1HNWT

Structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 33
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1hnwT00
2UUBT 5LMNT 4DR6T 1HNXT 4DV3T 4YHHT 1N36T 4LF4T 2UUAT 2UXCT 4JI3T 4NXNT 2ZM6T 4DV5T 4DR1T 3OTOT 4JI8T 4JI4T 5LMUT 1I94T 4B3TT 2UXBT 4LF5T 3T1HT 4DR3T 2UUCT 4LFBT 2F4VT 4LF7T 4KHPT 4LF6T 1XNRT 4K0KT 1N33T 5BR8T 4DV4T 4B3RT 4JI5T 4NXMT 1J5ET 1N34T 4OX9T 1FJGT 1IBLT 4DV6T 4DV7T 2VQET 1IBKT 4DR7T 4JI7T 2E5LT 5IWAT 4X64T 2VQFT 1XMQT 4AQYT 1HNZT 2HHHT 4JI6T 4DUZT 3T1YT 1XMOT 1XNQT 4LF9T 2UXDT 4DV0T 4JYAT 4GKJT 1N32T 1HR0T 4DV2T 4DR5T 4B3MT 4B3ST 4LF8T 4LFCT 4DUYT 2UU9T 1IBMT 4JV5T 1HNWT 4GKKT 4DV1T 4JI2T 4YY3T 4DR2T 4X65T 4X62T 4DR4T 4JI0T 4JI1T 4LFAT 4X66T
chains in the Genus database with same CATH superfamily
5HWYA 2VB6A 1OEDE 2QVAA 5AQQB 2V7KA 3ESLA 2UUCT 2V5CA 2G0UA 4DV3T 4L0RA 2ACZA 4E7SA 3OKQA 3AEAA 5ABGA 2IHR1 4ILBA 2UXCT 3AE7A 5A1LA 2V7JA 3P50A 2VL0A 1LRZA 4U7IA 5AQRB 1XZYA 4EAHA 4YSZA 2A2FX 3AA0B 3UU8A 1M62A 2CBJA 2XASB 5FY0A 4NXNT 2X0LB 2A9UA 4ZHQE 5LG3A 2X0YA 4DV5T 3DTOA 4YFSA 3OPCA 2KINB 3PUXF 2WZHA 2Q9QD 3ZSSA 4UVBB 2XQ3A 2C0SA 2X0HA 4TNVA 4EB6E 3OTOT 3AE2A 1HCIA 2X9YA 3DJBA 2WAUA 2BVMA 4YJ3E 2YDQA 1MMAA 3FXDB 3J7Yq 2CHOA 5LMUT 5JR9A 3N9NA 2BS2A 3RI5A 3KDSE 2Y48B 4TX5A 5CA1E 3ONXA 3KV5A 3OJAA 3KVAA 3SFDA 4TNWA 3W15B 5LGUB 4QH4A 3AE9A 3LSVA 5M4YA 2B1EA 5FNVE 2F4VT 3KINB 2XQ4A 4UV8B 2BDEA 2ODUA 2I0MA 5JVDE 4YJ2E 3AE6A 2V7LA 4EZ4A 2EHOA 5LP6E 2W63A 2VL8A 4UVCB 1J5WA 3D0TA 4TWHA 2UXXB 4PK6A 3CQGB 2R6GF 3NBXX 5BR8T 4QH5A 2WM9A 2X51A 3PUAA 4JBWF 4U3CA 4JI5T 2N9DA 2ZM8A 3CX8B 3VRAA 1X9BA 4ASKA 2K3WA 1KF6A 3AA7B 2QGSA 1M7KA 4ZZCA 2QRXA 2VK9A 1WCRA 1VRBA 2FUPA 3DP7A 2WU2A 3AA1B 3ETUA 4JEHB 4PJLA 3RIUC 3ZMSB 3AE4A 3QUJA 3GA8A 4G2AA 4QXBB 4I43B 1G73A 4A56A 2BG9B 4CN6A 1S94A 4IL9A 4WBNE 5F3JA 1FEWA 3LJCA 3ZN0B 4H9QC 2H89A 2JQHA 2L9QA 4IE0A 5LBQB 4G63A 4BJMA 1YKHB 4DBRA 4YTPA 2YN6A 4UV9B 1R8IA 4ILAA 5IWAT 1V9DA 2VQFT 1XMQT 4TWDA 3AAIA 4IL4A 3GWHA 2XAGB 2IIUA 2GK9A 3TLWA 2VKHA 3EAMA 5AQKB 1HFAA 5FXWA 3Q5DA 1ZP0A 2BVLA 2CWOA 4LF9T 1XNQT 2PG8A 2CPTA 5JREA 1D0XA 5JDQA 2CCQA 3RYIE 3CMLA 3ZMUB 4DV0T 1UGOA 2CM0A 2J1DG 2OA5A 4IDNA 2Q9QC 3RHWA 2W4XA 5JDLA 5JDNA 2XY8B 3AB3B 3MJXA 4B3MT 3RYHE 3PUSA 5L4HA 2V7MA 2D9DA 1ZKEA 2BG9C 2LRLA 3C50A 2YEVC 2NWBA 5H6QB 2LKGA 3L3PA 4P09A 3MACA 3P4WA 3S4UA 2WB5A 4F8HA 3CQXC 1MMDA 4HFCA 4DUYT 3PU8A 1OXZA 1IBMT 3N2GE 3UFGA 3ZC1A 3UTKA 2DWGA 1Z8UA 2XSAA 2XM2A 3MKDA 3FBZA 3FBLA 4PFOA 1NEKA 3AE3A 2KWIB 4LMLA 3ZT7A 1HNWT 4AKGA 3GN5B 1CUNA 3AEGA 4GKKT 5LGTB 4WNKA 2C5JA 4DV1T 2FJBA 3A5XA 4GYSA 5ETWA 4HGAA 4U74A 4JI2T 2VVNA 4P0AA 3HL6A 3HKDE 4ISTA 4NPPA 3UU6A 3UUXB 4X62T 5LHHB 4X65T 2MAWA 2WY2A 4YTMA 3TLTA 3VHLA 4EZHA 3HR0A 4NUUA 5JDFA 4ILUA 4P0BA 4EXTA 3M65A 3QB5K 4HFBA 4ZXLA 2LSKA 2WZIA 3O1IA 2A3DA 1ZHCA 5AFUL 1YD8G 4L5GA 4AKIA 3IF8B 5CA0E 2J4GA 1D1BA 4QX8B 5LBMA 5LMNT 3E0ZA 2KT9A 3MA9A 4HFDA 3SFEA 5F8PA 1N36T 4LF4T 2CLYB 5HAXA 2Q9QA 3ZYKA 2WQYA 5HXHA 5AQFB 3SWHA 4ZI7E 5IHYA 5LB7B 3RRCA 4ISSA 4AKRB 3EDVA 2JQ9A 2XSBA 3NZQA 4X5TA 2OV9A 2VWAA 2DL1A 2JMKA 2BG9A 1BR2A 4MALA 2WSSV 3AEFA 3PURA 5AQOB 2ZM6T 4HE8A 5JTGA 5ABEA 4X20E 4A97A 5FXZA 4BA9A 4CN4A 2FJDA 2LHNA 5JDMA 1BR4A 4F6RC 5GONE 1UUSA 2XAJB 3ANWB 4PFPA 3ZCIA 2MYSA 4QKNA 3RKGA 2NTYA 4JI8T 4O2AE 4OK0A 3BQLA 4O4IE 2EHOC 2FJAA 3FZFB 4MFRA 1B7TA 4MLKA 3SRZA 4A5XA 2JQKA 2V5DA 2LSJA 3U3IA 4LF5T 4PJNA 1D0YA 3T1HT 3PUGA 1T8BA 3LFMA 3UFEA 2ODVA 3L09A 3JADA 4V1Av 4WBOA 1YQ3A 1HF8A 2W2UA 3MXZA 4CI1B 4LFBT 4WZXA 2JJ9A 2XUEA 1SHZC 3VR9A 4BAYB 1W0AA 3Q2MA 3WI3A 2IAKA 1XNRT 3PJAA 2M6IA 4TV9E 4JI1T 2IDOB 3UUBA 4J2CA 4NIQA 3RKOA 3UUNA 2NOXA 2RA1A 3PUQA 5EK3A 3WAJA 4KHZF 3ZYLA 4YXDA 2OLTA 5FKYA 3ZLIA 3HKEE 4JUYA 3ZMVB 5L3DB 2HH7A 2NP9A 4XAXB 4CXXA 2CRBA 2DCFA 2CWYA 3QK6A 4O4LE 3BQKA 4B3RT 1J5ET 4HFEA 3IA3A 2YKSA 3P8CD 3FZMB 2V8SV 5FL0A 2BBJA 2XAFB 4NUVA 3F57A 4IDZA 3R84B 3TLUA 2MOZA 2BKNA 1FJGT 2E9XA 2E8IA 4DV6T 3H37A 4OFZA 4KI0F 2FJEA 3AEBA 2XZEA 4TV8E 5FMNA 2N1GA 1ZOYA 2VKOA 3K3QC 3RPUA 4U72A 3ZN1B 4DBQA 4YTNA 5L2LA 2LE8A 2LLYA 5JQGE 2ES0A 3ZJ2A 5CFBA 1HX8A 4AIUA 3V5UA 4CI2B 3AECA 4EEDA 1FMVA 2K24A 1D0ZA 1WYCA 1YQ4A 2DI4A 2PBIA 3G06A 5FY7A 4DVDA 2V7IA 1D1CA 2D5UA 2WMOA 2IMLA 1HG2A 1SA0E 2X68A 4I4TE 1XMOT 4PK5A 4ANJA 1UURA 5DJQC 5LJNA 2UXNB 2PFVA 5KMGP 2M67A 3C4WA 4KBMB 4PJMA 5AQSB 3ZSTA 4ERRA 2D0TA 2YK0A 4JYAT 2E9XB 4BJNA 3K1SA 3I9YA 4HEAA 2BKPA 4N78D 4HWFA 3NWIA 1IJ6A 2J62A 1U5PA 3OVUA 4UELA 4DV2T 1SE7A 4TUYE 4IDQA 1XDPA 2KMFA 4HWIB 1VCTA 1J1JA 2HN2A 1WYBA 2XQ6A 4UF0A 2MPKA 1W0BA 1QSDA 5DQWA 2BS4A 3KV6A 3WAKA 2BZBA 3AA6B 3O1JA 4JV5T 5HXCA 3SOLA 5LNKA 3ONLC 3L8RA 5LGNB 2LSYA 2LSIA 3AEEA 1WRDA 1QUUA 4HTEA 2LHRA 2XJ7A 2IC6A 3KBUA 3AE5A 3N2KE 2QYWA 3F2EA 1U4QA 4ZOLE 4ZI2C 3AAAB 4DO0A 3LK2B 2BS3A 4AKHA 4ZS3A 2K5BB 2ZMAA 4HKAA 4DR4T 3AEDA 3IEEA 4JEUB 3UUMA 3RF1A 4YY3T 2HPLA 3FZLB 5AQTB 4DMVA 1WLXA 2V6YB 4QXCB 4AQGA 4UF0B 3CVRA 4H9OC 3U78A 2NTXA 2WS3A 2CBIA 4IE4A 3LK3B 4CXWA 2L3LA 3K3OA 4GIWA 1S35A 2XPKA 2HPJA 5CB4E 4ILCA 4EGWA 5L3FB 2JQQA 3I9WA 5HXSA 1XDOA 1T72A 5LYJE 3JCFA 4LFAT 1MIVA 2UUBT 2W67A 4H9PC 3ZMTB 5JR9B 3VKHA 1E1HB 1LVKA 3LBXB 4IDOA 1HNXT 5DQVA 3VKGA 4YHHT 4O4JE 2LKHA 2UUAT 5J0ZA 2H88A 1YKEB 3JAFA 2Y6XA 2K9AA 1FMWA 2WDQA 3PUZF 5AQJB 3UULA 1JNZA 5LXTE 4JI3T 4ZZBA 3VRBA 3RC3A 4AISA 5J2TE 2CXLA 5LCYA 2XHEB 2C5IT 3AXJA 1KK7A 4H63H 4M1PA 2W62A 1HX1B 3GMIA 1NENA 3QC9A 5ADXL 2E2AA 5JRCA 3MK7C 5EK4A 3Q9DA 3JC6C 2J47A 3PUWF 1UX5A 2XQ7A 4ZI3D 3CK6A 4Z90A 4U2YA 2VASA 4L9IA 4JI4T 3B5MA 1HTJF 3P4SA 4HN9A 2VKDA 4QWNB 1L0VA 4C90A 5KDMC 2DLRA 2WWVA 4X1KE 2CXDA 1WR0A 2EHOD 2X9WA 2YDRA 3OYZA 4FI5A 1VOMA 4PW8A 2H7OA 1MNDA 3NZPA 5FVKA 4ZI3C 2LSGA 3C51A 5ABFB 4KHPT 2KLQA 4LF6T 2LOPA 5HEOA 1E2AA 1WFDA 3I1AA 5EZYE 5FP3A 2E9XC 3PJAJ 5FYMA 3RIUA 5JR9C 1BR0A 2LJLA 3B57A 2QA7A 3RGLA 4IT4A 3AVRA 5LOVE 5C2TA 1N33T 5FVLA 4IHJE 1AJ3A 5FXXA 5L47A 4EV6A 3PE0A 3K3NA 4E7ZA 2I6HA 2RPAA 4DV4T 1OEDC 3PUYF 2HN1A 2CEAA 3CIRA 2WDVA 4Z8XA 3ZKRA 4CXYA 4NXMT 1I6ZA 3HKCE 1FIOA 2IUBA 2VVSA 3LDQB 2LRKA 3E08A 4EOZB 2LM2A 1KFYA 3K8PC 2E9XD 3AE8A 1W09A 2NR4A 1LKXA 4UXNB 2Y8DA 3CX7B 3CKDA 2VQET 3AXJB 4UR9A 5IUXA 2LT3A 2KXPB 1IBKT 2A72A 2CA5A 4GYRA 4O4HE 4DR7T 3QOFA 1MNEA 4O2BE 4JI7T 1UK5A 3EABA 5LA6E 2E5LT 4ADZA 4X64T 1HNZT 2HHHT 1EZ3A 1MMNA 3UT5E 5JRCB 4EYUA 3KVBA 5AQHB 3TKLB 1T98A 2N2NA 3T1YT 5C3JA 2YU1A 2M6BA 5LJMA 3CX6B 5E0OA 4IE6A 4AI6A 4KMCA 5ABHA 4DUZT 4X1IE 2X9XA 3LBXA 3AVSA 2XQAA 5HEGA 4IIJE 3UU4A 4EYYR 5BMVE 1WR6A 5CGMA 3QB5A 2V6YA 5LHGB 5LG4A 4AQFA 2W00A 2WWUA 3H3AA 4O8SA 4OYKA 3N2OA 1N32T 1HR0T 1Z0PA 3T8OA 3I0QA 5FXVA 2XAQB 4B3ST 3PTRB 4Z91A 1YXRA 2SPCA 4QXHB 2KNDA 2DNXA 2X9HA 3RX6A 2ZM2A 4LFCT 3RC8A 3ZMZB 2XTLA 4XZCA 3UQ7A 2CHNA 3UU3A 2UU9T 4PK4A 1Y64B 4ZS2A 3P7IA 5FL1A 1GQEA 4OHFA 2D2SA 3RQWA 1QLBA 4CQIA 3ZC0A 1IJ5A 3C4ZA 2YOEA 2W61A 1OEDB 4LMJA 3JAEA 4PNIA 3SS1A 5C8YE 2V26A 3FB2A 2BBHA 3Q5XA 3TLSA 4HWDA 4IE5A 4YLHA 4PAGA 2AE9A 2I59A 1H7CA 3OYXA 1DU2A 4HWHA 3PUVF 5JDGA 3VR8A 3JC6D 4GK0E 2PTFA 3BK9A 4K0UA 5ABFA 2W66A 2YU2A 3L39A 3CWZB 2PJQA 3CQCB 5AQLB 3KBTA 3VU7H 3ZT5A 4LMKA 4COFA 3NVOA 3AAEB 2D0UA 2KWHA 1JNRA 3NKZA 5HEUA 4QX7B 4H9NC 4X66T 3I0OA 2JIWA 3A8YC 3M3ZB 4P1NA 3IBPA 3OBVE 5FY1A 3RYFE 4DR6T 5KXJA 5HWXA 5L3EB 1KNZA 2MBGA 3KFWX 1OWAA 1IAPA 2LOSA 4MBQA 4CZZB 5HEJA 5L3GB 4DR3T 2LM9A 3ZPOA 4HFHA 1T7SA 3NRYA 4U7YA 2L8KA 2BKOA 3TLVA 4U2ZA 2V6XA 2XQ9A 1US7B 4HWCA 4DR1T 4U33A 5L3CB 4PJJA 1D1AA 3FHNA 1BR1A 2JMHA 2Z6EA 3N9LA 3RIFA 4DMWA 1XWMA 3X1DA 3J9X1 1W9RA 2VKJA 4IE7A 4KP3C 5HCJA 2H7VC 4YSYA 3F31A 5KX5E 4DNDA 2IW5B 4TWFA 5F5WA 3ZCJA 1I94T 3GN5A 3LG7A 4ZI2D 4B3TT 2UXBT 4A98A 3RLFF 4CN1A 3QNUA 3V5SA 3N9MA 1X79A 2KZ7B 1MMGA 3C98B 3NRXA 5AQGB 3C64A 3EVYA 2DHRA 4Q25A 3ZT6A 1OEDA 4EIWA 5CJ5A 4I50E 3RIAA 4LF7T 3RQUA 2BG9E 1YW0A 3EUHA 2CLYC 3ETVA 5AQUB 3IHRA 3EI0A 1ZV4X 4OYJA 5AQVB 4TZ4C 1MIYA 4AQFC 2AXDS 2XQ5A 2RP4A 2YDSA 3A7MA 3N5LA 4GK5E 5IYZE 4JLEA 4EEBA 1HG5A 4FJOA 2B76A 3HI2A 3HKBE 4MHCA 5DABA 2WU5A 4UEMA 3UU5A 5J2UE 4K0KT 3FXEB 3C4XA 4X1YE 3KV9A 4TN7B 2FBWA 1KNPA 1IZNB 2NW7A 2WCAA 3B13A 3P4QA 2WP9A 3P4RA 5HXRA 4DIDB 3ZEFB 2C5KT 2XQ8A 1N34T 4C91A 4OX9T 1IBLT 2YINA 4HFVA 2X67A 3AE1A 2WMNA 4IGUA 4DV7T 4YT0A 3ANWA 1E7PA 5AQIB 5L3BB 3RH3A 5HXEA 5LHIB 1KNRA 2E5VA 3R6NA 4H63V 4CI3B 4AKLA 4GOUA 1NWMX 3P4PA 2P9BA 2VURA 4I0UA 2X66A 4YHJA 2K48A 5JH7E 4AQYT 1O3XA 5EK2A 4JI6T 2XAHB 2XQYA 4QHOA 4HFIA 4AXPA 4ZEYA 2ACXA 3E22E 5JDHA 2UXDT 5AQMB 3RYCE 3PU3A 2LEHA 4U31A 3N9QA 5J1GA 1G8XA 2Q9QB 3N9OA 1NAFA 2DWKA 3EDUA 3PDYA 4XBFB 5HCMA 1HS7A 3CPZA 4IDPA 3Q5EA 4WYVA 4GKJT 2WBLA 5H6RB 4DR5T 1VCSA 3ONJA 2CXFA 2ZLYA 3HA4A 4KUMB 2EHOB 4KX6A 4QH1A 2NW8A 1MIWA 4UIGA 4WW0A 4LF8T 2NW9A 3ZYMA 2CMRA 1Y01A 2H3RA 2JRKA 3ABVA 3FZHB 4YSXA 2KSRA 2MTQA 1CHUA 4JI0T 3UQ4A 1ZEEA 1KEYA 3Q5WA 5HEHA 2V1DB 5TAOA 1SUMB 2IC9A 4IREA 3FZKB 3MZKB 5AQPB 5AQNB 3ZJ1A 4H9SE 4H9RC 3O9XA 2ZM0A 3O4XE 1LVFA 3BQIA 2CE7A 4DR2T 1UCUA 3LK42 3KV4A 2JPFA 5L4EA 4UVAB 3EHZA 2W0GA 3RRWA 5HYAA 3O1HA 1UX4A 4I55E 2WDRA 3N9PA 3H3MA 4B6XA 2XM1A 3PV0F
chains in the Genus database with same CATH topology
2UUBT 5LMNT 4DR6T 1HNXT 4DV3T 4YHHT 1N36T 4LF4T 2UUAT 2UXCT 4JI3T 4NXNT 2ZM6T 4DV5T 4DR1T 3OTOT 4JI8T 4JI4T 5LMUT 1I94T 4B3TT 2UXBT 4LF5T 3T1HT 4DR3T 2UUCT 4LFBT 2F4VT 4LF7T 4KHPT 4LF6T 1XNRT 4K0KT 1N33T 5BR8T 4DV4T 4B3RT 4JI5T 4NXMT 1J5ET 1N34T 4OX9T 1FJGT 1IBLT 4DV6T 4DV7T 2VQET 1IBKT 4DR7T 4JI7T 2E5LT 5IWAT 4X64T 2VQFT 1XMQT 4AQYT 1HNZT 2HHHT 4JI6T 4DUZT 3T1YT 1XMOT 1XNQT 4LF9T 2UXDT 4DV0T 4JYAT 4GKJT 1N32T 1HR0T 4DV2T 4DR5T 4B3MT 4B3ST 4LF8T 4LFCT 4DUYT 2UU9T 1IBMT 4JV5T 1HNWT 4GKKT 4DV1T 4JI2T 4YY3T 4DR2T 4X65T 4X62T 4DR4T 4JI0T 4JI1T 4LFAT 4X66T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUB T;  5LMN T;  4DR6 T;  1HNX T;  4DV3 T;  4YHH T;  1N36 T;  4LF4 T;  2UUA T;  2UXC T;  4JI3 T;  4NXN T;  2ZM6 T;  4DV5 T;  4DR1 T;  3OTO T;  4JI8 T;  4JI4 T;  5LMU T;  1I94 T;  4B3T T;  2UXB T;  4LF5 T;  3T1H T;  4DR3 T;  2UUC T;  4LFB T;  2F4V T;  4LF7 T;  4KHP T;  4LF6 T;  1XNR T;  4K0K T;  1N33 T;  5BR8 T;  4DV4 T;  4B3R T;  4JI5 T;  4NXM T;  1J5E T;  1N34 T;  4OX9 T;  1FJG T;  1IBL T;  4DV6 T;  4DV7 T;  2VQE T;  1IBK T;  4DR7 T;  4JI7 T;  2E5L T;  5IWA T;  4X64 T;  2VQF T;  1XMQ T;  4AQY T;  1HNZ T;  2HHH T;  4JI6 T;  4DUZ T;  3T1Y T;  1XMO T;  1XNQ T;  4LF9 T;  2UXD T;  4DV0 T;  4JYA T;  4GKJ T;  1N32 T;  1HR0 T;  4DV2 T;  4DR5 T;  4B3M T;  4B3S T;  4LF8 T;  4LFC T;  4DUY T;  2UU9 T;  1IBM T;  4JV5 T;  1HNW T;  4GKK T;  4DV1 T;  4JI2 T;  4YY3 T;  4DR2 T;  4X65 T;  4X62 T;  4DR4 T;  4JI0 T;  4JI1 T;  4LFA T;  4X66 T; 
#chains in the Genus database with same CATH topology
 5HWY A;  2VB6 A;  1OED E;  2QVA A;  5AQQ B;  2V7K A;  3ESL A;  2UUC T;  2V5C A;  2G0U A;  4DV3 T;  4L0R A;  2ACZ A;  4E7S A;  3OKQ A;  3AEA A;  5ABG A;  2IHR 1;  4ILB A;  2UXC T;  3AE7 A;  5A1L A;  2V7J A;  3P50 A;  2VL0 A;  1LRZ A;  4U7I A;  5AQR B;  1XZY A;  4EAH A;  4YSZ A;  2A2F X;  3AA0 B;  3UU8 A;  1M62 A;  2CBJ A;  2XAS B;  5FY0 A;  4NXN T;  2X0L B;  2A9U A;  4ZHQ E;  5LG3 A;  2X0Y A;  4DV5 T;  3DTO A;  4YFS A;  3OPC A;  2KIN B;  3PUX F;  2WZH A;  2Q9Q D;  3ZSS A;  4UVB B;  2XQ3 A;  2C0S A;  2X0H A;  4TNV A;  4EB6 E;  3OTO T;  3AE2 A;  1HCI A;  2X9Y A;  3DJB A;  2WAU A;  2BVM A;  4YJ3 E;  2YDQ A;  1MMA A;  3FXD B;  3J7Y q;  2CHO A;  5LMU T;  5JR9 A;  3N9N A;  2BS2 A;  3RI5 A;  3KDS E;  2Y48 B;  4TX5 A;  5CA1 E;  3ONX A;  3KV5 A;  3OJA A;  3KVA A;  3SFD A;  4TNW A;  3W15 B;  5LGU B;  4QH4 A;  3AE9 A;  3LSV A;  5M4Y A;  2B1E A;  5FNV E;  2F4V T;  3KIN B;  2XQ4 A;  4UV8 B;  2BDE A;  2ODU A;  2I0M A;  5JVD E;  4YJ2 E;  3AE6 A;  2V7L A;  4EZ4 A;  2EHO A;  5LP6 E;  2W63 A;  2VL8 A;  4UVC B;  1J5W A;  3D0T A;  4TWH A;  2UXX B;  4PK6 A;  3CQG B;  2R6G F;  3NBX X;  5BR8 T;  4QH5 A;  2WM9 A;  2X51 A;  3PUA A;  4JBW F;  4U3C A;  4JI5 T;  2N9D A;  2ZM8 A;  3CX8 B;  3VRA A;  1X9B A;  4ASK A;  2K3W A;  1KF6 A;  3AA7 B;  2QGS A;  1M7K A;  4ZZC A;  2QRX A;  2VK9 A;  1WCR A;  1VRB A;  2FUP A;  3DP7 A;  2WU2 A;  3AA1 B;  3ETU A;  4JEH B;  4PJL A;  3RIU C;  3ZMS B;  3AE4 A;  3QUJ A;  3GA8 A;  4G2A A;  4QXB B;  4I43 B;  1G73 A;  4A56 A;  2BG9 B;  4CN6 A;  1S94 A;  4IL9 A;  4WBN E;  5F3J A;  1FEW A;  3LJC A;  3ZN0 B;  4H9Q C;  2H89 A;  2JQH A;  2L9Q A;  4IE0 A;  5LBQ B;  4G63 A;  4BJM A;  1YKH B;  4DBR A;  4YTP A;  2YN6 A;  4UV9 B;  1R8I A;  4ILA A;  5IWA T;  1V9D A;  2VQF T;  1XMQ T;  4TWD A;  3AAI A;  4IL4 A;  3GWH A;  2XAG B;  2IIU A;  2GK9 A;  3TLW A;  2VKH A;  3EAM A;  5AQK B;  1HFA A;  5FXW A;  3Q5D A;  1ZP0 A;  2BVL A;  2CWO A;  4LF9 T;  1XNQ T;  2PG8 A;  2CPT A;  5JRE A;  1D0X A;  5JDQ A;  2CCQ A;  3RYI E;  3CML A;  3ZMU B;  4DV0 T;  1UGO A;  2CM0 A;  2J1D G;  2OA5 A;  4IDN A;  2Q9Q C;  3RHW A;  2W4X A;  5JDL A;  5JDN A;  2XY8 B;  3AB3 B;  3MJX A;  4B3M T;  3RYH E;  3PUS A;  5L4H A;  2V7M A;  2D9D A;  1ZKE A;  2BG9 C;  2LRL A;  3C50 A;  2YEV C;  2NWB A;  5H6Q B;  2LKG A;  3L3P A;  4P09 A;  3MAC A;  3P4W A;  3S4U A;  2WB5 A;  4F8H A;  3CQX C;  1MMD A;  4HFC A;  4DUY T;  3PU8 A;  1OXZ A;  1IBM T;  3N2G E;  3UFG A;  3ZC1 A;  3UTK A;  2DWG A;  1Z8U A;  2XSA A;  2XM2 A;  3MKD A;  3FBZ A;  3FBL A;  4PFO A;  1NEK A;  3AE3 A;  2KWI B;  4LML A;  3ZT7 A;  1HNW T;  4AKG A;  3GN5 B;  1CUN A;  3AEG A;  4GKK T;  5LGT B;  4WNK A;  2C5J A;  4DV1 T;  2FJB A;  3A5X A;  4GYS A;  5ETW A;  4HGA A;  4U74 A;  4JI2 T;  2VVN A;  4P0A A;  3HL6 A;  3HKD E;  4IST A;  4NPP A;  3UU6 A;  3UUX B;  4X62 T;  5LHH B;  4X65 T;  2MAW A;  2WY2 A;  4YTM A;  3TLT A;  3VHL A;  4EZH A;  3HR0 A;  4NUU A;  5JDF A;  4ILU A;  4P0B A;  4EXT A;  3M65 A;  3QB5 K;  4HFB A;  4ZXL A;  2LSK A;  2WZI A;  3O1I A;  2A3D A;  1ZHC A;  5AFU L;  1YD8 G;  4L5G A;  4AKI A;  3IF8 B;  5CA0 E;  2J4G A;  1D1B A;  4QX8 B;  5LBM A;  5LMN T;  3E0Z A;  2KT9 A;  3MA9 A;  4HFD A;  3SFE A;  5F8P A;  1N36 T;  4LF4 T;  2CLY B;  5HAX A;  2Q9Q A;  3ZYK A;  2WQY A;  5HXH A;  5AQF B;  3SWH A;  4ZI7 E;  5IHY A;  5LB7 B;  3RRC A;  4ISS A;  4AKR B;  3EDV A;  2JQ9 A;  2XSB A;  3NZQ A;  4X5T A;  2OV9 A;  2VWA A;  2DL1 A;  2JMK A;  2BG9 A;  1BR2 A;  4MAL A;  2WSS V;  3AEF A;  3PUR A;  5AQO B;  2ZM6 T;  4HE8 A;  5JTG A;  5ABE A;  4X20 E;  4A97 A;  5FXZ A;  4BA9 A;  4CN4 A;  2FJD A;  2LHN A;  5JDM A;  1BR4 A;  4F6R C;  5GON E;  1UUS A;  2XAJ B;  3ANW B;  4PFP A;  3ZCI A;  2MYS A;  4QKN A;  3RKG A;  2NTY A;  4JI8 T;  4O2A E;  4OK0 A;  3BQL A;  4O4I E;  2EHO C;  2FJA A;  3FZF B;  4MFR A;  1B7T A;  4MLK A;  3SRZ A;  4A5X A;  2JQK A;  2V5D A;  2LSJ A;  3U3I A;  4LF5 T;  4PJN A;  1D0Y A;  3T1H T;  3PUG A;  1T8B A;  3LFM A;  3UFE A;  2ODV A;  3L09 A;  3JAD A;  4V1A v;  4WBO A;  1YQ3 A;  1HF8 A;  2W2U A;  3MXZ A;  4CI1 B;  4LFB T;  4WZX A;  2JJ9 A;  2XUE A;  1SHZ C;  3VR9 A;  4BAY B;  1W0A A;  3Q2M A;  3WI3 A;  2IAK A;  1XNR T;  3PJA A;  2M6I A;  4TV9 E;  4JI1 T;  2IDO B;  3UUB A;  4J2C A;  4NIQ A;  3RKO A;  3UUN A;  2NOX A;  2RA1 A;  3PUQ A;  5EK3 A;  3WAJ A;  4KHZ F;  3ZYL A;  4YXD A;  2OLT A;  5FKY A;  3ZLI A;  3HKE E;  4JUY A;  3ZMV B;  5L3D B;  2HH7 A;  2NP9 A;  4XAX B;  4CXX A;  2CRB A;  2DCF A;  2CWY A;  3QK6 A;  4O4L E;  3BQK A;  4B3R T;  1J5E T;  4HFE A;  3IA3 A;  2YKS A;  3P8C D;  3FZM B;  2V8S V;  5FL0 A;  2BBJ A;  2XAF B;  4NUV A;  3F57 A;  4IDZ A;  3R84 B;  3TLU A;  2MOZ A;  2BKN A;  1FJG T;  2E9X A;  2E8I A;  4DV6 T;  3H37 A;  4OFZ A;  4KI0 F;  2FJE A;  3AEB A;  2XZE A;  4TV8 E;  5FMN A;  2N1G A;  1ZOY A;  2VKO A;  3K3Q C;  3RPU A;  4U72 A;  3ZN1 B;  4DBQ A;  4YTN A;  5L2L A;  2LE8 A;  2LLY A;  5JQG E;  2ES0 A;  3ZJ2 A;  5CFB A;  1HX8 A;  4AIU A;  3V5U A;  4CI2 B;  3AEC A;  4EED A;  1FMV A;  2K24 A;  1D0Z A;  1WYC A;  1YQ4 A;  2DI4 A;  2PBI A;  3G06 A;  5FY7 A;  4DVD A;  2V7I A;  1D1C A;  2D5U A;  2WMO A;  2IML A;  1HG2 A;  1SA0 E;  2X68 A;  4I4T E;  1XMO T;  4PK5 A;  4ANJ A;  1UUR A;  5DJQ C;  5LJN A;  2UXN B;  2PFV A;  5KMG P;  2M67 A;  3C4W A;  4KBM B;  4PJM A;  5AQS B;  3ZST A;  4ERR A;  2D0T A;  2YK0 A;  4JYA T;  2E9X B;  4BJN A;  3K1S A;  3I9Y A;  4HEA A;  2BKP A;  4N78 D;  4HWF A;  3NWI A;  1IJ6 A;  2J62 A;  1U5P A;  3OVU A;  4UEL A;  4DV2 T;  1SE7 A;  4TUY E;  4IDQ A;  1XDP A;  2KMF A;  4HWI B;  1VCT A;  1J1J A;  2HN2 A;  1WYB A;  2XQ6 A;  4UF0 A;  2MPK A;  1W0B A;  1QSD A;  5DQW A;  2BS4 A;  3KV6 A;  3WAK A;  2BZB A;  3AA6 B;  3O1J A;  4JV5 T;  5HXC A;  3SOL A;  5LNK A;  3ONL C;  3L8R A;  5LGN B;  2LSY A;  2LSI A;  3AEE A;  1WRD A;  1QUU A;  4HTE A;  2LHR A;  2XJ7 A;  2IC6 A;  3KBU A;  3AE5 A;  3N2K E;  2QYW A;  3F2E A;  1U4Q A;  4ZOL E;  4ZI2 C;  3AAA B;  4DO0 A;  3LK2 B;  2BS3 A;  4AKH A;  4ZS3 A;  2K5B B;  2ZMA A;  4HKA A;  4DR4 T;  3AED A;  3IEE A;  4JEU B;  3UUM A;  3RF1 A;  4YY3 T;  2HPL A;  3FZL B;  5AQT B;  4DMV A;  1WLX A;  2V6Y B;  4QXC B;  4AQG A;  4UF0 B;  3CVR A;  4H9O C;  3U78 A;  2NTX A;  2WS3 A;  2CBI A;  4IE4 A;  3LK3 B;  4CXW A;  2L3L A;  3K3O A;  4GIW A;  1S35 A;  2XPK A;  2HPJ A;  5CB4 E;  4ILC A;  4EGW A;  5L3F B;  2JQQ A;  3I9W A;  5HXS A;  1XDO A;  1T72 A;  5LYJ E;  3JCF A;  4LFA T;  1MIV A;  2UUB T;  2W67 A;  4H9P C;  3ZMT B;  5JR9 B;  3VKH A;  1E1H B;  1LVK A;  3LBX B;  4IDO A;  1HNX T;  5DQV A;  3VKG A;  4YHH T;  4O4J E;  2LKH A;  2UUA T;  5J0Z A;  2H88 A;  1YKE B;  3JAF A;  2Y6X A;  2K9A A;  1FMW A;  2WDQ A;  3PUZ F;  5AQJ B;  3UUL A;  1JNZ A;  5LXT E;  4JI3 T;  4ZZB A;  3VRB A;  3RC3 A;  4AIS A;  5J2T E;  2CXL A;  5LCY A;  2XHE B;  2C5I T;  3AXJ A;  1KK7 A;  4H63 H;  4M1P A;  2W62 A;  1HX1 B;  3GMI A;  1NEN A;  3QC9 A;  5ADX L;  2E2A A;  5JRC A;  3MK7 C;  5EK4 A;  3Q9D A;  3JC6 C;  2J47 A;  3PUW F;  1UX5 A;  2XQ7 A;  4ZI3 D;  3CK6 A;  4Z90 A;  4U2Y A;  2VAS A;  4L9I A;  4JI4 T;  3B5M A;  1HTJ F;  3P4S A;  4HN9 A;  2VKD A;  4QWN B;  1L0V A;  4C90 A;  5KDM C;  2DLR A;  2WWV A;  4X1K E;  2CXD A;  1WR0 A;  2EHO D;  2X9W A;  2YDR A;  3OYZ A;  4FI5 A;  1VOM A;  4PW8 A;  2H7O A;  1MND A;  3NZP A;  5FVK A;  4ZI3 C;  2LSG A;  3C51 A;  5ABF B;  4KHP T;  2KLQ A;  4LF6 T;  2LOP A;  5HEO A;  1E2A A;  1WFD A;  3I1A A;  5EZY E;  5FP3 A;  2E9X C;  3PJA J;  5FYM A;  3RIU A;  5JR9 C;  1BR0 A;  2LJL A;  3B57 A;  2QA7 A;  3RGL A;  4IT4 A;  3AVR A;  5LOV E;  5C2T A;  1N33 T;  5FVL A;  4IHJ E;  1AJ3 A;  5FXX A;  5L47 A;  4EV6 A;  3PE0 A;  3K3N A;  4E7Z A;  2I6H A;  2RPA A;  4DV4 T;  1OED C;  3PUY F;  2HN1 A;  2CEA A;  3CIR A;  2WDV A;  4Z8X A;  3ZKR A;  4CXY A;  4NXM T;  1I6Z A;  3HKC E;  1FIO A;  2IUB A;  2VVS A;  3LDQ B;  2LRK A;  3E08 A;  4EOZ B;  2LM2 A;  1KFY A;  3K8P C;  2E9X D;  3AE8 A;  1W09 A;  2NR4 A;  1LKX A;  4UXN B;  2Y8D A;  3CX7 B;  3CKD A;  2VQE T;  3AXJ B;  4UR9 A;  5IUX A;  2LT3 A;  2KXP B;  1IBK T;  2A72 A;  2CA5 A;  4GYR A;  4O4H E;  4DR7 T;  3QOF A;  1MNE A;  4O2B E;  4JI7 T;  1UK5 A;  3EAB A;  5LA6 E;  2E5L T;  4ADZ A;  4X64 T;  1HNZ T;  2HHH T;  1EZ3 A;  1MMN A;  3UT5 E;  5JRC B;  4EYU A;  3KVB A;  5AQH B;  3TKL B;  1T98 A;  2N2N A;  3T1Y T;  5C3J A;  2YU1 A;  2M6B A;  5LJM A;  3CX6 B;  5E0O A;  4IE6 A;  4AI6 A;  4KMC A;  5ABH A;  4DUZ T;  4X1I E;  2X9X A;  3LBX A;  3AVS A;  2XQA A;  5HEG A;  4IIJ E;  3UU4 A;  4EYY R;  5BMV E;  1WR6 A;  5CGM A;  3QB5 A;  2V6Y A;  5LHG B;  5LG4 A;  4AQF A;  2W00 A;  2WWU A;  3H3A A;  4O8S A;  4OYK A;  3N2O A;  1N32 T;  1HR0 T;  1Z0P A;  3T8O A;  3I0Q A;  5FXV A;  2XAQ B;  4B3S T;  3PTR B;  4Z91 A;  1YXR A;  2SPC A;  4QXH B;  2KND A;  2DNX A;  2X9H A;  3RX6 A;  2ZM2 A;  4LFC T;  3RC8 A;  3ZMZ B;  2XTL A;  4XZC A;  3UQ7 A;  2CHN A;  3UU3 A;  2UU9 T;  4PK4 A;  1Y64 B;  4ZS2 A;  3P7I A;  5FL1 A;  1GQE A;  4OHF A;  2D2S A;  3RQW A;  1QLB A;  4CQI A;  3ZC0 A;  1IJ5 A;  3C4Z A;  2YOE A;  2W61 A;  1OED B;  4LMJ A;  3JAE A;  4PNI A;  3SS1 A;  5C8Y E;  2V26 A;  3FB2 A;  2BBH A;  3Q5X A;  3TLS A;  4HWD A;  4IE5 A;  4YLH A;  4PAG A;  2AE9 A;  2I59 A;  1H7C A;  3OYX A;  1DU2 A;  4HWH A;  3PUV F;  5JDG A;  3VR8 A;  3JC6 D;  4GK0 E;  2PTF A;  3BK9 A;  4K0U A;  5ABF A;  2W66 A;  2YU2 A;  3L39 A;  3CWZ B;  2PJQ A;  3CQC B;  5AQL B;  3KBT A;  3VU7 H;  3ZT5 A;  4LMK A;  4COF A;  3NVO A;  3AAE B;  2D0U A;  2KWH A;  1JNR A;  3NKZ A;  5HEU A;  4QX7 B;  4H9N C;  4X66 T;  3I0O A;  2JIW A;  3A8Y C;  3M3Z B;  4P1N A;  3IBP A;  3OBV E;  5FY1 A;  3RYF E;  4DR6 T;  5KXJ A;  5HWX A;  5L3E B;  1KNZ A;  2MBG A;  3KFW X;  1OWA A;  1IAP A;  2LOS A;  4MBQ A;  4CZZ B;  5HEJ A;  5L3G B;  4DR3 T;  2LM9 A;  3ZPO A;  4HFH A;  1T7S A;  3NRY A;  4U7Y A;  2L8K A;  2BKO A;  3TLV A;  4U2Z A;  2V6X A;  2XQ9 A;  1US7 B;  4HWC A;  4DR1 T;  4U33 A;  5L3C B;  4PJJ A;  1D1A A;  3FHN A;  1BR1 A;  2JMH A;  2Z6E A;  3N9L A;  3RIF A;  4DMW A;  1XWM A;  3X1D A;  3J9X 1;  1W9R A;  2VKJ A;  4IE7 A;  4KP3 C;  5HCJ A;  2H7V C;  4YSY A;  3F31 A;  5KX5 E;  4DND A;  2IW5 B;  4TWF A;  5F5W A;  3ZCJ A;  1I94 T;  3GN5 A;  3LG7 A;  4ZI2 D;  4B3T T;  2UXB T;  4A98 A;  3RLF F;  4CN1 A;  3QNU A;  3V5S A;  3N9M A;  1X79 A;  2KZ7 B;  1MMG A;  3C98 B;  3NRX A;  5AQG B;  3C64 A;  3EVY A;  2DHR A;  4Q25 A;  3ZT6 A;  1OED A;  4EIW A;  5CJ5 A;  4I50 E;  3RIA A;  4LF7 T;  3RQU A;  2BG9 E;  1YW0 A;  3EUH A;  2CLY C;  3ETV A;  5AQU B;  3IHR A;  3EI0 A;  1ZV4 X;  4OYJ A;  5AQV B;  4TZ4 C;  1MIY A;  4AQF C;  2AXD S;  2XQ5 A;  2RP4 A;  2YDS A;  3A7M A;  3N5L A;  4GK5 E;  5IYZ E;  4JLE A;  4EEB A;  1HG5 A;  4FJO A;  2B76 A;  3HI2 A;  3HKB E;  4MHC A;  5DAB A;  2WU5 A;  4UEM A;  3UU5 A;  5J2U E;  4K0K T;  3FXE B;  3C4X A;  4X1Y E;  3KV9 A;  4TN7 B;  2FBW A;  1KNP A;  1IZN B;  2NW7 A;  2WCA A;  3B13 A;  3P4Q A;  2WP9 A;  3P4R A;  5HXR A;  4DID B;  3ZEF B;  2C5K T;  2XQ8 A;  1N34 T;  4C91 A;  4OX9 T;  1IBL T;  2YIN A;  4HFV A;  2X67 A;  3AE1 A;  2WMN A;  4IGU A;  4DV7 T;  4YT0 A;  3ANW A;  1E7P A;  5AQI B;  5L3B B;  3RH3 A;  5HXE A;  5LHI B;  1KNR A;  2E5V A;  3R6N A;  4H63 V;  4CI3 B;  4AKL A;  4GOU A;  1NWM X;  3P4P A;  2P9B A;  2VUR A;  4I0U A;  2X66 A;  4YHJ A;  2K48 A;  5JH7 E;  4AQY T;  1O3X A;  5EK2 A;  4JI6 T;  2XAH B;  2XQY A;  4QHO A;  4HFI A;  4AXP A;  4ZEY A;  2ACX A;  3E22 E;  5JDH A;  2UXD T;  5AQM B;  3RYC E;  3PU3 A;  2LEH A;  4U31 A;  3N9Q A;  5J1G A;  1G8X A;  2Q9Q B;  3N9O A;  1NAF A;  2DWK A;  3EDU A;  3PDY A;  4XBF B;  5HCM A;  1HS7 A;  3CPZ A;  4IDP A;  3Q5E A;  4WYV A;  4GKJ T;  2WBL A;  5H6R B;  4DR5 T;  1VCS A;  3ONJ A;  2CXF A;  2ZLY A;  3HA4 A;  4KUM B;  2EHO B;  4KX6 A;  4QH1 A;  2NW8 A;  1MIW A;  4UIG A;  4WW0 A;  4LF8 T;  2NW9 A;  3ZYM A;  2CMR A;  1Y01 A;  2H3R A;  2JRK A;  3ABV A;  3FZH B;  4YSX A;  2KSR A;  2MTQ A;  1CHU A;  4JI0 T;  3UQ4 A;  1ZEE A;  1KEY A;  3Q5W A;  5HEH A;  2V1D B;  5TAO A;  1SUM B;  2IC9 A;  4IRE A;  3FZK B;  3MZK B;  5AQP B;  5AQN B;  3ZJ1 A;  4H9S E;  4H9R C;  3O9X A;  2ZM0 A;  3O4X E;  1LVF A;  3BQI A;  2CE7 A;  4DR2 T;  1UCU A;  3LK4 2;  3KV4 A;  2JPF A;  5L4E A;  4UVA B;  3EHZ A;  2W0G A;  3RRW A;  5HYA A;  3O1H A;  1UX4 A;  4I55 E;  2WDR A;  3N9P A;  3H3M A;  4B6X A;  2XM1 A;  3PV0 F; 
#chains in the Genus database with same CATH homology
 2UUB T;  5LMN T;  4DR6 T;  1HNX T;  4DV3 T;  4YHH T;  1N36 T;  4LF4 T;  2UUA T;  2UXC T;  4JI3 T;  4NXN T;  2ZM6 T;  4DV5 T;  4DR1 T;  3OTO T;  4JI8 T;  4JI4 T;  5LMU T;  1I94 T;  4B3T T;  2UXB T;  4LF5 T;  3T1H T;  4DR3 T;  2UUC T;  4LFB T;  2F4V T;  4LF7 T;  4KHP T;  4LF6 T;  1XNR T;  4K0K T;  1N33 T;  5BR8 T;  4DV4 T;  4B3R T;  4JI5 T;  4NXM T;  1J5E T;  1N34 T;  4OX9 T;  1FJG T;  1IBL T;  4DV6 T;  4DV7 T;  2VQE T;  1IBK T;  4DR7 T;  4JI7 T;  2E5L T;  5IWA T;  4X64 T;  2VQF T;  1XMQ T;  4AQY T;  1HNZ T;  2HHH T;  4JI6 T;  4DUZ T;  3T1Y T;  1XMO T;  1XNQ T;  4LF9 T;  2UXD T;  4DV0 T;  4JYA T;  4GKJ T;  1N32 T;  1HR0 T;  4DV2 T;  4DR5 T;  4B3M T;  4B3S T;  4LF8 T;  4LFC T;  4DUY T;  2UU9 T;  1IBM T;  4JV5 T;  1HNW T;  4GKK T;  4DV1 T;  4JI2 T;  4YY3 T;  4DR2 T;  4X65 T;  4X62 T;  4DR4 T;  4JI0 T;  4JI1 T;  4LFA T;  4X66 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...