A;  4ZI3 C;  4UVC B;  2V7J A;  3SRZ A;  5BMV E;  1E1H B;  3KVA A;  3K3N A;  4YLH A;  5FXW A;  1HG2 A;  2C0S A;  3N9N A;  2WMN A;  5HXC A;  5LHG B;  5LBQ B;  3DP7 A;  4I4T E;  3KBU A;  4IE0 A;  3E22 E;  2NP9 A;  4H9O C;  1LKX A;  2EHO A;  4YFS A;  4BAY B;  3ZYM A;  2KIN B;  1IJ6 A;  3ANW B;  3HR0 A;  1D1B A;  4YJ3 E;  5JDN A;  3WAJ A;  2CCQ A;  3NZP A;  5LGN B;  2CWO A;  4L5G A;  2NW9 A;  5GON E;  4YHJ A;  5LA6 E;  3N9L A;  4O4H E;  2H3R A;  3RX6 A;  2V7L A;  2W61 A;  3Q2M A;  2VWA A;  3ANW A;  5HWY A;  3UUL A;  2WMO A;  3U3I A;  3N2G E;  2LEH A;  2A2F X;  2KLQ A;  2KND A;  2YK0 A;  4I50 E;  2NTY A;  4TX5 A;  3GWH A;  2P9B A;  2Y6X A;  2QA7 A;  4ZI7 E;  3IBP A;  5FXZ A;  1VRB A;  3E0Z A;  1KNZ A;  3KDS E;  5JDF A;  3B57 A;  4O4L E;  5AFU L;  3EDV A;  1MMN A;  2DLR A;  3J9X 1;  4P0B A;  2H7V C;  2VKO A;  2LOP A;  4UV9 B;  3C4X A;  3GN5 B;  5LJN A;  3D0T A;  5J2T E;  2PJQ A;  4AQF C;  3SOL A;  4EZ4 A;  1S35 A;  3RC3 A;  2YU1 A;  3KBT A;  5LOV E;  5KDM C;  3PUG A;  3HI2 A;  4H63 H;  2D0T A;  4H9S E;  3HKE E;  5DJQ C;  1U4Q A;  3MJX A;  5JVD E;  4UVB B;  4AKG A;  5HXE A;  4WNK A;  4BJN A;  3TKL B;  2X9W A;  2YEV C;  2BDE A;  3GN5 A;  3K8P C;  2MYS A;  5LGT B;  5LXT E;  4PNI A;  2XAH B;  4FJO A;  3J7Y q;  4J2C A;  3IEE A;  2UXN B;  2WAU A;  3LK3 B;  3CWZ B;  5HXH A;  3H3A A;  1FMW A;  4L9I A;  4ZS2 A;  4ILU A;  1T98 A;  2XAF B;  4XAX B;  3RKO A;  1FMV A;  3BQL A;  2CXL A;  4EYY R;  4ZOL E;  2PBI A;  3LG7 A;  2HPJ A;  3DTO A;  4ANJ A;  1ZV4 X;  3CQC B;  4KBM B;  3LFM A;  3O1I A;  5L3B B;  3L09 A;  4H9R C;  1QUU A;  4YJ2 E;  1UX5 A;  1WR6 A;  3C50 A;  1G8X A;  3AA7 B;  5A1L A;  5HXS A;  5CB4 E;  2XHE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...