1HNWT

Structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 33
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1hnwT00
1I94T 4DR1T 1N33T 4OX9T 4KHPT 4B3ST 2HHHT 4JI5T 4X65T 4YHHT 2UUBT 4LF7T 2VQET 2F4VT 4LFAT 4LFCT 1HNWT 4DV4T 4AQYT 3T1HT 4LF8T 5LMNT 2UXDT 4JI0T 1IBLT 2ZM6T 4LF4T 2UXBT 4GKKT 4DV6T 5BR8T 4DR4T 4GKJT 2VQFT 1HNXT 4DR5T 1HR0T 4NXNT 4JI1T 4DUZT 1XMQT 1HNZT 4B3RT 4JI6T 1N32T 2UUCT 2UU9T 5IWAT 4B3TT 4K0KT 4X66T 4DR7T 4DV3T 4DR6T 4DV5T 4JI7T 4JV5T 4YY3T 4DR2T 4LF5T 4JI8T 4DV2T 1XNQT 2UUAT 2E5LT 4X64T 4JI2T 4LFBT 4DV7T 4DV0T 3OTOT 1XMOT 4DUYT 4B3MT 1N36T 1J5ET 5LMUT 3T1YT 2UXCT 4LF6T 4X62T 4LF9T 4NXMT 4JI4T 1IBMT 1XNRT 4DR3T 1FJGT 4JYAT 4DV1T 1IBKT 1N34T 4JI3T
chains in the Genus database with same CATH superfamily
3AE5A 4IDPA 4PW8A 1I94T 2V7JA 4O4IE 2WWVA 5JDQA 1VCSA 1ZEEA 3UQ7A 3EABA 3H3AA 4FJOA 3RLFF 4UVAB 3EUHA 3JADA 4QH5A 4N78D 3TLTA 4PFOA 4E7SA 3AVRA 2CCQA 5HEOA 2VASA 3WAKA 3VHLA 2QRXA 2X66A 3M3ZB 4OYJA 4B3ST 5JDGA 1OEDC 3TLWA 2OLTA 3F57A 3N5LA 1YKEB 2LSJA 5HXCA 4O4LE 3K3OA 1CUNA 2NOXA 2Y6XA 3IEEA 1JNRA 1J1JA 3KINB 4WYVA 3R6NA 1MNDA 1HNWT 1YXRA 2KT9A 4CN4A 3FHNA 4KI0F 2N2NA 3UU5A 2LSGA 3L3PA 3N9MA 4HFEA 4TWHA 3U3IA 5JR9C 4PK5A 5LG3A 4QXCB 3RX6A 3T1HT 4ZEYA 3AEAA 4I50E 3O4XE 3H37A 4H9SE 4L9IA 3T8OA 2NR4A 2VL0A 2P9BA 5FKYA 3KV6A 3PUVF 3Q5XA 3RRCA 2WCAA 2V6YA 4QXBB 3EHZA 5FNVE 3HKDE 5ABFA 2X9HA 3VRAA 3IF8B 3SOLA 5M4YA 4PNIA 3FZMB 3X1DA 3ZMUB 4EAHA 2NWBA 2SPCA 3FZLB 1WRDA 2LJLA 2IDOB 4K0UA 2K9AA 2BG9B 3NKZA 4ILUA 3OKQA 4H9PC 3GMIA 3VR8A 2KLQA 4X1IE 3PU8A 2Q9QC 5JDLA 4DMVA 4EIWA 4QH1A 1KEYA 5JDNA 4ERRA 4AKHA 1BR1A 2XQ3A 4ILAA 2MYSA 3MKDA 5FVLA 3B5MA 3OYZA 4DO0A 3ABVA 1W9RA 2G0UA 1HNXT 2MAWA 3PE0A 3PUXF 4TV9E 5IYZE 5L3CB 3QOFA 5AQJB 2IMLA 3ZMTB 2V1DB 2ZM2A 3E22E 3ETUA 1QUUA 2C5JA 4P1NA 4MBQA 4JI1T 3I0QA 2JRKA 3N2OA 4IE5A 5KXJA 2YN6A 4IDQA 1XMQT 4AKGA 2LOPA 3PDYA 1HNZT 1YQ3A 2WBLA 2DWKA 3B57A 4ZI2D 2I6HA 4I55E 3ONXA 1W0BA 2ACZA 4IE7A 3RC3A 4XAXB 5KDMC 2UUCT 2PFVA 1ZOYA 3V5UA 5L3BB 1U5PA 3KV4A 5A1LA 2Y48B 4B3TT 3MJXA 2OA5A 3N9LA 2CHNA 4CZZB 4YXDA 5LJNA 3OPCA 3PUSA 3VRBA 1XDOA 4TWDA 3RI5A 4A98A 4B6XA 2DL1A 3AE9A 4MFRA 3A7MA 4DV3T 4DBQA 2KWHA 2V7MA 4G2AA 4PFPA 4Z8XA 5JQGE 5LG4A 4OFZA 3HR0A 2W66A 1Z0PA 4YT0A 1SHZC 5AQVB 2BG9C 3UUNA 2HPLA 3ZN0B 5LGUB 1E1HB 1HFAA 2UUAT 5FP3A 2ES0A 2YU1A 4GIWA 3I9WA 5JR9A 5HWXA 3N2KE 1MMAA 2CWOA 2QVAA 3AEEA 3IBPA 4PJLA 2PBIA 2BZBA 4UXNB 3L8RA 5AQTB 5CA1E 5L4HA 3O1HA 3ESLA 3EDVA 5HAXA 2X0HA 2WB5A 2BS4A 2WDRA 4MLKA 5LXTE 4DUYT 1XMOT 3O9XA 4B3MT 4LFCT 4LMJA 1N36T 5FMNA 1J5ET 4AKLA 3FXDB 2LEHA 3RGLA 5LMUT 5IUXA 1U4QA 1D1AA 4JUYA 4NUVA 2WS3A 3ONJA 4QX8B 1WLXA 2KNDA 4IDOA 5AQSB 4X62T 2V7IA 1IZNB 3FB2A 2IAKA 2XAQB 3UTKA 4OYKA 5AQPB 2D2SA 4ZXLA 1IBMT 4MHCA 3RF1A 2WU2A 2YDRA 4ADZA 3W15B 1FJGT 1VCTA 4E7ZA 5HYAA 2FJBA 4YSXA 4EEDA 5LHHB 4TX5A 2NW9A 1UGOA 4ZZBA 4JI3T 4TN7B 3Q9DA 1MMNA 1UUSA 1W09A 2X68A 2V5CA 5L3EB 4UR9A 3LG7A 2V6YB 3PURA 1V9DA 4U2YA 3RKGA 1L0VA 4C90A 4OX9T 4GYSA 4ANJA 3SFDA 4KHPT 1Y64B 3N9QA 2X9XA 3PUGA 2HHHT 2CXFA 2VQET 3LJCA 3ZMZB 3K1SA 2ZLYA 5BMVE 4ASKA 2E9XA 4LMKA 4U7YA 1FEWA 2VL8A 4X20E 3RYIE 1KNZA 2LSKA 4DR7T 4H63V 1OEDE 4QHOA 4X5TA 2XQ9A 2CBJA 1KNRA 1UX4A 2KMFA 1R8IA 3CQXC 3MZKB 3P4RA 3DP7A 2CRBA 5L2LA 3LBXA 5LNKA 4UF0A 2J47A 4ZOLE 2E2AA 2J62A 4KX6A 5HEUA 4JI0T 1IBLT 2UXDT 2E9XC 2NW7A 3C98B 3OYXA 4HFBA 2XSAA 3ZSSA 2W00A 3AE2A 2CXLA 1VOMA 2BKOA 3CX6B 3P4PA 4ILBA 4U33A 5ADXL 5JRCB 4EYUA 4WZXA 3PJAJ 1T8BA 3RYCE 3QB5K 4HGAA 4YTPA 1UURA 2XASB 4H9NC 4LF4T 4KHZF 1LVFA 3V5SA 2FBWA 3UQ4A 4GKKT 3FZHB 4DV6T 2VWAA 2LLYA 3ZJ2A 2N1GA 3IA3A 3QNUA 2EHOA 3HA4A 4YLHA 3SWHA 5H6QB 2WAUA 2YDSA 3JC6D 3RYHE 2LKGA 4H9RC 4ISTA 2VQFT 4IT4A 4YSYA 3ZT5A 3ZEFB 2L8KA 5E0OA 1HTJF 5CJ5A 4AKIA 5C8YE 5FVKA 5AQFB 1W0AA 4PK6A 2J4GA 4EGWA 3PUWF 1S94A 2JMHA 3LDQB 4CXYA 4JLEA 5LHGB 5JDMA 2M67A 2C5IT 1XDPA 2ZM8A 3RQUA 3K8PC 3WAJA 2E9XD 2IW5B 2JQQA 5LGNB 3EI0A 2VVSA 5FYMA 3F2EA 5F3JA 4IE4A 4QWNB 5J2UE 2JQKA 2LRLA 3AEGA 4B3RT 3UU3A 2X0YA 1N32T 2I59A 1OEDB 2J1DG 4NIQA 2XM2A 4ILCA 3KBTA 3MXZA 3RQWA 3ZCIA 1MIWA 5HEJA 5IWAT 5AQKB 3JAEA 2LSIA 2UU9T 3NWIA 4YTNA 3IHRA 2ODVA 2VKDA 3CK6A 3JC6C 1E2AA 3AXJB 4X65T 2UUBT 3VKGA 4DR6T 2E5VA 4Q25A 4JI7T 4ZHQE 2VVNA 2H7OA 3NRXA 5LA6E 1US7B 5LOVE 2LRKA 1VRBA 5IHYA 5J1GA 3AAEB 3BQLA 3EAMA 5JVDE 4A56A 1HX1B 4IIJE 4IDZA 1YQ4A 2XTLA 4UV8B 3K3NA 5JRCA 5HCJA 5LP6E 5ABEA 2V5DA 2E5LT 3U78A 3RHWA 2HH7A 4H9QC 1X9BA 4A5XA 4COFA 1OXZA 1WYBA 4WBOA 4U7IA 2ACXA 5AQUB 1HF8A 2W62A 2CHOA 4DMWA 1X79A 2WSSV 1UK5A 4CN6A 1I6ZA 3EVYA 2DNXA 5JH7E 3KBUA 1M7KA 3NBXX 4TWFA 3CQGB 3T1YT 1OWAA 3GN5A 4GYRA 3N2GE 5FL0A 4LMLA 5J2TE 4LF6T 4AQGA 2DCFA 2EHOC 2ZM0A 3AAAB 4V1Av 3ZSTA 2CXDA 4ISSA 2QYWA 3WI3A 4CXXA 4GK0E 2WMOA 5LCYA 1CHUA 2YOEA 4I0UA 2W61A 1YKHB 1XNRT 4DR3T 2WP9A 3UFGA 5ABHA 2LE8A 5FXZA 3DTOA 5KMGP 3SS1A 2N9DA 1N34T 2DHRA 1WFDA 4ZZCA 5FXWA 2K24A 5HXRA 3UU8A 2KINB 2XQ4A 4PJMA 3QUJA 2CBIA 2CWYA 4JEUB 4NUUA 4WBNE 3P7IA 2WQYA 5JDHA 2L3LA 2WDQA 5HXEA 2V7LA 3AA6B 2QGSA 2BBJA 2XUEA 1HG5A 3BQIA 2VK9A 1N33T 4QXHB 2BVMA 5JREA 5AQRB 5HCMA 2WDVA 1M62A 2VURA 3QC9A 1NAFA 2A3DA 2XPKA 3UU4A 4JI5T 1SUMB 2E8IA 3AEFA 3VR9A 2XM1A 4AXPA 3KV5A 4I4TE 4F8HA 2JMKA 3I1AA 3AB3B 4CI3B 2QA7A 3ZLIA 2BDEA 2D0UA 2V7KA 2AXDS 3N9PA 4C91A 2LOSA 4L0RA 5FL1A 2VB6A 4O2AE 3SFEA 3UUXB 1IAPA 2WMNA 2BG9A 2EHOD 2XAFB 3AE4A 1DU2A 4LF8T 2MTQA 3RIFA 2XZEA 5CGMA 3AEBA 3OBVE 4OHFA 4HFCA 2CPTA 4NPPA 3MK7C 3E0ZA 3UUMA 5L4EA 4IHJE 4DBRA 3ETVA 1MNEA 2KSRA 2W0GA 5CA0E 3CQCB 3PUQA 1D1CA 2FUPA 2IHR1 3Q5DA 5AQOB 2M6IA 4O4HE 3NRYA 3CPZA 4HWIB 4UEMA 3UT5E 2V6XA 2W4XA 2ZM6T 1O3XA 2K3WA 3AA1B 2YDQA 3ANWA 4G63A 4O8SA 2LKHA 4ZS2A 2DLRA 3FXEB 4O4JE 5ABGA 1LRZA 4UV9B 2IIUA 2UXXB 2VKHA 3JCFA 1OEDA 1Y01A 3L09A 4UVBB 3BK9A 2W2UA 1KF6A 3HKCE 4I43B 3RH3A 2H3RA 2IUBA 1NEKA 5HWYA 4H9OC 2CA5A 5FY1A 1ZV4X 2AE9A 3Q2MA 3TLSA 2NW8A 3AXJA 4TZ4C 4YTMA 4UELA 1SE7A 5ETWA 3ZMVB 4DNDA 2LHNA 3HL6A 1YW0A 3OVUA 3FZFB 4L5GA 4EV6A 3ZT7A 2BKPA 4QKNA 4DIDB 1D1BA 1MIVA 5EK3A 5AQLB 2IC6A 3QB5A 4JEHB 3RPUA 2MBGA 2XQYA 2JJ9A 4GOUA 4CN1A 1BR0A 2H7VC 3ZMSB 2C0SA 4OK0A 3AA0B 4WW0A 3G06A 2NTXA 1UCUA 5CB4E 3ZYKA 5C2TA 2YKSA 2XQ8A 4P09A 3RIUC 5L3GB 2HN2A 2LHRA 3I0OA 1MIYA 2FJEA 4YJ2E 2WY2A 4YSZA 5EK2A 5FY0A 4K0KT 4AI6A 1GQEA 2L9QA 4KBMB 3ZKRA 2DWGA 2BKNA 2D9DA 1EZ3A 2HPJA 2PJQA 1T72A 2CLYC 2V26A 2X9WA 2XAGB 3D0TA 3HKEE 3KDSE 4IREA 5LBMA 3RIUA 4JV5T 4YY3T 3QK6A 5DJQC 4HFHA 1QLBA 2E9XB 4H63H 5AQQB 4DV2T 3CVRA 5JR9B 3ZC0A 3FBLA 5DQVA 5LJMA 4X1YE 4JI2T 4XBFB 2C5KT 2Y8DA 3P4SA 2CLYB 3AA7B 2NTYA 4LFBT 2A2FX 2D5UA 2BS3A 3UU6A 4EXTA 2XQ6A 2X67A 3TLUA 4EOZB 5CFBA 3RIAA 3Q5EA 3P4QA 3KV9A 5JDFA 5LB7B 5LGTB 2XQ5A 4U2ZA 1WR0A 2BBHA 3FBZA 5HEHA 3ZJ1A 3AE7A 4HWFA 2UXNB 4XZCA 2X51A 4UIGA 3O1JA 4Z91A 1BR4A 1WCRA 3C51A 1T98A 3PV0F 2VKOA 1G8XA 4BAYB 3M65A 4CQIA 1ZP0A 3ONLC 3C50A 1ZKEA 3AEDA 1IJ6A 4PJNA 3J9X1 3ZCJA 2OV9A 4IL9A 2WZIA 4CXWA 1YD8G 5F5WA 1JNZA 5HXSA 3ZN1B 4DV1T 1IBKT 2CEAA 1T7SA 3UFEA 3CX7B 3F31A 4PK4A 1HX8A 1D0ZA 1SA0E 2K5BB 2KZ7B 2LM2A 5FXXA 4TNWA 3ZYLA 3NZPA 5C3JA 4DR5T 1NWMX 2ZMAA 3C4XA 1HS7A 3PJAA 4PJJA 4DR1T 4JBWF 2WWUA 3LK2B 5L3DB 3J7Yq 2DI4A 5AQIB 3GN5B 4HEAA 4BJMA 2RA1A 1UX5A 4YHHT 4IL4A 4HFIA 4M1PA 4KP3C 2BS2A 4HFVA 4WNKA 2M6BA 4ZI7E 4CI1B 5HXHA 4LFAT 2F4VT 4KMCA 3B13A 1XWMA 2K48A 2B1EA 2KXPB 3MACA 4HKAA 5FXVA 4F6RC 4IE6A 4UF0B 5L3FB 3H3MA 4DV4T 2GK9A 4AQYT 5LBQB 3PUYF 2YK0A 2JQ9A 4X1KE 5LMNT 3E08A 1KK7A 4QH4A 3LFMA 2W67A 3LK3B 3A8YC 4IGUA 3RYFE 4HWCA 5EK4A 3BQKA 3SRZA 5KX5E 5EZYE 2XY8B 4AQFA 3NVOA 1D0YA 4QX7B 3N9OA 2PTFA 2XSBA 3P4WA 4EEBA 4AIUA 1H7CA 4EZHA 4IDNA 4ZI3C 4DV7T 2NP9A 1QSDA 5AQNB 2LM9A 2YINA 4KUMB 2UXBT 3AECA 4AQFC 4HWHA 1XZYA 3PU3A 3KVBA 2LT3A 2WM9A 2WZHA 2XAJB 4TV8E 3OJAA 2CE7A 5BR8T 4EB6E 4A97A 4DR4T 4GKJT 2FJAA 3CIRA 5JTGA 3PUZF 2Q9QA 1KFYA 2XQAA 4GK5E 4U3CA 3CWZB 1MMDA 4U74A 2R6GF 2XQ7A 4YHJA 4Z90A 2B76A 2MOZA 2YU2A 4ZS3A 3UUBA 2MPKA 3PTRB 3ZT6A 1NENA 1HR0T 4NXNT 2VKJA 2CMRA 5LYJE 3ZYMA 2JPFA 3DJBA 3CKDA 3KVAA 3K3QC 4PAGA 5DQWA 3HI2A 4DUZT 1FMWA 3UULA 4P0AA 3VKHA 5H6RB 2A72A 4U72A 1MMGA 1FIOA 2KWIB 3VU7H 5AQMB 2Q9QB 3GA8A 5J0ZA 4JI6T 4HTEA 3C64A 1LVKA 3O1IA 4J2CA 2FJDA 4BA9A 3S4UA 3ZC1A 3N9NA 5F8PA 4HWDA 2A9UA 2XHEB 4MALA 2LSYA 4FI5A 2I0MA 3GWHA 5ABFB 3FZKB 4IE0A 3CX8B 2JQHA 4X66T 3AE1A 2PG8A 4DV5T 3ANWB 1ZHCA 4CI2B 4HN9A 2HN1A 1FMVA 3RKOA 3I9YA 2Z6EA 3RC8A 4DR2T 3AE3A 5TAOA 4JI8T 4LF5T 3TKLB 5HEGA 1HCIA 5LHIB 3CMLA 1XNQT 5GONE 3PUAA 1LKXA 2CM0A 2Q9QD 3P50A 4HFDA 3RRWA 4P0BA 4X64T 1BR2A 2XAHB 3HKBE 4UVCB 5L47A 4LF7T 2H89A 2H88A 4TUYE 2W63A 4U31A 3TLVA 5AFUL 4DV0T 4YJ3E 3ZPOA 2ODUA 1KNPA 3OTOT 3LK42 1WR6A 2RP4A 3LBXB 5FY7A 1S35A 4AISA 2WU5A 3L39A 5DABA 4EZ4A 3AAIA 3C4WA 5AQGB 2JIWA 3LSVA 3NZQA 2BVLA 2IC9A 3AE8A 3KFWX 3Q5WA 1G73A 2UXCT 4TNVA 1J5WA 1WYCA 4AKRB 3AVSA 3R84B 4ZI2C 4HE8A 4LF9T 2X9YA 3A5XA 2RPAA 4NXMT 3MA9A 4ZI3D 1B7TA 1E7PA 4O2BE 2BG9E 4JI4T 5AQHB 1HG2A 4DVDA 1AJ3A 4YFSA 1Z8UA 1D0XA 2V8SV 2X0LB 3C4ZA 4BJNA 3AE6A 4JYAT 3EDUA 2EHOB 2XJ7A 3P8CD 1IJ5A 4EYYR 2D0TA 3JAFA 2YEVC
chains in the Genus database with same CATH topology
1I94T 4DR1T 1N33T 4OX9T 4KHPT 4B3ST 2HHHT 4JI5T 4X65T 4YHHT 2UUBT 4LF7T 2VQET 2F4VT 4LFAT 4LFCT 1HNWT 4DV4T 4AQYT 3T1HT 4LF8T 5LMNT 2UXDT 4JI0T 1IBLT 2ZM6T 4LF4T 2UXBT 4GKKT 4DV6T 5BR8T 4DR4T 4GKJT 2VQFT 1HNXT 4DR5T 1HR0T 4NXNT 4JI1T 4DUZT 1XMQT 1HNZT 4B3RT 4JI6T 1N32T 2UUCT 2UU9T 5IWAT 4B3TT 4K0KT 4X66T 4DR7T 4DV3T 4DR6T 4DV5T 4JI7T 4JV5T 4YY3T 4DR2T 4LF5T 4JI8T 4DV2T 1XNQT 2UUAT 2E5LT 4X64T 4JI2T 4LFBT 4DV7T 4DV0T 3OTOT 1XMOT 4DUYT 4B3MT 1N36T 1J5ET 5LMUT 3T1YT 2UXCT 4LF6T 4X62T 4LF9T 4NXMT 4JI4T 1IBMT 1XNRT 4DR3T 1FJGT 4JYAT 4DV1T 1IBKT 1N34T 4JI3T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I94 T;  4DR1 T;  1N33 T;  4OX9 T;  4KHP T;  4B3S T;  2HHH T;  4JI5 T;  4X65 T;  4YHH T;  2UUB T;  4LF7 T;  2VQE T;  2F4V T;  4LFA T;  4LFC T;  1HNW T;  4DV4 T;  4AQY T;  3T1H T;  4LF8 T;  5LMN T;  2UXD T;  4JI0 T;  1IBL T;  2ZM6 T;  4LF4 T;  2UXB T;  4GKK T;  4DV6 T;  5BR8 T;  4DR4 T;  4GKJ T;  2VQF T;  1HNX T;  4DR5 T;  1HR0 T;  4NXN T;  4JI1 T;  4DUZ T;  1XMQ T;  1HNZ T;  4B3R T;  4JI6 T;  1N32 T;  2UUC T;  2UU9 T;  5IWA T;  4B3T T;  4K0K T;  4X66 T;  4DR7 T;  4DV3 T;  4DR6 T;  4DV5 T;  4JI7 T;  4JV5 T;  4YY3 T;  4DR2 T;  4LF5 T;  4JI8 T;  4DV2 T;  1XNQ T;  2UUA T;  2E5L T;  4X64 T;  4JI2 T;  4LFB T;  4DV7 T;  4DV0 T;  3OTO T;  1XMO T;  4DUY T;  4B3M T;  1N36 T;  1J5E T;  5LMU T;  3T1Y T;  2UXC T;  4LF6 T;  4X62 T;  4LF9 T;  4NXM T;  4JI4 T;  1IBM T;  1XNR T;  4DR3 T;  1FJG T;  4JYA T;  4DV1 T;  1IBK T;  1N34 T;  4JI3 T; 
#chains in the Genus database with same CATH topology
 3AE5 A;  4IDP A;  4PW8 A;  1I94 T;  2V7J A;  4O4I E;  2WWV A;  5JDQ A;  1VCS A;  1ZEE A;  3UQ7 A;  3EAB A;  3H3A A;  4FJO A;  3RLF F;  4UVA B;  3EUH A;  3JAD A;  4QH5 A;  4N78 D;  3TLT A;  4PFO A;  4E7S A;  3AVR A;  2CCQ A;  5HEO A;  2VAS A;  3WAK A;  3VHL A;  2QRX A;  2X66 A;  3M3Z B;  4OYJ A;  4B3S T;  5JDG A;  1OED C;  3TLW A;  2OLT A;  3F57 A;  3N5L A;  1YKE B;  2LSJ A;  5HXC A;  4O4L E;  3K3O A;  1CUN A;  2NOX A;  2Y6X A;  3IEE A;  1JNR A;  1J1J A;  3KIN B;  4WYV A;  3R6N A;  1MND A;  1HNW T;  1YXR A;  2KT9 A;  4CN4 A;  3FHN A;  4KI0 F;  2N2N A;  3UU5 A;  2LSG A;  3L3P A;  3N9M A;  4HFE A;  4TWH A;  3U3I A;  5JR9 C;  4PK5 A;  5LG3 A;  4QXC B;  3RX6 A;  3T1H T;  4ZEY A;  3AEA A;  4I50 E;  3O4X E;  3H37 A;  4H9S E;  4L9I A;  3T8O A;  2NR4 A;  2VL0 A;  2P9B A;  5FKY A;  3KV6 A;  3PUV F;  3Q5X A;  3RRC A;  2WCA A;  2V6Y A;  4QXB B;  3EHZ A;  5FNV E;  3HKD E;  5ABF A;  2X9H A;  3VRA A;  3IF8 B;  3SOL A;  5M4Y A;  4PNI A;  3FZM B;  3X1D A;  3ZMU B;  4EAH A;  2NWB A;  2SPC A;  3FZL B;  1WRD A;  2LJL A;  2IDO B;  4K0U A;  2K9A A;  2BG9 B;  3NKZ A;  4ILU A;  3OKQ A;  4H9P C;  3GMI A;  3VR8 A;  2KLQ A;  4X1I E;  3PU8 A;  2Q9Q C;  5JDL A;  4DMV A;  4EIW A;  4QH1 A;  1KEY A;  5JDN A;  4ERR A;  4AKH A;  1BR1 A;  2XQ3 A;  4ILA A;  2MYS A;  3MKD A;  5FVL A;  3B5M A;  3OYZ A;  4DO0 A;  3ABV A;  1W9R A;  2G0U A;  1HNX T;  2MAW A;  3PE0 A;  3PUX F;  4TV9 E;  5IYZ E;  5L3C B;  3QOF A;  5AQJ B;  2IML A;  3ZMT B;  2V1D B;  2ZM2 A;  3E22 E;  3ETU A;  1QUU A;  2C5J A;  4P1N A;  4MBQ A;  4JI1 T;  3I0Q A;  2JRK A;  3N2O A;  4IE5 A;  5KXJ A;  2YN6 A;  4IDQ A;  1XMQ T;  4AKG A;  2LOP A;  3PDY A;  1HNZ T;  1YQ3 A;  2WBL A;  2DWK A;  3B57 A;  4ZI2 D;  2I6H A;  4I55 E;  3ONX A;  1W0B A;  2ACZ A;  4IE7 A;  3RC3 A;  4XAX B;  5KDM C;  2UUC T;  2PFV A;  1ZOY A;  3V5U A;  5L3B B;  1U5P A;  3KV4 A;  5A1L A;  2Y48 B;  4B3T T;  3MJX A;  2OA5 A;  3N9L A;  2CHN A;  4CZZ B;  4YXD A;  5LJN A;  3OPC A;  3PUS A;  3VRB A;  1XDO A;  4TWD A;  3RI5 A;  4A98 A;  4B6X A;  2DL1 A;  3AE9 A;  4MFR A;  3A7M A;  4DV3 T;  4DBQ A;  2KWH A;  2V7M A;  4G2A A;  4PFP A;  4Z8X A;  5JQG E;  5LG4 A;  4OFZ A;  3HR0 A;  2W66 A;  1Z0P A;  4YT0 A;  1SHZ C;  5AQV B;  2BG9 C;  3UUN A;  2HPL A;  3ZN0 B;  5LGU B;  1E1H B;  1HFA A;  2UUA T;  5FP3 A;  2ES0 A;  2YU1 A;  4GIW A;  3I9W A;  5JR9 A;  5HWX A;  3N2K E;  1MMA A;  2CWO A;  2QVA A;  3AEE A;  3IBP A;  4PJL A;  2PBI A;  2BZB A;  4UXN B;  3L8R A;  5AQT B;  5CA1 E;  5L4H A;  3O1H A;  3ESL A;  3EDV A;  5HAX A;  2X0H A;  2WB5 A;  2BS4 A;  2WDR A;  4MLK A;  5LXT E;  4DUY T;  1XMO T;  3O9X A;  4B3M T;  4LFC T;  4LMJ A;  1N36 T;  5FMN A;  1J5E T;  4AKL A;  3FXD B;  2LEH A;  3RGL A;  5LMU T;  5IUX A;  1U4Q A;  1D1A A;  4JUY A;  4NUV A;  2WS3 A;  3ONJ A;  4QX8 B;  1WLX A;  2KND A;  4IDO A;  5AQS B;  4X62 T;  2V7I A;  1IZN B;  3FB2 A;  2IAK A;  2XAQ B;  3UTK A;  4OYK A;  5AQP B;  2D2S A;  4ZXL A;  1IBM T;  4MHC A;  3RF1 A;  2WU2 A;  2YDR A;  4ADZ A;  3W15 B;  1FJG T;  1VCT A;  4E7Z A;  5HYA A;  2FJB A;  4YSX A;  4EED A;  5LHH B;  4TX5 A;  2NW9 A;  1UGO A;  4ZZB A;  4JI3 T;  4TN7 B;  3Q9D A;  1MMN A;  1UUS A;  1W09 A;  2X68 A;  2V5C A;  5L3E B;  4UR9 A;  3LG7 A;  2V6Y B;  3PUR A;  1V9D A;  4U2Y A;  3RKG A;  1L0V A;  4C90 A;  4OX9 T;  4GYS A;  4ANJ A;  3SFD A;  4KHP T;  1Y64 B;  3N9Q A;  2X9X A;  3PUG A;  2HHH T;  2CXF A;  2VQE T;  3LJC A;  3ZMZ B;  3K1S A;  2ZLY A;  5BMV E;  4ASK A;  2E9X A;  4LMK A;  4U7Y A;  1FEW A;  2VL8 A;  4X20 E;  3RYI E;  1KNZ A;  2LSK A;  4DR7 T;  4H63 V;  1OED E;  4QHO A;  4X5T A;  2XQ9 A;  2CBJ A;  1KNR A;  1UX4 A;  2KMF A;  1R8I A;  3CQX C;  3MZK B;  3P4R A;  3DP7 A;  2CRB A;  5L2L A;  3LBX A;  5LNK A;  4UF0 A;  2J47 A;  4ZOL E;  2E2A A;  2J62 A;  4KX6 A;  5HEU A;  4JI0 T;  1IBL T;  2UXD T;  2E9X C;  2NW7 A;  3C98 B;  3OYX A;  4HFB A;  2XSA A;  3ZSS A;  2W00 A;  3AE2 A;  2CXL A;  1VOM A;  2BKO A;  3CX6 B;  3P4P A;  4ILB A;  4U33 A;  5ADX L;  5JRC B;  4EYU A;  4WZX A;  3PJA J;  1T8B A;  3RYC E;  3QB5 K;  4HGA A;  4YTP A;  1UUR A;  2XAS B;  4H9N C;  4LF4 T;  4KHZ F;  1LVF A;  3V5S A;  2FBW A;  3UQ4 A;  4GKK T;  3FZH B;  4DV6 T;  2VWA A;  2LLY A;  3ZJ2 A;  2N1G A;  3IA3 A;  3QNU A;  2EHO A;  3HA4 A;  4YLH A;  3SWH A;  5H6Q B;  2WAU A;  2YDS A;  3JC6 D;  3RYH E;  2LKG A;  4H9R C;  4IST A;  2VQF T;  4IT4 A;  4YSY A;  3ZT5 A;  3ZEF B;  2L8K A;  5E0O A;  1HTJ F;  5CJ5 A;  4AKI A;  5C8Y E;  5FVK A;  5AQF B;  1W0A A;  4PK6 A;  2J4G A;  4EGW A;  3PUW F;  1S94 A;  2JMH A;  3LDQ B;  4CXY A;  4JLE A;  5LHG B;  5JDM A;  2M67 A;  2C5I T;  1XDP A;  2ZM8 A;  3RQU A;  3K8P C;  3WAJ A;  2E9X D;  2IW5 B;  2JQQ A;  5LGN B;  3EI0 A;  2VVS A;  5FYM A;  3F2E A;  5F3J A;  4IE4 A;  4QWN B;  5J2U E;  2JQK A;  2LRL A;  3AEG A;  4B3R T;  3UU3 A;  2X0Y A;  1N32 T;  2I59 A;  1OED B;  2J1D G;  4NIQ A;  2XM2 A;  4ILC A;  3KBT A;  3MXZ A;  3RQW A;  3ZCI A;  1MIW A;  5HEJ A;  5IWA T;  5AQK B;  3JAE A;  2LSI A;  2UU9 T;  3NWI A;  4YTN A;  3IHR A;  2ODV A;  2VKD A;  3CK6 A;  3JC6 C;  1E2A A;  3AXJ B;  4X65 T;  2UUB T;  3VKG A;  4DR6 T;  2E5V A;  4Q25 A;  4JI7 T;  4ZHQ E;  2VVN A;  2H7O A;  3NRX A;  5LA6 E;  1US7 B;  5LOV E;  2LRK A;  1VRB A;  5IHY A;  5J1G A;  3AAE B;  3BQL A;  3EAM A;  5JVD E;  4A56 A;  1HX1 B;  4IIJ E;  4IDZ A;  1YQ4 A;  2XTL A;  4UV8 B;  3K3N A;  5JRC A;  5HCJ A;  5LP6 E;  5ABE A;  2V5D A;  2E5L T;  3U78 A;  3RHW A;  2HH7 A;  4H9Q C;  1X9B A;  4A5X A;  4COF A;  1OXZ A;  1WYB A;  4WBO A;  4U7I A;  2ACX A;  5AQU B;  1HF8 A;  2W62 A;  2CHO A;  4DMW A;  1X79 A;  2WSS V;  1UK5 A;  4CN6 A;  1I6Z A;  3EVY A;  2DNX A;  5JH7 E;  3KBU A;  1M7K A;  3NBX X;  4TWF A;  3CQG B;  3T1Y T;  1OWA A;  3GN5 A;  4GYR A;  3N2G E;  5FL0 A;  4LML A;  5J2T E;  4LF6 T;  4AQG A;  2DCF A;  2EHO C;  2ZM0 A;  3AAA B;  4V1A v;  3ZST A;  2CXD A;  4ISS A;  2QYW A;  3WI3 A;  4CXX A;  4GK0 E;  2WMO A;  5LCY A;  1CHU A;  2YOE A;  4I0U A;  2W61 A;  1YKH B;  1XNR T;  4DR3 T;  2WP9 A;  3UFG A;  5ABH A;  2LE8 A;  5FXZ A;  3DTO A;  5KMG P;  3SS1 A;  2N9D A;  1N34 T;  2DHR A;  1WFD A;  4ZZC A;  5FXW A;  2K24 A;  5HXR A;  3UU8 A;  2KIN B;  2XQ4 A;  4PJM A;  3QUJ A;  2CBI A;  2CWY A;  4JEU B;  4NUU A;  4WBN E;  3P7I A;  2WQY A;  5JDH A;  2L3L A;  2WDQ A;  5HXE A;  2V7L A;  3AA6 B;  2QGS A;  2BBJ A;  2XUE A;  1HG5 A;  3BQI A;  2VK9 A;  1N33 T;  4QXH B;  2BVM A;  5JRE A;  5AQR B;  5HCM A;  2WDV A;  1M62 A;  2VUR A;  3QC9 A;  1NAF A;  2A3D A;  2XPK A;  3UU4 A;  4JI5 T;  1SUM B;  2E8I A;  3AEF A;  3VR9 A;  2XM1 A;  4AXP A;  3KV5 A;  4I4T E;  4F8H A;  2JMK A;  3I1A A;  3AB3 B;  4CI3 B;  2QA7 A;  3ZLI A;  2BDE A;  2D0U A;  2V7K A;  2AXD S;  3N9P A;  4C91 A;  2LOS A;  4L0R A;  5FL1 A;  2VB6 A;  4O2A E;  3SFE A;  3UUX B;  1IAP A;  2WMN A;  2BG9 A;  2EHO D;  2XAF B;  3AE4 A;  1DU2 A;  4LF8 T;  2MTQ A;  3RIF A;  2XZE A;  5CGM A;  3AEB A;  3OBV E;  4OHF A;  4HFC A;  2CPT A;  4NPP A;  3MK7 C;  3E0Z A;  3UUM A;  5L4E A;  4IHJ E;  4DBR A;  3ETV A;  1MNE A;  2KSR A;  2W0G A;  5CA0 E;  3CQC B;  3PUQ A;  1D1C A;  2FUP A;  2IHR 1;  3Q5D A;  5AQO B;  2M6I A;  4O4H E;  3NRY A;  3CPZ A;  4HWI B;  4UEM A;  3UT5 E;  2V6X A;  2W4X A;  2ZM6 T;  1O3X A;  2K3W A;  3AA1 B;  2YDQ A;  3ANW A;  4G63 A;  4O8S A;  2LKH A;  4ZS2 A;  2DLR A;  3FXE B;  4O4J E;  5ABG A;  1LRZ A;  4UV9 B;  2IIU A;  2UXX B;  2VKH A;  3JCF A;  1OED A;  1Y01 A;  3L09 A;  4UVB B;  3BK9 A;  2W2U A;  1KF6 A;  3HKC E;  4I43 B;  3RH3 A;  2H3R A;  2IUB A;  1NEK A;  5HWY A;  4H9O C;  2CA5 A;  5FY1 A;  1ZV4 X;  2AE9 A;  3Q2M A;  3TLS A;  2NW8 A;  3AXJ A;  4TZ4 C;  4YTM A;  4UEL A;  1SE7 A;  5ETW A;  3ZMV B;  4DND A;  2LHN A;  3HL6 A;  1YW0 A;  3OVU A;  3FZF B;  4L5G A;  4EV6 A;  3ZT7 A;  2BKP A;  4QKN A;  4DID B;  1D1B A;  1MIV A;  5EK3 A;  5AQL B;  2IC6 A;  3QB5 A;  4JEH B;  3RPU A;  2MBG A;  2XQY A;  2JJ9 A;  4GOU A;  4CN1 A;  1BR0 A;  2H7V C;  3ZMS B;  2C0S A;  4OK0 A;  3AA0 B;  4WW0 A;  3G06 A;  2NTX A;  1UCU A;  5CB4 E;  3ZYK A;  5C2T A;  2YKS A;  2XQ8 A;  4P09 A;  3RIU C;  5L3G B;  2HN2 A;  2LHR A;  3I0O A;  1MIY A;  2FJE A;  4YJ2 E;  2WY2 A;  4YSZ A;  5EK2 A;  5FY0 A;  4K0K T;  4AI6 A;  1GQE A;  2L9Q A;  4KBM B;  3ZKR A;  2DWG A;  2BKN A;  2D9D A;  1EZ3 A;  2HPJ A;  2PJQ A;  1T72 A;  2CLY C;  2V26 A;  2X9W A;  2XAG B;  3D0T A;  3HKE E;  3KDS E;  4IRE A;  5LBM A;  3RIU A;  4JV5 T;  4YY3 T;  3QK6 A;  5DJQ C;  4HFH A;  1QLB A;  2E9X B;  4H63 H;  5AQQ B;  4DV2 T;  3CVR A;  5JR9 B;  3ZC0 A;  3FBL A;  5DQV A;  5LJM A;  4X1Y E;  4JI2 T;  4XBF B;  2C5K T;  2Y8D A;  3P4S A;  2CLY B;  3AA7 B;  2NTY A;  4LFB T;  2A2F X;  2D5U A;  2BS3 A;  3UU6 A;  4EXT A;  2XQ6 A;  2X67 A;  3TLU A;  4EOZ B;  5CFB A;  3RIA A;  3Q5E A;  3P4Q A;  3KV9 A;  5JDF A;  5LB7 B;  5LGT B;  2XQ5 A;  4U2Z A;  1WR0 A;  2BBH A;  3FBZ A;  5HEH A;  3ZJ1 A;  3AE7 A;  4HWF A;  2UXN B;  4XZC A;  2X51 A;  4UIG A;  3O1J A;  4Z91 A;  1BR4 A;  1WCR A;  3C51 A;  1T98 A;  3PV0 F;  2VKO A;  1G8X A;  4BAY B;  3M65 A;  4CQI A;  1ZP0 A;  3ONL C;  3C50 A;  1ZKE A;  3AED A;  1IJ6 A;  4PJN A;  3J9X 1;  3ZCJ A;  2OV9 A;  4IL9 A;  2WZI A;  4CXW A;  1YD8 G;  5F5W A;  1JNZ A;  5HXS A;  3ZN1 B;  4DV1 T;  1IBK T;  2CEA A;  1T7S A;  3UFE A;  3CX7 B;  3F31 A;  4PK4 A;  1HX8 A;  1D0Z A;  1SA0 E;  2K5B B;  2KZ7 B;  2LM2 A;  5FXX A;  4TNW A;  3ZYL A;  3NZP A;  5C3J A;  4DR5 T;  1NWM X;  2ZMA A;  3C4X A;  1HS7 A;  3PJA A;  4PJJ A;  4DR1 T;  4JBW F;  2WWU A;  3LK2 B;  5L3D B;  3J7Y q;  2DI4 A;  5AQI B;  3GN5 B;  4HEA A;  4BJM A;  2RA1 A;  1UX5 A;  4YHH T;  4IL4 A;  4HFI A;  4M1P A;  4KP3 C;  2BS2 A;  4HFV A;  4WNK A;  2M6B A;  4ZI7 E;  4CI1 B;  5HXH A;  4LFA T;  2F4V T;  4KMC A;  3B13 A;  1XWM A;  2K48 A;  2B1E A;  2KXP B;  3MAC A;  4HKA A;  5FXV A;  4F6R C;  4IE6 A;  4UF0 B;  5L3F B;  3H3M A;  4DV4 T;  2GK9 A;  4AQY T;  5LBQ B;  3PUY F;  2YK0 A;  2JQ9 A;  4X1K E;  5LMN T;  3E08 A;  1KK7 A;  4QH4 A;  3LFM A;  2W67 A;  3LK3 B;  3A8Y C;  4IGU A;  3RYF E;  4HWC A;  5EK4 A;  3BQK A;  3SRZ A;  5KX5 E;  5EZY E;  2XY8 B;  4AQF A;  3NVO A;  1D0Y A;  4QX7 B;  3N9O A;  2PTF A;  2XSB A;  3P4W A;  4EEB A;  4AIU A;  1H7C A;  4EZH A;  4IDN A;  4ZI3 C;  4DV7 T;  2NP9 A;  1QSD A;  5AQN B;  2LM9 A;  2YIN A;  4KUM B;  2UXB T;  3AEC A;  4AQF C;  4HWH A;  1XZY A;  3PU3 A;  3KVB A;  2LT3 A;  2WM9 A;  2WZH A;  2XAJ B;  4TV8 E;  3OJA A;  2CE7 A;  5BR8 T;  4EB6 E;  4A97 A;  4DR4 T;  4GKJ T;  2FJA A;  3CIR A;  5JTG A;  3PUZ F;  2Q9Q A;  1KFY A;  2XQA A;  4GK5 E;  4U3C A;  3CWZ B;  1MMD A;  4U74 A;  2R6G F;  2XQ7 A;  4YHJ A;  4Z90 A;  2B76 A;  2MOZ A;  2YU2 A;  4ZS3 A;  3UUB A;  2MPK A;  3PTR B;  3ZT6 A;  1NEN A;  1HR0 T;  4NXN T;  2VKJ A;  2CMR A;  5LYJ E;  3ZYM A;  2JPF A;  3DJB A;  3CKD A;  3KVA A;  3K3Q C;  4PAG A;  5DQW A;  3HI2 A;  4DUZ T;  1FMW A;  3UUL A;  4P0A A;  3VKH A;  5H6R B;  2A72 A;  4U72 A;  1MMG A;  1FIO A;  2KWI B;  3VU7 H;  5AQM B;  2Q9Q B;  3GA8 A;  5J0Z A;  4JI6 T;  4HTE A;  3C64 A;  1LVK A;  3O1I A;  4J2C A;  2FJD A;  4BA9 A;  3S4U A;  3ZC1 A;  3N9N A;  5F8P A;  4HWD A;  2A9U A;  2XHE B;  4MAL A;  2LSY A;  4FI5 A;  2I0M A;  3GWH A;  5ABF B;  3FZK B;  4IE0 A;  3CX8 B;  2JQH A;  4X66 T;  3AE1 A;  2PG8 A;  4DV5 T;  3ANW B;  1ZHC A;  4CI2 B;  4HN9 A;  2HN1 A;  1FMV A;  3RKO A;  3I9Y A;  2Z6E A;  3RC8 A;  4DR2 T;  3AE3 A;  5TAO A;  4JI8 T;  4LF5 T;  3TKL B;  5HEG A;  1HCI A;  5LHI B;  3CML A;  1XNQ T;  5GON E;  3PUA A;  1LKX A;  2CM0 A;  2Q9Q D;  3P50 A;  4HFD A;  3RRW A;  4P0B A;  4X64 T;  1BR2 A;  2XAH B;  3HKB E;  4UVC B;  5L47 A;  4LF7 T;  2H89 A;  2H88 A;  4TUY E;  2W63 A;  4U31 A;  3TLV A;  5AFU L;  4DV0 T;  4YJ3 E;  3ZPO A;  2ODU A;  1KNP A;  3OTO T;  3LK4 2;  1WR6 A;  2RP4 A;  3LBX B;  5FY7 A;  1S35 A;  4AIS A;  2WU5 A;  3L39 A;  5DAB A;  4EZ4 A;  3AAI A;  3C4W A;  5AQG B;  2JIW A;  3LSV A;  3NZQ A;  2BVL A;  2IC9 A;  3AE8 A;  3KFW X;  3Q5W A;  1G73 A;  2UXC T;  4TNV A;  1J5W A;  1WYC A;  4AKR B;  3AVS A;  3R84 B;  4ZI2 C;  4HE8 A;  4LF9 T;  2X9Y A;  3A5X A;  2RPA A;  4NXM T;  3MA9 A;  4ZI3 D;  1B7T A;  1E7P A;  4O2B E;  2BG9 E;  4JI4 T;  5AQH B;  1HG2 A;  4DVD A;  1AJ3 A;  4YFS A;  1Z8U A;  1D0X A;  2V8S V;  2X0L B;  3C4Z A;  4BJN A;  3AE6 A;  4JYA T;  3EDU A;  2EHO B;  2XJ7 A;  3P8C D;  1IJ5 A;  4EYY R;  2D0T A;  3JAF A;  2YEV C; 
#chains in the Genus database with same CATH homology
 1I94 T;  4DR1 T;  1N33 T;  4OX9 T;  4KHP T;  4B3S T;  2HHH T;  4JI5 T;  4X65 T;  4YHH T;  2UUB T;  4LF7 T;  2VQE T;  2F4V T;  4LFA T;  4LFC T;  1HNW T;  4DV4 T;  4AQY T;  3T1H T;  4LF8 T;  5LMN T;  2UXD T;  4JI0 T;  1IBL T;  2ZM6 T;  4LF4 T;  2UXB T;  4GKK T;  4DV6 T;  5BR8 T;  4DR4 T;  4GKJ T;  2VQF T;  1HNX T;  4DR5 T;  1HR0 T;  4NXN T;  4JI1 T;  4DUZ T;  1XMQ T;  1HNZ T;  4B3R T;  4JI6 T;  1N32 T;  2UUC T;  2UU9 T;  5IWA T;  4B3T T;  4K0K T;  4X66 T;  4DR7 T;  4DV3 T;  4DR6 T;  4DV5 T;  4JI7 T;  4JV5 T;  4YY3 T;  4DR2 T;  4LF5 T;  4JI8 T;  4DV2 T;  1XNQ T;  2UUA T;  2E5L T;  4X64 T;  4JI2 T;  4LFB T;  4DV7 T;  4DV0 T;  3OTO T;  1XMO T;  4DUY T;  4B3M T;  1N36 T;  1J5E T;  5LMU T;  3T1Y T;  2UXC T;  4LF6 T;  4X62 T;  4LF9 T;  4NXM T;  4JI4 T;  1IBM T;  1XNR T;  4DR3 T;  1FJG T;  4JYA T;  4DV1 T;  1IBK T;  1N34 T;  4JI3 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...