4P1NA

Crystal structure of atg1-atg13 complex
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
262
structure length
190
Chain Sequence
SDSNITPFVESLSAKAFVMYSFAEMKFSQILNLIPAPELKKLCMESLLLYLKSLTILASSMKLTSKWWYENESKNCTLKLNILVQWIRDRFNECLDKAEFLRLKLHTLNQSEDPQVLDDPTIFVEKLIYDRALDISRNAARLEMEGNYNTCELAYATSLWMLEILLDEHLSDESDKEMIRKYVSSIANRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of starvation-induced assembly of the autophagy initiation complex.
pubmed doi rcsb
source organism Kluyveromyces marxianus
molecule tags Protein transport
molecule keywords Atg1 tMIT
total genus 77
structure length 190
sequence length 262
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12063 DUF3543 Domain of unknown function (DUF3543)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 4p1nA00
4WZXA 4U31A 3ZT7A 2WWVA 1WR0A 3K1SA 2V6YB 2LRKA 4IT4A 2LRLA 5LB7B 3EABA 4U2ZA 4U7IA 3ZSSA 4U3CA 3ZSTA 2WY2A 2MPKA 2RPAA 4CN1A 4ZEYA 2JQKA 5FVLA 2XZEA 4A5XA 2CRBA 4U33A 4U2YA 4CN4A 4CN6A 2K3WA 4NIQA 1WCRA 5CGMA 2JQHA 1WFDA 2A9UA 2DL1A 2V6XA 3ZT6A 2W2UA 1YXRA 4P1NA 5CJ5A 5FVKA 3ZT5A 2JQ9A 2V6YA 2CPTA 4U7YA
chains in the Genus database with same CATH superfamily
3B57A 1UX5A 2EHOA 5CB4E 3N2KE 5HXSA 3RQUA 5LJNA 4IE5A 5ABFA 3RRCA 4IDPA 4YSZA 3J7Yq 1I94T 4TWHA 2YEVC 1ZP0A 3P50A 4U72A 4AQYT 4ZI7E 4IREA 4PK4A 2MBGA 2YK0A 2E9XC 3Q2MA 2NP9A 2YU1A 1XMOT 4JEUB 3N9NA 4DUZT 2WY2A 3ZJ2A 5JDGA 1E2AA 2XUEA 4I4TE 4AIUA 2UXXB 1YD8G 2DHRA 3CMLA 5L3CB 3C64A 2K24A 5LJMA 2Y48B 2WZIA 2LSGA 3ONLC 3PUWF 3LSVA 4TX5A 1XMQT 2ES0A 4C90A 2XAJB 2NWBA 2AXDS 5A1LA 1SHZC 4O2AE 5LNKA 3W15B 3ZT6A 3PUSA 2Q9QA 2W2UA 4P1NA 2HHHT 3AVSA 4XZCA 4BA9A 3SS1A 2LHRA 2P9BA 4X1KE 5LHGB 2BVMA 3EDUA 5HYAA 4LFAT 3OJAA 1N34T 1BR0A 4Z8XA 3OVUA 4K0UA 3Q5XA 5HXCA 2WQYA 4H9NC 4JI8T 5AQSB 5IWAT 5HEOA 2WS3A 2XSAA 4Q25A 5JDHA 4QX7B 4AISA 1QLBA 3EHZA 4TUYE 5DQVA 3ZEFB 1MMGA 2LLYA 5LXTE 5FP3A 3LFMA 4EYUA 1D0XA 2QRXA 3CX7B 3NKZA 4B3ST 4AKLA 2V7KA 5HCMA 1UURA 4NXNT 3C4ZA 4B3MT 1D1BA 4YXDA 5M4YA 2W4XA 1EZ3A 1BR2A 2LHNA 2LSIA 4EXTA 4LF9T 1FMWA 2BKNA 3UU6A 5JDMA 2LOSA 2A9UA 1XWMA 4TV8E 4IL4A 1D1CA 3T8OA 3ZT5A 3AE9A 4H9QC 4NIQA 4ZOLE 3RPUA 3S4UA 3VHLA 4OYJA 2H7OA 3ZCIA 4DR3T 2CBJA 4EOZB 2DNXA 2W66A 2XAQB 1HX8A 3KBTA 2CHNA 3CX8B 4KI0F 4IL9A 5L4EA 2YOEA 2WM9A 4IE6A 2X0LB 2BKPA 4BAYB 1FJGT 3KV9A 1HS7A 3QC9A 4AQGA 3V5UA 3LBXA 4UVCB 3GMIA 4DR7T 1OEDA 4ZS2A 2RPAA 2HPLA 4PW8A 4CQIA 5CFBA 5J2TE 2WU5A 4ZI2D 3JAEA 3PUQA 5LGNB 5E0OA 2MAWA 4WBOA 2K48A 2KXPB 3L39A 1GQEA 3P8CD 4NUVA 4ZS3A 4X1IE 3RKOA 5FL1A 4HFBA 1Z8UA 3HL6A 2LT3A 3ONXA 3OPCA 1SE7A 2C0SA 4ILAA 4CXXA 2KT9A 3PJAA 1MMDA 5JDNA 3WAJA 1AJ3A 3AA1B 3SFDA 3AAIA 2X68A 5LG3A 4PJMA 4HFCA 5JH7E 2XQYA 3PJAJ 2KINB 1DU2A 4JLEA 3RIUA 2WDRA 3RRWA 3UU5A 4XBFB 1O3XA 2VK9A 3ETVA 2XQAA 4CI3B 3AXJB 5J1GA 4K0KT 5HXHA 4DMWA 2DWKA 4MLKA 2XSBA 2EHOB 4XAXB 2DCFA 4F8HA 4LF4T 2WP9A 1IBMT 2XY8B 4ZEYA 2BS4A 2D2SA 2V1DB 4TWDA 3FXDB 5HXRA 4X20E 1XDPA 4UEMA 3AEAA 3NBXX 5AQVB 3TLWA 3ZKRA 4DR2T 4DIDB 2XAFB 2BVLA 5FXZA 3RI5A 2ZM8A 4IDOA 4WNKA 4JI2T 4MFRA 2WSSV 4N78D 2M6IA 3ZMSB 2V6XA 3FXEB 3L3PA 4UV8B 3BQLA 2WAUA 3JC6C 3AE8A 2LKGA 1B7TA 4WBNE 2E8IA 4QXBB 4ZXLA 5EK4A 2V6YA 4EZHA 3BQKA 4GKKT 3LG7A 2BG9A 4YTMA 5FL0A 3H3MA 3AE7A 5HEUA 3AB3B 3ABVA 5BR8T 2JRKA 3AXJA 3QK6A 1S94A 2X9HA 2YDRA 3LK42 3GWHA 3EAMA 3PTRB 3ZC0A 4DR6T 3LDQB 3PURA 3UUNA 3AAAB 3H3AA 3P4WA 4U7IA 3EUHA 4Z91A 4ZI2C 2ZM2A 5JDFA 3JCFA 1OEDC 2V26A 3P7IA 4O4HE 4BJNA 1M62A 3HKDE 2VB6A 2YU2A 4TN7B 3ZYKA 2JPFA 1WR6A 2BKOA 1ZHCA 1I6ZA 2CLYB 1D0ZA 3P4RA 4O8SA 5EK2A 3UQ4A 4DR5T 3ZJ1A 2VVSA 1S35A 3SWHA 2XASB 1Y64B 1M7KA 1NEKA 5L3EB 3K3NA 4PJLA 2YKSA 3L8RA 4QH4A 3E0ZA 4OHFA 5AQOB 1IJ6A 2IC9A 2I0MA 2VVNA 4TV9E 4YSYA 4DV2T 3I9WA 3FZFB 3UU8A 4TZ4C 5J2UE 4JYAT 2CXDA 3PE0A 3ZPOA 2Q9QC 5AQPB 3LBXB 3NRXA 4EYYR 4L0RA 3K8PC 1WR0A 3ZN0B 4HFHA 3DTOA 4KX6A 3L09A 1W09A 4GK0E 4JI6T 2IHR1 4U74A 3RYFE 4JEHB 2CE7A 3CK6A 2YN6A 4EAHA 2JMKA 2D9DA 5HEHA 4GOUA 2V7LA 2HPJA 3N2OA 1Z0PA 1BR4A 5HEJA 2C5KT 5J0ZA 4CN4A 2PBIA 4PFOA 2XQ5A 2K3WA 5AQJB 2WMOA 2JQHA 2N1GA 2UXNB 2H3RA 1U5PA 2EHOC 1D1AA 2D0TA 2LM9A 2QVAA 4HEAA 4QH5A 1XDOA 5IYZE 2B76A 3M3ZB 4QH1A 3AAEB 4F6RC 5LG4A 3FB2A 2V7MA 3ETUA 3HI2A 1IJ5A 3R6NA 4DV1T 4JI7T 5JRCB 2UXDT 3KVAA 3CQGB 5FXVA 4DNDA 5JDQA 2B1EA 4KHPT 3Q5WA 2I59A 3D0TA 3DP7A 4YHHT 2CEAA 1KEYA 1R8IA 1UCUA 2UUAT 2E2AA 3AEFA 2H7VC 3C51A 2FJDA 3IEEA 1KNZA 5JTGA 2V8SV 4H63H 4IE4A 3NZPA 4ZZCA 2BS2A 2V5CA 5IUXA 4YTPA 3OYXA 3PDYA 2E9XA 2JQKA 2CRBA 3NWIA 2Q9QB 3QOFA 3NRYA 5L3DB 2W00A 4AKRB 1FEWA 2QGSA 1KNPA 1OXZA 2X67A 3AE5A 2FBWA 5L47A 2M67A 3CWZB 4H9RC 2KLQA 3UULA 3UQ7A 2DI4A 1N36T 3E08A 3K3QC 4M1PA 4P0BA 3ZYLA 4NPPA 4B3RT 3ZMZB 3RYCE 2WU2A 2UUCT 4H9PC 3HA4A 3H37A 2XPKA 1Y01A 2IAKA 4AQFC 2PJQA 3Q5DA 5FY0A 1FIOA 1LKXA 2KWIB 5LBMA 3QNUA 4UVAB 2W61A 3ZMUB 4B6XA 4JI0T 1ZOYA 5FKYA 4YJ2E 3ZSTA 3CIRA 3M65A 1UX4A 2LSKA 2W63A 4G2AA 3U78A 3FZLB 5LHIB 4X62T 4DV3T 3ANWB 3CKDA 4X64T 2JJ9A 4ZI3D 2MTQA 4QX8B 2LJLA 5ADXL 5C3JA 1MMNA 1ZV4X 3CQCB 2CHOA 5FMNA 1T72A 2E5VA 3TLUA 4DBRA 1VOMA 2W62A 3QUJA 4OX9T 2XZEA 5F3JA 2KSRA 4KBMB 4U33A 4GIWA 4EZ4A 4KP3C 4X5TA 4U2YA 5F5WA 2M6BA 4P0AA 2AE9A 1SA0E 2Z6EA 5EZYE 1JNZA 5IHYA 3N2GE 2DL1A 5LGUB 5CJ5A 2XQ8A 3IHRA 3Q5EA 3C50A 5FVKA 4DR1T 4B3TT 2NTYA 1WRDA 4PK6A 2XTLA 2XQ6A 2LEHA 3FBLA 3FZKB 4LMLA 5H6RB 3SOLA 2FJAA 4OFZA 4ASKA 3HR0A 4YJ3E 2CWYA 4I43B 1IAPA 2NW7A 5AQLB 4IDNA 2D5UA 2WDQA 2WZHA 4IT4A 4O4LE 4PJJA 4HFVA 2LRLA 3LJCA 4TNVA 4ZZBA 1KK7A 5HWYA 4JBWF 3RIFA 1HFAA 1U4QA 1J1JA 4BJMA 3TKLB 3CX6B 3F2EA 3JAFA 3KVBA 1YQ3A 4EGWA 2F4VT 2X9XA 4PFPA 3I9YA 3O1JA 5CA0E 3AEDA 5AQMB 3PUVF 2A72A 2BZBA 1HF8A 4CN6A 4TNWA 4IE0A 4DV5T 5L3BB 4JUYA 5BMVE 1X79A 1IBLT 3F57A 2C5JA 2JIWA 3P4QA 5JR9C 2XM1A 2EHOD 1WFDA 3I1AA 5HXEA 4DVDA 2K5BB 3A7MA 3R84B 4AKHA 3EDVA 3K3OA 4YLHA 2RP4A 4YT0A 2E9XB 3LK3B 1JNRA 2XAGB 5DJQC 3PUZF 2LKHA 3RC3A 4U31A 3N9QA 3X1DA 2E5LT 4AKGA 3HKEE 1VCTA 4UELA 1MNEA 1QUUA 4HWHA 5AQTB 3KV6A 3WAKA 5L3GB 1US7B 4GYSA 3VU7H 5AQQB 2V5DA 3V5SA 2PFVA 4X1YE 4KHZF 2X0YA 3N9MA 2PTFA 2CA5A 4NUUA 4U3CA 1LVFA 5HAXA 4JV5T 3VRAA 5HCJA 3UU4A 2W0GA 4DR4T 3TLVA 2CLYC 3KV5A 3ZN1B 2W67A 3CVRA 4JI5T 2YDQA 2BBHA 3UTKA 3I0OA 3ONJA 4QKNA 4EB6E 4DV0T 3WI3A 2X9YA 3C98B 2GK9A 3FHNA 2H88A 4CZZB 5HEGA 5ETWA 4C91A 3O4XE 3RQWA 1W0BA 1HG5A 2VKJA 3PUAA 4H9SE 4O2BE 4JI3T 4KMCA 1G73A 2XJ7A 2ZLYA 3G06A 3MA9A 4OK0A 2ZM6T 3A5XA 1N32T 4V1Av 2XQ9A 2WBLA 4HTEA 4DV7T 3RYIE 3RIUC 4LF5T 1WYCA 2UXBT 3AEGA 2Y6XA 2BS3A 4CI2B 5HWXA 1UGOA 1J5ET 2WWVA 1H7CA 1L0VA 2LSJA 3ZYMA 2X51A 2N2NA 3PUGA 4UVBB 3EI0A 2OV9A 4ILBA 5LOVE 3PU3A 3ZC1A 2LE8A 4H9OC 4PJNA 4U2ZA 1YKHB 3J9X1 2FJEA 4LMKA 1HCIA 3PUYF 2X9WA 3BK9A 3KV4A 2XM2A 4UF0A 1WYBA 5EK3A 2VWAA 3RIAA 2VKOA 2YDSA 4QXHB 1LRZA 4DO0A 5FVLA 4A5XA 4EEBA 3AA0B 2BBJA 5ABGA 1T8BA 4UXNB 5C2TA 5KX5E 3O9XA 4NXMT 3AA7B 3OBVE 2CWOA 2XAHB 5AQGB 2OLTA 5L3FB 5CGMA 3UFEA 3UUMA 1E1HB 3JADA 5FY1A 2VASA 1OEDB 3UT5E 1XNRT 4GK5E 3AE1A 5AQRB 2IC6A 2BDEA 3AEBA 4DMVA 3KBUA 2FJBA 3UUXB 2YINA 2NR4A 5DQWA 4X65T 2V7JA 5FY7A 3UFGA 4AXPA 5KDMC 3ZT7A 1IZNB 3PV0F 4HFIA 3K1SA 1FMVA 1CHUA 5LGTB 1G8XA 3CPZA 4YHJA 3RC8A 2FUPA 1ZEEA 2CBIA 2KWHA 1OWAA 5ABFB 2CXLA 4UV9B 1MNDA 2K9AA 3B13A 3EVYA 3FZMB 4PNIA 2MPKA 4UIGA 1W9RA 4ADZA 4AKIA 2JQQA 2PG8A 1WLXA 5GONE 5LMUT 3B5MA 5LP6E 4GKJT 2NOXA 2ACZA 5JR9A 4UF0B 2DWGA 2LM2A 3GN5A 2WDVA 2J1DG 3ESLA 4TWFA 3RF1A 1LVKA 2G0UA 3RHWA 3SRZA 4EEDA 3AA6B 4ANJA 2X66A 5KXJA 4AI6A 4ILUA 1NWMX 2IMLA 3OKQA 2ACXA 4YTNA 2CCQA 2XQ7A 2Y8DA 3UU3A 5JREA 1YQ4A 2Q9QD 2LRKA 3O1HA 2BG9E 4Z90A 4CI1B 2OA5A 1UK5A 5JDLA 5JRCA 3RX6A 3ANWA 3QB5A 4ILCA 3KINB 4IDZA 4WW0A 5LBQB 4L9IA 1KFYA 1E7PA 1T7SA 2BG9B 3DJBA 3RGLA 2VQFT 2V6YB 4DV4T 2C5IT 2IUBA 3RH3A 5LYJE 3FZHB 3VKGA 2CMRA 3MKDA 2QA7A 3I0QA 2VQET 3QB5K 3P4PA 4FI5A 4IE7A 1MIWA 2R6GF 4ISTA 5AQUB 3T1HT 3AEEA 3KFWX 3GN5B 2L9QA 3A8YC 3HKCE 4YY3T 3RLFF 1KNRA 1XNQT 2J47A 3N9LA 3TLSA 5LHHB 1D0YA 3MXZA 1KF6A 1BR1A 2J4GA 2MYSA 4MHCA 3OTOT 4IIJE 3CQXC 4A98A 4JI4T 5C8YE 1CUNA 4PAGA 2CM0A 5AQNB 4YSXA 3ZMTB 1HNXT 1HTJF 2UU9T 2J62A 2CPTA 1OEDE 3C4WA 4KUMB 3P4SA 4QXCB 2BG9C 2H89A 5AQIB 1NAFA 2A3DA 5AFUL 1MIVA 2CXFA 5LCYA 3VRBA 1HNZT 1YKEB 1V9DA 3ZCJA 4YFSA 5JQGE 3EABA 3MACA 2N9DA 2WWUA 4HWFA 5FYMA 1VRBA 3TLTA 2VURA 3MJXA 3N9PA 3SFEA 3AECA 4CN1A 5KMGP 1HX1B 4DBQA 2UXCT 5DABA 1HNWT 4HGAA 5L2LA 4LFBT 3PU8A 2VKHA 4A97A 1MMAA 2RA1A 2I6HA 1SUMB 3IA3A 2UUBT 2V7IA 5L4HA 2D0UA 4GYRA 1WCRA 3NZQA 4ISSA 4QWNB 4G63A 2SPCA 2QYWA 3AE4A 3KDSE 4HFDA 1T98A 1YXRA 2MOZA 3ZMVB 2A2FX 1ZKEA 5F8PA 2XHEB 4U7YA 4WYVA 3VR9A 4HWDA 4E7ZA 2L3LA 4I0UA 2HN1A 2ZM0A 3JC6D 2WCAA 4EV6A 2ODVA 3T1YT 4ZHQE 1IBKT 5ABEA 2ODUA 2VL0A 2NW9A 4A56A 5AQKB 4OYKA 5LB7B 2KMFA 3IBPA 4ERRA 5LMNT 3ZSSA 4JI1T 4IDQA 2KNDA 4QHOA 5FXXA 4LFCT 3N5LA 2NTXA 2IIUA 4I55E 4J2CA 5AQHB 5JVDE 4EIWA 2NW8A 3N9OA 4FJOA 4ZI3C 1QSDA 4L5GA 2X0HA 3VR8A 1XZYA 1HG2A 3PUXF 4HFEA 2XQ3A 4I50E 2LOPA 3HKBE 3GA8A 1X9BA 3Q9DA 4LF7T 5CA1E 5FNVE 5ABHA 3MZKB 3RYHE 2JQ9A 3FBZA 4WZXA 2LSYA 2L8KA 3AE2A 4LF8T 1N33T 5FXWA 3E22E 4O4JE 2WB5A 3VKHA 2HH7A 2ZMAA 5H6QB 2E9XD 4CXWA 1W0AA 3RKGA 3ZLIA 2VKDA 4E7SA 4CXYA 2VL8A 5AQFB 4LMJA 4H63V 1UUSA 3LK2B 4HKAA 5LA6E 3BQIA 2IW5B 2XQ4A 3AE6A 2IDOB 4PK5A 4MBQA 4HE8A 2DLRA 4UR9A 4DV6T 4LF6T 4HN9A 2HN2A 3O1IA 1J5WA 2WMNA 4HWCA 4IHJE 4P09A 3NVOA 3AE3A 5TAOA 3UUBA 4HWIB 1MIYA 4COFA 1HR0T 3U3IA 1VCSA 3AVRA 2JMHA 3C4XA 5JR9B 4AQFA 3OYZA 3F31A 4O4IE 4DUYT 2KZ7B 1YW0A 3IF8B 3MK7C 1NENA 4X66T 4MALA 4IGUA
chains in the Genus database with same CATH topology
4WZXA 4U31A 3ZT7A 2WWVA 1WR0A 3K1SA 2V6YB 2LRKA 4IT4A 2LRLA 5LB7B 3EABA 4U2ZA 4U7IA 3ZSSA 4U3CA 3ZSTA 2WY2A 2MPKA 2RPAA 4CN1A 4ZEYA 2JQKA 5FVLA 2XZEA 4A5XA 2CRBA 4U33A 4U2YA 4CN4A 4CN6A 2K3WA 4NIQA 1WCRA 5CGMA 2JQHA 1WFDA 2A9UA 2DL1A 2V6XA 3ZT6A 2W2UA 1YXRA 4P1NA 5CJ5A 5FVKA 3ZT5A 2JQ9A 2V6YA 2CPTA 4U7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WZX A;  4U31 A;  3ZT7 A;  2WWV A;  1WR0 A;  3K1S A;  2V6Y B;  2LRK A;  4IT4 A;  2LRL A;  5LB7 B;  3EAB A;  4U2Z A;  4U7I A;  3ZSS A;  4U3C A;  3ZST A;  2WY2 A;  2MPK A;  2RPA A;  4CN1 A;  4ZEY A;  2JQK A;  5FVL A;  2XZE A;  4A5X A;  2CRB A;  4U33 A;  4U2Y A;  4CN4 A;  4CN6 A;  2K3W A;  4NIQ A;  1WCR A;  5CGM A;  2JQH A;  1WFD A;  2A9U A;  2DL1 A;  2V6X A;  3ZT6 A;  2W2U A;  1YXR A;  4P1N A;  5CJ5 A;  5FVK A;  3ZT5 A;  2JQ9 A;  2V6Y A;  2CPT A;  4U7Y A; 
#chains in the Genus database with same CATH topology
 3B57 A;  1UX5 A;  2EHO A;  5CB4 E;  3N2K E;  5HXS A;  3RQU A;  5LJN A;  4IE5 A;  5ABF A;  3RRC A;  4IDP A;  4YSZ A;  3J7Y q;  1I94 T;  4TWH A;  2YEV C;  1ZP0 A;  3P50 A;  4U72 A;  4AQY T;  4ZI7 E;  4IRE A;  4PK4 A;  2MBG A;  2YK0 A;  2E9X C;  3Q2M A;  2NP9 A;  2YU1 A;  1XMO T;  4JEU B;  3N9N A;  4DUZ T;  2WY2 A;  3ZJ2 A;  5JDG A;  1E2A A;  2XUE A;  4I4T E;  4AIU A;  2UXX B;  1YD8 G;  2DHR A;  3CML A;  5L3C B;  3C64 A;  2K24 A;  5LJM A;  2Y48 B;  2WZI A;  2LSG A;  3ONL C;  3PUW F;  3LSV A;  4TX5 A;  1XMQ T;  2ES0 A;  4C90 A;  2XAJ B;  2NWB A;  2AXD S;  5A1L A;  1SHZ C;  4O2A E;  5LNK A;  3W15 B;  3ZT6 A;  3PUS A;  2Q9Q A;  2W2U A;  4P1N A;  2HHH T;  3AVS A;  4XZC A;  4BA9 A;  3SS1 A;  2LHR A;  2P9B A;  4X1K E;  5LHG B;  2BVM A;  3EDU A;  5HYA A;  4LFA T;  3OJA A;  1N34 T;  1BR0 A;  4Z8X A;  3OVU A;  4K0U A;  3Q5X A;  5HXC A;  2WQY A;  4H9N C;  4JI8 T;  5AQS B;  5IWA T;  5HEO A;  2WS3 A;  2XSA A;  4Q25 A;  5JDH A;  4QX7 B;  4AIS A;  1QLB A;  3EHZ A;  4TUY E;  5DQV A;  3ZEF B;  1MMG A;  2LLY A;  5LXT E;  5FP3 A;  3LFM A;  4EYU A;  1D0X A;  2QRX A;  3CX7 B;  3NKZ A;  4B3S T;  4AKL A;  2V7K A;  5HCM A;  1UUR A;  4NXN T;  3C4Z A;  4B3M T;  1D1B A;  4YXD A;  5M4Y A;  2W4X A;  1EZ3 A;  1BR2 A;  2LHN A;  2LSI A;  4EXT A;  4LF9 T;  1FMW A;  2BKN A;  3UU6 A;  5JDM A;  2LOS A;  2A9U A;  1XWM A;  4TV8 E;  4IL4 A;  1D1C A;  3T8O A;  3ZT5 A;  3AE9 A;  4H9Q C;  4NIQ A;  4ZOL E;  3RPU A;  3S4U A;  3VHL A;  4OYJ A;  2H7O A;  3ZCI A;  4DR3 T;  2CBJ A;  4EOZ B;  2DNX A;  2W66 A;  2XAQ B;  1HX8 A;  3KBT A;  2CHN A;  3CX8 B;  4KI0 F;  4IL9 A;  5L4E A;  2YOE A;  2WM9 A;  4IE6 A;  2X0L B;  2BKP A;  4BAY B;  1FJG T;  3KV9 A;  1HS7 A;  3QC9 A;  4AQG A;  3V5U A;  3LBX A;  4UVC B;  3GMI A;  4DR7 T;  1OED A;  4ZS2 A;  2RPA A;  2HPL A;  4PW8 A;  4CQI A;  5CFB A;  5J2T E;  2WU5 A;  4ZI2 D;  3JAE A;  3PUQ A;  5LGN B;  5E0O A;  2MAW A;  4WBO A;  2K48 A;  2KXP B;  3L39 A;  1GQE A;  3P8C D;  4NUV A;  4ZS3 A;  4X1I E;  3RKO A;  5FL1 A;  4HFB A;  1Z8U A;  3HL6 A;  2LT3 A;  3ONX A;  3OPC A;  1SE7 A;  2C0S A;  4ILA A;  4CXX A;  2KT9 A;  3PJA A;  1MMD A;  5JDN A;  3WAJ A;  1AJ3 A;  3AA1 B;  3SFD A;  3AAI A;  2X68 A;  5LG3 A;  4PJM A;  4HFC A;  5JH7 E;  2XQY A;  3PJA J;  2KIN B;  1DU2 A;  4JLE A;  3RIU A;  2WDR A;  3RRW A;  3UU5 A;  4XBF B;  1O3X A;  2VK9 A;  3ETV A;  2XQA A;  4CI3 B;  3AXJ B;  5J1G A;  4K0K T;  5HXH A;  4DMW A;  2DWK A;  4MLK A;  2XSB A;  2EHO B;  4XAX B;  2DCF A;  4F8H A;  4LF4 T;  2WP9 A;  1IBM T;  2XY8 B;  4ZEY A;  2BS4 A;  2D2S A;  2V1D B;  4TWD A;  3FXD B;  5HXR A;  4X20 E;  1XDP A;  4UEM A;  3AEA A;  3NBX X;  5AQV B;  3TLW A;  3ZKR A;  4DR2 T;  4DID B;  2XAF B;  2BVL A;  5FXZ A;  3RI5 A;  2ZM8 A;  4IDO A;  4WNK A;  4JI2 T;  4MFR A;  2WSS V;  4N78 D;  2M6I A;  3ZMS B;  2V6X A;  3FXE B;  3L3P A;  4UV8 B;  3BQL A;  2WAU A;  3JC6 C;  3AE8 A;  2LKG A;  1B7T A;  4WBN E;  2E8I A;  4QXB B;  4ZXL A;  5EK4 A;  2V6Y A;  4EZH A;  3BQK A;  4GKK T;  3LG7 A;  2BG9 A;  4YTM A;  5FL0 A;  3H3M A;  3AE7 A;  5HEU A;  3AB3 B;  3ABV A;  5BR8 T;  2JRK A;  3AXJ A;  3QK6 A;  1S94 A;  2X9H A;  2YDR A;  3LK4 2;  3GWH A;  3EAM A;  3PTR B;  3ZC0 A;  4DR6 T;  3LDQ B;  3PUR A;  3UUN A;  3AAA B;  3H3A A;  3P4W A;  4U7I A;  3EUH A;  4Z91 A;  4ZI2 C;  2ZM2 A;  5JDF A;  3JCF A;  1OED C;  2V26 A;  3P7I A;  4O4H E;  4BJN A;  1M62 A;  3HKD E;  2VB6 A;  2YU2 A;  4TN7 B;  3ZYK A;  2JPF A;  1WR6 A;  2BKO A;  1ZHC A;  1I6Z A;  2CLY B;  1D0Z A;  3P4R A;  4O8S A;  5EK2 A;  3UQ4 A;  4DR5 T;  3ZJ1 A;  2VVS A;  1S35 A;  3SWH A;  2XAS B;  1Y64 B;  1M7K A;  1NEK A;  5L3E B;  3K3N A;  4PJL A;  2YKS A;  3L8R A;  4QH4 A;  3E0Z A;  4OHF A;  5AQO B;  1IJ6 A;  2IC9 A;  2I0M A;  2VVN A;  4TV9 E;  4YSY A;  4DV2 T;  3I9W A;  3FZF B;  3UU8 A;  4TZ4 C;  5J2U E;  4JYA T;  2CXD A;  3PE0 A;  3ZPO A;  2Q9Q C;  5AQP B;  3LBX B;  3NRX A;  4EYY R;  4L0R A;  3K8P C;  1WR0 A;  3ZN0 B;  4HFH A;  3DTO A;  4KX6 A;  3L09 A;  1W09 A;  4GK0 E;  4JI6 T;  2IHR 1;  4U74 A;  3RYF E;  4JEH B;  2CE7 A;  3CK6 A;  2YN6 A;  4EAH A;  2JMK A;  2D9D A;  5HEH A;  4GOU A;  2V7L A;  2HPJ A;  3N2O A;  1Z0P A;  1BR4 A;  5HEJ A;  2C5K T;  5J0Z A;  4CN4 A;  2PBI A;  4PFO A;  2XQ5 A;  2K3W A;  5AQJ B;  2WMO A;  2JQH A;  2N1G A;  2UXN B;  2H3R A;  1U5P A;  2EHO C;  1D1A A;  2D0T A;  2LM9 A;  2QVA A;  4HEA A;  4QH5 A;  1XDO A;  5IYZ E;  2B76 A;  3M3Z B;  4QH1 A;  3AAE B;  4F6R C;  5LG4 A;  3FB2 A;  2V7M A;  3ETU A;  3HI2 A;  1IJ5 A;  3R6N A;  4DV1 T;  4JI7 T;  5JRC B;  2UXD T;  3KVA A;  3CQG B;  5FXV A;  4DND A;  5JDQ A;  2B1E A;  4KHP T;  3Q5W A;  2I59 A;  3D0T A;  3DP7 A;  4YHH T;  2CEA A;  1KEY A;  1R8I A;  1UCU A;  2UUA T;  2E2A A;  3AEF A;  2H7V C;  3C51 A;  2FJD A;  3IEE A;  1KNZ A;  5JTG A;  2V8S V;  4H63 H;  4IE4 A;  3NZP A;  4ZZC A;  2BS2 A;  2V5C A;  5IUX A;  4YTP A;  3OYX A;  3PDY A;  2E9X A;  2JQK A;  2CRB A;  3NWI A;  2Q9Q B;  3QOF A;  3NRY A;  5L3D B;  2W00 A;  4AKR B;  1FEW A;  2QGS A;  1KNP A;  1OXZ A;  2X67 A;  3AE5 A;  2FBW A;  5L47 A;  2M67 A;  3CWZ B;  4H9R C;  2KLQ A;  3UUL A;  3UQ7 A;  2DI4 A;  1N36 T;  3E08 A;  3K3Q C;  4M1P A;  4P0B A;  3ZYL A;  4NPP A;  4B3R T;  3ZMZ B;  3RYC E;  2WU2 A;  2UUC T;  4H9P C;  3HA4 A;  3H37 A;  2XPK A;  1Y01 A;  2IAK A;  4AQF C;  2PJQ A;  3Q5D A;  5FY0 A;  1FIO A;  1LKX A;  2KWI B;  5LBM A;  3QNU A;  4UVA B;  2W61 A;  3ZMU B;  4B6X A;  4JI0 T;  1ZOY A;  5FKY A;  4YJ2 E;  3ZST A;  3CIR A;  3M65 A;  1UX4 A;  2LSK A;  2W63 A;  4G2A A;  3U78 A;  3FZL B;  5LHI B;  4X62 T;  4DV3 T;  3ANW B;  3CKD A;  4X64 T;  2JJ9 A;  4ZI3 D;  2MTQ A;  4QX8 B;  2LJL A;  5ADX L;  5C3J A;  1MMN A;  1ZV4 X;  3CQC B;  2CHO A;  5FMN A;  1T72 A;  2E5V A;  3TLU A;  4DBR A;  1VOM A;  2W62 A;  3QUJ A;  4OX9 T;  2XZE A;  5F3J A;  2KSR A;  4KBM B;  4U33 A;  4GIW A;  4EZ4 A;  4KP3 C;  4X5T A;  4U2Y A;  5F5W A;  2M6B A;  4P0A A;  2AE9 A;  1SA0 E;  2Z6E A;  5EZY E;  1JNZ A;  5IHY A;  3N2G E;  2DL1 A;  5LGU B;  5CJ5 A;  2XQ8 A;  3IHR A;  3Q5E A;  3C50 A;  5FVK A;  4DR1 T;  4B3T T;  2NTY A;  1WRD A;  4PK6 A;  2XTL A;  2XQ6 A;  2LEH A;  3FBL A;  3FZK B;  4LML A;  5H6R B;  3SOL A;  2FJA A;  4OFZ A;  4ASK A;  3HR0 A;  4YJ3 E;  2CWY A;  4I43 B;  1IAP A;  2NW7 A;  5AQL B;  4IDN A;  2D5U A;  2WDQ A;  2WZH A;  4IT4 A;  4O4L E;  4PJJ A;  4HFV A;  2LRL A;  3LJC A;  4TNV A;  4ZZB A;  1KK7 A;  5HWY A;  4JBW F;  3RIF A;  1HFA A;  1U4Q A;  1J1J A;  4BJM A;  3TKL B;  3CX6 B;  3F2E A;  3JAF A;  3KVB A;  1YQ3 A;  4EGW A;  2F4V T;  2X9X A;  4PFP A;  3I9Y A;  3O1J A;  5CA0 E;  3AED A;  5AQM B;  3PUV F;  2A72 A;  2BZB A;  1HF8 A;  4CN6 A;  4TNW A;  4IE0 A;  4DV5 T;  5L3B B;  4JUY A;  5BMV E;  1X79 A;  1IBL T;  3F57 A;  2C5J A;  2JIW A;  3P4Q A;  5JR9 C;  2XM1 A;  2EHO D;  1WFD A;  3I1A A;  5HXE A;  4DVD A;  2K5B B;  3A7M A;  3R84 B;  4AKH A;  3EDV A;  3K3O A;  4YLH A;  2RP4 A;  4YT0 A;  2E9X B;  3LK3 B;  1JNR A;  2XAG B;  5DJQ C;  3PUZ F;  2LKH A;  3RC3 A;  4U31 A;  3N9Q A;  3X1D A;  2E5L T;  4AKG A;  3HKE E;  1VCT A;  4UEL A;  1MNE A;  1QUU A;  4HWH A;  5AQT B;  3KV6 A;  3WAK A;  5L3G B;  1US7 B;  4GYS A;  3VU7 H;  5AQQ B;  2V5D A;  3V5S A;  2PFV A;  4X1Y E;  4KHZ F;  2X0Y A;  3N9M A;  2PTF A;  2CA5 A;  4NUU A;  4U3C A;  1LVF A;  5HAX A;  4JV5 T;  3VRA A;  5HCJ A;  3UU4 A;  2W0G A;  4DR4 T;  3TLV A;  2CLY C;  3KV5 A;  3ZN1 B;  2W67 A;  3CVR A;  4JI5 T;  2YDQ A;  2BBH A;  3UTK A;  3I0O A;  3ONJ A;  4QKN A;  4EB6 E;  4DV0 T;  3WI3 A;  2X9Y A;  3C98 B;  2GK9 A;  3FHN A;  2H88 A;  4CZZ B;  5HEG A;  5ETW A;  4C91 A;  3O4X E;  3RQW A;  1W0B A;  1HG5 A;  2VKJ A;  3PUA A;  4H9S E;  4O2B E;  4JI3 T;  4KMC A;  1G73 A;  2XJ7 A;  2ZLY A;  3G06 A;  3MA9 A;  4OK0 A;  2ZM6 T;  3A5X A;  1N32 T;  4V1A v;  2XQ9 A;  2WBL A;  4HTE A;  4DV7 T;  3RYI E;  3RIU C;  4LF5 T;  1WYC A;  2UXB T;  3AEG A;  2Y6X A;  2BS3 A;  4CI2 B;  5HWX A;  1UGO A;  1J5E T;  2WWV A;  1H7C A;  1L0V A;  2LSJ A;  3ZYM A;  2X51 A;  2N2N A;  3PUG A;  4UVB B;  3EI0 A;  2OV9 A;  4ILB A;  5LOV E;  3PU3 A;  3ZC1 A;  2LE8 A;  4H9O C;  4PJN A;  4U2Z A;  1YKH B;  3J9X 1;  2FJE A;  4LMK A;  1HCI A;  3PUY F;  2X9W A;  3BK9 A;  3KV4 A;  2XM2 A;  4UF0 A;  1WYB A;  5EK3 A;  2VWA A;  3RIA A;  2VKO A;  2YDS A;  4QXH B;  1LRZ A;  4DO0 A;  5FVL A;  4A5X A;  4EEB A;  3AA0 B;  2BBJ A;  5ABG A;  1T8B A;  4UXN B;  5C2T A;  5KX5 E;  3O9X A;  4NXM T;  3AA7 B;  3OBV E;  2CWO A;  2XAH B;  5AQG B;  2OLT A;  5L3F B;  5CGM A;  3UFE A;  3UUM A;  1E1H B;  3JAD A;  5FY1 A;  2VAS A;  1OED B;  3UT5 E;  1XNR T;  4GK5 E;  3AE1 A;  5AQR B;  2IC6 A;  2BDE A;  3AEB A;  4DMV A;  3KBU A;  2FJB A;  3UUX B;  2YIN A;  2NR4 A;  5DQW A;  4X65 T;  2V7J A;  5FY7 A;  3UFG A;  4AXP A;  5KDM C;  3ZT7 A;  1IZN B;  3PV0 F;  4HFI A;  3K1S A;  1FMV A;  1CHU A;  5LGT B;  1G8X A;  3CPZ A;  4YHJ A;  3RC8 A;  2FUP A;  1ZEE A;  2CBI A;  2KWH A;  1OWA A;  5ABF B;  2CXL A;  4UV9 B;  1MND A;  2K9A A;  3B13 A;  3EVY A;  3FZM B;  4PNI A;  2MPK A;  4UIG A;  1W9R A;  4ADZ A;  4AKI A;  2JQQ A;  2PG8 A;  1WLX A;  5GON E;  5LMU T;  3B5M A;  5LP6 E;  4GKJ T;  2NOX A;  2ACZ A;  5JR9 A;  4UF0 B;  2DWG A;  2LM2 A;  3GN5 A;  2WDV A;  2J1D G;  3ESL A;  4TWF A;  3RF1 A;  1LVK A;  2G0U A;  3RHW A;  3SRZ A;  4EED A;  3AA6 B;  4ANJ A;  2X66 A;  5KXJ A;  4AI6 A;  4ILU A;  1NWM X;  2IML A;  3OKQ A;  2ACX A;  4YTN A;  2CCQ A;  2XQ7 A;  2Y8D A;  3UU3 A;  5JRE A;  1YQ4 A;  2Q9Q D;  2LRK A;  3O1H A;  2BG9 E;  4Z90 A;  4CI1 B;  2OA5 A;  1UK5 A;  5JDL A;  5JRC A;  3RX6 A;  3ANW A;  3QB5 A;  4ILC A;  3KIN B;  4IDZ A;  4WW0 A;  5LBQ B;  4L9I A;  1KFY A;  1E7P A;  1T7S A;  2BG9 B;  3DJB A;  3RGL A;  2VQF T;  2V6Y B;  4DV4 T;  2C5I T;  2IUB A;  3RH3 A;  5LYJ E;  3FZH B;  3VKG A;  2CMR A;  3MKD A;  2QA7 A;  3I0Q A;  2VQE T;  3QB5 K;  3P4P A;  4FI5 A;  4IE7 A;  1MIW A;  2R6G F;  4IST A;  5AQU B;  3T1H T;  3AEE A;  3KFW X;  3GN5 B;  2L9Q A;  3A8Y C;  3HKC E;  4YY3 T;  3RLF F;  1KNR A;  1XNQ T;  2J47 A;  3N9L A;  3TLS A;  5LHH B;  1D0Y A;  3MXZ A;  1KF6 A;  1BR1 A;  2J4G A;  2MYS A;  4MHC A;  3OTO T;  4IIJ E;  3CQX C;  4A98 A;  4JI4 T;  5C8Y E;  1CUN A;  4PAG A;  2CM0 A;  5AQN B;  4YSX A;  3ZMT B;  1HNX T;  1HTJ F;  2UU9 T;  2J62 A;  2CPT A;  1OED E;  3C4W A;  4KUM B;  3P4S A;  4QXC B;  2BG9 C;  2H89 A;  5AQI B;  1NAF A;  2A3D A;  5AFU L;  1MIV A;  2CXF A;  5LCY A;  3VRB A;  1HNZ T;  1YKE B;  1V9D A;  3ZCJ A;  4YFS A;  5JQG E;  3EAB A;  3MAC A;  2N9D A;  2WWU A;  4HWF A;  5FYM A;  1VRB A;  3TLT A;  2VUR A;  3MJX A;  3N9P A;  3SFE A;  3AEC A;  4CN1 A;  5KMG P;  1HX1 B;  4DBQ A;  2UXC T;  5DAB A;  1HNW T;  4HGA A;  5L2L A;  4LFB T;  3PU8 A;  2VKH A;  4A97 A;  1MMA A;  2RA1 A;  2I6H A;  1SUM B;  3IA3 A;  2UUB T;  2V7I A;  5L4H A;  2D0U A;  4GYR A;  1WCR A;  3NZQ A;  4ISS A;  4QWN B;  4G63 A;  2SPC A;  2QYW A;  3AE4 A;  3KDS E;  4HFD A;  1T98 A;  1YXR A;  2MOZ A;  3ZMV B;  2A2F X;  1ZKE A;  5F8P A;  2XHE B;  4U7Y A;  4WYV A;  3VR9 A;  4HWD A;  4E7Z A;  2L3L A;  4I0U A;  2HN1 A;  2ZM0 A;  3JC6 D;  2WCA A;  4EV6 A;  2ODV A;  3T1Y T;  4ZHQ E;  1IBK T;  5ABE A;  2ODU A;  2VL0 A;  2NW9 A;  4A56 A;  5AQK B;  4OYK A;  5LB7 B;  2KMF A;  3IBP A;  4ERR A;  5LMN T;  3ZSS A;  4JI1 T;  4IDQ A;  2KND A;  4QHO A;  5FXX A;  4LFC T;  3N5L A;  2NTX A;  2IIU A;  4I55 E;  4J2C A;  5AQH B;  5JVD E;  4EIW A;  2NW8 A;  3N9O A;  4FJO A;  4ZI3 C;  1QSD A;  4L5G A;  2X0H A;  3VR8 A;  1XZY A;  1HG2 A;  3PUX F;  4HFE A;  2XQ3 A;  4I50 E;  2LOP A;  3HKB E;  3GA8 A;  1X9B A;  3Q9D A;  4LF7 T;  5CA1 E;  5FNV E;  5ABH A;  3MZK B;  3RYH E;  2JQ9 A;  3FBZ A;  4WZX A;  2LSY A;  2L8K A;  3AE2 A;  4LF8 T;  1N33 T;  5FXW A;  3E22 E;  4O4J E;  2WB5 A;  3VKH A;  2HH7 A;  2ZMA A;  5H6Q B;  2E9X D;  4CXW A;  1W0A A;  3RKG A;  3ZLI A;  2VKD A;  4E7S A;  4CXY A;  2VL8 A;  5AQF B;  4LMJ A;  4H63 V;  1UUS A;  3LK2 B;  4HKA A;  5LA6 E;  3BQI A;  2IW5 B;  2XQ4 A;  3AE6 A;  2IDO B;  4PK5 A;  4MBQ A;  4HE8 A;  2DLR A;  4UR9 A;  4DV6 T;  4LF6 T;  4HN9 A;  2HN2 A;  3O1I A;  1J5W A;  2WMN A;  4HWC A;  4IHJ E;  4P09 A;  3NVO A;  3AE3 A;  5TAO A;  3UUB A;  4HWI B;  1MIY A;  4COF A;  1HR0 T;  3U3I A;  1VCS A;  3AVR A;  2JMH A;  3C4X A;  5JR9 B;  4AQF A;  3OYZ A;  3F31 A;  4O4I E;  4DUY T;  2KZ7 B;  1YW0 A;  3IF8 B;  3MK7 C;  1NEN A;  4X66 T;  4MAL A;  4IGU A; 
#chains in the Genus database with same CATH homology
 4WZX A;  4U31 A;  3ZT7 A;  2WWV A;  1WR0 A;  3K1S A;  2V6Y B;  2LRK A;  4IT4 A;  2LRL A;  5LB7 B;  3EAB A;  4U2Z A;  4U7I A;  3ZSS A;  4U3C A;  3ZST A;  2WY2 A;  2MPK A;  2RPA A;  4CN1 A;  4ZEY A;  2JQK A;  5FVL A;  2XZE A;  4A5X A;  2CRB A;  4U33 A;  4U2Y A;  4CN4 A;  4CN6 A;  2K3W A;  4NIQ A;  1WCR A;  5CGM A;  2JQH A;  1WFD A;  2A9U A;  2DL1 A;  2V6X A;  3ZT6 A;  2W2U A;  1YXR A;  4P1N A;  5CJ5 A;  5FVK A;  3ZT5 A;  2JQ9 A;  2V6Y A;  2CPT A;  4U7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...