1HNWT

Structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 33
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1hnwT00
1XMQT 2UXCT 2E5LT 4YHHT 4B3MT 2VQFT 5LMUT 4X64T 4JI7T 4K0KT 4B3RT 4B3ST 4DV4T 4JI3T 4JI0T 4DV5T 4DR2T 4JYAT 4DV1T 2UUBT 1N32T 1I94T 4GKKT 4AQYT 4DV6T 4JI4T 1FJGT 1N36T 4LFCT 2UXDT 4KHPT 4OX9T 1IBKT 4GKJT 4DR1T 4JI2T 1HR0T 1XNQT 4X66T 4B3TT 4LF9T 4DR3T 2F4VT 1N34T 4YY3T 2UU9T 1J5ET 2UUCT 4DR4T 3T1YT 1XMOT 4X65T 4JI8T 1HNWT 4DV0T 4LFAT 4DR6T 4DR5T 4X62T 4JI1T 4NXMT 2VQET 1N33T 4DUYT 4LF5T 4DV2T 4DR7T 3OTOT 1IBLT 1XNRT 4NXNT 4LF6T 1HNZT 5IWAT 4LF8T 1IBMT 5BR8T 4JI6T 4JV5T 4DUZT 4LF4T 4DV3T 3T1HT 4LF7T 4DV7T 2HHHT 2ZM6T 4LFBT 5LMNT 1HNXT 2UUAT 2UXBT 4JI5T
chains in the Genus database with same CATH superfamily
2UXCT 4Q25A 2FJDA 3ZLIA 3C64A 4QWNB 3P50A 2Y48B 1WRDA 2LHNA 4TNWA 4TV8E 3UUNA 1M62A 4EB6E 5HCJA 2CWOA 3NRXA 2XJ7A 4ILUA 2UUBT 1N32T 4EEDA 1HX1B 1O3XA 5ABEA 2LE8A 3FZKB 3ETVA 3ZSTA 1IZNB 2LKHA 3B13A 1IBKT 4YHJA 4YJ3E 4GKJT 2NWBA 3ETUA 4ZI2D 3JAFA 4U7IA 2W61A 2YOEA 5AQMB 4GOUA 5L3GB 2UU9T 3PU3A 5JDQA 4YTMA 4ZS3A 1G8XA 3AXJA 3RX6A 3CX8B 1QLBA 3OBVE 2XQ8A 2DLRA 3UFEA 2PTFA 3F2EA 3FZLB 5L3FB 4DV2T 2BDEA 3OYZA 3FXDB 4LF6T 3CK6A 2XQYA 3LK2B 5AQLB 2E9XD 2BG9B 3CIRA 4LFBT 4I0UA 1MNEA 2YDRA 5C8YE 5ABFA 3AEFA 5J1GA 3M3ZB 1IJ6A 4DV4T 1NWMX 3CPZA 2L9QA 3EDVA 2YK0A 3AEAA 5AQHB 2BBJA 4I55E 2EHOB 4IE6A 4DBQA 5LOVE 3ZT5A 1WFDA 5JDNA 1J5WA 4X1YE 4U74A 3KVAA 4IDZA 4L9IA 4H9PC 4LF9T 5L3CB 3K3QC 1W09A 3RIUA 2C5JA 4DV0T 4QXHB 1HFAA 2Z6EA 1S94A 2W66A 3R84B 4O4HE 4KP3C 2JQ9A 2EHOC 3UT5E 5CFBA 3LJCA 2MPKA 2JQKA 2V6YB 3ZMZB 2HHHT 2ZM6T 3VR9A 2LSJA 1US7B 4YSYA 2J47A 1KNZA 3RYHE 4PFPA 2Q9QB 4B3MT 4BAYB 4CXYA 2D2SA 4EYUA 5ADXL 3ZYLA 3RIFA 3AECA 3PUAA 2J62A 3AE9A 4E7ZA 1OWAA 1BR1A 5JREA 3CX6B 1UX5A 1GQEA 2BBHA 3HL6A 1KEYA 3S4UA 3LSVA 4CXWA 2HN1A 2LM2A 2PG8A 4LMKA 3ZC0A 3TLSA 5EK2A 4IDNA 4YT0A 3DJBA 4PJMA 2WU2A 1WR0A 4A97A 4DR4T 2WMOA 2Q9QC 2V7JA 3U78A 2VB6A 5LHIB 3QOFA 1DU2A 1N33T 4IT4A 3L09A 3RQUA 4QXBB 3OTOT 4DR7T 1IBLT 3AE6A 4ZI3D 2IC9A 3AE2A 2A72A 3HKDE 3QK6A 2V7IA 3RH3A 3MXZA 5FL0A 4AXPA 4AI6A 3N9LA 4AISA 3CWZB 3ZCIA 1MMDA 5IUXA 3AE3A 1L0VA 5CJ5A 3JAEA 2NW9A 3ZJ2A 1UUSA 4TWFA 5AQVB 4K0KT 1MMNA 3KFWX 3ZMUB 5LBQB 2H7VC 5AFUL 2XM2A 2B76A 5LNKA 3D0TA 5EK3A 3LBXB 1UGOA 3FBLA 3LFMA 2ACXA 3NWIA 4WYVA 4KUMB 5AQQB 5L3BB 1BR2A 4DBRA 3MA9A 3J9X1 3MJXA 4LFCT 1OEDA 2UXDT 3EAMA 4EXTA 3Q5EA 2VKHA 3UUBA 4FJOA 2RPAA 2E9XA 2W0GA 4QH1A 2KT9A 1ZKEA 4AQGA 2CHNA 2CXFA 2RP4A 4EEBA 3M65A 2PFVA 4YLHA 4UXNB 2X0HA 1HTJF 4O2BE 5EZYE 5LG3A 4EV6A 2WZIA 2LEHA 4H9OC 4HE8A 2Y8DA 3N9OA 4HFCA 3AE7A 2XAHB 2CPTA 2XPKA 2NW8A 2CEAA 2C0SA 3EI0A 4HFIA 2KZ7B 5E0OA 5AQKB 2CBIA 5LJMA 1KNPA 2IIUA 5LMUT 5CGMA 1SA0E 3PDYA 1KFYA 3RLFF 4TV9E 1IAPA 4PAGA 5ABGA 2JMHA 3JC6C 2KSRA 3N9MA 3VRAA 4IDOA 2V7MA 5LHHB 3RRWA 4AQYT 3Q5WA 4DV6T 2KMFA 4I43B 3ZMVB 3N2KE 3O9XA 2JJ9A 2VL0A 5JDLA 5L3DB 1X79A 3PUSA 1XZYA 2WAUA 4PNIA 3FBZA 1HR0T 3NBXX 4XZCA 4B3TT 4A56A 4IE7A 1D1CA 2BS3A 3PTRB 3N2OA 4AQFA 4P09A 2WM9A 4JEUB 4ZOLE 5DQWA 1VOMA 2N9DA 4X62T 3CMLA 1MIVA 2MTQA 4CI3B 2YDQA 3RIAA 3FZFB 4OFZA 2BKNA 3WAKA 1E2AA 3LK3B 1HX8A 4IL9A 3AE1A 2LSKA 5L4EA 5BR8T 2YN6A 3TLVA 4WBNE 4JV5T 4I50E 3TKLB 4OYKA 4HKAA 3T1HT 2NR4A 3NVOA 3HR0A 3PJAJ 3CQXC 4U3CA 4JI5T 5FY0A 4K0UA 2G0UA 5F3JA 2RA1A 4TZ4C 5HCMA 2WY2A 4DVDA 3TLWA 2X0LB 2IMLA 4P0AA 4KHZF 5LYJE 4UR9A 1JNZA 4YSXA 3P4WA 5CA1E 3PUVF 3CX7B 4TN7B 2D0TA 1WR6A 3C50A 4IDPA 4X1IE 1X9BA 2LJLA 2LM9A 4H9RC 4BA9A 1BR0A 2YDSA 4PJNA 5ABHA 3I1AA 1R8IA 3PUZF 5LCYA 3KBTA 3IF8B 4JI1T 2NW7A 2KLQA 5HEGA 1MIYA 2ZLYA 5AQNB 3ZT7A 4PJJA 3QNUA 2DL1A 2X51A 3ZMSB 4IIJE 3B5MA 2DNXA 2MAWA 5FVLA 4LF4T 4EAHA 2JPFA 2SPCA 4PK5A 2LOPA 4HGAA 2WQYA 5CA0E 4ILAA 1YXRA 2HN2A 1T98A 2V8SV 3H3AA 3QB5K 2IC6A 2EHOD 3JADA 4X64T 3UU4A 3ZKRA 3GWHA 1UCUA 1ZOYA 1SHZC 1FEWA 3T8OA 2WSSV 1AJ3A 3B57A 4UEMA 3NZPA 3UQ4A 4IL4A 4FI5A 1FJGT 5FNVE 2FBWA 3NZQA 2ACZA 4E7SA 1UURA 2W2UA 4AKLA 4ZI7E 3Q9DA 1HCIA 3PUYF 2D9DA 4OHFA 2HPLA 2VKOA 2W00A 4YSZA 1T7SA 2X9YA 1LRZA 5HEUA 1LVFA 2YEVC 3SFEA 4JBWF 4AIUA 5FXWA 2WDQA 2LKGA 2VK9A 3LG7A 2V6XA 5LGUB 4C90A 3BK9A 2E2AA 5FP3A 5FYMA 3N9PA 3UUMA 2Q9QD 3QB5A 4HFBA 2FUPA 3K8PC 2X9XA 1IBMT 1YQ4A 2CE7A 4GYRA 1FMWA 1QUUA 2W62A 4HWIB 2K3WA 2XQ9A 5AQPB 3GN5B 2ZMAA 2IDOB 3FHNA 1KNRA 2JIWA 2KWHA 3SS1A 2XQ7A 1VCTA 2A2FX 2XQAA 4X1KE 3KV4A 2X0YA 3AAIA 2UXBT 3H37A 3P4QA 2NTYA 4NUUA 4UF0B 2ES0A 2Y6XA 1VCSA 4UVCB 2LSYA 3BQKA 3GA8A 2W63A 4TNVA 3PURA 4G2AA 4OX9T 3CQGB 3A8YC 2C5KT 3O4XE 4H63H 2X9HA 4P0BA 4JLEA 4TUYE 4TWDA 4O2AE 5AQJB 2XQ3A 3TLTA 4XBFB 4ANJA 4H9NC 1LKXA 2FJAA 4LFAT 4O4JE 2W67A 4HWFA 5J2TE 3O1HA 2CWYA 4UVBB 1H7CA 4XAXB 2OA5A 4ZZCA 4H9QC 3AEBA 5AQOB 2WBLA 4A98A 3C4WA 5FVKA 1HNXT 1YKEB 3CQCB 2H3RA 3A5XA 3Q5XA 4HWCA 3PUGA 2ODVA 2VURA 2WCAA 4ZZBA 3KV5A 2XSBA 2WP9A 3FXEB 5JR9B 4U33A 2CM0A 5J2UE 2IW5B 4EIWA 4O4IE 2VVSA 4JYAT 2BG9A 2CXDA 1I94T 4PW8A 1T72A 3IHRA 5LGNB 4HN9A 3F31A 2H7OA 3JC6D 3KV9A 2DI4A 3ANWB 4EGWA 4WW0A 4MBQA 4U2ZA 4AQFC 4YY3T 4NIQA 4DMVA 4IDQA 2K24A 3WAJA 3IEEA 2JQHA 5C2TA 2FJBA 2EHOA 4J2CA 5JR9C 3VKGA 3I0QA 5LJNA 5M4YA 2VQET 2QGSA 4IE0A 4CXXA 3RYFE 3RC3A 2K48A 3VHLA 3MACA 4DUZT 1FIOA 3AEGA 4LF7T 4OYJA 2LOSA 3FB2A 5TAOA 2WDRA 2LSGA 2YU1A 5L3EB 2IAKA 5FMNA 3L39A 1VRBA 1BR4A 2WWUA 5FY7A 2XAGB 2HPJA 3RHWA 4F6RC 4B3ST 4JI3T 2XASB 2V6YA 3Q5DA 2BZBA 2BKPA 4PJLA 3AAEB 4QH5A 3P8CD 5HXRA 4ERRA 3AXJB 1N36T 2Q9QA 5HAXA 1SUMB 3NRYA 3P4RA 4ILCA 2VKJA 4BJNA 5KDMC 4U7YA 4B6XA 2I0MA 4X65T 4UV8B 1D0YA 3HKEE 4AKIA 3I9YA 1WYCA 4ISSA 5ABFB 4CI1B 1YW0A 4DUYT 1Y64B 1XDPA 3AA6B 4ZEYA 1XNRT 3EHZA 3KDSE 5IWAT 2M6BA 2H88A 1WYBA 1V9DA 3EVYA 5JDMA 4DV3T 3V5SA 2J1DG 3KBUA 2LLYA 1Z8UA 3ZEFB 5LP6E 5H6RB 1M7KA 5AQSB 1XMQT 5JRCB 2XAJB 3X1DA 1CUNA 1NEKA 4YXDA 3MKDA 1HG2A 4GYSA 1QSDA 4L0RA 2V5DA 3QC9A 1W0AA 2XHEB 3R6NA 4MHCA 2L3LA 1E1HB 3ZPOA 3ONJA 3FZMB 2DHRA 4CN6A 1U5PA 2CCQA 3AA7B 3ZYKA 4U31A 4NPPA 4UV9B 4LMLA 3SOLA 1N34T 3LBXA 2CBJA 3BQIA 3VR8A 1HS7A 5JDFA 4JI8T 5AQIB 2BS2A 2BVLA 2VASA 2KINB 4CZZB 3OPCA 2QRXA 4KI0F 1U4QA 1D0ZA 3RIUC 3PUWF 3EABA 3G06A 1S35A 2V7KA 5EK4A 3AEDA 3MZKB 4HEAA 4ISTA 3UFGA 3UULA 4ASKA 1I6ZA 5LMNT 5HYAA 2E5VA 4X20E 3OKQA 3AA0B 2E8IA 5FXVA 1MIWA 4YHHT 2ZM0A 2CLYC 3K3OA 4KX6A 2V7LA 2M67A 2CRBA 3W15B 5ETWA 1HF8A 3N9NA 2I59A 3EUHA 3C98B 2WB5A 4AKRB 4QX8B 4DR2T 2VL8A 3ZYMA 1D1AA 2X9WA 1Y01A 5HXCA 3PUXF 1KF6A 2V5CA 2ZM8A 3O1IA 4PK6A 2UXXB 4KHPT 1T8BA 2XTLA 3PV0F 4HFDA 4HWDA 3C51A 4QHOA 2XQ5A 4U2YA 3UUXB 5HEHA 4N78D 1EZ3A 2NOXA 2C5IT 2F4VT 2BVMA 4H9SE 4Z8XA 2M6IA 3ZJ1A 4OK0A 3ONLC 5JVDE 4JUYA 1HNWT 2XM1A 3F57A 4DR6T 2X67A 5LGTB 2QA7A 3N9QA 5LG4A 4C91A 3J7Yq 1XDOA 2VKDA 4MLKA 5LA6E 2ZM2A 2LHRA 4O4LE 2P9BA 5DQVA 1KK7A 4MFRA 4NXNT 5HXEA 5GONE 3CKDA 2R6GF 2BG9E 3RF1A 3N2GE 5LB7B 4CQIA 4LMJA 4U72A 4V1Av 1FMVA 2WDVA 5JDGA 3DP7A 5JTGA 2XAQB 5LHGB 3HKBE 1OEDB 2E5LT 5JRCA 3ZT6A 4JI7T 3RKGA 2AXDS 4B3RT 2NTXA 2XAFB 2K9AA 3JCFA 2E9XB 3LK42 3OYXA 3N5LA 2BG9C 3PU8A 3GMIA 3SWHA 3VU7H 4DMWA 2WZHA 3UU3A 4ZI2C 4CI2B 4DV1T 3RI5A 1OEDE 4HFEA 5HEOA 5JQGE 1UK5A 5KMGP 2XQ6A 4HFHA 5KXJA 2AE9A 2D5UA 5HXSA 2BKOA 3NKZA 5FY1A 4DR1T 3ZMTB 2A3DA 2ODUA 4KMCA 1XNQT 3TLUA 4IREA 2WMNA 3PE0A 4PK4A 1OEDC 3ZN1B 2LT3A 2DWGA 2N1GA 3ONXA 2XQ4A 5AQUB 2IHR1 2LRLA 4DNDA 2E9XC 4ZXLA 4CN4A 4YTNA 3ZSSA 2KWIB 1ZP0A 3C4XA 2J4GA 1HG5A 2LRKA 4UELA 3O1JA 4P1NA 4ADZA 5HWXA 2XSAA 3AA1B 3C4ZA 4MALA 3VKHA 1W9RA 3RYCE 2UUAT 5BMVE 4WZXA 2MOZA 3SRZA 1G73A 4ZS2A 4WNKA 5AQTB 1B7TA 5FL1A 4EYYR 5JH7E 4Z91A 4EZ4A 3SFDA 4KBMB 3RYIE 4GKKT 5LXTE 4GK5E 3RQWA 2QYWA 3ZC1A 1YQ3A 2VVNA 3RKOA 3UQ7A 2A9UA 4AKHA 3P4SA 4EOZB 5LBMA 3H3MA 3QUJA 3BQLA 4AKGA 1J5ET 1XMOT 3E08A 2OLTA 3U3IA 1Z0PA 4BJMA 2DWKA 5F8PA 3OVUA 2B1EA 3ZN0B 3PUQA 4NXMT 1YKHB 1E7PA 5FKYA 4LF5T 4IE4A 2XUEA 2OV9A 4CN1A 4UVAB 2W4XA 5L2LA 5KX5E 2X68A 4JEHB 2XZEA 2I6HA 1CHUA 2QVAA 4DV7T 5H6QB 2CXLA 2MBGA 3HKCE 1IJ5A 1NENA 4TX5A 1J1JA 5JDHA 4O8SA 1D1BA 3OJAA 2NP9A 5FXZA 2D0UA 5HEJA 3DTOA 5IYZE 3L8RA 4M1PA 4TWHA 1SE7A 2N2NA 1OXZA 3HI2A 4ILBA 1WCRA 4IHJE 5L47A 4JI0T 3E22E 2VWAA 2LSIA 3UU8A 3MK7C 2DCFA 3GN5A 3I0OA 2YINA 3AE4A 3P7IA 4G63A 2H89A 2CMRA 2FJEA 2KNDA 5C3JA 3K3NA 2YKSA 4IE5A 4UF0A 3LDQB 4NUVA 4YJ2E 1NAFA 4HWHA 1MMGA 5CB4E 4X66T 2PBIA 4DR3T 3AVRA 4ZI3C 2UUCT 2YU2A 3T1YT 2UXNB 4DO0A 3PJAA 3K1SA 3AB3B 3ESLA 3AAAB 2KXPB 3Q2MA 2XY8B 1LVKA 3WI3A 1WLXA 2HH7A 5J0ZA 2BS4A 1HNZT 1JNRA 4PFOA 3RC8A 4WBOA 3KVBA 5A1LA 1ZEEA 2WS3A 3AVSA 5DABA 3UU5A 4GIWA 2PJQA 3AEEA 2VQFT 4I4TE 4A5XA 4QH4A 3IA3A 3KINB 5FXXA 2V26A 4HFVA 4DV5T 1D0XA 4COFA 3AE8A 3CVRA 1XWMA 4QKNA 3L3PA 4YFSA 2IUBA 4JI4T 4ZHQE 3AE5A 2GK9A 1MMAA 3ZCJA 2X66A 1ZHCA 5AQFB 2MYSA 5JR9A 4DIDB 4X5TA 4JI2T 3FZHB 4QX7B 4Z90A 5AQRB 3KV6A 5IHYA 3RGLA 3ABVA 3UTKA 1ZV4X 3E0ZA 5F5WA 5AQGB 4IGUA 3A7MA 2JMKA 4DR5T 2WU5A 4QXCB 2JQQA 3HA4A 4HTEA 3ANWA 5HXHA 3EDUA 5DJQC 3V5UA 2L8KA 4L5GA 2CLYB 1W0BA 3RPUA 3P4PA 2CHOA 2CA5A 4LF8T 2JRKA 4H63V 2V1DB 4JI6T 4EZHA 1YD8G 4UIGA 4GK0E 4F8HA 5HWYA 1MNDA 5L4HA 3VRBA 4YTPA 2WWVA 3UU6A 2K5BB 3I9WA 3RRCA 1UX4A 3IBPA
chains in the Genus database with same CATH topology
1XMQT 2UXCT 2E5LT 4YHHT 4B3MT 2VQFT 5LMUT 4X64T 4JI7T 4K0KT 4B3RT 4B3ST 4DV4T 4JI3T 4JI0T 4DV5T 4DR2T 4JYAT 4DV1T 2UUBT 1N32T 1I94T 4GKKT 4AQYT 4DV6T 4JI4T 1FJGT 1N36T 4LFCT 2UXDT 4KHPT 4OX9T 1IBKT 4GKJT 4DR1T 4JI2T 1HR0T 1XNQT 4X66T 4B3TT 4LF9T 4DR3T 2F4VT 1N34T 4YY3T 2UU9T 1J5ET 2UUCT 4DR4T 3T1YT 1XMOT 4X65T 4JI8T 1HNWT 4DV0T 4LFAT 4DR6T 4DR5T 4X62T 4JI1T 4NXMT 2VQET 1N33T 4DUYT 4LF5T 4DV2T 4DR7T 3OTOT 1IBLT 1XNRT 4NXNT 4LF6T 1HNZT 5IWAT 4LF8T 1IBMT 5BR8T 4JI6T 4JV5T 4DUZT 4LF4T 4DV3T 3T1HT 4LF7T 4DV7T 2HHHT 2ZM6T 4LFBT 5LMNT 1HNXT 2UUAT 2UXBT 4JI5T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMQ T;  2UXC T;  2E5L T;  4YHH T;  4B3M T;  2VQF T;  5LMU T;  4X64 T;  4JI7 T;  4K0K T;  4B3R T;  4B3S T;  4DV4 T;  4JI3 T;  4JI0 T;  4DV5 T;  4DR2 T;  4JYA T;  4DV1 T;  2UUB T;  1N32 T;  1I94 T;  4GKK T;  4AQY T;  4DV6 T;  4JI4 T;  1FJG T;  1N36 T;  4LFC T;  2UXD T;  4KHP T;  4OX9 T;  1IBK T;  4GKJ T;  4DR1 T;  4JI2 T;  1HR0 T;  1XNQ T;  4X66 T;  4B3T T;  4LF9 T;  4DR3 T;  2F4V T;  1N34 T;  4YY3 T;  2UU9 T;  1J5E T;  2UUC T;  4DR4 T;  3T1Y T;  1XMO T;  4X65 T;  4JI8 T;  1HNW T;  4DV0 T;  4LFA T;  4DR6 T;  4DR5 T;  4X62 T;  4JI1 T;  4NXM T;  2VQE T;  1N33 T;  4DUY T;  4LF5 T;  4DV2 T;  4DR7 T;  3OTO T;  1IBL T;  1XNR T;  4NXN T;  4LF6 T;  1HNZ T;  5IWA T;  4LF8 T;  1IBM T;  5BR8 T;  4JI6 T;  4JV5 T;  4DUZ T;  4LF4 T;  4DV3 T;  3T1H T;  4LF7 T;  4DV7 T;  2HHH T;  2ZM6 T;  4LFB T;  5LMN T;  1HNX T;  2UUA T;  2UXB T;  4JI5 T; 
#chains in the Genus database with same CATH topology
 2UXC T;  4Q25 A;  2FJD A;  3ZLI A;  3C64 A;  4QWN B;  3P50 A;  2Y48 B;  1WRD A;  2LHN A;  4TNW A;  4TV8 E;  3UUN A;  1M62 A;  4EB6 E;  5HCJ A;  2CWO A;  3NRX A;  2XJ7 A;  4ILU A;  2UUB T;  1N32 T;  4EED A;  1HX1 B;  1O3X A;  5ABE A;  2LE8 A;  3FZK B;  3ETV A;  3ZST A;  1IZN B;  2LKH A;  3B13 A;  1IBK T;  4YHJ A;  4YJ3 E;  4GKJ T;  2NWB A;  3ETU A;  4ZI2 D;  3JAF A;  4U7I A;  2W61 A;  2YOE A;  5AQM B;  4GOU A;  5L3G B;  2UU9 T;  3PU3 A;  5JDQ A;  4YTM A;  4ZS3 A;  1G8X A;  3AXJ A;  3RX6 A;  3CX8 B;  1QLB A;  3OBV E;  2XQ8 A;  2DLR A;  3UFE A;  2PTF A;  3F2E A;  3FZL B;  5L3F B;  4DV2 T;  2BDE A;  3OYZ A;  3FXD B;  4LF6 T;  3CK6 A;  2XQY A;  3LK2 B;  5AQL B;  2E9X D;  2BG9 B;  3CIR A;  4LFB T;  4I0U A;  1MNE A;  2YDR A;  5C8Y E;  5ABF A;  3AEF A;  5J1G A;  3M3Z B;  1IJ6 A;  4DV4 T;  1NWM X;  3CPZ A;  2L9Q A;  3EDV A;  2YK0 A;  3AEA A;  5AQH B;  2BBJ A;  4I55 E;  2EHO B;  4IE6 A;  4DBQ A;  5LOV E;  3ZT5 A;  1WFD A;  5JDN A;  1J5W A;  4X1Y E;  4U74 A;  3KVA A;  4IDZ A;  4L9I A;  4H9P C;  4LF9 T;  5L3C B;  3K3Q C;  1W09 A;  3RIU A;  2C5J A;  4DV0 T;  4QXH B;  1HFA A;  2Z6E A;  1S94 A;  2W66 A;  3R84 B;  4O4H E;  4KP3 C;  2JQ9 A;  2EHO C;  3UT5 E;  5CFB A;  3LJC A;  2MPK A;  2JQK A;  2V6Y B;  3ZMZ B;  2HHH T;  2ZM6 T;  3VR9 A;  2LSJ A;  1US7 B;  4YSY A;  2J47 A;  1KNZ A;  3RYH E;  4PFP A;  2Q9Q B;  4B3M T;  4BAY B;  4CXY A;  2D2S A;  4EYU A;  5ADX L;  3ZYL A;  3RIF A;  3AEC A;  3PUA A;  2J62 A;  3AE9 A;  4E7Z A;  1OWA A;  1BR1 A;  5JRE A;  3CX6 B;  1UX5 A;  1GQE A;  2BBH A;  3HL6 A;  1KEY A;  3S4U A;  3LSV A;  4CXW A;  2HN1 A;  2LM2 A;  2PG8 A;  4LMK A;  3ZC0 A;  3TLS A;  5EK2 A;  4IDN A;  4YT0 A;  3DJB A;  4PJM A;  2WU2 A;  1WR0 A;  4A97 A;  4DR4 T;  2WMO A;  2Q9Q C;  2V7J A;  3U78 A;  2VB6 A;  5LHI B;  3QOF A;  1DU2 A;  1N33 T;  4IT4 A;  3L09 A;  3RQU A;  4QXB B;  3OTO T;  4DR7 T;  1IBL T;  3AE6 A;  4ZI3 D;  2IC9 A;  3AE2 A;  2A72 A;  3HKD E;  3QK6 A;  2V7I A;  3RH3 A;  3MXZ A;  5FL0 A;  4AXP A;  4AI6 A;  3N9L A;  4AIS A;  3CWZ B;  3ZCI A;  1MMD A;  5IUX A;  3AE3 A;  1L0V A;  5CJ5 A;  3JAE A;  2NW9 A;  3ZJ2 A;  1UUS A;  4TWF A;  5AQV B;  4K0K T;  1MMN A;  3KFW X;  3ZMU B;  5LBQ B;  2H7V C;  5AFU L;  2XM2 A;  2B76 A;  5LNK A;  3D0T A;  5EK3 A;  3LBX B;  1UGO A;  3FBL A;  3LFM A;  2ACX A;  3NWI A;  4WYV A;  4KUM B;  5AQQ B;  5L3B B;  1BR2 A;  4DBR A;  3MA9 A;  3J9X 1;  3MJX A;  4LFC T;  1OED A;  2UXD T;  3EAM A;  4EXT A;  3Q5E A;  2VKH A;  3UUB A;  4FJO A;  2RPA A;  2E9X A;  2W0G A;  4QH1 A;  2KT9 A;  1ZKE A;  4AQG A;  2CHN A;  2CXF A;  2RP4 A;  4EEB A;  3M65 A;  2PFV A;  4YLH A;  4UXN B;  2X0H A;  1HTJ F;  4O2B E;  5EZY E;  5LG3 A;  4EV6 A;  2WZI A;  2LEH A;  4H9O C;  4HE8 A;  2Y8D A;  3N9O A;  4HFC A;  3AE7 A;  2XAH B;  2CPT A;  2XPK A;  2NW8 A;  2CEA A;  2C0S A;  3EI0 A;  4HFI A;  2KZ7 B;  5E0O A;  5AQK B;  2CBI A;  5LJM A;  1KNP A;  2IIU A;  5LMU T;  5CGM A;  1SA0 E;  3PDY A;  1KFY A;  3RLF F;  4TV9 E;  1IAP A;  4PAG A;  5ABG A;  2JMH A;  3JC6 C;  2KSR A;  3N9M A;  3VRA A;  4IDO A;  2V7M A;  5LHH B;  3RRW A;  4AQY T;  3Q5W A;  4DV6 T;  2KMF A;  4I43 B;  3ZMV B;  3N2K E;  3O9X A;  2JJ9 A;  2VL0 A;  5JDL A;  5L3D B;  1X79 A;  3PUS A;  1XZY A;  2WAU A;  4PNI A;  3FBZ A;  1HR0 T;  3NBX X;  4XZC A;  4B3T T;  4A56 A;  4IE7 A;  1D1C A;  2BS3 A;  3PTR B;  3N2O A;  4AQF A;  4P09 A;  2WM9 A;  4JEU B;  4ZOL E;  5DQW A;  1VOM A;  2N9D A;  4X62 T;  3CML A;  1MIV A;  2MTQ A;  4CI3 B;  2YDQ A;  3RIA A;  3FZF B;  4OFZ A;  2BKN A;  3WAK A;  1E2A A;  3LK3 B;  1HX8 A;  4IL9 A;  3AE1 A;  2LSK A;  5L4E A;  5BR8 T;  2YN6 A;  3TLV A;  4WBN E;  4JV5 T;  4I50 E;  3TKL B;  4OYK A;  4HKA A;  3T1H T;  2NR4 A;  3NVO A;  3HR0 A;  3PJA J;  3CQX C;  4U3C A;  4JI5 T;  5FY0 A;  4K0U A;  2G0U A;  5F3J A;  2RA1 A;  4TZ4 C;  5HCM A;  2WY2 A;  4DVD A;  3TLW A;  2X0L B;  2IML A;  4P0A A;  4KHZ F;  5LYJ E;  4UR9 A;  1JNZ A;  4YSX A;  3P4W A;  5CA1 E;  3PUV F;  3CX7 B;  4TN7 B;  2D0T A;  1WR6 A;  3C50 A;  4IDP A;  4X1I E;  1X9B A;  2LJL A;  2LM9 A;  4H9R C;  4BA9 A;  1BR0 A;  2YDS A;  4PJN A;  5ABH A;  3I1A A;  1R8I A;  3PUZ F;  5LCY A;  3KBT A;  3IF8 B;  4JI1 T;  2NW7 A;  2KLQ A;  5HEG A;  1MIY A;  2ZLY A;  5AQN B;  3ZT7 A;  4PJJ A;  3QNU A;  2DL1 A;  2X51 A;  3ZMS B;  4IIJ E;  3B5M A;  2DNX A;  2MAW A;  5FVL A;  4LF4 T;  4EAH A;  2JPF A;  2SPC A;  4PK5 A;  2LOP A;  4HGA A;  2WQY A;  5CA0 E;  4ILA A;  1YXR A;  2HN2 A;  1T98 A;  2V8S V;  3H3A A;  3QB5 K;  2IC6 A;  2EHO D;  3JAD A;  4X64 T;  3UU4 A;  3ZKR A;  3GWH A;  1UCU A;  1ZOY A;  1SHZ C;  1FEW A;  3T8O A;  2WSS V;  1AJ3 A;  3B57 A;  4UEM A;  3NZP A;  3UQ4 A;  4IL4 A;  4FI5 A;  1FJG T;  5FNV E;  2FBW A;  3NZQ A;  2ACZ A;  4E7S A;  1UUR A;  2W2U A;  4AKL A;  4ZI7 E;  3Q9D A;  1HCI A;  3PUY F;  2D9D A;  4OHF A;  2HPL A;  2VKO A;  2W00 A;  4YSZ A;  1T7S A;  2X9Y A;  1LRZ A;  5HEU A;  1LVF A;  2YEV C;  3SFE A;  4JBW F;  4AIU A;  5FXW A;  2WDQ A;  2LKG A;  2VK9 A;  3LG7 A;  2V6X A;  5LGU B;  4C90 A;  3BK9 A;  2E2A A;  5FP3 A;  5FYM A;  3N9P A;  3UUM A;  2Q9Q D;  3QB5 A;  4HFB A;  2FUP A;  3K8P C;  2X9X A;  1IBM T;  1YQ4 A;  2CE7 A;  4GYR A;  1FMW A;  1QUU A;  2W62 A;  4HWI B;  2K3W A;  2XQ9 A;  5AQP B;  3GN5 B;  2ZMA A;  2IDO B;  3FHN A;  1KNR A;  2JIW A;  2KWH A;  3SS1 A;  2XQ7 A;  1VCT A;  2A2F X;  2XQA A;  4X1K E;  3KV4 A;  2X0Y A;  3AAI A;  2UXB T;  3H37 A;  3P4Q A;  2NTY A;  4NUU A;  4UF0 B;  2ES0 A;  2Y6X A;  1VCS A;  4UVC B;  2LSY A;  3BQK A;  3GA8 A;  2W63 A;  4TNV A;  3PUR A;  4G2A A;  4OX9 T;  3CQG B;  3A8Y C;  2C5K T;  3O4X E;  4H63 H;  2X9H A;  4P0B A;  4JLE A;  4TUY E;  4TWD A;  4O2A E;  5AQJ B;  2XQ3 A;  3TLT A;  4XBF B;  4ANJ A;  4H9N C;  1LKX A;  2FJA A;  4LFA T;  4O4J E;  2W67 A;  4HWF A;  5J2T E;  3O1H A;  2CWY A;  4UVB B;  1H7C A;  4XAX B;  2OA5 A;  4ZZC A;  4H9Q C;  3AEB A;  5AQO B;  2WBL A;  4A98 A;  3C4W A;  5FVK A;  1HNX T;  1YKE B;  3CQC B;  2H3R A;  3A5X A;  3Q5X A;  4HWC A;  3PUG A;  2ODV A;  2VUR A;  2WCA A;  4ZZB A;  3KV5 A;  2XSB A;  2WP9 A;  3FXE B;  5JR9 B;  4U33 A;  2CM0 A;  5J2U E;  2IW5 B;  4EIW A;  4O4I E;  2VVS A;  4JYA T;  2BG9 A;  2CXD A;  1I94 T;  4PW8 A;  1T72 A;  3IHR A;  5LGN B;  4HN9 A;  3F31 A;  2H7O A;  3JC6 D;  3KV9 A;  2DI4 A;  3ANW B;  4EGW A;  4WW0 A;  4MBQ A;  4U2Z A;  4AQF C;  4YY3 T;  4NIQ A;  4DMV A;  4IDQ A;  2K24 A;  3WAJ A;  3IEE A;  2JQH A;  5C2T A;  2FJB A;  2EHO A;  4J2C A;  5JR9 C;  3VKG A;  3I0Q A;  5LJN A;  5M4Y A;  2VQE T;  2QGS A;  4IE0 A;  4CXX A;  3RYF E;  3RC3 A;  2K48 A;  3VHL A;  3MAC A;  4DUZ T;  1FIO A;  3AEG A;  4LF7 T;  4OYJ A;  2LOS A;  3FB2 A;  5TAO A;  2WDR A;  2LSG A;  2YU1 A;  5L3E B;  2IAK A;  5FMN A;  3L39 A;  1VRB A;  1BR4 A;  2WWU A;  5FY7 A;  2XAG B;  2HPJ A;  3RHW A;  4F6R C;  4B3S T;  4JI3 T;  2XAS B;  2V6Y A;  3Q5D A;  2BZB A;  2BKP A;  4PJL A;  3AAE B;  4QH5 A;  3P8C D;  5HXR A;  4ERR A;  3AXJ B;  1N36 T;  2Q9Q A;  5HAX A;  1SUM B;  3NRY A;  3P4R A;  4ILC A;  2VKJ A;  4BJN A;  5KDM C;  4U7Y A;  4B6X A;  2I0M A;  4X65 T;  4UV8 B;  1D0Y A;  3HKE E;  4AKI A;  3I9Y A;  1WYC A;  4ISS A;  5ABF B;  4CI1 B;  1YW0 A;  4DUY T;  1Y64 B;  1XDP A;  3AA6 B;  4ZEY A;  1XNR T;  3EHZ A;  3KDS E;  5IWA T;  2M6B A;  2H88 A;  1WYB A;  1V9D A;  3EVY A;  5JDM A;  4DV3 T;  3V5S A;  2J1D G;  3KBU A;  2LLY A;  1Z8U A;  3ZEF B;  5LP6 E;  5H6R B;  1M7K A;  5AQS B;  1XMQ T;  5JRC B;  2XAJ B;  3X1D A;  1CUN A;  1NEK A;  4YXD A;  3MKD A;  1HG2 A;  4GYS A;  1QSD A;  4L0R A;  2V5D A;  3QC9 A;  1W0A A;  2XHE B;  3R6N A;  4MHC A;  2L3L A;  1E1H B;  3ZPO A;  3ONJ A;  3FZM B;  2DHR A;  4CN6 A;  1U5P A;  2CCQ A;  3AA7 B;  3ZYK A;  4U31 A;  4NPP A;  4UV9 B;  4LML A;  3SOL A;  1N34 T;  3LBX A;  2CBJ A;  3BQI A;  3VR8 A;  1HS7 A;  5JDF A;  4JI8 T;  5AQI B;  2BS2 A;  2BVL A;  2VAS A;  2KIN B;  4CZZ B;  3OPC A;  2QRX A;  4KI0 F;  1U4Q A;  1D0Z A;  3RIU C;  3PUW F;  3EAB A;  3G06 A;  1S35 A;  2V7K A;  5EK4 A;  3AED A;  3MZK B;  4HEA A;  4IST A;  3UFG A;  3UUL A;  4ASK A;  1I6Z A;  5LMN T;  5HYA A;  2E5V A;  4X20 E;  3OKQ A;  3AA0 B;  2E8I A;  5FXV A;  1MIW A;  4YHH T;  2ZM0 A;  2CLY C;  3K3O A;  4KX6 A;  2V7L A;  2M67 A;  2CRB A;  3W15 B;  5ETW A;  1HF8 A;  3N9N A;  2I59 A;  3EUH A;  3C98 B;  2WB5 A;  4AKR B;  4QX8 B;  4DR2 T;  2VL8 A;  3ZYM A;  1D1A A;  2X9W A;  1Y01 A;  5HXC A;  3PUX F;  1KF6 A;  2V5C A;  2ZM8 A;  3O1I A;  4PK6 A;  2UXX B;  4KHP T;  1T8B A;  2XTL A;  3PV0 F;  4HFD A;  4HWD A;  3C51 A;  4QHO A;  2XQ5 A;  4U2Y A;  3UUX B;  5HEH A;  4N78 D;  1EZ3 A;  2NOX A;  2C5I T;  2F4V T;  2BVM A;  4H9S E;  4Z8X A;  2M6I A;  3ZJ1 A;  4OK0 A;  3ONL C;  5JVD E;  4JUY A;  1HNW T;  2XM1 A;  3F57 A;  4DR6 T;  2X67 A;  5LGT B;  2QA7 A;  3N9Q A;  5LG4 A;  4C91 A;  3J7Y q;  1XDO A;  2VKD A;  4MLK A;  5LA6 E;  2ZM2 A;  2LHR A;  4O4L E;  2P9B A;  5DQV A;  1KK7 A;  4MFR A;  4NXN T;  5HXE A;  5GON E;  3CKD A;  2R6G F;  2BG9 E;  3RF1 A;  3N2G E;  5LB7 B;  4CQI A;  4LMJ A;  4U72 A;  4V1A v;  1FMV A;  2WDV A;  5JDG A;  3DP7 A;  5JTG A;  2XAQ B;  5LHG B;  3HKB E;  1OED B;  2E5L T;  5JRC A;  3ZT6 A;  4JI7 T;  3RKG A;  2AXD S;  4B3R T;  2NTX A;  2XAF B;  2K9A A;  3JCF A;  2E9X B;  3LK4 2;  3OYX A;  3N5L A;  2BG9 C;  3PU8 A;  3GMI A;  3SWH A;  3VU7 H;  4DMW A;  2WZH A;  3UU3 A;  4ZI2 C;  4CI2 B;  4DV1 T;  3RI5 A;  1OED E;  4HFE A;  5HEO A;  5JQG E;  1UK5 A;  5KMG P;  2XQ6 A;  4HFH A;  5KXJ A;  2AE9 A;  2D5U A;  5HXS A;  2BKO A;  3NKZ A;  5FY1 A;  4DR1 T;  3ZMT B;  2A3D A;  2ODU A;  4KMC A;  1XNQ T;  3TLU A;  4IRE A;  2WMN A;  3PE0 A;  4PK4 A;  1OED C;  3ZN1 B;  2LT3 A;  2DWG A;  2N1G A;  3ONX A;  2XQ4 A;  5AQU B;  2IHR 1;  2LRL A;  4DND A;  2E9X C;  4ZXL A;  4CN4 A;  4YTN A;  3ZSS A;  2KWI B;  1ZP0 A;  3C4X A;  2J4G A;  1HG5 A;  2LRK A;  4UEL A;  3O1J A;  4P1N A;  4ADZ A;  5HWX A;  2XSA A;  3AA1 B;  3C4Z A;  4MAL A;  3VKH A;  1W9R A;  3RYC E;  2UUA T;  5BMV E;  4WZX A;  2MOZ A;  3SRZ A;  1G73 A;  4ZS2 A;  4WNK A;  5AQT B;  1B7T A;  5FL1 A;  4EYY R;  5JH7 E;  4Z91 A;  4EZ4 A;  3SFD A;  4KBM B;  3RYI E;  4GKK T;  5LXT E;  4GK5 E;  3RQW A;  2QYW A;  3ZC1 A;  1YQ3 A;  2VVN A;  3RKO A;  3UQ7 A;  2A9U A;  4AKH A;  3P4S A;  4EOZ B;  5LBM A;  3H3M A;  3QUJ A;  3BQL A;  4AKG A;  1J5E T;  1XMO T;  3E08 A;  2OLT A;  3U3I A;  1Z0P A;  4BJM A;  2DWK A;  5F8P A;  3OVU A;  2B1E A;  3ZN0 B;  3PUQ A;  4NXM T;  1YKH B;  1E7P A;  5FKY A;  4LF5 T;  4IE4 A;  2XUE A;  2OV9 A;  4CN1 A;  4UVA B;  2W4X A;  5L2L A;  5KX5 E;  2X68 A;  4JEH B;  2XZE A;  2I6H A;  1CHU A;  2QVA A;  4DV7 T;  5H6Q B;  2CXL A;  2MBG A;  3HKC E;  1IJ5 A;  1NEN A;  4TX5 A;  1J1J A;  5JDH A;  4O8S A;  1D1B A;  3OJA A;  2NP9 A;  5FXZ A;  2D0U A;  5HEJ A;  3DTO A;  5IYZ E;  3L8R A;  4M1P A;  4TWH A;  1SE7 A;  2N2N A;  1OXZ A;  3HI2 A;  4ILB A;  1WCR A;  4IHJ E;  5L47 A;  4JI0 T;  3E22 E;  2VWA A;  2LSI A;  3UU8 A;  3MK7 C;  2DCF A;  3GN5 A;  3I0O A;  2YIN A;  3AE4 A;  3P7I A;  4G63 A;  2H89 A;  2CMR A;  2FJE A;  2KND A;  5C3J A;  3K3N A;  2YKS A;  4IE5 A;  4UF0 A;  3LDQ B;  4NUV A;  4YJ2 E;  1NAF A;  4HWH A;  1MMG A;  5CB4 E;  4X66 T;  2PBI A;  4DR3 T;  3AVR A;  4ZI3 C;  2UUC T;  2YU2 A;  3T1Y T;  2UXN B;  4DO0 A;  3PJA A;  3K1S A;  3AB3 B;  3ESL A;  3AAA B;  2KXP B;  3Q2M A;  2XY8 B;  1LVK A;  3WI3 A;  1WLX A;  2HH7 A;  5J0Z A;  2BS4 A;  1HNZ T;  1JNR A;  4PFO A;  3RC8 A;  4WBO A;  3KVB A;  5A1L A;  1ZEE A;  2WS3 A;  3AVS A;  5DAB A;  3UU5 A;  4GIW A;  2PJQ A;  3AEE A;  2VQF T;  4I4T E;  4A5X A;  4QH4 A;  3IA3 A;  3KIN B;  5FXX A;  2V26 A;  4HFV A;  4DV5 T;  1D0X A;  4COF A;  3AE8 A;  3CVR A;  1XWM A;  4QKN A;  3L3P A;  4YFS A;  2IUB A;  4JI4 T;  4ZHQ E;  3AE5 A;  2GK9 A;  1MMA A;  3ZCJ A;  2X66 A;  1ZHC A;  5AQF B;  2MYS A;  5JR9 A;  4DID B;  4X5T A;  4JI2 T;  3FZH B;  4QX7 B;  4Z90 A;  5AQR B;  3KV6 A;  5IHY A;  3RGL A;  3ABV A;  3UTK A;  1ZV4 X;  3E0Z A;  5F5W A;  5AQG B;  4IGU A;  3A7M A;  2JMK A;  4DR5 T;  2WU5 A;  4QXC B;  2JQQ A;  3HA4 A;  4HTE A;  3ANW A;  5HXH A;  3EDU A;  5DJQ C;  3V5U A;  2L8K A;  4L5G A;  2CLY B;  1W0B A;  3RPU A;  3P4P A;  2CHO A;  2CA5 A;  4LF8 T;  2JRK A;  4H63 V;  2V1D B;  4JI6 T;  4EZH A;  1YD8 G;  4UIG A;  4GK0 E;  4F8H A;  5HWY A;  1MND A;  5L4H A;  3VRB A;  4YTP A;  2WWV A;  3UU6 A;  2K5B B;  3I9W A;  3RRC A;  1UX4 A;  3IBP A; 
#chains in the Genus database with same CATH homology
 1XMQ T;  2UXC T;  2E5L T;  4YHH T;  4B3M T;  2VQF T;  5LMU T;  4X64 T;  4JI7 T;  4K0K T;  4B3R T;  4B3S T;  4DV4 T;  4JI3 T;  4JI0 T;  4DV5 T;  4DR2 T;  4JYA T;  4DV1 T;  2UUB T;  1N32 T;  1I94 T;  4GKK T;  4AQY T;  4DV6 T;  4JI4 T;  1FJG T;  1N36 T;  4LFC T;  2UXD T;  4KHP T;  4OX9 T;  1IBK T;  4GKJ T;  4DR1 T;  4JI2 T;  1HR0 T;  1XNQ T;  4X66 T;  4B3T T;  4LF9 T;  4DR3 T;  2F4V T;  1N34 T;  4YY3 T;  2UU9 T;  1J5E T;  2UUC T;  4DR4 T;  3T1Y T;  1XMO T;  4X65 T;  4JI8 T;  1HNW T;  4DV0 T;  4LFA T;  4DR6 T;  4DR5 T;  4X62 T;  4JI1 T;  4NXM T;  2VQE T;  1N33 T;  4DUY T;  4LF5 T;  4DV2 T;  4DR7 T;  3OTO T;  1IBL T;  1XNR T;  4NXN T;  4LF6 T;  1HNZ T;  5IWA T;  4LF8 T;  1IBM T;  5BR8 T;  4JI6 T;  4JV5 T;  4DUZ T;  4LF4 T;  4DV3 T;  3T1H T;  4LF7 T;  4DV7 T;  2HHH T;  2ZM6 T;  4LFB T;  5LMN T;  1HNX T;  2UUA T;  2UXB T;  4JI5 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...