2LRLA

Solution structures of the iia(chitobiose)-hpr complex of the n,n'-diacetylchitobiose branch of the escherichia coli phosphotransferase system
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
103
structure length
103
Chain Sequence
AEELEEVVMGLIINSGQARSLAYAALKQAKQGDFAAAKAMMDQSRMALNEAHLVQTKLIEGDAGEGKMKVSLVLVHAQLHLMTSMLARELITELIELHEKLKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords N,N'-diacetylchitobiose-specific phosphotransferase enzyme I
publication title Solution Structure of the IIAChitobiose-HPr Complex of the N,N'-Diacetylchitobiose Branch of the Escherichia coli Phosphotransferase System.
pubmed doi rcsb
source organism Escherichia coli
total genus 42
structure length 103
sequence length 103
chains with identical sequence B, C
ec nomenclature ec 2.7.1.-:
pdb deposition date 2012-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02255 PTS_IIA PTS system, Lactose/Cellobiose specific IIA subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2lrlA00
2CPTA 1YXRA 5FVKA 3ZSTA 5LB7B 3ZT6A 4U2ZA 4U3CA 2XZEA 2JQ9A 3ZT7A 3ZSSA 4IT4A 1WCRA 2A9UA 2LRKA 5CGMA 4P1NA 4U7IA 4U2YA 1WR0A 4WZXA 2W2UA 4CN4A 3K1SA 2JQHA 4CN1A 5CJ5A 4NIQA 1WFDA 2CRBA 2V6YA 3EABA 2V6YB 2K3WA 2WY2A 4A5XA 2V6XA 3ZT5A 4U7YA 4CN6A 4ZEYA 5FVLA 2LRLA 4U33A 4U31A 2WWVA 2RPAA 2DL1A 2JQKA 2MPKA
chains in the Genus database with same CATH superfamily
3CMLA 4DV4T 3EUHA 3ZMSB 3P4WA 3PUSA 3K3NA 2WZIA 1R8IA 2WP9A 2CBJA 2XAJB 2KWHA 2W4XA 4YTMA 5LHGB 4PJNA 3I9WA 4X62T 2JIWA 3UQ7A 5FY0A 2B76A 3UU8A 2XUEA 3MA9A 2ACXA 2Q9QD 3RRCA 3F57A 4UEMA 3CVRA 1Y01A 3UUNA 3IEEA 5LGTB 4IE4A 3H3AA 4HWCA 2DCFA 5TAOA 4JV5T 1KEYA 4EYYR 3AXJA 3QK6A 4EAHA 3MKDA 3ZJ2A 3K1SA 3H37A 2L9QA 2W63A 2WCAA 4LMLA 5FNVE 2YDRA 2ZLYA 3N9OA 4QKNA 2E2AA 3AA0B 1VCSA 4DIDB 2A9UA 2XJ7A 2NTXA 3P8CD 2J47A 2WMOA 4LF7T 3V5SA 2QRXA 4TWDA 2QA7A 5J1GA 4KX6A 5AQTB 1HX1B 2Y48B 1GQEA 4LFCT 3MXZA 4XAXB 1B7TA 4ILCA 3HKCE 2WAUA 5J2UE 1XNQT 4NUUA 4X1IE 1OWAA 5ABGA 4ZXLA 3VR9A 3J7Yq 5KMGP 3ZYLA 2XZEA 4IT4A 4IDZA 3CK6A 3NBXX 5JDQA 3O1JA 2V7KA 1D0ZA 2KINB 5ABFB 3NKZA 3WI3A 4YSXA 5HEUA 3Q5WA 4EOZB 4UXNB 4L9IA 3ZMUB 4QXHB 4LF8T 1UK5A 2JMHA 4LFAT 2IMLA 5LNKA 1YD8G 3ZN1B 4AKGA 5BR8T 2FJDA 2CXFA 3JAEA 5H6QB 2X0LB 3KBUA 5JDMA 4QX8B 5HCMA 1W9RA 2WDQA 3FBLA 4GKKT 5AQOB 2A72A 4ZZCA 3OKQA 1UX4A 3C4WA 3ZYKA 2JRKA 2K5BB 3F31A 3PUZF 5KDMC 2AXDS 3EAMA 3ETUA 4DBRA 3MK7C 3RGLA 2LKGA 2E5VA 1ZHCA 3JAFA 3FZKB 5AQVB 3VU7H 4JEUB 4JYAT 4U31A 1ZOYA 3OYZA 4DV6T 4P09A 3MJXA 4HFBA 4KBMB 4KI0F 4EIWA 1T72A 5AQGB 3FZHB 1JNRA 3I9YA 2WMNA 4TWFA 4IDPA 4IDQA 4GIWA 5HEGA 5BMVE 4B6XA 4V1Av 5C2TA 3CX8B 4YLHA 2MBGA 3HI2A 5FY7A 3NRYA 4A5XA 4AQFC 4HFIA 5JDHA 3FB2A 5LJNA 4GK5E 2V7LA 5HXCA 3ZT7A 3O4XE 4IL4A 2I6HA 5JDGA 5L4EA 1YW0A 5AQUB 1MIYA 2CA5A 4PK5A 5L3FB 1NWMX 3AE1A 2ES0A 4CI2B 5HWYA 3NZPA 2VQFT 1MMDA 2BVLA 2JMKA 1XMQT 4X66T 3B13A 4QH1A 5FXVA 2HN2A 2ODUA 3L3PA 4O4LE 4HWDA 1UX5A 5JDNA 3K3OA 1T98A 2V7JA 5IWAT 4AKIA 3AA1B 5L4HA 1UURA 4TWHA 2CHNA 4DR3T 2QYWA 4PJMA 3A7MA 1FJGT 2IHR1 2FUPA 4AIUA 1HG2A 3OTOT 4ZS2A 3DJBA 4GKJT 3ZC0A 3AAAB 1MNDA 4LMKA 2V6YB 3ZMTB 1SA0E 3T8OA 5JVDE 4JBWF 1CUNA 2CPTA 2HPJA 1HS7A 2OA5A 2KWIB 3T1HT 4DV1T 1ZEEA 3BQIA 3OYXA 4WZXA 2JQHA 4M1PA 4OK0A 3KVAA 2WDVA 3P4PA 4UELA 1T8BA 4MFRA 3RC8A 4AISA 4MBQA 2Q9QA 1YQ4A 2Q9QC 3SFDA 3AE5A 2BBHA 1U5PA 2BS3A 2E9XB 2ZM8A 5F5WA 2KXPB 4HWIB 2CLYC 2CBIA 4LMJA 2PBIA 3AB3B 4DNDA 4IHJE 2DWGA 4YTNA 5GONE 2WBLA 4HFDA 4MALA 1BR4A 5E0OA 2OV9A 2JQQA 3DTOA 1FIOA 3PURA 4EEBA 1MMNA 4CZZB 5HXHA 2VKDA 2JQKA 3G06A 5HEHA 3FZMB 2EHOB 3LBXA 2NW7A 3LK2B 1HFAA 1XDOA 2WB5A 2WS3A 1WRDA 2CWOA 4MHCA 5LJMA 4ZI2C 1WLXA 4IE7A 3J9X1 2LSJA 5C8YE 2WSSV 2RPAA 2BKNA 1BR0A 1OEDA 4IIJE 2V8SV 1OEDC 2X0HA 3WAKA 1KK7A 3CQXC 3TKLB 2KNDA 4JI3T 2FJAA 4LFBT 3ZSTA 5AFUL 4OYKA 2VASA 3UT5E 1G8XA 4XZCA 4AKRB 3AE7A 3AE4A 2HPLA 5LBMA 1J5WA 4TNVA 3A8YC 2H3RA 5HEOA 2CRBA 2X67A 1NENA 5FL0A 5L3EB 3S4UA 3KFWX 2VVNA 4AKHA 2UU9T 3LG7A 3ZSSA 4DR1T 2OLTA 1UGOA 1X9BA 3QUJA 3N9NA 2LSIA 4COFA 1WYCA 5JDFA 2BG9B 4YTPA 3ONJA 3CQCB 5LG3A 3AE3A 1MIVA 4YXDA 2DLRA 4EGWA 2IDOB 3AEGA 5CGMA 3BK9A 2LSYA 4L5GA 3ESLA 4ERRA 4JI7T 3EABA 3UU4A 5AQLB 4DMVA 2WU5A 2CXDA 3CWZB 3RQWA 5JR9B 4YSYA 3IBPA 3MZKB 3ZT6A 2W00A 1M7KA 3CPZA 1XNRT 4EEDA 1X79A 3CQGB 1HCIA 1XZYA 4U72A 5AQRB 4NUVA 2VKJA 2IIUA 4ZI7E 2K24A 4U7IA 4ISSA 1MIWA 3TLUA 4Z90A 4PJLA 2D0TA 3ZYMA 4CN1A 2ODVA 3AVSA 3SWHA 2ZM2A 2K48A 2C5IT 2X66A 5LHIB 5AQIB 2R6GF 4U74A 3ZMZB 2UXDT 3AXJB 1M62A 5HCJA 3C4XA 3L09A 3PJAA 2Z6EA 1LVKA 4A97A 2D9DA 4HEAA 1XWMA 4CQIA 4AI6A 4DR5T 1KNPA 2YINA 2N9DA 4IDOA 4G2AA 5L2LA 1I6ZA 1ZV4X 4ZI2D 4U3CA 4ZI3C 2AE9A 5AQQB 3UQ4A 3Q9DA 4E7SA 2YDQA 4WBNE 5AQJB 4NIQA 2V5CA 2XQ5A 2FJBA 3CKDA 4ZEYA 1FMWA 2WWVA 1US7B 3A5XA 4CXWA 3NRXA 1HF8A 3E0ZA 1O3XA 3PUXF 3Q2MA 3C51A 4JUYA 1VCTA 4UF0B 4YFSA 5CA0E 5LG4A 2BKPA 3RYHE 3QOFA 3EHZA 2HHHT 3QC9A 4UV8B 3F2EA 2UUBT 5DQVA 1S94A 4BAYB 3ZLIA 4PW8A 5C3JA 3I1AA 1IJ6A 4LF6T 4H9NC 2XQ4A 4OHFA 4X1KE 1WFDA 3SS1A 4PFPA 3PUVF 2XAQB 1W0BA 4DR4T 4HFVA 3N9PA 1NEKA 4CN4A 2K9AA 5L3DB 2F4VT 3IHRA 3HKBE 3PUAA 3I0QA 4QH4A 3HR0A 1HTJF 3KVBA 4H9OC 4DV3T 3BQKA 2DWKA 2LKHA 4DV5T 1OEDE 5FP3A 2XTLA 1WR0A 4QH5A 3LSVA 3UU3A 3GMIA 2CEAA 2IAKA 5LXTE 2LSKA 4TV8E 4ZHQE 3OPCA 3OJAA 4YHJA 5ABHA 4WNKA 2VKHA 3P7IA 4HKAA 5EZYE 3ANWB 3SOLA 3P50A 3SFEA 1VRBA 4YJ2E 4ZOLE 3FZLB 3C50A 4EB6E 2LOSA 2W67A 1SUMB 4O8SA 1XMOT 3UUMA 4C90A 3FHNA 2HH7A 2XY8B 5JQGE 3PUWF 4UVBB 4AQFA 1AJ3A 5L3GB 4MLKA 2H7OA 3N9MA 4ZZBA 4I4TE 4JI5T 2PTFA 3FXEB 2CMRA 4GYRA 4NXNT 4IGUA 3U78A 4ZI3D 3RIAA 1WYBA 3PUYF 4DO0A 4JI8T 3PDYA 1IBLT 2X9HA 5ADXL 5L3BB 4OX9T 2XPKA 2CHOA 2XQ8A 4HTEA 5IHYA 1HR0T 2V7IA 5F3JA 5HXEA 3W15B 3JADA 4O2AE 4DUYT 4IE5A 2UXNB 4ILAA 2NOXA 3AEBA 4IDNA 3L8RA 4LF5T 3KBTA 3WAJA 2V1DB 4GOUA 4I0UA 2XM1A 4UVAB 1KF6A 2DNXA 4K0KT 2V6YA 3JCFA 2NW8A 3PE0A 4PK4A 5FXXA 4IE6A 2UXXB 1LVFA 2HN1A 3Q5XA 4QHOA 5HWXA 5CA1E 5DJQC 1KFYA 2YDSA 3UTKA 4X65T 2GK9A 3O1IA 3T1YT 3ZCIA 3ZC1A 2D2SA 3GN5B 2VL0A 1IBKT 3E22E 5HYAA 1D1AA 1YXRA 4HWFA 4TZ4C 3RPUA 4HFCA 5KX5E 2J4GA 3H3MA 4UR9A 2CM0A 2MYSA 4DUZT 3KV5A 5EK4A 2E9XC 2ZM6T 1UUSA 1FEWA 4I43B 3E08A 4H9RC 4B3TT 2IC9A 3AE9A 4EYUA 5FVLA 3ONLC 2B1EA 4I55E 2MPKA 2J62A 1MMGA 2VKOA 4TN7B 2XM2A 2LSGA 2N2NA 1XDPA 2WZHA 3N5LA 2LOPA 4U33A 4KMCA 3PUQA 3PU3A 3AEFA 2D5UA 3PTRB 3LDQB 3KDSE 2RP4A 2BKOA 4DV0T 5LMNT 2EHOC 3HA4A 5DQWA 2D0UA 3NZQA 2XAFB 3TLVA 3QNUA 3RIUC 5AQFB 2BDEA 5FVKA 5EK3A 3CX6B 5HAXA 4H63V 4JI1T 4IE0A 2XQAA 4NPPA 3Q5EA 4ZS3A 3RHWA 3RQUA 3O9XA 4H63H 3KV6A 1BR2A 1S35A 4QX7B 3RH3A 2E8IA 1YQ3A 1ZKEA 2IC6A 4ISTA 1LRZA 2A3DA 4UIGA 4CI3B 2CXLA 3EI0A 2W2UA 2M67A 2PG8A 3U3IA 1HX8A 4K0UA 4X64T 3SRZA 3I0OA 5L47A 2W62A 3PUGA 4OYJA 2DI4A 2WWUA 2YK0A 2H7VC 4TUYE 5ETWA 1G73A 5LP6E 4IREA 2XSAA 5FL1A 5AQNB 1YKHB 2UXBT 3ZT5A 2BG9C 1MNEA 1D1BA 3AVRA 2KLQA 3CX7B 5JRCB 3EDUA 2XAGB 2KZ7B 5F8PA 2WDRA 4YT0A 4BJNA 3AE2A 3VR8A 3P4SA 2X9WA 2LM9A 2VQET 3ABVA 1SE7A 2Y8DA 3N2OA 4U7YA 4QXBB 3C64A 5JR9C 3VRBA 2ZMAA 2H89A 1VOMA 2MOZA 1WCRA 4I50E 2WM9A 3OBVE 5J2TE 4DVDA 3RLFF 5JH7E 4YSZA 2WY2A 3VKGA 4E7ZA 2E9XD 2LRLA 4EV6A 2XQ3A 3MACA 2XASB 4UVCB 3EDVA 4KP3C 4O4HE 2NP9A 3UUXB 3L39A 3RF1A 1N34T 3FXDB 1IZNB 2C5KT 5L3CB 2IW5B 3LK3B 3AEEA 3HKDE 5LCYA 5LMUT 2I59A 5AQHB 5FXZA 4B3ST 1QLBA 3P4QA 3M3ZB 2MTQA 1N32T 3AE8A 1OXZA 2LT3A 3RYIE 5AQKB 2NW9A 1MMAA 4BJMA 4XBFB 3ZN0B 3AEDA 1J1JA 2EHOD 2LE8A 4CI1B 2XSBA 4A98A 2JPFA 2LHNA 3ZPOA 3ONXA 4HFHA 3ETVA 2X51A 4P1NA 4LF4T 4O2BE 4P0BA 4G63A 4CXYA 4B3RT 4X20E 1D0XA 1IBMT 4QWNB 4A56A 3IA3A 3O1HA 3RRWA 3UFEA 3N2GE 4H9SE 4JEHB 2FJEA 5ABFA 4UF0A 2VWAA 1YKEB 4BA9A 2LJLA 5AQSB 3GWHA 3RYFE 1KNRA 5IUXA 1N33T 4AQGA 1IJ5A 3HL6A 4DBQA 4GYSA 2NTYA 3UFGA 2P9BA 3AA6B 3ZKRA 2M6BA 2BVMA 3C98B 5EK2A 2H88A 2LLYA 3R84B 2VURA 1Z0PA 3KINB 4U2YA 4P0AA 2V26A 5KXJA 3AAEB 2WQYA 1HNWT 4TX5A 1WR6A 3ZMVB 3RKOA 4LF9T 3RYCE 4DR2T 2VL8A 2CCQA 3TLWA 1HNZT 3RKGA 4ILUA 4Q25A 3VKHA 3V5UA 3CIRA 2ZM0A 4H9PC 4EZHA 2KSRA 5M4YA 4KHZF 5IYZE 2Y6XA 3UU5A 4O4JE 4OFZA 3ANWA 2MAWA 2J1DG 2C5JA 4EXTA 4PAGA 2N1GA 3M65A 2BBJA 1SHZC 3PU8A 5FY1A 2XQYA 5CFBA 5LB7B 3TLTA 4JI6T 3LJCA 4PK6A 2NR4A 4Z8XA 1N36T 4HFEA 5AQMB 2BG9E 3ZCJA 5FKYA 2V6XA 3FBZA 3AEAA 3JC6C 5J0ZA 4GK0E 4DV2T 3PV0F 2XHEB 3Q5DA 5JTGA 1UCUA 4AXPA 1BR1A 5FXWA 4JI2T 4JI4T 2A2FX 2YEVC 4KHPT 2V5DA 4ILBA 4N78D 2SPCA 3TLSA 2ACZA 2JQ9A 3C4ZA 5ABEA 3LK42 4TNWA 2L3LA 2LEHA 5CJ5A 4X1YE 5DABA 4CXXA 2X9YA 3LFMA 3QB5A 2WU2A 4U2ZA 1HNXT 2BS2A 1D0YA 4HE8A 1D1CA 3UU6A 4PNIA 3FZFB 2W66A 2X0YA 4ADZA 4FI5A 1CHUA 1QSDA 4HGAA 3N2KE 2YN6A 4DR6T 1E2AA 1V9DA 4J2CA 2QVAA 1Z8UA 5LOVE 5LA6E 5LHHB 1NAFA 3GN5A 5JDLA 2BZBA 3UUBA 2FBWA 2BS4A 2LM2A 2E9XA 2YKSA 5FMNA 4H9QC 4JI0T 5LGNB 4PJJA 2VVSA 3VHLA 4ASKA 5LGUB 4PFOA 3HKEE 2IUBA 5CB4E 1Y64B 4KUMB 1J5ET 3B5MA 1U4QA 4L0RA 2XQ9A 4QXCB 4JLEA 2Q9QB 2KT9A 2X68A 1T7SA 3RC3A 1HG5A 3N9QA 2LHRA 3B57A 4C91A 2CLYB 2UXCT 3RIFA 2XQ7A 2CWYA 4DR7T 4EZ4A 3EVYA 3N9LA 1L0VA 1FMVA 3AA7B 3ZEFB 4AKLA 3OVUA 4WYVA 2DHRA 1W0AA 2VK9A 3RI5A 4YY3T 2NWBA 1KNZA 2EHOA 2E5LT 4TV9E 1DU2A 1LKXA 2K3WA 3RIUA 4Z91A 2YU1A 1EZ3A 4UV9B 4F8HA 3JC6D 3BQLA 2LRKA 3AAIA 1E1HB 3K8PC 3LBXB 2CE7A 2UUAT 4WW0A 1ZP0A 4IL9A 2C0SA 2YOEA 2W0GA 2DL1A 2QGSA 1H7CA 4HN9A 4O4IE 3IF8B 5LBQB 3X1DA 1OEDB 3NWIA 2I0MA 5HXSA 2X9XA 5A1LA 3VRAA 4F6RC 2XAHB 4ANJA 4YJ3E 5FYMA 2L8KA 5H6RB 5AQPB 4DV7T 3RX6A 3DP7A 1IAPA 2G0UA 1QUUA 5HXRA 2KMFA 3P4RA 2V7MA 2PFVA 5JREA 2RA1A 2YU2A 1E7PA 3AECA 3D0TA 4NXMT 4B3MT 2W61A 3KV4A 4DMWA 2PJQA 4AQYT 3R6NA 2VB6A 2BG9A 3ZJ1A 2M6IA 1I94T 4CN6A 5JRCA 3PJAJ 2UUCT 3UULA 2JJ9A 3QB5K 5LYJE 4FJOA 3AE6A 3NVOA 3K3QC 1W09A 3GA8A 4HWHA 4YHHT 1JNZA 5JR9A 4X5TA 3KV9A 5HEJA 4WBOA 2XQ6A
chains in the Genus database with same CATH topology
2CPTA 1YXRA 5FVKA 3ZSTA 5LB7B 3ZT6A 4U2ZA 4U3CA 2XZEA 2JQ9A 3ZT7A 3ZSSA 4IT4A 1WCRA 2A9UA 2LRKA 5CGMA 4P1NA 4U7IA 4U2YA 1WR0A 4WZXA 2W2UA 4CN4A 3K1SA 2JQHA 4CN1A 5CJ5A 4NIQA 1WFDA 2CRBA 2V6YA 3EABA 2V6YB 2K3WA 2WY2A 4A5XA 2V6XA 3ZT5A 4U7YA 4CN6A 4ZEYA 5FVLA 2LRLA 4U33A 4U31A 2WWVA 2RPAA 2DL1A 2JQKA 2MPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CPT A;  1YXR A;  5FVK A;  3ZST A;  5LB7 B;  3ZT6 A;  4U2Z A;  4U3C A;  2XZE A;  2JQ9 A;  3ZT7 A;  3ZSS A;  4IT4 A;  1WCR A;  2A9U A;  2LRK A;  5CGM A;  4P1N A;  4U7I A;  4U2Y A;  1WR0 A;  4WZX A;  2W2U A;  4CN4 A;  3K1S A;  2JQH A;  4CN1 A;  5CJ5 A;  4NIQ A;  1WFD A;  2CRB A;  2V6Y A;  3EAB A;  2V6Y B;  2K3W A;  2WY2 A;  4A5X A;  2V6X A;  3ZT5 A;  4U7Y A;  4CN6 A;  4ZEY A;  5FVL A;  2LRL A;  4U33 A;  4U31 A;  2WWV A;  2RPA A;  2DL1 A;  2JQK A;  2MPK A; 
#chains in the Genus database with same CATH topology
 3CML A;  4DV4 T;  3EUH A;  3ZMS B;  3P4W A;  3PUS A;  3K3N A;  2WZI A;  1R8I A;  2WP9 A;  2CBJ A;  2XAJ B;  2KWH A;  2W4X A;  4YTM A;  5LHG B;  4PJN A;  3I9W A;  4X62 T;  2JIW A;  3UQ7 A;  5FY0 A;  2B76 A;  3UU8 A;  2XUE A;  3MA9 A;  2ACX A;  2Q9Q D;  3RRC A;  3F57 A;  4UEM A;  3CVR A;  1Y01 A;  3UUN A;  3IEE A;  5LGT B;  4IE4 A;  3H3A A;  4HWC A;  2DCF A;  5TAO A;  4JV5 T;  1KEY A;  4EYY R;  3AXJ A;  3QK6 A;  4EAH A;  3MKD A;  3ZJ2 A;  3K1S A;  3H37 A;  2L9Q A;  2W63 A;  2WCA A;  4LML A;  5FNV E;  2YDR A;  2ZLY A;  3N9O A;  4QKN A;  2E2A A;  3AA0 B;  1VCS A;  4DID B;  2A9U A;  2XJ7 A;  2NTX A;  3P8C D;  2J47 A;  2WMO A;  4LF7 T;  3V5S A;  2QRX A;  4TWD A;  2QA7 A;  5J1G A;  4KX6 A;  5AQT B;  1HX1 B;  2Y48 B;  1GQE A;  4LFC T;  3MXZ A;  4XAX B;  1B7T A;  4ILC A;  3HKC E;  2WAU A;  5J2U E;  1XNQ T;  4NUU A;  4X1I E;  1OWA A;  5ABG A;  4ZXL A;  3VR9 A;  3J7Y q;  5KMG P;  3ZYL A;  2XZE A;  4IT4 A;  4IDZ A;  3CK6 A;  3NBX X;  5JDQ A;  3O1J A;  2V7K A;  1D0Z A;  2KIN B;  5ABF B;  3NKZ A;  3WI3 A;  4YSX A;  5HEU A;  3Q5W A;  4EOZ B;  4UXN B;  4L9I A;  3ZMU B;  4QXH B;  4LF8 T;  1UK5 A;  2JMH A;  4LFA T;  2IML A;  5LNK A;  1YD8 G;  3ZN1 B;  4AKG A;  5BR8 T;  2FJD A;  2CXF A;  3JAE A;  5H6Q B;  2X0L B;  3KBU A;  5JDM A;  4QX8 B;  5HCM A;  1W9R A;  2WDQ A;  3FBL A;  4GKK T;  5AQO B;  2A72 A;  4ZZC A;  3OKQ A;  1UX4 A;  3C4W A;  3ZYK A;  2JRK A;  2K5B B;  3F31 A;  3PUZ F;  5KDM C;  2AXD S;  3EAM A;  3ETU A;  4DBR A;  3MK7 C;  3RGL A;  2LKG A;  2E5V A;  1ZHC A;  3JAF A;  3FZK B;  5AQV B;  3VU7 H;  4JEU B;  4JYA T;  4U31 A;  1ZOY A;  3OYZ A;  4DV6 T;  4P09 A;  3MJX A;  4HFB A;  4KBM B;  4KI0 F;  4EIW A;  1T72 A;  5AQG B;  3FZH B;  1JNR A;  3I9Y A;  2WMN A;  4TWF A;  4IDP A;  4IDQ A;  4GIW A;  5HEG A;  5BMV E;  4B6X A;  4V1A v;  5C2T A;  3CX8 B;  4YLH A;  2MBG A;  3HI2 A;  5FY7 A;  3NRY A;  4A5X A;  4AQF C;  4HFI A;  5JDH A;  3FB2 A;  5LJN A;  4GK5 E;  2V7L A;  5HXC A;  3ZT7 A;  3O4X E;  4IL4 A;  2I6H A;  5JDG A;  5L4E A;  1YW0 A;  5AQU B;  1MIY A;  2CA5 A;  4PK5 A;  5L3F B;  1NWM X;  3AE1 A;  2ES0 A;  4CI2 B;  5HWY A;  3NZP A;  2VQF T;  1MMD A;  2BVL A;  2JMK A;  1XMQ T;  4X66 T;  3B13 A;  4QH1 A;  5FXV A;  2HN2 A;  2ODU A;  3L3P A;  4O4L E;  4HWD A;  1UX5 A;  5JDN A;  3K3O A;  1T98 A;  2V7J A;  5IWA T;  4AKI A;  3AA1 B;  5L4H A;  1UUR A;  4TWH A;  2CHN A;  4DR3 T;  2QYW A;  4PJM A;  3A7M A;  1FJG T;  2IHR 1;  2FUP A;  4AIU A;  1HG2 A;  3OTO T;  4ZS2 A;  3DJB A;  4GKJ T;  3ZC0 A;  3AAA B;  1MND A;  4LMK A;  2V6Y B;  3ZMT B;  1SA0 E;  3T8O A;  5JVD E;  4JBW F;  1CUN A;  2CPT A;  2HPJ A;  1HS7 A;  2OA5 A;  2KWI B;  3T1H T;  4DV1 T;  1ZEE A;  3BQI A;  3OYX A;  4WZX A;  2JQH A;  4M1P A;  4OK0 A;  3KVA A;  2WDV A;  3P4P A;  4UEL A;  1T8B A;  4MFR A;  3RC8 A;  4AIS A;  4MBQ A;  2Q9Q A;  1YQ4 A;  2Q9Q C;  3SFD A;  3AE5 A;  2BBH A;  1U5P A;  2BS3 A;  2E9X B;  2ZM8 A;  5F5W A;  2KXP B;  4HWI B;  2CLY C;  2CBI A;  4LMJ A;  2PBI A;  3AB3 B;  4DND A;  4IHJ E;  2DWG A;  4YTN A;  5GON E;  2WBL A;  4HFD A;  4MAL A;  1BR4 A;  5E0O A;  2OV9 A;  2JQQ A;  3DTO A;  1FIO A;  3PUR A;  4EEB A;  1MMN A;  4CZZ B;  5HXH A;  2VKD A;  2JQK A;  3G06 A;  5HEH A;  3FZM B;  2EHO B;  3LBX A;  2NW7 A;  3LK2 B;  1HFA A;  1XDO A;  2WB5 A;  2WS3 A;  1WRD A;  2CWO A;  4MHC A;  5LJM A;  4ZI2 C;  1WLX A;  4IE7 A;  3J9X 1;  2LSJ A;  5C8Y E;  2WSS V;  2RPA A;  2BKN A;  1BR0 A;  1OED A;  4IIJ E;  2V8S V;  1OED C;  2X0H A;  3WAK A;  1KK7 A;  3CQX C;  3TKL B;  2KND A;  4JI3 T;  2FJA A;  4LFB T;  3ZST A;  5AFU L;  4OYK A;  2VAS A;  3UT5 E;  1G8X A;  4XZC A;  4AKR B;  3AE7 A;  3AE4 A;  2HPL A;  5LBM A;  1J5W A;  4TNV A;  3A8Y C;  2H3R A;  5HEO A;  2CRB A;  2X67 A;  1NEN A;  5FL0 A;  5L3E B;  3S4U A;  3KFW X;  2VVN A;  4AKH A;  2UU9 T;  3LG7 A;  3ZSS A;  4DR1 T;  2OLT A;  1UGO A;  1X9B A;  3QUJ A;  3N9N A;  2LSI A;  4COF A;  1WYC A;  5JDF A;  2BG9 B;  4YTP A;  3ONJ A;  3CQC B;  5LG3 A;  3AE3 A;  1MIV A;  4YXD A;  2DLR A;  4EGW A;  2IDO B;  3AEG A;  5CGM A;  3BK9 A;  2LSY A;  4L5G A;  3ESL A;  4ERR A;  4JI7 T;  3EAB A;  3UU4 A;  5AQL B;  4DMV A;  2WU5 A;  2CXD A;  3CWZ B;  3RQW A;  5JR9 B;  4YSY A;  3IBP A;  3MZK B;  3ZT6 A;  2W00 A;  1M7K A;  3CPZ A;  1XNR T;  4EED A;  1X79 A;  3CQG B;  1HCI A;  1XZY A;  4U72 A;  5AQR B;  4NUV A;  2VKJ A;  2IIU A;  4ZI7 E;  2K24 A;  4U7I A;  4ISS A;  1MIW A;  3TLU A;  4Z90 A;  4PJL A;  2D0T A;  3ZYM A;  4CN1 A;  2ODV A;  3AVS A;  3SWH A;  2ZM2 A;  2K48 A;  2C5I T;  2X66 A;  5LHI B;  5AQI B;  2R6G F;  4U74 A;  3ZMZ B;  2UXD T;  3AXJ B;  1M62 A;  5HCJ A;  3C4X A;  3L09 A;  3PJA A;  2Z6E A;  1LVK A;  4A97 A;  2D9D A;  4HEA A;  1XWM A;  4CQI A;  4AI6 A;  4DR5 T;  1KNP A;  2YIN A;  2N9D A;  4IDO A;  4G2A A;  5L2L A;  1I6Z A;  1ZV4 X;  4ZI2 D;  4U3C A;  4ZI3 C;  2AE9 A;  5AQQ B;  3UQ4 A;  3Q9D A;  4E7S A;  2YDQ A;  4WBN E;  5AQJ B;  4NIQ A;  2V5C A;  2XQ5 A;  2FJB A;  3CKD A;  4ZEY A;  1FMW A;  2WWV A;  1US7 B;  3A5X A;  4CXW A;  3NRX A;  1HF8 A;  3E0Z A;  1O3X A;  3PUX F;  3Q2M A;  3C51 A;  4JUY A;  1VCT A;  4UF0 B;  4YFS A;  5CA0 E;  5LG4 A;  2BKP A;  3RYH E;  3QOF A;  3EHZ A;  2HHH T;  3QC9 A;  4UV8 B;  3F2E A;  2UUB T;  5DQV A;  1S94 A;  4BAY B;  3ZLI A;  4PW8 A;  5C3J A;  3I1A A;  1IJ6 A;  4LF6 T;  4H9N C;  2XQ4 A;  4OHF A;  4X1K E;  1WFD A;  3SS1 A;  4PFP A;  3PUV F;  2XAQ B;  1W0B A;  4DR4 T;  4HFV A;  3N9P A;  1NEK A;  4CN4 A;  2K9A A;  5L3D B;  2F4V T;  3IHR A;  3HKB E;  3PUA A;  3I0Q A;  4QH4 A;  3HR0 A;  1HTJ F;  3KVB A;  4H9O C;  4DV3 T;  3BQK A;  2DWK A;  2LKH A;  4DV5 T;  1OED E;  5FP3 A;  2XTL A;  1WR0 A;  4QH5 A;  3LSV A;  3UU3 A;  3GMI A;  2CEA A;  2IAK A;  5LXT E;  2LSK A;  4TV8 E;  4ZHQ E;  3OPC A;  3OJA A;  4YHJ A;  5ABH A;  4WNK A;  2VKH A;  3P7I A;  4HKA A;  5EZY E;  3ANW B;  3SOL A;  3P50 A;  3SFE A;  1VRB A;  4YJ2 E;  4ZOL E;  3FZL B;  3C50 A;  4EB6 E;  2LOS A;  2W67 A;  1SUM B;  4O8S A;  1XMO T;  3UUM A;  4C90 A;  3FHN A;  2HH7 A;  2XY8 B;  5JQG E;  3PUW F;  4UVB B;  4AQF A;  1AJ3 A;  5L3G B;  4MLK A;  2H7O A;  3N9M A;  4ZZB A;  4I4T E;  4JI5 T;  2PTF A;  3FXE B;  2CMR A;  4GYR A;  4NXN T;  4IGU A;  3U78 A;  4ZI3 D;  3RIA A;  1WYB A;  3PUY F;  4DO0 A;  4JI8 T;  3PDY A;  1IBL T;  2X9H A;  5ADX L;  5L3B B;  4OX9 T;  2XPK A;  2CHO A;  2XQ8 A;  4HTE A;  5IHY A;  1HR0 T;  2V7I A;  5F3J A;  5HXE A;  3W15 B;  3JAD A;  4O2A E;  4DUY T;  4IE5 A;  2UXN B;  4ILA A;  2NOX A;  3AEB A;  4IDN A;  3L8R A;  4LF5 T;  3KBT A;  3WAJ A;  2V1D B;  4GOU A;  4I0U A;  2XM1 A;  4UVA B;  1KF6 A;  2DNX A;  4K0K T;  2V6Y A;  3JCF A;  2NW8 A;  3PE0 A;  4PK4 A;  5FXX A;  4IE6 A;  2UXX B;  1LVF A;  2HN1 A;  3Q5X A;  4QHO A;  5HWX A;  5CA1 E;  5DJQ C;  1KFY A;  2YDS A;  3UTK A;  4X65 T;  2GK9 A;  3O1I A;  3T1Y T;  3ZCI A;  3ZC1 A;  2D2S A;  3GN5 B;  2VL0 A;  1IBK T;  3E22 E;  5HYA A;  1D1A A;  1YXR A;  4HWF A;  4TZ4 C;  3RPU A;  4HFC A;  5KX5 E;  2J4G A;  3H3M A;  4UR9 A;  2CM0 A;  2MYS A;  4DUZ T;  3KV5 A;  5EK4 A;  2E9X C;  2ZM6 T;  1UUS A;  1FEW A;  4I43 B;  3E08 A;  4H9R C;  4B3T T;  2IC9 A;  3AE9 A;  4EYU A;  5FVL A;  3ONL C;  2B1E A;  4I55 E;  2MPK A;  2J62 A;  1MMG A;  2VKO A;  4TN7 B;  2XM2 A;  2LSG A;  2N2N A;  1XDP A;  2WZH A;  3N5L A;  2LOP A;  4U33 A;  4KMC A;  3PUQ A;  3PU3 A;  3AEF A;  2D5U A;  3PTR B;  3LDQ B;  3KDS E;  2RP4 A;  2BKO A;  4DV0 T;  5LMN T;  2EHO C;  3HA4 A;  5DQW A;  2D0U A;  3NZQ A;  2XAF B;  3TLV A;  3QNU A;  3RIU C;  5AQF B;  2BDE A;  5FVK A;  5EK3 A;  3CX6 B;  5HAX A;  4H63 V;  4JI1 T;  4IE0 A;  2XQA A;  4NPP A;  3Q5E A;  4ZS3 A;  3RHW A;  3RQU A;  3O9X A;  4H63 H;  3KV6 A;  1BR2 A;  1S35 A;  4QX7 B;  3RH3 A;  2E8I A;  1YQ3 A;  1ZKE A;  2IC6 A;  4IST A;  1LRZ A;  2A3D A;  4UIG A;  4CI3 B;  2CXL A;  3EI0 A;  2W2U A;  2M67 A;  2PG8 A;  3U3I A;  1HX8 A;  4K0U A;  4X64 T;  3SRZ A;  3I0O A;  5L47 A;  2W62 A;  3PUG A;  4OYJ A;  2DI4 A;  2WWU A;  2YK0 A;  2H7V C;  4TUY E;  5ETW A;  1G73 A;  5LP6 E;  4IRE A;  2XSA A;  5FL1 A;  5AQN B;  1YKH B;  2UXB T;  3ZT5 A;  2BG9 C;  1MNE A;  1D1B A;  3AVR A;  2KLQ A;  3CX7 B;  5JRC B;  3EDU A;  2XAG B;  2KZ7 B;  5F8P A;  2WDR A;  4YT0 A;  4BJN A;  3AE2 A;  3VR8 A;  3P4S A;  2X9W A;  2LM9 A;  2VQE T;  3ABV A;  1SE7 A;  2Y8D A;  3N2O A;  4U7Y A;  4QXB B;  3C64 A;  5JR9 C;  3VRB A;  2ZMA A;  2H89 A;  1VOM A;  2MOZ A;  1WCR A;  4I50 E;  2WM9 A;  3OBV E;  5J2T E;  4DVD A;  3RLF F;  5JH7 E;  4YSZ A;  2WY2 A;  3VKG A;  4E7Z A;  2E9X D;  2LRL A;  4EV6 A;  2XQ3 A;  3MAC A;  2XAS B;  4UVC B;  3EDV A;  4KP3 C;  4O4H E;  2NP9 A;  3UUX B;  3L39 A;  3RF1 A;  1N34 T;  3FXD B;  1IZN B;  2C5K T;  5L3C B;  2IW5 B;  3LK3 B;  3AEE A;  3HKD E;  5LCY A;  5LMU T;  2I59 A;  5AQH B;  5FXZ A;  4B3S T;  1QLB A;  3P4Q A;  3M3Z B;  2MTQ A;  1N32 T;  3AE8 A;  1OXZ A;  2LT3 A;  3RYI E;  5AQK B;  2NW9 A;  1MMA A;  4BJM A;  4XBF B;  3ZN0 B;  3AED A;  1J1J A;  2EHO D;  2LE8 A;  4CI1 B;  2XSB A;  4A98 A;  2JPF A;  2LHN A;  3ZPO A;  3ONX A;  4HFH A;  3ETV A;  2X51 A;  4P1N A;  4LF4 T;  4O2B E;  4P0B A;  4G63 A;  4CXY A;  4B3R T;  4X20 E;  1D0X A;  1IBM T;  4QWN B;  4A56 A;  3IA3 A;  3O1H A;  3RRW A;  3UFE A;  3N2G E;  4H9S E;  4JEH B;  2FJE A;  5ABF A;  4UF0 A;  2VWA A;  1YKE B;  4BA9 A;  2LJL A;  5AQS B;  3GWH A;  3RYF E;  1KNR A;  5IUX A;  1N33 T;  4AQG A;  1IJ5 A;  3HL6 A;  4DBQ A;  4GYS A;  2NTY A;  3UFG A;  2P9B A;  3AA6 B;  3ZKR A;  2M6B A;  2BVM A;  3C98 B;  5EK2 A;  2H88 A;  2LLY A;  3R84 B;  2VUR A;  1Z0P A;  3KIN B;  4U2Y A;  4P0A A;  2V26 A;  5KXJ A;  3AAE B;  2WQY A;  1HNW T;  4TX5 A;  1WR6 A;  3ZMV B;  3RKO A;  4LF9 T;  3RYC E;  4DR2 T;  2VL8 A;  2CCQ A;  3TLW A;  1HNZ T;  3RKG A;  4ILU A;  4Q25 A;  3VKH A;  3V5U A;  3CIR A;  2ZM0 A;  4H9P C;  4EZH A;  2KSR A;  5M4Y A;  4KHZ F;  5IYZ E;  2Y6X A;  3UU5 A;  4O4J E;  4OFZ A;  3ANW A;  2MAW A;  2J1D G;  2C5J A;  4EXT A;  4PAG A;  2N1G A;  3M65 A;  2BBJ A;  1SHZ C;  3PU8 A;  5FY1 A;  2XQY A;  5CFB A;  5LB7 B;  3TLT A;  4JI6 T;  3LJC A;  4PK6 A;  2NR4 A;  4Z8X A;  1N36 T;  4HFE A;  5AQM B;  2BG9 E;  3ZCJ A;  5FKY A;  2V6X A;  3FBZ A;  3AEA A;  3JC6 C;  5J0Z A;  4GK0 E;  4DV2 T;  3PV0 F;  2XHE B;  3Q5D A;  5JTG A;  1UCU A;  4AXP A;  1BR1 A;  5FXW A;  4JI2 T;  4JI4 T;  2A2F X;  2YEV C;  4KHP T;  2V5D A;  4ILB A;  4N78 D;  2SPC A;  3TLS A;  2ACZ A;  2JQ9 A;  3C4Z A;  5ABE A;  3LK4 2;  4TNW A;  2L3L A;  2LEH A;  5CJ5 A;  4X1Y E;  5DAB A;  4CXX A;  2X9Y A;  3LFM A;  3QB5 A;  2WU2 A;  4U2Z A;  1HNX T;  2BS2 A;  1D0Y A;  4HE8 A;  1D1C A;  3UU6 A;  4PNI A;  3FZF B;  2W66 A;  2X0Y A;  4ADZ A;  4FI5 A;  1CHU A;  1QSD A;  4HGA A;  3N2K E;  2YN6 A;  4DR6 T;  1E2A A;  1V9D A;  4J2C A;  2QVA A;  1Z8U A;  5LOV E;  5LA6 E;  5LHH B;  1NAF A;  3GN5 A;  5JDL A;  2BZB A;  3UUB A;  2FBW A;  2BS4 A;  2LM2 A;  2E9X A;  2YKS A;  5FMN A;  4H9Q C;  4JI0 T;  5LGN B;  4PJJ A;  2VVS A;  3VHL A;  4ASK A;  5LGU B;  4PFO A;  3HKE E;  2IUB A;  5CB4 E;  1Y64 B;  4KUM B;  1J5E T;  3B5M A;  1U4Q A;  4L0R A;  2XQ9 A;  4QXC B;  4JLE A;  2Q9Q B;  2KT9 A;  2X68 A;  1T7S A;  3RC3 A;  1HG5 A;  3N9Q A;  2LHR A;  3B57 A;  4C91 A;  2CLY B;  2UXC T;  3RIF A;  2XQ7 A;  2CWY A;  4DR7 T;  4EZ4 A;  3EVY A;  3N9L A;  1L0V A;  1FMV A;  3AA7 B;  3ZEF B;  4AKL A;  3OVU A;  4WYV A;  2DHR A;  1W0A A;  2VK9 A;  3RI5 A;  4YY3 T;  2NWB A;  1KNZ A;  2EHO A;  2E5L T;  4TV9 E;  1DU2 A;  1LKX A;  2K3W A;  3RIU A;  4Z91 A;  2YU1 A;  1EZ3 A;  4UV9 B;  4F8H A;  3JC6 D;  3BQL A;  2LRK A;  3AAI A;  1E1H B;  3K8P C;  3LBX B;  2CE7 A;  2UUA T;  4WW0 A;  1ZP0 A;  4IL9 A;  2C0S A;  2YOE A;  2W0G A;  2DL1 A;  2QGS A;  1H7C A;  4HN9 A;  4O4I E;  3IF8 B;  5LBQ B;  3X1D A;  1OED B;  3NWI A;  2I0M A;  5HXS A;  2X9X A;  5A1L A;  3VRA A;  4F6R C;  2XAH B;  4ANJ A;  4YJ3 E;  5FYM A;  2L8K A;  5H6R B;  5AQP B;  4DV7 T;  3RX6 A;  3DP7 A;  1IAP A;  2G0U A;  1QUU A;  5HXR A;  2KMF A;  3P4R A;  2V7M A;  2PFV A;  5JRE A;  2RA1 A;  2YU2 A;  1E7P A;  3AEC A;  3D0T A;  4NXM T;  4B3M T;  2W61 A;  3KV4 A;  4DMW A;  2PJQ A;  4AQY T;  3R6N A;  2VB6 A;  2BG9 A;  3ZJ1 A;  2M6I A;  1I94 T;  4CN6 A;  5JRC A;  3PJA J;  2UUC T;  3UUL A;  2JJ9 A;  3QB5 K;  5LYJ E;  4FJO A;  3AE6 A;  3NVO A;  3K3Q C;  1W09 A;  3GA8 A;  4HWH A;  4YHH T;  1JNZ A;  5JR9 A;  4X5T A;  3KV9 A;  5HEJ A;  4WBO A;  2XQ6 A; 
#chains in the Genus database with same CATH homology
 2CPT A;  1YXR A;  5FVK A;  3ZST A;  5LB7 B;  3ZT6 A;  4U2Z A;  4U3C A;  2XZE A;  2JQ9 A;  3ZT7 A;  3ZSS A;  4IT4 A;  1WCR A;  2A9U A;  2LRK A;  5CGM A;  4P1N A;  4U7I A;  4U2Y A;  1WR0 A;  4WZX A;  2W2U A;  4CN4 A;  3K1S A;  2JQH A;  4CN1 A;  5CJ5 A;  4NIQ A;  1WFD A;  2CRB A;  2V6Y A;  3EAB A;  2V6Y B;  2K3W A;  2WY2 A;  4A5X A;  2V6X A;  3ZT5 A;  4U7Y A;  4CN6 A;  4ZEY A;  5FVL A;  2LRL A;  4U33 A;  4U31 A;  2WWV A;  2RPA A;  2DL1 A;  2JQK A;  2MPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...