4KMCA

Structure analysis of m. tuberculosis rrna transcriptional regulator card and its interaction with t. aquaticus rna polymerase-beta1 domain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
79
structure length
79
Chain Sequence
TNWSRRYKANLEKLASGDVNKVAEVVRDLWRRDQERGLSAGEKRMLAKARQILVGELALAESTDDAKAETILDEVLAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA polymerase-binding transcription factor CarD
publication title Structure of the carboxy-terminal domain of Mycobacterium tuberculosis CarD protein: an essential rRNA transcriptional regulator
doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
total genus 34
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2013-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1290 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4kmcA00
4XAXB 4KBMB 4ILUA 4KMCA 4MFRA 2LT3A 4L5GA
chains in the Genus database with same CATH superfamily
4CI1B 5FY0A 3I1AA 4QHOA 2X9XA 3FBLA 3OBVE 3T1YT 3AE1A 4EOZB 2XQAA 4U31A 2LSIA 2E9XB 3FBZA 2NP9A 5AQGB 3RYCE 2M67A 2WZIA 1W0BA 1N33T 4IT4A 3K1SA 4QXBB 4DBQA 3KVAA 2WB5A 1HS7A 3ZT6A 1NENA 1Z0PA 3TLSA 2WCAA 3CQXC 1XDOA 3W15B 5AQQB 2NTYA 5JDGA 3RLFF 2KMFA 4AKRB 1CHUA 4GYRA 4ISTA 2NW8A 2LHNA 3A5XA 3ZMVB 5KDMC 3UULA 3Q2MA 2XAGB 3VKHA 2CBJA 4FI5A 2VWAA 5LYJE 4H63V 1KFYA 2CEAA 3B5MA 2QA7A 3DJBA 4DV4T 4JI6T 4WBOA 5IHYA 3ZEFB 4PW8A 3HA4A 2QRXA 5FKYA 1J5ET 2L3LA 2CM0A 3QNUA 4PJLA 4OFZA 4B3TT 3KV6A 3MK7C 4GK0E 2HN2A 2KINB 3C4ZA 4KUMB 3RYFE 1LRZA 5L4EA 2C5JA 1IJ6A 4NPPA 2WSSV 3BQKA 4I50E 4DV5T 1OXZA 4OX9T 4UXNB 2W62A 3PUQA 2LKGA 3N9OA 3AE4A 3OPCA 2IHR1 4MHCA 1L0VA 3ZSSA 2W0GA 2K24A 3RX6A 2CHNA 1XDPA 3CQCB 4CZZB 2ZMAA 4YLHA 4PFOA 3ZMSB 2W00A 2KNDA 5HEHA 3MZKB 3UQ4A 2V5DA 1UCUA 3CMLA 2VK9A 2XQ7A 2QGSA 1UX4A 4DV3T 2DWGA 2LSKA 2Q9QD 5FMNA 2XQ8A 1MIVA 2YOEA 3OJAA 2W2UA 3AAAB 3MJXA 4DR6T 3LG7A 1S35A 5LGTB 2ACXA 5FXZA 5LA6E 3IBPA 3I0QA 4UV9B 3MACA 4GIWA 5CA0E 2BS3A 4U3CA 4DNDA 2E5VA 3AECA 3KV4A 5HEGA 4Q25A 5LJNA 1T98A 3PUGA 4DV7T 4LFBT 3VU7H 2NR4A 4BAYB 3LK3B 4HFIA 5EZYE 3B57A 3C64A 5KMGP 5JR9A 4KI0F 4HFBA 3RI5A 3AE3A 3HKDE 2VQFT 3ZLIA 4JBWF 3U3IA 2UU9T 3P7IA 2H89A 4QKNA 5J0ZA 2WM9A 2V7LA 3NBXX 4TZ4C 4EIWA 3KV9A 5LOVE 5LB7B 4WNKA 5FXVA 4KHZF 1M7KA 4Z90A 5AQSB 4YHJA 5FVKA 3UU6A 4AKIA 2CXDA 2RPAA 1D1CA 4P0BA 3JADA 2FBWA 4TV9E 3ZT7A 5C3JA 2MYSA 1M62A 1KNPA 3I9YA 5LP6E 2VASA 3KV5A 5KX5E 5HCMA 1IBKT 4CXYA 4NUUA 3RRCA 2JMHA 4OYKA 3AEGA 1WLXA 2WAUA 5L2LA 2J1DG 2W61A 3KINB 1ZP0A 2SPCA 4NUVA 3NKZA 1XMQT 2JQHA 4TNVA 3SRZA 2V7JA 4H9PC 5ABEA 3GN5A 1LKXA 2EHOA 2V6XA 3P8CD 3PUYF 2V7IA 5CGMA 5AQOB 5HCJA 3I9WA 5JH7E 3AE6A 2UUBT 1N36T 3C51A 2WMNA 3MXZA 3NWIA 4MFRA 3K3QC 1HFAA 1LVFA 4C91A 2V6YA 3RPUA 1IZNB 3H37A 2JMKA 2FJBA 4JLEA 4TWHA 5JR9B 2WP9A 3RKGA 3RYHE 1WR0A 1QSDA 4HGAA 3Q5XA 1H7CA 2WS3A 1IAPA 2YN6A 4IL9A 2XAFB 2XJ7A 2PBIA 3AAIA 5LHIB 5DQVA 1D1BA 3L8RA 5AQVB 5FL0A 1UGOA 3MKDA 4YTMA 5JDHA 2M6IA 3PJAA 3K8PC 4TX5A 4A5XA 3N5LA 4GKKT 5AFUL 2QVAA 2K48A 4P09A 1AJ3A 1VRBA 2VL0A 4DUZT 5DJQC 4HWDA 1HX1B 2E9XC 4DR1T 2BKPA 2WDRA 4CI3B 5H6QB 4O2BE 2H3RA 2IAKA 1ZHCA 1XNRT 3KBUA 3JAEA 3TLVA 2I6HA 2YDRA 2ES0A 2HH7A 4ZZCA 3FZMB 3ZYKA 5AQLB 4I43B 2UXBT 4ISSA 3GN5B 1UX5A 2E5LT 2EHOB 1YQ4A 4H9OC 2XQ9A 5GONE 2ZM0A 1HG2A 4MALA 4U74A 2D0TA 2B1EA 5CB4E 4IL4A 3IA3A 4HFVA 4JV5T 3ZKRA 4YXDA 4O8SA 4AQYT 3ZC1A 3GMIA 3OVUA 1VOMA 1D0YA 2V6YB 4EEBA 4ILCA 4K0KT 3N9PA 5LHGB 2BG9E 2K3WA 2CPTA 2H7VC 3CVRA 3ZMTB 2QYWA 2ZM8A 2WU5A 2IIUA 3BQLA 1HF8A 1ZOYA 3F31A 4TV8E 4O2AE 3AVSA 2FUPA 3RH3A 3KFWX 1D0XA 4XBFB 4UELA 1VCTA 3IHRA 4J2CA 2UXXB 3NRXA 2VKHA 2NWBA 2YU2A 3TLWA 3ONXA 3RYIE 4GKJT 2K5BB 4QX7B 3SFDA 3QK6A 2YU1A 3UT5E 3ZMUB 1YKHB 3DP7A 2Z6EA 2XASB 2CWYA 2C0SA 3EAMA 4PK4A 5BR8T 4WBNE 5LGUB 5JTGA 3CK6A 1NAFA 4U2ZA 5LG3A 2V26A 5L3CB 5JREA 1YW0A 1UK5A 3RIFA 5JRCA 4KMCA 2H7OA 4PK5A 2A72A 3PV0F 5HAXA 4X1IE 1KK7A 3EUHA 2GK9A 4QX8B 4IIJE 2BG9A 1BR2A 4AISA 5HXSA 4AQGA 3VHLA 2LM9A 4X20E 2NTXA 1UURA 4JI0T 2J4GA 3PU3A 1BR1A 2X0LB 4KBMB 4DVDA 4M1PA 2YDQA 5J1GA 2XQ5A 3ETUA 1WRDA 1T72A 4UF0A 3RIUA 4PNIA 4ZS3A 5FYMA 2VKOA 2VQET 1U4QA 2MOZA 4AQFA 5FY1A 2MAWA 3O9XA 3EHZA 4ZI7E 3ZCIA 4HFCA 4ZHQE 3VR9A 3RRWA 2CRBA 4XZCA 4JI4T 1UUSA 1KF6A 4MBQA 5J2UE 2CXLA 3ONJA 1E2AA 2CCQA 3FZKB 4EV6A 4QXHB 2YEVC 3WI3A 2CBIA 3UUNA 3N2GE 3QC9A 4AKHA 5L3GB 4JI3T 3D0TA 2WWUA 2YDSA 4EYUA 2VB6A 3AB3B 2IDOB 2BS2A 4HWCA 5JDLA 3JCFA 3CKDA 4Z91A 4ZS2A 5FL1A 4LF7T 2KLQA 4L0RA 2XM2A 5AQMB 2CE7A 3UU5A 1HNXT 4CN4A 3RKOA 5JRCB 3AVRA 2I0MA 1WYBA 2C5KT 2LSJA 5AQKB 2BG9B 2UUAT 1NEKA 3VKGA 2V7MA 4AKGA 1BR4A 3UU3A 4IDOA 2VKDA 3AEBA 4BJNA 1T8BA 3A8YC 2D0UA 3N2OA 2A3DA 2NW9A 3FZFB 4DR7T 2MTQA 5HYAA 3FXDB 1YD8G 2XSBA 3AEDA 3V5UA 5HXRA 5J2TE 3E08A 4FJOA 4UF0B 1YQ3A 3H3MA 4DR4T 2KSRA 3MA9A 3HI2A 3QUJA 4LFAT 2K9AA 1X9BA 4QH5A 3UFGA 3UUBA 5JR9C 2W63A 2UXCT 5LGNB 4DMWA 2LSGA 2V1DB 4HN9A 2E9XD 3AEFA 2UXDT 3J9X1 4O4HE 1FIOA 3K3NA 4HWIB 4X62T 3CPZA 2BBHA 3ZC0A 3JAFA 3QB5A 1Y64B 2VVNA 3UFEA 3GWHA 3U78A 4ZEYA 2H88A 1YXRA 4P1NA 4YSXA 2WY2A 1WYCA 5AQUB 4DR5T 4TWDA 1FEWA 4AI6A 2Y48B 4LF6T 4DV2T 2XUEA 3LBXA 2KWIB 3HKBE 4O4IE 2BZBA 5LG4A 5L3DB 4YJ2E 5AQJB 3SWHA 2V8SV 3IF8B 3F57A 2MBGA 3O1IA 1JNZA 3TKLB 5CA1E 3UU4A 2WDVA 2CLYB 3EVYA 3OYZA 3M65A 4UVBB 4ZI2C 4ERRA 3H3AA 2X0YA 4YJ3E 3C4XA 3NRYA 2EHOC 2RA1A 5AQRB 3O1HA 4TUYE 2LJLA 1BR0A 2IC9A 2D5UA 2Q9QA 2L8KA 5JDFA 1SHZC 4IHJE 2XPKA 1J1JA 3PU8A 4MLKA 4I4TE 5JVDE 1MMAA 1MIYA 3UUMA 3PUXF 5HXHA 4LMJA 4EAHA 4O4JE 1OEDE 4EZ4A 3NZQA 1VCSA 4A98A 2C5IT 3RC8A 2LOPA 3RHWA 4IGUA 4UEMA 2JQ9A 2XM1A 1MNDA 3FXEB 2PG8A 2X9YA 2XQ6A 5FVLA 5HEUA 3N9MA 4WZXA 4O4LE 1MIWA 3UTKA 1WFDA 2XQ4A 4PJNA 2PTFA 2XQ3A 4NIQA 4IDPA 4WYVA 1ZV4X 2JJ9A 3VRBA 2E2AA 3AAEB 4OYJA 3R6NA 2ACZA 5H6RB 3PUVF 1KNRA 1T7SA 5AQFB 4DR2T 2D9DA 2A9UA 4JEUB 1G73A 2HN1A 2LE8A 1IBMT 1ZKEA 2G0UA 5E0OA 2NW7A 3TLUA 4B3MT 4AXPA 3LBXB 2XTLA 4I55E 3HKEE 5FNVE 1D1AA 3ETVA 3N9LA 4EGWA 2A2FX 1HTJF 4KP3C 1D0ZA 2YK0A 4G2AA 4HWHA 1IBLT 2LEHA 2DLRA 4X5TA 1OEDA 3O4XE 2P9BA 3QB5K 4DV6T 1HNZT 4ILBA 2RP4A 4HWFA 5AQHB 5AQIB 3LJCA 2LHRA 1R8IA 2BS4A 5LMNT 4IE0A 4GOUA 5FXWA 4DO0A 2WWVA 1HNWT 3NVOA 1KNZA 4TN7B 2WQYA 2Q9QB 3AE2A 3BK9A 3LDQB 2OA5A 3E22E 4ILAA 4PAGA 3KDSE 5F3JA 3GA8A 5L47A 3AE9A 1FJGT 4F8HA 5JQGE 3PUAA 4P0AA 2ODVA 5F5WA 3G06A 3ABVA 3R84B 4ANJA 4DV0T 1OWAA 2CWOA 2KWHA 3ZJ1A 1MMGA 1GQEA 4XAXB 5KXJA 5TAOA 4ADZA 3C98B 4TWFA 3ZT5A 3AA0B 4KHPT 2JQQA 2AXDS 1FMVA 1N32T 2NOXA 5EK3A 3EDVA 3HL6A 2LOSA 4IDNA 4QH1A 4NXNT 3CIRA 3N9QA 1KEYA 3F2EA 3RC3A 5AQPB 2LRLA 2KT9A 2DNXA 5L3FB 2DHRA 5A1LA 5L3EB 4K0UA 4PK6A 2VKJA 2BBJA 2KZ7B 2XHEB 3TLTA 4LF4T 3AEEA 4IE5A 2XSAA 4U7YA 3FZHB 4H9RC 2X9WA 5FXXA 3ZN1B 3SOLA 1OEDB 5ETWA 4EXTA 2WDQA 5ABHA 4IDQA 5LJMA 4EEDA 3FHNA 4L9IA 1ZEEA 3CX7B 3ZCJA 4I0UA 4DUYT 1HCIA 3T1HT 2BG9C 3E0ZA 3WAKA 4LMLA 4CXWA 4A97A 5C2TA 3P4RA 5L3BB 3EI0A 4IREA 5LBMA 4LF5T 4UVAB 2MPKA 3QOFA 1V9DA 4PJMA 2LT3A 4DR3T 2DL1A 4PJJA 2V5CA 2N1GA 1N34T 5FP3A 3T8OA 4CN1A 3C50A 3EABA 3CQGB 2UUCT 4LMKA 3ANWA 3ZSTA 2OV9A 4IE6A 4JI1T 1IJ5A 3RIUC 5LMUT 2X67A 4G63A 3BQIA 4JI8T 3LSVA 5EK4A 5DQWA 2X0HA 5FY7A 4YT0A 5HEOA 3VR8A 4AQFC 5F8PA 4LF8T 3PJAJ 4UIGA 1HG5A 4EZHA 2D2SA 1E1HB 4U33A 4V1Av 2R6GF 4DIDB 4LFCT 1CUNA 5C8YE 3LK42 2IMLA 2CHOA 4NXMT 5IYZE 2IC6A 2V7KA 1QUUA 2IUBA 4HTEA 4ZI2D 2M6BA 3PURA 4JEHB 4HFDA 4AIUA 2EHOD 1W09A 3ESLA 3KBTA 3PUWF 3RIAA 1W0AA 3AXJA 4YY3T 3K3OA 3V5SA 3FZLB 3PDYA 4L5GA 4U72A 1G8XA 3NZPA 3OKQA 4B3ST 4PFPA 1I94T 2FJEA 4ZXLA 3I0OA 3N9NA 2WMOA 3AA6B 4ILUA 4C90A 4HE8A 3Q9DA 2CLYC 2LRKA 2JPFA 5ABGA 2DCFA 3RGLA 4TNWA 4H63H 2ZM6T 3IEEA 1I6ZA 2HHHT 5LXTE 5IWAT 4H9QC 3SS1A 4QXCB 3DTOA 3AE5A 3N2KE 4LF9T 4X65T 4Z8XA 2BVMA 3RF1A 2E8IA 5CJ5A 3L39A 4BJMA 2FJDA 1XNQT 3ANWB 4COFA 4ZI3D 2JIWA 2BKNA 5HXEA 4ZOLE 1E7PA 3ZMZB 2ZLYA 1LVKA 5ABFA 5IUXA 2LKHA 3Q5DA 5LCYA 4IDZA 3M3ZB 4DBRA 4OK0A 5JDMA 4B6XA 5JDNA 1DU2A 4A56A 2XY8B 5LBQB 1QLBA 3FB2A 5M4YA 5AQTB 4CI2B 5HWXA 1XZYA 4E7SA 2WBLA 3AXJB 2CMRA 2OLTA 1SUMB 3WAJA 3KVBA 1MMNA 2L9QA 3P4PA 3UU8A 3PUZF 4HFEA 3LFMA 2LLYA 3RQWA 2YKSA 4X64T 2PJQA 3ZYMA 4EYYR 2B76A 5LHHB 5ADXL 1WR6A 4DMVA 3AE8A 4YSYA 2AE9A 1HX8A 4UVCB 1MMDA 4UR9A 4AKLA 5CFBA 3JC6D 3ZYLA 4N78D 2X66A 4UV8B 2I59A 5HEJA 3UQ7A 5HXCA 4JUYA 3PUSA 2X9HA 1SA0E 4DV1T 2Q9QC 2X51A 1J5WA 2ZM2A 3PE0A 1HR0T 2CXFA 2LSYA 3ZJ2A 2UXNB 2F4VT 4OHFA 2J62A 4H9SE 4KX6A 2W66A 2N2NA 3P4WA 4YHHT 2J47A 4X66T 3S4UA 4YSZA 2DWKA 4YTNA 1U5PA 4HKAA 4X1KE 5ABFB 3AEAA 4HFHA 2XQYA 2PFVA 1YKEB 4CN6A 3CX6B 2HPJA 3AA1B 4IE7A 4ZI3C 1JNRA 3ZPOA 2XZEA 1NWMX 1W9RA 5JDQA 4JYAT 3B13A 4E7ZA 3AE7A 3CX8B 2E9XA 2X68A 4WW0A 5L4HA 4H9NC 3P50A 2N9DA 3P4SA 2W4XA 5AQNB 2XAQB 3ONLC 4QH4A 1WCRA 1O3XA 2BKOA 1Z8UA 4GK5E 4U2YA 1MNEA 4EB6E 3UUXB 2Y6XA 1X79A 4F6RC 3L3PA 2BVLA 2IW5B 5LNKA 3RQUA 2VVSA 3Q5WA 2VURA 4BA9A 4YFSA 1SE7A 4JI2T 3PTRB 1Y01A 3SFEA 3C4WA 1OEDC 5EK2A 2KXPB 2JRKA 3ZN0B 3HR0A 2Y8DA 2WZHA 4ASKA 2DI4A 1EZ3A 3O1JA 4HEAA 4GYSA 2XAJB 3X1DA 4ZZBA 2CA5A 3EDUA 1XWMA 1B7TA 4QWNB 2WU2A 5HWYA 3AA7B 2FJAA 2W67A 3OTOT 4IE4A 4U7IA 3A7MA 3JC6C 3Q5EA 4YTPA 2ODUA 3P4QA 4JI5T 2JQKA 1S94A 1US7B 4JI7T 5DABA 3L09A 3CWZB 2BDEA 2XAHB 4B3RT 3HKCE 4CXXA 3LK2B 3VRAA 1FMWA 4CQIA 2VL8A 3J7Yq 2LM2A 2YINA 1XMOT 4X1YE 3OYXA 2HPLA 5BMVE
chains in the Genus database with same CATH topology
1Y64B 1HG5A 4CI1B 3UFEA 3GWHA 4EZHA 5FY0A 3I1AA 4QHOA 2X9XA 3U78A 3MKDA 3FBLA 3OBVE 5JDHA 3K8PC 2D2SA 1E1HB 4TX5A 1WYCA 3N5LA 4EOZB 4V1Av 5AFUL 2K48A 2LSIA 4P09A 1CUNA 2E9XB 3FBZA 1VRBA 3LK42 1FEWA 5C8YE 1AJ3A 2NP9A 5DJQC 5IYZE 3RYCE 4AI6A 2Y48B 2IC6A 2V7KA 2M67A 2E9XC 1QUUA 4HTEA 4ZI2D 2XUEA 3LBXA 2KWIB 3HKBE 4CI3B 3PURA 4JEHB 4QXBB 4DBQA 5H6QB 3KVAA 4O4IE 2BZBA 2EHOD 5LG4A 1HS7A 5L3DB 3ESLA 4O2BE 3KBTA 2H3RA 2IAKA 1ZHCA 4YJ2E 3KBUA 1Z0PA 3SWHA 3K3OA 3CQXC 3IF8B 3F57A 3W15B 2NTYA 5JDGA 3V5SA 2KMFA 4AKRB 2MBGA 3O1IA 2ES0A 2HH7A 4GYRA 4ISTA 3TKLB 3ZYKA 5CA1E 2NW8A 3PDYA 4L5GA 2LHNA 4U72A 4I43B 1G8XA 3A5XA 3NZPA 3OKQA 3ZMVB 5KDMC 2CLYB 3EVYA 3UULA 3OYZA 4ISSA 3GN5B 1UX5A 4PFPA 3Q2MA 3M65A 2EHOB 3I0OA 2XAGB 3VKHA 4UVBB 4ZI2C 3N9NA 2WMOA 3AA6B 3H3AA 4H9OC 4ILUA 4HE8A 5GONE 4C90A 4ERRA 3Q9DA 2ZM0A 1HG2A 2CLYC 2JPFA 4YJ3E 2DCFA 4MALA 4U74A 4FI5A 3C4XA 3NRYA 2EHOC 2RA1A 4H63H 3IEEA 2D0TA 5LXTE 2VWAA 3O1HA 5LYJE 4TUYE 4H9QC 3SS1A 2LJLA 1BR0A 2B1EA 2IC9A 2D5UA 4H63V 2Q9QA 5CB4E 4HFVA 2L8KA 4QXCB 5JDFA 3DTOA 1SHZC 2CEAA 4IHJE 3PU8A 4MLKA 2QA7A 4I4TE 5JVDE 4O8SA 1MMAA 3DJBA 1MIYA 3UUMA 3N2KE 5HXHA 4WBOA 5IHYA 3GMIA 3ZC1A 3ZEFB 4EAHA 4O4JE 4Z8XA 1VOMA 1D0YA 2BVMA 3NZQA 4PW8A 4EZ4A 2E8IA 3HA4A 2C5IT 3RC8A 2LOPA 3N9PA 4BJMA 5LHGB 2L3LA 4IGUA 4UEMA 3ANWB 2H7VC 2CM0A 1MNDA 4PJLA 3FXEB 4ZI3D 2PG8A 4OFZA 3KV6A 2X9YA 3MK7C 4GK0E 5HXEA 4ZOLE 2KINB 3C4ZA 3CVRA 3N9MA 3ZMTB 4KUMB 3ZMZB 4O4LE 2ZLYA 3RYFE 2ZM8A 1LRZA 1LVKA 1MIWA 3UTKA 2C5JA 1IJ6A 4PJNA 3BQLA 1HF8A 2WSSV 3BQKA 3F31A 1ZV4X 5LCYA 2JJ9A 4TV8E 4I50E 4IDZA 4O2AE 3AAEB 1OXZA 3AVSA 4OYJA 3R6NA 3RH3A 5H6RB 3KFWX 4UXNB 1D0XA 4XBFB 4DBRA 2W62A 4UELA 3PUQA 3N9OA 4OK0A 5JDMA 3IHRA 4B6XA 4J2CA 5JDNA 4A56A 2UXXB 5LBQB 3NRXA 4MHCA 4JEUB 2VKHA 2NWBA 2YU2A 2W0GA 3ONXA 1G73A 3RYIE 3FB2A 2K5BB 5M4YA 2K24A 2LE8A 3RX6A 4QX7B 3QK6A 3CQCB 2YU1A 3UT5E 4CZZB 3ZMUB 1YKHB 2ZMAA 4YLHA 3DP7A 1ZKEA 2Z6EA 2G0UA 2XASB 4PFOA 3ZMSB 5E0OA 2NW7A 2W00A 4AXPA 4CI2B 2KNDA 2CWYA 3LBXB 2C0SA 5HWXA 3MZKB 2XTLA 4PK4A 4I55E 3HKEE 4WBNE 4E7SA 5FNVE 5LGUB 1D1AA 2WBLA 3ETVA 1NAFA 3N9LA 2A2FX 1HTJF 4KP3C 1D0ZA 2YK0A 4G2AA 2CMRA 2V26A 1UCUA 5L3CB 5JREA 3WAJA 3CMLA 1YW0A 2VK9A 3KVBA 1MMNA 2LEHA 2DLRA 2QGSA 1UX4A 2L9QA 5JRCA 4KMCA 2H7OA 4PK5A 2A72A 3LFMA 2DWGA 5HAXA 4X1IE 2LSKA 1KK7A 2PJQA 2Q9QD 3O4XE 5FMNA 2P9BA 3EUHA 2GK9A 3ZYMA 4EYYR 1MIVA 4QX8B 4IIJE 5LHHB 1BR2A 3OJAA 5ADXL 3AAAB 1WR6A 5HXSA 3MJXA 4DMVA 2RP4A 3LG7A 1S35A 5LGTB 2ACXA 5FXZA 5LA6E 3LJCA 2LHRA 3IBPA 4AQGA 3VHLA 3I0QA 2LM9A 1HX8A 4IE0A 4UVCB 1MMDA 4UV9B 4AKLA 3MACA 3JC6D 4X20E 3ZYLA 4GIWA 4GOUA 4N78D 2NTXA 5FXWA 2X66A 4UV8B 4DO0A 5CA0E 3PU3A 1KNZA 4TN7B 3BK9A 1BR1A 2Q9QB 4DNDA 2X0LB 2I59A 2OA5A 4KBMB 5HXCA 4DVDA 4JUYA 3PUSA 3KV4A 2X9HA 4M1PA 1SA0E 3E22E 5J1GA 5LJNA 1T98A 3PUGA 2Q9QC 4PAGA 3ETUA 3KDSE 2X51A 2ZM2A 3PE0A 1WRDA 3VU7H 5F3JA 3GA8A 2CXFA 2LSYA 4BAYB 3ZJ2A 2UXNB 3LK3B 4UF0A 5EZYE 3B57A 3C64A 5KMGP 5JQGE 4OHFA 5JR9A 4H9SE 3PUAA 4PNIA 4ZS3A 2N2NA 4P0AA 2ODVA 5FYMA 2VKOA 3S4UA 3R84B 4ANJA 3HKDE 2DWKA 1OWAA 2CWOA 1U5PA 4HKAA 1U4QA 2KWHA 2MOZA 4X1KE 3ZLIA 4AQFA 5FY1A 3ZJ1A 3U3IA 1MMGA 3P7IA 3O9XA 4QKNA 2XQYA 4XAXB 4ZI7E 5TAOA 2WM9A 2V7LA 2PFVA 3NBXX 4TZ4C 3ZCIA 4ZHQE 4EIWA 3KV9A 5LOVE 4ADZA 4WNKA 3C98B 5FXVA 1YKEB 3RRWA 3CX6B 3AA0B 4XZCA 2HPJA 3AA1B 4IE7A 4ZI3C 2JQQA 3ZPOA 4YHJA 4AKIA 1FMVA 4MBQA 5J2UE 1NWMX 2CXLA 2NOXA 5JDQA 2CXDA 2CCQA 4QXHB 5EK3A 2YEVC 3B13A 4E7ZA 1D1CA 3WI3A 4P0BA 3CX8B 2E9XA 2X68A 3EDVA 3HL6A 3UUNA 2LOSA 3N2GE 3QC9A 4WW0A 4TV9E 4H9NC 4AKHA 5L3GB 2MYSA 3I9YA 5LP6E 2N9DA 2VASA 3KV5A 3D0TA 2WWUA 3N9QA 5KX5E 3F2EA 3RC3A 4EYUA 4CXYA 2VB6A 4NUUA 3AB3B 3RRCA 2JMHA 2KT9A 2XAQB 2DNXA 4OYKA 5L3FB 2DHRA 5A1LA 5JDLA 5L3EB 1O3XA 3CKDA 4K0UA 4ZS2A 4GK5E 4EB6E 1WLXA 1MNEA 4PK6A 2VKJA 2KLQA 3UUXB 2KZ7B 2WAUA 2Y6XA 5L2LA 4L0RA 2J1DG 1X79A 4F6RC 2XHEB 2W61A 3L3PA 4IE5A 2CE7A 3KINB 2BVLA 2SPCA 4NUVA 2IW5B 5LNKA 4H9RC 2X9WA 5FXXA 3ZN1B 3Q5WA 3RKOA 3SRZA 3SOLA 5JRCB 3AVRA 2V7JA 4BA9A 1WYBA 2C5KT 4H9PC 5ETWA 4EXTA 4YFSA 2LSJA 3PTRB 3GN5A 5LJMA 1LKXA 2EHOA 3C4WA 3VKGA 5EK2A 3FHNA 2V7MA 4L9IA 1ZEEA 4AKGA 3CX7B 3ZCJA 2KXPB 1BR4A 2JRKA 2VKDA 3P8CD 1HCIA 3ZN0B 4BJNA 3E0ZA 3HR0A 3WAKA 2D0UA 2V7IA 4CXWA 2Y8DA 3N2OA 2A3DA 4ASKA 5L3BB 3I9WA 2DI4A 1EZ3A 2NW9A 5LBMA 4UVAB 5JH7E 3O1JA 1V9DA 4HEAA 2LT3A 3C51A 4PJMA 4GYSA 2XAJB 2MTQA 2WMNA 5HYAA 3FXDB 2CA5A 3MXZA 3EDUA 4PJJA 4MFRA 3K3QC 1B7TA 1YD8G 2N1GA 1HFAA 4QWNB 1LVFA 5FP3A 4C91A 3T8OA 5HWYA 3C50A 3RPUA 1IZNB 3V5UA 3AA7B 5HXRA 5J2TE 3CQGB 3E08A 4FJOA 3H37A 4UF0B 2JMKA 4JLEA 4IE4A 3ANWA 5JR9B 3JC6C 2ODUA 4IE6A 3MA9A 3RYHE 3HI2A 1IJ5A 3QUJA 2K9AA 2X67A 4G63A 1QSDA 1S94A 1US7B 5JR9C 5DABA 4HGAA 3L09A 3CWZB 2BDEA 2W63A 5LGNB 2XAHB 3BQIA 4DMWA 3Q5XA 1H7CA 3HKCE 1IAPA 2LSGA 5EK4A 4CXXA 2V1DB 4HN9A 2XAFB 2E9XD 5DQWA 3LK2B 5FY7A 1FMWA 3J9X1 4O4HE 1FIOA 4CQIA 2VL8A 2PBIA 4AQFC 3K3NA 3J7Yq 5F8PA 2YINA 3AAIA 3CPZA 5LHIB 4UIGA 4X1YE 5DQVA 1D1BA 3OYXA 2HPLA 3ZC0A 5BMVE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XAX B;  4KBM B;  4ILU A;  4KMC A;  4MFR A;  2LT3 A;  4L5G A; 
#chains in the Genus database with same CATH topology
 4CI1 B;  5FY0 A;  3I1A A;  4QHO A;  2X9X A;  3FBL A;  3OBV E;  3T1Y T;  3AE1 A;  4EOZ B;  2XQA A;  4U31 A;  2LSI A;  2E9X B;  3FBZ A;  2NP9 A;  5AQG B;  3RYC E;  2M67 A;  2WZI A;  1W0B A;  1N33 T;  4IT4 A;  3K1S A;  4QXB B;  4DBQ A;  3KVA A;  2WB5 A;  1HS7 A;  3ZT6 A;  1NEN A;  1Z0P A;  3TLS A;  2WCA A;  3CQX C;  1XDO A;  3W15 B;  5AQQ B;  2NTY A;  5JDG A;  3RLF F;  2KMF A;  4AKR B;  1CHU A;  4GYR A;  4IST A;  2NW8 A;  2LHN A;  3A5X A;  3ZMV B;  5KDM C;  3UUL A;  3Q2M A;  2XAG B;  3VKH A;  2CBJ A;  4FI5 A;  2VWA A;  5LYJ E;  4H63 V;  1KFY A;  2CEA A;  3B5M A;  2QA7 A;  3DJB A;  4DV4 T;  4JI6 T;  4WBO A;  5IHY A;  3ZEF B;  4PW8 A;  3HA4 A;  2QRX A;  5FKY A;  1J5E T;  2L3L A;  2CM0 A;  3QNU A;  4PJL A;  4OFZ A;  4B3T T;  3KV6 A;  3MK7 C;  4GK0 E;  2HN2 A;  2KIN B;  3C4Z A;  4KUM B;  3RYF E;  1LRZ A;  5L4E A;  2C5J A;  1IJ6 A;  4NPP A;  2WSS V;  3BQK A;  4I50 E;  4DV5 T;  1OXZ A;  4OX9 T;  4UXN B;  2W62 A;  3PUQ A;  2LKG A;  3N9O A;  3AE4 A;  3OPC A;  2IHR 1;  4MHC A;  1L0V A;  3ZSS A;  2W0G A;  2K24 A;  3RX6 A;  2CHN A;  1XDP A;  3CQC B;  4CZZ B;  2ZMA A;  4YLH A;  4PFO A;  3ZMS B;  2W00 A;  2KND A;  5HEH A;  3MZK B;  3UQ4 A;  2V5D A;  1UCU A;  3CML A;  2VK9 A;  2XQ7 A;  2QGS A;  1UX4 A;  4DV3 T;  2DWG A;  2LSK A;  2Q9Q D;  5FMN A;  2XQ8 A;  1MIV A;  2YOE A;  3OJA A;  2W2U A;  3AAA B;  3MJX A;  4DR6 T;  3LG7 A;  1S35 A;  5LGT B;  2ACX A;  5FXZ A;  5LA6 E;  3IBP A;  3I0Q A;  4UV9 B;  3MAC A;  4GIW A;  5CA0 E;  2BS3 A;  4U3C A;  4DND A;  2E5V A;  3AEC A;  3KV4 A;  5HEG A;  4Q25 A;  5LJN A;  1T98 A;  3PUG A;  4DV7 T;  4LFB T;  3VU7 H;  2NR4 A;  4BAY B;  3LK3 B;  4HFI A;  5EZY E;  3B57 A;  3C64 A;  5KMG P;  5JR9 A;  4KI0 F;  4HFB A;  3RI5 A;  3AE3 A;  3HKD E;  2VQF T;  3ZLI A;  4JBW F;  3U3I A;  2UU9 T;  3P7I A;  2H89 A;  4QKN A;  5J0Z A;  2WM9 A;  2V7L A;  3NBX X;  4TZ4 C;  4EIW A;  3KV9 A;  5LOV E;  5LB7 B;  4WNK A;  5FXV A;  4KHZ F;  1M7K A;  4Z90 A;  5AQS B;  4YHJ A;  5FVK A;  3UU6 A;  4AKI A;  2CXD A;  2RPA A;  1D1C A;  4P0B A;  3JAD A;  2FBW A;  4TV9 E;  3ZT7 A;  5C3J A;  2MYS A;  1M62 A;  1KNP A;  3I9Y A;  5LP6 E;  2VAS A;  3KV5 A;  5KX5 E;  5HCM A;  1IBK T;  4CXY A;  4NUU A;  3RRC A;  2JMH A;  4OYK A;  3AEG A;  1WLX A;  2WAU A;  5L2L A;  2J1D G;  2W61 A;  3KIN B;  1ZP0 A;  2SPC A;  4NUV A;  3NKZ A;  1XMQ T;  2JQH A;  4TNV A;  3SRZ A;  2V7J A;  4H9P C;  5ABE A;  3GN5 A;  1LKX A;  2EHO A;  2V6X A;  3P8C D;  3PUY F;  2V7I A;  5CGM A;  5AQO B;  5HCJ A;  3I9W A;  5JH7 E;  3AE6 A;  2UUB T;  1N36 T;  3C51 A;  2WMN A;  3MXZ A;  3NWI A;  4MFR A;  3K3Q C;  1HFA A;  1LVF A;  4C91 A;  2V6Y A;  3RPU A;  1IZN B;  3H37 A;  2JMK A;  2FJB A;  4JLE A;  4TWH A;  5JR9 B;  2WP9 A;  3RKG A;  3RYH E;  1WR0 A;  1QSD A;  4HGA A;  3Q5X A;  1H7C A;  2WS3 A;  1IAP A;  2YN6 A;  4IL9 A;  2XAF B;  2XJ7 A;  2PBI A;  3AAI A;  5LHI B;  5DQV A;  1D1B A;  3L8R A;  5AQV B;  5FL0 A;  1UGO A;  3MKD A;  4YTM A;  5JDH A;  2M6I A;  3PJA A;  3K8P C;  4TX5 A;  4A5X A;  3N5L A;  4GKK T;  5AFU L;  2QVA A;  2K48 A;  4P09 A;  1AJ3 A;  1VRB A;  2VL0 A;  4DUZ T;  5DJQ C;  4HWD A;  1HX1 B;  2E9X C;  4DR1 T;  2BKP A;  2WDR A;  4CI3 B;  5H6Q B;  4O2B E;  2H3R A;  2IAK A;  1ZHC A;  1XNR T;  3KBU A;  3JAE A;  3TLV A;  2I6H A;  2YDR A;  2ES0 A;  2HH7 A;  4ZZC A;  3FZM B;  3ZYK A;  5AQL B;  4I43 B;  2UXB T;  4ISS A;  3GN5 B;  1UX5 A;  2E5L T;  2EHO B;  1YQ4 A;  4H9O C;  2XQ9 A;  5GON E;  2ZM0 A;  1HG2 A;  4MAL A;  4U74 A;  2D0T A;  2B1E A;  5CB4 E;  4IL4 A;  3IA3 A;  4HFV A;  4JV5 T;  3ZKR A;  4YXD A;  4O8S A;  4AQY T;  3ZC1 A;  3GMI A;  3OVU A;  1VOM A;  1D0Y A;  2V6Y B;  4EEB A;  4ILC A;  4K0K T;  3N9P A;  5LHG B;  2BG9 E;  2K3W A;  2CPT A;  2H7V C;  3CVR A;  3ZMT B;  2QYW A;  2ZM8 A;  2WU5 A;  2IIU A;  3BQL A;  1HF8 A;  1ZOY A;  3F31 A;  4TV8 E;  4O2A E;  3AVS A;  2FUP A;  3RH3 A;  3KFW X;  1D0X A;  4XBF B;  4UEL A;  1VCT A;  3IHR A;  4J2C A;  2UXX B;  3NRX A;  2VKH A;  2NWB A;  2YU2 A;  3TLW A;  3ONX A;  3RYI E;  4GKJ T;  2K5B B;  4QX7 B;  3SFD A;  3QK6 A;  2YU1 A;  3UT5 E;  3ZMU B;  1YKH B;  3DP7 A;  2Z6E A;  2XAS B;  2CWY A;  2C0S A;  3EAM A;  4PK4 A;  5BR8 T;  4WBN E;  5LGU B;  5JTG A;  3CK6 A;  1NAF A;  4U2Z A;  5LG3 A;  2V26 A;  5L3C B;  5JRE A;  1YW0 A;  1UK5 A;  3RIF A;  5JRC A;  4KMC A;  2H7O A;  4PK5 A;  2A72 A;  3PV0 F;  5HAX A;  4X1I E;  1KK7 A;  3EUH A;  2GK9 A;  4QX8 B;  4IIJ E;  2BG9 A;  1BR2 A;  4AIS A;  5HXS A;  4AQG A;  3VHL A;  2LM9 A;  4X20 E;  2NTX A;  1UUR A;  4JI0 T;  2J4G A;  3PU3 A;  1BR1 A;  2X0L B;  4KBM B;  4DVD A;  4M1P A;  2YDQ A;  5J1G A;  2XQ5 A;  3ETU A;  1WRD A;  1T72 A;  4UF0 A;  3RIU A;  4PNI A;  4ZS3 A;  5FYM A;  2VKO A;  2VQE T;  1U4Q A;  2MOZ A;  4AQF A;  5FY1 A;  2MAW A;  3O9X A;  3EHZ A;  4ZI7 E;  3ZCI A;  4HFC A;  4ZHQ E;  3VR9 A;  3RRW A;  2CRB A;  4XZC A;  4JI4 T;  1UUS A;  1KF6 A;  4MBQ A;  5J2U E;  2CXL A;  3ONJ A;  1E2A A;  2CCQ A;  3FZK B;  4EV6 A;  4QXH B;  2YEV C;  3WI3 A;  2CBI A;  3UUN A;  3N2G E;  3QC9 A;  4AKH A;  5L3G B;  4JI3 T;  3D0T A;  2WWU A;  2YDS A;  4EYU A;  2VB6 A;  3AB3 B;  2IDO B;  2BS2 A;  4HWC A;  5JDL A;  3JCF A;  3CKD A;  4Z91 A;  4ZS2 A;  5FL1 A;  4LF7 T;  2KLQ A;  4L0R A;  2XM2 A;  5AQM B;  2CE7 A;  3UU5 A;  1HNX T;  4CN4 A;  3RKO A;  5JRC B;  3AVR A;  2I0M A;  1WYB A;  2C5K T;  2LSJ A;  5AQK B;  2BG9 B;  2UUA T;  1NEK A;  3VKG A;  2V7M A;  4AKG A;  1BR4 A;  3UU3 A;  4IDO A;  2VKD A;  3AEB A;  4BJN A;  1T8B A;  3A8Y C;  2D0U A;  3N2O A;  2A3D A;  2NW9 A;  3FZF B;  4DR7 T;  2MTQ A;  5HYA A;  3FXD B;  1YD8 G;  2XSB A;  3AED A;  3V5U A;  5HXR A;  5J2T E;  3E08 A;  4FJO A;  4UF0 B;  1YQ3 A;  3H3M A;  4DR4 T;  2KSR A;  3MA9 A;  3HI2 A;  3QUJ A;  4LFA T;  2K9A A;  1X9B A;  4QH5 A;  3UFG A;  3UUB A;  5JR9 C;  2W63 A;  2UXC T;  5LGN B;  4DMW A;  2LSG A;  2V1D B;  4HN9 A;  2E9X D;  3AEF A;  2UXD T;  3J9X 1;  4O4H E;  1FIO A;  3K3N A;  4HWI B;  4X62 T;  3CPZ A;  2BBH A;  3ZC0 A;  3JAF A;  3QB5 A;  1Y64 B;  2VVN A;  3UFE A;  3GWH A;  3U78 A;  4ZEY A;  2H88 A;  1YXR A;  4P1N A;  4YSX A;  2WY2 A;  1WYC A;  5AQU B;  4DR5 T;  4TWD A;  1FEW A;  4AI6 A;  2Y48 B;  4LF6 T;  4DV2 T;  2XUE A;  3LBX A;  2KWI B;  3HKB E;  4O4I E;  2BZB A;  5LG4 A;  5L3D B;  4YJ2 E;  5AQJ B;  3SWH A;  2V8S V;  3IF8 B;  3F57 A;  2MBG A;  3O1I A;  1JNZ A;  3TKL B;  5CA1 E;  3UU4 A;  2WDV A;  2CLY B;  3EVY A;  3OYZ A;  3M65 A;  4UVB B;  4ZI2 C;  4ERR A;  3H3A A;  2X0Y A;  4YJ3 E;  3C4X A;  3NRY A;  2EHO C;  2RA1 A;  5AQR B;  3O1H A;  4TUY E;  2LJL A;  1BR0 A;  2IC9 A;  2D5U A;  2Q9Q A;  2L8K A;  5JDF A;  1SHZ C;  4IHJ E;  2XPK A;  1J1J A;  3PU8 A;  4MLK A;  4I4T E;  5JVD E;  1MMA A;  1MIY A;  3UUM A;  3PUX F;  5HXH A;  4LMJ A;  4EAH A;  4O4J E;  1OED E;  4EZ4 A;  3NZQ A;  1VCS A;  4A98 A;  2C5I T;  3RC8 A;  2LOP A;  3RHW A;  4IGU A;  4UEM A;  2JQ9 A;  2XM1 A;  1MND A;  3FXE B;  2PG8 A;  2X9Y A;  2XQ6 A;  5FVL A;  5HEU A;  3N9M A;  4WZX A;  4O4L E;  1MIW A;  3UTK A;  1WFD A;  2XQ4 A;  4PJN A;  2PTF A;  2XQ3 A;  4NIQ A;  4IDP A;  4WYV A;  1ZV4 X;  2JJ9 A;  3VRB A;  2E2A A;  3AAE B;  4OYJ A;  3R6N A;  2ACZ A;  5H6R B;  3PUV F;  1KNR A;  1T7S A;  5AQF B;  4DR2 T;  2D9D A;  2A9U A;  4JEU B;  1G73 A;  2HN1 A;  2LE8 A;  1IBM T;  1ZKE A;  2G0U A;  5E0O A;  2NW7 A;  3TLU A;  4B3M T;  4AXP A;  3LBX B;  2XTL A;  4I55 E;  3HKE E;  5FNV E;  1D1A A;  3ETV A;  3N9L A;  4EGW A;  2A2F X;  1HTJ F;  4KP3 C;  1D0Z A;  2YK0 A;  4G2A A;  4HWH A;  1IBL T;  2LEH A;  2DLR A;  4X5T A;  1OED A;  3O4X E;  2P9B A;  3QB5 K;  4DV6 T;  1HNZ T;  4ILB A;  2RP4 A;  4HWF A;  5AQH B;  5AQI B;  3LJC A;  2LHR A;  1R8I A;  2BS4 A;  5LMN T;  4IE0 A;  4GOU A;  5FXW A;  4DO0 A;  2WWV A;  1HNW T;  3NVO A;  1KNZ A;  4TN7 B;  2WQY A;  2Q9Q B;  3AE2 A;  3BK9 A;  3LDQ B;  2OA5 A;  3E22 E;  4ILA A;  4PAG A;  3KDS E;  5F3J A;  3GA8 A;  5L47 A;  3AE9 A;  1FJG T;  4F8H A;  5JQG E;  3PUA A;  4P0A A;  2ODV A;  5F5W A;  3G06 A;  3ABV A;  3R84 B;  4ANJ A;  4DV0 T;  1OWA A;  2CWO A;  2KWH A;  3ZJ1 A;  1MMG A;  1GQE A;  4XAX B;  5KXJ A;  5TAO A;  4ADZ A;  3C98 B;  4TWF A;  3ZT5 A;  3AA0 B;  4KHP T;  2JQQ A;  2AXD S;  1FMV A;  1N32 T;  2NOX A;  5EK3 A;  3EDV A;  3HL6 A;  2LOS A;  4IDN A;  4QH1 A;  4NXN T;  3CIR A;  3N9Q A;  1KEY A;  3F2E A;  3RC3 A;  5AQP B;  2LRL A;  2KT9 A;  2DNX A;  5L3F B;  2DHR A;  5A1L A;  5L3E B;  4K0U A;  4PK6 A;  2VKJ A;  2BBJ A;  2KZ7 B;  2XHE B;  3TLT A;  4LF4 T;  3AEE A;  4IE5 A;  2XSA A;  4U7Y A;  3FZH B;  4H9R C;  2X9W A;  5FXX A;  3ZN1 B;  3SOL A;  1OED B;  5ETW A;  4EXT A;  2WDQ A;  5ABH A;  4IDQ A;  5LJM A;  4EED A;  3FHN A;  4L9I A;  1ZEE A;  3CX7 B;  3ZCJ A;  4I0U A;  4DUY T;  1HCI A;  3T1H T;  2BG9 C;  3E0Z A;  3WAK A;  4LML A;  4CXW A;  4A97 A;  5C2T A;  3P4R A;  5L3B B;  3EI0 A;  4IRE A;  5LBM A;  4LF5 T;  4UVA B;  2MPK A;  3QOF A;  1V9D A;  4PJM A;  2LT3 A;  4DR3 T;  2DL1 A;  4PJJ A;  2V5C A;  2N1G A;  1N34 T;  5FP3 A;  3T8O A;  4CN1 A;  3C50 A;  3EAB A;  3CQG B;  2UUC T;  4LMK A;  3ANW A;  3ZST A;  2OV9 A;  4IE6 A;  4JI1 T;  1IJ5 A;  3RIU C;  5LMU T;  2X67 A;  4G63 A;  3BQI A;  4JI8 T;  3LSV A;  5EK4 A;  5DQW A;  2X0H A;  5FY7 A;  4YT0 A;  5HEO A;  3VR8 A;  4AQF C;  5F8P A;  4LF8 T;  3PJA J;  4UIG A;  1HG5 A;  4EZH A;  2D2S A;  1E1H B;  4U33 A;  4V1A v;  2R6G F;  4DID B;  4LFC T;  1CUN A;  5C8Y E;  3LK4 2;  2IML A;  2CHO A;  4NXM T;  5IYZ E;  2IC6 A;  2V7K A;  1QUU A;  2IUB A;  4HTE A;  4ZI2 D;  2M6B A;  3PUR A;  4JEH B;  4HFD A;  4AIU A;  2EHO D;  1W09 A;  3ESL A;  3KBT A;  3PUW F;  3RIA A;  1W0A A;  3AXJ A;  4YY3 T;  3K3O A;  3V5S A;  3FZL B;  3PDY A;  4L5G A;  4U72 A;  1G8X A;  3NZP A;  3OKQ A;  4B3S T;  4PFP A;  1I94 T;  2FJE A;  4ZXL A;  3I0O A;  3N9N A;  2WMO A;  3AA6 B;  4ILU A;  4C90 A;  4HE8 A;  3Q9D A;  2CLY C;  2LRK A;  2JPF A;  5ABG A;  2DCF A;  3RGL A;  4TNW A;  4H63 H;  2ZM6 T;  3IEE A;  1I6Z A;  2HHH T;  5LXT E;  5IWA T;  4H9Q C;  3SS1 A;  4QXC B;  3DTO A;  3AE5 A;  3N2K E;  4LF9 T;  4X65 T;  4Z8X A;  2BVM A;  3RF1 A;  2E8I A;  5CJ5 A;  3L39 A;  4BJM A;  2FJD A;  1XNQ T;  3ANW B;  4COF A;  4ZI3 D;  2JIW A;  2BKN A;  5HXE A;  4ZOL E;  1E7P A;  3ZMZ B;  2ZLY A;  1LVK A;  5ABF A;  5IUX A;  2LKH A;  3Q5D A;  5LCY A;  4IDZ A;  3M3Z B;  4DBR A;  4OK0 A;  5JDM A;  4B6X A;  5JDN A;  1DU2 A;  4A56 A;  2XY8 B;  5LBQ B;  1QLB A;  3FB2 A;  5M4Y A;  5AQT B;  4CI2 B;  5HWX A;  1XZY A;  4E7S A;  2WBL A;  3AXJ B;  2CMR A;  2OLT A;  1SUM B;  3WAJ A;  3KVB A;  1MMN A;  2L9Q A;  3P4P A;  3UU8 A;  3PUZ F;  4HFE A;  3LFM A;  2LLY A;  3RQW A;  2YKS A;  4X64 T;  2PJQ A;  3ZYM A;  4EYY R;  2B76 A;  5LHH B;  5ADX L;  1WR6 A;  4DMV A;  3AE8 A;  4YSY A;  2AE9 A;  1HX8 A;  4UVC B;  1MMD A;  4UR9 A;  4AKL A;  5CFB A;  3JC6 D;  3ZYL A;  4N78 D;  2X66 A;  4UV8 B;  2I59 A;  5HEJ A;  3UQ7 A;  5HXC A;  4JUY A;  3PUS A;  2X9H A;  1SA0 E;  4DV1 T;  2Q9Q C;  2X51 A;  1J5W A;  2ZM2 A;  3PE0 A;  1HR0 T;  2CXF A;  2LSY A;  3ZJ2 A;  2UXN B;  2F4V T;  4OHF A;  2J62 A;  4H9S E;  4KX6 A;  2W66 A;  2N2N A;  3P4W A;  4YHH T;  2J47 A;  4X66 T;  3S4U A;  4YSZ A;  2DWK A;  4YTN A;  1U5P A;  4HKA A;  4X1K E;  5ABF B;  3AEA A;  4HFH A;  2XQY A;  2PFV A;  1YKE B;  4CN6 A;  3CX6 B;  2HPJ A;  3AA1 B;  4IE7 A;  4ZI3 C;  1JNR A;  3ZPO A;  2XZE A;  1NWM X;  1W9R A;  5JDQ A;  4JYA T;  3B13 A;  4E7Z A;  3AE7 A;  3CX8 B;  2E9X A;  2X68 A;  4WW0 A;  5L4H A;  4H9N C;  3P50 A;  2N9D A;  3P4S A;  2W4X A;  5AQN B;  2XAQ B;  3ONL C;  4QH4 A;  1WCR A;  1O3X A;  2BKO A;  1Z8U A;  4GK5 E;  4U2Y A;  1MNE A;  4EB6 E;  3UUX B;  2Y6X A;  1X79 A;  4F6R C;  3L3P A;  2BVL A;  2IW5 B;  5LNK A;  3RQU A;  2VVS A;  3Q5W A;  2VUR A;  4BA9 A;  4YFS A;  1SE7 A;  4JI2 T;  3PTR B;  1Y01 A;  3SFE A;  3C4W A;  1OED C;  5EK2 A;  2KXP B;  2JRK A;  3ZN0 B;  3HR0 A;  2Y8D A;  2WZH A;  4ASK A;  2DI4 A;  1EZ3 A;  3O1J A;  4HEA A;  4GYS A;  2XAJ B;  3X1D A;  4ZZB A;  2CA5 A;  3EDU A;  1XWM A;  1B7T A;  4QWN B;  2WU2 A;  5HWY A;  3AA7 B;  2FJA A;  2W67 A;  3OTO T;  4IE4 A;  4U7I A;  3A7M A;  3JC6 C;  3Q5E A;  4YTP A;  2ODU A;  3P4Q A;  4JI5 T;  2JQK A;  1S94 A;  1US7 B;  4JI7 T;  5DAB A;  3L09 A;  3CWZ B;  2BDE A;  2XAH B;  4B3R T;  3HKC E;  4CXX A;  3LK2 B;  3VRA A;  1FMW A;  4CQI A;  2VL8 A;  3J7Y q;  2LM2 A;  2YIN A;  1XMO T;  4X1Y E;  3OYX A;  2HPL A;  5BMV E; 
#chains in the Genus database with same CATH homology
 1Y64 B;  1HG5 A;  4CI1 B;  3UFE A;  3GWH A;  4EZH A;  5FY0 A;  3I1A A;  4QHO A;  2X9X A;  3U78 A;  3MKD A;  3FBL A;  3OBV E;  5JDH A;  3K8P C;  2D2S A;  1E1H B;  4TX5 A;  1WYC A;  3N5L A;  4EOZ B;  4V1A v;  5AFU L;  2K48 A;  2LSI A;  4P09 A;  1CUN A;  2E9X B;  3FBZ A;  1VRB A;  3LK4 2;  1FEW A;  5C8Y E;  1AJ3 A;  2NP9 A;  5DJQ C;  5IYZ E;  3RYC E;  4AI6 A;  2Y48 B;  2IC6 A;  2V7K A;  2M67 A;  2E9X C;  1QUU A;  4HTE A;  4ZI2 D;  2XUE A;  3LBX A;  2KWI B;  3HKB E;  4CI3 B;  3PUR A;  4JEH B;  4QXB B;  4DBQ A;  5H6Q B;  3KVA A;  4O4I E;  2BZB A;  2EHO D;  5LG4 A;  1HS7 A;  5L3D B;  3ESL A;  4O2B E;  3KBT A;  2H3R A;  2IAK A;  1ZHC A;  4YJ2 E;  3KBU A;  1Z0P A;  3SWH A;  3K3O A;  3CQX C;  3IF8 B;  3F57 A;  3W15 B;  2NTY A;  5JDG A;  3V5S A;  2KMF A;  4AKR B;  2MBG A;  3O1I A;  2ES0 A;  2HH7 A;  4GYR A;  4IST A;  3TKL B;  3ZYK A;  5CA1 E;  2NW8 A;  3PDY A;  4L5G A;  2LHN A;  4U72 A;  4I43 B;  1G8X A;  3A5X A;  3NZP A;  3OKQ A;  3ZMV B;  5KDM C;  2CLY B;  3EVY A;  3UUL A;  3OYZ A;  4ISS A;  3GN5 B;  1UX5 A;  4PFP A;  3Q2M A;  3M65 A;  2EHO B;  3I0O A;  2XAG B;  3VKH A;  4UVB B;  4ZI2 C;  3N9N A;  2WMO A;  3AA6 B;  3H3A A;  4H9O C;  4ILU A;  4HE8 A;  5GON E;  4C90 A;  4ERR A;  3Q9D A;  2ZM0 A;  1HG2 A;  2CLY C;  2JPF A;  4YJ3 E;  2DCF A;  4MAL A;  4U74 A;  4FI5 A;  3C4X A;  3NRY A;  2EHO C;  2RA1 A;  4H63 H;  3IEE A;  2D0T A;  5LXT E;  2VWA A;  3O1H A;  5LYJ E;  4TUY E;  4H9Q C;  3SS1 A;  2LJL A;  1BR0 A;  2B1E A;  2IC9 A;  2D5U A;  4H63 V;  2Q9Q A;  5CB4 E;  4HFV A;  2L8K A;  4QXC B;  5JDF A;  3DTO A;  1SHZ C;  2CEA A;  4IHJ E;  3PU8 A;  4MLK A;  2QA7 A;  4I4T E;  5JVD E;  4O8S A;  1MMA A;  3DJB A;  1MIY A;  3UUM A;  3N2K E;  5HXH A;  4WBO A;  5IHY A;  3GMI A;  3ZC1 A;  3ZEF B;  4EAH A;  4O4J E;  4Z8X A;  1VOM A;  1D0Y A;  2BVM A;  3NZQ A;  4PW8 A;  4EZ4 A;  2E8I A;  3HA4 A;  2C5I T;  3RC8 A;  2LOP A;  3N9P A;  4BJM A;  5LHG B;  2L3L A;  4IGU A;  4UEM A;  3ANW B;  2H7V C;  2CM0 A;  1MND A;  4PJL A;  3FXE B;  4ZI3 D;  2PG8 A;  4OFZ A;  3KV6 A;  2X9Y A;  3MK7 C;  4GK0 E;  5HXE A;  4ZOL E;  2KIN B;  3C4Z A;  3CVR A;  3N9M A;  3ZMT B;  4KUM B;  3ZMZ B;  4O4L E;  2ZLY A;  3RYF E;  2ZM8 A;  1LRZ A;  1LVK A;  1MIW A;  3UTK A;  2C5J A;  1IJ6 A;  4PJN A;  3BQL A;  1HF8 A;  2WSS V;  3BQK A;  3F31 A;  1ZV4 X;  5LCY A;  2JJ9 A;  4TV8 E;  4I50 E;  4IDZ A;  4O2A E;  3AAE B;  1OXZ A;  3AVS A;  4OYJ A;  3R6N A;  3RH3 A;  5H6R B;  3KFW X;  4UXN B;  1D0X A;  4XBF B;  4DBR A;  2W62 A;  4UEL A;  3PUQ A;  3N9O A;  4OK0 A;  5JDM A;  3IHR A;  4B6X A;  4J2C A;  5JDN A;  4A56 A;  2UXX B;  5LBQ B;  3NRX A;  4MHC A;  4JEU B;  2VKH A;  2NWB A;  2YU2 A;  2W0G A;  3ONX A;  1G73 A;  3RYI E;  3FB2 A;  2K5B B;  5M4Y A;  2K24 A;  2LE8 A;  3RX6 A;  4QX7 B;  3QK6 A;  3CQC B;  2YU1 A;  3UT5 E;  4CZZ B;  3ZMU B;  1YKH B;  2ZMA A;  4YLH A;  3DP7 A;  1ZKE A;  2Z6E A;  2G0U A;  2XAS B;  4PFO A;  3ZMS B;  5E0O A;  2NW7 A;  2W00 A;  4AXP A;  4CI2 B;  2KND A;  2CWY A;  3LBX B;  2C0S A;  5HWX A;  3MZK B;  2XTL A;  4PK4 A;  4I55 E;  3HKE E;  4WBN E;  4E7S A;  5FNV E;  5LGU B;  1D1A A;  2WBL A;  3ETV A;  1NAF A;  3N9L A;  2A2F X;  1HTJ F;  4KP3 C;  1D0Z A;  2YK0 A;  4G2A A;  2CMR A;  2V26 A;  1UCU A;  5L3C B;  5JRE A;  3WAJ A;  3CML A;  1YW0 A;  2VK9 A;  3KVB A;  1MMN A;  2LEH A;  2DLR A;  2QGS A;  1UX4 A;  2L9Q A;  5JRC A;  4KMC A;  2H7O A;  4PK5 A;  2A72 A;  3LFM A;  2DWG A;  5HAX A;  4X1I E;  2LSK A;  1KK7 A;  2PJQ A;  2Q9Q D;  3O4X E;  5FMN A;  2P9B A;  3EUH A;  2GK9 A;  3ZYM A;  4EYY R;  1MIV A;  4QX8 B;  4IIJ E;  5LHH B;  1BR2 A;  3OJA A;  5ADX L;  3AAA B;  1WR6 A;  5HXS A;  3MJX A;  4DMV A;  2RP4 A;  3LG7 A;  1S35 A;  5LGT B;  2ACX A;  5FXZ A;  5LA6 E;  3LJC A;  2LHR A;  3IBP A;  4AQG A;  3VHL A;  3I0Q A;  2LM9 A;  1HX8 A;  4IE0 A;  4UVC B;  1MMD A;  4UV9 B;  4AKL A;  3MAC A;  3JC6 D;  4X20 E;  3ZYL A;  4GIW A;  4GOU A;  4N78 D;  2NTX A;  5FXW A;  2X66 A;  4UV8 B;  4DO0 A;  5CA0 E;  3PU3 A;  1KNZ A;  4TN7 B;  3BK9 A;  1BR1 A;  2Q9Q B;  4DND A;  2X0L B;  2I59 A;  2OA5 A;  4KBM B;  5HXC A;  4DVD A;  4JUY A;  3PUS A;  3KV4 A;  2X9H A;  4M1P A;  1SA0 E;  3E22 E;  5J1G A;  5LJN A;  1T98 A;  3PUG A;  2Q9Q C;  4PAG A;  3ETU A;  3KDS E;  2X51 A;  2ZM2 A;  3PE0 A;  1WRD A;  3VU7 H;  5F3J A;  3GA8 A;  2CXF A;  2LSY A;  4BAY B;  3ZJ2 A;  2UXN B;  3LK3 B;  4UF0 A;  5EZY E;  3B57 A;  3C64 A;  5KMG P;  5JQG E;  4OHF A;  5JR9 A;  4H9S E;  3PUA A;  4PNI A;  4ZS3 A;  2N2N A;  4P0A A;  2ODV A;  5FYM A;  2VKO A;  3S4U A;  3R84 B;  4ANJ A;  3HKD E;  2DWK A;  1OWA A;  2CWO A;  1U5P A;  4HKA A;  1U4Q A;  2KWH A;  2MOZ A;  4X1K E;  3ZLI A;  4AQF A;  5FY1 A;  3ZJ1 A;  3U3I A;  1MMG A;  3P7I A;  3O9X A;  4QKN A;  2XQY A;  4XAX B;  4ZI7 E;  5TAO A;  2WM9 A;  2V7L A;  2PFV A;  3NBX X;  4TZ4 C;  3ZCI A;  4ZHQ E;  4EIW A;  3KV9 A;  5LOV E;  4ADZ A;  4WNK A;  3C98 B;  5FXV A;  1YKE B;  3RRW A;  3CX6 B;  3AA0 B;  4XZC A;  2HPJ A;  3AA1 B;  4IE7 A;  4ZI3 C;  2JQQ A;  3ZPO A;  4YHJ A;  4AKI A;  1FMV A;  4MBQ A;  5J2U E;  1NWM X;  2CXL A;  2NOX A;  5JDQ A;  2CXD A;  2CCQ A;  4QXH B;  5EK3 A;  2YEV C;  3B13 A;  4E7Z A;  1D1C A;  3WI3 A;  4P0B A;  3CX8 B;  2E9X A;  2X68 A;  3EDV A;  3HL6 A;  3UUN A;  2LOS A;  3N2G E;  3QC9 A;  4WW0 A;  4TV9 E;  4H9N C;  4AKH A;  5L3G B;  2MYS A;  3I9Y A;  5LP6 E;  2N9D A;  2VAS A;  3KV5 A;  3D0T A;  2WWU A;  3N9Q A;  5KX5 E;  3F2E A;  3RC3 A;  4EYU A;  4CXY A;  2VB6 A;  4NUU A;  3AB3 B;  3RRC A;  2JMH A;  2KT9 A;  2XAQ B;  2DNX A;  4OYK A;  5L3F B;  2DHR A;  5A1L A;  5JDL A;  5L3E B;  1O3X A;  3CKD A;  4K0U A;  4ZS2 A;  4GK5 E;  4EB6 E;  1WLX A;  1MNE A;  4PK6 A;  2VKJ A;  2KLQ A;  3UUX B;  2KZ7 B;  2WAU A;  2Y6X A;  5L2L A;  4L0R A;  2J1D G;  1X79 A;  4F6R C;  2XHE B;  2W61 A;  3L3P A;  4IE5 A;  2CE7 A;  3KIN B;  2BVL A;  2SPC A;  4NUV A;  2IW5 B;  5LNK A;  4H9R C;  2X9W A;  5FXX A;  3ZN1 B;  3Q5W A;  3RKO A;  3SRZ A;  3SOL A;  5JRC B;  3AVR A;  2V7J A;  4BA9 A;  1WYB A;  2C5K T;  4H9P C;  5ETW A;  4EXT A;  4YFS A;  2LSJ A;  3PTR B;  3GN5 A;  5LJM A;  1LKX A;  2EHO A;  3C4W A;  3VKG A;  5EK2 A;  3FHN A;  2V7M A;  4L9I A;  1ZEE A;  4AKG A;  3CX7 B;  3ZCJ A;  2KXP B;  1BR4 A;  2JRK A;  2VKD A;  3P8C D;  1HCI A;  3ZN0 B;  4BJN A;  3E0Z A;  3HR0 A;  3WAK A;  2D0U A;  2V7I A;  4CXW A;  2Y8D A;  3N2O A;  2A3D A;  4ASK A;  5L3B B;  3I9W A;  2DI4 A;  1EZ3 A;  2NW9 A;  5LBM A;  4UVA B;  5JH7 E;  3O1J A;  1V9D A;  4HEA A;  2LT3 A;  3C51 A;  4PJM A;  4GYS A;  2XAJ B;  2MTQ A;  2WMN A;  5HYA A;  3FXD B;  2CA5 A;  3MXZ A;  3EDU A;  4PJJ A;  4MFR A;  3K3Q C;  1B7T A;  1YD8 G;  2N1G A;  1HFA A;  4QWN B;  1LVF A;  5FP3 A;  4C91 A;  3T8O A;  5HWY A;  3C50 A;  3RPU A;  1IZN B;  3V5U A;  3AA7 B;  5HXR A;  5J2T E;  3CQG B;  3E08 A;  4FJO A;  3H37 A;  4UF0 B;  2JMK A;  4JLE A;  4IE4 A;  3ANW A;  5JR9 B;  3JC6 C;  2ODU A;  4IE6 A;  3MA9 A;  3RYH E;  3HI2 A;  1IJ5 A;  3QUJ A;  2K9A A;  2X67 A;  4G63 A;  1QSD A;  1S94 A;  1US7 B;  5JR9 C;  5DAB A;  4HGA A;  3L09 A;  3CWZ B;  2BDE A;  2W63 A;  5LGN B;  2XAH B;  3BQI A;  4DMW A;  3Q5X A;  1H7C A;  3HKC E;  1IAP A;  2LSG A;  5EK4 A;  4CXX A;  2V1D B;  4HN9 A;  2XAF B;  2E9X D;  5DQW A;  3LK2 B;  5FY7 A;  1FMW A;  3J9X 1;  4O4H E;  1FIO A;  4CQI A;  2VL8 A;  2PBI A;  4AQF C;  3K3N A;  3J7Y q;  5F8P A;  2YIN A;  3AAI A;  3CPZ A;  5LHI B;  4UIG A;  4X1Y E;  5DQV A;  1D1B A;  3OYX A;  2HPL A;  3ZC0 A;  5BMV E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...