2LRLA

Solution structures of the iia(chitobiose)-hpr complex of the n,n'-diacetylchitobiose branch of the escherichia coli phosphotransferase system
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
103
structure length
103
Chain Sequence
AEELEEVVMGLIINSGQARSLAYAALKQAKQGDFAAAKAMMDQSRMALNEAHLVQTKLIEGDAGEGKMKVSLVLVHAQLHLMTSMLARELITELIELHEKLKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the IIAChitobiose-HPr Complex of the N,N'-Diacetylchitobiose Branch of the Escherichia coli Phosphotransferase System.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords N,N'-diacetylchitobiose-specific phosphotransferase enzyme I
total genus 42
structure length 103
sequence length 103
chains with identical sequence B, C
ec nomenclature ec 2.7.1.-:
pdb deposition date 2012-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02255 PTS_IIA PTS system, Lactose/Cellobiose specific IIA subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2lrlA00
2V6YA 4U31A 5FVLA 2RPAA 2WWVA 2W2UA 1WCRA 4CN1A 5FVKA 3EABA 4U7IA 2DL1A 2V6XA 2LRLA 1YXRA 1WFDA 4CN4A 2XZEA 4U2ZA 3K1SA 3ZT7A 4CN6A 3ZSTA 3ZT6A 3ZSSA 3ZT5A 1WR0A 5CJ5A 2V6YB 4A5XA 4U2YA 4IT4A 2WY2A 4P1NA 4ZEYA 5CGMA 2CPTA 4U7YA 2CRBA 4U33A 4NIQA 2MPKA 2JQ9A 2LRKA 4U3CA 2JQKA 5LB7B 2K3WA 2A9UA 4WZXA 2JQHA
chains in the Genus database with same CATH superfamily
1KF6A 3CWZB 3BK9A 2YKSA 3AECA 4UVAB 4LF8T 3UT5E 3U3IA 3ZMVB 4P0AA 5LBQB 5KX5E 2V6XA 4O4JE 2X0YA 3FZMB 2CWYA 1NENA 4Z90A 3ZSTA 4F8HA 1IBKT 2JIWA 5KMGP 5AQFB 4PK6A 3AEAA 3KV4A 1LKXA 2AE9A 4PW8A 5ABFB 5AQUB 1UUSA 2FJAA 2UXXB 2BG9E 2W0GA 2XSBA 4QXBB 3VHLA 3ZYKA 2B76A 1WYBA 2CEAA 1BR2A 2L8KA 3NWIA 3VR8A 4EGWA 2FJEA 2ZM6T 5HEJA 2WY2A 3VKHA 2CWOA 5HXEA 2E9XD 3RYHE 2AXDS 3EVYA 4UVCB 4JI5T 3VRBA 2BS4A 1HF8A 3ZT5A 1FMVA 4ILBA 2XUEA 3ZN0B 3HKDE 4JI7T 2WMNA 1LRZA 3KV6A 4JI2T 2W00A 3ZC1A 4JEHB 4HFHA 5L2LA 3IEEA 4G2AA 4IREA 3ANWA 4YJ3E 3J7Yq 2V6YA 4PFPA 2WWVA 1MIWA 2WP9A 1FMWA 1H7CA 3ETUA 3CQGB 3EABA 5EZYE 3NZPA 2I0MA 4JEUB 4MALA 5FVKA 4ZZCA 4ASKA 3C50A 3CQXC 2VVSA 4GK0E 4H9SE 3T8OA 4ADZA 4C90A 4DV2T 4AKGA 2H89A 3AAIA 3GA8A 5LG4A 4WW0A 3ZPOA 3LBXA 2IUBA 2WMOA 3C4WA 3ZMTB 2G0UA 3AXJA 3LBXB 2NW9A 3H3MA 3ZLIA 5CA0E 3EDVA 3FBZA 1W09A 3HKCE 5F5WA 3V5SA 3ZYLA 1YD8G 2KSRA 2LKGA 2WS3A 4ZS3A 3CPZA 5AQGB 5HXCA 2MBGA 4ZEYA 5ABGA 4EXTA 3A5XA 5FL1A 2C5IT 5LCYA 4U3CA 3R84B 4ZHQE 3UU4A 4KX6A 2JQQA 4ERRA 2CM0A 2M67A 2Q9QC 2XQ7A 4H63H 4LMKA 5EK2A 3PE0A 1XMQT 2PTFA 1KK7A 1CHUA 2E5VA 2YU2A 3HKEE 2NTXA 3DP7A 1MMDA 2EHOB 3HL6A 3N2KE 5HAXA 3UULA 4YFSA 4YSZA 2J1DG 2JPFA 2BBHA 2YDRA 4UF0B 3TLSA 4K0KT 2Y8DA 4EYUA 1IAPA 3PTRB 4LFCT 5AQJB 3GMIA 4ZZBA 2H7VC 4OFZA 3KVBA 2XQ5A 2UXCT 3JC6D 3TLWA 3LJCA 4ZI3D 3AE7A 3AE9A 4I43B 2M6IA 1JNRA 2LSYA 2Y6XA 3UU5A 4A56A 4IL4A 3AA7B 3VR9A 1BR1A 4OK0A 1KFYA 5C3JA 3PUXF 2XQ6A 3RIFA 4TWHA 4M1PA 2Q9QB 2XPKA 3CQCB 3KDSE 3AA6B 2XM1A 1NAFA 2ODUA 2YOEA 3N9LA 4H63V 4HWCA 4I50E 2JQKA 2QYWA 2X9HA 4L0RA 3LK3B 5HEHA 5L3DB 1XWMA 2WWUA 4PJJA 2XAHB 4DR5T 4ANJA 2FJBA 1ZKEA 3RQWA 2X51A 4TWDA 5C2TA 2NW7A 5JDFA 2ZM8A 4IDNA 3SOLA 3K1SA 4ZI3C 5ADXL 3ZC0A 2R6GF 1T98A 3UQ4A 4AISA 5AQIB 3ONXA 1WR0A 5LGNB 3RI5A 1D1BA 2MYSA 4DR2T 4IE0A 2V6YB 2CLYB 2LKHA 4P09A 3N2OA 4I0UA 2W67A 4X1KE 5HYAA 2NOXA 3OBVE 2CXFA 4JLEA 3QNUA 5HXSA 2NTYA 4X1IE 4DV5T 4TN7B 4X5TA 1HR0T 2DWKA 3GWHA 5JDGA 2LSKA 5JDNA 4B3ST 1HX8A 2XAFB 2H7OA 3LK42 5LHIB 2XQ8A 3IBPA 3OYXA 1E2AA 3QB5A 4OYJA 2CXLA 1J5ET 1V9DA 3K3NA 2BKOA 3PUYF 5L4EA 1VOMA 2PG8A 2ZM2A 2BS3A 4H9OC 5DABA 5HEGA 2C5KT 1VRBA 1QUUA 2DL1A 3B57A 1SUMB 3DTOA 5HCMA 2IC6A 1WFDA 2LHRA 2MTQA 3WAKA 4H9PC 1FJGT 3NKZA 1XNRT 1YW0A 1IJ5A 2H3RA 4DIDB 5CA1E 4CI3B 1QLBA 1YKHB 3J9X1 4JI6T 5CJ5A 1N32T 1N34T 4NUVA 2X9XA 3EUHA 5FXVA 4A5XA 3KVAA 2WM9A 2KWHA 4UF0A 3UTKA 3K8PC 1KNZA 5HWXA 5M4YA 5HXHA 2CMRA 2OV9A 3F57A 2OA5A 4AQFC 1OXZA 2WSSV 2UXDT 3ABVA 3CX8B 5AQLB 2VVNA 4ILAA 1BR4A 4QKNA 2I6HA 4ILUA 1D0XA 1WLXA 4HWIB 3IF8B 3UUMA 2WDQA 1HX1B 4O2AE 2JRKA 4DMWA 5L4HA 3TLTA 2LM2A 1UURA 1M7KA 4CN1A 3HR0A 3AAAB 3K3OA 1MMAA 2XM2A 3LG7A 4TV9E 2V7LA 4PK5A 4U7IA 2D5UA 2VKDA 3FBLA 3KFWX 4CQIA 4LF7T 2SPCA 3RLFF 4KMCA 1R8IA 1W0BA 1MIVA 4EEBA 2NWBA 2LOPA 3ZCIA 2UU9T 2JMHA 3L8RA 3AB3B 4ZI2C 3GN5B 4GYSA 1UCUA 2LJLA 2PFVA 5AQKB 4A97A 1HNWT 1G73A 1IBLT 5ABHA 3MXZA 4U2YA 4IE7A 1O3XA 4IL9A 4P0BA 3FXDB 3V5UA 4BAYB 2A72A 5JDLA 1XMOT 3N5LA 1HTJF 4O4LE 3CX7B 5FMNA 3E22E 3PUQA 4IIJE 4UELA 5FNVE 3N9QA 3AE6A 5FY1A 1NWMX 2VL0A 2CLYC 3MACA 3C98B 3ZMUB 4QXHB 2E2AA 2XQYA 1WRDA 3ZN1B 2W66A 3AEFA 1US7B 4KBMB 3E0ZA 2KWIB 3UU8A 4DUZT 2Z6EA 3HA4A 5HXRA 4EAHA 4YHHT 5FYMA 1WCRA 1Y64B 2VB6A 3UU3A 3IHRA 5AQMB 5EK4A 5ABEA 3Q5WA 4IDQA 3SS1A 5LXTE 2RA1A 3I9YA 5JR9B 4U2ZA 4WBOA 3P4PA 3LSVA 1BR0A 3C51A 1ZOYA 2KNDA 2BZBA 3MJXA 4L9IA 4DUYT 3I0QA 4DV6T 1HFAA 3Q2MA 3N9PA 4AKRB 3JCFA 3RKGA 4DV3T 1IZNB 3NBXX 1U4QA 2E9XC 2XAGB 2VQFT 2HHHT 4V1Av 3P7IA 4X20E 1W0AA 3PUWF 5FL0A 1MMNA 3RYIE 4EV6A 1B7TA 4HWFA 4TUYE 5H6RB 2X0HA 3ZEFB 5ABFA 4CI2B 4QXCB 4KI0F 2LSGA 3FB2A 3FZHB 3ZMSB 3P4WA 2L9QA 4LMJA 2NP9A 3C4XA 4EOZB 1MNEA 3W15B 3FXEB 4I55E 5FVLA 4TZ4C 4AKHA 4ISTA 4EIWA 2ES0A 3Q5XA 2HPLA 4KHZF 2IW5B 2UUBT 4HFDA 5LP6E 4QH1A 2W61A 2Y48B 4ZI2D 3ZT6A 5LGUB 2LHNA 4JV5T 5L3CB 2X9WA 4L5GA 4TNWA 3O1JA 4HGAA 4QH4A 2XJ7A 3RF1A 4YXDA 3T1HT 4X62T 1Z0PA 2IAKA 3M65A 1W9RA 4PNIA 4HEAA 5EK3A 3JAFA 5KXJA 4GKKT 2XAJB 2XQ3A 3NZQA 4U74A 4HFVA 2CCQA 2CA5A 3OVUA 5J0ZA 3AXJB 2WB5A 4YTMA 5DQWA 4AXPA 2KMFA 4PK4A 4YHJA 4BA9A 2W63A 5AQHB 2X67A 3QUJA 2EHOD 5AQTB 2V7IA 4QX8B 3A7MA 3RIUC 2QGSA 1OWAA 3KV5A 3GN5A 4DR4T 1XDPA 2FBWA 2VURA 3WAJA 2WU5A 3K3QC 2H88A 4HKAA 4X1YE 3F2EA 5AQNB 2RPAA 3AVSA 2DWGA 5BMVE 2VK9A 3CK6A 3LDQB 4UIGA 2HN1A 2W62A 4MFRA 2ACXA 2N2NA 3EI0A 5JR9C 5LYJE 5J2TE 2XZEA 3CKDA 2EHOA 1D0ZA 1WR6A 2LE8A 5JDQA 4CXYA 3Q9DA 1X9BA 3PV0F 4J2CA 1MIYA 4LFBT 3MK7C 3RH3A 4QX7B 1QSDA 2BKNA 4AKLA 3SFEA 4H9RC 2IDOB 3CX6B 1I6ZA 2J47A 3AEDA 3X1DA 5J1GA 2KLQA 2K9AA 3Q5DA 4U33A 4BJMA 2MPKA 3MZKB 4Z91A 2VWAA 4MHCA 4K0UA 3PURA 4HN9A 4O4HE 3PJAJ 1N33T 5HCJA 2V1DB 2A9UA 2C0SA 2JMKA 5CFBA 3OPCA 4GOUA 5JDHA 4IE4A 4WYVA 2BG9A 5F3JA 2CBJA 1U5PA 3P8CD 5LHGB 1IBMT 3C64A 4PJNA 1YXRA 4YTNA 5KDMC 1IJ6A 3ZKRA 3TLVA 3AA0B 3ZT7A 3D0TA 4X66T 3CVRA 3OTOT 4ZI7E 4LF9T 2V5CA 3ZSSA 3RPUA 2CBIA 3NVOA 1D1AA 2XQ4A 4FJOA 2P9BA 1SHZC 4UV9B 2V5DA 4OX9T 3PU8A 1S35A 1DU2A 2V26A 1UX4A 3ZJ1A 3AE4A 2CE7A 1ZV4X 3OKQA 4O4IE 4P1NA 4UVBB 1FIOA 2CPTA 3O1HA 4E7ZA 3ANWB 1HNXT 3N2GE 1Y01A 4DBQA 3KINB 2Q9QD 3VRAA 3UQ7A 3O1IA 4FI5A 4HFEA 5C8YE 3QC9A 4JYAT 3QB5K 4H9NC 3O4XE 2GK9A 3AE3A 5FXXA 1L0VA 4EZHA 2WBLA 1SE7A 5AQRB 3TLUA 4G63A 3U78A 2K5BB 2W2UA 4GKJT 4XZCA 3AE1A 2HN2A 5L47A 2PBIA 4IDOA 4PFOA 2J62A 2LRLA 4Z8XA 5GONE 3RQUA 2X0LB 3PUSA 2WZIA 3E08A 5AQSB 4ZXLA 1N36T 4JI0T 2BS2A 4ISSA 4AIUA 3MA9A 4BJNA 3Q5EA 3A8YC 3FHNA 1HG5A 5ETWA 5JTGA 5JRCA 2DNXA 2BKPA 4CI1B 5JRCB 2XSAA 2BDEA 4DV4T 5IUXA 5JREA 4CXWA 2KINB 1GQEA 4KUMB 4YSXA 3UFEA 3S4UA 1G8XA 2ZLYA 3SRZA 4U7YA 2IMLA 2LOSA 2MAWA 3AE5A 4HWDA 5E0OA 2I59A 4IE6A 2E9XA 2M6BA 1OEDB 2VKHA 5LBMA 3KV9A 2E9XB 1EZ3A 2V7JA 3FZFB 2WU2A 4UV8B 5LA6E 3RRCA 3P4RA 4XAXB 2ACZA 2JQHA 2K24A 2XQAA 2VKJA 1J1JA 1T7SA 2WDRA 5JVDE 2XQ9A 3NRYA 4NUUA 3I9WA 4PAGA 1D0YA 3RC8A 4TNVA 5L3BB 4IDPA 3BQIA 3RKOA 4DR6T 2D0TA 3VKGA 2IIUA 2LSIA 4CN4A 4X65T 2LM9A 2K48A 4X64T 3L39A 4GK5E 4IGUA 4ZS2A 2KT9A 4NXMT 3G06A 3PDYA 3TKLB 3HKBE 3NRXA 1UX5A 3FZLB 2WCAA 3BQLA 2BBJA 5AQPB 4DV1T 2BG9B 1XNQT 1J5WA 2YINA 3SFDA 3RIAA 3EAMA 2VQET 1D1CA 2CHOA 2DI4A 2YN6A 4QH5A 4HTEA 1M62A 3FZKB 2ODVA 4O8SA 5HEUA 1XZYA 2IC9A 1YKEB 2YDSA 5HWYA 4DV0T 4LF5T 2A3DA 2K3WA 2NW8A 3QOFA 2DHRA 3AEEA 4IDZA 4NPPA 1Z8UA 4MLKA 3LFMA 4JUYA 5TAOA 2J4GA 4GIWA 2YK0A 3PUZF 3RYFE 3RRWA 1E7PA 1I94T 2W4XA 3ZMZB 5LNKA 3N9MA 2MOZA 3ESLA 3B5MA 5LG3A 4B3TT 2DLRA 3EHZA 3ZCJA 3AVRA 2ZM0A 3DJBA 3CIRA 3SWHA 1CUNA 1KEYA 2Q9QA 4DV7T 4TX5A 1HNZT 2D9DA 3OYZA 5LOVE 5L3EB 1XDOA 4E7SA 2QVAA 4YSYA 5L3FB 3T1YT 1YQ4A 1LVFA 3AAEB 4OYKA 5FP3A 2HPJA 4F6RC 4LF6T 3VU7H 1E1HB 2CRBA 3AA1B 3P50A 4UEMA 5AFUL 2F4VT 1OEDC 4WZXA 4OHFA 3UU6A 5LHHB 1LVKA 1JNZA 2V7MA 3PU3A 2ZMAA 5DJQC 5AQQB 5BR8T 2HH7A 1ZEEA 3B13A 3KBTA 4CXXA 4CN6A 4WBNE 5L3GB 4XBFB 1AJ3A 4EB6E 2LLYA 5IWAT 4YT0A 1ZP0A 3L3PA 3UUNA 4UXNB 1FEWA 3BQKA 4QHOA 4LFAT 5FY0A 3JAEA 2BVLA 2LSJA 4A98A 2CXDA 2LT3A 2BG9C 4YY3T 4NXNT 2YDQA 3M3ZB 5JQGE 1WYCA 1OEDA 2VKOA 3IA3A 2L3LA 3RGLA 4YLHA 1VCTA 1MNDA 2WZHA 4EYYR 4C91A 4O2BE 2OLTA 4B3RT 4AI6A 1HG2A 3O9XA 4GYRA 2YEVC 1MMGA 3I1AA 4AQGA 4DBRA 2WDVA 4DR3T 3PUGA 2UUCT 4H9QC 1S94A 2XHEB 3RHWA 2N9DA 5LB7B 2XASB 3AEGA 2UXNB 4HFIA 2X9YA 2E8IA 2N1GA 2X68A 3PUAA 4HFCA 5FY7A 3UUXB 2V7KA 5LJNA 4WNKA 4U31A 5LGTB 2WQYA 4DVDA 4IE5A 4B3MT 4U72A 4HFBA 2XTLA 4KHPT 2C5JA 4PJMA 3P4SA 3H37A 3RC3A 3UFGA 1UGOA 3N9NA 5F8PA 5CB4E 2D2SA 3P4QA 4LF4T 1T72A 2RP4A 2YU1A 5IHYA 5JDMA 3RIUA 5IYZE 2WAUA 4EZ4A 4JBWF 4PJLA 1OEDE 4CZZB 3PUVF 4MBQA 1UK5A 3C4ZA 2UXBT 3UUBA 2IHR1 4UR9A 4B6XA 5LJMA 2D0UA 3KBUA 3MKDA 4QWNB 4YJ2E 2BVMA 4YTPA 4AKIA 4TWFA 5H6QB 2LRKA 3JADA 3JC6C 5DQVA 2FJDA 3WI3A 2EHOC 2QRXA 5HEOA 4DR7T 3N9OA 2DCFA 2QA7A 5JR9A 3RYCE 2E5LT 1X79A 4JI8T 5J2UE 3ZYMA 2V8SV 4AQYT 4HWHA 3ZJ2A 2VL8A 5FKYA 4I4TE 3PJAA 4DO0A 3ETVA 5FXZA 4DMVA 2NR4A 4DR1T 1NEKA 3EDUA 4ZOLE 4DNDA 5LMNT 2KZ7B 5A1LA 2CHNA 3RX6A 2LEHA 3AE2A 4AQFA 1ZHCA 4COFA 1SA0E 2B1EA 5AQVB 4N78D 3LK2B 2XY8B 2JJ9A 1T8BA 2PJQA 4LMLA 5FXWA 2UUAT 4JI3T 4JI4T 3AE8A 3ONJA 4Q25A 3F31A 1VCSA 1YQ3A 4IT4A 4TV8E 5CGMA 3AEBA 5JH7E 3CMLA 3OJAA 3I0OA 3QK6A 4NIQA 2JQ9A 2VASA 4ILCA 1HS7A 2FUPA 3H3AA 2XAQB 4HE8A 4IHJE 4KP3C 3HI2A 3L09A 5AQOB 4EEDA 3R6NA 5LMUT 3ONLC 2KXPB 2A2FX 2X66A 4JI1T 1HCIA 1KNRA 1KNPA
chains in the Genus database with same CATH topology
2V6YA 4U31A 5FVLA 2RPAA 2WWVA 2W2UA 1WCRA 4CN1A 5FVKA 3EABA 4U7IA 2DL1A 2V6XA 2LRLA 1YXRA 1WFDA 4CN4A 2XZEA 4U2ZA 3K1SA 3ZT7A 4CN6A 3ZSTA 3ZT6A 3ZSSA 3ZT5A 1WR0A 5CJ5A 2V6YB 4A5XA 4U2YA 4IT4A 2WY2A 4P1NA 4ZEYA 5CGMA 2CPTA 4U7YA 2CRBA 4U33A 4NIQA 2MPKA 2JQ9A 2LRKA 4U3CA 2JQKA 5LB7B 2K3WA 2A9UA 4WZXA 2JQHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V6Y A;  4U31 A;  5FVL A;  2RPA A;  2WWV A;  2W2U A;  1WCR A;  4CN1 A;  5FVK A;  3EAB A;  4U7I A;  2DL1 A;  2V6X A;  2LRL A;  1YXR A;  1WFD A;  4CN4 A;  2XZE A;  4U2Z A;  3K1S A;  3ZT7 A;  4CN6 A;  3ZST A;  3ZT6 A;  3ZSS A;  3ZT5 A;  1WR0 A;  5CJ5 A;  2V6Y B;  4A5X A;  4U2Y A;  4IT4 A;  2WY2 A;  4P1N A;  4ZEY A;  5CGM A;  2CPT A;  4U7Y A;  2CRB A;  4U33 A;  4NIQ A;  2MPK A;  2JQ9 A;  2LRK A;  4U3C A;  2JQK A;  5LB7 B;  2K3W A;  2A9U A;  4WZX A;  2JQH A; 
#chains in the Genus database with same CATH topology
 1KF6 A;  3CWZ B;  3BK9 A;  2YKS A;  3AEC A;  4UVA B;  4LF8 T;  3UT5 E;  3U3I A;  3ZMV B;  4P0A A;  5LBQ B;  5KX5 E;  2V6X A;  4O4J E;  2X0Y A;  3FZM B;  2CWY A;  1NEN A;  4Z90 A;  3ZST A;  4F8H A;  1IBK T;  2JIW A;  5KMG P;  5AQF B;  4PK6 A;  3AEA A;  3KV4 A;  1LKX A;  2AE9 A;  4PW8 A;  5ABF B;  5AQU B;  1UUS A;  2FJA A;  2UXX B;  2BG9 E;  2W0G A;  2XSB A;  4QXB B;  3VHL A;  3ZYK A;  2B76 A;  1WYB A;  2CEA A;  1BR2 A;  2L8K A;  3NWI A;  3VR8 A;  4EGW A;  2FJE A;  2ZM6 T;  5HEJ A;  2WY2 A;  3VKH A;  2CWO A;  5HXE A;  2E9X D;  3RYH E;  2AXD S;  3EVY A;  4UVC B;  4JI5 T;  3VRB A;  2BS4 A;  1HF8 A;  3ZT5 A;  1FMV A;  4ILB A;  2XUE A;  3ZN0 B;  3HKD E;  4JI7 T;  2WMN A;  1LRZ A;  3KV6 A;  4JI2 T;  2W00 A;  3ZC1 A;  4JEH B;  4HFH A;  5L2L A;  3IEE A;  4G2A A;  4IRE A;  3ANW A;  4YJ3 E;  3J7Y q;  2V6Y A;  4PFP A;  2WWV A;  1MIW A;  2WP9 A;  1FMW A;  1H7C A;  3ETU A;  3CQG B;  3EAB A;  5EZY E;  3NZP A;  2I0M A;  4JEU B;  4MAL A;  5FVK A;  4ZZC A;  4ASK A;  3C50 A;  3CQX C;  2VVS A;  4GK0 E;  4H9S E;  3T8O A;  4ADZ A;  4C90 A;  4DV2 T;  4AKG A;  2H89 A;  3AAI A;  3GA8 A;  5LG4 A;  4WW0 A;  3ZPO A;  3LBX A;  2IUB A;  2WMO A;  3C4W A;  3ZMT B;  2G0U A;  3AXJ A;  3LBX B;  2NW9 A;  3H3M A;  3ZLI A;  5CA0 E;  3EDV A;  3FBZ A;  1W09 A;  3HKC E;  5F5W A;  3V5S A;  3ZYL A;  1YD8 G;  2KSR A;  2LKG A;  2WS3 A;  4ZS3 A;  3CPZ A;  5AQG B;  5HXC A;  2MBG A;  4ZEY A;  5ABG A;  4EXT A;  3A5X A;  5FL1 A;  2C5I T;  5LCY A;  4U3C A;  3R84 B;  4ZHQ E;  3UU4 A;  4KX6 A;  2JQQ A;  4ERR A;  2CM0 A;  2M67 A;  2Q9Q C;  2XQ7 A;  4H63 H;  4LMK A;  5EK2 A;  3PE0 A;  1XMQ T;  2PTF A;  1KK7 A;  1CHU A;  2E5V A;  2YU2 A;  3HKE E;  2NTX A;  3DP7 A;  1MMD A;  2EHO B;  3HL6 A;  3N2K E;  5HAX A;  3UUL A;  4YFS A;  4YSZ A;  2J1D G;  2JPF A;  2BBH A;  2YDR A;  4UF0 B;  3TLS A;  4K0K T;  2Y8D A;  4EYU A;  1IAP A;  3PTR B;  4LFC T;  5AQJ B;  3GMI A;  4ZZB A;  2H7V C;  4OFZ A;  3KVB A;  2XQ5 A;  2UXC T;  3JC6 D;  3TLW A;  3LJC A;  4ZI3 D;  3AE7 A;  3AE9 A;  4I43 B;  2M6I A;  1JNR A;  2LSY A;  2Y6X A;  3UU5 A;  4A56 A;  4IL4 A;  3AA7 B;  3VR9 A;  1BR1 A;  4OK0 A;  1KFY A;  5C3J A;  3PUX F;  2XQ6 A;  3RIF A;  4TWH A;  4M1P A;  2Q9Q B;  2XPK A;  3CQC B;  3KDS E;  3AA6 B;  2XM1 A;  1NAF A;  2ODU A;  2YOE A;  3N9L A;  4H63 V;  4HWC A;  4I50 E;  2JQK A;  2QYW A;  2X9H A;  4L0R A;  3LK3 B;  5HEH A;  5L3D B;  1XWM A;  2WWU A;  4PJJ A;  2XAH B;  4DR5 T;  4ANJ A;  2FJB A;  1ZKE A;  3RQW A;  2X51 A;  4TWD A;  5C2T A;  2NW7 A;  5JDF A;  2ZM8 A;  4IDN A;  3SOL A;  3K1S A;  4ZI3 C;  5ADX L;  3ZC0 A;  2R6G F;  1T98 A;  3UQ4 A;  4AIS A;  5AQI B;  3ONX A;  1WR0 A;  5LGN B;  3RI5 A;  1D1B A;  2MYS A;  4DR2 T;  4IE0 A;  2V6Y B;  2CLY B;  2LKH A;  4P09 A;  3N2O A;  4I0U A;  2W67 A;  4X1K E;  5HYA A;  2NOX A;  3OBV E;  2CXF A;  4JLE A;  3QNU A;  5HXS A;  2NTY A;  4X1I E;  4DV5 T;  4TN7 B;  4X5T A;  1HR0 T;  2DWK A;  3GWH A;  5JDG A;  2LSK A;  5JDN A;  4B3S T;  1HX8 A;  2XAF B;  2H7O A;  3LK4 2;  5LHI B;  2XQ8 A;  3IBP A;  3OYX A;  1E2A A;  3QB5 A;  4OYJ A;  2CXL A;  1J5E T;  1V9D A;  3K3N A;  2BKO A;  3PUY F;  5L4E A;  1VOM A;  2PG8 A;  2ZM2 A;  2BS3 A;  4H9O C;  5DAB A;  5HEG A;  2C5K T;  1VRB A;  1QUU A;  2DL1 A;  3B57 A;  1SUM B;  3DTO A;  5HCM A;  2IC6 A;  1WFD A;  2LHR A;  2MTQ A;  3WAK A;  4H9P C;  1FJG T;  3NKZ A;  1XNR T;  1YW0 A;  1IJ5 A;  2H3R A;  4DID B;  5CA1 E;  4CI3 B;  1QLB A;  1YKH B;  3J9X 1;  4JI6 T;  5CJ5 A;  1N32 T;  1N34 T;  4NUV A;  2X9X A;  3EUH A;  5FXV A;  4A5X A;  3KVA A;  2WM9 A;  2KWH A;  4UF0 A;  3UTK A;  3K8P C;  1KNZ A;  5HWX A;  5M4Y A;  5HXH A;  2CMR A;  2OV9 A;  3F57 A;  2OA5 A;  4AQF C;  1OXZ A;  2WSS V;  2UXD T;  3ABV A;  3CX8 B;  5AQL B;  2VVN A;  4ILA A;  1BR4 A;  4QKN A;  2I6H A;  4ILU A;  1D0X A;  1WLX A;  4HWI B;  3IF8 B;  3UUM A;  2WDQ A;  1HX1 B;  4O2A E;  2JRK A;  4DMW A;  5L4H A;  3TLT A;  2LM2 A;  1UUR A;  1M7K A;  4CN1 A;  3HR0 A;  3AAA B;  3K3O A;  1MMA A;  2XM2 A;  3LG7 A;  4TV9 E;  2V7L A;  4PK5 A;  4U7I A;  2D5U A;  2VKD A;  3FBL A;  3KFW X;  4CQI A;  4LF7 T;  2SPC A;  3RLF F;  4KMC A;  1R8I A;  1W0B A;  1MIV A;  4EEB A;  2NWB A;  2LOP A;  3ZCI A;  2UU9 T;  2JMH A;  3L8R A;  3AB3 B;  4ZI2 C;  3GN5 B;  4GYS A;  1UCU A;  2LJL A;  2PFV A;  5AQK B;  4A97 A;  1HNW T;  1G73 A;  1IBL T;  5ABH A;  3MXZ A;  4U2Y A;  4IE7 A;  1O3X A;  4IL9 A;  4P0B A;  3FXD B;  3V5U A;  4BAY B;  2A72 A;  5JDL A;  1XMO T;  3N5L A;  1HTJ F;  4O4L E;  3CX7 B;  5FMN A;  3E22 E;  3PUQ A;  4IIJ E;  4UEL A;  5FNV E;  3N9Q A;  3AE6 A;  5FY1 A;  1NWM X;  2VL0 A;  2CLY C;  3MAC A;  3C98 B;  3ZMU B;  4QXH B;  2E2A A;  2XQY A;  1WRD A;  3ZN1 B;  2W66 A;  3AEF A;  1US7 B;  4KBM B;  3E0Z A;  2KWI B;  3UU8 A;  4DUZ T;  2Z6E A;  3HA4 A;  5HXR A;  4EAH A;  4YHH T;  5FYM A;  1WCR A;  1Y64 B;  2VB6 A;  3UU3 A;  3IHR A;  5AQM B;  5EK4 A;  5ABE A;  3Q5W A;  4IDQ A;  3SS1 A;  5LXT E;  2RA1 A;  3I9Y A;  5JR9 B;  4U2Z A;  4WBO A;  3P4P A;  3LSV A;  1BR0 A;  3C51 A;  1ZOY A;  2KND A;  2BZB A;  3MJX A;  4L9I A;  4DUY T;  3I0Q A;  4DV6 T;  1HFA A;  3Q2M A;  3N9P A;  4AKR B;  3JCF A;  3RKG A;  4DV3 T;  1IZN B;  3NBX X;  1U4Q A;  2E9X C;  2XAG B;  2VQF T;  2HHH T;  4V1A v;  3P7I A;  4X20 E;  1W0A A;  3PUW F;  5FL0 A;  1MMN A;  3RYI E;  4EV6 A;  1B7T A;  4HWF A;  4TUY E;  5H6R B;  2X0H A;  3ZEF B;  5ABF A;  4CI2 B;  4QXC B;  4KI0 F;  2LSG A;  3FB2 A;  3FZH B;  3ZMS B;  3P4W A;  2L9Q A;  4LMJ A;  2NP9 A;  3C4X A;  4EOZ B;  1MNE A;  3W15 B;  3FXE B;  4I55 E;  5FVL A;  4TZ4 C;  4AKH A;  4IST A;  4EIW A;  2ES0 A;  3Q5X A;  2HPL A;  4KHZ F;  2IW5 B;  2UUB T;  4HFD A;  5LP6 E;  4QH1 A;  2W61 A;  2Y48 B;  4ZI2 D;  3ZT6 A;  5LGU B;  2LHN A;  4JV5 T;  5L3C B;  2X9W A;  4L5G A;  4TNW A;  3O1J A;  4HGA A;  4QH4 A;  2XJ7 A;  3RF1 A;  4YXD A;  3T1H T;  4X62 T;  1Z0P A;  2IAK A;  3M65 A;  1W9R A;  4PNI A;  4HEA A;  5EK3 A;  3JAF A;  5KXJ A;  4GKK T;  2XAJ B;  2XQ3 A;  3NZQ A;  4U74 A;  4HFV A;  2CCQ A;  2CA5 A;  3OVU A;  5J0Z A;  3AXJ B;  2WB5 A;  4YTM A;  5DQW A;  4AXP A;  2KMF A;  4PK4 A;  4YHJ A;  4BA9 A;  2W63 A;  5AQH B;  2X67 A;  3QUJ A;  2EHO D;  5AQT B;  2V7I A;  4QX8 B;  3A7M A;  3RIU C;  2QGS A;  1OWA A;  3KV5 A;  3GN5 A;  4DR4 T;  1XDP A;  2FBW A;  2VUR A;  3WAJ A;  2WU5 A;  3K3Q C;  2H88 A;  4HKA A;  4X1Y E;  3F2E A;  5AQN B;  2RPA A;  3AVS A;  2DWG A;  5BMV E;  2VK9 A;  3CK6 A;  3LDQ B;  4UIG A;  2HN1 A;  2W62 A;  4MFR A;  2ACX A;  2N2N A;  3EI0 A;  5JR9 C;  5LYJ E;  5J2T E;  2XZE A;  3CKD A;  2EHO A;  1D0Z A;  1WR6 A;  2LE8 A;  5JDQ A;  4CXY A;  3Q9D A;  1X9B A;  3PV0 F;  4J2C A;  1MIY A;  4LFB T;  3MK7 C;  3RH3 A;  4QX7 B;  1QSD A;  2BKN A;  4AKL A;  3SFE A;  4H9R C;  2IDO B;  3CX6 B;  1I6Z A;  2J47 A;  3AED A;  3X1D A;  5J1G A;  2KLQ A;  2K9A A;  3Q5D A;  4U33 A;  4BJM A;  2MPK A;  3MZK B;  4Z91 A;  2VWA A;  4MHC A;  4K0U A;  3PUR A;  4HN9 A;  4O4H E;  3PJA J;  1N33 T;  5HCJ A;  2V1D B;  2A9U A;  2C0S A;  2JMK A;  5CFB A;  3OPC A;  4GOU A;  5JDH A;  4IE4 A;  4WYV A;  2BG9 A;  5F3J A;  2CBJ A;  1U5P A;  3P8C D;  5LHG B;  1IBM T;  3C64 A;  4PJN A;  1YXR A;  4YTN A;  5KDM C;  1IJ6 A;  3ZKR A;  3TLV A;  3AA0 B;  3ZT7 A;  3D0T A;  4X66 T;  3CVR A;  3OTO T;  4ZI7 E;  4LF9 T;  2V5C A;  3ZSS A;  3RPU A;  2CBI A;  3NVO A;  1D1A A;  2XQ4 A;  4FJO A;  2P9B A;  1SHZ C;  4UV9 B;  2V5D A;  4OX9 T;  3PU8 A;  1S35 A;  1DU2 A;  2V26 A;  1UX4 A;  3ZJ1 A;  3AE4 A;  2CE7 A;  1ZV4 X;  3OKQ A;  4O4I E;  4P1N A;  4UVB B;  1FIO A;  2CPT A;  3O1H A;  4E7Z A;  3ANW B;  1HNX T;  3N2G E;  1Y01 A;  4DBQ A;  3KIN B;  2Q9Q D;  3VRA A;  3UQ7 A;  3O1I A;  4FI5 A;  4HFE A;  5C8Y E;  3QC9 A;  4JYA T;  3QB5 K;  4H9N C;  3O4X E;  2GK9 A;  3AE3 A;  5FXX A;  1L0V A;  4EZH A;  2WBL A;  1SE7 A;  5AQR B;  3TLU A;  4G63 A;  3U78 A;  2K5B B;  2W2U A;  4GKJ T;  4XZC A;  3AE1 A;  2HN2 A;  5L47 A;  2PBI A;  4IDO A;  4PFO A;  2J62 A;  2LRL A;  4Z8X A;  5GON E;  3RQU A;  2X0L B;  3PUS A;  2WZI A;  3E08 A;  5AQS B;  4ZXL A;  1N36 T;  4JI0 T;  2BS2 A;  4ISS A;  4AIU A;  3MA9 A;  4BJN A;  3Q5E A;  3A8Y C;  3FHN A;  1HG5 A;  5ETW A;  5JTG A;  5JRC A;  2DNX A;  2BKP A;  4CI1 B;  5JRC B;  2XSA A;  2BDE A;  4DV4 T;  5IUX A;  5JRE A;  4CXW A;  2KIN B;  1GQE A;  4KUM B;  4YSX A;  3UFE A;  3S4U A;  1G8X A;  2ZLY A;  3SRZ A;  4U7Y A;  2IML A;  2LOS A;  2MAW A;  3AE5 A;  4HWD A;  5E0O A;  2I59 A;  4IE6 A;  2E9X A;  2M6B A;  1OED B;  2VKH A;  5LBM A;  3KV9 A;  2E9X B;  1EZ3 A;  2V7J A;  3FZF B;  2WU2 A;  4UV8 B;  5LA6 E;  3RRC A;  3P4R A;  4XAX B;  2ACZ A;  2JQH A;  2K24 A;  2XQA A;  2VKJ A;  1J1J A;  1T7S A;  2WDR A;  5JVD E;  2XQ9 A;  3NRY A;  4NUU A;  3I9W A;  4PAG A;  1D0Y A;  3RC8 A;  4TNV A;  5L3B B;  4IDP A;  3BQI A;  3RKO A;  4DR6 T;  2D0T A;  3VKG A;  2IIU A;  2LSI A;  4CN4 A;  4X65 T;  2LM9 A;  2K48 A;  4X64 T;  3L39 A;  4GK5 E;  4IGU A;  4ZS2 A;  2KT9 A;  4NXM T;  3G06 A;  3PDY A;  3TKL B;  3HKB E;  3NRX A;  1UX5 A;  3FZL B;  2WCA A;  3BQL A;  2BBJ A;  5AQP B;  4DV1 T;  2BG9 B;  1XNQ T;  1J5W A;  2YIN A;  3SFD A;  3RIA A;  3EAM A;  2VQE T;  1D1C A;  2CHO A;  2DI4 A;  2YN6 A;  4QH5 A;  4HTE A;  1M62 A;  3FZK B;  2ODV A;  4O8S A;  5HEU A;  1XZY A;  2IC9 A;  1YKE B;  2YDS A;  5HWY A;  4DV0 T;  4LF5 T;  2A3D A;  2K3W A;  2NW8 A;  3QOF A;  2DHR A;  3AEE A;  4IDZ A;  4NPP A;  1Z8U A;  4MLK A;  3LFM A;  4JUY A;  5TAO A;  2J4G A;  4GIW A;  2YK0 A;  3PUZ F;  3RYF E;  3RRW A;  1E7P A;  1I94 T;  2W4X A;  3ZMZ B;  5LNK A;  3N9M A;  2MOZ A;  3ESL A;  3B5M A;  5LG3 A;  4B3T T;  2DLR A;  3EHZ A;  3ZCJ A;  3AVR A;  2ZM0 A;  3DJB A;  3CIR A;  3SWH A;  1CUN A;  1KEY A;  2Q9Q A;  4DV7 T;  4TX5 A;  1HNZ T;  2D9D A;  3OYZ A;  5LOV E;  5L3E B;  1XDO A;  4E7S A;  2QVA A;  4YSY A;  5L3F B;  3T1Y T;  1YQ4 A;  1LVF A;  3AAE B;  4OYK A;  5FP3 A;  2HPJ A;  4F6R C;  4LF6 T;  3VU7 H;  1E1H B;  2CRB A;  3AA1 B;  3P50 A;  4UEM A;  5AFU L;  2F4V T;  1OED C;  4WZX A;  4OHF A;  3UU6 A;  5LHH B;  1LVK A;  1JNZ A;  2V7M A;  3PU3 A;  2ZMA A;  5DJQ C;  5AQQ B;  5BR8 T;  2HH7 A;  1ZEE A;  3B13 A;  3KBT A;  4CXX A;  4CN6 A;  4WBN E;  5L3G B;  4XBF B;  1AJ3 A;  4EB6 E;  2LLY A;  5IWA T;  4YT0 A;  1ZP0 A;  3L3P A;  3UUN A;  4UXN B;  1FEW A;  3BQK A;  4QHO A;  4LFA T;  5FY0 A;  3JAE A;  2BVL A;  2LSJ A;  4A98 A;  2CXD A;  2LT3 A;  2BG9 C;  4YY3 T;  4NXN T;  2YDQ A;  3M3Z B;  5JQG E;  1WYC A;  1OED A;  2VKO A;  3IA3 A;  2L3L A;  3RGL A;  4YLH A;  1VCT A;  1MND A;  2WZH A;  4EYY R;  4C91 A;  4O2B E;  2OLT A;  4B3R T;  4AI6 A;  1HG2 A;  3O9X A;  4GYR A;  2YEV C;  1MMG A;  3I1A A;  4AQG A;  4DBR A;  2WDV A;  4DR3 T;  3PUG A;  2UUC T;  4H9Q C;  1S94 A;  2XHE B;  3RHW A;  2N9D A;  5LB7 B;  2XAS B;  3AEG A;  2UXN B;  4HFI A;  2X9Y A;  2E8I A;  2N1G A;  2X68 A;  3PUA A;  4HFC A;  5FY7 A;  3UUX B;  2V7K A;  5LJN A;  4WNK A;  4U31 A;  5LGT B;  2WQY A;  4DVD A;  4IE5 A;  4B3M T;  4U72 A;  4HFB A;  2XTL A;  4KHP T;  2C5J A;  4PJM A;  3P4S A;  3H37 A;  3RC3 A;  3UFG A;  1UGO A;  3N9N A;  5F8P A;  5CB4 E;  2D2S A;  3P4Q A;  4LF4 T;  1T72 A;  2RP4 A;  2YU1 A;  5IHY A;  5JDM A;  3RIU A;  5IYZ E;  2WAU A;  4EZ4 A;  4JBW F;  4PJL A;  1OED E;  4CZZ B;  3PUV F;  4MBQ A;  1UK5 A;  3C4Z A;  2UXB T;  3UUB A;  2IHR 1;  4UR9 A;  4B6X A;  5LJM A;  2D0U A;  3KBU A;  3MKD A;  4QWN B;  4YJ2 E;  2BVM A;  4YTP A;  4AKI A;  4TWF A;  5H6Q B;  2LRK A;  3JAD A;  3JC6 C;  5DQV A;  2FJD A;  3WI3 A;  2EHO C;  2QRX A;  5HEO A;  4DR7 T;  3N9O A;  2DCF A;  2QA7 A;  5JR9 A;  3RYC E;  2E5L T;  1X79 A;  4JI8 T;  5J2U E;  3ZYM A;  2V8S V;  4AQY T;  4HWH A;  3ZJ2 A;  2VL8 A;  5FKY A;  4I4T E;  3PJA A;  4DO0 A;  3ETV A;  5FXZ A;  4DMV A;  2NR4 A;  4DR1 T;  1NEK A;  3EDU A;  4ZOL E;  4DND A;  5LMN T;  2KZ7 B;  5A1L A;  2CHN A;  3RX6 A;  2LEH A;  3AE2 A;  4AQF A;  1ZHC A;  4COF A;  1SA0 E;  2B1E A;  5AQV B;  4N78 D;  3LK2 B;  2XY8 B;  2JJ9 A;  1T8B A;  2PJQ A;  4LML A;  5FXW A;  2UUA T;  4JI3 T;  4JI4 T;  3AE8 A;  3ONJ A;  4Q25 A;  3F31 A;  1VCS A;  1YQ3 A;  4IT4 A;  4TV8 E;  5CGM A;  3AEB A;  5JH7 E;  3CML A;  3OJA A;  3I0O A;  3QK6 A;  4NIQ A;  2JQ9 A;  2VAS A;  4ILC A;  1HS7 A;  2FUP A;  3H3A A;  2XAQ B;  4HE8 A;  4IHJ E;  4KP3 C;  3HI2 A;  3L09 A;  5AQO B;  4EED A;  3R6N A;  5LMU T;  3ONL C;  2KXP B;  2A2F X;  2X66 A;  4JI1 T;  1HCI A;  1KNR A;  1KNP A; 
#chains in the Genus database with same CATH homology
 2V6Y A;  4U31 A;  5FVL A;  2RPA A;  2WWV A;  2W2U A;  1WCR A;  4CN1 A;  5FVK A;  3EAB A;  4U7I A;  2DL1 A;  2V6X A;  2LRL A;  1YXR A;  1WFD A;  4CN4 A;  2XZE A;  4U2Z A;  3K1S A;  3ZT7 A;  4CN6 A;  3ZST A;  3ZT6 A;  3ZSS A;  3ZT5 A;  1WR0 A;  5CJ5 A;  2V6Y B;  4A5X A;  4U2Y A;  4IT4 A;  2WY2 A;  4P1N A;  4ZEY A;  5CGM A;  2CPT A;  4U7Y A;  2CRB A;  4U33 A;  4NIQ A;  2MPK A;  2JQ9 A;  2LRK A;  4U3C A;  2JQK A;  5LB7 B;  2K3W A;  2A9U A;  4WZX A;  2JQH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...