4P1NA

Crystal structure of atg1-atg13 complex
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
262
structure length
190
Chain Sequence
SDSNITPFVESLSAKAFVMYSFAEMKFSQILNLIPAPELKKLCMESLLLYLKSLTILASSMKLTSKWWYENESKNCTLKLNILVQWIRDRFNECLDKAEFLRLKLHTLNQSEDPQVLDDPTIFVEKLIYDRALDISRNAARLEMEGNYNTCELAYATSLWMLEILLDEHLSDESDKEMIRKYVSSIANRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords Atg1 tMIT
publication title Structural basis of starvation-induced assembly of the autophagy initiation complex.
pubmed doi rcsb
source organism Kluyveromyces marxianus
total genus 77
structure length 190
sequence length 262
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12063 DUF3543 Domain of unknown function (DUF3543)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 4p1nA00
1WR0A 2XZEA 2V6XA 1WFDA 5CGMA 3ZT6A 2WWVA 3ZT5A 4U33A 2LRKA 3EABA 2A9UA 2JQHA 4IT4A 1YXRA 2DL1A 2JQ9A 4NIQA 4WZXA 2K3WA 4CN6A 3K1SA 4CN1A 2V6YA 2RPAA 5FVLA 4U3CA 5LB7B 3ZSTA 2LRLA 4P1NA 4CN4A 2W2UA 4A5XA 2MPKA 4ZEYA 4U2YA 2V6YB 2CPTA 3ZSSA 4U7IA 4U2ZA 3ZT7A 4U31A 2JQKA 5CJ5A 2CRBA 5FVKA 4U7YA 1WCRA 2WY2A
chains in the Genus database with same CATH superfamily
3RGLA 4HFDA 2XM2A 4QHOA 1Z0PA 3CX7B 5JR9A 5HEUA 3HI2A 3PUXF 4CQIA 5AQPB 2B76A 2W61A 4AKHA 4YSXA 4H9RC 2HN2A 4NPPA 2IIUA 3GMIA 4CI3B 2SPCA 4IL9A 2D9DA 2UXCT 2D2SA 4A97A 1UGOA 4EXTA 2WWUA 2XQ3A 2M6IA 3Q9DA 1Z8UA 3CIRA 3LBXA 2NTXA 2DLRA 4WBOA 2W67A 1UUSA 3CQXC 3ONXA 4UEMA 3LDQB 5AQSB 2WB5A 2XM1A 1CHUA 3MZKB 4TWHA 4EB6E 3AAAB 3KV6A 5LHHB 4B3RT 5AQMB 3PUYF 3LG7A 3P4PA 4YFSA 4GYRA 2K9AA 5AQUB 4IE7A 1VCSA 3KDSE 4L5GA 3P7IA 2VKOA 4O4IE 3MA9A 2UXXB 4U31A 3P4RA 1T7SA 2DNXA 5L3FB 5JRCA 2FJAA 4EOZB 4LF8T 5JTGA 2FJBA 3O1JA 4P09A 4JUYA 4DV3T 2KNDA 3B13A 2W2UA 3RYIE 1U4QA 4DR6T 1W9RA 2KZ7B 4E7ZA 3BQLA 3WAJA 4U33A 3OBVE 4H9OC 4EAHA 4KUMB 4TV9E 1WRDA 2MBGA 1D1AA 3HKBE 3W15B 4GKKT 2ZM0A 1YW0A 4IDPA 5ABHA 1QLBA 2IUBA 5LG3A 3H3MA 2AE9A 3EABA 1N32T 4LFAT 3FZKB 2CWOA 5AFUL 2Y48B 3LSVA 2V5DA 2IC9A 4BAYB 3J7Yq 5TAOA 4X62T 4U72A 2E9XC 3HL6A 3NZPA 2BBJA 2Q9QC 4IDNA 2ODVA 3RRWA 1JNRA 1XNRT 2BKOA 2V26A 2BZBA 5L3BB 3PUZF 5AQGB 2K24A 4YJ3E 3C64A 4WNKA 3MK7C 2CA5A 5LBQB 3PJAA 4ASKA 4AXPA 1XMQT 1YQ4A 2DCFA 3L8RA 3ZLIA 3ZMVB 1BR2A 3N5LA 3BQIA 2VQET 3PUWF 4TWFA 4IE6A 1SE7A 3AEBA 2WQYA 1ZKEA 2A2FX 4YSZA 4H9SE 4AKLA 5FXXA 2Y8DA 4HEAA 3C4ZA 3P50A 5FKYA 2H3RA 3ZYKA 2DHRA 5LHGB 4LF9T 3AAIA 4I43B 4JI4T 4ZZBA 3ANWA 3O9XA 1QSDA 4K0UA 2OA5A 2X9XA 1FJGT 4PJMA 1HX1B 1T98A 5ABGA 5AQJB 1OXZA 3AE6A 2WSSV 5CJ5A 3T1YT 5LMUT 4TV8E 1MNEA 2YDSA 3RIFA 2EHOB 2R6GF 2VB6A 3ZYMA 5AQIB 3RQWA 2JQ9A 1NEKA 2YINA 5LBMA 5AQLB 4COFA 4Z90A 5AQFB 5E0OA 4O2BE 2LKGA 4L0RA 3ZMTB 2QYWA 2E9XD 3OVUA 4GOUA 2BKPA 5ABEA 2D0UA 5AQVB 1XZYA 2Q9QD 5LP6E 3RYHE 1IBKT 3AE9A 2KSRA 5CA1E 3AVRA 1SA0E 2NW7A 3ONJA 3FB2A 3OPCA 3DTOA 4FI5A 4QWNB 4XAXB 5JDFA 4YTPA 5HXSA 5LOVE 4KI0F 5FXZA 4DBRA 2CM0A 3PUSA 2XAFB 2E5LT 3AE7A 1MMDA 2E5VA 3AE8A 1W0AA 3KVBA 1KF6A 3FHNA 2K3WA 2ZM8A 4QH4A 5JR9B 4DMWA 2XSAA 2WMNA 2H88A 4AKGA 2RA1A 1WR0A 4P0AA 4IE5A 1W0BA 2VURA 4GKJT 4UIGA 3CPZA 2C5KT 1AJ3A 3AECA 4B6XA 4MALA 3ZPOA 2VWAA 4JI8T 3EHZA 3UUBA 3O1IA 5LJMA 2MTQA 2NW8A 4PK6A 3LBXB 2E9XB 2XQ9A 5LXTE 4LF7T 5L4HA 4DR2T 2HPLA 4BJNA 3RKGA 2Q9QB 3ETVA 3RI5A 3QNUA 3PUGA 2BVMA 1J5ET 3RIAA 2WP9A 2J62A 3ZMSB 2F4VT 1BR0A 1V9DA 5FP3A 4JI7T 4E7SA 2UUAT 3OTOT 3RYFE 3K1SA 4CN4A 1OEDC 1X79A 3UFEA 3VU7H 1D1CA 1MMGA 2ZLYA 1B7TA 1J1JA 2BS4A 2YKSA 3FZLB 2XUEA 4HE8A 2XAGB 2V6YA 1M62A 3UQ4A 4G63A 3TLVA 4AIUA 5FY7A 1G73A 3UUXB 1UX5A 4JV5T 3L09A 1NWMX 3AXJB 4HFHA 4DV2T 3TLUA 3RC8A 2RPAA 1HNZT 2KWHA 4HFIA 3ZCJA 5JH7E 5LYJE 4WW0A 2OLTA 5LG4A 4EYYR 2XJ7A 4ZS2A 4HWHA 3FBZA 4J2CA 2L3LA 2X0HA 1Y64B 3IHRA 2YDQA 4V1Av 5LCYA 3UTKA 1VCTA 4U74A 4UV9B 5KMGP 3K3NA 2LSKA 1LRZA 2GK9A 1N34T 5L3DB 2CXLA 3RYCE 3JCFA 5HXRA 3V5UA 3ZMUB 2I6HA 1N36T 3QC9A 5BMVE 2A9UA 3K3OA 2UUBT 4AKRB 4PNIA 2CEAA 2AXDS 4A56A 3ZEFB 4ZI2C 2ODUA 3ONLC 2M67A 4CI2B 4OK0A 4TX5A 1NAFA 2X0YA 5HWXA 2CMRA 4HFEA 3IA3A 4DV7T 3PURA 2VKJA 4JEHB 1HR0T 2CBIA 3EAMA 2CHNA 3SWHA 3PUQA 3PJAJ 5HEGA 5ETWA 3RF1A 3OKQA 2E9XA 1WFDA 1MIWA 3MKDA 4DV5T 4AQGA 4NXMT 2IHR1 2ACXA 3R6NA 2Q9QA 1ZP0A 4H9QC 3ZSSA 4QXCB 5IYZE 4U7YA 3AEAA 3ANWB 4HTEA 3KV5A 2QGSA 3DJBA 4ERRA 3H3AA 2QA7A 3NRYA 4LFCT 4TZ4C 4DUYT 3ZC0A 4CI1B 3NZQA 3NBXX 3GN5A 2W66A 3HKDE 2QRXA 4H9PC 3U3IA 5FVKA 2JIWA 2KWIB 2DWKA 4YHHT 2W4XA 3X1DA 4DV0T 4DMVA 3A5XA 5J0ZA 1SUMB 3KFWX 3AEEA 1KNZA 2K5BB 3FZHB 4MLKA 5CB4E 5CA0E 3AXJA 3JADA 3VRBA 2W0GA 4X64T 4PJLA 2FJDA 1S35A 3CX6B 2BG9C 5LA6E 3FXEB 3CKDA 1HS7A 3HKCE 4ZI2D 2ZMAA 5JDLA 3UUMA 2LSJA 2CXDA 4LF5T 4X65T 5AQKB 3OJAA 4K0KT 2CBJA 3ZSTA 2LSYA 4JEUB 2IC6A 2X9YA 2VKHA 5J1GA 4B3MT 4ZHQE 2J1DG 3RH3A 4O2AE 3AE3A 2JQQA 4QXHB 5FXVA 4PK4A 4YLHA 4MFRA 4XBFB 1YQ3A 4UELA 1ZHCA 4WYVA 4MBQA 2WDVA 4JI1T 3KBTA 1DU2A 2XHEB 2XQAA 1IBMT 1KEYA 2E2AA 3FZMB 4C91A 5L47A 2WZHA 4UVCB 3PTRB 2X51A 3AEDA 3HA4A 3C50A 4QXBB 2W63A 2XQ5A 2CCQA 1UURA 4JBWF 2DI4A 3BQKA 4XZCA 5H6RB 2V8SV 2JPFA 4CN1A 4U3CA 5JDHA 1UX4A 5IHYA 4DR7T 4JI6T 2CLYC 2CPTA 2I0MA 2WDQA 4U2ZA 3LK2B 2BKNA 1WR6A 5HXEA 4QH1A 2FJEA 4DR1T 2LSIA 2XTLA 3LFMA 1LVKA 5LGUB 3C51A 2E8IA 5FY1A 2XQ4A 2ZM2A 4CXWA 3OYZA 2N2NA 4HKAA 3B5MA 2XQ8A 3MACA 1W09A 5L3GB 4O4LE 4QH5A 4NUUA 3LK42 2V6YB 3L3PA 2C0SA 3ZCIA 2XY8B 1U5PA 4DNDA 3MJXA 1D0ZA 3Q5XA 5F8PA 4X1YE 5HXCA 4ILUA 1HNWT 1IJ5A 3J9X1 2WMOA 4DV1T 4ILCA 2YN6A 3E08A 4EZ4A 1M7KA 4HFVA 2LOPA 4ZI7E 4ILAA 3ETUA 5LNKA 5JREA 1G8XA 5FL1A 5EZYE 1OEDA 4EIWA 3FXDB 2Z6EA 2V6XA 2K48A 5JVDE 2W62A 3EUHA 2KMFA 2DL1A 3Q5EA 5HYAA 3PDYA 5AQOB 4LF4T 2UU9T 3ZT7A 1HTJF 3JC6C 3RX6A 5L3EB 2V7MA 4IE4A 2YOEA 2CWYA 2C5JA 2B1EA 4TNVA 2XASB 3AE4A 5JQGE 1OWAA 1OEDE 4F6RC 2X67A 3TLSA 1JNZA 4HWIB 1Y01A 3SS1A 4AQYT 3IEEA 5LGTB 5FMNA 3UUNA 2V7JA 3AA1B 4ADZA 1KFYA 4YY3T 1MMNA 3WI3A 4ZOLE 3MXZA 3A8YC 4JLEA 4MHCA 4O8SA 5J2UE 4DUZT 3AB3B 2NOXA 4LMLA 2LOSA 3EDUA 3N9NA 4Z91A 5HEHA 4CXYA 2YEVC 3CX8B 4IE0A 1WLXA 2WBLA 2PJQA 3O1HA 5EK4A 2L8KA 5AQTB 4ZI3C 3ZYLA 1UK5A 4CN6A 3CMLA 4DR4T 2V1DB 1WYCA 2XAJB 2YK0A 3E22E 2IW5B 2V7IA 4TWDA 4AKIA 1GQEA 5A1LA 1XNQT 4OYKA 2JJ9A 2A3DA 1IZNB 3F2EA 3AEGA 2H89A 2Y6XA 3K8PC 5ABFA 2HN1A 3I1AA 4BJMA 4H63V 4IGUA 3GN5B 5AQNB 4GIWA 2NW9A 3QUJA 4PFOA 3IBPA 1IAPA 5AQHB 1O3XA 4WBNE 1BR1A 3QK6A 1HX8A 1YKEB 3JC6D 4ZS3A 3N9QA 1US7B 3G06A 1I6ZA 3K3QC 5LB7B 1SHZC 2PBIA 2LT3A 1T72A 3I9WA 2VVNA 3PUVF 4CXXA 4G2AA 4X66T 1MIYA 2NP9A 2WAUA 1ZEEA 2CE7A 1D0XA 3P4SA 4EYUA 2UXDT 3C98B 5IWAT 3AAEB 3EI0A 3CWZB 2JQKA 3TLTA 4CZZB 4X5TA 3CQGB 3VRAA 4N78D 4EGWA 3ZN0B 1HNXT 4AQFA 4KP3C 3QB5K 1FMVA 4UF0B 5AQQB 2ZM6T 2LSGA 4PJNA 5CFBA 4ZI3D 4KX6A 2UXNB 4IHJE 1VOMA 2BG9A 4QKNA 5JDNA 3UU8A 5LJNA 4PJJA 5L3CB 1EZ3A 2IAKA 2UXBT 3RRCA 2LRKA 4H63H 4NIQA 2WCAA 2XAQB 2X68A 4I4TE 1MMAA 4I50E 5F3JA 4FJOA 1HF8A 4TUYE 4DO0A 1MNDA 4A98A 4DR5T 4M1PA 2BG9E 5H6QB 3GA8A 2LM9A 2IDOB 3UU3A 5KDMC 2XAHB 5DJQC 4PK5A 2LRLA 2EHOC 2WU5A 2LLYA 4PFPA 3HR0A 5DQWA 3TLWA 5EK2A 5DABA 1R8IA 1LVFA 5DQVA 1E1HB 4ZXLA 4C90A 4HWCA 2XQ6A 4OYJA 1ZOYA 2WU2A 5BR8T 3N9LA 3Q2MA 2LEHA 2PTFA 5C2TA 5F5WA 3OYXA 3H37A 3P4QA 4Q25A 3C4XA 3SFDA 2N1GA 3CK6A 4AI6A 5KXJA 5HAXA 2CRBA 2OV9A 3SFEA 5GONE 3IF8B 2N9DA 3RIUA 4DR3T 1MIVA 4JI5T 2VKDA 5LGNB 3P8CD 4Z8XA 4EZHA 5HCMA 3ZC1A 4YT0A 1X9BA 4PAGA 5FYMA 1XMOT 4AQFC 2A72A 2V7KA 4B3ST 3ZN1B 3Q5WA 4LMKA 4KHPT 3P4WA 1D0YA 4GK5E 4BA9A 3S4UA 1HG2A 5HXHA 3UU5A 3ZKRA 4X1IE 3BK9A 3AE2A 1BR4A 4IREA 4L9IA 1OEDB 5JR9C 3L39A 3I9YA 2UUCT 3LJCA 1XDPA 1KNPA 2X9WA 3WAKA 3O4XE 4ISTA 1IBLT 1L0VA 2X9HA 5JDMA 4I55E 3T1HT 4HWDA 4ANJA 2XZEA 2HH7A 3RPUA 4UF0A 5J2TE 4JI3T 3UULA 2YU2A 5AQRB 2FUPA 2JRKA 3NRXA 4U2YA 5C3JA 4YTMA 2EHOD 4DV4T 2DWGA 2YDRA 2M6BA 2WY2A 3VKGA 5LHIB 2C5IT 5CGMA 2LHNA 2P9BA 2JQHA 3M65A 5M4YA 1UCUA 3PE0A 4NXNT 4IIJE 3NWIA 4UV8B 4IDOA 3SRZA 5L2LA 1I94T 3AA6B 4P0BA 4PW8A 3UT5E 2WM9A 3RIUC 1KK7A 4OX9T 4JI2T 2FBWA 2JMHA 2BS2A 2VASA 3KV4A 3EVYA 3PV0F 2VL8A 3ABVA 3KINB 4IT4A 1YXRA 3DP7A 3PU8A 2QVAA 4I0UA 4KMCA 3AEFA 3ZJ2A 5C8YE 1FMWA 5FNVE 2LM2A 2VK9A 4O4HE 4IDZA 5ABFB 2VL0A 3D0TA 2MYSA 5IUXA 5L4EA 3I0OA 4AISA 3N9PA 2WDRA 5FL0A 3HKEE 2PG8A 3TKLB 3PU3A 3N2OA 3SOLA 4LFBT 2BDEA 1H7CA 2KLQA 2WS3A 1S94A 4H9NC 4HN9A 3KV9A 4YTNA 2KT9A 2NR4A 3VR9A 2X66A 3NKZA 4ILBA 3I0QA 2V7LA 3RC3A 4UVBB 2KINB 4LF6T 1T8BA 3RLFF 4U7IA 2D0TA 3KBUA 3KVAA 4X1KE 4ZZCA 3ZT6A 1E2AA 3VKHA 4KHZF 1J5WA 1D1BA 2J47A 3C4WA 2NWBA 4IL4A 2MPKA 2RP4A 2XPKA 4NUVA 1CUNA 4YSYA 3RHWA 3CQCB 3B57A 1XDOA 2WZIA 2LKHA 4OFZA 2XQ7A 4DVDA 3AVSA 3LK3B 1HCIA 5KX5E 1YD8G 5ADXL 1IJ6A 3GWHA 3FBLA 4LMJA 2BG9B 3AA7B 4HFBA 3FZFB 1N33T 2VQFT 2BBHA 4EEDA 4HFCA 2VVSA 4WZXA 3UFGA 4JYAT 5FVLA 3N9OA 5LMNT 3EDVA 4O4JE 3AA0B 4JI0T 4OHFA 2H7VC 3ZT5A 4UR9A 1FEWA 1VRBA 3JAEA 4QX8B 3ESLA 4TN7B 1YKHB 3N9MA 4IDQA 2BVLA 3VR8A 2XSBA 3E0ZA 4EEBA 3VHLA 3AE1A 2PFVA 4YXDA 3NVOA 2V5CA 4ZEYA 3UQ7A 5HCJA 3N2GE 4UVAB 2KXPB 2ACZA 4QX7B 3N2KE 2L9QA 3UU6A 4YHJA 2HPJA 3M3ZB 4DBQA 4HGAA 2H7OA 5HEJA 3PUAA 4DV6T 4UXNB 3ZMZB 2LE8A 2IMLA 2BS3A 2MAWA 2EHOA 2I59A 3ZJ1A 3V5SA 1WCRA 1QUUA 5JDQA 4ISSA 4F8HA 2CLYB 5JRCB 2XQYA 2CHOA 3T8OA 1WYBA 2HHHT 1LKXA 2JMKA 4X20E 1HG5A 5EK3A 5JDGA 1ZV4X 1HFAA 1XWMA 5HEOA 4TNWA 4GYSA 2LJLA 2J4GA 2WWVA 5FY0A 1E7PA 4KBMB 2W00A 5FXWA 1KNRA 4P1NA 3F31A 4A5XA 3F57A 3Q5DA 1NENA 2X0LB 3JAFA 3QB5A 3AE5A 2MOZA 3RKOA 4YJ2E 4B3TT 3A7MA 4GK0E 2NTYA 2LHRA 5HWYA 3UU4A 3QOFA 1FIOA 4HWFA 2G0UA 2D5UA 2CXFA 2ES0A 4EV6A 3CVRA 4DIDB 2YU1A 3RQUA 3R84B 3U78A
chains in the Genus database with same CATH topology
1WR0A 2XZEA 2V6XA 1WFDA 5CGMA 3ZT6A 2WWVA 3ZT5A 4U33A 2LRKA 3EABA 2A9UA 2JQHA 4IT4A 1YXRA 2DL1A 2JQ9A 4NIQA 4WZXA 2K3WA 4CN6A 3K1SA 4CN1A 2V6YA 2RPAA 5FVLA 4U3CA 5LB7B 3ZSTA 2LRLA 4P1NA 4CN4A 2W2UA 4A5XA 2MPKA 4ZEYA 4U2YA 2V6YB 2CPTA 3ZSSA 4U7IA 4U2ZA 3ZT7A 4U31A 2JQKA 5CJ5A 2CRBA 5FVKA 4U7YA 1WCRA 2WY2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WR0 A;  2XZE A;  2V6X A;  1WFD A;  5CGM A;  3ZT6 A;  2WWV A;  3ZT5 A;  4U33 A;  2LRK A;  3EAB A;  2A9U A;  2JQH A;  4IT4 A;  1YXR A;  2DL1 A;  2JQ9 A;  4NIQ A;  4WZX A;  2K3W A;  4CN6 A;  3K1S A;  4CN1 A;  2V6Y A;  2RPA A;  5FVL A;  4U3C A;  5LB7 B;  3ZST A;  2LRL A;  4P1N A;  4CN4 A;  2W2U A;  4A5X A;  2MPK A;  4ZEY A;  4U2Y A;  2V6Y B;  2CPT A;  3ZSS A;  4U7I A;  4U2Z A;  3ZT7 A;  4U31 A;  2JQK A;  5CJ5 A;  2CRB A;  5FVK A;  4U7Y A;  1WCR A;  2WY2 A; 
#chains in the Genus database with same CATH topology
 3RGL A;  4HFD A;  2XM2 A;  4QHO A;  1Z0P A;  3CX7 B;  5JR9 A;  5HEU A;  3HI2 A;  3PUX F;  4CQI A;  5AQP B;  2B76 A;  2W61 A;  4AKH A;  4YSX A;  4H9R C;  2HN2 A;  4NPP A;  2IIU A;  3GMI A;  4CI3 B;  2SPC A;  4IL9 A;  2D9D A;  2UXC T;  2D2S A;  4A97 A;  1UGO A;  4EXT A;  2WWU A;  2XQ3 A;  2M6I A;  3Q9D A;  1Z8U A;  3CIR A;  3LBX A;  2NTX A;  2DLR A;  4WBO A;  2W67 A;  1UUS A;  3CQX C;  3ONX A;  4UEM A;  3LDQ B;  5AQS B;  2WB5 A;  2XM1 A;  1CHU A;  3MZK B;  4TWH A;  4EB6 E;  3AAA B;  3KV6 A;  5LHH B;  4B3R T;  5AQM B;  3PUY F;  3LG7 A;  3P4P A;  4YFS A;  4GYR A;  2K9A A;  5AQU B;  4IE7 A;  1VCS A;  3KDS E;  4L5G A;  3P7I A;  2VKO A;  4O4I E;  3MA9 A;  2UXX B;  4U31 A;  3P4R A;  1T7S A;  2DNX A;  5L3F B;  5JRC A;  2FJA A;  4EOZ B;  4LF8 T;  5JTG A;  2FJB A;  3O1J A;  4P09 A;  4JUY A;  4DV3 T;  2KND A;  3B13 A;  2W2U A;  3RYI E;  1U4Q A;  4DR6 T;  1W9R A;  2KZ7 B;  4E7Z A;  3BQL A;  3WAJ A;  4U33 A;  3OBV E;  4H9O C;  4EAH A;  4KUM B;  4TV9 E;  1WRD A;  2MBG A;  1D1A A;  3HKB E;  3W15 B;  4GKK T;  2ZM0 A;  1YW0 A;  4IDP A;  5ABH A;  1QLB A;  2IUB A;  5LG3 A;  3H3M A;  2AE9 A;  3EAB A;  1N32 T;  4LFA T;  3FZK B;  2CWO A;  5AFU L;  2Y48 B;  3LSV A;  2V5D A;  2IC9 A;  4BAY B;  3J7Y q;  5TAO A;  4X62 T;  4U72 A;  2E9X C;  3HL6 A;  3NZP A;  2BBJ A;  2Q9Q C;  4IDN A;  2ODV A;  3RRW A;  1JNR A;  1XNR T;  2BKO A;  2V26 A;  2BZB A;  5L3B B;  3PUZ F;  5AQG B;  2K24 A;  4YJ3 E;  3C64 A;  4WNK A;  3MK7 C;  2CA5 A;  5LBQ B;  3PJA A;  4ASK A;  4AXP A;  1XMQ T;  1YQ4 A;  2DCF A;  3L8R A;  3ZLI A;  3ZMV B;  1BR2 A;  3N5L A;  3BQI A;  2VQE T;  3PUW F;  4TWF A;  4IE6 A;  1SE7 A;  3AEB A;  2WQY A;  1ZKE A;  2A2F X;  4YSZ A;  4H9S E;  4AKL A;  5FXX A;  2Y8D A;  4HEA A;  3C4Z A;  3P50 A;  5FKY A;  2H3R A;  3ZYK A;  2DHR A;  5LHG B;  4LF9 T;  3AAI A;  4I43 B;  4JI4 T;  4ZZB A;  3ANW A;  3O9X A;  1QSD A;  4K0U A;  2OA5 A;  2X9X A;  1FJG T;  4PJM A;  1HX1 B;  1T98 A;  5ABG A;  5AQJ B;  1OXZ A;  3AE6 A;  2WSS V;  5CJ5 A;  3T1Y T;  5LMU T;  4TV8 E;  1MNE A;  2YDS A;  3RIF A;  2EHO B;  2R6G F;  2VB6 A;  3ZYM A;  5AQI B;  3RQW A;  2JQ9 A;  1NEK A;  2YIN A;  5LBM A;  5AQL B;  4COF A;  4Z90 A;  5AQF B;  5E0O A;  4O2B E;  2LKG A;  4L0R A;  3ZMT B;  2QYW A;  2E9X D;  3OVU A;  4GOU A;  2BKP A;  5ABE A;  2D0U A;  5AQV B;  1XZY A;  2Q9Q D;  5LP6 E;  3RYH E;  1IBK T;  3AE9 A;  2KSR A;  5CA1 E;  3AVR A;  1SA0 E;  2NW7 A;  3ONJ A;  3FB2 A;  3OPC A;  3DTO A;  4FI5 A;  4QWN B;  4XAX B;  5JDF A;  4YTP A;  5HXS A;  5LOV E;  4KI0 F;  5FXZ A;  4DBR A;  2CM0 A;  3PUS A;  2XAF B;  2E5L T;  3AE7 A;  1MMD A;  2E5V A;  3AE8 A;  1W0A A;  3KVB A;  1KF6 A;  3FHN A;  2K3W A;  2ZM8 A;  4QH4 A;  5JR9 B;  4DMW A;  2XSA A;  2WMN A;  2H88 A;  4AKG A;  2RA1 A;  1WR0 A;  4P0A A;  4IE5 A;  1W0B A;  2VUR A;  4GKJ T;  4UIG A;  3CPZ A;  2C5K T;  1AJ3 A;  3AEC A;  4B6X A;  4MAL A;  3ZPO A;  2VWA A;  4JI8 T;  3EHZ A;  3UUB A;  3O1I A;  5LJM A;  2MTQ A;  2NW8 A;  4PK6 A;  3LBX B;  2E9X B;  2XQ9 A;  5LXT E;  4LF7 T;  5L4H A;  4DR2 T;  2HPL A;  4BJN A;  3RKG A;  2Q9Q B;  3ETV A;  3RI5 A;  3QNU A;  3PUG A;  2BVM A;  1J5E T;  3RIA A;  2WP9 A;  2J62 A;  3ZMS B;  2F4V T;  1BR0 A;  1V9D A;  5FP3 A;  4JI7 T;  4E7S A;  2UUA T;  3OTO T;  3RYF E;  3K1S A;  4CN4 A;  1OED C;  1X79 A;  3UFE A;  3VU7 H;  1D1C A;  1MMG A;  2ZLY A;  1B7T A;  1J1J A;  2BS4 A;  2YKS A;  3FZL B;  2XUE A;  4HE8 A;  2XAG B;  2V6Y A;  1M62 A;  3UQ4 A;  4G63 A;  3TLV A;  4AIU A;  5FY7 A;  1G73 A;  3UUX B;  1UX5 A;  4JV5 T;  3L09 A;  1NWM X;  3AXJ B;  4HFH A;  4DV2 T;  3TLU A;  3RC8 A;  2RPA A;  1HNZ T;  2KWH A;  4HFI A;  3ZCJ A;  5JH7 E;  5LYJ E;  4WW0 A;  2OLT A;  5LG4 A;  4EYY R;  2XJ7 A;  4ZS2 A;  4HWH A;  3FBZ A;  4J2C A;  2L3L A;  2X0H A;  1Y64 B;  3IHR A;  2YDQ A;  4V1A v;  5LCY A;  3UTK A;  1VCT A;  4U74 A;  4UV9 B;  5KMG P;  3K3N A;  2LSK A;  1LRZ A;  2GK9 A;  1N34 T;  5L3D B;  2CXL A;  3RYC E;  3JCF A;  5HXR A;  3V5U A;  3ZMU B;  2I6H A;  1N36 T;  3QC9 A;  5BMV E;  2A9U A;  3K3O A;  2UUB T;  4AKR B;  4PNI A;  2CEA A;  2AXD S;  4A56 A;  3ZEF B;  4ZI2 C;  2ODU A;  3ONL C;  2M67 A;  4CI2 B;  4OK0 A;  4TX5 A;  1NAF A;  2X0Y A;  5HWX A;  2CMR A;  4HFE A;  3IA3 A;  4DV7 T;  3PUR A;  2VKJ A;  4JEH B;  1HR0 T;  2CBI A;  3EAM A;  2CHN A;  3SWH A;  3PUQ A;  3PJA J;  5HEG A;  5ETW A;  3RF1 A;  3OKQ A;  2E9X A;  1WFD A;  1MIW A;  3MKD A;  4DV5 T;  4AQG A;  4NXM T;  2IHR 1;  2ACX A;  3R6N A;  2Q9Q A;  1ZP0 A;  4H9Q C;  3ZSS A;  4QXC B;  5IYZ E;  4U7Y A;  3AEA A;  3ANW B;  4HTE A;  3KV5 A;  2QGS A;  3DJB A;  4ERR A;  3H3A A;  2QA7 A;  3NRY A;  4LFC T;  4TZ4 C;  4DUY T;  3ZC0 A;  4CI1 B;  3NZQ A;  3NBX X;  3GN5 A;  2W66 A;  3HKD E;  2QRX A;  4H9P C;  3U3I A;  5FVK A;  2JIW A;  2KWI B;  2DWK A;  4YHH T;  2W4X A;  3X1D A;  4DV0 T;  4DMV A;  3A5X A;  5J0Z A;  1SUM B;  3KFW X;  3AEE A;  1KNZ A;  2K5B B;  3FZH B;  4MLK A;  5CB4 E;  5CA0 E;  3AXJ A;  3JAD A;  3VRB A;  2W0G A;  4X64 T;  4PJL A;  2FJD A;  1S35 A;  3CX6 B;  2BG9 C;  5LA6 E;  3FXE B;  3CKD A;  1HS7 A;  3HKC E;  4ZI2 D;  2ZMA A;  5JDL A;  3UUM A;  2LSJ A;  2CXD A;  4LF5 T;  4X65 T;  5AQK B;  3OJA A;  4K0K T;  2CBJ A;  3ZST A;  2LSY A;  4JEU B;  2IC6 A;  2X9Y A;  2VKH A;  5J1G A;  4B3M T;  4ZHQ E;  2J1D G;  3RH3 A;  4O2A E;  3AE3 A;  2JQQ A;  4QXH B;  5FXV A;  4PK4 A;  4YLH A;  4MFR A;  4XBF B;  1YQ3 A;  4UEL A;  1ZHC A;  4WYV A;  4MBQ A;  2WDV A;  4JI1 T;  3KBT A;  1DU2 A;  2XHE B;  2XQA A;  1IBM T;  1KEY A;  2E2A A;  3FZM B;  4C91 A;  5L47 A;  2WZH A;  4UVC B;  3PTR B;  2X51 A;  3AED A;  3HA4 A;  3C50 A;  4QXB B;  2W63 A;  2XQ5 A;  2CCQ A;  1UUR A;  4JBW F;  2DI4 A;  3BQK A;  4XZC A;  5H6R B;  2V8S V;  2JPF A;  4CN1 A;  4U3C A;  5JDH A;  1UX4 A;  5IHY A;  4DR7 T;  4JI6 T;  2CLY C;  2CPT A;  2I0M A;  2WDQ A;  4U2Z A;  3LK2 B;  2BKN A;  1WR6 A;  5HXE A;  4QH1 A;  2FJE A;  4DR1 T;  2LSI A;  2XTL A;  3LFM A;  1LVK A;  5LGU B;  3C51 A;  2E8I A;  5FY1 A;  2XQ4 A;  2ZM2 A;  4CXW A;  3OYZ A;  2N2N A;  4HKA A;  3B5M A;  2XQ8 A;  3MAC A;  1W09 A;  5L3G B;  4O4L E;  4QH5 A;  4NUU A;  3LK4 2;  2V6Y B;  3L3P A;  2C0S A;  3ZCI A;  2XY8 B;  1U5P A;  4DND A;  3MJX A;  1D0Z A;  3Q5X A;  5F8P A;  4X1Y E;  5HXC A;  4ILU A;  1HNW T;  1IJ5 A;  3J9X 1;  2WMO A;  4DV1 T;  4ILC A;  2YN6 A;  3E08 A;  4EZ4 A;  1M7K A;  4HFV A;  2LOP A;  4ZI7 E;  4ILA A;  3ETU A;  5LNK A;  5JRE A;  1G8X A;  5FL1 A;  5EZY E;  1OED A;  4EIW A;  3FXD B;  2Z6E A;  2V6X A;  2K48 A;  5JVD E;  2W62 A;  3EUH A;  2KMF A;  2DL1 A;  3Q5E A;  5HYA A;  3PDY A;  5AQO B;  4LF4 T;  2UU9 T;  3ZT7 A;  1HTJ F;  3JC6 C;  3RX6 A;  5L3E B;  2V7M A;  4IE4 A;  2YOE A;  2CWY A;  2C5J A;  2B1E A;  4TNV A;  2XAS B;  3AE4 A;  5JQG E;  1OWA A;  1OED E;  4F6R C;  2X67 A;  3TLS A;  1JNZ A;  4HWI B;  1Y01 A;  3SS1 A;  4AQY T;  3IEE A;  5LGT B;  5FMN A;  3UUN A;  2V7J A;  3AA1 B;  4ADZ A;  1KFY A;  4YY3 T;  1MMN A;  3WI3 A;  4ZOL E;  3MXZ A;  3A8Y C;  4JLE A;  4MHC A;  4O8S A;  5J2U E;  4DUZ T;  3AB3 B;  2NOX A;  4LML A;  2LOS A;  3EDU A;  3N9N A;  4Z91 A;  5HEH A;  4CXY A;  2YEV C;  3CX8 B;  4IE0 A;  1WLX A;  2WBL A;  2PJQ A;  3O1H A;  5EK4 A;  2L8K A;  5AQT B;  4ZI3 C;  3ZYL A;  1UK5 A;  4CN6 A;  3CML A;  4DR4 T;  2V1D B;  1WYC A;  2XAJ B;  2YK0 A;  3E22 E;  2IW5 B;  2V7I A;  4TWD A;  4AKI A;  1GQE A;  5A1L A;  1XNQ T;  4OYK A;  2JJ9 A;  2A3D A;  1IZN B;  3F2E A;  3AEG A;  2H89 A;  2Y6X A;  3K8P C;  5ABF A;  2HN1 A;  3I1A A;  4BJM A;  4H63 V;  4IGU A;  3GN5 B;  5AQN B;  4GIW A;  2NW9 A;  3QUJ A;  4PFO A;  3IBP A;  1IAP A;  5AQH B;  1O3X A;  4WBN E;  1BR1 A;  3QK6 A;  1HX8 A;  1YKE B;  3JC6 D;  4ZS3 A;  3N9Q A;  1US7 B;  3G06 A;  1I6Z A;  3K3Q C;  5LB7 B;  1SHZ C;  2PBI A;  2LT3 A;  1T72 A;  3I9W A;  2VVN A;  3PUV F;  4CXX A;  4G2A A;  4X66 T;  1MIY A;  2NP9 A;  2WAU A;  1ZEE A;  2CE7 A;  1D0X A;  3P4S A;  4EYU A;  2UXD T;  3C98 B;  5IWA T;  3AAE B;  3EI0 A;  3CWZ B;  2JQK A;  3TLT A;  4CZZ B;  4X5T A;  3CQG B;  3VRA A;  4N78 D;  4EGW A;  3ZN0 B;  1HNX T;  4AQF A;  4KP3 C;  3QB5 K;  1FMV A;  4UF0 B;  5AQQ B;  2ZM6 T;  2LSG A;  4PJN A;  5CFB A;  4ZI3 D;  4KX6 A;  2UXN B;  4IHJ E;  1VOM A;  2BG9 A;  4QKN A;  5JDN A;  3UU8 A;  5LJN A;  4PJJ A;  5L3C B;  1EZ3 A;  2IAK A;  2UXB T;  3RRC A;  2LRK A;  4H63 H;  4NIQ A;  2WCA A;  2XAQ B;  2X68 A;  4I4T E;  1MMA A;  4I50 E;  5F3J A;  4FJO A;  1HF8 A;  4TUY E;  4DO0 A;  1MND A;  4A98 A;  4DR5 T;  4M1P A;  2BG9 E;  5H6Q B;  3GA8 A;  2LM9 A;  2IDO B;  3UU3 A;  5KDM C;  2XAH B;  5DJQ C;  4PK5 A;  2LRL A;  2EHO C;  2WU5 A;  2LLY A;  4PFP A;  3HR0 A;  5DQW A;  3TLW A;  5EK2 A;  5DAB A;  1R8I A;  1LVF A;  5DQV A;  1E1H B;  4ZXL A;  4C90 A;  4HWC A;  2XQ6 A;  4OYJ A;  1ZOY A;  2WU2 A;  5BR8 T;  3N9L A;  3Q2M A;  2LEH A;  2PTF A;  5C2T A;  5F5W A;  3OYX A;  3H37 A;  3P4Q A;  4Q25 A;  3C4X A;  3SFD A;  2N1G A;  3CK6 A;  4AI6 A;  5KXJ A;  5HAX A;  2CRB A;  2OV9 A;  3SFE A;  5GON E;  3IF8 B;  2N9D A;  3RIU A;  4DR3 T;  1MIV A;  4JI5 T;  2VKD A;  5LGN B;  3P8C D;  4Z8X A;  4EZH A;  5HCM A;  3ZC1 A;  4YT0 A;  1X9B A;  4PAG A;  5FYM A;  1XMO T;  4AQF C;  2A72 A;  2V7K A;  4B3S T;  3ZN1 B;  3Q5W A;  4LMK A;  4KHP T;  3P4W A;  1D0Y A;  4GK5 E;  4BA9 A;  3S4U A;  1HG2 A;  5HXH A;  3UU5 A;  3ZKR A;  4X1I E;  3BK9 A;  3AE2 A;  1BR4 A;  4IRE A;  4L9I A;  1OED B;  5JR9 C;  3L39 A;  3I9Y A;  2UUC T;  3LJC A;  1XDP A;  1KNP A;  2X9W A;  3WAK A;  3O4X E;  4IST A;  1IBL T;  1L0V A;  2X9H A;  5JDM A;  4I55 E;  3T1H T;  4HWD A;  4ANJ A;  2XZE A;  2HH7 A;  3RPU A;  4UF0 A;  5J2T E;  4JI3 T;  3UUL A;  2YU2 A;  5AQR B;  2FUP A;  2JRK A;  3NRX A;  4U2Y A;  5C3J A;  4YTM A;  2EHO D;  4DV4 T;  2DWG A;  2YDR A;  2M6B A;  2WY2 A;  3VKG A;  5LHI B;  2C5I T;  5CGM A;  2LHN A;  2P9B A;  2JQH A;  3M65 A;  5M4Y A;  1UCU A;  3PE0 A;  4NXN T;  4IIJ E;  3NWI A;  4UV8 B;  4IDO A;  3SRZ A;  5L2L A;  1I94 T;  3AA6 B;  4P0B A;  4PW8 A;  3UT5 E;  2WM9 A;  3RIU C;  1KK7 A;  4OX9 T;  4JI2 T;  2FBW A;  2JMH A;  2BS2 A;  2VAS A;  3KV4 A;  3EVY A;  3PV0 F;  2VL8 A;  3ABV A;  3KIN B;  4IT4 A;  1YXR A;  3DP7 A;  3PU8 A;  2QVA A;  4I0U A;  4KMC A;  3AEF A;  3ZJ2 A;  5C8Y E;  1FMW A;  5FNV E;  2LM2 A;  2VK9 A;  4O4H E;  4IDZ A;  5ABF B;  2VL0 A;  3D0T A;  2MYS A;  5IUX A;  5L4E A;  3I0O A;  4AIS A;  3N9P A;  2WDR A;  5FL0 A;  3HKE E;  2PG8 A;  3TKL B;  3PU3 A;  3N2O A;  3SOL A;  4LFB T;  2BDE A;  1H7C A;  2KLQ A;  2WS3 A;  1S94 A;  4H9N C;  4HN9 A;  3KV9 A;  4YTN A;  2KT9 A;  2NR4 A;  3VR9 A;  2X66 A;  3NKZ A;  4ILB A;  3I0Q A;  2V7L A;  3RC3 A;  4UVB B;  2KIN B;  4LF6 T;  1T8B A;  3RLF F;  4U7I A;  2D0T A;  3KBU A;  3KVA A;  4X1K E;  4ZZC A;  3ZT6 A;  1E2A A;  3VKH A;  4KHZ F;  1J5W A;  1D1B A;  2J47 A;  3C4W A;  2NWB A;  4IL4 A;  2MPK A;  2RP4 A;  2XPK A;  4NUV A;  1CUN A;  4YSY A;  3RHW A;  3CQC B;  3B57 A;  1XDO A;  2WZI A;  2LKH A;  4OFZ A;  2XQ7 A;  4DVD A;  3AVS A;  3LK3 B;  1HCI A;  5KX5 E;  1YD8 G;  5ADX L;  1IJ6 A;  3GWH A;  3FBL A;  4LMJ A;  2BG9 B;  3AA7 B;  4HFB A;  3FZF B;  1N33 T;  2VQF T;  2BBH A;  4EED A;  4HFC A;  2VVS A;  4WZX A;  3UFG A;  4JYA T;  5FVL A;  3N9O A;  5LMN T;  3EDV A;  4O4J E;  3AA0 B;  4JI0 T;  4OHF A;  2H7V C;  3ZT5 A;  4UR9 A;  1FEW A;  1VRB A;  3JAE A;  4QX8 B;  3ESL A;  4TN7 B;  1YKH B;  3N9M A;  4IDQ A;  2BVL A;  3VR8 A;  2XSB A;  3E0Z A;  4EEB A;  3VHL A;  3AE1 A;  2PFV A;  4YXD A;  3NVO A;  2V5C A;  4ZEY A;  3UQ7 A;  5HCJ A;  3N2G E;  4UVA B;  2KXP B;  2ACZ A;  4QX7 B;  3N2K E;  2L9Q A;  3UU6 A;  4YHJ A;  2HPJ A;  3M3Z B;  4DBQ A;  4HGA A;  2H7O A;  5HEJ A;  3PUA A;  4DV6 T;  4UXN B;  3ZMZ B;  2LE8 A;  2IML A;  2BS3 A;  2MAW A;  2EHO A;  2I59 A;  3ZJ1 A;  3V5S A;  1WCR A;  1QUU A;  5JDQ A;  4ISS A;  4F8H A;  2CLY B;  5JRC B;  2XQY A;  2CHO A;  3T8O A;  1WYB A;  2HHH T;  1LKX A;  2JMK A;  4X20 E;  1HG5 A;  5EK3 A;  5JDG A;  1ZV4 X;  1HFA A;  1XWM A;  5HEO A;  4TNW A;  4GYS A;  2LJL A;  2J4G A;  2WWV A;  5FY0 A;  1E7P A;  4KBM B;  2W00 A;  5FXW A;  1KNR A;  4P1N A;  3F31 A;  4A5X A;  3F57 A;  3Q5D A;  1NEN A;  2X0L B;  3JAF A;  3QB5 A;  3AE5 A;  2MOZ A;  3RKO A;  4YJ2 E;  4B3T T;  3A7M A;  4GK0 E;  2NTY A;  2LHR A;  5HWY A;  3UU4 A;  3QOF A;  1FIO A;  4HWF A;  2G0U A;  2D5U A;  2CXF A;  2ES0 A;  4EV6 A;  3CVR A;  4DID B;  2YU1 A;  3RQU A;  3R84 B;  3U78 A; 
#chains in the Genus database with same CATH homology
 1WR0 A;  2XZE A;  2V6X A;  1WFD A;  5CGM A;  3ZT6 A;  2WWV A;  3ZT5 A;  4U33 A;  2LRK A;  3EAB A;  2A9U A;  2JQH A;  4IT4 A;  1YXR A;  2DL1 A;  2JQ9 A;  4NIQ A;  4WZX A;  2K3W A;  4CN6 A;  3K1S A;  4CN1 A;  2V6Y A;  2RPA A;  5FVL A;  4U3C A;  5LB7 B;  3ZST A;  2LRL A;  4P1N A;  4CN4 A;  2W2U A;  4A5X A;  2MPK A;  4ZEY A;  4U2Y A;  2V6Y B;  2CPT A;  3ZSS A;  4U7I A;  4U2Z A;  3ZT7 A;  4U31 A;  2JQK A;  5CJ5 A;  2CRB A;  5FVK A;  4U7Y A;  1WCR A;  2WY2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...