4P1NA

Crystal structure of atg1-atg13 complex
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
262
structure length
190
Chain Sequence
SDSNITPFVESLSAKAFVMYSFAEMKFSQILNLIPAPELKKLCMESLLLYLKSLTILASSMKLTSKWWYENESKNCTLKLNILVQWIRDRFNECLDKAEFLRLKLHTLNQSEDPQVLDDPTIFVEKLIYDRALDISRNAARLEMEGNYNTCELAYATSLWMLEILLDEHLSDESDKEMIRKYVSSIANRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Atg1 tMIT
publication title Structural basis of starvation-induced assembly of the autophagy initiation complex.
pubmed doi rcsb
source organism Kluyveromyces marxianus
molecule tags Protein transport
total genus 77
structure length 190
sequence length 262
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12063 DUF3543 Domain of unknown function (DUF3543)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 4p1nA00
2K3WA 2XZEA 2CPTA 4U3CA 4CN4A 2RPAA 2LRLA 2JQ9A 4U31A 3ZT6A 4CN1A 2DL1A 2CRBA 4A5XA 5LB7B 2JQHA 4ZEYA 5CJ5A 2V6YB 2LRKA 3EABA 4U33A 4U2YA 1WFDA 2MPKA 4WZXA 2WWVA 4IT4A 5CGMA 4NIQA 4U2ZA 2V6XA 4U7YA 5FVLA 2V6YA 2JQKA 2W2UA 4U7IA 4CN6A 1WCRA 5FVKA 4P1NA 1WR0A 2A9UA 1YXRA 3ZT5A 2WY2A 3K1SA 3ZT7A 3ZSTA 3ZSSA
chains in the Genus database with same CATH superfamily
5H6RB 2CBIA 3Q2MA 2V7MA 5LB7B 4IE5A 1HG2A 1WFDA 3PUXF 2CXFA 3L3PA 3N9OA 2BBHA 2X9YA 1D1CA 3ZC0A 2YOEA 3NWIA 1NAFA 2H7VC 3N5LA 5LYJE 2W0GA 2X0LB 4U33A 2PG8A 4IHJE 2X66A 5HWYA 4DR1T 3UUMA 4AIUA 2OLTA 4ZS2A 3ZCIA 1T7SA 4QKNA 3U78A 2XTLA 2IIUA 2RA1A 4GKKT 5FY7A 4LF9T 4B3ST 2VVNA 2D9DA 4EV6A 5C8YE 1XNRT 4CXXA 4DV3T 1WCRA 3FBLA 2EHOC 3Q5EA 2BBJA 2Q9QC 4WYVA 5JVDE 4UXNB 4F8HA 2XZEA 5FXVA 1S94A 4YSYA 1MMDA 4IE0A 3AA0B 1IJ5A 5CJ5A 3CPZA 2LSJA 3RH3A 3KV5A 4JI7T 2BKNA 2BG9E 4X66T 3S4UA 5BR8T 2DI4A 4GOUA 1MIYA 4BJMA 2XQAA 3H37A 5JR9C 4ZHQE 2WCAA 4QH4A 3CQCB 3SWHA 4HFEA 2FJAA 4LF8T 3AA1B 3C4XA 2LEHA 3LFMA 2A9UA 3ZJ1A 1KEYA 1W09A 4XZCA 2E9XB 3AXJA 3KBUA 4YJ2E 1SE7A 1ZHCA 4EZ4A 4ILCA 5JREA 2CWYA 4HE8A 2V1DB 2V7LA 3EAMA 2JPFA 3LG7A 3FZMB 2WZHA 2PBIA 4YFSA 3QOFA 3UULA 4OYJA 5KXJA 2RP4A 4U2YA 2WWVA 2VKHA 3PUSA 4ZI3C 1ZKEA 2WMNA 2K9AA 3RLFF 2KT9A 2EHOA 4DBQA 3K3QC 2Q9QA 1N36T 4HFIA 4G63A 2JJ9A 3LBXB 1S35A 4UIGA 4DV6T 3ONJA 2KINB 4EB6E 5IUXA 4ZI2D 3RYCE 4AQFC 3UTKA 2X0HA 3DP7A 3JAEA 3C4WA 5AQVB 1WR6A 2XQ7A 5L3EB 4LMJA 4J2CA 4EOZB 1NENA 3R84B 3FHNA 4JV5T 1AJ3A 3OBVE 2R6GF 4C91A 4CQIA 2ZLYA 5JR9A 4LF5T 2CHNA 4MHCA 5JRCA 2YU2A 3JC6D 2OA5A 4JYAT 4EYYR 1I94T 3PU8A 2LSIA 4GKJT 1L0VA 1Z8UA 5FY0A 3TLTA 1W9RA 3ZMVB 3UFEA 3UU5A 4H63H 2W2UA 3PU3A 1WYCA 4UEMA 4HWHA 1LVKA 4DR3T 2JQ9A 2YEVC 5C3JA 3O1HA 4KBMB 4A97A 2XAJB 5ADXL 3N9PA 3RF1A 3D0TA 1MMAA 3VHLA 4PJJA 2IDOB 3J9X1 5AQIB 3RQWA 4U74A 1IAPA 1BR1A 1KF6A 2WMOA 3TLUA 5HXHA 3Q5WA 3PV0F 2YDQA 4QXBB 3BK9A 4DV2T 3ZYLA 3C64A 1HR0T 3PUQA 3AE8A 1N34T 2L8KA 2UXNB 3RIAA 2V8SV 5AQTB 2LKGA 4CI2B 2YINA 1DU2A 4CXYA 3AEEA 5ABGA 2LHNA 3VKHA 5CGMA 2H88A 1Y64B 3CIRA 1X9BA 2WDVA 2WP9A 4HFCA 4ASKA 2CEAA 1OEDC 4H9PC 2XSAA 2WDRA 5FL1A 4AKGA 1HX8A 4X20E 3MJXA 2FJDA 2XQ6A 4U72A 4IT4A 2KWHA 4Z8XA 1B7TA 5AQOB 3TKLB 3JCFA 2LM2A 4TZ4C 1HFAA 2X9WA 3I9WA 2LOPA 4YHJA 3QB5A 3EHZA 5JTGA 4BJNA 5E0OA 1HG5A 2BKOA 3A8YC 3AAEB 2XQ4A 4TNWA 1IBKT 3VR9A 3L8RA 3FB2A 4H63V 4WNKA 4X62T 4UVCB 3T8OA 5ABFA 4IDOA 2FJEA 2I6HA 3M65A 4WW0A 2NOXA 3QK6A 3IHRA 3AEAA 5F5WA 3KVAA 4O8SA 3PUZF 2UUAT 5AQKB 3L09A 2ODVA 4IE7A 3QNUA 5ETWA 4DV4T 2CLYB 4UF0B 3UU8A 2Q9QD 2RPAA 4M1PA 5HEHA 5AQUB 4AKIA 2UXCT 1KNZA 3NKZA 1HNZT 3N2GE 4JI5T 3R6NA 3FXDB 4CZZB 3IEEA 4B3TT 5FXWA 2BS3A 4ILAA 4TV9E 1OEDA 4YTMA 5AQJB 2UXXB 3NRYA 2MYSA 4YTNA 4IL4A 1HNXT 1FIOA 2IW5B 2HPJA 3VRBA 2P9BA 2KZ7B 5L4HA 4N78D 2BG9C 1QLBA 3AEFA 2CBJA 2WM9A 2YDRA 1D1BA 1EZ3A 5JDQA 5FVLA 1G73A 2WS3A 4H9SE 2JIWA 4DMVA 4GK0E 4KMCA 4EEBA 4F6RC 4U3CA 4DVDA 4JI3T 4H9OC 5LJNA 4QX7B 1YQ4A 2WU5A 3AE6A 4EYUA 4AXPA 3PUVF 3PUAA 3RYHE 3CK6A 1MIWA 5LCYA 5L3DB 4HGAA 4ZI3D 1FMVA 4Z91A 1R8IA 4TWHA 3G06A 2E5VA 5HXSA 4PFPA 5HCMA 4A56A 5KMGP 1XWMA 4TUYE 5JDLA 3E22E 4HFBA 4NIQA 4QXHB 3N9QA 3F57A 4PK6A 3MZKB 4PK5A 4NXNT 3AA7B 3P8CD 2MAWA 1LVFA 2XAGB 5HYAA 4JI8T 1MIVA 5LHIB 4QH5A 5HCJA 4OK0A 3UUBA 4G2AA 4Z90A 3O4XE 3PUGA 5HXCA 3VR8A 4L0RA 4XBFB 1SHZC 3SOLA 2B76A 1HX1B 3ZMUB 4CN4A 3RPUA 4A5XA 3UUNA 3O1IA 4DNDA 1HTJF 4AKHA 3CKDA 2BG9A 2WQYA 4ILBA 4P0AA 4E7SA 4HWDA 4IREA 3NZQA 3PURA 4KI0F 2LLYA 2Z6EA 3C98B 2I59A 4I0UA 2LSGA 3RKGA 2V5DA 2ZM2A 3GWHA 1M7KA 4X1IE 5AQHB 3VU7H 4IE6A 3ZCJA 2A3DA 3AVSA 4IDQA 4X5TA 1LRZA 3J7Yq 4YJ3E 2MBGA 3AA6B 1VOMA 2D0TA 2VASA 3ZT6A 5LA6E 5FXZA 3E0ZA 3O9XA 2V6YB 4AISA 3ETUA 4ZXLA 4JEHB 2V6XA 1YKHB 4WBNE 3KVBA 4MALA 2A72A 5HEJA 3ZT5A 2I0MA 1T72A 2VKDA 3P4PA 3P4WA 3AECA 3ZYMA 5LNKA 1MNDA 2XPKA 4HWIB 3JADA 2YKSA 1I6ZA 3V5SA 1XDOA 2VL8A 2JQQA 3WI3A 5LHGB 3AEGA 5LHHB 1D0YA 2FBWA 4UELA 4ZZCA 2VWAA 4H9NC 3PTRB 4IDZA 5LG3A 4EAHA 2CRBA 4IDNA 1T8BA 2FUPA 3T1HT 2X0YA 2UUCT 4BAYB 2KWIB 5FKYA 3AE3A 3K1SA 2GK9A 2LM9A 1UCUA 3GN5A 4O4IE 2DNXA 3HKDE 3CQGB 5FP3A 2YK0A 2IMLA 2X67A 3LDQB 1XNQT 1E7PA 2D5UA 4L9IA 2W62A 3KV4A 2BZBA 3AE1A 4MFRA 3FXEB 4XAXB 3ZN1B 1VCSA 4YSZA 4TWFA 2JQHA 1J1JA 4LF7T 3ANWA 2AXDS 3GMIA 4YTPA 5EK4A 3IF8B 5L3FB 2CXLA 2CMRA 4DUYT 4YSXA 1UGOA 2J4GA 4DUZT 3I0QA 4CXWA 2M67A 1IBLT 2HN2A 4KHPT 2BS4A 3U3IA 4JEUB 5KDMC 3CX8B 4ANJA 3AAAB 1HNWT 2IC9A 1ZV4X 2LKHA 4BA9A 3NRXA 2IC6A 4P1NA 2E9XC 2NW9A 2WY2A 3ZSSA 2W67A 2K3WA 3K3NA 2Y6XA 3FZHB 5AQNB 4NUUA 4HFDA 3UU3A 1Y01A 4L5GA 4TNVA 2H89A 2LOSA 5FXXA 1G8XA 2JQKA 2XQYA 3OTOT 1WR0A 4JBWF 3QUJA 2J62A 5FYMA 4HWFA 5FL0A 2K5BB 1UX5A 2G0UA 2UXDT 1ZP0A 3X1DA 2NTYA 3DTOA 2WWUA 4TX5A 2V5CA 1UURA 5GONE 2X9XA 4DR2T 3BQKA 3UFGA 2C5JA 4DBRA 3LK42 4U7YA 5IWAT 3BQLA 4B3RT 4ISTA 3HI2A 2VKJA 2HPLA 1YQ3A 3P4QA 1J5WA 2LSYA 4HWCA 4ZEYA 4KHZF 2MTQA 3K8PC 5AQMB 2H3RA 4GYSA 4NPPA 3CX6B 4HFHA 2UU9T 2SPCA 2CPTA 2J1DG 2QGSA 2VQFT 2VVSA 3UT5E 1T98A 4NUVA 2E9XA 1BR4A 3A7MA 4O4HE 3C4ZA 3P4SA 5IHYA 2XASB 1QUUA 4EZHA 4KP3C 5FVKA 3MXZA 2N9DA 4P09A 2V7KA 4ZOLE 3HKEE 4OHFA 5LGTB 3HKCE 2A2FX 1VCTA 5JQGE 5EK2A 3TLSA 3AE4A 3ONLC 4YY3T 1X79A 1YXRA 3HA4A 4EGWA 3PUWF 4ISSA 3F31A 3BQIA 4FI5A 3P4RA 1YD8G 1VRBA 4DV1T 1CHUA 3AE2A 5L3BB 4X64T 2XQ5A 3LBXA 1GQEA 3C50A 4CI3B 5LP6E 4YT0A 5IYZE 3CMLA 3IBPA 5JDGA 2W66A 3ZT7A 4I43B 3ZEFB 2EHOD 4COFA 5F8PA 1W0AA 2V7JA 5TAOA 3L39A 1NWMX 5AQPB 1NEKA 2NWBA 3ZLIA 5J2UE 2HN1A 5DQWA 2BS2A 1MMNA 3RRCA 4IDPA 4B3MT 1UX4A 4QXCB 5L3CB 2DL1A 3KBTA 4K0UA 3EABA 5LG4A 3A5XA 3P7IA 3ONXA 5L47A 5HXEA 3KFWX 5AQSB 2XM1A 1U4QA 3EI0A 5CA0E 5L3GB 1V9DA 4OX9T 5EK3A 3ZMTB 4HN9A 5LXTE 4FJOA 3AXJB 1Z0PA 3PE0A 1MNEA 2KXPB 2WAUA 2QRXA 2ZM8A 4JI2T 3VKGA 4DV0T 2LRLA 3QC9A 1WLXA 4DR7T 1E1HB 2BVMA 2WSSV 3SFEA 3AAIA 3MACA 3FZFB 3ABVA 1D0XA 4JI1T 5M4YA 3QB5K 2D0UA 5ABHA 4CN1A 1JNRA 3HKBE 3OYXA 4GYRA 4O4JE 5L2LA 5J0ZA 4UVAB 3E08A 2LJLA 3UU4A 3OKQA 4X1YE 2XAHB 1HS7A 2EHOB 4AI6A 2B1EA 2Q9QB 4MLKA 3WAKA 3N2KE 2YDSA 4EXTA 3AE5A 4QWNB 2JMKA 2BKPA 4E7ZA 3C51A 2LT3A 2DWGA 3TLWA 3UUXB 3RC8A 2BVLA 4LFBT 4U7IA 3ZMSB 5AQRB 4EEDA 4YXDA 2AE9A 2E9XD 3LK3B 4KUMB 4PJLA 4Q25A 5JR9B 4ERRA 2Y8DA 2LSKA 5JRCB 2F4VT 5LBQB 3PDYA 4I55E 3TLVA 4JI6T 4DV7T 4DV5T 3B57A 5HXRA 5J2TE 3RKOA 2K24A 4X65T 4V1Av 1OXZA 2ACZA 2JRKA 4LF6T 5JH7E 3SRZA 1YW0A 2M6BA 4IE4A 4K0KT 2CHOA 2XHEB 3ZKRA 4UF0A 5JDFA 3RIFA 4YHHT 1ZEEA 1HCIA 2CWOA 4PFOA 2WDQA 2L3LA 3UQ4A 3H3AA 4H9RC 2YU1A 2KLQA 3CVRA 4C90A 3RIUC 1D1AA 2VK9A 3DJBA 1LKXA 5BMVE 4DR6T 4HEAA 4O4LE 3ZYKA 2NW8A 1OWAA 3KINB 1WRDA 2XAFB 3M3ZB 2ACXA 2XY8B 4GK5E 3UU6A 3ETVA 3EVYA 5C2TA 4JI0T 2NTXA 3FZKB 4WBOA 3WAJA 4NXMT 5HAXA 4IL9A 3W15B 2PJQA 1SUMB 3CX7B 1BR0A 4TWDA 2X68A 1KFYA 4DR5T 3ZN0B 4MBQA 3N9MA 3LSVA 1UUSA 1U5PA 4DIDB 4CI1B 1MMGA 5LOVE 4OYKA 4WZXA 3PUYF 1N32T 3EUHA 5KX5E 5FMNA 1HF8A 1UK5A 4QH1A 2CE7A 3MKDA 3P50A 2UUBT 3OVUA 2V26A 4U31A 3AE9A 2KSRA 2ZMAA 3Q5XA 2N1GA 2XM2A 4LF4T 5HWXA 4A98A 5ABFB 4ZZBA 3B5MA 3AEDA 2UXBT 3PJAJ 4HFVA 3VRAA 4I4TE 3RIUA 1KK7A 4HTEA 2XAQB 2LHRA 5AQQB 1XMOT 4AKRB 4ZI7E 3T1YT 3KV6A 4ADZA 2XQ9A 1JNZA 3RQUA 5FNVE 2HHHT 3I1AA 4DMWA 2L9QA 1YKEB 2ODUA 2W63A 3AE7A 5LMUT 3EDUA 3RX6A 4AQGA 5AQLB 2X9HA 1OEDB 4ILUA 2W4XA 3CWZB 3JAFA 3N9LA 5DJQC 5LGNB 2CXDA 3ZJ2A 3ESLA 2LE8A 2ZM0A 2C0SA 2E5LT 1WYBA 5LBMA 1KNRA 1US7B 2DHRA 4QHOA 2BDEA 2KNDA 5JDHA 3MK7C 1IJ6A 2W61A 2CCQA 2QA7A 2W00A 2V6YA 1BR2A 4DR4T 3AVRA 5A1LA 3ZSTA 3AEBA 2JMHA 2QYWA 3CQXC 4B6XA 3EDVA 3K3OA 4AQYT 3OJAA 2XQ8A 1IZNB 4LFCT 2E2AA 1SA0E 5DQVA 3RRWA 3B13A 4X1KE 4AQFA 4UR9A 2NP9A 1H7CA 5EZYE 3RI5A 1J5ET 2MPKA 4PW8A 4IIJE 5HEGA 3IA3A 3OYZA 5HEUA 2XJ7A 5CFBA 2M6IA 3RC3A 5AFUL 2PTFA 4ZS3A 4LMLA 4UVBB 2D2SA 3LK2B 2IAKA 2KMFA 2V7IA 2LRKA 3RYIE 3H3MA 4U2ZA 4UV8B 2OV9A 5JDNA 2X51A 4KX6A 4PJMA 3HR0A 3AB3B 2VL0A 3FZLB 3HL6A 2BG9B 2Y48B 3ZMZB 1FJGT 2FJBA 3Q5DA 3KV9A 3N2OA 1QSDA 3RHWA 5LJMA 2WZIA 2ES0A 2NW7A 4TN7B 3UQ7A 2VURA 1O3XA 2ZM6T 2HH7A 2PFVA 2CA5A 2WB5A 3NVOA 5J1GA 1KNPA 3RGLA 4PNIA 4OFZA 4ZI2C 2NR4A 2E8IA 3NZPA 2XUEA 1W0BA 3GA8A 2WBLA 3F2EA 2IUBA 4PK4A 2YN6A 2DWKA 5L4EA 3ZPOA 1FEWA 5DABA 4LMKA 4AKLA 2CM0A 1N33T 3JC6C 4GIWA 4JLEA 4LFAT 2VKOA 3O1JA 4PAGA 2QVAA 4UV9B 3SS1A 5F3JA 5LGUB 5CB4E 2DCFA 3I0OA 3OPCA 5LMNT 3ZC1A 1ZOYA 4EIWA 3LJCA 1XDPA 2K48A 1M62A 1E2AA 4DO0A 4PJNA 2VB6A 1D0ZA 2C5IT 5H6QB 1CUNA 2XSBA 4I50E 1FMWA 3I9YA 2C5KT 4HKAA 5FY1A 4IGUA 3FBZA 2DLRA 2N2NA 4JUYA 1XMQT 4CN6A 3GN5B 2CLYC 3Q9DA 3PJAA 4JI4T 1IBMT 2XQ3A 4QX8B 1OEDE 5ABEA 1XZYA 5HEOA 4O2AE 5AQGB 2J47A 2MOZA 4P0BA 2WU2A 2VQET 3ANWB 3SFDA 2H7OA 5CA1E 3MA9A 3NBXX 2IHR1 3N9NA 5AQFB 3KDSE 4H9QC 4O2BE 3V5UA 4YLHA 4TV8E 3RYFE 5JDMA
chains in the Genus database with same CATH topology
2K3WA 2XZEA 2CPTA 4U3CA 4CN4A 2RPAA 2LRLA 2JQ9A 4U31A 3ZT6A 4CN1A 2DL1A 2CRBA 4A5XA 5LB7B 2JQHA 4ZEYA 5CJ5A 2V6YB 2LRKA 3EABA 4U33A 4U2YA 1WFDA 2MPKA 4WZXA 2WWVA 4IT4A 5CGMA 4NIQA 4U2ZA 2V6XA 4U7YA 5FVLA 2V6YA 2JQKA 2W2UA 4U7IA 4CN6A 1WCRA 5FVKA 4P1NA 1WR0A 2A9UA 1YXRA 3ZT5A 2WY2A 3K1SA 3ZT7A 3ZSTA 3ZSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K3W A;  2XZE A;  2CPT A;  4U3C A;  4CN4 A;  2RPA A;  2LRL A;  2JQ9 A;  4U31 A;  3ZT6 A;  4CN1 A;  2DL1 A;  2CRB A;  4A5X A;  5LB7 B;  2JQH A;  4ZEY A;  5CJ5 A;  2V6Y B;  2LRK A;  3EAB A;  4U33 A;  4U2Y A;  1WFD A;  2MPK A;  4WZX A;  2WWV A;  4IT4 A;  5CGM A;  4NIQ A;  4U2Z A;  2V6X A;  4U7Y A;  5FVL A;  2V6Y A;  2JQK A;  2W2U A;  4U7I A;  4CN6 A;  1WCR A;  5FVK A;  4P1N A;  1WR0 A;  2A9U A;  1YXR A;  3ZT5 A;  2WY2 A;  3K1S A;  3ZT7 A;  3ZST A;  3ZSS A; 
#chains in the Genus database with same CATH topology
 5H6R B;  2CBI A;  3Q2M A;  2V7M A;  5LB7 B;  4IE5 A;  1HG2 A;  1WFD A;  3PUX F;  2CXF A;  3L3P A;  3N9O A;  2BBH A;  2X9Y A;  1D1C A;  3ZC0 A;  2YOE A;  3NWI A;  1NAF A;  2H7V C;  3N5L A;  5LYJ E;  2W0G A;  2X0L B;  4U33 A;  2PG8 A;  4IHJ E;  2X66 A;  5HWY A;  4DR1 T;  3UUM A;  4AIU A;  2OLT A;  4ZS2 A;  3ZCI A;  1T7S A;  4QKN A;  3U78 A;  2XTL A;  2IIU A;  2RA1 A;  4GKK T;  5FY7 A;  4LF9 T;  4B3S T;  2VVN A;  2D9D A;  4EV6 A;  5C8Y E;  1XNR T;  4CXX A;  4DV3 T;  1WCR A;  3FBL A;  2EHO C;  3Q5E A;  2BBJ A;  2Q9Q C;  4WYV A;  5JVD E;  4UXN B;  4F8H A;  2XZE A;  5FXV A;  1S94 A;  4YSY A;  1MMD A;  4IE0 A;  3AA0 B;  1IJ5 A;  5CJ5 A;  3CPZ A;  2LSJ A;  3RH3 A;  3KV5 A;  4JI7 T;  2BKN A;  2BG9 E;  4X66 T;  3S4U A;  5BR8 T;  2DI4 A;  4GOU A;  1MIY A;  4BJM A;  2XQA A;  3H37 A;  5JR9 C;  4ZHQ E;  2WCA A;  4QH4 A;  3CQC B;  3SWH A;  4HFE A;  2FJA A;  4LF8 T;  3AA1 B;  3C4X A;  2LEH A;  3LFM A;  2A9U A;  3ZJ1 A;  1KEY A;  1W09 A;  4XZC A;  2E9X B;  3AXJ A;  3KBU A;  4YJ2 E;  1SE7 A;  1ZHC A;  4EZ4 A;  4ILC A;  5JRE A;  2CWY A;  4HE8 A;  2V1D B;  2V7L A;  3EAM A;  2JPF A;  3LG7 A;  3FZM B;  2WZH A;  2PBI A;  4YFS A;  3QOF A;  3UUL A;  4OYJ A;  5KXJ A;  2RP4 A;  4U2Y A;  2WWV A;  2VKH A;  3PUS A;  4ZI3 C;  1ZKE A;  2WMN A;  2K9A A;  3RLF F;  2KT9 A;  2EHO A;  4DBQ A;  3K3Q C;  2Q9Q A;  1N36 T;  4HFI A;  4G63 A;  2JJ9 A;  3LBX B;  1S35 A;  4UIG A;  4DV6 T;  3ONJ A;  2KIN B;  4EB6 E;  5IUX A;  4ZI2 D;  3RYC E;  4AQF C;  3UTK A;  2X0H A;  3DP7 A;  3JAE A;  3C4W A;  5AQV B;  1WR6 A;  2XQ7 A;  5L3E B;  4LMJ A;  4J2C A;  4EOZ B;  1NEN A;  3R84 B;  3FHN A;  4JV5 T;  1AJ3 A;  3OBV E;  2R6G F;  4C91 A;  4CQI A;  2ZLY A;  5JR9 A;  4LF5 T;  2CHN A;  4MHC A;  5JRC A;  2YU2 A;  3JC6 D;  2OA5 A;  4JYA T;  4EYY R;  1I94 T;  3PU8 A;  2LSI A;  4GKJ T;  1L0V A;  1Z8U A;  5FY0 A;  3TLT A;  1W9R A;  3ZMV B;  3UFE A;  3UU5 A;  4H63 H;  2W2U A;  3PU3 A;  1WYC A;  4UEM A;  4HWH A;  1LVK A;  4DR3 T;  2JQ9 A;  2YEV C;  5C3J A;  3O1H A;  4KBM B;  4A97 A;  2XAJ B;  5ADX L;  3N9P A;  3RF1 A;  3D0T A;  1MMA A;  3VHL A;  4PJJ A;  2IDO B;  3J9X 1;  5AQI B;  3RQW A;  4U74 A;  1IAP A;  1BR1 A;  1KF6 A;  2WMO A;  3TLU A;  5HXH A;  3Q5W A;  3PV0 F;  2YDQ A;  4QXB B;  3BK9 A;  4DV2 T;  3ZYL A;  3C64 A;  1HR0 T;  3PUQ A;  3AE8 A;  1N34 T;  2L8K A;  2UXN B;  3RIA A;  2V8S V;  5AQT B;  2LKG A;  4CI2 B;  2YIN A;  1DU2 A;  4CXY A;  3AEE A;  5ABG A;  2LHN A;  3VKH A;  5CGM A;  2H88 A;  1Y64 B;  3CIR A;  1X9B A;  2WDV A;  2WP9 A;  4HFC A;  4ASK A;  2CEA A;  1OED C;  4H9P C;  2XSA A;  2WDR A;  5FL1 A;  4AKG A;  1HX8 A;  4X20 E;  3MJX A;  2FJD A;  2XQ6 A;  4U72 A;  4IT4 A;  2KWH A;  4Z8X A;  1B7T A;  5AQO B;  3TKL B;  3JCF A;  2LM2 A;  4TZ4 C;  1HFA A;  2X9W A;  3I9W A;  2LOP A;  4YHJ A;  3QB5 A;  3EHZ A;  5JTG A;  4BJN A;  5E0O A;  1HG5 A;  2BKO A;  3A8Y C;  3AAE B;  2XQ4 A;  4TNW A;  1IBK T;  3VR9 A;  3L8R A;  3FB2 A;  4H63 V;  4WNK A;  4X62 T;  4UVC B;  3T8O A;  5ABF A;  4IDO A;  2FJE A;  2I6H A;  3M65 A;  4WW0 A;  2NOX A;  3QK6 A;  3IHR A;  3AEA A;  5F5W A;  3KVA A;  4O8S A;  3PUZ F;  2UUA T;  5AQK B;  3L09 A;  2ODV A;  4IE7 A;  3QNU A;  5ETW A;  4DV4 T;  2CLY B;  4UF0 B;  3UU8 A;  2Q9Q D;  2RPA A;  4M1P A;  5HEH A;  5AQU B;  4AKI A;  2UXC T;  1KNZ A;  3NKZ A;  1HNZ T;  3N2G E;  4JI5 T;  3R6N A;  3FXD B;  4CZZ B;  3IEE A;  4B3T T;  5FXW A;  2BS3 A;  4ILA A;  4TV9 E;  1OED A;  4YTM A;  5AQJ B;  2UXX B;  3NRY A;  2MYS A;  4YTN A;  4IL4 A;  1HNX T;  1FIO A;  2IW5 B;  2HPJ A;  3VRB A;  2P9B A;  2KZ7 B;  5L4H A;  4N78 D;  2BG9 C;  1QLB A;  3AEF A;  2CBJ A;  2WM9 A;  2YDR A;  1D1B A;  1EZ3 A;  5JDQ A;  5FVL A;  1G73 A;  2WS3 A;  4H9S E;  2JIW A;  4DMV A;  4GK0 E;  4KMC A;  4EEB A;  4F6R C;  4U3C A;  4DVD A;  4JI3 T;  4H9O C;  5LJN A;  4QX7 B;  1YQ4 A;  2WU5 A;  3AE6 A;  4EYU A;  4AXP A;  3PUV F;  3PUA A;  3RYH E;  3CK6 A;  1MIW A;  5LCY A;  5L3D B;  4HGA A;  4ZI3 D;  1FMV A;  4Z91 A;  1R8I A;  4TWH A;  3G06 A;  2E5V A;  5HXS A;  4PFP A;  5HCM A;  4A56 A;  5KMG P;  1XWM A;  4TUY E;  5JDL A;  3E22 E;  4HFB A;  4NIQ A;  4QXH B;  3N9Q A;  3F57 A;  4PK6 A;  3MZK B;  4PK5 A;  4NXN T;  3AA7 B;  3P8C D;  2MAW A;  1LVF A;  2XAG B;  5HYA A;  4JI8 T;  1MIV A;  5LHI B;  4QH5 A;  5HCJ A;  4OK0 A;  3UUB A;  4G2A A;  4Z90 A;  3O4X E;  3PUG A;  5HXC A;  3VR8 A;  4L0R A;  4XBF B;  1SHZ C;  3SOL A;  2B76 A;  1HX1 B;  3ZMU B;  4CN4 A;  3RPU A;  4A5X A;  3UUN A;  3O1I A;  4DND A;  1HTJ F;  4AKH A;  3CKD A;  2BG9 A;  2WQY A;  4ILB A;  4P0A A;  4E7S A;  4HWD A;  4IRE A;  3NZQ A;  3PUR A;  4KI0 F;  2LLY A;  2Z6E A;  3C98 B;  2I59 A;  4I0U A;  2LSG A;  3RKG A;  2V5D A;  2ZM2 A;  3GWH A;  1M7K A;  4X1I E;  5AQH B;  3VU7 H;  4IE6 A;  3ZCJ A;  2A3D A;  3AVS A;  4IDQ A;  4X5T A;  1LRZ A;  3J7Y q;  4YJ3 E;  2MBG A;  3AA6 B;  1VOM A;  2D0T A;  2VAS A;  3ZT6 A;  5LA6 E;  5FXZ A;  3E0Z A;  3O9X A;  2V6Y B;  4AIS A;  3ETU A;  4ZXL A;  4JEH B;  2V6X A;  1YKH B;  4WBN E;  3KVB A;  4MAL A;  2A72 A;  5HEJ A;  3ZT5 A;  2I0M A;  1T72 A;  2VKD A;  3P4P A;  3P4W A;  3AEC A;  3ZYM A;  5LNK A;  1MND A;  2XPK A;  4HWI B;  3JAD A;  2YKS A;  1I6Z A;  3V5S A;  1XDO A;  2VL8 A;  2JQQ A;  3WI3 A;  5LHG B;  3AEG A;  5LHH B;  1D0Y A;  2FBW A;  4UEL A;  4ZZC A;  2VWA A;  4H9N C;  3PTR B;  4IDZ A;  5LG3 A;  4EAH A;  2CRB A;  4IDN A;  1T8B A;  2FUP A;  3T1H T;  2X0Y A;  2UUC T;  4BAY B;  2KWI B;  5FKY A;  3AE3 A;  3K1S A;  2GK9 A;  2LM9 A;  1UCU A;  3GN5 A;  4O4I E;  2DNX A;  3HKD E;  3CQG B;  5FP3 A;  2YK0 A;  2IML A;  2X67 A;  3LDQ B;  1XNQ T;  1E7P A;  2D5U A;  4L9I A;  2W62 A;  3KV4 A;  2BZB A;  3AE1 A;  4MFR A;  3FXE B;  4XAX B;  3ZN1 B;  1VCS A;  4YSZ A;  4TWF A;  2JQH A;  1J1J A;  4LF7 T;  3ANW A;  2AXD S;  3GMI A;  4YTP A;  5EK4 A;  3IF8 B;  5L3F B;  2CXL A;  2CMR A;  4DUY T;  4YSX A;  1UGO A;  2J4G A;  4DUZ T;  3I0Q A;  4CXW A;  2M67 A;  1IBL T;  2HN2 A;  4KHP T;  2BS4 A;  3U3I A;  4JEU B;  5KDM C;  3CX8 B;  4ANJ A;  3AAA B;  1HNW T;  2IC9 A;  1ZV4 X;  2LKH A;  4BA9 A;  3NRX A;  2IC6 A;  4P1N A;  2E9X C;  2NW9 A;  2WY2 A;  3ZSS A;  2W67 A;  2K3W A;  3K3N A;  2Y6X A;  3FZH B;  5AQN B;  4NUU A;  4HFD A;  3UU3 A;  1Y01 A;  4L5G A;  4TNV A;  2H89 A;  2LOS A;  5FXX A;  1G8X A;  2JQK A;  2XQY A;  3OTO T;  1WR0 A;  4JBW F;  3QUJ A;  2J62 A;  5FYM A;  4HWF A;  5FL0 A;  2K5B B;  1UX5 A;  2G0U A;  2UXD T;  1ZP0 A;  3X1D A;  2NTY A;  3DTO A;  2WWU A;  4TX5 A;  2V5C A;  1UUR A;  5GON E;  2X9X A;  4DR2 T;  3BQK A;  3UFG A;  2C5J A;  4DBR A;  3LK4 2;  4U7Y A;  5IWA T;  3BQL A;  4B3R T;  4IST A;  3HI2 A;  2VKJ A;  2HPL A;  1YQ3 A;  3P4Q A;  1J5W A;  2LSY A;  4HWC A;  4ZEY A;  4KHZ F;  2MTQ A;  3K8P C;  5AQM B;  2H3R A;  4GYS A;  4NPP A;  3CX6 B;  4HFH A;  2UU9 T;  2SPC A;  2CPT A;  2J1D G;  2QGS A;  2VQF T;  2VVS A;  3UT5 E;  1T98 A;  4NUV A;  2E9X A;  1BR4 A;  3A7M A;  4O4H E;  3C4Z A;  3P4S A;  5IHY A;  2XAS B;  1QUU A;  4EZH A;  4KP3 C;  5FVK A;  3MXZ A;  2N9D A;  4P09 A;  2V7K A;  4ZOL E;  3HKE E;  4OHF A;  5LGT B;  3HKC E;  2A2F X;  1VCT A;  5JQG E;  5EK2 A;  3TLS A;  3AE4 A;  3ONL C;  4YY3 T;  1X79 A;  1YXR A;  3HA4 A;  4EGW A;  3PUW F;  4ISS A;  3F31 A;  3BQI A;  4FI5 A;  3P4R A;  1YD8 G;  1VRB A;  4DV1 T;  1CHU A;  3AE2 A;  5L3B B;  4X64 T;  2XQ5 A;  3LBX A;  1GQE A;  3C50 A;  4CI3 B;  5LP6 E;  4YT0 A;  5IYZ E;  3CML A;  3IBP A;  5JDG A;  2W66 A;  3ZT7 A;  4I43 B;  3ZEF B;  2EHO D;  4COF A;  5F8P A;  1W0A A;  2V7J A;  5TAO A;  3L39 A;  1NWM X;  5AQP B;  1NEK A;  2NWB A;  3ZLI A;  5J2U E;  2HN1 A;  5DQW A;  2BS2 A;  1MMN A;  3RRC A;  4IDP A;  4B3M T;  1UX4 A;  4QXC B;  5L3C B;  2DL1 A;  3KBT A;  4K0U A;  3EAB A;  5LG4 A;  3A5X A;  3P7I A;  3ONX A;  5L47 A;  5HXE A;  3KFW X;  5AQS B;  2XM1 A;  1U4Q A;  3EI0 A;  5CA0 E;  5L3G B;  1V9D A;  4OX9 T;  5EK3 A;  3ZMT B;  4HN9 A;  5LXT E;  4FJO A;  3AXJ B;  1Z0P A;  3PE0 A;  1MNE A;  2KXP B;  2WAU A;  2QRX A;  2ZM8 A;  4JI2 T;  3VKG A;  4DV0 T;  2LRL A;  3QC9 A;  1WLX A;  4DR7 T;  1E1H B;  2BVM A;  2WSS V;  3SFE A;  3AAI A;  3MAC A;  3FZF B;  3ABV A;  1D0X A;  4JI1 T;  5M4Y A;  3QB5 K;  2D0U A;  5ABH A;  4CN1 A;  1JNR A;  3HKB E;  3OYX A;  4GYR A;  4O4J E;  5L2L A;  5J0Z A;  4UVA B;  3E08 A;  2LJL A;  3UU4 A;  3OKQ A;  4X1Y E;  2XAH B;  1HS7 A;  2EHO B;  4AI6 A;  2B1E A;  2Q9Q B;  4MLK A;  3WAK A;  3N2K E;  2YDS A;  4EXT A;  3AE5 A;  4QWN B;  2JMK A;  2BKP A;  4E7Z A;  3C51 A;  2LT3 A;  2DWG A;  3TLW A;  3UUX B;  3RC8 A;  2BVL A;  4LFB T;  4U7I A;  3ZMS B;  5AQR B;  4EED A;  4YXD A;  2AE9 A;  2E9X D;  3LK3 B;  4KUM B;  4PJL A;  4Q25 A;  5JR9 B;  4ERR A;  2Y8D A;  2LSK A;  5JRC B;  2F4V T;  5LBQ B;  3PDY A;  4I55 E;  3TLV A;  4JI6 T;  4DV7 T;  4DV5 T;  3B57 A;  5HXR A;  5J2T E;  3RKO A;  2K24 A;  4X65 T;  4V1A v;  1OXZ A;  2ACZ A;  2JRK A;  4LF6 T;  5JH7 E;  3SRZ A;  1YW0 A;  2M6B A;  4IE4 A;  4K0K T;  2CHO A;  2XHE B;  3ZKR A;  4UF0 A;  5JDF A;  3RIF A;  4YHH T;  1ZEE A;  1HCI A;  2CWO A;  4PFO A;  2WDQ A;  2L3L A;  3UQ4 A;  3H3A A;  4H9R C;  2YU1 A;  2KLQ A;  3CVR A;  4C90 A;  3RIU C;  1D1A A;  2VK9 A;  3DJB A;  1LKX A;  5BMV E;  4DR6 T;  4HEA A;  4O4L E;  3ZYK A;  2NW8 A;  1OWA A;  3KIN B;  1WRD A;  2XAF B;  3M3Z B;  2ACX A;  2XY8 B;  4GK5 E;  3UU6 A;  3ETV A;  3EVY A;  5C2T A;  4JI0 T;  2NTX A;  3FZK B;  4WBO A;  3WAJ A;  4NXM T;  5HAX A;  4IL9 A;  3W15 B;  2PJQ A;  1SUM B;  3CX7 B;  1BR0 A;  4TWD A;  2X68 A;  1KFY A;  4DR5 T;  3ZN0 B;  4MBQ A;  3N9M A;  3LSV A;  1UUS A;  1U5P A;  4DID B;  4CI1 B;  1MMG A;  5LOV E;  4OYK A;  4WZX A;  3PUY F;  1N32 T;  3EUH A;  5KX5 E;  5FMN A;  1HF8 A;  1UK5 A;  4QH1 A;  2CE7 A;  3MKD A;  3P50 A;  2UUB T;  3OVU A;  2V26 A;  4U31 A;  3AE9 A;  2KSR A;  2ZMA A;  3Q5X A;  2N1G A;  2XM2 A;  4LF4 T;  5HWX A;  4A98 A;  5ABF B;  4ZZB A;  3B5M A;  3AED A;  2UXB T;  3PJA J;  4HFV A;  3VRA A;  4I4T E;  3RIU A;  1KK7 A;  4HTE A;  2XAQ B;  2LHR A;  5AQQ B;  1XMO T;  4AKR B;  4ZI7 E;  3T1Y T;  3KV6 A;  4ADZ A;  2XQ9 A;  1JNZ A;  3RQU A;  5FNV E;  2HHH T;  3I1A A;  4DMW A;  2L9Q A;  1YKE B;  2ODU A;  2W63 A;  3AE7 A;  5LMU T;  3EDU A;  3RX6 A;  4AQG A;  5AQL B;  2X9H A;  1OED B;  4ILU A;  2W4X A;  3CWZ B;  3JAF A;  3N9L A;  5DJQ C;  5LGN B;  2CXD A;  3ZJ2 A;  3ESL A;  2LE8 A;  2ZM0 A;  2C0S A;  2E5L T;  1WYB A;  5LBM A;  1KNR A;  1US7 B;  2DHR A;  4QHO A;  2BDE A;  2KND A;  5JDH A;  3MK7 C;  1IJ6 A;  2W61 A;  2CCQ A;  2QA7 A;  2W00 A;  2V6Y A;  1BR2 A;  4DR4 T;  3AVR A;  5A1L A;  3ZST A;  3AEB A;  2JMH A;  2QYW A;  3CQX C;  4B6X A;  3EDV A;  3K3O A;  4AQY T;  3OJA A;  2XQ8 A;  1IZN B;  4LFC T;  2E2A A;  1SA0 E;  5DQV A;  3RRW A;  3B13 A;  4X1K E;  4AQF A;  4UR9 A;  2NP9 A;  1H7C A;  5EZY E;  3RI5 A;  1J5E T;  2MPK A;  4PW8 A;  4IIJ E;  5HEG A;  3IA3 A;  3OYZ A;  5HEU A;  2XJ7 A;  5CFB A;  2M6I A;  3RC3 A;  5AFU L;  2PTF A;  4ZS3 A;  4LML A;  4UVB B;  2D2S A;  3LK2 B;  2IAK A;  2KMF A;  2V7I A;  2LRK A;  3RYI E;  3H3M A;  4U2Z A;  4UV8 B;  2OV9 A;  5JDN A;  2X51 A;  4KX6 A;  4PJM A;  3HR0 A;  3AB3 B;  2VL0 A;  3FZL B;  3HL6 A;  2BG9 B;  2Y48 B;  3ZMZ B;  1FJG T;  2FJB A;  3Q5D A;  3KV9 A;  3N2O A;  1QSD A;  3RHW A;  5LJM A;  2WZI A;  2ES0 A;  2NW7 A;  4TN7 B;  3UQ7 A;  2VUR A;  1O3X A;  2ZM6 T;  2HH7 A;  2PFV A;  2CA5 A;  2WB5 A;  3NVO A;  5J1G A;  1KNP A;  3RGL A;  4PNI A;  4OFZ A;  4ZI2 C;  2NR4 A;  2E8I A;  3NZP A;  2XUE A;  1W0B A;  3GA8 A;  2WBL A;  3F2E A;  2IUB A;  4PK4 A;  2YN6 A;  2DWK A;  5L4E A;  3ZPO A;  1FEW A;  5DAB A;  4LMK A;  4AKL A;  2CM0 A;  1N33 T;  3JC6 C;  4GIW A;  4JLE A;  4LFA T;  2VKO A;  3O1J A;  4PAG A;  2QVA A;  4UV9 B;  3SS1 A;  5F3J A;  5LGU B;  5CB4 E;  2DCF A;  3I0O A;  3OPC A;  5LMN T;  3ZC1 A;  1ZOY A;  4EIW A;  3LJC A;  1XDP A;  2K48 A;  1M62 A;  1E2A A;  4DO0 A;  4PJN A;  2VB6 A;  1D0Z A;  2C5I T;  5H6Q B;  1CUN A;  2XSB A;  4I50 E;  1FMW A;  3I9Y A;  2C5K T;  4HKA A;  5FY1 A;  4IGU A;  3FBZ A;  2DLR A;  2N2N A;  4JUY A;  1XMQ T;  4CN6 A;  3GN5 B;  2CLY C;  3Q9D A;  3PJA A;  4JI4 T;  1IBM T;  2XQ3 A;  4QX8 B;  1OED E;  5ABE A;  1XZY A;  5HEO A;  4O2A E;  5AQG B;  2J47 A;  2MOZ A;  4P0B A;  2WU2 A;  2VQE T;  3ANW B;  3SFD A;  2H7O A;  5CA1 E;  3MA9 A;  3NBX X;  2IHR 1;  3N9N A;  5AQF B;  3KDS E;  4H9Q C;  4O2B E;  3V5U A;  4YLH A;  4TV8 E;  3RYF E;  5JDM A; 
#chains in the Genus database with same CATH homology
 2K3W A;  2XZE A;  2CPT A;  4U3C A;  4CN4 A;  2RPA A;  2LRL A;  2JQ9 A;  4U31 A;  3ZT6 A;  4CN1 A;  2DL1 A;  2CRB A;  4A5X A;  5LB7 B;  2JQH A;  4ZEY A;  5CJ5 A;  2V6Y B;  2LRK A;  3EAB A;  4U33 A;  4U2Y A;  1WFD A;  2MPK A;  4WZX A;  2WWV A;  4IT4 A;  5CGM A;  4NIQ A;  4U2Z A;  2V6X A;  4U7Y A;  5FVL A;  2V6Y A;  2JQK A;  2W2U A;  4U7I A;  4CN6 A;  1WCR A;  5FVK A;  4P1N A;  1WR0 A;  2A9U A;  1YXR A;  3ZT5 A;  2WY2 A;  3K1S A;  3ZT7 A;  3ZST A;  3ZSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...