2LRLA

Solution structures of the iia(chitobiose)-hpr complex of the n,n'-diacetylchitobiose branch of the escherichia coli phosphotransferase system
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
103
structure length
103
Chain Sequence
b'AEELEEVVMGLIINSGQARSLAYAALKQAKQGDFAAAKAMMDQSRMALNEAHLVQTKLIEGDAGEGKMKVSLVLVHAQLHLMTSMLARELITELIELHEKLKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N,N'-diacetylchitobiose-specific phosphotransferase enzyme I
publication title Solution Structure of the IIAChitobiose-HPr Complex of the N,N'-Diacetylchitobiose Branch of the Escherichia coli Phosphotransferase System.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 42
structure length 103
sequence length 103
chains with identical sequence B, C
ec nomenclature ec 2.7.1.-:
pdb deposition date 2012-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02255 PTS_IIA PTS system, Lactose/Cellobiose specific IIA subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2lrlA00
4U2YA 3ZT5A 5FVLA 2A9UA 2V6YA 4NIQA 3ZSSA 2JQ9A 2XZEA 3K1SA 2CPTA 2DL1A 4P1NA 2WY2A 4U7IA 3ZT7A 2V6YB 2V6XA 4IT4A 2K3WA 4CN1A 5CJ5A 4U7YA 2JQHA 1YXRA 4A5XA 4U2ZA 4CN6A 2MPKA 1WFDA 5CGMA 4U33A 4WZXA 3EABA 2WWVA 3ZT6A 4ZEYA 1WR0A 2JQKA 3ZSTA 2RPAA 2W2UA 2LRLA 4CN4A 4U3CA 2LRKA 1WCRA 2CRBA 5FVKA 5LB7B 4U31A
chains in the Genus database with same CATH superfamily
3QC9A 2FUPA 1Z8UA 4KUMB 2UXCT 4MALA 3ZYLA 3VRAA 2YDQA 2CBIA 2W62A 3RKGA 2CE7A 4PFOA 1GQEA 1U4QA 5FNVE 2BBHA 2ZM6T 1XDOA 3PDYA 3ZEFB 1IJ5A 1FMWA 4C90A 3P50A 5DJQC 3ZT6A 3JADA 4HWDA 3U78A 2M6IA 1YW0A 2V6YA 1ZHCA 3C98B 4O4IE 1HNZT 3CK6A 3P4SA 5FXZA 1FEWA 3O4XE 3IHRA 1JNRA 2NOXA 2X9HA 2PBIA 4X20E 4AQFC 3EDVA 4B3ST 2Y48B 4A97A 3BQIA 3SFDA 5IYZE 3N2OA 3LK42 2Q9QD 3AEFA 2WU5A 3GN5B 3I9YA 4H63H 2E9XB 1IBLT 2KT9A 4GYSA 3IA3A 2IMLA 1HTJF 4DIDB 3AEGA 5ABFA 2BVMA 4EOZB 2LSJA 4HN9A 4J2CA 1MMNA 2BG9E 2YKSA 2UXNB 1W0AA 2WWVA 2H89A 3HI2A 5EZYE 5FXWA 3AA0B 2LSYA 2QA7A 1QLBA 2AE9A 1LKXA 2IIUA 2ZMAA 4QXCB 3N9OA 4PK5A 5AQJB 3P8CD 4AKRB 5JDNA 4MLKA 3HR0A 2QVAA 1XNQT 3ZMUB 4ZS3A 3AEDA 2DI4A 4PK4A 4QXBB 1US7B 4TWFA 2D9DA 4U31A 4EZ4A 2YEVC 3KINB 1N32T 2VQET 1DU2A 4DBQA 2XAHB 3C50A 4L5GA 4H9NC 5LG3A 4QX7B 1HG2A 2IAKA 2P9BA 3VU7H 3FXEB 3RYFE 3F31A 2W61A 1YQ3A 3CX8B 4LFCT 4ILUA 4JLEA 5HAXA 4UEMA 1MIYA 3QB5K 3CX7B 1W09A 5LGTB 4TX5A 5LMNT 1D0YA 3UULA 5CA0E 3UT5E 5AQTB 3HKEE 3NBXX 5JR9B 2HH7A 2PJQA 3UFGA 3QNUA 4AI6A 1W9RA 2C5JA 3AXJA 2IUBA 4KMCA 1HX8A 4LF4T 3FZKB 2A2FX 4X1KE 2EHOB 1WLXA 4DV6T 4EYUA 5FY7A 5L3GB 4O4LE 2DWKA 5FXXA 3AE2A 2LT3A 2YU2A 4JI0T 3PUGA 5AQVB 5ADXL 1SHZC 2LEHA 2GK9A 4X66T 1LVFA 5LB7B 2HPLA 2DWGA 4LF7T 4BJMA 5JDHA 5HYAA 3FZLB 1M7KA 4IDPA 4YY3T 1T98A 2WDVA 4PJNA 4ZI2D 3C4XA 5J2UE 5JR9A 1MMAA 3K3NA 3MA9A 5J0ZA 4EIWA 2WB5A 3AA6B 1D1AA 2VVNA 1J5ET 4Z91A 4ZS2A 3RI5A 3B13A 1O3XA 5AFUL 4DV3T 3AE6A 3FHNA 2NR4A 3SS1A 5LP6E 3OVUA 2QRXA 4HFVA 5E0OA 5HEOA 4PW8A 3PJAJ 4HEAA 2X51A 2XM2A 1MIWA 4G2AA 4A5XA 2Q9QB 3JC6D 2CLYC 5HXRA 3A7MA 4JI3T 3ZN0B 3LBXB 2ZLYA 4NIQA 3J9X1 4HWHA 2CXDA 2ZM0A 1D1BA 2HPJA 3CQGB 1IBKT 3UUMA 1BR2A 3TLUA 4UVCB 3UQ7A 5JTGA 3PJAA 3CVRA 2ODVA 2XQ7A 3PUQA 2RA1A 3PU3A 3ZCIA 2V1DB 3CPZA 1HS7A 1WR0A 3PV0F 2HHHT 3NRYA 3PUWF 2DHRA 1H7CA 4LF5T 1NAFA 2Q9QA 1LVKA 5FL0A 4DR1T 2VL0A 5HWYA 3N2GE 5AQPB 5BMVE 4CI3B 2V5DA 2D0UA 4B6XA 3GWHA 3PE0A 5KX5E 3UU6A 5AQUB 3G06A 2WMNA 2ES0A 2LJLA 1YXRA 2C0SA 4KX6A 4XZCA 4ISTA 2VKHA 4ZEYA 3AAIA 1SE7A 5TAOA 4YLHA 2LRLA 3M3ZB 3RYHE 2M6BA 5HCMA 3ZMSB 3UTKA 1XZYA 4P1NA 1N34T 1B7TA 4UIGA 2K9AA 2ZM2A 1JNZA 4LF9T 5EK4A 4DR6T 3N9MA 4YSXA 4NXNT 5LCYA 3AVSA 2L8KA 2VWAA 4NUUA 4ZI3D 3MZKB 3AEAA 2J62A 2WY2A 3PUZF 3RRCA 2BG9B 3P7IA 4X62T 4TWDA 2XQAA 1UX4A 2XM1A 3TLSA 4TV8E 3LK2B 3NZPA 2NW9A 3WAKA 3HKDE 3AE7A 4IE0A 3I0QA 4AXPA 2D0TA 3QOFA 2NW7A 4COFA 3FZFB 5HEGA 2YDSA 4YXDA 2NTYA 2D5UA 4K0UA 2YINA 5EK3A 2KWIB 2XAQB 1M62A 3PUYF 2N1GA 4U74A 4DR3T 4QKNA 3WI3A 4DO0A 1OEDC 2EHOD 4HFHA 3C4ZA 5C3JA 3ONXA 5JDFA 3ZSSA 3RGLA 4H9OC 3D0TA 2WCAA 4YT0A 4DMVA 2WBLA 2OA5A 1HX1B 3A5XA 4JEHB 4U72A 2YN6A 2HN2A 4EEDA 1KNRA 5AQNB 2WDQA 3QK6A 3MKDA 3RKOA 4AKLA 4YJ2E 1KFYA 2LKHA 4HWCA 4F8HA 3ZMZB 5L4EA 3V5SA 4JEUB 4ERRA 3RYIE 1IBMT 3EAMA 3GA8A 3OYZA 5FL1A 3KV5A 4OYJA 1X79A 4IT4A 4IHJE 2W67A 2PFVA 3AEEA 2KSRA 3O1HA 3E08A 3Q5XA 3N9LA 2W00A 3S4UA 2LHNA 4Z90A 4ILAA 2UU9T 2KNDA 3FBLA 2WZIA 4MHCA 3E22E 4IDOA 1D0XA 4LMKA 2BS3A 1KK7A 2XASB 3RH3A 4JV5T 3UQ4A 5L3CB 5ABEA 4PK6A 5LXTE 4CXXA 3PUAA 2XAFB 2LM2A 1N33T 1I6ZA 3KVAA 2UUAT 4ISSA 3C4WA 5HEHA 1HFAA 5JH7E 2SPCA 3P4QA 2BZBA 4UF0B 5LHGB 2N9DA 2FJAA 1E1HB 4DNDA 3LDQB 5H6RB 4DV2T 5C2TA 4TNWA 5H6QB 5LOVE 2UXDT 2C5IT 4K0KT 4GIWA 4YTMA 2NWBA 4TNVA 3K3QC 5A1LA 4KHZF 3UUNA 3GN5A 3BK9A 2E9XA 4PJJA 3C51A 3Q2MA 2XQ3A 5JDQA 1WCRA 3R84B 3JAFA 5FVLA 1WRDA 5L3DB 5JRCB 2IC6A 4HFIA 2WP9A 2CA5A 3E0ZA 2XSAA 5LJNA 3KVBA 5JREA 5AQHB 2CWOA 4DMWA 1UURA 3ETUA 2CHNA 4EAHA 2YU1A 3SFEA 1L0VA 2X66A 1ZEEA 4PJLA 5HCJA 1SA0E 1NEKA 3SRZA 2XQ5A 2XQ8A 3RIUA 2VQFT 2XAJB 3UFEA 4ZI7E 5F3JA 5FP3A 5ETWA 3DJBA 1E7PA 1XDPA 2X9XA 3FZMB 4P0BA 2MTQA 3ZMTB 4ZOLE 4A56A 2I0MA 4PNIA 5LMUT 4XBFB 4V1Av 4NXMT 2X0LB 3AECA 5JRCA 2V7KA 4LMJA 4UR9A 1XNRT 4CI1B 3VKGA 1MMDA 4DBRA 2LM9A 2WU2A 1IJ6A 5CJ5A 1J5WA 1WFDA 5LGNB 5L47A 3HL6A 2KINB 3ZSTA 3AAEB 5F8PA 2C5KT 4DR2T 2V8SV 4F6RC 1T72A 3PTRB 1G8XA 5L2LA 3MJXA 4U7IA 5HEUA 1X9BA 2CBJA 3HKBE 2BDEA 3RRWA 3O1JA 4CN6A 3MACA 3Q5EA 2BKOA 3CMLA 4FI5A 2RPAA 4OK0A 2EHOA 5HWXA 5AQOB 5LG4A 3AE4A 2JMHA 1KNPA 4TZ4C 2B76A 3ETVA 2XQ4A 2FJEA 4X1IE 4JI8T 4ZZCA 2ACXA 5AQKB 1G73A 3AAAB 3SOLA 1BR0A 2H7OA 5DQWA 3RHWA 1T7SA 3OTOT 5DABA 3F57A 3T1YT 4KI0F 3U3IA 3VHLA 3F2EA 4GKKT 4AQFA 4KBMB 4DR5T 4IDZA 5LJMA 4P09A 5FYMA 5M4YA 3ZPOA 3OJAA 3MK7C 2JQKA 4LF8T 3NZQA 2XQ9A 2XTLA 4U3CA 3RF1A 4DUZT 1Z0PA 3KDSE 2L9QA 5ABHA 3CKDA 4YTPA 5AQMB 4CN1A 2CEAA 5LHIB 3LJCA 4CQIA 2KXPB 2IDOB 1OEDE 2DNXA 4ZXLA 4B3MT 3TLWA 4H9RC 4X1YE 3LFMA 3K1SA 3P4WA 4Q25A 4WYVA 1FIOA 3ONJA 2JMKA 3VR8A 2DLRA 4AKHA 2VL8A 3H37A 4U33A 4A98A 5AQQB 1VCSA 2IC9A 1V9DA 3LBXA 4Z8XA 5L4HA 4I0UA 5HXEA 4G63A 3HKCE 2YK0A 4YHJA 3OKQA 4MFRA 1SUMB 3H3AA 4O4HE 4DVDA 3OYXA 4ZZBA 4KHPT 5IWAT 3RC3A 4H9QC 5LBQB 2FBWA 2BVLA 4WBOA 3P4PA 4YHHT 4JI4T 3T8OA 4OYKA 4JI1T 3ZJ1A 2FJBA 1UUSA 3EHZA 3PUSA 4KP3C 5C8YE 3UU4A 2E9XC 2WSSV 5LHHB 4HKAA 3EDUA 5HXSA 3FB2A 3KBUA 4FJOA 3RC8A 3IF8B 3GMIA 2ACZA 2LHRA 2NP9A 3B5MA 4YFSA 4PJMA 1OXZA 2V7IA 4UV9B 3N5LA 1XMQT 3N9PA 2I6HA 5JQGE 5J1GA 2WQYA 1BR1A 4EB6E 2WM9A 1KF6A 3CQCB 3CQXC 4CXWA 4EEBA 5JDLA 4QH1A 3RIUC 2XUEA 4TUYE 2BS2A 2E8IA 1T8BA 2K5BB 3W15B 5ABGA 2CLYB 3ESLA 1CHUA 4TWHA 2HN1A 4JI7T 4H9SE 4WBNE 2V7MA 2YDRA 2XAGB 5JVDE 4JUYA 4CI2B 2BG9A 2DL1A 3RIAA 5KDMC 3ZYKA 3ZC1A 5DQVA 4XAXB 4HGAA 2VASA 4BAYB 3VRBA 5IUXA 2MOZA 5AQLB 3UU5A 5KMGP 1S35A 4IE6A 1HNXT 2WWUA 3RIFA 4QH4A 3VKHA 4HTEA 4TN7B 4AQYT 2A9UA 2KMFA 2XZEA 4WW0A 2Y8DA 2M67A 4AKGA 3IBPA 5JR9C 2XPKA 1MNDA 4E7SA 4IE7A 4P0AA 3V5UA 3HA4A 3N9QA 2MYSA 1W0BA 2VK9A 3ZMVB 3PURA 3L8RA 4JI2T 4HFEA 5ABFB 1QSDA 1VCTA 2LSIA 2EHOC 5AQFB 3EI0A 4QHOA 4ILBA 2LE8A 3N9NA 3RYCE 2RP4A 4GOUA 3ZJ2A 2QYWA 3ABVA 4IREA 4ADZA 2E2AA 3R6NA 3DP7A 2CPTA 1MMGA 5AQGB 2BBJA 3O1IA 2NW8A 2E5VA 3PUVF 1XWMA 3UU8A 4JYAT 2W0GA 4QH5A 5GONE 4BJNA 2ODUA 1KNZA 2V7LA 2X0YA 2BS4A 3KV6A 4EXTA 2LLYA 2MPKA 2CMRA 5FY1A 4NPPA 3RQUA 1D1CA 3UUBA 3A8YC 4HFBA 2XHEB 4LFBT 4ANJA 4IL4A 4YTNA 3ZT5A 3BQKA 3AA7B 2W66A 3FBZA 1YKHB 3AVRA 3RLFF 3EVYA 3JCFA 3QUJA 2X68A 3AE1A 4U2ZA 4UVAB 2JJ9A 1J1JA 2CWYA 2OV9A 2QGSA 2Q9QC 4IE4A 5HXHA 4DV7T 4HE8A 3CX6B 4OFZA 4CXYA 4YJ3E 3AA1B 1CUNA 1IZNB 5CFBA 1D0ZA 3AXJB 3KV4A 4B3TT 2IHR1 3B57A 2A3DA 4QXHB 2AXDS 4O4JE 4PFPA 3K3OA 1HR0T 5L3EB 3P4RA 3RQWA 2JQQA 1WYCA 2D2SA 2X67A 4EZHA 2JQHA 4UF0A 3BQLA 3NKZA 4DV4T 1OEDB 3C64A 4IGUA 3TKLB 4DUYT 3EUHA 2X9WA 4UV8B 2UXBT 3H3MA 4EGWA 3I9WA 4HFCA 1UGOA 3VR9A 4AISA 4X5TA 4CZZB 4GK0E 2VKJA 4QX8B 2R6GF 4H9PC 1UK5A 3EABA 1ZP0A 4UVBB 2MBGA 5CA1E 1BR4A 1ZKEA 5LYJE 4YSYA 4PAGA 3AE3A 4H63V 3ZN1B 3K8PC 3OBVE 3IEEA 4I4TE 2WAUA 4TV9E 2FJDA 2Z6EA 3O9XA 2H88A 2XSBA 3AE8A 4JI5T 1LRZA 3AB3B 2N2NA 4HWFA 2YOEA 4O2BE 4I43B 5FMNA 1Y64B 2V26A 3FXDB 3L09A 5JDGA 3CIRA 5JDMA 2KZ7B 3ZC0A 2IW5B 5AQRB 2WZHA 2XQ6A 3WAJA 1OEDA 4E7ZA 3PUXF 2PTFA 4QWNB 2PG8A 4GK5E 2XY8B 2UUBT 3M65A 1XMOT 4DR4T 2G0UA 2ZM8A 2CHOA 4GKJT 3I0OA 3ZYMA 4L9IA 1WR6A 4UXNB 2WS3A 3T1HT 1HG5A 4YSZA 3LK3B 3LG7A 3ZT7A 2UUCT 4IE5A 5KXJA 5FXVA 2Y6XA 2BG9C 3KV9A 2JIWA 4B3RT 4JI6T 3PU8A 1VRBA 4LMLA 3L3PA 3ZLIA 2UXXB 1WYBA 5LGUB 5BR8T 3Q5DA 5AQSB 2OLTA 1YQ4A 1ZV4X 4OX9T 5L3FB 5HXCA 5EK2A 4GYRA 3ZCJA 4BA9A 2KWHA 3I1AA 2CRBA 2XQYA 2LOSA 4LFAT 2V7JA 3AEBA 1HCIA 4IIJE 5FY0A 2E5LT 4I55E 4ZI2C 4L0RA 3TLTA 3FZHB 1I94T 1R8IA 4LF6T 2LKGA 1QUUA 1NWMX 1OWAA 4ZHQE 5LBMA 4X65T 3Q9DA 4HFDA 1EZ3A 5J2TE 4C91A 4ILCA 4DV1T 3QB5A 2CCQA 3ANWB 4MBQA 5CGMA 2A72A 3AE5A 1FJGT 3NWIA 4AQGA 2X9YA 1E2AA 3JC6C 2JPFA 5LA6E 5AQIB 5HEJA 4UELA 3X1DA 1MNEA 2XJ7A 2K3WA 3UU3A 2KLQA 4IDNA 2W63A 4DV5T 3RPUA 2CM0A 5F5WA 4JBWF 2LRKA 4EV6A 1Y01A 1YKEB 2I59A 4IL9A 4O2AE 2LOPA 2E9XD 2VKOA 4U7YA 1FMVA 2K48A 1IAPA 2CXLA 2WMOA 2VKDA 4OHFA 3UUXB 4O8SA 2LSKA 2J47A 4WNKA 3ONLC 2MAWA 4U2YA 2W4XA 3LSVA 1UCUA 3ANWA 3SWHA 1U5PA 3RX6A 2W2UA 4ASKA 1NENA 3OPCA 5CB4E 4M1PA 4X64T 1YD8G 1VOMA 1AJ3A 3L39A 2BKPA 5LNKA 2JQ9A 2X0HA 3JAEA 2H3RA 2V6XA 5FKYA 4IDQA 3Q5WA 3MXZA 4EYYR 1ZOYA 2JRKA 2L3LA 3AE9A 1S94A 1HF8A 2B1EA 1N36T 2BKNA 2VVSA 5L3BB 3NVOA 3TLVA 2WDRA 2H7VC 2K24A 2CXFA 3KBTA 3NRXA 4ZI3C 4N78D 2V5CA 4WZXA 2J4GA 2F4VT 3DTOA 1UX5A 3N2KE 2NTXA 1KEYA 4CN4A 4HWIB 2J1DG 5FVKA 4NUVA 1HNWT 4I50E 2V6YB 4DV0T 4AIUA 3CWZB 4AKIA 4DR7T 2DCFA 5IHYA 3KFWX 1MIVA 2VB6A 2VURA 2LSGA 3ZKRA 3J7Yq
chains in the Genus database with same CATH topology
4U2YA 3ZT5A 5FVLA 2A9UA 2V6YA 4NIQA 3ZSSA 2JQ9A 2XZEA 3K1SA 2CPTA 2DL1A 4P1NA 2WY2A 4U7IA 3ZT7A 2V6YB 2V6XA 4IT4A 2K3WA 4CN1A 5CJ5A 4U7YA 2JQHA 1YXRA 4A5XA 4U2ZA 4CN6A 2MPKA 1WFDA 5CGMA 4U33A 4WZXA 3EABA 2WWVA 3ZT6A 4ZEYA 1WR0A 2JQKA 3ZSTA 2RPAA 2W2UA 2LRLA 4CN4A 4U3CA 2LRKA 1WCRA 2CRBA 5FVKA 5LB7B 4U31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U2Y A;  3ZT5 A;  5FVL A;  2A9U A;  2V6Y A;  4NIQ A;  3ZSS A;  2JQ9 A;  2XZE A;  3K1S A;  2CPT A;  2DL1 A;  4P1N A;  2WY2 A;  4U7I A;  3ZT7 A;  2V6Y B;  2V6X A;  4IT4 A;  2K3W A;  4CN1 A;  5CJ5 A;  4U7Y A;  2JQH A;  1YXR A;  4A5X A;  4U2Z A;  4CN6 A;  2MPK A;  1WFD A;  5CGM A;  4U33 A;  4WZX A;  3EAB A;  2WWV A;  3ZT6 A;  4ZEY A;  1WR0 A;  2JQK A;  3ZST A;  2RPA A;  2W2U A;  2LRL A;  4CN4 A;  4U3C A;  2LRK A;  1WCR A;  2CRB A;  5FVK A;  5LB7 B;  4U31 A; 
#chains in the Genus database with same CATH topology
 3QC9 A;  2FUP A;  1Z8U A;  4KUM B;  2UXC T;  4MAL A;  3ZYL A;  3VRA A;  2YDQ A;  2CBI A;  2W62 A;  3RKG A;  2CE7 A;  4PFO A;  1GQE A;  1U4Q A;  5FNV E;  2BBH A;  2ZM6 T;  1XDO A;  3PDY A;  3ZEF B;  1IJ5 A;  1FMW A;  4C90 A;  3P50 A;  5DJQ C;  3ZT6 A;  3JAD A;  4HWD A;  3U78 A;  2M6I A;  1YW0 A;  2V6Y A;  1ZHC A;  3C98 B;  4O4I E;  1HNZ T;  3CK6 A;  3P4S A;  5FXZ A;  1FEW A;  3O4X E;  3IHR A;  1JNR A;  2NOX A;  2X9H A;  2PBI A;  4X20 E;  4AQF C;  3EDV A;  4B3S T;  2Y48 B;  4A97 A;  3BQI A;  3SFD A;  5IYZ E;  3N2O A;  3LK4 2;  2Q9Q D;  3AEF A;  2WU5 A;  3GN5 B;  3I9Y A;  4H63 H;  2E9X B;  1IBL T;  2KT9 A;  4GYS A;  3IA3 A;  2IML A;  1HTJ F;  4DID B;  3AEG A;  5ABF A;  2BVM A;  4EOZ B;  2LSJ A;  4HN9 A;  4J2C A;  1MMN A;  2BG9 E;  2YKS A;  2UXN B;  1W0A A;  2WWV A;  2H89 A;  3HI2 A;  5EZY E;  5FXW A;  3AA0 B;  2LSY A;  2QA7 A;  1QLB A;  2AE9 A;  1LKX A;  2IIU A;  2ZMA A;  4QXC B;  3N9O A;  4PK5 A;  5AQJ B;  3P8C D;  4AKR B;  5JDN A;  4MLK A;  3HR0 A;  2QVA A;  1XNQ T;  3ZMU B;  4ZS3 A;  3AED A;  2DI4 A;  4PK4 A;  4QXB B;  1US7 B;  4TWF A;  2D9D A;  4U31 A;  4EZ4 A;  2YEV C;  3KIN B;  1N32 T;  2VQE T;  1DU2 A;  4DBQ A;  2XAH B;  3C50 A;  4L5G A;  4H9N C;  5LG3 A;  4QX7 B;  1HG2 A;  2IAK A;  2P9B A;  3VU7 H;  3FXE B;  3RYF E;  3F31 A;  2W61 A;  1YQ3 A;  3CX8 B;  4LFC T;  4ILU A;  4JLE A;  5HAX A;  4UEM A;  1MIY A;  3QB5 K;  3CX7 B;  1W09 A;  5LGT B;  4TX5 A;  5LMN T;  1D0Y A;  3UUL A;  5CA0 E;  3UT5 E;  5AQT B;  3HKE E;  3NBX X;  5JR9 B;  2HH7 A;  2PJQ A;  3UFG A;  3QNU A;  4AI6 A;  1W9R A;  2C5J A;  3AXJ A;  2IUB A;  4KMC A;  1HX8 A;  4LF4 T;  3FZK B;  2A2F X;  4X1K E;  2EHO B;  1WLX A;  4DV6 T;  4EYU A;  5FY7 A;  5L3G B;  4O4L E;  2DWK A;  5FXX A;  3AE2 A;  2LT3 A;  2YU2 A;  4JI0 T;  3PUG A;  5AQV B;  5ADX L;  1SHZ C;  2LEH A;  2GK9 A;  4X66 T;  1LVF A;  5LB7 B;  2HPL A;  2DWG A;  4LF7 T;  4BJM A;  5JDH A;  5HYA A;  3FZL B;  1M7K A;  4IDP A;  4YY3 T;  1T98 A;  2WDV A;  4PJN A;  4ZI2 D;  3C4X A;  5J2U E;  5JR9 A;  1MMA A;  3K3N A;  3MA9 A;  5J0Z A;  4EIW A;  2WB5 A;  3AA6 B;  1D1A A;  2VVN A;  1J5E T;  4Z91 A;  4ZS2 A;  3RI5 A;  3B13 A;  1O3X A;  5AFU L;  4DV3 T;  3AE6 A;  3FHN A;  2NR4 A;  3SS1 A;  5LP6 E;  3OVU A;  2QRX A;  4HFV A;  5E0O A;  5HEO A;  4PW8 A;  3PJA J;  4HEA A;  2X51 A;  2XM2 A;  1MIW A;  4G2A A;  4A5X A;  2Q9Q B;  3JC6 D;  2CLY C;  5HXR A;  3A7M A;  4JI3 T;  3ZN0 B;  3LBX B;  2ZLY A;  4NIQ A;  3J9X 1;  4HWH A;  2CXD A;  2ZM0 A;  1D1B A;  2HPJ A;  3CQG B;  1IBK T;  3UUM A;  1BR2 A;  3TLU A;  4UVC B;  3UQ7 A;  5JTG A;  3PJA A;  3CVR A;  2ODV A;  2XQ7 A;  3PUQ A;  2RA1 A;  3PU3 A;  3ZCI A;  2V1D B;  3CPZ A;  1HS7 A;  1WR0 A;  3PV0 F;  2HHH T;  3NRY A;  3PUW F;  2DHR A;  1H7C A;  4LF5 T;  1NAF A;  2Q9Q A;  1LVK A;  5FL0 A;  4DR1 T;  2VL0 A;  5HWY A;  3N2G E;  5AQP B;  5BMV E;  4CI3 B;  2V5D A;  2D0U A;  4B6X A;  3GWH A;  3PE0 A;  5KX5 E;  3UU6 A;  5AQU B;  3G06 A;  2WMN A;  2ES0 A;  2LJL A;  1YXR A;  2C0S A;  4KX6 A;  4XZC A;  4IST A;  2VKH A;  4ZEY A;  3AAI A;  1SE7 A;  5TAO A;  4YLH A;  2LRL A;  3M3Z B;  3RYH E;  2M6B A;  5HCM A;  3ZMS B;  3UTK A;  1XZY A;  4P1N A;  1N34 T;  1B7T A;  4UIG A;  2K9A A;  2ZM2 A;  1JNZ A;  4LF9 T;  5EK4 A;  4DR6 T;  3N9M A;  4YSX A;  4NXN T;  5LCY A;  3AVS A;  2L8K A;  2VWA A;  4NUU A;  4ZI3 D;  3MZK B;  3AEA A;  2J62 A;  2WY2 A;  3PUZ F;  3RRC A;  2BG9 B;  3P7I A;  4X62 T;  4TWD A;  2XQA A;  1UX4 A;  2XM1 A;  3TLS A;  4TV8 E;  3LK2 B;  3NZP A;  2NW9 A;  3WAK A;  3HKD E;  3AE7 A;  4IE0 A;  3I0Q A;  4AXP A;  2D0T A;  3QOF A;  2NW7 A;  4COF A;  3FZF B;  5HEG A;  2YDS A;  4YXD A;  2NTY A;  2D5U A;  4K0U A;  2YIN A;  5EK3 A;  2KWI B;  2XAQ B;  1M62 A;  3PUY F;  2N1G A;  4U74 A;  4DR3 T;  4QKN A;  3WI3 A;  4DO0 A;  1OED C;  2EHO D;  4HFH A;  3C4Z A;  5C3J A;  3ONX A;  5JDF A;  3ZSS A;  3RGL A;  4H9O C;  3D0T A;  2WCA A;  4YT0 A;  4DMV A;  2WBL A;  2OA5 A;  1HX1 B;  3A5X A;  4JEH B;  4U72 A;  2YN6 A;  2HN2 A;  4EED A;  1KNR A;  5AQN B;  2WDQ A;  3QK6 A;  3MKD A;  3RKO A;  4AKL A;  4YJ2 E;  1KFY A;  2LKH A;  4HWC A;  4F8H A;  3ZMZ B;  5L4E A;  3V5S A;  4JEU B;  4ERR A;  3RYI E;  1IBM T;  3EAM A;  3GA8 A;  3OYZ A;  5FL1 A;  3KV5 A;  4OYJ A;  1X79 A;  4IT4 A;  4IHJ E;  2W67 A;  2PFV A;  3AEE A;  2KSR A;  3O1H A;  3E08 A;  3Q5X A;  3N9L A;  2W00 A;  3S4U A;  2LHN A;  4Z90 A;  4ILA A;  2UU9 T;  2KND A;  3FBL A;  2WZI A;  4MHC A;  3E22 E;  4IDO A;  1D0X A;  4LMK A;  2BS3 A;  1KK7 A;  2XAS B;  3RH3 A;  4JV5 T;  3UQ4 A;  5L3C B;  5ABE A;  4PK6 A;  5LXT E;  4CXX A;  3PUA A;  2XAF B;  2LM2 A;  1N33 T;  1I6Z A;  3KVA A;  2UUA T;  4ISS A;  3C4W A;  5HEH A;  1HFA A;  5JH7 E;  2SPC A;  3P4Q A;  2BZB A;  4UF0 B;  5LHG B;  2N9D A;  2FJA A;  1E1H B;  4DND A;  3LDQ B;  5H6R B;  4DV2 T;  5C2T A;  4TNW A;  5H6Q B;  5LOV E;  2UXD T;  2C5I T;  4K0K T;  4GIW A;  4YTM A;  2NWB A;  4TNV A;  3K3Q C;  5A1L A;  4KHZ F;  3UUN A;  3GN5 A;  3BK9 A;  2E9X A;  4PJJ A;  3C51 A;  3Q2M A;  2XQ3 A;  5JDQ A;  1WCR A;  3R84 B;  3JAF A;  5FVL A;  1WRD A;  5L3D B;  5JRC B;  2IC6 A;  4HFI A;  2WP9 A;  2CA5 A;  3E0Z A;  2XSA A;  5LJN A;  3KVB A;  5JRE A;  5AQH B;  2CWO A;  4DMW A;  1UUR A;  3ETU A;  2CHN A;  4EAH A;  2YU1 A;  3SFE A;  1L0V A;  2X66 A;  1ZEE A;  4PJL A;  5HCJ A;  1SA0 E;  1NEK A;  3SRZ A;  2XQ5 A;  2XQ8 A;  3RIU A;  2VQF T;  2XAJ B;  3UFE A;  4ZI7 E;  5F3J A;  5FP3 A;  5ETW A;  3DJB A;  1E7P A;  1XDP A;  2X9X A;  3FZM B;  4P0B A;  2MTQ A;  3ZMT B;  4ZOL E;  4A56 A;  2I0M A;  4PNI A;  5LMU T;  4XBF B;  4V1A v;  4NXM T;  2X0L B;  3AEC A;  5JRC A;  2V7K A;  4LMJ A;  4UR9 A;  1XNR T;  4CI1 B;  3VKG A;  1MMD A;  4DBR A;  2LM9 A;  2WU2 A;  1IJ6 A;  5CJ5 A;  1J5W A;  1WFD A;  5LGN B;  5L47 A;  3HL6 A;  2KIN B;  3ZST A;  3AAE B;  5F8P A;  2C5K T;  4DR2 T;  2V8S V;  4F6R C;  1T72 A;  3PTR B;  1G8X A;  5L2L A;  3MJX A;  4U7I A;  5HEU A;  1X9B A;  2CBJ A;  3HKB E;  2BDE A;  3RRW A;  3O1J A;  4CN6 A;  3MAC A;  3Q5E A;  2BKO A;  3CML A;  4FI5 A;  2RPA A;  4OK0 A;  2EHO A;  5HWX A;  5AQO B;  5LG4 A;  3AE4 A;  2JMH A;  1KNP A;  4TZ4 C;  2B76 A;  3ETV A;  2XQ4 A;  2FJE A;  4X1I E;  4JI8 T;  4ZZC A;  2ACX A;  5AQK B;  1G73 A;  3AAA B;  3SOL A;  1BR0 A;  2H7O A;  5DQW A;  3RHW A;  1T7S A;  3OTO T;  5DAB A;  3F57 A;  3T1Y T;  4KI0 F;  3U3I A;  3VHL A;  3F2E A;  4GKK T;  4AQF A;  4KBM B;  4DR5 T;  4IDZ A;  5LJM A;  4P09 A;  5FYM A;  5M4Y A;  3ZPO A;  3OJA A;  3MK7 C;  2JQK A;  4LF8 T;  3NZQ A;  2XQ9 A;  2XTL A;  4U3C A;  3RF1 A;  4DUZ T;  1Z0P A;  3KDS E;  2L9Q A;  5ABH A;  3CKD A;  4YTP A;  5AQM B;  4CN1 A;  2CEA A;  5LHI B;  3LJC A;  4CQI A;  2KXP B;  2IDO B;  1OED E;  2DNX A;  4ZXL A;  4B3M T;  3TLW A;  4H9R C;  4X1Y E;  3LFM A;  3K1S A;  3P4W A;  4Q25 A;  4WYV A;  1FIO A;  3ONJ A;  2JMK A;  3VR8 A;  2DLR A;  4AKH A;  2VL8 A;  3H37 A;  4U33 A;  4A98 A;  5AQQ B;  1VCS A;  2IC9 A;  1V9D A;  3LBX A;  4Z8X A;  5L4H A;  4I0U A;  5HXE A;  4G63 A;  3HKC E;  2YK0 A;  4YHJ A;  3OKQ A;  4MFR A;  1SUM B;  3H3A A;  4O4H E;  4DVD A;  3OYX A;  4ZZB A;  4KHP T;  5IWA T;  3RC3 A;  4H9Q C;  5LBQ B;  2FBW A;  2BVL A;  4WBO A;  3P4P A;  4YHH T;  4JI4 T;  3T8O A;  4OYK A;  4JI1 T;  3ZJ1 A;  2FJB A;  1UUS A;  3EHZ A;  3PUS A;  4KP3 C;  5C8Y E;  3UU4 A;  2E9X C;  2WSS V;  5LHH B;  4HKA A;  3EDU A;  5HXS A;  3FB2 A;  3KBU A;  4FJO A;  3RC8 A;  3IF8 B;  3GMI A;  2ACZ A;  2LHR A;  2NP9 A;  3B5M A;  4YFS A;  4PJM A;  1OXZ A;  2V7I A;  4UV9 B;  3N5L A;  1XMQ T;  3N9P A;  2I6H A;  5JQG E;  5J1G A;  2WQY A;  1BR1 A;  4EB6 E;  2WM9 A;  1KF6 A;  3CQC B;  3CQX C;  4CXW A;  4EEB A;  5JDL A;  4QH1 A;  3RIU C;  2XUE A;  4TUY E;  2BS2 A;  2E8I A;  1T8B A;  2K5B B;  3W15 B;  5ABG A;  2CLY B;  3ESL A;  1CHU A;  4TWH A;  2HN1 A;  4JI7 T;  4H9S E;  4WBN E;  2V7M A;  2YDR A;  2XAG B;  5JVD E;  4JUY A;  4CI2 B;  2BG9 A;  2DL1 A;  3RIA A;  5KDM C;  3ZYK A;  3ZC1 A;  5DQV A;  4XAX B;  4HGA A;  2VAS A;  4BAY B;  3VRB A;  5IUX A;  2MOZ A;  5AQL B;  3UU5 A;  5KMG P;  1S35 A;  4IE6 A;  1HNX T;  2WWU A;  3RIF A;  4QH4 A;  3VKH A;  4HTE A;  4TN7 B;  4AQY T;  2A9U A;  2KMF A;  2XZE A;  4WW0 A;  2Y8D A;  2M67 A;  4AKG A;  3IBP A;  5JR9 C;  2XPK A;  1MND A;  4E7S A;  4IE7 A;  4P0A A;  3V5U A;  3HA4 A;  3N9Q A;  2MYS A;  1W0B A;  2VK9 A;  3ZMV B;  3PUR A;  3L8R A;  4JI2 T;  4HFE A;  5ABF B;  1QSD A;  1VCT A;  2LSI A;  2EHO C;  5AQF B;  3EI0 A;  4QHO A;  4ILB A;  2LE8 A;  3N9N A;  3RYC E;  2RP4 A;  4GOU A;  3ZJ2 A;  2QYW A;  3ABV A;  4IRE A;  4ADZ A;  2E2A A;  3R6N A;  3DP7 A;  2CPT A;  1MMG A;  5AQG B;  2BBJ A;  3O1I A;  2NW8 A;  2E5V A;  3PUV F;  1XWM A;  3UU8 A;  4JYA T;  2W0G A;  4QH5 A;  5GON E;  4BJN A;  2ODU A;  1KNZ A;  2V7L A;  2X0Y A;  2BS4 A;  3KV6 A;  4EXT A;  2LLY A;  2MPK A;  2CMR A;  5FY1 A;  4NPP A;  3RQU A;  1D1C A;  3UUB A;  3A8Y C;  4HFB A;  2XHE B;  4LFB T;  4ANJ A;  4IL4 A;  4YTN A;  3ZT5 A;  3BQK A;  3AA7 B;  2W66 A;  3FBZ A;  1YKH B;  3AVR A;  3RLF F;  3EVY A;  3JCF A;  3QUJ A;  2X68 A;  3AE1 A;  4U2Z A;  4UVA B;  2JJ9 A;  1J1J A;  2CWY A;  2OV9 A;  2QGS A;  2Q9Q C;  4IE4 A;  5HXH A;  4DV7 T;  4HE8 A;  3CX6 B;  4OFZ A;  4CXY A;  4YJ3 E;  3AA1 B;  1CUN A;  1IZN B;  5CFB A;  1D0Z A;  3AXJ B;  3KV4 A;  4B3T T;  2IHR 1;  3B57 A;  2A3D A;  4QXH B;  2AXD S;  4O4J E;  4PFP A;  3K3O A;  1HR0 T;  5L3E B;  3P4R A;  3RQW A;  2JQQ A;  1WYC A;  2D2S A;  2X67 A;  4EZH A;  2JQH A;  4UF0 A;  3BQL A;  3NKZ A;  4DV4 T;  1OED B;  3C64 A;  4IGU A;  3TKL B;  4DUY T;  3EUH A;  2X9W A;  4UV8 B;  2UXB T;  3H3M A;  4EGW A;  3I9W A;  4HFC A;  1UGO A;  3VR9 A;  4AIS A;  4X5T A;  4CZZ B;  4GK0 E;  2VKJ A;  4QX8 B;  2R6G F;  4H9P C;  1UK5 A;  3EAB A;  1ZP0 A;  4UVB B;  2MBG A;  5CA1 E;  1BR4 A;  1ZKE A;  5LYJ E;  4YSY A;  4PAG A;  3AE3 A;  4H63 V;  3ZN1 B;  3K8P C;  3OBV E;  3IEE A;  4I4T E;  2WAU A;  4TV9 E;  2FJD A;  2Z6E A;  3O9X A;  2H88 A;  2XSB A;  3AE8 A;  4JI5 T;  1LRZ A;  3AB3 B;  2N2N A;  4HWF A;  2YOE A;  4O2B E;  4I43 B;  5FMN A;  1Y64 B;  2V26 A;  3FXD B;  3L09 A;  5JDG A;  3CIR A;  5JDM A;  2KZ7 B;  3ZC0 A;  2IW5 B;  5AQR B;  2WZH A;  2XQ6 A;  3WAJ A;  1OED A;  4E7Z A;  3PUX F;  2PTF A;  4QWN B;  2PG8 A;  4GK5 E;  2XY8 B;  2UUB T;  3M65 A;  1XMO T;  4DR4 T;  2G0U A;  2ZM8 A;  2CHO A;  4GKJ T;  3I0O A;  3ZYM A;  4L9I A;  1WR6 A;  4UXN B;  2WS3 A;  3T1H T;  1HG5 A;  4YSZ A;  3LK3 B;  3LG7 A;  3ZT7 A;  2UUC T;  4IE5 A;  5KXJ A;  5FXV A;  2Y6X A;  2BG9 C;  3KV9 A;  2JIW A;  4B3R T;  4JI6 T;  3PU8 A;  1VRB A;  4LML A;  3L3P A;  3ZLI A;  2UXX B;  1WYB A;  5LGU B;  5BR8 T;  3Q5D A;  5AQS B;  2OLT A;  1YQ4 A;  1ZV4 X;  4OX9 T;  5L3F B;  5HXC A;  5EK2 A;  4GYR A;  3ZCJ A;  4BA9 A;  2KWH A;  3I1A A;  2CRB A;  2XQY A;  2LOS A;  4LFA T;  2V7J A;  3AEB A;  1HCI A;  4IIJ E;  5FY0 A;  2E5L T;  4I55 E;  4ZI2 C;  4L0R A;  3TLT A;  3FZH B;  1I94 T;  1R8I A;  4LF6 T;  2LKG A;  1QUU A;  1NWM X;  1OWA A;  4ZHQ E;  5LBM A;  4X65 T;  3Q9D A;  4HFD A;  1EZ3 A;  5J2T E;  4C91 A;  4ILC A;  4DV1 T;  3QB5 A;  2CCQ A;  3ANW B;  4MBQ A;  5CGM A;  2A72 A;  3AE5 A;  1FJG T;  3NWI A;  4AQG A;  2X9Y A;  1E2A A;  3JC6 C;  2JPF A;  5LA6 E;  5AQI B;  5HEJ A;  4UEL A;  3X1D A;  1MNE A;  2XJ7 A;  2K3W A;  3UU3 A;  2KLQ A;  4IDN A;  2W63 A;  4DV5 T;  3RPU A;  2CM0 A;  5F5W A;  4JBW F;  2LRK A;  4EV6 A;  1Y01 A;  1YKE B;  2I59 A;  4IL9 A;  4O2A E;  2LOP A;  2E9X D;  2VKO A;  4U7Y A;  1FMV A;  2K48 A;  1IAP A;  2CXL A;  2WMO A;  2VKD A;  4OHF A;  3UUX B;  4O8S A;  2LSK A;  2J47 A;  4WNK A;  3ONL C;  2MAW A;  4U2Y A;  2W4X A;  3LSV A;  1UCU A;  3ANW A;  3SWH A;  1U5P A;  3RX6 A;  2W2U A;  4ASK A;  1NEN A;  3OPC A;  5CB4 E;  4M1P A;  4X64 T;  1YD8 G;  1VOM A;  1AJ3 A;  3L39 A;  2BKP A;  5LNK A;  2JQ9 A;  2X0H A;  3JAE A;  2H3R A;  2V6X A;  5FKY A;  4IDQ A;  3Q5W A;  3MXZ A;  4EYY R;  1ZOY A;  2JRK A;  2L3L A;  3AE9 A;  1S94 A;  1HF8 A;  2B1E A;  1N36 T;  2BKN A;  2VVS A;  5L3B B;  3NVO A;  3TLV A;  2WDR A;  2H7V C;  2K24 A;  2CXF A;  3KBT A;  3NRX A;  4ZI3 C;  4N78 D;  2V5C A;  4WZX A;  2J4G A;  2F4V T;  3DTO A;  1UX5 A;  3N2K E;  2NTX A;  1KEY A;  4CN4 A;  4HWI B;  2J1D G;  5FVK A;  4NUV A;  1HNW T;  4I50 E;  2V6Y B;  4DV0 T;  4AIU A;  3CWZ B;  4AKI A;  4DR7 T;  2DCF A;  5IHY A;  3KFW X;  1MIV A;  2VB6 A;  2VUR A;  2LSG A;  3ZKR A;  3J7Y q; 
#chains in the Genus database with same CATH homology
 4U2Y A;  3ZT5 A;  5FVL A;  2A9U A;  2V6Y A;  4NIQ A;  3ZSS A;  2JQ9 A;  2XZE A;  3K1S A;  2CPT A;  2DL1 A;  4P1N A;  2WY2 A;  4U7I A;  3ZT7 A;  2V6Y B;  2V6X A;  4IT4 A;  2K3W A;  4CN1 A;  5CJ5 A;  4U7Y A;  2JQH A;  1YXR A;  4A5X A;  4U2Z A;  4CN6 A;  2MPK A;  1WFD A;  5CGM A;  4U33 A;  4WZX A;  3EAB A;  2WWV A;  3ZT6 A;  4ZEY A;  1WR0 A;  2JQK A;  3ZST A;  2RPA A;  2W2U A;  2LRL A;  4CN4 A;  4U3C A;  2LRK A;  1WCR A;  2CRB A;  5FVK A;  5LB7 B;  4U31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...