4KMCA

Structure analysis of m. tuberculosis rrna transcriptional regulator card and its interaction with t. aquaticus rna polymerase-beta1 domain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
79
structure length
79
Chain Sequence
TNWSRRYKANLEKLASGDVNKVAEVVRDLWRRDQERGLSAGEKRMLAKARQILVGELALAESTDDAKAETILDEVLAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the carboxy-terminal domain of Mycobacterium tuberculosis CarD protein: an essential rRNA transcriptional regulator
doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
molecule keywords RNA polymerase-binding transcription factor CarD
total genus 34
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2013-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1290 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4kmcA00
4MFRA 4XAXB 4ILUA 2LT3A 4KMCA 4KBMB 4L5GA
chains in the Genus database with same CATH superfamily
3UUNA 2W62A 2ZM2A 3EDVA 1H7CA 4EYUA 3ZC1A 3CWZB 4DUYT 1UGOA 4Q25A 4IDQA 5DJQC 2CBIA 5J1GA 5JVDE 2QVAA 1X9BA 2X68A 4UEMA 1FIOA 4I4TE 2BBJA 3AA0B 1IZNB 3QNUA 5FXXA 2WSSV 5LMUT 2YKSA 2WQYA 3PUQA 2BG9B 3ZYKA 2XY8B 3H37A 3ZT7A 1AJ3A 4NXNT 2Q9QC 3ABVA 5FL1A 2CHNA 4JBWF 5LGNB 2A3DA 2VKHA 3N9PA 3O1HA 2W2UA 4HTEA 3ZT5A 5JDGA 5KMGP 1N34T 3AE5A 1I94T 2HPJA 3TLUA 4KMCA 4LF7T 2ACXA 1NEKA 2MYSA 2C5JA 4YSYA 5ABFA 4DV4T 4DVDA 4EEBA 5HEJA 4JI3T 3JADA 3FB2A 1KF6A 3OPCA 2WWVA 4BAYB 2W4XA 5IYZE 4JI8T 2AXDS 3Q5EA 5AQKB 3OYZA 5L4EA 4JI7T 4JV5T 2ODUA 4U7YA 4DMVA 4U72A 3P7IA 3PUVF 2VKDA 5HEOA 2V6YA 5LOVE 3ZSSA 5LMNT 2FJAA 3O1JA 1HNZT 2Q9QB 2C0SA 4AXPA 1E2AA 4PJNA 2GK9A 2A9UA 2W61A 3LJCA 3OKQA 4TX5A 4WNKA 5AQMB 5AQQB 2Y6XA 5FNVE 2NW9A 2RP4A 5L3CB 2XPKA 3ZMZB 5L3DB 2XSAA 4FI5A 2FJBA 4KHZF 4AKLA 2ODVA 1SHZC 1MNDA 2LE8A 2HN1A 3NBXX 4M1PA 2J1DG 4PJLA 4V1Av 5HCMA 4EB6E 5AQGB 3K8PC 1D0YA 1SA0E 3BQLA 3PV0F 3EABA 4Z91A 5EK4A 5CGMA 4UV9B 4X65T 1CHUA 3AEFA 3VHLA 3AE3A 2X0LB 3RC8A 1S35A 1VRBA 4CN4A 1HTJF 3OBVE 2V7LA 4YSXA 2NWBA 3PE0A 2Y48B 5LNKA 2UXXB 4YSZA 2ES0A 4NUUA 2ZM6T 4LF5T 2JQ9A 1G73A 3OJAA 4IDPA 3KVAA 4ADZA 1LRZA 3MZKB 4DR3T 4JEHB 3O9XA 5KXJA 4QH5A 5FP3A 4ZZBA 4AISA 3KBTA 2LSJA 1XMQT 1WR6A 2WZHA 3KINB 5F3JA 5J2UE 3C98B 2D2SA 1D0XA 4IT4A 2VK9A 5CJ5A 4IE7A 4FJOA 4U2YA 4LMLA 5ADXL 2FUPA 4TZ4C 3CIRA 1LVKA 3SFEA 4A97A 5L47A 5L3BB 5LGUB 4AKIA 1LVFA 1IAPA 2W67A 2LRLA 2XUEA 4HE8A 3UU5A 3KVBA 2C5KT 4H63V 1N32T 4PK5A 3PU3A 2X9HA 1QLBA 4P09A 2IIUA 2PG8A 3L39A 2QGSA 2V5DA 2OLTA 3MKDA 4YJ2E 2WU2A 5HWXA 3CX6B 4GK0E 1BR1A 2LSKA 2XAQB 4CQIA 1GQEA 5C3JA 4YHHT 4HEAA 1J5ET 4LF4T 1UX5A 5FKYA 2UXDT 3ZT6A 3EI0A 2KXPB 2LKHA 3DJBA 1KNRA 4PJJA 3GN5B 4HFEA 3TKLB 3KDSE 4H9RC 2E9XD 2LEHA 1Z0PA 2BBHA 2JPFA 3PJAJ 5L3GB 5KDMC 2VQET 3K3OA 4IHJE 1WCRA 2W63A 2LKGA 5AQPB 1MMGA 4H63H 4EV6A 4BJNA 3C4XA 2X9WA 4AQFC 3NZPA 2KWIB 2YINA 3I1AA 2HPLA 3ZMVB 4YT0A 3AVSA 2V7KA 3NKZA 2E5VA 2KZ7B 2XQ6A 3N2OA 1FMVA 4E7SA 3SWHA 2IC6A 3ANWB 3ZLIA 3P4SA 1HR0T 5F5WA 2V8SV 3FXEB 3JC6C 4B6XA 4HWFA 4QKNA 3M3ZB 3G06A 4NPPA 5BMVE 4ZI7E 1UCUA 2D0UA 2LRKA 4EZ4A 1W0AA 3UUBA 3GWHA 2XAFB 3RYFE 2XQYA 4DBQA 3PUXF 4I43B 1JNRA 4CZZB 5AQRB 2DI4A 3EVYA 2WDQA 4HWCA 2X0YA 2YDQA 3K3NA 5C8YE 2BG9E 3TLSA 1IJ5A 4F8HA 3N2KE 1MNEA 2I6HA 2XQAA 3E0ZA 3VR8A 2CMRA 3UFGA 2KWHA 5LHGB 2JQKA 1J1JA 4X5TA 1N33T 2I59A 3RYHE 2E9XB 3ZKRA 1QSDA 4K0KT 1B7TA 3GMIA 4LFCT 2V1DB 4DNDA 4EXTA 5FL0A 1W09A 1VCTA 3AEGA 4HFVA 3AXJA 3CKDA 5AFUL 5JR9B 3QB5K 2VVNA 3K3QC 4YTPA 1N36T 1NAFA 2CBJA 3P50A 2X9XA 3ETUA 3AE8A 3FBLA 4DR7T 2BZBA 3PUAA 4X66T 2J47A 4DV7T 2NTYA 3HKBE 3MJXA 3R84B 3LDQB 4GKJT 3DP7A 5GONE 3B13A 4CI2B 4C90A 5AQNB 1CUNA 1HFAA 4HFIA 2BVLA 4QXHB 3P4QA 3IA3A 2VQFT 2XAJB 4QWNB 2E9XC 5EZYE 3UQ7A 2BDEA 2C5IT 2XZEA 3ONXA 3X1DA 4U7IA 1HX1B 4ERRA 3P4PA 2VL8A 2LLYA 2X67A 5JR9C 4A56A 4ILBA 4MFRA 3ZMUB 5A1LA 4YY3T 4CN6A 3CQGB 4JI0T 3UTKA 2DCFA 2NW8A 3AA6B 1HNWT 1Y01A 5AQSB 5JTGA 3I0OA 3C4ZA 3U3IA 3AE9A 1OEDA 1XNQT 2V26A 4QHOA 4PFPA 5J2TE 3J7Yq 2PBIA 4DIDB 1YXRA 2YK0A 1YQ3A 4KI0F 2VURA 4QXCB 4HGAA 3Q5XA 3UUMA 5ABFB 5LJNA 2V7IA 3LBXA 3CQXC 1D1BA 2WDVA 3EHZA 3FXDB 3RH3A 3VR9A 5CA1E 4DR5T 3IHRA 4E7ZA 4HWDA 1YW0A 3RIUC 1LKXA 1VCSA 2B76A 3FHNA 4TWHA 2H7VC 3Q5DA 4IGUA 2CRBA 2W0GA 1MMDA 3I9YA 4UV8B 4ANJA 2XHEB 3HL6A 4XZCA 5TAOA 3RQUA 1MMNA 4DR1T 1MIWA 1XWMA 2CE7A 2V6YB 4J2CA 3LFMA 4P0AA 4DO0A 3AA1B 4EYYR 3QC9A 2KMFA 4XBFB 4TN7B 4IDZA 2Y8DA 3E22E 4GOUA 2VVSA 2UU9T 5JDHA 4OX9T 3N9NA 4DV0T 5AQFB 4KHPT 2JQQA 3CX8B 1YD8G 2PTFA 3V5SA 2H88A 4X64T 2M6BA 2EHOB 3SOLA 3K1SA 1WLXA 2LT3A 5HEHA 2J62A 2XQ5A 2JRKA 3MK7C 4HFBA 4I50E 1FMWA 4ZS2A 1MIYA 1G8XA 1W9RA 3CPZA 2LM2A 2WM9A 3EAMA 4N78D 4EOZB 2HHHT 2D0TA 1V9DA 2Z6EA 4ILCA 4EEDA 3N9LA 4H9NC 4ZS3A 5L3EB 2VWAA 2WBLA 4IDNA 2N2NA 4JUYA 4C91A 3LK3B 3PUGA 4TWFA 3Q2MA 3WAJA 2LJLA 3ZEFB 2WZIA 1KK7A 4KX6A 2BS4A 4HWHA 4LF9T 4HFDA 2F4VT 2JQHA 4IL9A 5ETWA 5JRCB 4TNVA 4UF0B 5JDQA 1XMOT 3E08A 4G63A 2IAKA 2NW7A 4YHJA 2R6GF 4PAGA 4GYSA 2EHOC 4NUVA 4X62T 2WCAA 3Q9DA 3IF8B 2LOPA 3FZMB 4JEUB 2X9YA 4UR9A 4A98A 3IEEA 2RA1A 5ABHA 4PW8A 3AEDA 3O4XE 3EUHA 2BKPA 1IJ6A 5JDMA 2BG9A 2JIWA 4LMJA 5AQVB 2VL0A 3F2EA 1KNPA 1X79A 3NRXA 2E8IA 2CHOA 4H9SE 5ABGA 2IDOB 4LF6T 2CM0A 3OVUA 3TLWA 4A5XA 5LGTB 1MIVA 2N9DA 4CI3B 3TLVA 2VKJA 5LJMA 1ZEEA 3NRYA 4DBRA 3AAIA 2LSGA 4LF8T 2LOSA 3N9QA 4JYAT 3JC6D 3RC3A 2DHRA 4YFSA 3RF1A 3S4UA 3MACA 3VKGA 2V7JA 5FXZA 4AQGA 3UUXB 4TUYE 1ZKEA 2E5LT 3AEAA 2QRXA 1NWMX 3N2GE 5AQHB 5HAXA 4DV5T 2CXLA 2XQ8A 3KV4A 4DUZT 4GIWA 2CPTA 1HG2A 2EHOD 2ZLYA 2KLQA 3AB3B 2CCQA 4QH4A 2A2FX 3P4RA 2XTLA 2UXNB 5FYMA 4IE5A 1D0ZA 4ZI3D 4GKKT 2HH7A 3ZSTA 3ZC0A 1US7B 2PFVA 4HFHA 3RRWA 2JJ9A 3AE7A 5LXTE 2K3WA 3OYXA 4P0BA 3QUJA 2K5BB 2X66A 2YU1A 3B5MA 2BKOA 2ZM8A 3OTOT 4EIWA 3RIFA 4CXXA 5LG3A 4HN9A 4KBMB 1R8IA 3CQCB 5HEGA 5LHIB 4DV2T 2V7MA 1VOMA 3C4WA 3AA7B 3ESLA 3AVRA 2DWKA 3M65A 2XQ7A 4O4LE 1ZOYA 4DR6T 1HS7A 3GA8A 1D1AA 2X0HA 2X51A 3AECA 3PJAA 3RPUA 4DV1T 2FJEA 2W66A 3F57A 4UVCB 5IHYA 2K48A 4QXBB 3V5UA 2MTQA 2OV9A 1SUMB 3DTOA 1HX8A 3EDUA 4QX8B 1Z8UA 5IWAT 3CMLA 2RPAA 5FY0A 1ZHCA 1UURA 3AXJB 3HR0A 1UX4A 2WB5A 5DQVA 4H9OC 4OFZA 5HEUA 4PFOA 1FJGT 3RRCA 3TLTA 4YTMA 2I0MA 5JDNA 2XAHB 4K0UA 2XM1A 4P1NA 5ABEA 2KINB 3AEEA 1XDOA 1IBLT 2KNDA 4X1YE 5AQOB 5FXWA 1E7PA 4JI5T 4H9QC 4MLKA 1T72A 5LA6E 3JCFA 4HWIB 3RIAA 5L3FB 3LK2B 4EAHA 4AKGA 3KV9A 4PK4A 3QOFA 2E2AA 4WBNE 2WS3A 3QB5A 4ZZCA 2NP9A 4LFBT 4O2BE 1BR0A 5LB7B 2V6XA 1XZYA 2VASA 5CB4E 1L0VA 3WI3A 4EZHA 3RIUA 5LBQB 1U4QA 1YQ4A 3BQIA 4YLHA 2ACZA 2W00A 4BJMA 1ZV4X 2XQ3A 2OA5A 2WY2A 2JMKA 3L09A 2L8KA 3PTRB 3BQKA 4JLEA 4BA9A 2VB6A 2MOZA 2FBWA 4U31A 5HWYA 4HKAA 4ILAA 4ASKA 4F6RC 4COFA 4AKHA 4ZI2D 1OEDB 4JI2T 5M4YA 3R6NA 1YKEB 2CXDA 2WWUA 2QYWA 2BS2A 3ETVA 5LCYA 4AQYT 2DLRA 3AAAB 3ZPOA 4B3TT 4ZEYA 3RYIE 2CXFA 3ZCJA 3BK9A 4HFCA 3H3MA 5DQWA 2JMHA 3KFWX 3RX6A 4UXNB 3C64A 5HCJA 2YU2A 3JAFA 3PURA 2MBGA 4UIGA 4WZXA 3RLFF 3W15B 5HXSA 2K24A 2L3LA 5H6QB 3RQWA 3FZLB 3IBPA 4CN1A 2A72A 2XSBA 4TWDA 3T1HT 1I6ZA 2H89A 4ZI2C 2H7OA 1OXZA 4GYRA 5CFBA 4I55E 4O2AE 1XNRT 3GN5A 3UU8A 4JI4T 2WU5A 5L2LA 4CXYA 3VRBA 1UUSA 5JREA 3LK42 5CA0E 1OEDC 4CI1B 4L0RA 4JI1T 3PUYF 5LG4A 4DV3T 4ISTA 5EK3A 2UUCT 5JDFA 4EGWA 5AQIB 2P9BA 5J0ZA 1ZP0A 4ISSA 4YJ3E 4GK5E 3F31A 2Q9QA 1T7SA 1WRDA 2AE9A 2D5UA 2HN2A 2DWGA 3T8OA 4X1IE 2IHR1 1Y64B 3RGLA 3UU4A 3ZMTB 3CK6A 4ZHQE 4MHCA 2KSRA 4JI6T 2VKOA 3PUZF 4X1KE 5JH7E 1QUUA 3LG7A 3NWIA 4MBQA 5H6RB 4ZI3C 2E9XA 1NENA 1WFDA 3AE2A 3ZN0B 1O3XA 1IBMT 1WYBA 3T1YT 2LM9A 2H3RA 3ZN1B 3KBUA 3A8YC 1BR4A 4DV6T 3ONLC 1IBKT 1WR0A 2N1GA 3JAEA 5E0OA 2ZM0A 1HG5A 2L9QA 3QK6A 4B3MT 5FVKA 2KT9A 3I0QA 3ZYLA 3RKOA 4B3RT 2XM2A 3A5XA 2YDSA 3MXZA 2SPCA 4WYVA 4IE4A 4PK6A 3WAKA 3UQ4A 4QH1A 2WAUA 4UVAB 4IE0A 2M67A 4I0UA 5JR9A 3ZJ2A 1OEDE 5AQLB 5FMNA 2UUBT 2UUAT 2NOXA 3VU7H 4YXDA 3A7MA 4IE6A 3D0TA 2IW5B 4IDOA 3N9OA 3C51A 2CWYA 5EK2A 2CWOA 4O8SA 5IUXA 3UU6A 3NVOA 1W0BA 1KFYA 4OK0A 4IL4A 5AQJB 4WW0A 4B3ST 3FZHB 2D9DA 1EZ3A 2XASB 1HF8A 2XQ4A 5BR8T 5HYAA 2MPKA 4U2ZA 2BKNA 4Z8XA 4CXWA 2ZMAA 2YN6A 3AE1A 2NTXA 3MA9A 1E1HB 3AAEB 3HA4A 3Q5WA 5FY1A 2CLYC 2K9AA 4OYKA 5FVLA 4PNIA 2QA7A 3PDYA 5FY7A 3NZQA 3J9X1 1U5PA 2CA5A 1KEYA 4G2AA 3HI2A 2BS3A 3VKHA 4AKRB 2G0UA 5LYJE 2Q9QD 4L5GA 2B1EA 4DR4T 4MALA 3PUWF 3CX7B 4IIJE 5JDLA 1FEWA 2WMOA 2WP9A 1SE7A 4L9IA 1M7KA 1KNZA 3I9WA 1HCIA 3N9MA 5HXEA 3LBXB 4LMKA 2WMNA 2XAGB 4O4HE 2CLYB 5HXCA 1OWAA 3L3PA 2XJ7A 3RI5A 2IMLA 2V5CA 4TNWA 1D1CA 3ZCIA 3ONJA 1S94A 3CVRA 1BR2A 3FZFB 4UELA 5F8PA 4TV9E 3KV6A 3UFEA 3UT5E 1DU2A 3PUSA 4AIUA 3ANWA 2M6IA 1J5WA 2EHOA 4O4JE 2J4GA 3AE4A 3HKDE 3PU8A 4TV8E 3VRAA 5FXVA 5HXRA 1XDPA 2DL1A 5JQGE 4H9PC 4QX7B 4ILUA 4NXMT 4OHFA 3KV5A 3L8RA 3ZYMA 4O4IE 5C2TA 1UK5A 2IC9A 2IUBA 3RHWA 3ZMSB 1HNXT 1YKHB 2XQ9A 4U33A 3ZJ1A 3P8CD 3HKEE 4U3CA 3HKCE 2BVMA 2YOEA 3B57A 4U74A 4XAXB 3UULA 3FZKB 2FJDA 2LHRA 3SFDA 4NIQA 4AQFA 2LHNA 3SS1A 5LP6E 1JNZA 2NR4A 3LSVA 5LHHB 5JRCA 2MAWA 2DNXA 2PJQA 4OYJA 2UXBT 2YDRA 4YTNA 4UVBB 3AE6A 5KX5E 4PJMA 4AI6A 5AQUB 4LFAT 3UU3A 3RYCE 3P4WA 2YEVC 3H3AA 3RKGA 3AEBA 5DABA 1T8BA 4DMWA 3C50A 3N5LA 2BG9C 1T98A 4DR2T 2CEAA 4ZOLE 5LBMA 3SRZA 1M62A 2LSIA 1MMAA 2LSYA 2WDRA 3O1IA 4KP3C 1WYCA 4UF0A 4ZXLA 5L4HA 3U78A 4X20E 5HXHA 4Z90A 2UXCT 5AQTB 4KUMB 4WBOA 3FBZA 4IREA
chains in the Genus database with same CATH topology
3UUNA 2W62A 2ZM2A 3EDVA 1H7CA 4EYUA 3ZC1A 3CWZB 5JVDE 5DJQC 5J1GA 2X68A 4UEMA 1FIOA 4I4TE 3AA0B 5FXXA 1IZNB 2WSSV 3PUQA 3ZYKA 3H37A 1AJ3A 2Q9QC 2A3DA 2VKHA 3N9PA 3O1HA 4HTEA 5JDGA 5KMGP 2HPJA 4KMCA 2ACXA 2MYSA 2C5JA 4DVDA 3FB2A 4BAYB 5IYZE 3OYZA 2ODUA 4DMVA 4U72A 3P7IA 5LOVE 2VKDA 3O1JA 2Q9QB 2C0SA 4AXPA 4PJNA 2GK9A 3LJCA 2W61A 3OKQA 4TX5A 4WNKA 5FNVE 2Y6XA 2NW9A 2RP4A 5L3CB 3ZMZB 5L3DB 4FI5A 4AKLA 2ODVA 1SHZC 1MNDA 2LE8A 3NBXX 4M1PA 4V1Av 2J1DG 4PJLA 4EB6E 3K8PC 1D0YA 1SA0E 3BQLA 5EK4A 4UV9B 3VHLA 2X0LB 3RC8A 1VRBA 1S35A 1HTJF 3OBVE 2V7LA 2NWBA 3PE0A 2Y48B 5LNKA 2UXXB 2ES0A 4NUUA 3OJAA 1G73A 4ADZA 3KVAA 1LRZA 3MZKB 4JEHB 3O9XA 5FP3A 3KBTA 2LSJA 1WR6A 5F3JA 3KINB 5J2UE 3C98B 2D2SA 1D0XA 2VK9A 4IE7A 4FJOA 5ADXL 4TZ4C 5LGUB 1LVKA 5L3BB 4AKIA 1LVFA 1IAPA 2XUEA 4HE8A 3KVBA 2C5KT 4H63V 4PK5A 3PU3A 2X9HA 4P09A 2PG8A 4YJ2E 2QGSA 3MKDA 5HWXA 3CX6B 4GK0E 1BR1A 2LSKA 2XAQB 4CQIA 4HEAA 1UX5A 2KXPB 3DJBA 4PJJA 3TKLB 3GN5B 3KDSE 4H9RC 2E9XD 2LEHA 1Z0PA 2JPFA 5L3GB 5KDMC 3K3OA 4IHJE 2W63A 1MMGA 4H63H 4BJNA 3C4XA 2X9WA 4AQFC 3NZPA 2KWIB 2YINA 3I1AA 2HPLA 3ZMVB 3AVSA 2V7KA 2KZ7B 3N2OA 4E7SA 1FMVA 3SWHA 2IC6A 3ANWB 3ZLIA 4B6XA 3FXEB 3JC6C 4QKNA 5BMVE 4ZI7E 1UCUA 2D0UA 4EZ4A 3GWHA 2XAFB 3RYFE 2XQYA 4DBQA 4I43B 4CZZB 5LJMA 2DI4A 3EVYA 5C8YE 3K3NA 1IJ5A 3N2KE 1MNEA 3E0ZA 2CMRA 5LHGB 2KWHA 2I59A 3RYHE 2E9XB 1QSDA 1B7TA 3GMIA 2V1DB 4DNDA 4EXTA 5LGNB 5AFUL 4HFVA 3CKDA 5JR9B 3K3QC 1NAFA 2X9XA 3ETUA 3FBLA 2BZBA 3PUAA 2NTYA 3HKBE 3MJXA 3R84B 3DP7A 5GONE 3B13A 4CI2B 4C90A 1CUNA 1HFAA 2BVLA 4QXHB 2XAJB 4QWNB 2E9XC 5EZYE 2BDEA 2C5IT 3ONXA 4ERRA 2VL8A 2X67A 5JR9C 4A56A 4MFRA 3ZMUB 5A1LA 3CQGB 3UTKA 2DCFA 2NW8A 3AA6B 3I0OA 3C4ZA 3U3IA 2V26A 4QHOA 4PFPA 5J2TE 3J7Yq 2PBIA 2YK0A 4QXCB 4HGAA 3Q5XA 3UUMA 5LJNA 2V7IA 3LBXA 3CQXC 1D1BA 3FXDB 5CA1E 3RH3A 3IHRA 4E7ZA 1YW0A 1LKXA 3FHNA 2H7VC 4IGUA 2W0GA 1MMDA 3I9YA 4UV8B 4ANJA 2XHEB 3HL6A 4XZCA 5TAOA 1MMNA 1MIWA 2CE7A 4J2CA 3LFMA 4P0AA 4DO0A 3AA1B 4EYYR 3QC9A 2KMFA 4XBFB 4TN7B 4IDZA 2Y8DA 3E22E 4GOUA 5JDHA 3N9NA 2JQQA 3CX8B 1YD8G 3V5SA 2EHOB 3SOLA 1WLXA 2LT3A 4ZS2A 3MK7C 2JRKA 4I50E 1FMWA 1MIYA 1G8XA 3CPZA 2WM9A 4N78D 4EOZB 2D0TA 1V9DA 2Z6EA 5L3EB 3N9LA 4H9NC 4ZS3A 2VWAA 2WBLA 2N2NA 4JUYA 4C91A 3LK3B 3PUGA 3Q2MA 2LJLA 3ZEFB 1KK7A 5ETWA 5JRCB 4UF0B 5JDQA 3E08A 4G63A 2IAKA 2NW7A 4YHJA 4PAGA 4GYSA 2EHOC 4NUVA 3Q9DA 3IF8B 2LOPA 4JEUB 2X9YA 3IEEA 2RA1A 4PW8A 3O4XE 3EUHA 1IJ6A 5JDMA 3F2EA 1X79A 3NRXA 2E8IA 4H9SE 2CM0A 5LGTB 1MIVA 2N9DA 4CI3B 2VKJA 1ZEEA 3NRYA 4DBRA 3AAIA 2LSGA 2LOSA 3N9QA 3JC6D 3RC3A 2DHRA 4YFSA 3S4UA 3VKGA 3MACA 2V7JA 5FXZA 3UUXB 4TUYE 1ZKEA 1NWMX 3N2GE 5HAXA 2CXLA 3KV4A 4GIWA 1HG2A 2EHOD 2ZLYA 2KLQA 3AB3B 2CCQA 2A2FX 2XTLA 2UXNB 5FYMA 4IE5A 1D0ZA 4ZI3D 2HH7A 3ZC0A 1US7B 2PFVA 3RRWA 2JJ9A 5LXTE 3OYXA 4P0BA 3QUJA 2K5BB 2X66A 2YU1A 2ZM8A 4EIWA 4CXXA 5LHIB 4HN9A 4KBMB 3CQCB 2V7MA 1VOMA 3C4WA 3AA7B 3ESLA 3AVRA 2DWKA 3M65A 4O4LE 1HS7A 3GA8A 1D1AA 2X51A 3RPUA 3F57A 4UVCB 3V5UA 5IHYA 2K48A 4QXBB 2MTQA 3DTOA 3EDUA 1HX8A 4QX8B 3CMLA 5FY0A 1ZHCA 3HR0A 1UX4A 5DQVA 4H9OC 4OFZA 4PFOA 3RRCA 5JDNA 2XAHB 4K0UA 2KINB 2KNDA 4X1YE 5FXWA 4H9QC 4MLKA 5LA6E 5L3FB 3LK2B 4EAHA 4AKGA 3KV9A 4PK4A 4WBNE 2NP9A 4O2BE 1BR0A 4EZHA 2VASA 5CB4E 3WI3A 5LBQB 1U4QA 3BQIA 4YLHA 2W00A 4BJMA 1ZV4X 2OA5A 3L09A 2JMKA 4JLEA 2L8KA 3PTRB 3BQKA 4BA9A 2VB6A 2MOZA 5HWYA 4ASKA 4HKAA 4F6RC 4AKHA 4ZI2D 5M4YA 3R6NA 1YKEB 2CXDA 2WWUA 3ETVA 5LCYA 2DLRA 3AAAB 3ZPOA 3RYIE 2CXFA 3ZCJA 3BK9A 5DQWA 2JMHA 3KFWX 3RX6A 4UXNB 3C64A 2YU2A 3PURA 2MBGA 3W15B 4UIGA 5HXSA 2K24A 2L3LA 5H6QB 3IBPA 2A72A 4ZI2C 2H7OA 1OXZA 4GYRA 4I55E 4O2AE 3GN5A 5L2LA 4CXYA 5JREA 3LK42 5CA0E 4CI1B 4L0RA 5LG4A 4ISTA 5EK3A 5JDFA 2P9BA 4ISSA 4YJ3E 4GK5E 3F31A 2Q9QA 2D5UA 1WRDA 2DWGA 3T8OA 4X1IE 1Y64B 3ZMTB 4ZHQE 4MHCA 2VKOA 4X1KE 5JH7E 1QUUA 3LG7A 4MBQA 5H6RB 4ZI3C 2E9XA 3ZN0B 1O3XA 1WYBA 2LM9A 2H3RA 3ZN1B 3KBUA 1BR4A 2N1GA 5E0OA 2ZM0A 1HG5A 2L9QA 3QK6A 2KT9A 3I0QA 3ZYLA 3RKOA 3A5XA 3MXZA 2SPCA 4IE4A 4PK6A 3WAKA 4UVAB 2WAUA 4IE0A 2M67A 3ZJ2A 5JR9A 5FMNA 2NOXA 3VU7H 4IE6A 3D0TA 2IW5B 3N9OA 3C51A 2CWYA 2CWOA 4O8SA 4OK0A 4WW0A 1EZ3A 2XASB 1HF8A 5HYAA 4Z8XA 4CXWA 2ZMAA 2NTXA 3MA9A 1E1HB 3AAEB 3HA4A 3Q5WA 5FY1A 2CLYC 2K9AA 4OYKA 4PNIA 2QA7A 3PDYA 5FY7A 3NZQA 3J9X1 1U5PA 2CA5A 4G2AA 3HI2A 3VKHA 4AKRB 2G0UA 5LYJE 2Q9QD 4L5GA 2B1EA 4MALA 3CX7B 4IIJE 5JDLA 1FEWA 2WMOA 4L9IA 1KNZA 3I9WA 1HCIA 3N9MA 5HXEA 3LBXB 2WMNA 2XAGB 4O4HE 2CLYB 5HXCA 1OWAA 3L3PA 4AQGA 1D1CA 1S94A 3CVRA 1BR2A 4UELA 5F8PA 3UT5E 4TV9E 3KV6A 3UFEA 3PUSA 3ANWA 5EK2A 2EHOA 4O4JE 4TV8E 3HKDE 3PU8A 5FXVA 5HXRA 5JQGE 4H9PC 4QX7B 4ILUA 4OHFA 3KV5A 3ZYMA 4O4IE 2IC9A 3ZMSB 1YKHB 3ZJ1A 3P8CD 3HKEE 3HKCE 2BVMA 4U74A 3B57A 4XAXB 3UULA 2LHRA 4AQFA 2LHNA 3SS1A 5LP6E 5LHHB 2PJQA 2DNXA 4OYJA 4UVBB 5KX5E 4PJMA 4AI6A 3RYCE 2YEVC 3H3AA 5DABA 4DMWA 3C50A 3N5LA 1T98A 2CEAA 4ZOLE 5LBMA 3SRZA 2LSIA 2LSYA 1MMAA 4KP3C 3O1IA 4UF0A 3U78A 1WYCA 3WAJA 5JRCA 4X20E 5HXHA 4KUMB 4WBOA 3FBZA 3ZCIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MFR A;  4XAX B;  4ILU A;  2LT3 A;  4KMC A;  4KBM B;  4L5G A; 
#chains in the Genus database with same CATH topology
 3UUN A;  2W62 A;  2ZM2 A;  3EDV A;  1H7C A;  4EYU A;  3ZC1 A;  3CWZ B;  4DUY T;  1UGO A;  4Q25 A;  4IDQ A;  5DJQ C;  2CBI A;  5J1G A;  5JVD E;  2QVA A;  1X9B A;  2X68 A;  4UEM A;  1FIO A;  4I4T E;  2BBJ A;  3AA0 B;  1IZN B;  3QNU A;  5FXX A;  2WSS V;  5LMU T;  2YKS A;  2WQY A;  3PUQ A;  2BG9 B;  3ZYK A;  2XY8 B;  3H37 A;  3ZT7 A;  1AJ3 A;  4NXN T;  2Q9Q C;  3ABV A;  5FL1 A;  2CHN A;  4JBW F;  5LGN B;  2A3D A;  2VKH A;  3N9P A;  3O1H A;  2W2U A;  4HTE A;  3ZT5 A;  5JDG A;  5KMG P;  1N34 T;  3AE5 A;  1I94 T;  2HPJ A;  3TLU A;  4KMC A;  4LF7 T;  2ACX A;  1NEK A;  2MYS A;  2C5J A;  4YSY A;  5ABF A;  4DV4 T;  4DVD A;  4EEB A;  5HEJ A;  4JI3 T;  3JAD A;  3FB2 A;  1KF6 A;  3OPC A;  2WWV A;  4BAY B;  2W4X A;  5IYZ E;  4JI8 T;  2AXD S;  3Q5E A;  5AQK B;  3OYZ A;  5L4E A;  4JI7 T;  4JV5 T;  2ODU A;  4U7Y A;  4DMV A;  4U72 A;  3P7I A;  3PUV F;  2VKD A;  5HEO A;  2V6Y A;  5LOV E;  3ZSS A;  5LMN T;  2FJA A;  3O1J A;  1HNZ T;  2Q9Q B;  2C0S A;  4AXP A;  1E2A A;  4PJN A;  2GK9 A;  2A9U A;  2W61 A;  3LJC A;  3OKQ A;  4TX5 A;  4WNK A;  5AQM B;  5AQQ B;  2Y6X A;  5FNV E;  2NW9 A;  2RP4 A;  5L3C B;  2XPK A;  3ZMZ B;  5L3D B;  2XSA A;  4FI5 A;  2FJB A;  4KHZ F;  4AKL A;  2ODV A;  1SHZ C;  1MND A;  2LE8 A;  2HN1 A;  3NBX X;  4M1P A;  2J1D G;  4PJL A;  4V1A v;  5HCM A;  4EB6 E;  5AQG B;  3K8P C;  1D0Y A;  1SA0 E;  3BQL A;  3PV0 F;  3EAB A;  4Z91 A;  5EK4 A;  5CGM A;  4UV9 B;  4X65 T;  1CHU A;  3AEF A;  3VHL A;  3AE3 A;  2X0L B;  3RC8 A;  1S35 A;  1VRB A;  4CN4 A;  1HTJ F;  3OBV E;  2V7L A;  4YSX A;  2NWB A;  3PE0 A;  2Y48 B;  5LNK A;  2UXX B;  4YSZ A;  2ES0 A;  4NUU A;  2ZM6 T;  4LF5 T;  2JQ9 A;  1G73 A;  3OJA A;  4IDP A;  3KVA A;  4ADZ A;  1LRZ A;  3MZK B;  4DR3 T;  4JEH B;  3O9X A;  5KXJ A;  4QH5 A;  5FP3 A;  4ZZB A;  4AIS A;  3KBT A;  2LSJ A;  1XMQ T;  1WR6 A;  2WZH A;  3KIN B;  5F3J A;  5J2U E;  3C98 B;  2D2S A;  1D0X A;  4IT4 A;  2VK9 A;  5CJ5 A;  4IE7 A;  4FJO A;  4U2Y A;  4LML A;  5ADX L;  2FUP A;  4TZ4 C;  3CIR A;  1LVK A;  3SFE A;  4A97 A;  5L47 A;  5L3B B;  5LGU B;  4AKI A;  1LVF A;  1IAP A;  2W67 A;  2LRL A;  2XUE A;  4HE8 A;  3UU5 A;  3KVB A;  2C5K T;  4H63 V;  1N32 T;  4PK5 A;  3PU3 A;  2X9H A;  1QLB A;  4P09 A;  2IIU A;  2PG8 A;  3L39 A;  2QGS A;  2V5D A;  2OLT A;  3MKD A;  4YJ2 E;  2WU2 A;  5HWX A;  3CX6 B;  4GK0 E;  1BR1 A;  2LSK A;  2XAQ B;  4CQI A;  1GQE A;  5C3J A;  4YHH T;  4HEA A;  1J5E T;  4LF4 T;  1UX5 A;  5FKY A;  2UXD T;  3ZT6 A;  3EI0 A;  2KXP B;  2LKH A;  3DJB A;  1KNR A;  4PJJ A;  3GN5 B;  4HFE A;  3TKL B;  3KDS E;  4H9R C;  2E9X D;  2LEH A;  1Z0P A;  2BBH A;  2JPF A;  3PJA J;  5L3G B;  5KDM C;  2VQE T;  3K3O A;  4IHJ E;  1WCR A;  2W63 A;  2LKG A;  5AQP B;  1MMG A;  4H63 H;  4EV6 A;  4BJN A;  3C4X A;  2X9W A;  4AQF C;  3NZP A;  2KWI B;  2YIN A;  3I1A A;  2HPL A;  3ZMV B;  4YT0 A;  3AVS A;  2V7K A;  3NKZ A;  2E5V A;  2KZ7 B;  2XQ6 A;  3N2O A;  1FMV A;  4E7S A;  3SWH A;  2IC6 A;  3ANW B;  3ZLI A;  3P4S A;  1HR0 T;  5F5W A;  2V8S V;  3FXE B;  3JC6 C;  4B6X A;  4HWF A;  4QKN A;  3M3Z B;  3G06 A;  4NPP A;  5BMV E;  4ZI7 E;  1UCU A;  2D0U A;  2LRK A;  4EZ4 A;  1W0A A;  3UUB A;  3GWH A;  2XAF B;  3RYF E;  2XQY A;  4DBQ A;  3PUX F;  4I43 B;  1JNR A;  4CZZ B;  5AQR B;  2DI4 A;  3EVY A;  2WDQ A;  4HWC A;  2X0Y A;  2YDQ A;  3K3N A;  5C8Y E;  2BG9 E;  3TLS A;  1IJ5 A;  4F8H A;  3N2K E;  1MNE A;  2I6H A;  2XQA A;  3E0Z A;  3VR8 A;  2CMR A;  3UFG A;  2KWH A;  5LHG B;  2JQK A;  1J1J A;  4X5T A;  1N33 T;  2I59 A;  3RYH E;  2E9X B;  3ZKR A;  1QSD A;  4K0K T;  1B7T A;  3GMI A;  4LFC T;  2V1D B;  4DND A;  4EXT A;  5FL0 A;  1W09 A;  1VCT A;  3AEG A;  4HFV A;  3AXJ A;  3CKD A;  5AFU L;  5JR9 B;  3QB5 K;  2VVN A;  3K3Q C;  4YTP A;  1N36 T;  1NAF A;  2CBJ A;  3P50 A;  2X9X A;  3ETU A;  3AE8 A;  3FBL A;  4DR7 T;  2BZB A;  3PUA A;  4X66 T;  2J47 A;  4DV7 T;  2NTY A;  3HKB E;  3MJX A;  3R84 B;  3LDQ B;  4GKJ T;  3DP7 A;  5GON E;  3B13 A;  4CI2 B;  4C90 A;  5AQN B;  1CUN A;  1HFA A;  4HFI A;  2BVL A;  4QXH B;  3P4Q A;  3IA3 A;  2VQF T;  2XAJ B;  4QWN B;  2E9X C;  5EZY E;  3UQ7 A;  2BDE A;  2C5I T;  2XZE A;  3ONX A;  3X1D A;  4U7I A;  1HX1 B;  4ERR A;  3P4P A;  2VL8 A;  2LLY A;  2X67 A;  5JR9 C;  4A56 A;  4ILB A;  4MFR A;  3ZMU B;  5A1L A;  4YY3 T;  4CN6 A;  3CQG B;  4JI0 T;  3UTK A;  2DCF A;  2NW8 A;  3AA6 B;  1HNW T;  1Y01 A;  5AQS B;  5JTG A;  3I0O A;  3C4Z A;  3U3I A;  3AE9 A;  1OED A;  1XNQ T;  2V26 A;  4QHO A;  4PFP A;  5J2T E;  3J7Y q;  2PBI A;  4DID B;  1YXR A;  2YK0 A;  1YQ3 A;  4KI0 F;  2VUR A;  4QXC B;  4HGA A;  3Q5X A;  3UUM A;  5ABF B;  5LJN A;  2V7I A;  3LBX A;  3CQX C;  1D1B A;  2WDV A;  3EHZ A;  3FXD B;  3RH3 A;  3VR9 A;  5CA1 E;  4DR5 T;  3IHR A;  4E7Z A;  4HWD A;  1YW0 A;  3RIU C;  1LKX A;  1VCS A;  2B76 A;  3FHN A;  4TWH A;  2H7V C;  3Q5D A;  4IGU A;  2CRB A;  2W0G A;  1MMD A;  3I9Y A;  4UV8 B;  4ANJ A;  2XHE B;  3HL6 A;  4XZC A;  5TAO A;  3RQU A;  1MMN A;  4DR1 T;  1MIW A;  1XWM A;  2CE7 A;  2V6Y B;  4J2C A;  3LFM A;  4P0A A;  4DO0 A;  3AA1 B;  4EYY R;  3QC9 A;  2KMF A;  4XBF B;  4TN7 B;  4IDZ A;  2Y8D A;  3E22 E;  4GOU A;  2VVS A;  2UU9 T;  5JDH A;  4OX9 T;  3N9N A;  4DV0 T;  5AQF B;  4KHP T;  2JQQ A;  3CX8 B;  1YD8 G;  2PTF A;  3V5S A;  2H88 A;  4X64 T;  2M6B A;  2EHO B;  3SOL A;  3K1S A;  1WLX A;  2LT3 A;  5HEH A;  2J62 A;  2XQ5 A;  2JRK A;  3MK7 C;  4HFB A;  4I50 E;  1FMW A;  4ZS2 A;  1MIY A;  1G8X A;  1W9R A;  3CPZ A;  2LM2 A;  2WM9 A;  3EAM A;  4N78 D;  4EOZ B;  2HHH T;  2D0T A;  1V9D A;  2Z6E A;  4ILC A;  4EED A;  3N9L A;  4H9N C;  4ZS3 A;  5L3E B;  2VWA A;  2WBL A;  4IDN A;  2N2N A;  4JUY A;  4C91 A;  3LK3 B;  3PUG A;  4TWF A;  3Q2M A;  3WAJ A;  2LJL A;  3ZEF B;  2WZI A;  1KK7 A;  4KX6 A;  2BS4 A;  4HWH A;  4LF9 T;  4HFD A;  2F4V T;  2JQH A;  4IL9 A;  5ETW A;  5JRC B;  4TNV A;  4UF0 B;  5JDQ A;  1XMO T;  3E08 A;  4G63 A;  2IAK A;  2NW7 A;  4YHJ A;  2R6G F;  4PAG A;  4GYS A;  2EHO C;  4NUV A;  4X62 T;  2WCA A;  3Q9D A;  3IF8 B;  2LOP A;  3FZM B;  4JEU B;  2X9Y A;  4UR9 A;  4A98 A;  3IEE A;  2RA1 A;  5ABH A;  4PW8 A;  3AED A;  3O4X E;  3EUH A;  2BKP A;  1IJ6 A;  5JDM A;  2BG9 A;  2JIW A;  4LMJ A;  5AQV B;  2VL0 A;  3F2E A;  1KNP A;  1X79 A;  3NRX A;  2E8I A;  2CHO A;  4H9S E;  5ABG A;  2IDO B;  4LF6 T;  2CM0 A;  3OVU A;  3TLW A;  4A5X A;  5LGT B;  1MIV A;  2N9D A;  4CI3 B;  3TLV A;  2VKJ A;  5LJM A;  1ZEE A;  3NRY A;  4DBR A;  3AAI A;  2LSG A;  4LF8 T;  2LOS A;  3N9Q A;  4JYA T;  3JC6 D;  3RC3 A;  2DHR A;  4YFS A;  3RF1 A;  3S4U A;  3MAC A;  3VKG A;  2V7J A;  5FXZ A;  4AQG A;  3UUX B;  4TUY E;  1ZKE A;  2E5L T;  3AEA A;  2QRX A;  1NWM X;  3N2G E;  5AQH B;  5HAX A;  4DV5 T;  2CXL A;  2XQ8 A;  3KV4 A;  4DUZ T;  4GIW A;  2CPT A;  1HG2 A;  2EHO D;  2ZLY A;  2KLQ A;  3AB3 B;  2CCQ A;  4QH4 A;  2A2F X;  3P4R A;  2XTL A;  2UXN B;  5FYM A;  4IE5 A;  1D0Z A;  4ZI3 D;  4GKK T;  2HH7 A;  3ZST A;  3ZC0 A;  1US7 B;  2PFV A;  4HFH A;  3RRW A;  2JJ9 A;  3AE7 A;  5LXT E;  2K3W A;  3OYX A;  4P0B A;  3QUJ A;  2K5B B;  2X66 A;  2YU1 A;  3B5M A;  2BKO A;  2ZM8 A;  3OTO T;  4EIW A;  3RIF A;  4CXX A;  5LG3 A;  4HN9 A;  4KBM B;  1R8I A;  3CQC B;  5HEG A;  5LHI B;  4DV2 T;  2V7M A;  1VOM A;  3C4W A;  3AA7 B;  3ESL A;  3AVR A;  2DWK A;  3M65 A;  2XQ7 A;  4O4L E;  1ZOY A;  4DR6 T;  1HS7 A;  3GA8 A;  1D1A A;  2X0H A;  2X51 A;  3AEC A;  3PJA A;  3RPU A;  4DV1 T;  2FJE A;  2W66 A;  3F57 A;  4UVC B;  5IHY A;  2K48 A;  4QXB B;  3V5U A;  2MTQ A;  2OV9 A;  1SUM B;  3DTO A;  1HX8 A;  3EDU A;  4QX8 B;  1Z8U A;  5IWA T;  3CML A;  2RPA A;  5FY0 A;  1ZHC A;  1UUR A;  3AXJ B;  3HR0 A;  1UX4 A;  2WB5 A;  5DQV A;  4H9O C;  4OFZ A;  5HEU A;  4PFO A;  1FJG T;  3RRC A;  3TLT A;  4YTM A;  2I0M A;  5JDN A;  2XAH B;  4K0U A;  2XM1 A;  4P1N A;  5ABE A;  2KIN B;  3AEE A;  1XDO A;  1IBL T;  2KND A;  4X1Y E;  5AQO B;  5FXW A;  1E7P A;  4JI5 T;  4H9Q C;  4MLK A;  1T72 A;  5LA6 E;  3JCF A;  4HWI B;  3RIA A;  5L3F B;  3LK2 B;  4EAH A;  4AKG A;  3KV9 A;  4PK4 A;  3QOF A;  2E2A A;  4WBN E;  2WS3 A;  3QB5 A;  4ZZC A;  2NP9 A;  4LFB T;  4O2B E;  1BR0 A;  5LB7 B;  2V6X A;  1XZY A;  2VAS A;  5CB4 E;  1L0V A;  3WI3 A;  4EZH A;  3RIU A;  5LBQ B;  1U4Q A;  1YQ4 A;  3BQI A;  4YLH A;  2ACZ A;  2W00 A;  4BJM A;  1ZV4 X;  2XQ3 A;  2OA5 A;  2WY2 A;  2JMK A;  3L09 A;  2L8K A;  3PTR B;  3BQK A;  4JLE A;  4BA9 A;  2VB6 A;  2MOZ A;  2FBW A;  4U31 A;  5HWY A;  4HKA A;  4ILA A;  4ASK A;  4F6R C;  4COF A;  4AKH A;  4ZI2 D;  1OED B;  4JI2 T;  5M4Y A;  3R6N A;  1YKE B;  2CXD A;  2WWU A;  2QYW A;  2BS2 A;  3ETV A;  5LCY A;  4AQY T;  2DLR A;  3AAA B;  3ZPO A;  4B3T T;  4ZEY A;  3RYI E;  2CXF A;  3ZCJ A;  3BK9 A;  4HFC A;  3H3M A;  5DQW A;  2JMH A;  3KFW X;  3RX6 A;  4UXN B;  3C64 A;  5HCJ A;  2YU2 A;  3JAF A;  3PUR A;  2MBG A;  4UIG A;  4WZX A;  3RLF F;  3W15 B;  5HXS A;  2K24 A;  2L3L A;  5H6Q B;  3RQW A;  3FZL B;  3IBP A;  4CN1 A;  2A72 A;  2XSB A;  4TWD A;  3T1H T;  1I6Z A;  2H89 A;  4ZI2 C;  2H7O A;  1OXZ A;  4GYR A;  5CFB A;  4I55 E;  4O2A E;  1XNR T;  3GN5 A;  3UU8 A;  4JI4 T;  2WU5 A;  5L2L A;  4CXY A;  3VRB A;  1UUS A;  5JRE A;  3LK4 2;  5CA0 E;  1OED C;  4CI1 B;  4L0R A;  4JI1 T;  3PUY F;  5LG4 A;  4DV3 T;  4IST A;  5EK3 A;  2UUC T;  5JDF A;  4EGW A;  5AQI B;  2P9B A;  5J0Z A;  1ZP0 A;  4ISS A;  4YJ3 E;  4GK5 E;  3F31 A;  2Q9Q A;  1T7S A;  1WRD A;  2AE9 A;  2D5U A;  2HN2 A;  2DWG A;  3T8O A;  4X1I E;  2IHR 1;  1Y64 B;  3RGL A;  3UU4 A;  3ZMT B;  3CK6 A;  4ZHQ E;  4MHC A;  2KSR A;  4JI6 T;  2VKO A;  3PUZ F;  4X1K E;  5JH7 E;  1QUU A;  3LG7 A;  3NWI A;  4MBQ A;  5H6R B;  4ZI3 C;  2E9X A;  1NEN A;  1WFD A;  3AE2 A;  3ZN0 B;  1O3X A;  1IBM T;  1WYB A;  3T1Y T;  2LM9 A;  2H3R A;  3ZN1 B;  3KBU A;  3A8Y C;  1BR4 A;  4DV6 T;  3ONL C;  1IBK T;  1WR0 A;  2N1G A;  3JAE A;  5E0O A;  2ZM0 A;  1HG5 A;  2L9Q A;  3QK6 A;  4B3M T;  5FVK A;  2KT9 A;  3I0Q A;  3ZYL A;  3RKO A;  4B3R T;  2XM2 A;  3A5X A;  2YDS A;  3MXZ A;  2SPC A;  4WYV A;  4IE4 A;  4PK6 A;  3WAK A;  3UQ4 A;  4QH1 A;  2WAU A;  4UVA B;  4IE0 A;  2M67 A;  4I0U A;  5JR9 A;  3ZJ2 A;  1OED E;  5AQL B;  5FMN A;  2UUB T;  2UUA T;  2NOX A;  3VU7 H;  4YXD A;  3A7M A;  4IE6 A;  3D0T A;  2IW5 B;  4IDO A;  3N9O A;  3C51 A;  2CWY A;  5EK2 A;  2CWO A;  4O8S A;  5IUX A;  3UU6 A;  3NVO A;  1W0B A;  1KFY A;  4OK0 A;  4IL4 A;  5AQJ B;  4WW0 A;  4B3S T;  3FZH B;  2D9D A;  1EZ3 A;  2XAS B;  1HF8 A;  2XQ4 A;  5BR8 T;  5HYA A;  2MPK A;  4U2Z A;  2BKN A;  4Z8X A;  4CXW A;  2ZMA A;  2YN6 A;  3AE1 A;  2NTX A;  3MA9 A;  1E1H B;  3AAE B;  3HA4 A;  3Q5W A;  5FY1 A;  2CLY C;  2K9A A;  4OYK A;  5FVL A;  4PNI A;  2QA7 A;  3PDY A;  5FY7 A;  3NZQ A;  3J9X 1;  1U5P A;  2CA5 A;  1KEY A;  4G2A A;  3HI2 A;  2BS3 A;  3VKH A;  4AKR B;  2G0U A;  5LYJ E;  2Q9Q D;  4L5G A;  2B1E A;  4DR4 T;  4MAL A;  3PUW F;  3CX7 B;  4IIJ E;  5JDL A;  1FEW A;  2WMO A;  2WP9 A;  1SE7 A;  4L9I A;  1M7K A;  1KNZ A;  3I9W A;  1HCI A;  3N9M A;  5HXE A;  3LBX B;  4LMK A;  2WMN A;  2XAG B;  4O4H E;  2CLY B;  5HXC A;  1OWA A;  3L3P A;  2XJ7 A;  3RI5 A;  2IML A;  2V5C A;  4TNW A;  1D1C A;  3ZCI A;  3ONJ A;  1S94 A;  3CVR A;  1BR2 A;  3FZF B;  4UEL A;  5F8P A;  4TV9 E;  3KV6 A;  3UFE A;  3UT5 E;  1DU2 A;  3PUS A;  4AIU A;  3ANW A;  2M6I A;  1J5W A;  2EHO A;  4O4J E;  2J4G A;  3AE4 A;  3HKD E;  3PU8 A;  4TV8 E;  3VRA A;  5FXV A;  5HXR A;  1XDP A;  2DL1 A;  5JQG E;  4H9P C;  4QX7 B;  4ILU A;  4NXM T;  4OHF A;  3KV5 A;  3L8R A;  3ZYM A;  4O4I E;  5C2T A;  1UK5 A;  2IC9 A;  2IUB A;  3RHW A;  3ZMS B;  1HNX T;  1YKH B;  2XQ9 A;  4U33 A;  3ZJ1 A;  3P8C D;  3HKE E;  4U3C A;  3HKC E;  2BVM A;  2YOE A;  3B57 A;  4U74 A;  4XAX B;  3UUL A;  3FZK B;  2FJD A;  2LHR A;  3SFD A;  4NIQ A;  4AQF A;  2LHN A;  3SS1 A;  5LP6 E;  1JNZ A;  2NR4 A;  3LSV A;  5LHH B;  5JRC A;  2MAW A;  2DNX A;  2PJQ A;  4OYJ A;  2UXB T;  2YDR A;  4YTN A;  4UVB B;  3AE6 A;  5KX5 E;  4PJM A;  4AI6 A;  5AQU B;  4LFA T;  3UU3 A;  3RYC E;  3P4W A;  2YEV C;  3H3A A;  3RKG A;  3AEB A;  5DAB A;  1T8B A;  4DMW A;  3C50 A;  3N5L A;  2BG9 C;  1T98 A;  4DR2 T;  2CEA A;  4ZOL E;  5LBM A;  3SRZ A;  1M62 A;  2LSI A;  1MMA A;  2LSY A;  2WDR A;  3O1I A;  4KP3 C;  1WYC A;  4UF0 A;  4ZXL A;  5L4H A;  3U78 A;  4X20 E;  5HXH A;  4Z90 A;  2UXC T;  5AQT B;  4KUM B;  4WBO A;  3FBZ A;  4IRE A; 
#chains in the Genus database with same CATH homology
 3UUN A;  2W62 A;  2ZM2 A;  3EDV A;  1H7C A;  4EYU A;  3ZC1 A;  3CWZ B;  5JVD E;  5DJQ C;  5J1G A;  2X68 A;  4UEM A;  1FIO A;  4I4T E;  3AA0 B;  5FXX A;  1IZN B;  2WSS V;  3PUQ A;  3ZYK A;  3H37 A;  1AJ3 A;  2Q9Q C;  2A3D A;  2VKH A;  3N9P A;  3O1H A;  4HTE A;  5JDG A;  5KMG P;  2HPJ A;  4KMC A;  2ACX A;  2MYS A;  2C5J A;  4DVD A;  3FB2 A;  4BAY B;  5IYZ E;  3OYZ A;  2ODU A;  4DMV A;  4U72 A;  3P7I A;  5LOV E;  2VKD A;  3O1J A;  2Q9Q B;  2C0S A;  4AXP A;  4PJN A;  2GK9 A;  3LJC A;  2W61 A;  3OKQ A;  4TX5 A;  4WNK A;  5FNV E;  2Y6X A;  2NW9 A;  2RP4 A;  5L3C B;  3ZMZ B;  5L3D B;  4FI5 A;  4AKL A;  2ODV A;  1SHZ C;  1MND A;  2LE8 A;  3NBX X;  4M1P A;  4V1A v;  2J1D G;  4PJL A;  4EB6 E;  3K8P C;  1D0Y A;  1SA0 E;  3BQL A;  5EK4 A;  4UV9 B;  3VHL A;  2X0L B;  3RC8 A;  1VRB A;  1S35 A;  1HTJ F;  3OBV E;  2V7L A;  2NWB A;  3PE0 A;  2Y48 B;  5LNK A;  2UXX B;  2ES0 A;  4NUU A;  3OJA A;  1G73 A;  4ADZ A;  3KVA A;  1LRZ A;  3MZK B;  4JEH B;  3O9X A;  5FP3 A;  3KBT A;  2LSJ A;  1WR6 A;  5F3J A;  3KIN B;  5J2U E;  3C98 B;  2D2S A;  1D0X A;  2VK9 A;  4IE7 A;  4FJO A;  5ADX L;  4TZ4 C;  5LGU B;  1LVK A;  5L3B B;  4AKI A;  1LVF A;  1IAP A;  2XUE A;  4HE8 A;  3KVB A;  2C5K T;  4H63 V;  4PK5 A;  3PU3 A;  2X9H A;  4P09 A;  2PG8 A;  4YJ2 E;  2QGS A;  3MKD A;  5HWX A;  3CX6 B;  4GK0 E;  1BR1 A;  2LSK A;  2XAQ B;  4CQI A;  4HEA A;  1UX5 A;  2KXP B;  3DJB A;  4PJJ A;  3TKL B;  3GN5 B;  3KDS E;  4H9R C;  2E9X D;  2LEH A;  1Z0P A;  2JPF A;  5L3G B;  5KDM C;  3K3O A;  4IHJ E;  2W63 A;  1MMG A;  4H63 H;  4BJN A;  3C4X A;  2X9W A;  4AQF C;  3NZP A;  2KWI B;  2YIN A;  3I1A A;  2HPL A;  3ZMV B;  3AVS A;  2V7K A;  2KZ7 B;  3N2O A;  4E7S A;  1FMV A;  3SWH A;  2IC6 A;  3ANW B;  3ZLI A;  4B6X A;  3FXE B;  3JC6 C;  4QKN A;  5BMV E;  4ZI7 E;  1UCU A;  2D0U A;  4EZ4 A;  3GWH A;  2XAF B;  3RYF E;  2XQY A;  4DBQ A;  4I43 B;  4CZZ B;  5LJM A;  2DI4 A;  3EVY A;  5C8Y E;  3K3N A;  1IJ5 A;  3N2K E;  1MNE A;  3E0Z A;  2CMR A;  5LHG B;  2KWH A;  2I59 A;  3RYH E;  2E9X B;  1QSD A;  1B7T A;  3GMI A;  2V1D B;  4DND A;  4EXT A;  5LGN B;  5AFU L;  4HFV A;  3CKD A;  5JR9 B;  3K3Q C;  1NAF A;  2X9X A;  3ETU A;  3FBL A;  2BZB A;  3PUA A;  2NTY A;  3HKB E;  3MJX A;  3R84 B;  3DP7 A;  5GON E;  3B13 A;  4CI2 B;  4C90 A;  1CUN A;  1HFA A;  2BVL A;  4QXH B;  2XAJ B;  4QWN B;  2E9X C;  5EZY E;  2BDE A;  2C5I T;  3ONX A;  4ERR A;  2VL8 A;  2X67 A;  5JR9 C;  4A56 A;  4MFR A;  3ZMU B;  5A1L A;  3CQG B;  3UTK A;  2DCF A;  2NW8 A;  3AA6 B;  3I0O A;  3C4Z A;  3U3I A;  2V26 A;  4QHO A;  4PFP A;  5J2T E;  3J7Y q;  2PBI A;  2YK0 A;  4QXC B;  4HGA A;  3Q5X A;  3UUM A;  5LJN A;  2V7I A;  3LBX A;  3CQX C;  1D1B A;  3FXD B;  5CA1 E;  3RH3 A;  3IHR A;  4E7Z A;  1YW0 A;  1LKX A;  3FHN A;  2H7V C;  4IGU A;  2W0G A;  1MMD A;  3I9Y A;  4UV8 B;  4ANJ A;  2XHE B;  3HL6 A;  4XZC A;  5TAO A;  1MMN A;  1MIW A;  2CE7 A;  4J2C A;  3LFM A;  4P0A A;  4DO0 A;  3AA1 B;  4EYY R;  3QC9 A;  2KMF A;  4XBF B;  4TN7 B;  4IDZ A;  2Y8D A;  3E22 E;  4GOU A;  5JDH A;  3N9N A;  2JQQ A;  3CX8 B;  1YD8 G;  3V5S A;  2EHO B;  3SOL A;  1WLX A;  2LT3 A;  4ZS2 A;  3MK7 C;  2JRK A;  4I50 E;  1FMW A;  1MIY A;  1G8X A;  3CPZ A;  2WM9 A;  4N78 D;  4EOZ B;  2D0T A;  1V9D A;  2Z6E A;  5L3E B;  3N9L A;  4H9N C;  4ZS3 A;  2VWA A;  2WBL A;  2N2N A;  4JUY A;  4C91 A;  3LK3 B;  3PUG A;  3Q2M A;  2LJL A;  3ZEF B;  1KK7 A;  5ETW A;  5JRC B;  4UF0 B;  5JDQ A;  3E08 A;  4G63 A;  2IAK A;  2NW7 A;  4YHJ A;  4PAG A;  4GYS A;  2EHO C;  4NUV A;  3Q9D A;  3IF8 B;  2LOP A;  4JEU B;  2X9Y A;  3IEE A;  2RA1 A;  4PW8 A;  3O4X E;  3EUH A;  1IJ6 A;  5JDM A;  3F2E A;  1X79 A;  3NRX A;  2E8I A;  4H9S E;  2CM0 A;  5LGT B;  1MIV A;  2N9D A;  4CI3 B;  2VKJ A;  1ZEE A;  3NRY A;  4DBR A;  3AAI A;  2LSG A;  2LOS A;  3N9Q A;  3JC6 D;  3RC3 A;  2DHR A;  4YFS A;  3S4U A;  3VKG A;  3MAC A;  2V7J A;  5FXZ A;  3UUX B;  4TUY E;  1ZKE A;  1NWM X;  3N2G E;  5HAX A;  2CXL A;  3KV4 A;  4GIW A;  1HG2 A;  2EHO D;  2ZLY A;  2KLQ A;  3AB3 B;  2CCQ A;  2A2F X;  2XTL A;  2UXN B;  5FYM A;  4IE5 A;  1D0Z A;  4ZI3 D;  2HH7 A;  3ZC0 A;  1US7 B;  2PFV A;  3RRW A;  2JJ9 A;  5LXT E;  3OYX A;  4P0B A;  3QUJ A;  2K5B B;  2X66 A;  2YU1 A;  2ZM8 A;  4EIW A;  4CXX A;  5LHI B;  4HN9 A;  4KBM B;  3CQC B;  2V7M A;  1VOM A;  3C4W A;  3AA7 B;  3ESL A;  3AVR A;  2DWK A;  3M65 A;  4O4L E;  1HS7 A;  3GA8 A;  1D1A A;  2X51 A;  3RPU A;  3F57 A;  4UVC B;  3V5U A;  5IHY A;  2K48 A;  4QXB B;  2MTQ A;  3DTO A;  3EDU A;  1HX8 A;  4QX8 B;  3CML A;  5FY0 A;  1ZHC A;  3HR0 A;  1UX4 A;  5DQV A;  4H9O C;  4OFZ A;  4PFO A;  3RRC A;  5JDN A;  2XAH B;  4K0U A;  2KIN B;  2KND A;  4X1Y E;  5FXW A;  4H9Q C;  4MLK A;  5LA6 E;  5L3F B;  3LK2 B;  4EAH A;  4AKG A;  3KV9 A;  4PK4 A;  4WBN E;  2NP9 A;  4O2B E;  1BR0 A;  4EZH A;  2VAS A;  5CB4 E;  3WI3 A;  5LBQ B;  1U4Q A;  3BQI A;  4YLH A;  2W00 A;  4BJM A;  1ZV4 X;  2OA5 A;  3L09 A;  2JMK A;  4JLE A;  2L8K A;  3PTR B;  3BQK A;  4BA9 A;  2VB6 A;  2MOZ A;  5HWY A;  4ASK A;  4HKA A;  4F6R C;  4AKH A;  4ZI2 D;  5M4Y A;  3R6N A;  1YKE B;  2CXD A;  2WWU A;  3ETV A;  5LCY A;  2DLR A;  3AAA B;  3ZPO A;  3RYI E;  2CXF A;  3ZCJ A;  3BK9 A;  5DQW A;  2JMH A;  3KFW X;  3RX6 A;  4UXN B;  3C64 A;  2YU2 A;  3PUR A;  2MBG A;  3W15 B;  4UIG A;  5HXS A;  2K24 A;  2L3L A;  5H6Q B;  3IBP A;  2A72 A;  4ZI2 C;  2H7O A;  1OXZ A;  4GYR A;  4I55 E;  4O2A E;  3GN5 A;  5L2L A;  4CXY A;  5JRE A;  3LK4 2;  5CA0 E;  4CI1 B;  4L0R A;  5LG4 A;  4IST A;  5EK3 A;  5JDF A;  2P9B A;  4ISS A;  4YJ3 E;  4GK5 E;  3F31 A;  2Q9Q A;  2D5U A;  1WRD A;  2DWG A;  3T8O A;  4X1I E;  1Y64 B;  3ZMT B;  4ZHQ E;  4MHC A;  2VKO A;  4X1K E;  5JH7 E;  1QUU A;  3LG7 A;  4MBQ A;  5H6R B;  4ZI3 C;  2E9X A;  3ZN0 B;  1O3X A;  1WYB A;  2LM9 A;  2H3R A;  3ZN1 B;  3KBU A;  1BR4 A;  2N1G A;  5E0O A;  2ZM0 A;  1HG5 A;  2L9Q A;  3QK6 A;  2KT9 A;  3I0Q A;  3ZYL A;  3RKO A;  3A5X A;  3MXZ A;  2SPC A;  4IE4 A;  4PK6 A;  3WAK A;  4UVA B;  2WAU A;  4IE0 A;  2M67 A;  3ZJ2 A;  5JR9 A;  5FMN A;  2NOX A;  3VU7 H;  4IE6 A;  3D0T A;  2IW5 B;  3N9O A;  3C51 A;  2CWY A;  2CWO A;  4O8S A;  4OK0 A;  4WW0 A;  1EZ3 A;  2XAS B;  1HF8 A;  5HYA A;  4Z8X A;  4CXW A;  2ZMA A;  2NTX A;  3MA9 A;  1E1H B;  3AAE B;  3HA4 A;  3Q5W A;  5FY1 A;  2CLY C;  2K9A A;  4OYK A;  4PNI A;  2QA7 A;  3PDY A;  5FY7 A;  3NZQ A;  3J9X 1;  1U5P A;  2CA5 A;  4G2A A;  3HI2 A;  3VKH A;  4AKR B;  2G0U A;  5LYJ E;  2Q9Q D;  4L5G A;  2B1E A;  4MAL A;  3CX7 B;  4IIJ E;  5JDL A;  1FEW A;  2WMO A;  4L9I A;  1KNZ A;  3I9W A;  1HCI A;  3N9M A;  5HXE A;  3LBX B;  2WMN A;  2XAG B;  4O4H E;  2CLY B;  5HXC A;  1OWA A;  3L3P A;  4AQG A;  1D1C A;  1S94 A;  3CVR A;  1BR2 A;  4UEL A;  5F8P A;  3UT5 E;  4TV9 E;  3KV6 A;  3UFE A;  3PUS A;  3ANW A;  5EK2 A;  2EHO A;  4O4J E;  4TV8 E;  3HKD E;  3PU8 A;  5FXV A;  5HXR A;  5JQG E;  4H9P C;  4QX7 B;  4ILU A;  4OHF A;  3KV5 A;  3ZYM A;  4O4I E;  2IC9 A;  3ZMS B;  1YKH B;  3ZJ1 A;  3P8C D;  3HKE E;  3HKC E;  2BVM A;  4U74 A;  3B57 A;  4XAX B;  3UUL A;  2LHR A;  4AQF A;  2LHN A;  3SS1 A;  5LP6 E;  5LHH B;  2PJQ A;  2DNX A;  4OYJ A;  4UVB B;  5KX5 E;  4PJM A;  4AI6 A;  3RYC E;  2YEV C;  3H3A A;  5DAB A;  4DMW A;  3C50 A;  3N5L A;  1T98 A;  2CEA A;  4ZOL E;  5LBM A;  3SRZ A;  2LSI A;  2LSY A;  1MMA A;  4KP3 C;  3O1I A;  4UF0 A;  3U78 A;  1WYC A;  3WAJ A;  5JRC A;  4X20 E;  5HXH A;  4KUM B;  4WBO A;  3FBZ A;  3ZCI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...