4P1NA

Crystal structure of atg1-atg13 complex
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
262
structure length
190
Chain Sequence
b'SDSNITPFVESLSAKAFVMYSFAEMKFSQILNLIPAPELKKLCMESLLLYLKSLTILASSMKLTSKWWYENESKNCTLKLNILVQWIRDRFNECLDKAEFLRLKLHTLNQSEDPQVLDDPTIFVEKLIYDRALDISRNAARLEMEGNYNTCELAYATSLWMLEILLDEHLSDESDKEMIRKYVSSIANRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Atg1 tMIT
publication title Structural basis of starvation-induced assembly of the autophagy initiation complex.
pubmed doi rcsb
source organism Kluyveromyces marxianus
molecule tags Protein transport
total genus 77
structure length 190
sequence length 262
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12063 DUF3543 Domain of unknown function (DUF3543)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 4p1nA00
2JQKA 2WY2A 5LB7B 2V6YB 3ZT6A 4U3CA 2W2UA 2V6YA 4CN1A 2K3WA 2JQ9A 4U2ZA 4A5XA 1WCRA 2LRLA 2XZEA 3EABA 3K1SA 5CGMA 5FVLA 1WR0A 4CN6A 5CJ5A 1YXRA 1WFDA 2LRKA 2RPAA 4U33A 4NIQA 3ZSSA 4U7IA 2CRBA 2JQHA 3ZSTA 4U7YA 2V6XA 2DL1A 2MPKA 4U2YA 3ZT7A 4IT4A 2WWVA 4U31A 4WZXA 3ZT5A 4ZEYA 2CPTA 4CN4A 4P1NA 2A9UA 5FVKA
chains in the Genus database with same CATH superfamily
5FXVA 4ZS2A 4KHZF 2ACXA 3AEEA 1D1CA 3ANWA 3LK2B 5EZYE 2NTYA 3KFWX 5JDLA 3AAAB 2HPLA 4P0BA 4TNWA 2K3WA 5BR8T 2K24A 5AQJB 5ADXL 2PFVA 2XZEA 5FNVE 4WYVA 5JQGE 5F3JA 3CX8B 4E7ZA 1IBKT 2VKOA 4L0RA 3RC3A 3ZSSA 3CPZA 3BQKA 4OYJA 5JR9B 3OTOT 2BZBA 4GKJT 5LGUB 3ONJA 3T1YT 1J1JA 3I1AA 4COFA 3TLVA 1D0ZA 3LJCA 3RIFA 3RPUA 1UX5A 3I0QA 3J7Yq 4LF4T 2IC6A 1OEDC 5HXHA 4DV3T 2BVLA 5EK2A 2UUAT 1WYBA 2DHRA 2LSJA 5M4YA 2H3RA 5A1LA 3FBZA 1MMAA 2YOEA 3O1JA 4UVAB 3SWHA 2H7VC 3ETUA 3ZC1A 3EHZA 2KMFA 2WDVA 4NUVA 2XAQB 5LJMA 3O4XE 3FZFB 3FXEB 4AKGA 2D0TA 5AQVB 4YJ2E 3PUGA 4QHOA 1D1AA 2WCAA 5AQMB 3ETVA 1KEYA 4JBWF 3S4UA 3W15B 5AQPB 3PUAA 4DNDA 5LGTB 4U31A 1Z8UA 1UUSA 2C0SA 4H9PC 3KBUA 3IEEA 3RRCA 3MA9A 2KZ7B 2UXBT 2H89A 5J2TE 3OJAA 3PUVF 5CFBA 1LKXA 1T72A 5CA1E 5HXCA 5CJ5A 3UQ4A 3ZKRA 2ZM2A 2EHOC 2BG9E 2E5VA 2V5DA 2LLYA 4QXBB 1IZNB 4F8HA 3UUBA 2NW8A 1U4QA 5FVLA 3RIUC 4U72A 4DV4T 2WU2A 4CZZB 1YQ3A 3F31A 4GOUA 1AJ3A 5AQKB 5FVKA 1HNXT 2LSIA 4L5GA 2VKHA 1W0AA 3AE3A 4X62T 3UUNA 1S35A 2GK9A 4F6RC 4KI0F 3NRYA 2VQET 4MHCA 5BMVE 1E1HB 2W00A 2KLQA 4UXNB 5IHYA 4EB6E 5FL0A 3MACA 3K8PC 3QC9A 4H9OC 4HE8A 4LFAT 1BR4A 3ZMZB 2D9DA 3NKZA 2XPKA 3B57A 2XQAA 1G73A 4OFZA 3ZYMA 5LG3A 2V1DB 3LK3B 4X65T 2UXCT 3R84B 2CA5A 2M67A 4AQGA 4JI7T 1W09A 3E22E 3KV4A 1WCRA 4HFDA 3JAEA 2CLYB 4IE5A 3C4XA 1YW0A 3M65A 3AA6B 3WI3A 1XDOA 1MNDA 3JAFA 5JREA 3PUSA 5HCMA 5GONE 3AA7B 1HTJF 4QH1A 5AQFB 4GYSA 5LBQB 4ILBA 1N36T 1YQ4A 4B3MT 2J4GA 3Q5DA 3BQLA 1I94T 1DU2A 2EHOD 3NZQA 3C4ZA 3VKHA 2LJLA 5JDHA 2IAKA 4U2YA 4LMKA 1ZOYA 2CXFA 2CPTA 2NTXA 3UULA 2YU2A 5L2LA 3P4RA 4TUYE 5DABA 4QX7B 2IHR1 2XAGB 2K5BB 2IMLA 3PV0F 2ES0A 1U5PA 1US7B 4UR9A 4BA9A 4EEBA 3GN5B 3N9OA 1OXZA 4QX8B 3CVRA 3ZPOA 1HNWT 2IW5B 4AQFC 4EZ4A 2LRLA 2YKSA 1MMDA 2KWIB 3LSVA 3RF1A 1VCSA 1HX1B 4ANJA 3AE4A 4IT4A 4G63A 3QUJA 4UV8B 3QB5A 2LSGA 5H6QB 2WMOA 4LF6T 5HXSA 4JI6T 2BDEA 4HFHA 2W63A 2JQHA 4PNIA 5AQRB 1E2AA 2DWKA 4IL4A 2B76A 3K3NA 2WZIA 3RQWA 4MALA 3G06A 4CN6A 1FEWA 1MIVA 4U7IA 2WS3A 4DUZT 4CXXA 5HEGA 3AXJA 2SPCA 4E7SA 4ZOLE 2YDQA 1W9RA 1ZEEA 4WZXA 2WQYA 3JC6D 4X1IE 4H63H 1IAPA 4DR1T 3PE0A 3RH3A 2V8SV 5AQIB 4DBRA 2X9WA 1W0BA 3AE1A 1IBMT 4JI4T 3FZLB 1BR0A 4ISSA 4CXWA 4QKNA 5IWAT 2C5KT 4UELA 5AQNB 4LF5T 3OKQA 4JI5T 4UF0A 4HGAA 1M62A 3TLWA 4TWHA 2C5JA 4HFCA 4I43B 2CLYC 2LHRA 3RKOA 2WZHA 2VKDA 2V7MA 4ILUA 3SFDA 3GA8A 3Q5EA 3ZMUB 3C64A 1KNZA 3F57A 1YXRA 2CBIA 1G8XA 5LGNB 3CQGB 5LBMA 4CI2B 3C51A 5HEUA 2NR4A 1VOMA 2CMRA 5F5WA 4CI1B 2BKNA 2E9XB 2WY2A 5CB4E 3CQCB 3PJAJ 3FZMB 3FXDB 3UU5A 2CE7A 3FB2A 2CBJA 4HKAA 1R8IA 4H9NC 2HN1A 3VRAA 3OVUA 3KINB 2Z6EA 5ETWA 3VRBA 4GKKT 3BQIA 2A2FX 3UUXB 2WBLA 2W2UA 1E7PA 1N34T 3RHWA 3Q5XA 2WAUA 2V7JA 2XTLA 3PUZF 2FJDA 2CCQA 2E8IA 2KT9A 3AAIA 3PTRB 2AXDS 4NXNT 4CXYA 5FKYA 4AQYT 4LFCT 5KXJA 2PG8A 2X9XA 2RA1A 4JLEA 2JQQA 2IUBA 2XAFB 4A98A 5C3JA 4PJLA 3P50A 5IYZE 2X9YA 3ZT7A 5HYAA 4AISA 4HWDA 1NENA 3MKDA 4M1PA 2V6YB 3T8OA 3ZN0B 5AQQB 3ZCJA 5HXEA 2DNXA 1L0VA 3K3QC 2IDOB 3AE9A 3UT5E 2BKPA 5AFUL 2MOZA 4OK0A 3PUWF 2WDRA 2BG9B 1T7SA 3OPCA 5JRCB 4O4LE 4B6XA 4PJJA 2LM9A 1KNRA 3AB3B 3EAMA 1WFDA 3EUHA 3SRZA 2UUCT 4EIWA 2CHOA 5FP3A 5JDFA 4UVCB 2X68A 2NP9A 3C4WA 2YK0A 5KDMC 5HWYA 2QVAA 2QRXA 2JPFA 2FJAA 2OLTA 3H3AA 3EI0A 4NPPA 5EK4A 3CK6A 3D0TA 2N9DA 5KMGP 5IUXA 5FL1A 3N9MA 4HFBA 3HKCE 1UCUA 2W67A 2KWHA 5AQSB 2XQ5A 3FZHB 2A3DA 5L3EB 1ZKEA 4O8SA 4AKLA 3A5XA 2WP9A 5ABFB 2MTQA 4ZI2C 1ZHCA 2YDRA 4IDZA 1FMWA 3C98B 2C5IT 4OHFA 2E9XC 4N78D 3I9WA 5E0OA 3KV9A 4QXHB 3PU3A 1WYCA 2V7KA 4K0UA 3NBXX 4U74A 5C2TA 2XJ7A 5LMUT 1UURA 2IIUA 2W66A 1QSDA 3KV6A 2G0UA 4Z8XA 1JNZA 3V5SA 1WRDA 3RRWA 4C90A 5LCYA 4JEHB 2CXLA 1J5ET 4ISTA 4P1NA 3TLUA 4YTPA 5AQTB 4O2AE 1SHZC 4ZZBA 2XQ3A 2LHNA 4Q25A 3UFGA 4XBFB 2F4VT 3E0ZA 2LOPA 2Q9QB 5LNKA 5LB7B 1UK5A 3N9LA 4EAHA 3AA1B 3HKEE 4X5TA 5KX5E 3VHLA 2VQFT 2H7OA 2ZLYA 4X20E 4EXTA 1MMGA 3ESLA 2W62A 4K0KT 3JC6C 2LKGA 2UXDT 3ZT6A 5JR9C 2BG9C 4C91A 1QUUA 2JMHA 5CA0E 4DMVA 2UXNB 5JDMA 3N9PA 3MZKB 3ZMSB 5FY1A 3EDVA 4MLKA 4L9IA 5L4HA 4DR4T 2WMNA 2E2AA 2V7LA 3J9X1 2QA7A 3ZC0A 1Y01A 5LOVE 1MIWA 3CKDA 1HR0T 2ZM8A 2V6XA 4ZI2D 3LBXA 4EYUA 2RP4A 3NRXA 2J1DG 2KSRA 5HXRA 5AQOB 2E9XD 4U2ZA 2HN2A 4QH4A 3ZJ1A 2FJBA 4P09A 1EZ3A 2I59A 5JDGA 3SS1A 5LHGB 4WW0A 2YU1A 4HN9A 3B5MA 3WAKA 4IDPA 2V7IA 1ZP0A 1UX4A 2QGSA 4LF8T 4TX5A 2XAJB 2ZMAA 3LFMA 2P9BA 3IF8B 4P0AA 4DV2T 3AA0B 2JQ9A 3TKLB 4EV6A 1OEDA 3DTOA 4HTEA 1HG2A 5LP6E 3DJBA 3JCFA 2LE8A 2XSBA 1D0YA 2D0UA 3L3PA 1OWAA 2K48A 1ZV4X 4IE0A 5TAOA 2ZM0A 2JMKA 3K3OA 4QH5A 2LRKA 5HCJA 3AAEB 5AQHB 1LVFA 3CX6B 5L3DB 3E08A 4OX9T 3IHRA 3X1DA 3PURA 4UIGA 3R6NA 2DI4A 3ZMVB 2LSYA 1QLBA 2A9UA 2M6BA 5L3BB 4B3TT 3RYIE 4YT0A 2X9HA 4BJNA 3PUQA 2HPJA 3O9XA 3PUXF 3KDSE 2M6IA 3L09A 3AEFA 3GWHA 3OBVE 5LJNA 4B3RT 4KX6A 3N9NA 3UU4A 2VASA 1UGOA 2Q9QC 2XQ7A 2VKJA 3ZMTB 4LF7T 4WNKA 5AQUB 2EHOA 2X0HA 2JJ9A 4O4IE 3VR8A 2V26A 3AXJB 5DQVA 4H9SE 4IDNA 4EGWA 3UTKA 4JV5T 1VRBA 4CN1A 1KF6A 3RIUA 4IE4A 2XHEB 4DIDB 3I9YA 4ASKA 2CXDA 3P4QA 3AE5A 2LM2A 3AEBA 4DVDA 4UEMA 4U7YA 5JH7E 3RKGA 4PW8A 3ONXA 3P4WA 5AQGB 2PBIA 1BR1A 5JVDE 4DR3T 4LFBT 2ACZA 4DV0T 1IJ6A 1KFYA 2FUPA 1LVKA 3K1SA 4UF0B 5FMNA 2RPAA 3SOLA 3KVAA 4AKRB 3N2GE 4PFPA 3HA4A 5HWXA 2BS4A 1YD8G 1O3XA 2X67A 3HKBE 3BK9A 1OEDE 3HR0A 3RLFF 3FBLA 3VKGA 2LSKA 3GMIA 1GQEA 1Y64B 4U33A 1KK7A 3F2EA 3O1HA 4BAYB 2L3LA 1XMQT 3AE8A 2XQ8A 3PUYF 4TV9E 2I6HA 1NAFA 5FXXA 4DV6T 5LG4A 2Y6XA 5F8PA 1X9BA 2HH7A 4NIQA 4ZI3C 4G2AA 2MPKA 5JR9A 4DV5T 3CIRA 2YINA 5JRCA 4LMJA 4O2BE 4YXDA 2VURA 3RQUA 1FMVA 4X66T 4B3ST 4LF9T 1WR0A 4UV9B 2E5LT 5DJQC 3UU8A 5J0ZA 4MFRA 3MJXA 4FI5A 1B7TA 2CHNA 3UU3A 4UVBB 4HFEA 4GK5E 1D0XA 3Q9DA 1FIOA 4EOZB 3LG7A 4O4HE 4A56A 4IDOA 2Q9QD 3A8YC 2XM1A 3RYHE 4HEAA 3ANWB 1J5WA 4DMWA 1SUMB 2X0LB 2Y8DA 3P7IA 4JYAT 3VU7H 3AVRA 4TNVA 1H7CA 2XQ9A 2WSSV 4I50E 2BBHA 3QOFA 1KNPA 4TWDA 2NW9A 2H88A 2VL0A 4KUMB 2VWAA 5ABHA 5LMNT 4NXMT 2WDQA 2MAWA 3MXZA 3ZLIA 3C50A 5FY7A 4AQFA 2DLRA 3CX7B 2Y48B 4YSYA 3N9QA 3UQ7A 4A97A 3IBPA 5ABFA 3RX6A 4JI0T 1XNRT 2X66A 1N32T 2AE9A 4O4JE 4HFVA 4AIUA 4PK4A 3PJAA 4HWHA 3ZYKA 3QB5K 4DBQA 4BJMA 1HFAA 3NWIA 4QXCB 1IJ5A 5HAXA 4KMCA 3P8CD 3N2KE 4Z91A 2HHHT 2UU9T 4JI8T 5J1GA 5FY0A 4GK0E 5AQLB 3KVBA 4ZI3D 5FXWA 3WAJA 1XWMA 4YTMA 4I55E 2WWUA 4JI2T 2UUBT 1HNZT 1HG5A 4YHJA 1M7KA 3AVSA 3P4PA 2NOXA 2PTFA 1XDPA 2VVSA 1WR6A 2OV9A 3AE2A 2MYSA 4IL9A 2I0MA 4AKHA 3LK42 4DV1T 3EVYA 3I0OA 2XY8B 3Q5WA 3ZN1B 2Q9QA 1MNEA 4CN4A 3QNUA 2W61A 2ODVA 1V9DA 2DCFA 3ZCIA 4IE7A 1SE7A 1HF8A 2QYWA 2VVNA 3P4SA 2BS2A 4JUYA 4AXPA 2K9AA 2YN6A 3MK7C 4H9QC 3AE6A 2XSAA 3UUMA 3CQXC 2YDSA 5L3CB 3DP7A 2X0YA 2NWBA 4YTNA 5H6RB 4PAGA 3ZYLA 2LOSA 4KBMB 3TLTA 3FZKB 5J2UE 4GIWA 3ZSTA 3HL6A 2KXPB 2VB6A 2JIWA 4HWCA 5FXZA 3U78A 3ZT5A 2JQKA 3NVOA 4FJOA 5ABEA 4QWNB 2IC9A 2FJEA 2XQ6A 5LHHB 2DWGA 1BR2A 3VR9A 3ZJ2A 3B13A 4KP3C 4IGUA 4J2CA 4DR6T 4YY3T 1I6ZA 5HEOA 4IREA 4TWFA 5JTGA 3FHNA 1FJGT 3GN5A 3KV5A 2JRKA 4PFOA 2XQYA 1XMOT 4OYKA 3UFEA 4A5XA 3QK6A 3EABA 2XAHB 4EYYR 2BBJA 2XQ4A 1WLXA 1Z0PA 5LXTE 5JDNA 4NUUA 3T1HT 3NZPA 2KNDA 5DQWA 2PJQA 4ZZCA 4DR7T 2N2NA 2LT3A 4U3CA 1XZYA 2OA5A 4H9RC 4JEUB 2WM9A 2LKHA 2ZM6T 4X1KE 4CI3B 3L39A 4DR2T 3U3IA 3LBXB 1CHUA 5L3FB 2B1EA 4XZCA 3ONLC 4KHPT 2YEVC 4ILAA 4YFSA 3RYFE 2V5CA 5LA6E 4X64T 3OYXA 5CGMA 2CWYA 4EEDA 4GYRA 1MMNA 1CUNA 2XUEA 1HCIA 4I4TE 4TV8E 3Q2MA 2D2SA 3SFEA 4DO0A 3H37A 1D1BA 2ODUA 3KBTA 4CQIA 2D5UA 4H63V 1YKEB 1HX8A 4YSXA 1IBLT 4ERRA 2MBGA 2L9QA 4IHJE 5C8YE 4X1YE 4V1Av 1SA0E 4XAXB 2DL1A 2W4XA 3RGLA 4Z90A 3O1IA 5ABGA 2A72A 5JDQA 3HI2A 1S94A 2CWOA 5LHIB 3EDUA 1OEDB 3V5UA 3A7MA 3N2OA 3CMLA 1VCTA 4PJMA 2J62A 2R6GF 4ZHQE 3M3ZB 4WBOA 3JADA 4YHHT 3RIAA 2VL8A 4ZS3A 2XASB 3AEGA 3AE7A 4IIJE 1XNQT 2CEAA 4I0UA 1N33T 4HWIB 5L3GB 4LMLA 3PU8A 1T8BA 2CRBA 3OYZA 1NEKA 2KINB 3AECA 4PK6A 4MBQA 3L8RA 4ZI7E 4WBNE 2E9XA 2XM2A 2J47A 4IDQA 2BS3A 5L47A 2BVMA 3AEAA 2W0GA 4YJ3E 4HWFA 4YSZA 1NWMX 3TLSA 4DV7T 3RYCE 1HS7A 3ZEFB 4PK5A 2N1GA 4JI1T 5FYMA 5LYJE 4YLHA 4AKIA 2LEHA 1MIYA 2EHOB 2BKOA 1X79A 3HKDE 2WB5A 1T98A 1YKHB 2WWVA 2FBWA 4TZ4C 3PDYA 4ADZA 4PJNA 3AEDA 4ZXLA 5HEJA 2CM0A 2VK9A 2X51A 4JI3T 3LDQB 3CWZB 2NW7A 4TN7B 5EK3A 2WU5A 4EZHA 3N5LA 3UU6A 3RI5A 2V6YA 4AI6A 1LRZA 5L4EA 3RC8A 3IA3A 2L8KA 3ABVA 1JNRA 4HFIA 4DR5T 4DUYT 4IE6A 4ILCA 5HEHA 3H3MA 4ZEYA 2UXXB 2BG9A
chains in the Genus database with same CATH topology
2JQKA 2WY2A 5LB7B 2V6YB 3ZT6A 4U3CA 2W2UA 2V6YA 4CN1A 2K3WA 2JQ9A 4U2ZA 4A5XA 1WCRA 2LRLA 2XZEA 3EABA 3K1SA 5CGMA 5FVLA 1WR0A 4CN6A 5CJ5A 1YXRA 1WFDA 2LRKA 2RPAA 4U33A 4NIQA 3ZSSA 4U7IA 2CRBA 2JQHA 3ZSTA 4U7YA 2V6XA 2DL1A 2MPKA 4U2YA 3ZT7A 4IT4A 2WWVA 4U31A 4WZXA 3ZT5A 4ZEYA 2CPTA 4CN4A 4P1NA 2A9UA 5FVKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JQK A;  2WY2 A;  5LB7 B;  2V6Y B;  3ZT6 A;  4U3C A;  2W2U A;  2V6Y A;  4CN1 A;  2K3W A;  2JQ9 A;  4U2Z A;  4A5X A;  1WCR A;  2LRL A;  2XZE A;  3EAB A;  3K1S A;  5CGM A;  5FVL A;  1WR0 A;  4CN6 A;  5CJ5 A;  1YXR A;  1WFD A;  2LRK A;  2RPA A;  4U33 A;  4NIQ A;  3ZSS A;  4U7I A;  2CRB A;  2JQH A;  3ZST A;  4U7Y A;  2V6X A;  2DL1 A;  2MPK A;  4U2Y A;  3ZT7 A;  4IT4 A;  2WWV A;  4U31 A;  4WZX A;  3ZT5 A;  4ZEY A;  2CPT A;  4CN4 A;  4P1N A;  2A9U A;  5FVK A; 
#chains in the Genus database with same CATH topology
 5FXV A;  4ZS2 A;  4KHZ F;  2ACX A;  3AEE A;  1D1C A;  3ANW A;  3LK2 B;  5EZY E;  2NTY A;  3KFW X;  5JDL A;  3AAA B;  2HPL A;  4P0B A;  4TNW A;  2K3W A;  5BR8 T;  2K24 A;  5AQJ B;  5ADX L;  2PFV A;  2XZE A;  5FNV E;  4WYV A;  5JQG E;  5F3J A;  3CX8 B;  4E7Z A;  1IBK T;  2VKO A;  4L0R A;  3RC3 A;  3ZSS A;  3CPZ A;  3BQK A;  4OYJ A;  5JR9 B;  3OTO T;  2BZB A;  4GKJ T;  5LGU B;  3ONJ A;  3T1Y T;  1J1J A;  3I1A A;  4COF A;  3TLV A;  1D0Z A;  3LJC A;  3RIF A;  3RPU A;  1UX5 A;  3I0Q A;  3J7Y q;  4LF4 T;  2IC6 A;  1OED C;  5HXH A;  4DV3 T;  2BVL A;  5EK2 A;  2UUA T;  1WYB A;  2DHR A;  2LSJ A;  5M4Y A;  2H3R A;  5A1L A;  3FBZ A;  1MMA A;  2YOE A;  3O1J A;  4UVA B;  3SWH A;  2H7V C;  3ETU A;  3ZC1 A;  3EHZ A;  2KMF A;  2WDV A;  4NUV A;  2XAQ B;  5LJM A;  3O4X E;  3FZF B;  3FXE B;  4AKG A;  2D0T A;  5AQV B;  4YJ2 E;  3PUG A;  4QHO A;  1D1A A;  2WCA A;  5AQM B;  3ETV A;  1KEY A;  4JBW F;  3S4U A;  3W15 B;  5AQP B;  3PUA A;  4DND A;  5LGT B;  4U31 A;  1Z8U A;  1UUS A;  2C0S A;  4H9P C;  3KBU A;  3IEE A;  3RRC A;  3MA9 A;  2KZ7 B;  2UXB T;  2H89 A;  5J2T E;  3OJA A;  3PUV F;  5CFB A;  1LKX A;  1T72 A;  5CA1 E;  5HXC A;  5CJ5 A;  3UQ4 A;  3ZKR A;  2ZM2 A;  2EHO C;  2BG9 E;  2E5V A;  2V5D A;  2LLY A;  4QXB B;  1IZN B;  4F8H A;  3UUB A;  2NW8 A;  1U4Q A;  5FVL A;  3RIU C;  4U72 A;  4DV4 T;  2WU2 A;  4CZZ B;  1YQ3 A;  3F31 A;  4GOU A;  1AJ3 A;  5AQK B;  5FVK A;  1HNX T;  2LSI A;  4L5G A;  2VKH A;  1W0A A;  3AE3 A;  4X62 T;  3UUN A;  1S35 A;  2GK9 A;  4F6R C;  4KI0 F;  3NRY A;  2VQE T;  4MHC A;  5BMV E;  1E1H B;  2W00 A;  2KLQ A;  4UXN B;  5IHY A;  4EB6 E;  5FL0 A;  3MAC A;  3K8P C;  3QC9 A;  4H9O C;  4HE8 A;  4LFA T;  1BR4 A;  3ZMZ B;  2D9D A;  3NKZ A;  2XPK A;  3B57 A;  2XQA A;  1G73 A;  4OFZ A;  3ZYM A;  5LG3 A;  2V1D B;  3LK3 B;  4X65 T;  2UXC T;  3R84 B;  2CA5 A;  2M67 A;  4AQG A;  4JI7 T;  1W09 A;  3E22 E;  3KV4 A;  1WCR A;  4HFD A;  3JAE A;  2CLY B;  4IE5 A;  3C4X A;  1YW0 A;  3M65 A;  3AA6 B;  3WI3 A;  1XDO A;  1MND A;  3JAF A;  5JRE A;  3PUS A;  5HCM A;  5GON E;  3AA7 B;  1HTJ F;  4QH1 A;  5AQF B;  4GYS A;  5LBQ B;  4ILB A;  1N36 T;  1YQ4 A;  4B3M T;  2J4G A;  3Q5D A;  3BQL A;  1I94 T;  1DU2 A;  2EHO D;  3NZQ A;  3C4Z A;  3VKH A;  2LJL A;  5JDH A;  2IAK A;  4U2Y A;  4LMK A;  1ZOY A;  2CXF A;  2CPT A;  2NTX A;  3UUL A;  2YU2 A;  5L2L A;  3P4R A;  4TUY E;  5DAB A;  4QX7 B;  2IHR 1;  2XAG B;  2K5B B;  2IML A;  3PV0 F;  2ES0 A;  1U5P A;  1US7 B;  4UR9 A;  4BA9 A;  4EEB A;  3GN5 B;  3N9O A;  1OXZ A;  4QX8 B;  3CVR A;  3ZPO A;  1HNW T;  2IW5 B;  4AQF C;  4EZ4 A;  2LRL A;  2YKS A;  1MMD A;  2KWI B;  3LSV A;  3RF1 A;  1VCS A;  1HX1 B;  4ANJ A;  3AE4 A;  4IT4 A;  4G63 A;  3QUJ A;  4UV8 B;  3QB5 A;  2LSG A;  5H6Q B;  2WMO A;  4LF6 T;  5HXS A;  4JI6 T;  2BDE A;  4HFH A;  2W63 A;  2JQH A;  4PNI A;  5AQR B;  1E2A A;  2DWK A;  4IL4 A;  2B76 A;  3K3N A;  2WZI A;  3RQW A;  4MAL A;  3G06 A;  4CN6 A;  1FEW A;  1MIV A;  4U7I A;  2WS3 A;  4DUZ T;  4CXX A;  5HEG A;  3AXJ A;  2SPC A;  4E7S A;  4ZOL E;  2YDQ A;  1W9R A;  1ZEE A;  4WZX A;  2WQY A;  3JC6 D;  4X1I E;  4H63 H;  1IAP A;  4DR1 T;  3PE0 A;  3RH3 A;  2V8S V;  5AQI B;  4DBR A;  2X9W A;  1W0B A;  3AE1 A;  1IBM T;  4JI4 T;  3FZL B;  1BR0 A;  4ISS A;  4CXW A;  4QKN A;  5IWA T;  2C5K T;  4UEL A;  5AQN B;  4LF5 T;  3OKQ A;  4JI5 T;  4UF0 A;  4HGA A;  1M62 A;  3TLW A;  4TWH A;  2C5J A;  4HFC A;  4I43 B;  2CLY C;  2LHR A;  3RKO A;  2WZH A;  2VKD A;  2V7M A;  4ILU A;  3SFD A;  3GA8 A;  3Q5E A;  3ZMU B;  3C64 A;  1KNZ A;  3F57 A;  1YXR A;  2CBI A;  1G8X A;  5LGN B;  3CQG B;  5LBM A;  4CI2 B;  3C51 A;  5HEU A;  2NR4 A;  1VOM A;  2CMR A;  5F5W A;  4CI1 B;  2BKN A;  2E9X B;  2WY2 A;  5CB4 E;  3CQC B;  3PJA J;  3FZM B;  3FXD B;  3UU5 A;  2CE7 A;  3FB2 A;  2CBJ A;  4HKA A;  1R8I A;  4H9N C;  2HN1 A;  3VRA A;  3OVU A;  3KIN B;  2Z6E A;  5ETW A;  3VRB A;  4GKK T;  3BQI A;  2A2F X;  3UUX B;  2WBL A;  2W2U A;  1E7P A;  1N34 T;  3RHW A;  3Q5X A;  2WAU A;  2V7J A;  2XTL A;  3PUZ F;  2FJD A;  2CCQ A;  2E8I A;  2KT9 A;  3AAI A;  3PTR B;  2AXD S;  4NXN T;  4CXY A;  5FKY A;  4AQY T;  4LFC T;  5KXJ A;  2PG8 A;  2X9X A;  2RA1 A;  4JLE A;  2JQQ A;  2IUB A;  2XAF B;  4A98 A;  5C3J A;  4PJL A;  3P50 A;  5IYZ E;  2X9Y A;  3ZT7 A;  5HYA A;  4AIS A;  4HWD A;  1NEN A;  3MKD A;  4M1P A;  2V6Y B;  3T8O A;  3ZN0 B;  5AQQ B;  3ZCJ A;  5HXE A;  2DNX A;  1L0V A;  3K3Q C;  2IDO B;  3AE9 A;  3UT5 E;  2BKP A;  5AFU L;  2MOZ A;  4OK0 A;  3PUW F;  2WDR A;  2BG9 B;  1T7S A;  3OPC A;  5JRC B;  4O4L E;  4B6X A;  4PJJ A;  2LM9 A;  1KNR A;  3AB3 B;  3EAM A;  1WFD A;  3EUH A;  3SRZ A;  2UUC T;  4EIW A;  2CHO A;  5FP3 A;  5JDF A;  4UVC B;  2X68 A;  2NP9 A;  3C4W A;  2YK0 A;  5KDM C;  5HWY A;  2QVA A;  2QRX A;  2JPF A;  2FJA A;  2OLT A;  3H3A A;  3EI0 A;  4NPP A;  5EK4 A;  3CK6 A;  3D0T A;  2N9D A;  5KMG P;  5IUX A;  5FL1 A;  3N9M A;  4HFB A;  3HKC E;  1UCU A;  2W67 A;  2KWH A;  5AQS B;  2XQ5 A;  3FZH B;  2A3D A;  5L3E B;  1ZKE A;  4O8S A;  4AKL A;  3A5X A;  2WP9 A;  5ABF B;  2MTQ A;  4ZI2 C;  1ZHC A;  2YDR A;  4IDZ A;  1FMW A;  3C98 B;  2C5I T;  4OHF A;  2E9X C;  4N78 D;  3I9W A;  5E0O A;  3KV9 A;  4QXH B;  3PU3 A;  1WYC A;  2V7K A;  4K0U A;  3NBX X;  4U74 A;  5C2T A;  2XJ7 A;  5LMU T;  1UUR A;  2IIU A;  2W66 A;  1QSD A;  3KV6 A;  2G0U A;  4Z8X A;  1JNZ A;  3V5S A;  1WRD A;  3RRW A;  4C90 A;  5LCY A;  4JEH B;  2CXL A;  1J5E T;  4IST A;  4P1N A;  3TLU A;  4YTP A;  5AQT B;  4O2A E;  1SHZ C;  4ZZB A;  2XQ3 A;  2LHN A;  4Q25 A;  3UFG A;  4XBF B;  2F4V T;  3E0Z A;  2LOP A;  2Q9Q B;  5LNK A;  5LB7 B;  1UK5 A;  3N9L A;  4EAH A;  3AA1 B;  3HKE E;  4X5T A;  5KX5 E;  3VHL A;  2VQF T;  2H7O A;  2ZLY A;  4X20 E;  4EXT A;  1MMG A;  3ESL A;  2W62 A;  4K0K T;  3JC6 C;  2LKG A;  2UXD T;  3ZT6 A;  5JR9 C;  2BG9 C;  4C91 A;  1QUU A;  2JMH A;  5CA0 E;  4DMV A;  2UXN B;  5JDM A;  3N9P A;  3MZK B;  3ZMS B;  5FY1 A;  3EDV A;  4MLK A;  4L9I A;  5L4H A;  4DR4 T;  2WMN A;  2E2A A;  2V7L A;  3J9X 1;  2QA7 A;  3ZC0 A;  1Y01 A;  5LOV E;  1MIW A;  3CKD A;  1HR0 T;  2ZM8 A;  2V6X A;  4ZI2 D;  3LBX A;  4EYU A;  2RP4 A;  3NRX A;  2J1D G;  2KSR A;  5HXR A;  5AQO B;  2E9X D;  4U2Z A;  2HN2 A;  4QH4 A;  3ZJ1 A;  2FJB A;  4P09 A;  1EZ3 A;  2I59 A;  5JDG A;  3SS1 A;  5LHG B;  4WW0 A;  2YU1 A;  4HN9 A;  3B5M A;  3WAK A;  4IDP A;  2V7I A;  1ZP0 A;  1UX4 A;  2QGS A;  4LF8 T;  4TX5 A;  2XAJ B;  2ZMA A;  3LFM A;  2P9B A;  3IF8 B;  4P0A A;  4DV2 T;  3AA0 B;  2JQ9 A;  3TKL B;  4EV6 A;  1OED A;  3DTO A;  4HTE A;  1HG2 A;  5LP6 E;  3DJB A;  3JCF A;  2LE8 A;  2XSB A;  1D0Y A;  2D0U A;  3L3P A;  1OWA A;  2K48 A;  1ZV4 X;  4IE0 A;  5TAO A;  2ZM0 A;  2JMK A;  3K3O A;  4QH5 A;  2LRK A;  5HCJ A;  3AAE B;  5AQH B;  1LVF A;  3CX6 B;  5L3D B;  3E08 A;  4OX9 T;  3IHR A;  3X1D A;  3PUR A;  4UIG A;  3R6N A;  2DI4 A;  3ZMV B;  2LSY A;  1QLB A;  2A9U A;  2M6B A;  5L3B B;  4B3T T;  3RYI E;  4YT0 A;  2X9H A;  4BJN A;  3PUQ A;  2HPJ A;  3O9X A;  3PUX F;  3KDS E;  2M6I A;  3L09 A;  3AEF A;  3GWH A;  3OBV E;  5LJN A;  4B3R T;  4KX6 A;  3N9N A;  3UU4 A;  2VAS A;  1UGO A;  2Q9Q C;  2XQ7 A;  2VKJ A;  3ZMT B;  4LF7 T;  4WNK A;  5AQU B;  2EHO A;  2X0H A;  2JJ9 A;  4O4I E;  3VR8 A;  2V26 A;  3AXJ B;  5DQV A;  4H9S E;  4IDN A;  4EGW A;  3UTK A;  4JV5 T;  1VRB A;  4CN1 A;  1KF6 A;  3RIU A;  4IE4 A;  2XHE B;  4DID B;  3I9Y A;  4ASK A;  2CXD A;  3P4Q A;  3AE5 A;  2LM2 A;  3AEB A;  4DVD A;  4UEM A;  4U7Y A;  5JH7 E;  3RKG A;  4PW8 A;  3ONX A;  3P4W A;  5AQG B;  2PBI A;  1BR1 A;  5JVD E;  4DR3 T;  4LFB T;  2ACZ A;  4DV0 T;  1IJ6 A;  1KFY A;  2FUP A;  1LVK A;  3K1S A;  4UF0 B;  5FMN A;  2RPA A;  3SOL A;  3KVA A;  4AKR B;  3N2G E;  4PFP A;  3HA4 A;  5HWX A;  2BS4 A;  1YD8 G;  1O3X A;  2X67 A;  3HKB E;  3BK9 A;  1OED E;  3HR0 A;  3RLF F;  3FBL A;  3VKG A;  2LSK A;  3GMI A;  1GQE A;  1Y64 B;  4U33 A;  1KK7 A;  3F2E A;  3O1H A;  4BAY B;  2L3L A;  1XMQ T;  3AE8 A;  2XQ8 A;  3PUY F;  4TV9 E;  2I6H A;  1NAF A;  5FXX A;  4DV6 T;  5LG4 A;  2Y6X A;  5F8P A;  1X9B A;  2HH7 A;  4NIQ A;  4ZI3 C;  4G2A A;  2MPK A;  5JR9 A;  4DV5 T;  3CIR A;  2YIN A;  5JRC A;  4LMJ A;  4O2B E;  4YXD A;  2VUR A;  3RQU A;  1FMV A;  4X66 T;  4B3S T;  4LF9 T;  1WR0 A;  4UV9 B;  2E5L T;  5DJQ C;  3UU8 A;  5J0Z A;  4MFR A;  3MJX A;  4FI5 A;  1B7T A;  2CHN A;  3UU3 A;  4UVB B;  4HFE A;  4GK5 E;  1D0X A;  3Q9D A;  1FIO A;  4EOZ B;  3LG7 A;  4O4H E;  4A56 A;  4IDO A;  2Q9Q D;  3A8Y C;  2XM1 A;  3RYH E;  4HEA A;  3ANW B;  1J5W A;  4DMW A;  1SUM B;  2X0L B;  2Y8D A;  3P7I A;  4JYA T;  3VU7 H;  3AVR A;  4TNV A;  1H7C A;  2XQ9 A;  2WSS V;  4I50 E;  2BBH A;  3QOF A;  1KNP A;  4TWD A;  2NW9 A;  2H88 A;  2VL0 A;  4KUM B;  2VWA A;  5ABH A;  5LMN T;  4NXM T;  2WDQ A;  2MAW A;  3MXZ A;  3ZLI A;  3C50 A;  5FY7 A;  4AQF A;  2DLR A;  3CX7 B;  2Y48 B;  4YSY A;  3N9Q A;  3UQ7 A;  4A97 A;  3IBP A;  5ABF A;  3RX6 A;  4JI0 T;  1XNR T;  2X66 A;  1N32 T;  2AE9 A;  4O4J E;  4HFV A;  4AIU A;  4PK4 A;  3PJA A;  4HWH A;  3ZYK A;  3QB5 K;  4DBQ A;  4BJM A;  1HFA A;  3NWI A;  4QXC B;  1IJ5 A;  5HAX A;  4KMC A;  3P8C D;  3N2K E;  4Z91 A;  2HHH T;  2UU9 T;  4JI8 T;  5J1G A;  5FY0 A;  4GK0 E;  5AQL B;  3KVB A;  4ZI3 D;  5FXW A;  3WAJ A;  1XWM A;  4YTM A;  4I55 E;  2WWU A;  4JI2 T;  2UUB T;  1HNZ T;  1HG5 A;  4YHJ A;  1M7K A;  3AVS A;  3P4P A;  2NOX A;  2PTF A;  1XDP A;  2VVS A;  1WR6 A;  2OV9 A;  3AE2 A;  2MYS A;  4IL9 A;  2I0M A;  4AKH A;  3LK4 2;  4DV1 T;  3EVY A;  3I0O A;  2XY8 B;  3Q5W A;  3ZN1 B;  2Q9Q A;  1MNE A;  4CN4 A;  3QNU A;  2W61 A;  2ODV A;  1V9D A;  2DCF A;  3ZCI A;  4IE7 A;  1SE7 A;  1HF8 A;  2QYW A;  2VVN A;  3P4S A;  2BS2 A;  4JUY A;  4AXP A;  2K9A A;  2YN6 A;  3MK7 C;  4H9Q C;  3AE6 A;  2XSA A;  3UUM A;  3CQX C;  2YDS A;  5L3C B;  3DP7 A;  2X0Y A;  2NWB A;  4YTN A;  5H6R B;  4PAG A;  3ZYL A;  2LOS A;  4KBM B;  3TLT A;  3FZK B;  5J2U E;  4GIW A;  3ZST A;  3HL6 A;  2KXP B;  2VB6 A;  2JIW A;  4HWC A;  5FXZ A;  3U78 A;  3ZT5 A;  2JQK A;  3NVO A;  4FJO A;  5ABE A;  4QWN B;  2IC9 A;  2FJE A;  2XQ6 A;  5LHH B;  2DWG A;  1BR2 A;  3VR9 A;  3ZJ2 A;  3B13 A;  4KP3 C;  4IGU A;  4J2C A;  4DR6 T;  4YY3 T;  1I6Z A;  5HEO A;  4IRE A;  4TWF A;  5JTG A;  3FHN A;  1FJG T;  3GN5 A;  3KV5 A;  2JRK A;  4PFO A;  2XQY A;  1XMO T;  4OYK A;  3UFE A;  4A5X A;  3QK6 A;  3EAB A;  2XAH B;  4EYY R;  2BBJ A;  2XQ4 A;  1WLX A;  1Z0P A;  5LXT E;  5JDN A;  4NUU A;  3T1H T;  3NZP A;  2KND A;  5DQW A;  2PJQ A;  4ZZC A;  4DR7 T;  2N2N A;  2LT3 A;  4U3C A;  1XZY A;  2OA5 A;  4H9R C;  4JEU B;  2WM9 A;  2LKH A;  2ZM6 T;  4X1K E;  4CI3 B;  3L39 A;  4DR2 T;  3U3I A;  3LBX B;  1CHU A;  5L3F B;  2B1E A;  4XZC A;  3ONL C;  4KHP T;  2YEV C;  4ILA A;  4YFS A;  3RYF E;  2V5C A;  5LA6 E;  4X64 T;  3OYX A;  5CGM A;  2CWY A;  4EED A;  4GYR A;  1MMN A;  1CUN A;  2XUE A;  1HCI A;  4I4T E;  4TV8 E;  3Q2M A;  2D2S A;  3SFE A;  4DO0 A;  3H37 A;  1D1B A;  2ODU A;  3KBT A;  4CQI A;  2D5U A;  4H63 V;  1YKE B;  1HX8 A;  4YSX A;  1IBL T;  4ERR A;  2MBG A;  2L9Q A;  4IHJ E;  5C8Y E;  4X1Y E;  4V1A v;  1SA0 E;  4XAX B;  2DL1 A;  2W4X A;  3RGL A;  4Z90 A;  3O1I A;  5ABG A;  2A72 A;  5JDQ A;  3HI2 A;  1S94 A;  2CWO A;  5LHI B;  3EDU A;  1OED B;  3V5U A;  3A7M A;  3N2O A;  3CML A;  1VCT A;  4PJM A;  2J62 A;  2R6G F;  4ZHQ E;  3M3Z B;  4WBO A;  3JAD A;  4YHH T;  3RIA A;  2VL8 A;  4ZS3 A;  2XAS B;  3AEG A;  3AE7 A;  4IIJ E;  1XNQ T;  2CEA A;  4I0U A;  1N33 T;  4HWI B;  5L3G B;  4LML A;  3PU8 A;  1T8B A;  2CRB A;  3OYZ A;  1NEK A;  2KIN B;  3AEC A;  4PK6 A;  4MBQ A;  3L8R A;  4ZI7 E;  4WBN E;  2E9X A;  2XM2 A;  2J47 A;  4IDQ A;  2BS3 A;  5L47 A;  2BVM A;  3AEA A;  2W0G A;  4YJ3 E;  4HWF A;  4YSZ A;  1NWM X;  3TLS A;  4DV7 T;  3RYC E;  1HS7 A;  3ZEF B;  4PK5 A;  2N1G A;  4JI1 T;  5FYM A;  5LYJ E;  4YLH A;  4AKI A;  2LEH A;  1MIY A;  2EHO B;  2BKO A;  1X79 A;  3HKD E;  2WB5 A;  1T98 A;  1YKH B;  2WWV A;  2FBW A;  4TZ4 C;  3PDY A;  4ADZ A;  4PJN A;  3AED A;  4ZXL A;  5HEJ A;  2CM0 A;  2VK9 A;  2X51 A;  4JI3 T;  3LDQ B;  3CWZ B;  2NW7 A;  4TN7 B;  5EK3 A;  2WU5 A;  4EZH A;  3N5L A;  3UU6 A;  3RI5 A;  2V6Y A;  4AI6 A;  1LRZ A;  5L4E A;  3RC8 A;  3IA3 A;  2L8K A;  3ABV A;  1JNR A;  4HFI A;  4DR5 T;  4DUY T;  4IE6 A;  4ILC A;  5HEH A;  3H3M A;  4ZEY A;  2UXX B;  2BG9 A; 
#chains in the Genus database with same CATH homology
 2JQK A;  2WY2 A;  5LB7 B;  2V6Y B;  3ZT6 A;  4U3C A;  2W2U A;  2V6Y A;  4CN1 A;  2K3W A;  2JQ9 A;  4U2Z A;  4A5X A;  1WCR A;  2LRL A;  2XZE A;  3EAB A;  3K1S A;  5CGM A;  5FVL A;  1WR0 A;  4CN6 A;  5CJ5 A;  1YXR A;  1WFD A;  2LRK A;  2RPA A;  4U33 A;  4NIQ A;  3ZSS A;  4U7I A;  2CRB A;  2JQH A;  3ZST A;  4U7Y A;  2V6X A;  2DL1 A;  2MPK A;  4U2Y A;  3ZT7 A;  4IT4 A;  2WWV A;  4U31 A;  4WZX A;  3ZT5 A;  4ZEY A;  2CPT A;  4CN4 A;  4P1N A;  2A9U A;  5FVK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...