2LRLA

Solution structures of the iia(chitobiose)-hpr complex of the n,n'-diacetylchitobiose branch of the escherichia coli phosphotransferase system
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
103
structure length
103
Chain Sequence
b'AEELEEVVMGLIINSGQARSLAYAALKQAKQGDFAAAKAMMDQSRMALNEAHLVQTKLIEGDAGEGKMKVSLVLVHAQLHLMTSMLARELITELIELHEKLKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N,N'-diacetylchitobiose-specific phosphotransferase enzyme I
molecule tags Transferase
source organism Escherichia coli
publication title Solution Structure of the IIAChitobiose-HPr Complex of the N,N'-Diacetylchitobiose Branch of the Escherichia coli Phosphotransferase System.
pubmed doi rcsb
total genus 42
structure length 103
sequence length 103
chains with identical sequence B, C
ec nomenclature ec 2.7.1.-:
pdb deposition date 2012-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02255 PTS_IIA PTS system, Lactose/Cellobiose specific IIA subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2lrlA00
4WZXA 2W2UA 4U33A 2JQHA 4ZEYA 4U2ZA 2XZEA 5LB7B 2LRLA 3ZSSA 2CPTA 5FVKA 4A5XA 2V6YB 4CN4A 5CGMA 3EABA 3ZSTA 2LRKA 4IT4A 2JQ9A 4U3CA 2V6XA 2K3WA 4U7YA 2V6YA 4U31A 2WY2A 2CRBA 1YXRA 3K1SA 4NIQA 5FVLA 4CN1A 2RPAA 4U7IA 2WWVA 2MPKA 5CJ5A 4CN6A 3ZT6A 3ZT5A 1WFDA 4U2YA 1WR0A 4P1NA 1WCRA 2JQKA 3ZT7A 2A9UA 2DL1A
chains in the Genus database with same CATH superfamily
3FXDB 2CBIA 1KF6A 4B6XA 4CI3B 2VWAA 3AEBA 2X67A 2JQHA 1D1AA 4H9RC 4UV8B 2XZEA 5H6RB 5ABHA 2BBHA 3OVUA 3N2OA 3IEEA 4HWDA 4L5GA 5EK3A 5ABGA 4A56A 4YHJA 2V7IA 5JDLA 5F5WA 2DHRA 3VHLA 5KX5E 2WMNA 5JDFA 4HTEA 2LJLA 4UV9B 3UFEA 1SUMB 2XJ7A 1UK5A 3UUNA 3UT5E 3N5LA 3T1HT 4UR9A 1XNRT 4TN7B 2HN2A 3K1SA 3C4ZA 4QHOA 3FZMB 3PDYA 3P4PA 1WYBA 3PU3A 4OFZA 3R6NA 2QRXA 3A7MA 4HKAA 4ILAA 4P0AA 2WWVA 1XMQT 2Q9QD 2QGSA 4UXNB 5C3JA 2R6GF 1IJ6A 3HKDE 5AQUB 1KFYA 1NEKA 2XY8B 3H37A 3O1HA 4ILBA 5L4EA 2CA5A 3QB5A 3UU6A 2Y8DA 1OEDC 2WU5A 3FZLB 4NUVA 2NOXA 3BQKA 3NKZA 3NVOA 1US7B 2WP9A 2LRLA 2FJBA 2H7OA 3MK7C 4EZHA 2BG9A 4DNDA 4BJMA 5JRCA 2WDQA 3C64A 4ISTA 3P8CD 2XQYA 3AVSA 5AFUL 2KNDA 5IHYA 2BS3A 3JAEA 5HEOA 4AKGA 2UXXB 1XDOA 4PK6A 4TNWA 4IIJE 3KV9A 3AAEB 4B3TT 4B3MT 2WU2A 4AKIA 4EEDA 1X9BA 2EHOD 2CM0A 1D1CA 2V5DA 4G2AA 4HGAA 3RLFF 3UTKA 4KI0F 2VKHA 5AQVB 2RPAA 3GA8A 1H7CA 2RA1A 2BKOA 4YFSA 2E5LT 4HWIB 4B3ST 3KV4A 2XM2A 3AA6B 5L3CB 3X1DA 3OKQA 4GIWA 1WCRA 3N9NA 2D0TA 3RKGA 2V7MA 3N2GE 2UUAT 1IBKT 2PBIA 3ZPOA 3OPCA 4WZXA 1O3XA 1QSDA 3UQ7A 3I9WA 5JQGE 3KBUA 5AQFB 3MXZA 1HF8A 2WWUA 2WZHA 4IDPA 5HCMA 4YHHT 2K48A 3SFDA 3T8OA 3IA3A 4DMVA 3AA7B 4JI0T 3ZSTA 2EHOB 1NENA 1HTJF 2XQ8A 5EZYE 4ZZBA 2VURA 4WYVA 2JQ9A 2LM9A 5JTGA 4X62T 2W62A 5LJNA 4NIQA 4QXHB 5FVLA 5LXTE 4YJ3E 2N1GA 4PAGA 2BVMA 2NW7A 5KDMC 4TZ4C 3CQGB 1OEDA 3EI0A 3ABVA 4CXWA 2UXBT 4DV6T 4KX6A 5AQLB 4EV6A 4DR6T 5TAOA 1HG5A 3PUGA 3N2KE 4Z8XA 2LSJA 5JR9B 1IZNB 2CWYA 1WR0A 3AE4A 3CX7B 2LLYA 4AKHA 4DR4T 2NTXA 3AE8A 4JEUB 5FY0A 1FMWA 4OHFA 1X79A 2XPKA 3ZMVB 3DTOA 2W2UA 4TWDA 3VRBA 2UU9T 1MIYA 3ZMSB 2PG8A 2KLQA 3CQXC 1T8BA 4AI6A 2PFVA 2W66A 3JC6C 3ETVA 3P4QA 1L0VA 4K0KT 5AQIB 4I50E 4KBMB 4O4HE 1KK7A 2E2AA 3CVRA 4NXMT 4DR7T 4IT4A 4AKLA 4EIWA 1MMAA 1Z8UA 1HNWT 2H89A 3M3ZB 2WY2A 2B76A 4CXXA 3P4RA 4I4TE 3B13A 3NZQA 4IE4A 2B1EA 3QUJA 4GYRA 2Q9QC 3B5MA 3UUMA 3V5UA 2CBJA 3P4WA 3IF8B 4DBQA 4HEAA 1XMOT 4UVAB 3I0OA 1D0ZA 2HPJA 2W67A 3F2EA 4O2AE 5LOVE 4H9SE 5AQPB 4JI3T 4EXTA 4JI4T 2DLRA 4O4LE 4DO0A 1QLBA 4P09A 3VKGA 1N33T 3UFGA 2A9UA 3VR9A 3ZKRA 4CI2B 5FP3A 3T1YT 2NW9A 1OWAA 5GONE 3JCFA 5HXCA 3C50A 4KHZF 4XAXB 5CB4E 2NWBA 5AQKB 4IE6A 3TLWA 2K9AA 4EZ4A 5LGUB 3ONXA 2V7KA 2FUPA 2JQQA 2JJ9A 5JH7E 2E8IA 2V6YB 2D9DA 4HFIA 2ACZA 2J62A 2IC9A 2KXPB 2LM2A 1LVKA 3RGLA 3A5XA 3ZC0A 3NBXX 2W00A 2VL0A 5CFBA 3E22E 4GK5E 4TV9E 3VRAA 3I1AA 2BG9C 4X65T 2XSAA 1N32T 5HXSA 5BR8T 4NUUA 3LG7A 1KNZA 2X0HA 3BK9A 1E1HB 3HI2A 3U78A 5J2TE 5LG3A 3PU8A 5F8PA 2E9XD 4QX7B 4KUMB 4U7IA 4JI1T 2MPKA 2XM1A 3AAAB 1MIVA 1YQ3A 2DI4A 2Q9QB 3I0QA 3R84B 3SS1A 4OX9T 5HAXA 3N9OA 3CQCB 1XZYA 4PJLA 1ZKEA 4AQFC 4ZZCA 1FIOA 5LP6E 3KVBA 3RRWA 3PTRB 2UUCT 2M67A 2PTFA 1IJ5A 4H9QC 4EOZB 1UGOA 2H88A 3OTOT 4ILUA 4UEMA 2UUBT 4H9NC 2L8KA 4ZOLE 3WAKA 2W4XA 1E2AA 2CHOA 2V7LA 3O9XA 1I94T 2WBLA 3AEEA 3EUHA 4TNVA 4ADZA 2LOSA 4QH5A 2KT9A 3G06A 4U3CA 5J2UE 5LNKA 2BBJA 3MZKB 4XZCA 1ZHCA 4YJ2E 2BG9B 5EK2A 1WRDA 1YW0A 2IAKA 3PUSA 2CWOA 2LOPA 3PUWF 4IDQA 2NR4A 5E0OA 3RIAA 1T7SA 4YTNA 4YXDA 2MBGA 2H3RA 4H9PC 3QNUA 4KMCA 3ZJ1A 4TWHA 4HFHA 1QUUA 5JRCB 3L3PA 4JI2T 2QYWA 4IE0A 4L9IA 4U74A 4IL4A 2X9HA 1KNPA 3PUXF 5LG4A 3ZJ2A 1E7PA 3LK42 2WZIA 1MMDA 2MAWA 4IHJE 1S35A 3AE3A 5L3BB 3CMLA 1V9DA 1ZP0A 1KNRA 5AQSB 2ZM0A 5FY1A 5DQWA 3PUZF 3AE9A 3NRYA 4LMJA 2ACXA 2XQ6A 4EYYR 2CMRA 5L3DB 3CX8B 2UXNB 2PJQA 2Y6XA 3UQ4A 5L3FB 2VQET 1MNDA 4IGUA 5FMNA 3LDQB 5JDHA 4UF0B 4MFRA 2X0LB 4MHCA 2XAGB 3RF1A 1CHUA 2C5JA 3CPZA 3FZHB 3RH3A 3RYCE 2W0GA 2WB5A 3RYIE 1B7TA 3ANWA 2ES0A 3GWHA 3O1JA 2XSBA 4TWFA 3TLVA 4X20E 3V5SA 2V5CA 2E9XB 2ODVA 3C51A 3QB5K 2HN1A 3ZYMA 2NTYA 5J1GA 5M4YA 3OYZA 2LKHA 3RQWA 3UU5A 4DUZT 1FJGT 4H9OC 4PNIA 1U5PA 3NRXA 3ZC1A 4Q25A 1WR6A 5LBQB 4WW0A 3P4SA 2MYSA 1BR4A 1UURA 5JVDE 1W0AA 3ZCJA 3OYXA 2DWKA 4CN4A 3HA4A 5HEGA 1D0XA 1T72A 4YSZA 2A3DA 3RC8A 4CXYA 5LJMA 5HEHA 4BAYB 3ESLA 4GKKT 4JI8T 3WI3A 3LJCA 3TLTA 4XBFB 2ZMAA 4H63H 2WS3A 4TUYE 4LF4T 2VQFT 2IDOB 5ADXL 4Z91A 2X0YA 3O4XE 1FEWA 2VKDA 4MBQA 4JEHB 4BA9A 2K5BB 3C4XA 5JR9A 5A1LA 4NXNT 2YINA 2HH7A 4ILCA 4X5TA 2DL1A 3S4UA 2BDEA 4JI5T 2ZM6T 5HXRA 4LF9T 2CLYC 5LMNT 2CHNA 3AE1A 3KBTA 2I59A 2A72A 2C5KT 4IL9A 2LHNA 4ZHQE 3FHNA 2OLTA 5IUXA 5CA0E 2M6BA 2Q9QA 3L39A 4UVBB 5FXZA 2EHOA 1D1BA 4AKRB 1OXZA 3LSVA 4DR3T 4KHPT 5F3JA 4PK4A 1WLXA 3TLUA 2WMOA 2JMKA 3PE0A 3EAMA 1HG2A 3FZFB 3JADA 3QC9A 4FI5A 4YTMA 1YKHB 4WBOA 4ISSA 4LF5T 3AVRA 3RIUA 2J4GA 2XUEA 4EYUA 3ZMTB 2LSGA 1LVFA 4CN6A 5IWAT 3ZT6A 3ZEFB 3ZT5A 1JNRA 5HWYA 4LF8T 4GKJT 4X1YE 4EAHA 3LK2B 4P1NA 3J9X1 3L09A 2QA7A 2XQ7A 3C4WA 4HN9A 3QOFA 5KMGP 2DCFA 2YU2A 5AQTB 1R8IA 4V1Av 1J5WA 3N9PA 4KP3C 1KEYA 3JC6D 3HKBE 4HWCA 1W09A 3TLSA 3BQIA 3AE2A 3AEFA 2P9BA 2D0UA 2JIWA 2IHR1 5DABA 3UUXB 3VR8A 4A5XA 1WYCA 3I9YA 3PUVF 2UXCT 2CLYB 2Z6EA 2QVAA 4I55E 3IHRA 2IUBA 2LRKA 4LFBT 3NZPA 3EVYA 3PUQA 3RIFA 2JRKA 2K3WA 3UU4A 4DMWA 3ZYKA 2XQ3A 3ONLC 4K0UA 4AQFA 1YXRA 3HR0A 5AQQB 4AIUA 5HXHA 5L47A 5L2LA 2F4VT 1AJ3A 2G0UA 2IIUA 3PUYF 1OEDE 5HCJA 4GYSA 2M6IA 2X9WA 4X1KE 2YEVC 4AISA 1D0YA 1YKEB 2BZBA 1MNEA 2JMHA 5IYZE 3SWHA 3H3AA 3KVAA 4AXPA 3EDVA 2LE8A 2LEHA 1VCSA 3FZKB 3Q2MA 5DJQC 5LA6E 3SOLA 4DBRA 5JDMA 2VASA 5AQOB 1M7KA 2ZM2A 3P50A 3ANWB 3NWIA 5ETWA 3AEGA 1NWMX 4PFPA 4E7ZA 2IMLA 3B57A 5LB7B 5FVKA 2JPFA 3H3MA 4AQYT 2AXDS 2J47A 2WCAA 1BR2A 2LSYA 4LMKA 2SPCA 2V7JA 3VU7H 5CGMA 4X1IE 3PJAJ 4LF6T 1OEDB 2H7VC 3JAFA 3KINB 4X64T 2KMFA 3C98B 3F57A 3MKDA 3MACA 4HFDA 4PJNA 5FL0A 3RKOA 4E7SA 1YD8G 2E9XC 5HXEA 3D0TA 4YY3T 4DV1T 2YDSA 2K24A 2EHOC 2WDVA 3AB3B 3CIRA 3K3NA 3K8PC 4IDNA 4O8SA 4FJOA 4JUYA 4UVCB 3TKLB 5CJ5A 4DV5T 3K3QC 2A2FX 3CKDA 3AA0B 3M65A 5AQGB 4C91A 4DVDA 4U2YA 3RPUA 4ANJA 2CCQA 4HWHA 4DR2T 1HNZT 1BR0A 3LBXB 1YQ4A 4QKNA 4DV2T 3CWZB 2V26A 3AA1B 1Y64B 4HFVA 4F6RC 2YDRA 5J0ZA 2RP4A 4WBNE 2GK9A 4LFAT 2FJDA 2DNXA 3RQUA 5LHHB 4J2CA 4CZZB 1FMVA 2VKJA 4OYJA 3BQLA 2YDQA 4PJJA 2C0SA 4DUYT 4LF7T 5KXJA 5AQNB 4U31A 3AE7A 5FNVE 5DQVA 3ZYLA 3Q9DA 2CEAA 3PUAA 2IW5B 3J7Yq 3AECA 2X9XA 4IDZA 2WM9A 4C90A 5FYMA 2AE9A 2HHHT 1M62A 3ONJA 4DV7T 1IAPA 3SRZA 1Z0PA 2KWIB 4HFCA 1WFDA 4PJMA 4H63V 1HX8A 2CE7A 2LSIA 3AEAA 4AQGA 5ABFA 3GN5B 5FXVA 5FY7A 2OA5A 2XQ4A 4IE7A 2YKSA 1NAFA 4GK0E 3ZLIA 3RRCA 5JDNA 5HEUA 1CUNA 5LCYA 2VL8A 2X66A 2IC6A 3PV0F 2N9DA 4U33A 4COFA 4DV0T 1SA0E 3A8YC 3ZSSA 2VKOA 2FBWA 3E08A 4EB6E 1SHZC 4JLEA 4N78D 2L3LA 4HWFA 1ZV4X 2LKGA 5EK4A 4G63A 2E9XA 2VVNA 4YSXA 3LFMA 3IBPA 5ABFB 2XQ5A 1UX5A 2E5VA 1G73A 4PK5A 1J1JA 4PW8A 3AE6A 3PURA 3ZN1B 4YTPA 5LHGB 2V6YA 5AQHB 3CK6A 4YSYA 2CRBA 5LMUT 3F31A 4CN1A 4F8HA 3FXEB 3K3OA 3OBVE 5JDGA 4OYKA 1ZOYA 3ZCIA 4DV3T 2KZ7B 1XDPA 1HX1B 2X51A 1HFAA 1VCTA 3UU8A 4JYAT 1VOMA 1MIWA 2CXDA 3P7IA 4Z90A 4LFCT 3HL6A 1XWMA 5FXWA 3RI5A 4ZEYA 1HS7A 4I43B 4YLHA 3Q5DA 4QH1A 4LMLA 2ZM8A 4I0UA 3VKHA 5ABEA 1LKXA 2BS2A 2N2NA 3KV5A 1U4QA 2X68A 3W15B 4PFOA 4UELA 4DR5T 2BKPA 3EHZA 2W61A 4GOUA 1MMNA 2NP9A 1J5ET 2XAHB 3LBXA 4TV8E 4WNKA 5FL1A 1T98A 1GQEA 2XAJB 4ZS3A 2KSRA 3N9LA 4ZXLA 3ZMUB 1DU2A 4O4JE 1IBMT 2WSSV 3DJBA 1N36T 4DV4T 2J1DG 2ODUA 4CQIA 4HFBA 3KV6A 4IREA 4NPPA 2V1DB 5C8YE 3UULA 5L3GB 3RX6A 4ZS2A 5CA1E 5L4HA 1W0BA 1W9RA 2FJEA 3KFWX 3AXJA 4HE8A 3ZT7A 4EEBA 4JV5T 4IDOA 2XQAA 1XNQT 3FB2A 2D2SA 1N34T 3L8RA 4TX5A 4UIGA 3RC3A 5HYAA 2YK0A 3Q5EA 2X9YA 2CXLA 5LGTB 4U2ZA 3PJAA 5C2TA 1HNXT 3N9QA 1MMGA 4QXBB 4UF0A 3UU3A 5HWXA 2BG9E 2OV9A 4ZI7E 2I0MA 4JI6T 3Q5WA 4A98A 2D5UA 2NW8A 3KDSE 3WAJA 4YT0A 1G8XA 4QXCB 4ASKA 4DR1T 4CI1B 5AQRB 3OJAA 2L9QA 5FKYA 3AAIA 4ZI3C 2KINB 2XQ9A 2LHRA 2MTQA 4U7YA 4ERRA 1I6ZA 2UXDT 3RYFE 2VK9A 5JREA 1LRZA 3E0ZA 3AE5A 1HCIA 2MOZA 1UUSA 2LSKA 4L0RA 4P0BA 1EZ3A 4JI7T 3GN5A 2KWHA 3MA9A 5LYJE 3RHWA 2XAFB 1HR0T 4DIDB 1S94A 2XAQB 5BMVE 2YN6A 2JQKA 4B3RT 2HPLA 2ZLYA 3N9MA 1VRBA 2XTLA 3GMIA 4JBWF 4MALA 4QWNB 5LBMA 3UUBA 4O4IE 3ZN0B 4A97A 5LGNB 2V8SV 2VB6A 2Y48B 3Q5XA 2WAUA 4HFEA 2CPTA 1IBLT 5JR9C 4QX8B 2XASB 3AXJB 5AQJB 2XHEB 4EGWA 2YOEA 3HKEE 2I6HA 1ZEEA 3EABA 2C5IT 2LT3A 3DP7A 3HKCE 2BS4A 3MJXA 2VVSA 3QK6A 3CX6B 4QH4A 4BJNA 4IE5A 4O2BE 4MLKA 2V6XA 1BR1A 4M1PA 3RYHE 1UCUA 4X66T 1JNZA 1Y01A 2YU1A 4U72A 3SFEA 4ZI2C 4ZI3D 3EDUA 5AQMB 3LK3B 5H6QB 5L3EB 2DWGA 3FBLA 2FJAA 3FBZA 2WQYA 3O1IA 3ZMZB 1UX4A 3U3IA 5HEJA 1SE7A 3AEDA 4OK0A 2W63A 2BVLA 5LHIB 2CXFA 2WDRA 5JDQA 3ETUA 3RIUC 5FXXA 4ZI2D 2BKNA
chains in the Genus database with same CATH topology
4WZXA 2W2UA 4U33A 2JQHA 4ZEYA 4U2ZA 2XZEA 5LB7B 2LRLA 3ZSSA 2CPTA 5FVKA 4A5XA 2V6YB 4CN4A 5CGMA 3EABA 3ZSTA 2LRKA 4IT4A 2JQ9A 4U3CA 2V6XA 2K3WA 4U7YA 2V6YA 4U31A 2WY2A 2CRBA 1YXRA 3K1SA 4NIQA 5FVLA 4CN1A 2RPAA 4U7IA 2WWVA 2MPKA 5CJ5A 4CN6A 3ZT6A 3ZT5A 1WFDA 4U2YA 1WR0A 4P1NA 1WCRA 2JQKA 3ZT7A 2A9UA 2DL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WZX A;  2W2U A;  4U33 A;  2JQH A;  4ZEY A;  4U2Z A;  2XZE A;  5LB7 B;  2LRL A;  3ZSS A;  2CPT A;  5FVK A;  4A5X A;  2V6Y B;  4CN4 A;  5CGM A;  3EAB A;  3ZST A;  2LRK A;  4IT4 A;  2JQ9 A;  4U3C A;  2V6X A;  2K3W A;  4U7Y A;  2V6Y A;  4U31 A;  2WY2 A;  2CRB A;  1YXR A;  3K1S A;  4NIQ A;  5FVL A;  4CN1 A;  2RPA A;  4U7I A;  2WWV A;  2MPK A;  5CJ5 A;  4CN6 A;  3ZT6 A;  3ZT5 A;  1WFD A;  4U2Y A;  1WR0 A;  4P1N A;  1WCR A;  2JQK A;  3ZT7 A;  2A9U A;  2DL1 A; 
#chains in the Genus database with same CATH topology
 3FXD B;  2CBI A;  1KF6 A;  4B6X A;  4CI3 B;  2VWA A;  3AEB A;  2X67 A;  2JQH A;  1D1A A;  4H9R C;  4UV8 B;  2XZE A;  5H6R B;  5ABH A;  2BBH A;  3OVU A;  3N2O A;  3IEE A;  4HWD A;  4L5G A;  5EK3 A;  5ABG A;  4A56 A;  4YHJ A;  2V7I A;  5JDL A;  5F5W A;  2DHR A;  3VHL A;  5KX5 E;  2WMN A;  5JDF A;  4HTE A;  2LJL A;  4UV9 B;  3UFE A;  1SUM B;  2XJ7 A;  1UK5 A;  3UUN A;  3UT5 E;  3N5L A;  3T1H T;  4UR9 A;  1XNR T;  4TN7 B;  2HN2 A;  3K1S A;  3C4Z A;  4QHO A;  3FZM B;  3PDY A;  3P4P A;  1WYB A;  3PU3 A;  4OFZ A;  3R6N A;  2QRX A;  3A7M A;  4HKA A;  4ILA A;  4P0A A;  2WWV A;  1XMQ T;  2Q9Q D;  2QGS A;  4UXN B;  5C3J A;  2R6G F;  1IJ6 A;  3HKD E;  5AQU B;  1KFY A;  1NEK A;  2XY8 B;  3H37 A;  3O1H A;  4ILB A;  5L4E A;  2CA5 A;  3QB5 A;  3UU6 A;  2Y8D A;  1OED C;  2WU5 A;  3FZL B;  4NUV A;  2NOX A;  3BQK A;  3NKZ A;  3NVO A;  1US7 B;  2WP9 A;  2LRL A;  2FJB A;  2H7O A;  3MK7 C;  4EZH A;  2BG9 A;  4DND A;  4BJM A;  5JRC A;  2WDQ A;  3C64 A;  4IST A;  3P8C D;  2XQY A;  3AVS A;  5AFU L;  2KND A;  5IHY A;  2BS3 A;  3JAE A;  5HEO A;  4AKG A;  2UXX B;  1XDO A;  4PK6 A;  4TNW A;  4IIJ E;  3KV9 A;  3AAE B;  4B3T T;  4B3M T;  2WU2 A;  4AKI A;  4EED A;  1X9B A;  2EHO D;  2CM0 A;  1D1C A;  2V5D A;  4G2A A;  4HGA A;  3RLF F;  3UTK A;  4KI0 F;  2VKH A;  5AQV B;  2RPA A;  3GA8 A;  1H7C A;  2RA1 A;  2BKO A;  4YFS A;  2E5L T;  4HWI B;  4B3S T;  3KV4 A;  2XM2 A;  3AA6 B;  5L3C B;  3X1D A;  3OKQ A;  4GIW A;  1WCR A;  3N9N A;  2D0T A;  3RKG A;  2V7M A;  3N2G E;  2UUA T;  1IBK T;  2PBI A;  3ZPO A;  3OPC A;  4WZX A;  1O3X A;  1QSD A;  3UQ7 A;  3I9W A;  5JQG E;  3KBU A;  5AQF B;  3MXZ A;  1HF8 A;  2WWU A;  2WZH A;  4IDP A;  5HCM A;  4YHH T;  2K48 A;  3SFD A;  3T8O A;  3IA3 A;  4DMV A;  3AA7 B;  4JI0 T;  3ZST A;  2EHO B;  1NEN A;  1HTJ F;  2XQ8 A;  5EZY E;  4ZZB A;  2VUR A;  4WYV A;  2JQ9 A;  2LM9 A;  5JTG A;  4X62 T;  2W62 A;  5LJN A;  4NIQ A;  4QXH B;  5FVL A;  5LXT E;  4YJ3 E;  2N1G A;  4PAG A;  2BVM A;  2NW7 A;  5KDM C;  4TZ4 C;  3CQG B;  1OED A;  3EI0 A;  3ABV A;  4CXW A;  2UXB T;  4DV6 T;  4KX6 A;  5AQL B;  4EV6 A;  4DR6 T;  5TAO A;  1HG5 A;  3PUG A;  3N2K E;  4Z8X A;  2LSJ A;  5JR9 B;  1IZN B;  2CWY A;  1WR0 A;  3AE4 A;  3CX7 B;  2LLY A;  4AKH A;  4DR4 T;  2NTX A;  3AE8 A;  4JEU B;  5FY0 A;  1FMW A;  4OHF A;  1X79 A;  2XPK A;  3ZMV B;  3DTO A;  2W2U A;  4TWD A;  3VRB A;  2UU9 T;  1MIY A;  3ZMS B;  2PG8 A;  2KLQ A;  3CQX C;  1T8B A;  4AI6 A;  2PFV A;  2W66 A;  3JC6 C;  3ETV A;  3P4Q A;  1L0V A;  4K0K T;  5AQI B;  4I50 E;  4KBM B;  4O4H E;  1KK7 A;  2E2A A;  3CVR A;  4NXM T;  4DR7 T;  4IT4 A;  4AKL A;  4EIW A;  1MMA A;  1Z8U A;  1HNW T;  2H89 A;  3M3Z B;  2WY2 A;  2B76 A;  4CXX A;  3P4R A;  4I4T E;  3B13 A;  3NZQ A;  4IE4 A;  2B1E A;  3QUJ A;  4GYR A;  2Q9Q C;  3B5M A;  3UUM A;  3V5U A;  2CBJ A;  3P4W A;  3IF8 B;  4DBQ A;  4HEA A;  1XMO T;  4UVA B;  3I0O A;  1D0Z A;  2HPJ A;  2W67 A;  3F2E A;  4O2A E;  5LOV E;  4H9S E;  5AQP B;  4JI3 T;  4EXT A;  4JI4 T;  2DLR A;  4O4L E;  4DO0 A;  1QLB A;  4P09 A;  3VKG A;  1N33 T;  3UFG A;  2A9U A;  3VR9 A;  3ZKR A;  4CI2 B;  5FP3 A;  3T1Y T;  2NW9 A;  1OWA A;  5GON E;  3JCF A;  5HXC A;  3C50 A;  4KHZ F;  4XAX B;  5CB4 E;  2NWB A;  5AQK B;  4IE6 A;  3TLW A;  2K9A A;  4EZ4 A;  5LGU B;  3ONX A;  2V7K A;  2FUP A;  2JQQ A;  2JJ9 A;  5JH7 E;  2E8I A;  2V6Y B;  2D9D A;  4HFI A;  2ACZ A;  2J62 A;  2IC9 A;  2KXP B;  2LM2 A;  1LVK A;  3RGL A;  3A5X A;  3ZC0 A;  3NBX X;  2W00 A;  2VL0 A;  5CFB A;  3E22 E;  4GK5 E;  4TV9 E;  3VRA A;  3I1A A;  2BG9 C;  4X65 T;  2XSA A;  1N32 T;  5HXS A;  5BR8 T;  4NUU A;  3LG7 A;  1KNZ A;  2X0H A;  3BK9 A;  1E1H B;  3HI2 A;  3U78 A;  5J2T E;  5LG3 A;  3PU8 A;  5F8P A;  2E9X D;  4QX7 B;  4KUM B;  4U7I A;  4JI1 T;  2MPK A;  2XM1 A;  3AAA B;  1MIV A;  1YQ3 A;  2DI4 A;  2Q9Q B;  3I0Q A;  3R84 B;  3SS1 A;  4OX9 T;  5HAX A;  3N9O A;  3CQC B;  1XZY A;  4PJL A;  1ZKE A;  4AQF C;  4ZZC A;  1FIO A;  5LP6 E;  3KVB A;  3RRW A;  3PTR B;  2UUC T;  2M67 A;  2PTF A;  1IJ5 A;  4H9Q C;  4EOZ B;  1UGO A;  2H88 A;  3OTO T;  4ILU A;  4UEM A;  2UUB T;  4H9N C;  2L8K A;  4ZOL E;  3WAK A;  2W4X A;  1E2A A;  2CHO A;  2V7L A;  3O9X A;  1I94 T;  2WBL A;  3AEE A;  3EUH A;  4TNV A;  4ADZ A;  2LOS A;  4QH5 A;  2KT9 A;  3G06 A;  4U3C A;  5J2U E;  5LNK A;  2BBJ A;  3MZK B;  4XZC A;  1ZHC A;  4YJ2 E;  2BG9 B;  5EK2 A;  1WRD A;  1YW0 A;  2IAK A;  3PUS A;  2CWO A;  2LOP A;  3PUW F;  4IDQ A;  2NR4 A;  5E0O A;  3RIA A;  1T7S A;  4YTN A;  4YXD A;  2MBG A;  2H3R A;  4H9P C;  3QNU A;  4KMC A;  3ZJ1 A;  4TWH A;  4HFH A;  1QUU A;  5JRC B;  3L3P A;  4JI2 T;  2QYW A;  4IE0 A;  4L9I A;  4U74 A;  4IL4 A;  2X9H A;  1KNP A;  3PUX F;  5LG4 A;  3ZJ2 A;  1E7P A;  3LK4 2;  2WZI A;  1MMD A;  2MAW A;  4IHJ E;  1S35 A;  3AE3 A;  5L3B B;  3CML A;  1V9D A;  1ZP0 A;  1KNR A;  5AQS B;  2ZM0 A;  5FY1 A;  5DQW A;  3PUZ F;  3AE9 A;  3NRY A;  4LMJ A;  2ACX A;  2XQ6 A;  4EYY R;  2CMR A;  5L3D B;  3CX8 B;  2UXN B;  2PJQ A;  2Y6X A;  3UQ4 A;  5L3F B;  2VQE T;  1MND A;  4IGU A;  5FMN A;  3LDQ B;  5JDH A;  4UF0 B;  4MFR A;  2X0L B;  4MHC A;  2XAG B;  3RF1 A;  1CHU A;  2C5J A;  3CPZ A;  3FZH B;  3RH3 A;  3RYC E;  2W0G A;  2WB5 A;  3RYI E;  1B7T A;  3ANW A;  2ES0 A;  3GWH A;  3O1J A;  2XSB A;  4TWF A;  3TLV A;  4X20 E;  3V5S A;  2V5C A;  2E9X B;  2ODV A;  3C51 A;  3QB5 K;  2HN1 A;  3ZYM A;  2NTY A;  5J1G A;  5M4Y A;  3OYZ A;  2LKH A;  3RQW A;  3UU5 A;  4DUZ T;  1FJG T;  4H9O C;  4PNI A;  1U5P A;  3NRX A;  3ZC1 A;  4Q25 A;  1WR6 A;  5LBQ B;  4WW0 A;  3P4S A;  2MYS A;  1BR4 A;  1UUR A;  5JVD E;  1W0A A;  3ZCJ A;  3OYX A;  2DWK A;  4CN4 A;  3HA4 A;  5HEG A;  1D0X A;  1T72 A;  4YSZ A;  2A3D A;  3RC8 A;  4CXY A;  5LJM A;  5HEH A;  4BAY B;  3ESL A;  4GKK T;  4JI8 T;  3WI3 A;  3LJC A;  3TLT A;  4XBF B;  2ZMA A;  4H63 H;  2WS3 A;  4TUY E;  4LF4 T;  2VQF T;  2IDO B;  5ADX L;  4Z91 A;  2X0Y A;  3O4X E;  1FEW A;  2VKD A;  4MBQ A;  4JEH B;  4BA9 A;  2K5B B;  3C4X A;  5JR9 A;  5A1L A;  4NXN T;  2YIN A;  2HH7 A;  4ILC A;  4X5T A;  2DL1 A;  3S4U A;  2BDE A;  4JI5 T;  2ZM6 T;  5HXR A;  4LF9 T;  2CLY C;  5LMN T;  2CHN A;  3AE1 A;  3KBT A;  2I59 A;  2A72 A;  2C5K T;  4IL9 A;  2LHN A;  4ZHQ E;  3FHN A;  2OLT A;  5IUX A;  5CA0 E;  2M6B A;  2Q9Q A;  3L39 A;  4UVB B;  5FXZ A;  2EHO A;  1D1B A;  4AKR B;  1OXZ A;  3LSV A;  4DR3 T;  4KHP T;  5F3J A;  4PK4 A;  1WLX A;  3TLU A;  2WMO A;  2JMK A;  3PE0 A;  3EAM A;  1HG2 A;  3FZF B;  3JAD A;  3QC9 A;  4FI5 A;  4YTM A;  1YKH B;  4WBO A;  4ISS A;  4LF5 T;  3AVR A;  3RIU A;  2J4G A;  2XUE A;  4EYU A;  3ZMT B;  2LSG A;  1LVF A;  4CN6 A;  5IWA T;  3ZT6 A;  3ZEF B;  3ZT5 A;  1JNR A;  5HWY A;  4LF8 T;  4GKJ T;  4X1Y E;  4EAH A;  3LK2 B;  4P1N A;  3J9X 1;  3L09 A;  2QA7 A;  2XQ7 A;  3C4W A;  4HN9 A;  3QOF A;  5KMG P;  2DCF A;  2YU2 A;  5AQT B;  1R8I A;  4V1A v;  1J5W A;  3N9P A;  4KP3 C;  1KEY A;  3JC6 D;  3HKB E;  4HWC A;  1W09 A;  3TLS A;  3BQI A;  3AE2 A;  3AEF A;  2P9B A;  2D0U A;  2JIW A;  2IHR 1;  5DAB A;  3UUX B;  3VR8 A;  4A5X A;  1WYC A;  3I9Y A;  3PUV F;  2UXC T;  2CLY B;  2Z6E A;  2QVA A;  4I55 E;  3IHR A;  2IUB A;  2LRK A;  4LFB T;  3NZP A;  3EVY A;  3PUQ A;  3RIF A;  2JRK A;  2K3W A;  3UU4 A;  4DMW A;  3ZYK A;  2XQ3 A;  3ONL C;  4K0U A;  4AQF A;  1YXR A;  3HR0 A;  5AQQ B;  4AIU A;  5HXH A;  5L47 A;  5L2L A;  2F4V T;  1AJ3 A;  2G0U A;  2IIU A;  3PUY F;  1OED E;  5HCJ A;  4GYS A;  2M6I A;  2X9W A;  4X1K E;  2YEV C;  4AIS A;  1D0Y A;  1YKE B;  2BZB A;  1MNE A;  2JMH A;  5IYZ E;  3SWH A;  3H3A A;  3KVA A;  4AXP A;  3EDV A;  2LE8 A;  2LEH A;  1VCS A;  3FZK B;  3Q2M A;  5DJQ C;  5LA6 E;  3SOL A;  4DBR A;  5JDM A;  2VAS A;  5AQO B;  1M7K A;  2ZM2 A;  3P50 A;  3ANW B;  3NWI A;  5ETW A;  3AEG A;  1NWM X;  4PFP A;  4E7Z A;  2IML A;  3B57 A;  5LB7 B;  5FVK A;  2JPF A;  3H3M A;  4AQY T;  2AXD S;  2J47 A;  2WCA A;  1BR2 A;  2LSY A;  4LMK A;  2SPC A;  2V7J A;  3VU7 H;  5CGM A;  4X1I E;  3PJA J;  4LF6 T;  1OED B;  2H7V C;  3JAF A;  3KIN B;  4X64 T;  2KMF A;  3C98 B;  3F57 A;  3MKD A;  3MAC A;  4HFD A;  4PJN A;  5FL0 A;  3RKO A;  4E7S A;  1YD8 G;  2E9X C;  5HXE A;  3D0T A;  4YY3 T;  4DV1 T;  2YDS A;  2K24 A;  2EHO C;  2WDV A;  3AB3 B;  3CIR A;  3K3N A;  3K8P C;  4IDN A;  4O8S A;  4FJO A;  4JUY A;  4UVC B;  3TKL B;  5CJ5 A;  4DV5 T;  3K3Q C;  2A2F X;  3CKD A;  3AA0 B;  3M65 A;  5AQG B;  4C91 A;  4DVD A;  4U2Y A;  3RPU A;  4ANJ A;  2CCQ A;  4HWH A;  4DR2 T;  1HNZ T;  1BR0 A;  3LBX B;  1YQ4 A;  4QKN A;  4DV2 T;  3CWZ B;  2V26 A;  3AA1 B;  1Y64 B;  4HFV A;  4F6R C;  2YDR A;  5J0Z A;  2RP4 A;  4WBN E;  2GK9 A;  4LFA T;  2FJD A;  2DNX A;  3RQU A;  5LHH B;  4J2C A;  4CZZ B;  1FMV A;  2VKJ A;  4OYJ A;  3BQL A;  2YDQ A;  4PJJ A;  2C0S A;  4DUY T;  4LF7 T;  5KXJ A;  5AQN B;  4U31 A;  3AE7 A;  5FNV E;  5DQV A;  3ZYL A;  3Q9D A;  2CEA A;  3PUA A;  2IW5 B;  3J7Y q;  3AEC A;  2X9X A;  4IDZ A;  2WM9 A;  4C90 A;  5FYM A;  2AE9 A;  2HHH T;  1M62 A;  3ONJ A;  4DV7 T;  1IAP A;  3SRZ A;  1Z0P A;  2KWI B;  4HFC A;  1WFD A;  4PJM A;  4H63 V;  1HX8 A;  2CE7 A;  2LSI A;  3AEA A;  4AQG A;  5ABF A;  3GN5 B;  5FXV A;  5FY7 A;  2OA5 A;  2XQ4 A;  4IE7 A;  2YKS A;  1NAF A;  4GK0 E;  3ZLI A;  3RRC A;  5JDN A;  5HEU A;  1CUN A;  5LCY A;  2VL8 A;  2X66 A;  2IC6 A;  3PV0 F;  2N9D A;  4U33 A;  4COF A;  4DV0 T;  1SA0 E;  3A8Y C;  3ZSS A;  2VKO A;  2FBW A;  3E08 A;  4EB6 E;  1SHZ C;  4JLE A;  4N78 D;  2L3L A;  4HWF A;  1ZV4 X;  2LKG A;  5EK4 A;  4G63 A;  2E9X A;  2VVN A;  4YSX A;  3LFM A;  3IBP A;  5ABF B;  2XQ5 A;  1UX5 A;  2E5V A;  1G73 A;  4PK5 A;  1J1J A;  4PW8 A;  3AE6 A;  3PUR A;  3ZN1 B;  4YTP A;  5LHG B;  2V6Y A;  5AQH B;  3CK6 A;  4YSY A;  2CRB A;  5LMU T;  3F31 A;  4CN1 A;  4F8H A;  3FXE B;  3K3O A;  3OBV E;  5JDG A;  4OYK A;  1ZOY A;  3ZCI A;  4DV3 T;  2KZ7 B;  1XDP A;  1HX1 B;  2X51 A;  1HFA A;  1VCT A;  3UU8 A;  4JYA T;  1VOM A;  1MIW A;  2CXD A;  3P7I A;  4Z90 A;  4LFC T;  3HL6 A;  1XWM A;  5FXW A;  3RI5 A;  4ZEY A;  1HS7 A;  4I43 B;  4YLH A;  3Q5D A;  4QH1 A;  4LML A;  2ZM8 A;  4I0U A;  3VKH A;  5ABE A;  1LKX A;  2BS2 A;  2N2N A;  3KV5 A;  1U4Q A;  2X68 A;  3W15 B;  4PFO A;  4UEL A;  4DR5 T;  2BKP A;  3EHZ A;  2W61 A;  4GOU A;  1MMN A;  2NP9 A;  1J5E T;  2XAH B;  3LBX A;  4TV8 E;  4WNK A;  5FL1 A;  1T98 A;  1GQE A;  2XAJ B;  4ZS3 A;  2KSR A;  3N9L A;  4ZXL A;  3ZMU B;  1DU2 A;  4O4J E;  1IBM T;  2WSS V;  3DJB A;  1N36 T;  4DV4 T;  2J1D G;  2ODU A;  4CQI A;  4HFB A;  3KV6 A;  4IRE A;  4NPP A;  2V1D B;  5C8Y E;  3UUL A;  5L3G B;  3RX6 A;  4ZS2 A;  5CA1 E;  5L4H A;  1W0B A;  1W9R A;  2FJE A;  3KFW X;  3AXJ A;  4HE8 A;  3ZT7 A;  4EEB A;  4JV5 T;  4IDO A;  2XQA A;  1XNQ T;  3FB2 A;  2D2S A;  1N34 T;  3L8R A;  4TX5 A;  4UIG A;  3RC3 A;  5HYA A;  2YK0 A;  3Q5E A;  2X9Y A;  2CXL A;  5LGT B;  4U2Z A;  3PJA A;  5C2T A;  1HNX T;  3N9Q A;  1MMG A;  4QXB B;  4UF0 A;  3UU3 A;  5HWX A;  2BG9 E;  2OV9 A;  4ZI7 E;  2I0M A;  4JI6 T;  3Q5W A;  4A98 A;  2D5U A;  2NW8 A;  3KDS E;  3WAJ A;  4YT0 A;  1G8X A;  4QXC B;  4ASK A;  4DR1 T;  4CI1 B;  5AQR B;  3OJA A;  2L9Q A;  5FKY A;  3AAI A;  4ZI3 C;  2KIN B;  2XQ9 A;  2LHR A;  2MTQ A;  4U7Y A;  4ERR A;  1I6Z A;  2UXD T;  3RYF E;  2VK9 A;  5JRE A;  1LRZ A;  3E0Z A;  3AE5 A;  1HCI A;  2MOZ A;  1UUS A;  2LSK A;  4L0R A;  4P0B A;  1EZ3 A;  4JI7 T;  3GN5 A;  2KWH A;  3MA9 A;  5LYJ E;  3RHW A;  2XAF B;  1HR0 T;  4DID B;  1S94 A;  2XAQ B;  5BMV E;  2YN6 A;  2JQK A;  4B3R T;  2HPL A;  2ZLY A;  3N9M A;  1VRB A;  2XTL A;  3GMI A;  4JBW F;  4MAL A;  4QWN B;  5LBM A;  3UUB A;  4O4I E;  3ZN0 B;  4A97 A;  5LGN B;  2V8S V;  2VB6 A;  2Y48 B;  3Q5X A;  2WAU A;  4HFE A;  2CPT A;  1IBL T;  5JR9 C;  4QX8 B;  2XAS B;  3AXJ B;  5AQJ B;  2XHE B;  4EGW A;  2YOE A;  3HKE E;  2I6H A;  1ZEE A;  3EAB A;  2C5I T;  2LT3 A;  3DP7 A;  3HKC E;  2BS4 A;  3MJX A;  2VVS A;  3QK6 A;  3CX6 B;  4QH4 A;  4BJN A;  4IE5 A;  4O2B E;  4MLK A;  2V6X A;  1BR1 A;  4M1P A;  3RYH E;  1UCU A;  4X66 T;  1JNZ A;  1Y01 A;  2YU1 A;  4U72 A;  3SFE A;  4ZI2 C;  4ZI3 D;  3EDU A;  5AQM B;  3LK3 B;  5H6Q B;  5L3E B;  2DWG A;  3FBL A;  2FJA A;  3FBZ A;  2WQY A;  3O1I A;  3ZMZ B;  1UX4 A;  3U3I A;  5HEJ A;  1SE7 A;  3AED A;  4OK0 A;  2W63 A;  2BVL A;  5LHI B;  2CXF A;  2WDR A;  5JDQ A;  3ETU A;  3RIU C;  5FXX A;  4ZI2 D;  2BKN A; 
#chains in the Genus database with same CATH homology
 4WZX A;  2W2U A;  4U33 A;  2JQH A;  4ZEY A;  4U2Z A;  2XZE A;  5LB7 B;  2LRL A;  3ZSS A;  2CPT A;  5FVK A;  4A5X A;  2V6Y B;  4CN4 A;  5CGM A;  3EAB A;  3ZST A;  2LRK A;  4IT4 A;  2JQ9 A;  4U3C A;  2V6X A;  2K3W A;  4U7Y A;  2V6Y A;  4U31 A;  2WY2 A;  2CRB A;  1YXR A;  3K1S A;  4NIQ A;  5FVL A;  4CN1 A;  2RPA A;  4U7I A;  2WWV A;  2MPK A;  5CJ5 A;  4CN6 A;  3ZT6 A;  3ZT5 A;  1WFD A;  4U2Y A;  1WR0 A;  4P1N A;  1WCR A;  2JQK A;  3ZT7 A;  2A9U A;  2DL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...