2LRLA

Solution structures of the iia(chitobiose)-hpr complex of the n,n'-diacetylchitobiose branch of the escherichia coli phosphotransferase system
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
103
structure length
103
Chain Sequence
AEELEEVVMGLIINSGQARSLAYAALKQAKQGDFAAAKAMMDQSRMALNEAHLVQTKLIEGDAGEGKMKVSLVLVHAQLHLMTSMLARELITELIELHEKLKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N,N'-diacetylchitobiose-specific phosphotransferase enzyme I
publication title Solution Structure of the IIAChitobiose-HPr Complex of the N,N'-Diacetylchitobiose Branch of the Escherichia coli Phosphotransferase System.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 42
structure length 103
sequence length 103
chains with identical sequence B, C
ec nomenclature ec 2.7.1.-:
pdb deposition date 2012-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02255 PTS_IIA PTS system, Lactose/Cellobiose specific IIA subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2lrlA00
2MPKA 4U31A 5CGMA 4WZXA 4CN6A 2DL1A 1WCRA 3ZSTA 1WFDA 2W2UA 4U7IA 5LB7B 2V6YA 2JQ9A 2CPTA 4U33A 2RPAA 2JQHA 3ZT5A 2CRBA 2JQKA 2WY2A 4U7YA 4U2YA 3ZT6A 2V6XA 4NIQA 4U3CA 3ZT7A 4CN1A 1YXRA 4U2ZA 2WWVA 5CJ5A 3ZSSA 2V6YB 5FVKA 2A9UA 2LRLA 5FVLA 3EABA 4IT4A 2LRKA 2XZEA 4A5XA 3K1SA 4CN4A 1WR0A 2K3WA 4P1NA 4ZEYA
chains in the Genus database with same CATH superfamily
5J2UE 5FXVA 3PUWF 4EYYR 1MMGA 1KFYA 5EK2A 3PTRB 2P9BA 4E7ZA 3BQLA 3JAFA 2J1DG 3RKGA 2CLYB 3B57A 4EYUA 1N36T 5HXRA 2LM2A 5HEOA 4KHZF 3PV0F 1FJGT 3AA0B 4DR1T 2X66A 3O9XA 5JRCB 4GYSA 4GK5E 2MTQA 4CI1B 3CX6B 1O3XA 3ZMTB 1OWAA 3ZYLA 2B76A 3Q2MA 3RRCA 3PDYA 3N9NA 5AQFB 3C50A 2FJDA 4X1KE 2QA7A 4GOUA 2JPFA 3A7MA 3ONXA 2M6BA 3HL6A 3ZC1A 4B3MT 1D1BA 3L8RA 4UVAB 4AI6A 5LNKA 2BDEA 3ZSTA 1HTJF 5FKYA 3VHLA 2LM9A 2KZ7B 4J2CA 4JI8T 2XM1A 4C91A 3PUZF 5H6QB 3FZMB 2V5CA 2YDSA 4PNIA 3OVUA 2HPJA 2VQFT 4EB6E 2QRXA 3NBXX 2HN1A 2YK0A 1X9BA 3SOLA 4HWFA 4JI5T 2W00A 2LKHA 2KWHA 1T98A 2M6IA 5AQRB 2IMLA 3I9WA 1W09A 4GKJT 4QH5A 5AQVB 4EOZB 5A1LA 2LSGA 3AE5A 4P0BA 1ZP0A 5LGUB 2X68A 3IA3A 3QC9A 2LHRA 3AEAA 5LHHB 5LMUT 1S35A 3FZFB 3LFMA 3FXEB 1U4QA 1YD8G 2KMFA 3OBVE 2W67A 4TZ4C 4YHHT 4MLKA 2XQ6A 4PAGA 1KNZA 2YDQA 4F8HA 2JQHA 1D0ZA 3HA4A 4HGAA 3IF8B 4HN9A 5FY0A 2V7JA 3N9MA 1MMDA 3CVRA 3EI0A 5ABFA 4WBOA 4HE8A 4EGWA 1ZV4X 4U31A 3T8OA 3UUXB 4UF0A 4DV1T 4QHOA 4B3ST 5DABA 1US7B 4DIDB 2KWIB 4U7YA 1NWMX 4H9SE 5LMNT 4JI0T 4JI6T 4GKKT 2ACXA 4TUYE 4TX5A 4IDZA 1WCRA 4IDPA 3AEBA 2ACZA 4TV9E 5ADXL 1W9RA 1OEDB 3FBZA 3LK3B 3I9YA 1FMVA 4GIWA 4WNKA 2JQQA 5L3EB 3OPCA 3O1HA 4DR5T 2CCQA 4U7IA 4HFDA 1OXZA 3LJCA 4IIJE 4IREA 4WW0A 2X9YA 3EUHA 3V5SA 2V7KA 1IZNB 5EZYE 4M1PA 1HFAA 1WFDA 2FUPA 5IHYA 2WAUA 2HPLA 5HYAA 2BBJA 4MFRA 3FXDB 2XAQB 1D1AA 2X9HA 5LG3A 1WR0A 5IWAT 5LYJE 4X5TA 3UU6A 2KSRA 3VRAA 2W0GA 3DTOA 3TLSA 2XQAA 5FVLA 5KX5E 4DV5T 2YDRA 2WP9A 2XQ7A 2ZM0A 4ZEYA 5KDMC 1LVKA 5J0ZA 3LSVA 5L3FB 5AQNB 3BK9A 4ERRA 1HCIA 2J62A 2WDVA 4ZI2D 2LRLA 3J9X1 4XAXB 3P50A 1N33T 4B3TT 3AB3B 2X9XA 3ZKRA 1NENA 5AQPB 4JEHB 3U78A 2Q9QC 2XQ4A 3OTOT 1X79A 4ANJA 1MMNA 2JQ9A 2DWKA 2V6YA 3QB5K 4IE6A 4MBQA 3KV5A 4ZI2C 3FZHB 2DNXA 4DMVA 5L2LA 4CXXA 3NZQA 2XQ5A 4CN1A 2WMNA 4IE7A 5HEHA 2XQYA 2Q9QA 2A2FX 3M65A 2XTLA 4DV0T 3H3AA 1WR6A 1BR1A 3CPZA 4IDQA 1MIYA 1XZYA 5F5WA 5F8PA 4EV6A 1UK5A 3N9QA 3ZT6A 2LSIA 1G73A 2BVLA 2CHNA 2PG8A 4DMWA 5JDNA 2CXLA 4A97A 3AEEA 5J1GA 1XWMA 2X0HA 5DJQC 2YN6A 2V7LA 3JCFA 2D0TA 3UQ4A 2ZM6T 2UXNB 4EIWA 2UUCT 3CQCB 1LRZA 4I50E 5CJ5A 4YLHA 2XPKA 3N2GE 2ODVA 3RC3A 1KNPA 1IAPA 2K48A 1DU2A 3K1SA 4CN4A 3E0ZA 2Q9QB 5FNVE 4BJNA 3AAAB 1ZEEA 2OA5A 5AQQB 4ZS3A 4X1IE 3AA1B 3N9LA 2E5LT 4XZCA 5LG4A 2WCAA 3ZCIA 5FL0A 4JV5T 2DWGA 5BR8T 4CQIA 5LGTB 2LLYA 2DCFA 3KDSE 4HKAA 4P1NA 1MIWA 1IBMT 2LSYA 3GA8A 4HWIB 1AJ3A 5CA1E 2WY2A 4KP3C 3QOFA 1NAFA 3H37A 1QLBA 4GK0E 1L0VA 3P4PA 2AXDS 1HNWT 3ETUA 2HH7A 5FL1A 3MKDA 4L9IA 1IBLT 3B5MA 3ZMVB 2K24A 3ZYKA 4OYKA 2WMOA 3UULA 4AKLA 2WU2A 3ONJA 2CWOA 4ZI3C 2D5UA 3PU8A 2X9WA 3CQGB 1LKXA 4Q25A 2DI4A 5L3DB 3DP7A 2EHOB 1CUNA 2BS4A 3CQXC 1HR0T 2V5DA 5HXHA 2CHOA 4UV8B 5JQGE 3TLVA 1VCSA 1XDOA 1KK7A 1J1JA 1VOMA 4KX6A 2V7IA 2E9XD 4DV6T 4DR4T 3N9PA 3PUXF 2UXDT 3CX7B 3QNUA 4U2ZA 3AEFA 4CI2B 1YQ3A 2E5VA 2LE8A 4IGUA 2VB6A 3QUJA 3UUBA 2W62A 3RRWA 3D0TA 2UXXB 2WM9A 2H7VC 2BG9C 1HX8A 3CKDA 3AE6A 1N32T 2BBHA 4H63V 1HNZT 3K8PC 4QXHB 4X20E 4HEAA 2NP9A 4QX8B 5HEGA 1W0BA 3QK6A 3FZKB 2BG9A 3E08A 4ASKA 3DJBA 5C2TA 2K9AA 2CRBA 2WS3A 3RC8A 4DR2T 3RQUA 3GMIA 2NWBA 2XUEA 4CXYA 3RHWA 2N1GA 5L47A 5AQJB 4A5XA 4HFCA 4UVCB 3F31A 4QWNB 3WI3A 4EXTA 1T8BA 2H3RA 5HXEA 1KEYA 2RPAA 3AE7A 3ZYMA 2VASA 5AQLB 4MALA 2H7OA 1JNRA 2DLRA 2D2SA 2WZHA 2Y6XA 4JI2T 3CX8B 2XAGB 3RLFF 1SA0E 2ZM8A 3GN5A 3KV6A 2UU9T 3RYCE 2VL8A 4LF4T 2CBJA 3P4RA 2BG9B 3LK2B 2LOSA 3UUMA 4ADZA 2VK9A 1H7CA 4H9NC 4HTEA 2VKOA 2KLQA 1NEKA 3HI2A 3UU4A 2XSBA 4WZXA 5C8YE 1BR4A 5LHIB 4DR6T 5LCYA 3ANWA 5HWYA 4A98A 3UUNA 3X1DA 3ZSSA 4DV7T 3CK6A 4LF9T 3QB5A 2Z6EA 4IL4A 1YQ4A 4YJ2E 2BKPA 3EDUA 4X64T 3PUAA 5LP6E 5LGNB 4NIQA 5JR9C 1D1CA 3FZLB 3RF1A 4OYJA 2QVAA 4ILAA 3GWHA 3V5UA 4IHJE 5F3JA 1VRBA 4LF5T 3CWZB 3ETVA 3ZT5A 4UVBB 3CMLA 3VKGA 5FP3A 3TKLB 3LBXA 4HFIA 3P4WA 4PW8A 2A9UA 3ANWB 5JR9A 4YJ3E 2GK9A 3NKZA 2MAWA 3NRYA 3VU7H 2D0UA 5ABFB 1Y64B 4FI5A 1MNEA 3RQWA 3UTKA 4O4HE 4UF0B 2YKSA 2OV9A 4JI7T 5CA0E 2KXPB 3AE2A 4KUMB 2I6HA 2YEVC 2W63A 5LB7B 3C98B 4HFHA 5IYZE 3MACA 4IE4A 5ABEA 3P8CD 5FY7A 2FJBA 3NZPA 2LT3A 1KF6A 5JH7E 3LBXB 4G2AA 5ABHA 2PTFA 1XNQT 4TV8E 1ZHCA 2LSKA 4DBRA 3HKBE 3RI5A 4LF6T 1LVFA 3F57A 3AAEB 5HWXA 4DBQA 2YU1A 2CMRA 3HKCE 4GYRA 4BA9A 5LBMA 3PE0A 4H9OC 2E2AA 3AE4A 4Z8XA 3P4QA 1JNZA 4B3RT 3C64A 2WSSV 4X62T 2FJAA 3FHNA 2CBIA 2C5KT 2XASB 2JQKA 3H3MA 4WYVA 2NW7A 2VKDA 4QXCB 1SE7A 2BVMA 2RA1A 4K0UA 3F2EA 4HFBA 4B6XA 2ZLYA 2YOEA 3UU8A 3K3NA 2QYWA 3JADA 1N34T 1SUMB 1Z8UA 1XMOT 3AE8A 3ZPOA 5CGMA 2YINA 4FJOA 2BZBA 4N78D 3AECA 2W4XA 4F6RC 1G8XA 1WRDA 3VKHA 3O4XE 5LHGB 3RYIE 2UXBT 4LMJA 4JI3T 4ZHQE 2XSAA 2VKHA 5AQTB 4ISSA 1QSDA 4O4IE 4YTMA 5TAOA 4TWHA 4PK4A 4Z90A 3AXJA 2LKGA 4G63A 3NVOA 2V6XA 5CB4E 1XNRT 2PFVA 3ZN1B 2IC9A 4X65T 2C5IT 2LRKA 3PUVF 4NUVA 4CZZB 4LFBT 3G06A 3R6NA 1MIVA 4TNWA 5AQUB 3EVYA 3N5LA 2AE9A 4UEMA 4JBWF 5JDFA 2Y48B 2WDRA 2V6YB 5FXZA 3UU5A 2HN2A 3RH3A 2X0YA 1WYCA 4ILCA 4OFZA 3NRXA 2NR4A 4QH4A 5ABGA 1HG5A 3A5XA 3O1JA 4OHFA 3AXJB 2VVNA 5AQSB 2OLTA 2V8SV 2KNDA 4UXNB 1T72A 3UFEA 4ISTA 2K3WA 4AKRB 3AAIA 4TNVA 2CLYC 3PJAA 2WWUA 2ZMAA 3ZEFB 5GONE 4LFCT 5AFUL 1FIOA 2IW5B 4LFAT 4TWFA 4KBMB 2V26A 3RKOA 3KBUA 4AQFC 2BS3A 1UGOA 4LMKA 3A8YC 3AE3A 3RIAA 1R8IA 2LJLA 3P7IA 1IBKT 2N9DA 5JVDE 5BMVE 1UCUA 4COFA 5AQOB 5FXWA 2IUBA 5JRCA 1YKEB 3AE1A 4AQFA 2R6GF 2XQ8A 1QUUA 3IEEA 5FYMA 5LBQB 4NPPA 2CXFA 1W0AA 2JRKA 3LK42 3ZT7A 5FVKA 1BR2A 1XMQT 5HEJA 2WBLA 2X51A 1S94A 4DUYT 2UUAT 4BJMA 4DV3T 1IJ6A 2ES0A 2L9QA 1BR0A 5H6RB 2W2UA 4AISA 1WYBA 1HNXT 4LF8T 4I0UA 1SHZC 3ZN0B 2X67A 5JTGA 4MHCA 3UU3A 5E0OA 1OEDE 2X0LB 2WQYA 1M7KA 4KMCA 1YW0A 3SRZA 3JAEA 5L4EA 4IDOA 2MOZA 4OX9T 5AQMB 5EK3A 1U5PA 4ZS2A 1MNDA 2FJEA 4NXNT 2VQET 2XAHB 1ZKEA 4YSZA 3EABA 5JDLA 4UELA 1HF8A 3JC6D 5HXCA 4X66T 2H89A 3KBTA 4DUZT 1IJ5A 1V9DA 4KHPT 3KV4A 4IL9A 2M67A 2E9XC 3BQIA 2CA5A 4AKIA 4YHJA 2UUBT 1KNRA 2LOPA 2MPKA 3EAMA 3FBLA 3S4UA 3OYZA 3KINB 3HKEE 4PJLA 1D0YA 4U2YA 3CIRA 3JC6C 2JMKA 3L09A 3PUYF 2E9XA 3HKDE 4O8SA 3HR0A 3UQ7A 3PU3A 2K5BB 1E1HB 2CE7A 4BAYB 4EZHA 3WAKA 4DV2T 3Q5EA 4CN6A 3KV9A 2J4GA 4ZXLA 2LEHA 2BKNA 4JI1T 2L8KA 3K3OA 3I1AA 2L3LA 5AQKB 3ESLA 5LJMA 2IAKA 3OYXA 2IHR1 2NTXA 3Q5XA 1WLXA 3OKQA 3SFDA 4K0KT 3MA9A 1J5WA 1HS7A 3TLTA 4JI4T 4EZ4A 2NOXA 4ILBA 4H9PC 4EEDA 1FEWA 4QH1A 4PK5A 3ZC0A 2LHNA 4QX7B 1I6ZA 1UURA 4AQYT 3PUGA 2MBGA 1I94T 4H63H 2E9XB 4YTPA 3UFGA 2IIUA 1OEDC 3P4SA 2XJ7A 5FY1A 4I4TE 5KMGP 4PJJA 1Y01A 3NWIA 2CM0A 3ONLC 4JEUB 3RGLA 2BKOA 3MZKB 4IT4A 3W15B 4P0AA 3SWHA 4WBNE 1J5ET 1CHUA 2VWAA 4EEBA 4IE5A 3ZMUB 4P09A 1FMWA 4AKHA 4YY3T 2E8IA 1OEDA 4U74A 3Q5DA 3RYFE 3GN5B 4LF7T 1MMAA 2ZM2A 3N9OA 2KT9A 3ZCJA 1GQEA 3T1HT 3RPUA 4PJNA 3ZJ2A 3KVBA 2JMHA 2F4VT 3RIFA 5HAXA 3VR9A 4YXDA 2WDQA 5ETWA 2VL0A 2WB5A 4JLEA 3B13A 3AA6B 2CWYA 4C90A 2RP4A 3AEDA 1E7PA 3FB2A 4AXPA 2IC6A 3AVSA 4U72A 3R84B 2HHHT 2XHEB 2C5JA 4YTNA 3KVAA 4QXBB 2VKJA 4V1Av 4ZZCA 5LJNA 5FMNA 2KINB 4ILUA 4O4JE 4NUUA 4O4LE 2WWVA 3UT5E 3KFWX 2XAJB 3LDQB 3ZMSB 5CFBA 5JR9B 5HXSA 4OK0A 2DHRA 4CI3B 4U3CA 5L4HA 4IE0A 3EHZA 2NW8A 2C0SA 5HCMA 4I55E 2PBIA 3BQKA 5LXTE 5FXXA 3AE9A 3SS1A 3EDVA 3N2OA 3VRBA 2DL1A 5C3JA 4DNDA 3AEGA 3I0OA 4DO0A 3WAJA 4PJMA 1YXRA 4A56A 4PK6A 4AKGA 3M3ZB 2NTYA 5JDMA 4AQGA 2Q9QD 3U3IA 4I43B 4HWCA 5L3CB 3RX6A 2XY8B 4UIGA 1T7SA 1B7TA 4U33A 4YFSA 4DVDA 4L5GA 2WU5A 5AQHB 4PFPA 3C4ZA 4HWDA 2N2NA 3Q9DA 4HWHA 3PURA 3ZLIA 2G0UA 3SFEA 5AQIB 2BS2A 3I0QA 4KI0F 4L0RA 2LSJA 3AVRA 4TN7B 3ZJ1A 3PJAJ 2VVSA 3VR8A 2JJ9A 4HFEA 2MYSA 2FBWA 2XQ9A 4H9RC 5DQWA 3OJAA 3C4WA 1E2AA 2CXDA 2W66A 3TLWA 4YSYA 4DV4T 2A72A 2PJQA 5LOVE 2UXCT 5IUXA 5EK4A 4Z91A 3RIUC 5JREA 2B1EA 2EHOD 1Z0PA 3E22E 3MXZA 3Q5WA 3L39A 1HG2A 4IDNA 2VURA 4O2AE 4AIUA 3PUQA 2Y8DA 4ZI7E 5HCJA 2H88A 1UX4A 5L3GB 2WZIA 4X1YE 4O2BE 4JYAT 2CPTA 2NW9A 3RIUA 1HX1B 3K3QC 3IBPA 2XZEA 3MK7C 2JIWA 5JDGA 4TWDA 2V7MA 2CEAA 5JDHA 2XM2A 4JUYA 4UR9A 2EHOC 4ZZBA 2XQ3A 1YKHB 2I59A 4DR7T 4YSXA 3C4XA 4CXWA 1UX5A 2V1DB 4DR3T 5KXJA 5HEUA 2BG9E 2XAFB 3O1IA 4H9QC 1M62A 4E7SA 1XDPA 5DQVA 4ZOLE 2EHOA 3ZMZB 4ZI3D 4NXMT 2SPCA 4EAHA 3PUSA 5LA6E 3C51A 3J7Yq 4LMLA 4PFOA 4YT0A 3T1YT 3N2KE 1ZOYA 1EZ3A 2I0MA 2J47A 1UUSA 3ABVA 2YU2A 5JDQA 3MJXA 3TLUA 4HFVA 5L3BB 2D9DA 4QKNA 3IHRA 2W61A 4UV9B 3L3PA 2ODUA 2A3DA 3LG7A 5J2TE 2IDOB 5M4YA 1D0XA 3AA7B 3RYHE 2QGSA 5AQGB 1VCTA 4XBFB
chains in the Genus database with same CATH topology
2MPKA 4U31A 5CGMA 4WZXA 4CN6A 2DL1A 1WCRA 3ZSTA 1WFDA 2W2UA 4U7IA 5LB7B 2V6YA 2JQ9A 2CPTA 4U33A 2RPAA 2JQHA 3ZT5A 2CRBA 2JQKA 2WY2A 4U7YA 4U2YA 3ZT6A 2V6XA 4NIQA 4U3CA 3ZT7A 4CN1A 1YXRA 4U2ZA 2WWVA 5CJ5A 3ZSSA 2V6YB 5FVKA 2A9UA 2LRLA 5FVLA 3EABA 4IT4A 2LRKA 2XZEA 4A5XA 3K1SA 4CN4A 1WR0A 2K3WA 4P1NA 4ZEYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MPK A;  4U31 A;  5CGM A;  4WZX A;  4CN6 A;  2DL1 A;  1WCR A;  3ZST A;  1WFD A;  2W2U A;  4U7I A;  5LB7 B;  2V6Y A;  2JQ9 A;  2CPT A;  4U33 A;  2RPA A;  2JQH A;  3ZT5 A;  2CRB A;  2JQK A;  2WY2 A;  4U7Y A;  4U2Y A;  3ZT6 A;  2V6X A;  4NIQ A;  4U3C A;  3ZT7 A;  4CN1 A;  1YXR A;  4U2Z A;  2WWV A;  5CJ5 A;  3ZSS A;  2V6Y B;  5FVK A;  2A9U A;  2LRL A;  5FVL A;  3EAB A;  4IT4 A;  2LRK A;  2XZE A;  4A5X A;  3K1S A;  4CN4 A;  1WR0 A;  2K3W A;  4P1N A;  4ZEY A; 
#chains in the Genus database with same CATH topology
 5J2U E;  5FXV A;  3PUW F;  4EYY R;  1MMG A;  1KFY A;  5EK2 A;  3PTR B;  2P9B A;  4E7Z A;  3BQL A;  3JAF A;  2J1D G;  3RKG A;  2CLY B;  3B57 A;  4EYU A;  1N36 T;  5HXR A;  2LM2 A;  5HEO A;  4KHZ F;  3PV0 F;  1FJG T;  3AA0 B;  4DR1 T;  2X66 A;  3O9X A;  5JRC B;  4GYS A;  4GK5 E;  2MTQ A;  4CI1 B;  3CX6 B;  1O3X A;  3ZMT B;  1OWA A;  3ZYL A;  2B76 A;  3Q2M A;  3RRC A;  3PDY A;  3N9N A;  5AQF B;  3C50 A;  2FJD A;  4X1K E;  2QA7 A;  4GOU A;  2JPF A;  3A7M A;  3ONX A;  2M6B A;  3HL6 A;  3ZC1 A;  4B3M T;  1D1B A;  3L8R A;  4UVA B;  4AI6 A;  5LNK A;  2BDE A;  3ZST A;  1HTJ F;  5FKY A;  3VHL A;  2LM9 A;  2KZ7 B;  4J2C A;  4JI8 T;  2XM1 A;  4C91 A;  3PUZ F;  5H6Q B;  3FZM B;  2V5C A;  2YDS A;  4PNI A;  3OVU A;  2HPJ A;  2VQF T;  4EB6 E;  2QRX A;  3NBX X;  2HN1 A;  2YK0 A;  1X9B A;  3SOL A;  4HWF A;  4JI5 T;  2W00 A;  2LKH A;  2KWH A;  1T98 A;  2M6I A;  5AQR B;  2IML A;  3I9W A;  1W09 A;  4GKJ T;  4QH5 A;  5AQV B;  4EOZ B;  5A1L A;  2LSG A;  3AE5 A;  4P0B A;  1ZP0 A;  5LGU B;  2X68 A;  3IA3 A;  3QC9 A;  2LHR A;  3AEA A;  5LHH B;  5LMU T;  1S35 A;  3FZF B;  3LFM A;  3FXE B;  1U4Q A;  1YD8 G;  2KMF A;  3OBV E;  2W67 A;  4TZ4 C;  4YHH T;  4MLK A;  2XQ6 A;  4PAG A;  1KNZ A;  2YDQ A;  4F8H A;  2JQH A;  1D0Z A;  3HA4 A;  4HGA A;  3IF8 B;  4HN9 A;  5FY0 A;  2V7J A;  3N9M A;  1MMD A;  3CVR A;  3EI0 A;  5ABF A;  4WBO A;  4HE8 A;  4EGW A;  1ZV4 X;  4U31 A;  3T8O A;  3UUX B;  4UF0 A;  4DV1 T;  4QHO A;  4B3S T;  5DAB A;  1US7 B;  4DID B;  2KWI B;  4U7Y A;  1NWM X;  4H9S E;  5LMN T;  4JI0 T;  4JI6 T;  4GKK T;  2ACX A;  4TUY E;  4TX5 A;  4IDZ A;  1WCR A;  4IDP A;  3AEB A;  2ACZ A;  4TV9 E;  5ADX L;  1W9R A;  1OED B;  3FBZ A;  3LK3 B;  3I9Y A;  1FMV A;  4GIW A;  4WNK A;  2JQQ A;  5L3E B;  3OPC A;  3O1H A;  4DR5 T;  2CCQ A;  4U7I A;  4HFD A;  1OXZ A;  3LJC A;  4IIJ E;  4IRE A;  4WW0 A;  2X9Y A;  3EUH A;  3V5S A;  2V7K A;  1IZN B;  5EZY E;  4M1P A;  1HFA A;  1WFD A;  2FUP A;  5IHY A;  2WAU A;  2HPL A;  5HYA A;  2BBJ A;  4MFR A;  3FXD B;  2XAQ B;  1D1A A;  2X9H A;  5LG3 A;  1WR0 A;  5IWA T;  5LYJ E;  4X5T A;  3UU6 A;  2KSR A;  3VRA A;  2W0G A;  3DTO A;  3TLS A;  2XQA A;  5FVL A;  5KX5 E;  4DV5 T;  2YDR A;  2WP9 A;  2XQ7 A;  2ZM0 A;  4ZEY A;  5KDM C;  1LVK A;  5J0Z A;  3LSV A;  5L3F B;  5AQN B;  3BK9 A;  4ERR A;  1HCI A;  2J62 A;  2WDV A;  4ZI2 D;  2LRL A;  3J9X 1;  4XAX B;  3P50 A;  1N33 T;  4B3T T;  3AB3 B;  2X9X A;  3ZKR A;  1NEN A;  5AQP B;  4JEH B;  3U78 A;  2Q9Q C;  2XQ4 A;  3OTO T;  1X79 A;  4ANJ A;  1MMN A;  2JQ9 A;  2DWK A;  2V6Y A;  3QB5 K;  4IE6 A;  4MBQ A;  3KV5 A;  4ZI2 C;  3FZH B;  2DNX A;  4DMV A;  5L2L A;  4CXX A;  3NZQ A;  2XQ5 A;  4CN1 A;  2WMN A;  4IE7 A;  5HEH A;  2XQY A;  2Q9Q A;  2A2F X;  3M65 A;  2XTL A;  4DV0 T;  3H3A A;  1WR6 A;  1BR1 A;  3CPZ A;  4IDQ A;  1MIY A;  1XZY A;  5F5W A;  5F8P A;  4EV6 A;  1UK5 A;  3N9Q A;  3ZT6 A;  2LSI A;  1G73 A;  2BVL A;  2CHN A;  2PG8 A;  4DMW A;  5JDN A;  2CXL A;  4A97 A;  3AEE A;  5J1G A;  1XWM A;  2X0H A;  5DJQ C;  2YN6 A;  2V7L A;  3JCF A;  2D0T A;  3UQ4 A;  2ZM6 T;  2UXN B;  4EIW A;  2UUC T;  3CQC B;  1LRZ A;  4I50 E;  5CJ5 A;  4YLH A;  2XPK A;  3N2G E;  2ODV A;  3RC3 A;  1KNP A;  1IAP A;  2K48 A;  1DU2 A;  3K1S A;  4CN4 A;  3E0Z A;  2Q9Q B;  5FNV E;  4BJN A;  3AAA B;  1ZEE A;  2OA5 A;  5AQQ B;  4ZS3 A;  4X1I E;  3AA1 B;  3N9L A;  2E5L T;  4XZC A;  5LG4 A;  2WCA A;  3ZCI A;  5FL0 A;  4JV5 T;  2DWG A;  5BR8 T;  4CQI A;  5LGT B;  2LLY A;  2DCF A;  3KDS E;  4HKA A;  4P1N A;  1MIW A;  1IBM T;  2LSY A;  3GA8 A;  4HWI B;  1AJ3 A;  5CA1 E;  2WY2 A;  4KP3 C;  3QOF A;  1NAF A;  3H37 A;  1QLB A;  4GK0 E;  1L0V A;  3P4P A;  2AXD S;  1HNW T;  3ETU A;  2HH7 A;  5FL1 A;  3MKD A;  4L9I A;  1IBL T;  3B5M A;  3ZMV B;  2K24 A;  3ZYK A;  4OYK A;  2WMO A;  3UUL A;  4AKL A;  2WU2 A;  3ONJ A;  2CWO A;  4ZI3 C;  2D5U A;  3PU8 A;  2X9W A;  3CQG B;  1LKX A;  4Q25 A;  2DI4 A;  5L3D B;  3DP7 A;  2EHO B;  1CUN A;  2BS4 A;  3CQX C;  1HR0 T;  2V5D A;  5HXH A;  2CHO A;  4UV8 B;  5JQG E;  3TLV A;  1VCS A;  1XDO A;  1KK7 A;  1J1J A;  1VOM A;  4KX6 A;  2V7I A;  2E9X D;  4DV6 T;  4DR4 T;  3N9P A;  3PUX F;  2UXD T;  3CX7 B;  3QNU A;  4U2Z A;  3AEF A;  4CI2 B;  1YQ3 A;  2E5V A;  2LE8 A;  4IGU A;  2VB6 A;  3QUJ A;  3UUB A;  2W62 A;  3RRW A;  3D0T A;  2UXX B;  2WM9 A;  2H7V C;  2BG9 C;  1HX8 A;  3CKD A;  3AE6 A;  1N32 T;  2BBH A;  4H63 V;  1HNZ T;  3K8P C;  4QXH B;  4X20 E;  4HEA A;  2NP9 A;  4QX8 B;  5HEG A;  1W0B A;  3QK6 A;  3FZK B;  2BG9 A;  3E08 A;  4ASK A;  3DJB A;  5C2T A;  2K9A A;  2CRB A;  2WS3 A;  3RC8 A;  4DR2 T;  3RQU A;  3GMI A;  2NWB A;  2XUE A;  4CXY A;  3RHW A;  2N1G A;  5L47 A;  5AQJ B;  4A5X A;  4HFC A;  4UVC B;  3F31 A;  4QWN B;  3WI3 A;  4EXT A;  1T8B A;  2H3R A;  5HXE A;  1KEY A;  2RPA A;  3AE7 A;  3ZYM A;  2VAS A;  5AQL B;  4MAL A;  2H7O A;  1JNR A;  2DLR A;  2D2S A;  2WZH A;  2Y6X A;  4JI2 T;  3CX8 B;  2XAG B;  3RLF F;  1SA0 E;  2ZM8 A;  3GN5 A;  3KV6 A;  2UU9 T;  3RYC E;  2VL8 A;  4LF4 T;  2CBJ A;  3P4R A;  2BG9 B;  3LK2 B;  2LOS A;  3UUM A;  4ADZ A;  2VK9 A;  1H7C A;  4H9N C;  4HTE A;  2VKO A;  2KLQ A;  1NEK A;  3HI2 A;  3UU4 A;  2XSB A;  4WZX A;  5C8Y E;  1BR4 A;  5LHI B;  4DR6 T;  5LCY A;  3ANW A;  5HWY A;  4A98 A;  3UUN A;  3X1D A;  3ZSS A;  4DV7 T;  3CK6 A;  4LF9 T;  3QB5 A;  2Z6E A;  4IL4 A;  1YQ4 A;  4YJ2 E;  2BKP A;  3EDU A;  4X64 T;  3PUA A;  5LP6 E;  5LGN B;  4NIQ A;  5JR9 C;  1D1C A;  3FZL B;  3RF1 A;  4OYJ A;  2QVA A;  4ILA A;  3GWH A;  3V5U A;  4IHJ E;  5F3J A;  1VRB A;  4LF5 T;  3CWZ B;  3ETV A;  3ZT5 A;  4UVB B;  3CML A;  3VKG A;  5FP3 A;  3TKL B;  3LBX A;  4HFI A;  3P4W A;  4PW8 A;  2A9U A;  3ANW B;  5JR9 A;  4YJ3 E;  2GK9 A;  3NKZ A;  2MAW A;  3NRY A;  3VU7 H;  2D0U A;  5ABF B;  1Y64 B;  4FI5 A;  1MNE A;  3RQW A;  3UTK A;  4O4H E;  4UF0 B;  2YKS A;  2OV9 A;  4JI7 T;  5CA0 E;  2KXP B;  3AE2 A;  4KUM B;  2I6H A;  2YEV C;  2W63 A;  5LB7 B;  3C98 B;  4HFH A;  5IYZ E;  3MAC A;  4IE4 A;  5ABE A;  3P8C D;  5FY7 A;  2FJB A;  3NZP A;  2LT3 A;  1KF6 A;  5JH7 E;  3LBX B;  4G2A A;  5ABH A;  2PTF A;  1XNQ T;  4TV8 E;  1ZHC A;  2LSK A;  4DBR A;  3HKB E;  3RI5 A;  4LF6 T;  1LVF A;  3F57 A;  3AAE B;  5HWX A;  4DBQ A;  2YU1 A;  2CMR A;  3HKC E;  4GYR A;  4BA9 A;  5LBM A;  3PE0 A;  4H9O C;  2E2A A;  3AE4 A;  4Z8X A;  3P4Q A;  1JNZ A;  4B3R T;  3C64 A;  2WSS V;  4X62 T;  2FJA A;  3FHN A;  2CBI A;  2C5K T;  2XAS B;  2JQK A;  3H3M A;  4WYV A;  2NW7 A;  2VKD A;  4QXC B;  1SE7 A;  2BVM A;  2RA1 A;  4K0U A;  3F2E A;  4HFB A;  4B6X A;  2ZLY A;  2YOE A;  3UU8 A;  3K3N A;  2QYW A;  3JAD A;  1N34 T;  1SUM B;  1Z8U A;  1XMO T;  3AE8 A;  3ZPO A;  5CGM A;  2YIN A;  4FJO A;  2BZB A;  4N78 D;  3AEC A;  2W4X A;  4F6R C;  1G8X A;  1WRD A;  3VKH A;  3O4X E;  5LHG B;  3RYI E;  2UXB T;  4LMJ A;  4JI3 T;  4ZHQ E;  2XSA A;  2VKH A;  5AQT B;  4ISS A;  1QSD A;  4O4I E;  4YTM A;  5TAO A;  4TWH A;  4PK4 A;  4Z90 A;  3AXJ A;  2LKG A;  4G63 A;  3NVO A;  2V6X A;  5CB4 E;  1XNR T;  2PFV A;  3ZN1 B;  2IC9 A;  4X65 T;  2C5I T;  2LRK A;  3PUV F;  4NUV A;  4CZZ B;  4LFB T;  3G06 A;  3R6N A;  1MIV A;  4TNW A;  5AQU B;  3EVY A;  3N5L A;  2AE9 A;  4UEM A;  4JBW F;  5JDF A;  2Y48 B;  2WDR A;  2V6Y B;  5FXZ A;  3UU5 A;  2HN2 A;  3RH3 A;  2X0Y A;  1WYC A;  4ILC A;  4OFZ A;  3NRX A;  2NR4 A;  4QH4 A;  5ABG A;  1HG5 A;  3A5X A;  3O1J A;  4OHF A;  3AXJ B;  2VVN A;  5AQS B;  2OLT A;  2V8S V;  2KND A;  4UXN B;  1T72 A;  3UFE A;  4IST A;  2K3W A;  4AKR B;  3AAI A;  4TNV A;  2CLY C;  3PJA A;  2WWU A;  2ZMA A;  3ZEF B;  5GON E;  4LFC T;  5AFU L;  1FIO A;  2IW5 B;  4LFA T;  4TWF A;  4KBM B;  2V26 A;  3RKO A;  3KBU A;  4AQF C;  2BS3 A;  1UGO A;  4LMK A;  3A8Y C;  3AE3 A;  3RIA A;  1R8I A;  2LJL A;  3P7I A;  1IBK T;  2N9D A;  5JVD E;  5BMV E;  1UCU A;  4COF A;  5AQO B;  5FXW A;  2IUB A;  5JRC A;  1YKE B;  3AE1 A;  4AQF A;  2R6G F;  2XQ8 A;  1QUU A;  3IEE A;  5FYM A;  5LBQ B;  4NPP A;  2CXF A;  1W0A A;  2JRK A;  3LK4 2;  3ZT7 A;  5FVK A;  1BR2 A;  1XMQ T;  5HEJ A;  2WBL A;  2X51 A;  1S94 A;  4DUY T;  2UUA T;  4BJM A;  4DV3 T;  1IJ6 A;  2ES0 A;  2L9Q A;  1BR0 A;  5H6R B;  2W2U A;  4AIS A;  1WYB A;  1HNX T;  4LF8 T;  4I0U A;  1SHZ C;  3ZN0 B;  2X67 A;  5JTG A;  4MHC A;  3UU3 A;  5E0O A;  1OED E;  2X0L B;  2WQY A;  1M7K A;  4KMC A;  1YW0 A;  3SRZ A;  3JAE A;  5L4E A;  4IDO A;  2MOZ A;  4OX9 T;  5AQM B;  5EK3 A;  1U5P A;  4ZS2 A;  1MND A;  2FJE A;  4NXN T;  2VQE T;  2XAH B;  1ZKE A;  4YSZ A;  3EAB A;  5JDL A;  4UEL A;  1HF8 A;  3JC6 D;  5HXC A;  4X66 T;  2H89 A;  3KBT A;  4DUZ T;  1IJ5 A;  1V9D A;  4KHP T;  3KV4 A;  4IL9 A;  2M67 A;  2E9X C;  3BQI A;  2CA5 A;  4AKI A;  4YHJ A;  2UUB T;  1KNR A;  2LOP A;  2MPK A;  3EAM A;  3FBL A;  3S4U A;  3OYZ A;  3KIN B;  3HKE E;  4PJL A;  1D0Y A;  4U2Y A;  3CIR A;  3JC6 C;  2JMK A;  3L09 A;  3PUY F;  2E9X A;  3HKD E;  4O8S A;  3HR0 A;  3UQ7 A;  3PU3 A;  2K5B B;  1E1H B;  2CE7 A;  4BAY B;  4EZH A;  3WAK A;  4DV2 T;  3Q5E A;  4CN6 A;  3KV9 A;  2J4G A;  4ZXL A;  2LEH A;  2BKN A;  4JI1 T;  2L8K A;  3K3O A;  3I1A A;  2L3L A;  5AQK B;  3ESL A;  5LJM A;  2IAK A;  3OYX A;  2IHR 1;  2NTX A;  3Q5X A;  1WLX A;  3OKQ A;  3SFD A;  4K0K T;  3MA9 A;  1J5W A;  1HS7 A;  3TLT A;  4JI4 T;  4EZ4 A;  2NOX A;  4ILB A;  4H9P C;  4EED A;  1FEW A;  4QH1 A;  4PK5 A;  3ZC0 A;  2LHN A;  4QX7 B;  1I6Z A;  1UUR A;  4AQY T;  3PUG A;  2MBG A;  1I94 T;  4H63 H;  2E9X B;  4YTP A;  3UFG A;  2IIU A;  1OED C;  3P4S A;  2XJ7 A;  5FY1 A;  4I4T E;  5KMG P;  4PJJ A;  1Y01 A;  3NWI A;  2CM0 A;  3ONL C;  4JEU B;  3RGL A;  2BKO A;  3MZK B;  4IT4 A;  3W15 B;  4P0A A;  3SWH A;  4WBN E;  1J5E T;  1CHU A;  2VWA A;  4EEB A;  4IE5 A;  3ZMU B;  4P09 A;  1FMW A;  4AKH A;  4YY3 T;  2E8I A;  1OED A;  4U74 A;  3Q5D A;  3RYF E;  3GN5 B;  4LF7 T;  1MMA A;  2ZM2 A;  3N9O A;  2KT9 A;  3ZCJ A;  1GQE A;  3T1H T;  3RPU A;  4PJN A;  3ZJ2 A;  3KVB A;  2JMH A;  2F4V T;  3RIF A;  5HAX A;  3VR9 A;  4YXD A;  2WDQ A;  5ETW A;  2VL0 A;  2WB5 A;  4JLE A;  3B13 A;  3AA6 B;  2CWY A;  4C90 A;  2RP4 A;  3AED A;  1E7P A;  3FB2 A;  4AXP A;  2IC6 A;  3AVS A;  4U72 A;  3R84 B;  2HHH T;  2XHE B;  2C5J A;  4YTN A;  3KVA A;  4QXB B;  2VKJ A;  4V1A v;  4ZZC A;  5LJN A;  5FMN A;  2KIN B;  4ILU A;  4O4J E;  4NUU A;  4O4L E;  2WWV A;  3UT5 E;  3KFW X;  2XAJ B;  3LDQ B;  3ZMS B;  5CFB A;  5JR9 B;  5HXS A;  4OK0 A;  2DHR A;  4CI3 B;  4U3C A;  5L4H A;  4IE0 A;  3EHZ A;  2NW8 A;  2C0S A;  5HCM A;  4I55 E;  2PBI A;  3BQK A;  5LXT E;  5FXX A;  3AE9 A;  3SS1 A;  3EDV A;  3N2O A;  3VRB A;  2DL1 A;  5C3J A;  4DND A;  3AEG A;  3I0O A;  4DO0 A;  3WAJ A;  4PJM A;  1YXR A;  4A56 A;  4PK6 A;  4AKG A;  3M3Z B;  2NTY A;  5JDM A;  4AQG A;  2Q9Q D;  3U3I A;  4I43 B;  4HWC A;  5L3C B;  3RX6 A;  2XY8 B;  4UIG A;  1T7S A;  1B7T A;  4U33 A;  4YFS A;  4DVD A;  4L5G A;  2WU5 A;  5AQH B;  4PFP A;  3C4Z A;  4HWD A;  2N2N A;  3Q9D A;  4HWH A;  3PUR A;  3ZLI A;  2G0U A;  3SFE A;  5AQI B;  2BS2 A;  3I0Q A;  4KI0 F;  4L0R A;  2LSJ A;  3AVR A;  4TN7 B;  3ZJ1 A;  3PJA J;  2VVS A;  3VR8 A;  2JJ9 A;  4HFE A;  2MYS A;  2FBW A;  2XQ9 A;  4H9R C;  5DQW A;  3OJA A;  3C4W A;  1E2A A;  2CXD A;  2W66 A;  3TLW A;  4YSY A;  4DV4 T;  2A72 A;  2PJQ A;  5LOV E;  2UXC T;  5IUX A;  5EK4 A;  4Z91 A;  3RIU C;  5JRE A;  2B1E A;  2EHO D;  1Z0P A;  3E22 E;  3MXZ A;  3Q5W A;  3L39 A;  1HG2 A;  4IDN A;  2VUR A;  4O2A E;  4AIU A;  3PUQ A;  2Y8D A;  4ZI7 E;  5HCJ A;  2H88 A;  1UX4 A;  5L3G B;  2WZI A;  4X1Y E;  4O2B E;  4JYA T;  2CPT A;  2NW9 A;  3RIU A;  1HX1 B;  3K3Q C;  3IBP A;  2XZE A;  3MK7 C;  2JIW A;  5JDG A;  4TWD A;  2V7M A;  2CEA A;  5JDH A;  2XM2 A;  4JUY A;  4UR9 A;  2EHO C;  4ZZB A;  2XQ3 A;  1YKH B;  2I59 A;  4DR7 T;  4YSX A;  3C4X A;  4CXW A;  1UX5 A;  2V1D B;  4DR3 T;  5KXJ A;  5HEU A;  2BG9 E;  2XAF B;  3O1I A;  4H9Q C;  1M62 A;  4E7S A;  1XDP A;  5DQV A;  4ZOL E;  2EHO A;  3ZMZ B;  4ZI3 D;  4NXM T;  2SPC A;  4EAH A;  3PUS A;  5LA6 E;  3C51 A;  3J7Y q;  4LML A;  4PFO A;  4YT0 A;  3T1Y T;  3N2K E;  1ZOY A;  1EZ3 A;  2I0M A;  2J47 A;  1UUS A;  3ABV A;  2YU2 A;  5JDQ A;  3MJX A;  3TLU A;  4HFV A;  5L3B B;  2D9D A;  4QKN A;  3IHR A;  2W61 A;  4UV9 B;  3L3P A;  2ODU A;  2A3D A;  3LG7 A;  5J2T E;  2IDO B;  5M4Y A;  1D0X A;  3AA7 B;  3RYH E;  2QGS A;  5AQG B;  1VCT A;  4XBF B; 
#chains in the Genus database with same CATH homology
 2MPK A;  4U31 A;  5CGM A;  4WZX A;  4CN6 A;  2DL1 A;  1WCR A;  3ZST A;  1WFD A;  2W2U A;  4U7I A;  5LB7 B;  2V6Y A;  2JQ9 A;  2CPT A;  4U33 A;  2RPA A;  2JQH A;  3ZT5 A;  2CRB A;  2JQK A;  2WY2 A;  4U7Y A;  4U2Y A;  3ZT6 A;  2V6X A;  4NIQ A;  4U3C A;  3ZT7 A;  4CN1 A;  1YXR A;  4U2Z A;  2WWV A;  5CJ5 A;  3ZSS A;  2V6Y B;  5FVK A;  2A9U A;  2LRL A;  5FVL A;  3EAB A;  4IT4 A;  2LRK A;  2XZE A;  4A5X A;  3K1S A;  4CN4 A;  1WR0 A;  2K3W A;  4P1N A;  4ZEY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...