4P1NA

Crystal structure of atg1-atg13 complex
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
262
structure length
190
Chain Sequence
SDSNITPFVESLSAKAFVMYSFAEMKFSQILNLIPAPELKKLCMESLLLYLKSLTILASSMKLTSKWWYENESKNCTLKLNILVQWIRDRFNECLDKAEFLRLKLHTLNQSEDPQVLDDPTIFVEKLIYDRALDISRNAARLEMEGNYNTCELAYATSLWMLEILLDEHLSDESDKEMIRKYVSSIANRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of starvation-induced assembly of the autophagy initiation complex.
pubmed doi rcsb
source organism Kluyveromyces marxianus
molecule tags Protein transport
molecule keywords Atg1 tMIT
total genus 77
structure length 190
sequence length 262
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12063 DUF3543 Domain of unknown function (DUF3543)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 4p1nA00
5LB7B 4CN6A 2WY2A 3ZSTA 1WR0A 3K1SA 4U33A 4U2YA 4IT4A 2JQHA 4NIQA 2DL1A 4WZXA 5CJ5A 5FVLA 2JQKA 4P1NA 5FVKA 2K3WA 2JQ9A 2W2UA 4A5XA 4U31A 5CGMA 4U7IA 4U3CA 4U2ZA 3EABA 3ZT6A 2CPTA 2V6XA 2V6YB 4U7YA 2WWVA 4CN4A 1WFDA 3ZSSA 2LRKA 2A9UA 2V6YA 4ZEYA 1WCRA 3ZT7A 2XZEA 3ZT5A 1YXRA 2MPKA 4CN1A 2LRLA 2RPAA 2CRBA
chains in the Genus database with same CATH superfamily
3CQXC 2JIWA 2QA7A 5JDGA 2WS3A 4TWHA 3QB5K 3ZSTA 2UXCT 4L9IA 3GN5B 2CXFA 2XQ7A 1HCIA 2LSYA 2QVAA 2Q9QC 4YJ2E 1E7PA 4EV6A 4UVBB 2VKOA 3L8RA 4TZ4C 1VCSA 2L8KA 3P4PA 3ZC1A 1D0YA 2UXXB 2KINB 2VKDA 4XAXB 1V9DA 2H3RA 2A2FX 3DP7A 5FYMA 3A5XA 4HTEA 3RYCE 4ZOLE 4U72A 1WRDA 2LOSA 2C0SA 4QWNB 2X67A 5JREA 1YW0A 2WP9A 3CPZA 4JI8T 2V6YB 1HFAA 3B57A 3SWHA 3QB5A 5ABHA 2CLYC 4WW0A 2E8IA 5LG4A 1QUUA 5HWXA 1HX1B 2ZM2A 5HXCA 5AQGB 1O3XA 2W00A 2V1DB 3DTOA 3NRYA 1IBMT 2NP9A 2ODVA 1W0BA 3ZT7A 2JJ9A 4KP3C 4B3ST 2N1GA 2W61A 4ILUA 4O4JE 2R6GF 4U7IA 1NENA 5DJQC 3RKOA 2NOXA 2PFVA 3RYFE 5ETWA 2V7IA 4BA9A 2DNXA 4ERRA 4ANJA 4IE4A 1FJGT 4AKIA 4YLHA 1W09A 2BKOA 4DVDA 4DMWA 5FL1A 2XPKA 5CJ5A 5JR9B 3RIUC 2N9DA 4ZZCA 4F6RC 2OV9A 1UK5A 4TUYE 1JNRA 2UXBT 3O9XA 1UX4A 2FBWA 3T1YT 2CHOA 1XMOT 4AI6A 2FJEA 4ZI3C 1ZOYA 5DQVA 5ADXL 3Q5EA 4MALA 2CXDA 2WWVA 4JEHB 4PK6A 4UV8B 3F57A 3VKHA 3PU3A 2L3LA 4HFBA 3AXJA 1D1AA 2WM9A 1FIOA 4HGAA 2IDOB 2YK0A 4LF9T 3Q5DA 3AE5A 2A3DA 2Y48B 2Z6EA 3EDVA 3KFWX 3ZSSA 4PW8A 1N34T 2YOEA 4UIGA 3FXEB 1HF8A 1YXRA 2HH7A 3UFGA 3KBUA 4CN1A 5CFBA 5L3BB 1BR0A 2J62A 3ZMUB 1KNRA 4J2CA 3D0TA 4WBOA 3J7Yq 2ODUA 1N36T 4IE7A 1VRBA 2WZIA 5IUXA 4IGUA 1KEYA 2LSIA 4LFAT 1N33T 3CVRA 3CX8B 3ETUA 3K3OA 3JCFA 3G06A 3MJXA 3O1IA 4AKRB 3BQKA 2W2UA 4YSYA 3MKDA 2K5BB 5CA0E 3OBVE 4OYKA 4KHZF 4O4LE 2UUCT 3I0QA 3ZT6A 5H6QB 3TLUA 3JAEA 1B7TA 1XDOA 5HEOA 2HPLA 2GK9A 3MZKB 3DJBA 4KUMB 2EHOB 2JMHA 3P4QA 3NRXA 4KX6A 4CN4A 3CWZB 4OFZA 4YHHT 2M6IA 4QX8B 3HKDE 5DABA 5F8PA 1D1BA 5J1GA 1SE7A 3H3MA 2E2AA 3B5MA 5LCYA 3I0OA 4KMCA 1LRZA 4ZS2A 2V5DA 3KVAA 1JNZA 1L0VA 1WLXA 3LFMA 4QKNA 1T8BA 3UUXB 4AQGA 1XNRT 4CXYA 3OTOT 2FJDA 4UF0A 3CQCB 1HTJF 2WSSV 4H9RC 4JI3T 2WU5A 4TV9E 2XSAA 3WAJA 2LSKA 3UU3A 3UULA 3VR9A 1ZV4X 4WZXA 2EHOC 3W15B 1YKHB 2X9WA 4N78D 4NPPA 3RRWA 3VRBA 5BMVE 3ONJA 5LHGB 3V5UA 4HN9A 3M3ZB 5LP6E 4NXNT 3VKGA 4PJJA 3RIUA 2PJQA 3N2OA 1XDPA 3I9WA 1D1CA 3PU8A 4EOZB 1ZKEA 3E0ZA 4PNIA 5L3DB 1LKXA 2IAKA 2LOPA 3PUXF 4AQFA 3FHNA 2YU1A 3AAEB 3KV6A 3MXZA 2XQ3A 2V26A 2VURA 3MACA 4YXDA 4ZHQE 4DV0T 5JDLA 4GKJT 3A7MA 4HFVA 5HXSA 3M65A 4AQFC 4KHPT 2WMOA 3C98B 3CQGB 3C4WA 3ESLA 4OHFA 4I43B 2XAGB 4OX9T 5LMNT 4HFIA 5LYJE 5IWAT 3QK6A 5F3JA 3EI0A 2WWUA 5BR8T 3KDSE 4IDNA 2XQ5A 5HWYA 1HG5A 4IE5A 3ONXA 3T8OA 4YFSA 4O4IE 1ZP0A 2WQYA 4KI0F 4DMVA 4HWFA 4MFRA 3QC9A 4IDQA 2ZLYA 3BQIA 1W9RA 4LF4T 4P09A 4QXBB 3C4ZA 2FUPA 3UUMA 4HE8A 3RQWA 2WDQA 5IYZE 2MAWA 1SHZC 2PG8A 2XQAA 3ZN1B 5LGUB 4B3RT 1MNEA 3L39A 4ISSA 4H9NC 3JAFA 4JUYA 2XAHB 4C91A 4F8HA 1KNPA 2W66A 3NVOA 4I50E 2A9UA 3AE9A 3JC6C 4IHJE 4NUUA 5JDMA 3UTKA 4EEDA 1X9BA 2C5JA 4NXMT 4DR7T 5LHIB 4LFBT 3H37A 2H7VC 2XQYA 3P50A 3RPUA 3U78A 2LHNA 3RYIE 2VWAA 5CA1E 3N2GE 4DV1T 4CI2B 3PUZF 2BKNA 2M6BA 3HKCE 4U2YA 4UELA 4V1Av 1OEDC 1R8IA 2K9AA 3SOLA 4EYYR 2IC6A 3OVUA 2CLYB 5HEUA 4JI5T 3R6NA 5FVKA 2I0MA 2KNDA 2WDVA 3RI5A 3MK7C 4ILCA 4DV5T 3P4RA 3AAAB 4HEAA 2NR4A 4ZXLA 4JI4T 3MA9A 1XWMA 2WCAA 4H63H 5JDFA 4CI1B 3UU4A 3ZJ1A 1ZEEA 1BR2A 4YSZA 2JQQA 3AEDA 1U5PA 2LKHA 2P9BA 3AB3B 3FB2A 2J4GA 2A72A 4ZS3A 4PJMA 3TLVA 4A56A 5KXJA 1W0AA 3FZKB 4X1YE 5AQPB 3F2EA 4EXTA 2CMRA 2MTQA 2W62A 2X0LB 2DWKA 5HAXA 5JRCB 5FXVA 2WU2A 3GWHA 3HA4A 4L5GA 2KLQA 4A97A 3IA3A 2LM2A 3QUJA 4HWDA 1OXZA 1YD8G 5AQJB 3TLWA 5LGNB 4CN6A 4EGWA 4XZCA 2NW9A 3SFEA 3RGLA 5LBMA 4JI2T 5JDHA 2LEHA 2VVSA 4X1KE 5CB4E 3GMIA 4YSXA 3N2KE 5FVLA 2V8SV 2B76A 2LT3A 3N9NA 5L3EB 2LLYA 2IW5B 2JQ9A 3IBPA 3QNUA 5IHYA 4GIWA 5AFUL 2NTYA 3FZHB 1LVFA 3BK9A 1LVKA 2XY8B 2EHOA 2I6HA 3AVRA 3UU6A 4ZI7E 3PV0F 4H9PC 3SRZA 5LNKA 3ZCIA 5HEHA 2KWIB 3AECA 4HFHA 2LKGA 4EYUA 4TNWA 4ASKA 5FL0A 3ZMVB 2VQET 1MIVA 2BG9E 2MPKA 5FY7A 1Y64B 4DR4T 3AEGA 5JRCA 2YKSA 2RP4A 5AQVB 5L3FB 3KBTA 2D9DA 3AE7A 3PUGA 2X66A 4TWDA 2DLRA 2B1EA 5AQHB 5HCJA 3VR8A 2UUAT 5HCMA 5C8YE 1HNXT 4HWHA 4IE6A 5LBQB 4B3MT 4CQIA 2BDEA 4O2BE 3WI3A 3K3NA 2LHRA 2LSGA 4U31A 3PJAJ 2ZM6T 2UXDT 5LG3A 3LK2B 2XHEB 3C64A 3OYXA 3BQLA 3P8CD 4H9SE 3R84B 3RC3A 1MIYA 1M7KA 2V7LA 3L09A 2V7JA 3ZKRA 3PUAA 4TWFA 3TLSA 1IBLT 2IIUA 5AQOB 5JDQA 1QLBA 4QH1A 1S35A 1KK7A 3HR0A 3PTRB 2H88A 3N5LA 4ISTA 2D0UA 1FMWA 3AE2A 3EAMA 5CGMA 4K0KT 3RRCA 2CE7A 5L3CB 5LA6E 1SUMB 3GA8A 5HEJA 4FJOA 4MLKA 4AKGA 5JDNA 4I55E 3AE6A 5AQKB 2JQHA 1DU2A 3C4XA 4HFEA 2IMLA 3NKZA 1FEWA 1XNQT 1U4QA 1X79A 4QHOA 2JQKA 2Q9QD 3AE3A 4P1NA 4X66T 2W63A 4X5TA 4I4TE 4OK0A 1US7B 2LM9A 5LJMA 2X9HA 4JLEA 2XQ8A 4EZHA 3C50A 3ZC0A 1YQ3A 5AQQB 1Y01A 3EDUA 3K3QC 2BVMA 4JBWF 2YU2A 2MBGA 1EZ3A 2CEAA 2JMKA 4ILBA 2LRKA 3UU8A 2XQ4A 4YT0A 3AE4A 5L3GB 4GYRA 1OEDA 4Z91A 2D0TA 2UU9T 2RA1A 2XZEA 3PUVF 4YTPA 4BAYB 3VHLA 2HPJA 4JI7T 5J2UE 1Z8UA 1UCUA 4IIJE 2CBJA 4CI3B 1M62A 2J1DG 3N9QA 2QYWA 4IT4A 2KSRA 3H3AA 5LGTB 2X51A 3PUQA 3UQ7A 3TLTA 2AXDS 2Q9QB 2QGSA 3OJAA 3PUYF 4IDZA 4AIUA 1HR0T 4A5XA 1KNZA 5J0ZA 2F4VT 5FNVE 4G2AA 4DUYT 2XQ9A 1HG2A 4EIWA 3ABVA 4Z8XA 5FY0A 5JR9A 4JEUB 1HNZT 2VL8A 2BG9C 3O4XE 5EK3A 2BBHA 3FZLB 3N9OA 1BR4A 4TX5A 2N2NA 3GN5A 3ZLIA 1GQEA 4GYSA 4JYAT 2XUEA 4ZEYA 2E9XB 4H9QC 1MNDA 4IL4A 1QSDA 4PJLA 3Q9DA 5AQIB 3AA6B 3RHWA 5HYAA 5LMUT 2PTFA 3PDYA 4DR2T 2E9XD 2LJLA 4NUVA 2W4XA 4DNDA 1I94T 4Q25A 3AA0B 2XQ6A 4TV8E 4C90A 1MIWA 3NWIA 4NIQA 4P0BA 3ZMZB 3ZYLA 5KDMC 3KV9A 5JVDE 1J1JA 3LSVA 3EVYA 4ILAA 2V7MA 2PBIA 3V5SA 3LG7A 3S4UA 3PE0A 4AKLA 1N32T 1OEDB 2CPTA 1CHUA 4WNKA 1MMAA 3I1AA 5TAOA 3P4WA 2CBIA 5HEGA 3RIAA 2Y8DA 3UU5A 2VKJA 3L3PA 2HN1A 2NWBA 3HKEE 3HKBE 4MHCA 5GONE 4X1IE 4WBNE 4DV4T 1UUSA 2JRKA 3WAKA 1MMNA 4YTMA 3QOFA 5FXXA 3RQUA 3UQ4A 1WCRA 2CM0A 4LMJA 3IEEA 4DIDB 3EHZA 2CCQA 2WB5A 2XAQB 1NEKA 3ZN0B 3ZT5A 1MMGA 4GK5E 2VK9A 2L9QA 4LMLA 1SA0E 4E7SA 2BKPA 5C3JA 3RC8A 2CHNA 1S94A 1FMVA 3ETVA 2WAUA 4CXWA 2UXNB 4IE0A 4AKHA 2CA5A 3E22E 2IC9A 4DV2T 5LOVE 2YDSA 3O1JA 3KVBA 4WYVA 3ZJ2A 4DR5T 5L2LA 3NZPA 4Z90A 4P0AA 4YY3T 2YDRA 4X65T 2NW8A 3C51A 1E2AA 4LF6T 1WR6A 2W0GA 5FP3A 3T1HT 2Y6XA 3P4SA 2XAFB 5JH7E 4U7YA 2XAJB 1VOMA 4EZ4A 1YKEB 4QH5A 4YTNA 1HX8A 3ANWB 2CXLA 3TKLB 3KV4A 5ABFA 3JADA 2WBLA 5LHHB 2VASA 2BS3A 2V6YA 2BG9A 1VCTA 2W67A 2XSBA 5AQTB 3X1DA 5L4EA 4DR3T 2X0YA 1WYCA 3LDQB 4TN7B 3F31A 5AQMB 3J9X1 3UFEA 4DBRA 2XJ7A 2DI4A 5HXEA 2E9XC 2RPAA 3LBXA 4HFCA 3ZCJA 5ABGA 4DV3T 3OPCA 2WY2A 3FZMB 5C2TA 3K1SA 1ZHCA 4QXCB 2XASB 5L4HA 1Z0PA 4U33A 3PURA 4H9OC 4LMKA 5JTGA 2OA5A 2HN2A 3PJAA 3LK3B 3O1HA 4PAGA 3KINB 4X20E 2ZMAA 3CMLA 3NBXX 4AXPA 5A1LA 5M4YA 4G63A 1HS7A 3LBXB 2X9XA 1G73A 3EUHA 4O8SA 2JPFA 5AQRB 2FJAA 2IUBA 4MBQA 2C5IT 3LJCA 4QH4A 5AQLB 3RH3A 1I6ZA 1IZNB 2YINA 3ZYKA 2YEVC 4JI6T 1IJ5A 3RX6A 1T72A 2J47A 2H89A 2VB6A 4TNVA 4JI0T 5FKYA 3ZYMA 4FI5A 4DR1T 1HNWT 1OEDE 4X64T 2I59A 2D5UA 2WZHA 5AQFB 1D0XA 5AQUB 4PJNA 3ZEFB 4E7ZA 2D2SA 2BS4A 2E5LT 4PFPA 2AE9A 4EB6E 4ZI2D 4BJMA 5DQWA 1AJ3A 2CWOA 4K0UA 3U3IA 1WR0A 4GOUA 3IF8B 5EK2A 4LF8T 3AEAA 5HXRA 3VRAA 2XM2A 4IDOA 1J5WA 1CUNA 5LXTE 4DUZT 1KF6A 2MYSA 2X9YA 2K3WA 4UEMA 2C5KT 2E5VA 4ZZBA 3RKGA 4LF7T 3HI2A 2BBJA 2WMNA 2X0HA 2QRXA 2V6XA 2KT9A 2LSJA 1MMDA 2XTLA 3AAIA 3AVSA 3IHRA 3N9LA 3Q5XA 4IREA 3SS1A 2VKHA 3ZPOA 1IBKT 4HKAA 1H7CA 1WFDA 3AE1A 3AXJB 4M1PA 2K24A 5L47A 4UXNB 4PK5A 2IHR1 4UVCB 3N9MA 4UF0B 2SPCA 3P7IA 2E9XA 2CWYA 3CX7B 3I9YA 3ZMSB 2M67A 4YJ3E 5E0OA 4ADZA 4UR9A 5F5WA 2BVLA 4H63V 1T7SA 5H6RB 2OLTA 3FBZA 3VU7H 2LRLA 2KWHA 3UT5E 2ES0A 4CZZB 1KFYA 3LK42 4JV5T 3UUBA 2X68A 3PUWF 4YHJA 4O4HE 1BR1A 4COFA 2VQFT 3RF1A 2ZM0A 3Q5WA 1YQ4A 4U74A 4AISA 4BJNA 3CIRA 3FBLA 3SFDA 5LJNA 2H7OA 2NTXA 4IDPA 2KXPB 3CKDA 1J5ET 2V5CA 2FJBA 3FXDB 1XZYA 4OYJA 4UVAB 3AA7B 5FXWA 3RIFA 3AEBA 4PK4A 4HWIB 5JR9C 1OWAA 4GKKT 5J2TE 4L0RA 4EEBA 4A98A 2VVNA 2HHHT 4O2AE 1D0ZA 2XM1A 3OKQA 3OYZA 1NWMX 1NAFA 2NW7A 1UURA 2ACXA 2G0UA 1T98A 3B13A 3PUSA 3RYHE 4EAHA 1IAPA 3CK6A 3JC6D 4LF5T 2UUBT 3HL6A 3A8YC 1XMQT 2ACZA 2BZBA 2K48A 4LFCT 2YN6A 4ZI2C 4B3TT 5ABFB 2VL0A 3K8PC 2CRBA 3N9PA 2KZ7B 4QXHB 3AEFA 5LB7B 3KV5A 4DV7T 4ZI3D 5KMGP 3AE8A 4KBMB 2WDRA 4DO0A 5ABEA 4PFOA 2MOZA 3FZFB 2DL1A 4JI1T 4DR6T 2DCFA 2KMFA 2ZM8A 5FMNA 1G8XA 3ZMTB 3AA1B 4UV9B 2Q9QA 3CX6B 4B6XA 5JQGE 4XBFB 1E1HB 4GK0E 4QX7B 4HFDA 1UX5A 4X62T 4U2ZA 4CXXA 3EABA 2DHRA 2YDQA 4I0UA 5AQNB 3E08A 1WYBA 3Q2MA 3RLFF 5KX5E 2LE8A 3ANWA 1IJ6A 3AEEA 3NZQA 2V7KA 2EHOD 3ONLC 5AQSB 5EZYE 2BG9B 3UUNA 4AQYT 5HXHA 5FY1A 4HWCA 4DBQA 5EK4A 2BS2A 2DWGA 4DV6T 5FXZA 4IL9A 1UGOA 4U3CA
chains in the Genus database with same CATH topology
5LB7B 4CN6A 2WY2A 3ZSTA 1WR0A 3K1SA 4U33A 4U2YA 4IT4A 2JQHA 4NIQA 2DL1A 4WZXA 5CJ5A 5FVLA 2JQKA 4P1NA 5FVKA 2K3WA 2JQ9A 2W2UA 4A5XA 4U31A 5CGMA 4U7IA 4U3CA 4U2ZA 3EABA 3ZT6A 2CPTA 2V6XA 2V6YB 4U7YA 2WWVA 4CN4A 1WFDA 3ZSSA 2LRKA 2A9UA 2V6YA 4ZEYA 1WCRA 3ZT7A 2XZEA 3ZT5A 1YXRA 2MPKA 4CN1A 2LRLA 2RPAA 2CRBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LB7 B;  4CN6 A;  2WY2 A;  3ZST A;  1WR0 A;  3K1S A;  4U33 A;  4U2Y A;  4IT4 A;  2JQH A;  4NIQ A;  2DL1 A;  4WZX A;  5CJ5 A;  5FVL A;  2JQK A;  4P1N A;  5FVK A;  2K3W A;  2JQ9 A;  2W2U A;  4A5X A;  4U31 A;  5CGM A;  4U7I A;  4U3C A;  4U2Z A;  3EAB A;  3ZT6 A;  2CPT A;  2V6X A;  2V6Y B;  4U7Y A;  2WWV A;  4CN4 A;  1WFD A;  3ZSS A;  2LRK A;  2A9U A;  2V6Y A;  4ZEY A;  1WCR A;  3ZT7 A;  2XZE A;  3ZT5 A;  1YXR A;  2MPK A;  4CN1 A;  2LRL A;  2RPA A;  2CRB A; 
#chains in the Genus database with same CATH topology
 3CQX C;  2JIW A;  2QA7 A;  5JDG A;  2WS3 A;  4TWH A;  3QB5 K;  3ZST A;  2UXC T;  4L9I A;  3GN5 B;  2CXF A;  2XQ7 A;  1HCI A;  2LSY A;  2QVA A;  2Q9Q C;  4YJ2 E;  1E7P A;  4EV6 A;  4UVB B;  2VKO A;  3L8R A;  4TZ4 C;  1VCS A;  2L8K A;  3P4P A;  3ZC1 A;  1D0Y A;  2UXX B;  2KIN B;  2VKD A;  4XAX B;  1V9D A;  2H3R A;  2A2F X;  3DP7 A;  5FYM A;  3A5X A;  4HTE A;  3RYC E;  4ZOL E;  4U72 A;  1WRD A;  2LOS A;  2C0S A;  4QWN B;  2X67 A;  5JRE A;  1YW0 A;  2WP9 A;  3CPZ A;  4JI8 T;  2V6Y B;  1HFA A;  3B57 A;  3SWH A;  3QB5 A;  5ABH A;  2CLY C;  4WW0 A;  2E8I A;  5LG4 A;  1QUU A;  5HWX A;  1HX1 B;  2ZM2 A;  5HXC A;  5AQG B;  1O3X A;  2W00 A;  2V1D B;  3DTO A;  3NRY A;  1IBM T;  2NP9 A;  2ODV A;  1W0B A;  3ZT7 A;  2JJ9 A;  4KP3 C;  4B3S T;  2N1G A;  2W61 A;  4ILU A;  4O4J E;  2R6G F;  4U7I A;  1NEN A;  5DJQ C;  3RKO A;  2NOX A;  2PFV A;  3RYF E;  5ETW A;  2V7I A;  4BA9 A;  2DNX A;  4ERR A;  4ANJ A;  4IE4 A;  1FJG T;  4AKI A;  4YLH A;  1W09 A;  2BKO A;  4DVD A;  4DMW A;  5FL1 A;  2XPK A;  5CJ5 A;  5JR9 B;  3RIU C;  2N9D A;  4ZZC A;  4F6R C;  2OV9 A;  1UK5 A;  4TUY E;  1JNR A;  2UXB T;  3O9X A;  1UX4 A;  2FBW A;  3T1Y T;  2CHO A;  1XMO T;  4AI6 A;  2FJE A;  4ZI3 C;  1ZOY A;  5DQV A;  5ADX L;  3Q5E A;  4MAL A;  2CXD A;  2WWV A;  4JEH B;  4PK6 A;  4UV8 B;  3F57 A;  3VKH A;  3PU3 A;  2L3L A;  4HFB A;  3AXJ A;  1D1A A;  2WM9 A;  1FIO A;  4HGA A;  2IDO B;  2YK0 A;  4LF9 T;  3Q5D A;  3AE5 A;  2A3D A;  2Y48 B;  2Z6E A;  3EDV A;  3KFW X;  3ZSS A;  4PW8 A;  1N34 T;  2YOE A;  4UIG A;  3FXE B;  1HF8 A;  1YXR A;  2HH7 A;  3UFG A;  3KBU A;  4CN1 A;  5CFB A;  5L3B B;  1BR0 A;  2J62 A;  3ZMU B;  1KNR A;  4J2C A;  3D0T A;  4WBO A;  3J7Y q;  2ODU A;  1N36 T;  4IE7 A;  1VRB A;  2WZI A;  5IUX A;  4IGU A;  1KEY A;  2LSI A;  4LFA T;  1N33 T;  3CVR A;  3CX8 B;  3ETU A;  3K3O A;  3JCF A;  3G06 A;  3MJX A;  3O1I A;  4AKR B;  3BQK A;  2W2U A;  4YSY A;  3MKD A;  2K5B B;  5CA0 E;  3OBV E;  4OYK A;  4KHZ F;  4O4L E;  2UUC T;  3I0Q A;  3ZT6 A;  5H6Q B;  3TLU A;  3JAE A;  1B7T A;  1XDO A;  5HEO A;  2HPL A;  2GK9 A;  3MZK B;  3DJB A;  4KUM B;  2EHO B;  2JMH A;  3P4Q A;  3NRX A;  4KX6 A;  4CN4 A;  3CWZ B;  4OFZ A;  4YHH T;  2M6I A;  4QX8 B;  3HKD E;  5DAB A;  5F8P A;  1D1B A;  5J1G A;  1SE7 A;  3H3M A;  2E2A A;  3B5M A;  5LCY A;  3I0O A;  4KMC A;  1LRZ A;  4ZS2 A;  2V5D A;  3KVA A;  1JNZ A;  1L0V A;  1WLX A;  3LFM A;  4QKN A;  1T8B A;  3UUX B;  4AQG A;  1XNR T;  4CXY A;  3OTO T;  2FJD A;  4UF0 A;  3CQC B;  1HTJ F;  2WSS V;  4H9R C;  4JI3 T;  2WU5 A;  4TV9 E;  2XSA A;  3WAJ A;  2LSK A;  3UU3 A;  3UUL A;  3VR9 A;  1ZV4 X;  4WZX A;  2EHO C;  3W15 B;  1YKH B;  2X9W A;  4N78 D;  4NPP A;  3RRW A;  3VRB A;  5BMV E;  3ONJ A;  5LHG B;  3V5U A;  4HN9 A;  3M3Z B;  5LP6 E;  4NXN T;  3VKG A;  4PJJ A;  3RIU A;  2PJQ A;  3N2O A;  1XDP A;  3I9W A;  1D1C A;  3PU8 A;  4EOZ B;  1ZKE A;  3E0Z A;  4PNI A;  5L3D B;  1LKX A;  2IAK A;  2LOP A;  3PUX F;  4AQF A;  3FHN A;  2YU1 A;  3AAE B;  3KV6 A;  3MXZ A;  2XQ3 A;  2V26 A;  2VUR A;  3MAC A;  4YXD A;  4ZHQ E;  4DV0 T;  5JDL A;  4GKJ T;  3A7M A;  4HFV A;  5HXS A;  3M65 A;  4AQF C;  4KHP T;  2WMO A;  3C98 B;  3CQG B;  3C4W A;  3ESL A;  4OHF A;  4I43 B;  2XAG B;  4OX9 T;  5LMN T;  4HFI A;  5LYJ E;  5IWA T;  3QK6 A;  5F3J A;  3EI0 A;  2WWU A;  5BR8 T;  3KDS E;  4IDN A;  2XQ5 A;  5HWY A;  1HG5 A;  4IE5 A;  3ONX A;  3T8O A;  4YFS A;  4O4I E;  1ZP0 A;  2WQY A;  4KI0 F;  4DMV A;  4HWF A;  4MFR A;  3QC9 A;  4IDQ A;  2ZLY A;  3BQI A;  1W9R A;  4LF4 T;  4P09 A;  4QXB B;  3C4Z A;  2FUP A;  3UUM A;  4HE8 A;  3RQW A;  2WDQ A;  5IYZ E;  2MAW A;  1SHZ C;  2PG8 A;  2XQA A;  3ZN1 B;  5LGU B;  4B3R T;  1MNE A;  3L39 A;  4ISS A;  4H9N C;  3JAF A;  4JUY A;  2XAH B;  4C91 A;  4F8H A;  1KNP A;  2W66 A;  3NVO A;  4I50 E;  2A9U A;  3AE9 A;  3JC6 C;  4IHJ E;  4NUU A;  5JDM A;  3UTK A;  4EED A;  1X9B A;  2C5J A;  4NXM T;  4DR7 T;  5LHI B;  4LFB T;  3H37 A;  2H7V C;  2XQY A;  3P50 A;  3RPU A;  3U78 A;  2LHN A;  3RYI E;  2VWA A;  5CA1 E;  3N2G E;  4DV1 T;  4CI2 B;  3PUZ F;  2BKN A;  2M6B A;  3HKC E;  4U2Y A;  4UEL A;  4V1A v;  1OED C;  1R8I A;  2K9A A;  3SOL A;  4EYY R;  2IC6 A;  3OVU A;  2CLY B;  5HEU A;  4JI5 T;  3R6N A;  5FVK A;  2I0M A;  2KND A;  2WDV A;  3RI5 A;  3MK7 C;  4ILC A;  4DV5 T;  3P4R A;  3AAA B;  4HEA A;  2NR4 A;  4ZXL A;  4JI4 T;  3MA9 A;  1XWM A;  2WCA A;  4H63 H;  5JDF A;  4CI1 B;  3UU4 A;  3ZJ1 A;  1ZEE A;  1BR2 A;  4YSZ A;  2JQQ A;  3AED A;  1U5P A;  2LKH A;  2P9B A;  3AB3 B;  3FB2 A;  2J4G A;  2A72 A;  4ZS3 A;  4PJM A;  3TLV A;  4A56 A;  5KXJ A;  1W0A A;  3FZK B;  4X1Y E;  5AQP B;  3F2E A;  4EXT A;  2CMR A;  2MTQ A;  2W62 A;  2X0L B;  2DWK A;  5HAX A;  5JRC B;  5FXV A;  2WU2 A;  3GWH A;  3HA4 A;  4L5G A;  2KLQ A;  4A97 A;  3IA3 A;  2LM2 A;  3QUJ A;  4HWD A;  1OXZ A;  1YD8 G;  5AQJ B;  3TLW A;  5LGN B;  4CN6 A;  4EGW A;  4XZC A;  2NW9 A;  3SFE A;  3RGL A;  5LBM A;  4JI2 T;  5JDH A;  2LEH A;  2VVS A;  4X1K E;  5CB4 E;  3GMI A;  4YSX A;  3N2K E;  5FVL A;  2V8S V;  2B76 A;  2LT3 A;  3N9N A;  5L3E B;  2LLY A;  2IW5 B;  2JQ9 A;  3IBP A;  3QNU A;  5IHY A;  4GIW A;  5AFU L;  2NTY A;  3FZH B;  1LVF A;  3BK9 A;  1LVK A;  2XY8 B;  2EHO A;  2I6H A;  3AVR A;  3UU6 A;  4ZI7 E;  3PV0 F;  4H9P C;  3SRZ A;  5LNK A;  3ZCI A;  5HEH A;  2KWI B;  3AEC A;  4HFH A;  2LKG A;  4EYU A;  4TNW A;  4ASK A;  5FL0 A;  3ZMV B;  2VQE T;  1MIV A;  2BG9 E;  2MPK A;  5FY7 A;  1Y64 B;  4DR4 T;  3AEG A;  5JRC A;  2YKS A;  2RP4 A;  5AQV B;  5L3F B;  3KBT A;  2D9D A;  3AE7 A;  3PUG A;  2X66 A;  4TWD A;  2DLR A;  2B1E A;  5AQH B;  5HCJ A;  3VR8 A;  2UUA T;  5HCM A;  5C8Y E;  1HNX T;  4HWH A;  4IE6 A;  5LBQ B;  4B3M T;  4CQI A;  2BDE A;  4O2B E;  3WI3 A;  3K3N A;  2LHR A;  2LSG A;  4U31 A;  3PJA J;  2ZM6 T;  2UXD T;  5LG3 A;  3LK2 B;  2XHE B;  3C64 A;  3OYX A;  3BQL A;  3P8C D;  4H9S E;  3R84 B;  3RC3 A;  1MIY A;  1M7K A;  2V7L A;  3L09 A;  2V7J A;  3ZKR A;  3PUA A;  4TWF A;  3TLS A;  1IBL T;  2IIU A;  5AQO B;  5JDQ A;  1QLB A;  4QH1 A;  1S35 A;  1KK7 A;  3HR0 A;  3PTR B;  2H88 A;  3N5L A;  4IST A;  2D0U A;  1FMW A;  3AE2 A;  3EAM A;  5CGM A;  4K0K T;  3RRC A;  2CE7 A;  5L3C B;  5LA6 E;  1SUM B;  3GA8 A;  5HEJ A;  4FJO A;  4MLK A;  4AKG A;  5JDN A;  4I55 E;  3AE6 A;  5AQK B;  2JQH A;  1DU2 A;  3C4X A;  4HFE A;  2IML A;  3NKZ A;  1FEW A;  1XNQ T;  1U4Q A;  1X79 A;  4QHO A;  2JQK A;  2Q9Q D;  3AE3 A;  4P1N A;  4X66 T;  2W63 A;  4X5T A;  4I4T E;  4OK0 A;  1US7 B;  2LM9 A;  5LJM A;  2X9H A;  4JLE A;  2XQ8 A;  4EZH A;  3C50 A;  3ZC0 A;  1YQ3 A;  5AQQ B;  1Y01 A;  3EDU A;  3K3Q C;  2BVM A;  4JBW F;  2YU2 A;  2MBG A;  1EZ3 A;  2CEA A;  2JMK A;  4ILB A;  2LRK A;  3UU8 A;  2XQ4 A;  4YT0 A;  3AE4 A;  5L3G B;  4GYR A;  1OED A;  4Z91 A;  2D0T A;  2UU9 T;  2RA1 A;  2XZE A;  3PUV F;  4YTP A;  4BAY B;  3VHL A;  2HPJ A;  4JI7 T;  5J2U E;  1Z8U A;  1UCU A;  4IIJ E;  2CBJ A;  4CI3 B;  1M62 A;  2J1D G;  3N9Q A;  2QYW A;  4IT4 A;  2KSR A;  3H3A A;  5LGT B;  2X51 A;  3PUQ A;  3UQ7 A;  3TLT A;  2AXD S;  2Q9Q B;  2QGS A;  3OJA A;  3PUY F;  4IDZ A;  4AIU A;  1HR0 T;  4A5X A;  1KNZ A;  5J0Z A;  2F4V T;  5FNV E;  4G2A A;  4DUY T;  2XQ9 A;  1HG2 A;  4EIW A;  3ABV A;  4Z8X A;  5FY0 A;  5JR9 A;  4JEU B;  1HNZ T;  2VL8 A;  2BG9 C;  3O4X E;  5EK3 A;  2BBH A;  3FZL B;  3N9O A;  1BR4 A;  4TX5 A;  2N2N A;  3GN5 A;  3ZLI A;  1GQE A;  4GYS A;  4JYA T;  2XUE A;  4ZEY A;  2E9X B;  4H9Q C;  1MND A;  4IL4 A;  1QSD A;  4PJL A;  3Q9D A;  5AQI B;  3AA6 B;  3RHW A;  5HYA A;  5LMU T;  2PTF A;  3PDY A;  4DR2 T;  2E9X D;  2LJL A;  4NUV A;  2W4X A;  4DND A;  1I94 T;  4Q25 A;  3AA0 B;  2XQ6 A;  4TV8 E;  4C90 A;  1MIW A;  3NWI A;  4NIQ A;  4P0B A;  3ZMZ B;  3ZYL A;  5KDM C;  3KV9 A;  5JVD E;  1J1J A;  3LSV A;  3EVY A;  4ILA A;  2V7M A;  2PBI A;  3V5S A;  3LG7 A;  3S4U A;  3PE0 A;  4AKL A;  1N32 T;  1OED B;  2CPT A;  1CHU A;  4WNK A;  1MMA A;  3I1A A;  5TAO A;  3P4W A;  2CBI A;  5HEG A;  3RIA A;  2Y8D A;  3UU5 A;  2VKJ A;  3L3P A;  2HN1 A;  2NWB A;  3HKE E;  3HKB E;  4MHC A;  5GON E;  4X1I E;  4WBN E;  4DV4 T;  1UUS A;  2JRK A;  3WAK A;  1MMN A;  4YTM A;  3QOF A;  5FXX A;  3RQU A;  3UQ4 A;  1WCR A;  2CM0 A;  4LMJ A;  3IEE A;  4DID B;  3EHZ A;  2CCQ A;  2WB5 A;  2XAQ B;  1NEK A;  3ZN0 B;  3ZT5 A;  1MMG A;  4GK5 E;  2VK9 A;  2L9Q A;  4LML A;  1SA0 E;  4E7S A;  2BKP A;  5C3J A;  3RC8 A;  2CHN A;  1S94 A;  1FMV A;  3ETV A;  2WAU A;  4CXW A;  2UXN B;  4IE0 A;  4AKH A;  2CA5 A;  3E22 E;  2IC9 A;  4DV2 T;  5LOV E;  2YDS A;  3O1J A;  3KVB A;  4WYV A;  3ZJ2 A;  4DR5 T;  5L2L A;  3NZP A;  4Z90 A;  4P0A A;  4YY3 T;  2YDR A;  4X65 T;  2NW8 A;  3C51 A;  1E2A A;  4LF6 T;  1WR6 A;  2W0G A;  5FP3 A;  3T1H T;  2Y6X A;  3P4S A;  2XAF B;  5JH7 E;  4U7Y A;  2XAJ B;  1VOM A;  4EZ4 A;  1YKE B;  4QH5 A;  4YTN A;  1HX8 A;  3ANW B;  2CXL A;  3TKL B;  3KV4 A;  5ABF A;  3JAD A;  2WBL A;  5LHH B;  2VAS A;  2BS3 A;  2V6Y A;  2BG9 A;  1VCT A;  2W67 A;  2XSB A;  5AQT B;  3X1D A;  5L4E A;  4DR3 T;  2X0Y A;  1WYC A;  3LDQ B;  4TN7 B;  3F31 A;  5AQM B;  3J9X 1;  3UFE A;  4DBR A;  2XJ7 A;  2DI4 A;  5HXE A;  2E9X C;  2RPA A;  3LBX A;  4HFC A;  3ZCJ A;  5ABG A;  4DV3 T;  3OPC A;  2WY2 A;  3FZM B;  5C2T A;  3K1S A;  1ZHC A;  4QXC B;  2XAS B;  5L4H A;  1Z0P A;  4U33 A;  3PUR A;  4H9O C;  4LMK A;  5JTG A;  2OA5 A;  2HN2 A;  3PJA A;  3LK3 B;  3O1H A;  4PAG A;  3KIN B;  4X20 E;  2ZMA A;  3CML A;  3NBX X;  4AXP A;  5A1L A;  5M4Y A;  4G63 A;  1HS7 A;  3LBX B;  2X9X A;  1G73 A;  3EUH A;  4O8S A;  2JPF A;  5AQR B;  2FJA A;  2IUB A;  4MBQ A;  2C5I T;  3LJC A;  4QH4 A;  5AQL B;  3RH3 A;  1I6Z A;  1IZN B;  2YIN A;  3ZYK A;  2YEV C;  4JI6 T;  1IJ5 A;  3RX6 A;  1T72 A;  2J47 A;  2H89 A;  2VB6 A;  4TNV A;  4JI0 T;  5FKY A;  3ZYM A;  4FI5 A;  4DR1 T;  1HNW T;  1OED E;  4X64 T;  2I59 A;  2D5U A;  2WZH A;  5AQF B;  1D0X A;  5AQU B;  4PJN A;  3ZEF B;  4E7Z A;  2D2S A;  2BS4 A;  2E5L T;  4PFP A;  2AE9 A;  4EB6 E;  4ZI2 D;  4BJM A;  5DQW A;  1AJ3 A;  2CWO A;  4K0U A;  3U3I A;  1WR0 A;  4GOU A;  3IF8 B;  5EK2 A;  4LF8 T;  3AEA A;  5HXR A;  3VRA A;  2XM2 A;  4IDO A;  1J5W A;  1CUN A;  5LXT E;  4DUZ T;  1KF6 A;  2MYS A;  2X9Y A;  2K3W A;  4UEM A;  2C5K T;  2E5V A;  4ZZB A;  3RKG A;  4LF7 T;  3HI2 A;  2BBJ A;  2WMN A;  2X0H A;  2QRX A;  2V6X A;  2KT9 A;  2LSJ A;  1MMD A;  2XTL A;  3AAI A;  3AVS A;  3IHR A;  3N9L A;  3Q5X A;  4IRE A;  3SS1 A;  2VKH A;  3ZPO A;  1IBK T;  4HKA A;  1H7C A;  1WFD A;  3AE1 A;  3AXJ B;  4M1P A;  2K24 A;  5L47 A;  4UXN B;  4PK5 A;  2IHR 1;  4UVC B;  3N9M A;  4UF0 B;  2SPC A;  3P7I A;  2E9X A;  2CWY A;  3CX7 B;  3I9Y A;  3ZMS B;  2M67 A;  4YJ3 E;  5E0O A;  4ADZ A;  4UR9 A;  5F5W A;  2BVL A;  4H63 V;  1T7S A;  5H6R B;  2OLT A;  3FBZ A;  3VU7 H;  2LRL A;  2KWH A;  3UT5 E;  2ES0 A;  4CZZ B;  1KFY A;  3LK4 2;  4JV5 T;  3UUB A;  2X68 A;  3PUW F;  4YHJ A;  4O4H E;  1BR1 A;  4COF A;  2VQF T;  3RF1 A;  2ZM0 A;  3Q5W A;  1YQ4 A;  4U74 A;  4AIS A;  4BJN A;  3CIR A;  3FBL A;  3SFD A;  5LJN A;  2H7O A;  2NTX A;  4IDP A;  2KXP B;  3CKD A;  1J5E T;  2V5C A;  2FJB A;  3FXD B;  1XZY A;  4OYJ A;  4UVA B;  3AA7 B;  5FXW A;  3RIF A;  3AEB A;  4PK4 A;  4HWI B;  5JR9 C;  1OWA A;  4GKK T;  5J2T E;  4L0R A;  4EEB A;  4A98 A;  2VVN A;  2HHH T;  4O2A E;  1D0Z A;  2XM1 A;  3OKQ A;  3OYZ A;  1NWM X;  1NAF A;  2NW7 A;  1UUR A;  2ACX A;  2G0U A;  1T98 A;  3B13 A;  3PUS A;  3RYH E;  4EAH A;  1IAP A;  3CK6 A;  3JC6 D;  4LF5 T;  2UUB T;  3HL6 A;  3A8Y C;  1XMQ T;  2ACZ A;  2BZB A;  2K48 A;  4LFC T;  2YN6 A;  4ZI2 C;  4B3T T;  5ABF B;  2VL0 A;  3K8P C;  2CRB A;  3N9P A;  2KZ7 B;  4QXH B;  3AEF A;  5LB7 B;  3KV5 A;  4DV7 T;  4ZI3 D;  5KMG P;  3AE8 A;  4KBM B;  2WDR A;  4DO0 A;  5ABE A;  4PFO A;  2MOZ A;  3FZF B;  2DL1 A;  4JI1 T;  4DR6 T;  2DCF A;  2KMF A;  2ZM8 A;  5FMN A;  1G8X A;  3ZMT B;  3AA1 B;  4UV9 B;  2Q9Q A;  3CX6 B;  4B6X A;  5JQG E;  4XBF B;  1E1H B;  4GK0 E;  4QX7 B;  4HFD A;  1UX5 A;  4X62 T;  4U2Z A;  4CXX A;  3EAB A;  2DHR A;  2YDQ A;  4I0U A;  5AQN B;  3E08 A;  1WYB A;  3Q2M A;  3RLF F;  5KX5 E;  2LE8 A;  3ANW A;  1IJ6 A;  3AEE A;  3NZQ A;  2V7K A;  2EHO D;  3ONL C;  5AQS B;  5EZY E;  2BG9 B;  3UUN A;  4AQY T;  5HXH A;  5FY1 A;  4HWC A;  4DBQ A;  5EK4 A;  2BS2 A;  2DWG A;  4DV6 T;  5FXZ A;  4IL9 A;  1UGO A;  4U3C A; 
#chains in the Genus database with same CATH homology
 5LB7 B;  4CN6 A;  2WY2 A;  3ZST A;  1WR0 A;  3K1S A;  4U33 A;  4U2Y A;  4IT4 A;  2JQH A;  4NIQ A;  2DL1 A;  4WZX A;  5CJ5 A;  5FVL A;  2JQK A;  4P1N A;  5FVK A;  2K3W A;  2JQ9 A;  2W2U A;  4A5X A;  4U31 A;  5CGM A;  4U7I A;  4U3C A;  4U2Z A;  3EAB A;  3ZT6 A;  2CPT A;  2V6X A;  2V6Y B;  4U7Y A;  2WWV A;  4CN4 A;  1WFD A;  3ZSS A;  2LRK A;  2A9U A;  2V6Y A;  4ZEY A;  1WCR A;  3ZT7 A;  2XZE A;  3ZT5 A;  1YXR A;  2MPK A;  4CN1 A;  2LRL A;  2RPA A;  2CRB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...