3MACA

Crystal structure of gp41-derived protein complexed with fab 8062
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
216
structure length
193
Chain Sequence
MQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILATTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLEGQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARITWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLEGQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Transmembrane glycoprotein
publication title Structural Basis of HIV-1 Neutralization by Affinity Matured Fabs Directed against the Internal Trimeric Coiled-Coil of gp41.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 96
structure length 193
sequence length 216
ec nomenclature
pdb deposition date 2010-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1860 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3macA00
3MA9A 2CMRA 3MACA
chains in the Genus database with same CATH superfamily
1YKHB 1MMNA 2LEHA 3KV6A 5HWXA 4NUUA 4PW8A 2V1DB 4YSYA 3P8CD 3RKOA 5FVLA 4AKIA 5FL1A 2UUBT 2XAQB 3HR0A 2JIWA 3H3MA 4YTPA 5KXJA 5JR9C 2H88A 3MXZA 5F5WA 3RQWA 2WQYA 3FBZA 2XPKA 3FXDB 4A98A 3HKEE 3GA8A 3PTRB 4JEUB 3AAIA 2ZM0A 5FXZA 3N2OA 2J1DG 5GONE 3ONXA 3LSVA 3DP7A 4MBQA 4CN1A 2N2NA 5IYZE 4XAXB 1UK5A 2Q9QA 3K1SA 2KWHA 2PTFA 5LJNA 1UUSA 2IAKA 4CQIA 1Z8UA 3UQ4A 3AE1A 2HH7A 5EZYE 3N5LA 3ZT7A 2M6BA 2WP9A 4P0BA 4XBFB 1J1JA 5HEHA 3A5XA 4LMJA 2UXBT 2CBJA 3SOLA 3AXJA 3O9XA 4UR9A 2V26A 4ASKA 4HN9A 4P09A 1QLBA 2WDRA 3C64A 5KX5E 1LVFA 1OEDA 1IZNB 3C51A 2XQ7A 2JRKA 2LM2A 3UFGA 2K48A 3TLWA 5AQGB 2CXLA 4LFCT 1Z0PA 3RLFF 5AQHB 5AQSB 2VURA 5ABGA 4MFRA 4ZHQE 2K3WA 2UXDT 3QNUA 3BK9A 3FZHB 4HFBA 5EK4A 3ETVA 2EHOC 2NR4A 5AQMB 1HG5A 2LSIA 3PE0A 5CFBA 3AAAB 3UUNA 4HFDA 4LF5T 4YSXA 4QXHB 4OHFA 2JMHA 2V7IA 2P9BA 1BR4A 4X66T 3VR9A 2LSGA 2W2UA 2OV9A 3U3IA 4TV8E 4BAYB 2L9QA 3AA7B 1VRBA 4X1KE 1N33T 4JI1T 3UTKA 1XNRT 4C90A 4P1NA 5AQPB 2QA7A 5LGTB 3C98B 4JBWF 4M1PA 2ZLYA 2WMNA 2BG9C 5E0OA 5JH7E 2FBWA 4EZ4A 1MNEA 3ANWB 4ISTA 4FI5A 3CQCB 3O4XE 4NUVA 2JQHA 3C4XA 2ODVA 1SHZC 3ZC1A 4OFZA 3LK3B 3QK6A 3A7MA 2W0GA 4NXMT 2X66A 3UU8A 2NW8A 5FXWA 4JI4T 2I0MA 1NAFA 2ZM2A 2XAGB 3AE5A 4F8HA 4DR7T 1H7CA 2VKDA 4KUMB 4Z90A 3RKGA 2BG9B 3HKCE 4BA9A 4K0UA 3AVRA 5HCMA 4QXBB 4V1Av 3WAJA 1D1BA 4AQFA 3KBUA 1V9DA 3P50A 4NPPA 4PK4A 2YDSA 4H63H 5DQVA 3ZKRA 3CX7B 2FJBA 3RC8A 4QKNA 3ZMSB 2ES0A 2W67A 4UF0B 2LT3A 5BR8T 2J47A 3KV9A 2HPLA 3JAFA 4MLKA 3OPCA 2V7KA 2FJEA 4U74A 3ZSTA 3AAEB 4C91A 3R84B 1BR2A 1OEDE 3AE2A 2BKNA 1NEKA 2XASB 3EI0A 5HEGA 4TZ4C 2D5UA 4PNIA 3LK42 5JDLA 4GIWA 2W4XA 2XQYA 4ZI3D 4LMLA 2WS3A 1SE7A 3ZSSA 4U31A 5BMVE 4ILCA 1XDOA 3RIAA 4EIWA 4EOZB 1KF6A 4YSZA 1KNRA 1T98A 2V6YA 2LHRA 2VKJA 5LGNB 4DMVA 1HNWT 2E9XC 4KI0F 5AQQB 2XQ4A 4ISSA 5JTGA 4LMKA 4JUYA 4QHOA 4B6XA 1S35A 4JI7T 4HWHA 3EVYA 2JPFA 3U78A 2UXCT 1HS7A 2H89A 2WY2A 3ABVA 3TLSA 4DMWA 3JC6D 2CWYA 5FYMA 2M6IA 3V5UA 4CXYA 2FJAA 2C5KT 3SRZA 5FP3A 4DR4T 3M65A 2KWIB 2K24A 4KMCA 1D0XA 2CBIA 3PUWF 3BQKA 2LSJA 5L2LA 4H9RC 2KLQA 1UX5A 5J1GA 2BS2A 1Y64B 1J5ET 2LSKA 4AKLA 2CXFA 3AEGA 4O4LE 3QOFA 4EYYR 4DR1T 4HWIB 1Y01A 2KT9A 3K3OA 3OVUA 2XTLA 2I6HA 1HTJF 5JDHA 3ZYLA 4PK5A 1UCUA 2NTXA 4DUZT 3PUAA 1G8XA 4ZEYA 5HYAA 2WB5A 5LJMA 4U2ZA 1LRZA 5FKYA 2ZM6T 1WRDA 4WNKA 4DR2T 3H37A 3BQLA 1WCRA 3ZN1B 3OTOT 2YDQA 1D1AA 3NBXX 3RIUC 3I1AA 3BQIA 4TUYE 5L4HA 3VKGA 2VVSA 3KV5A 3EHZA 5LA6E 2BKOA 3RYCE 3UT5E 1US7B 1YXRA 2WZIA 3Q9DA 4A56A 2E5VA 4X5TA 3H3AA 5FXVA 3L09A 5AQRB 4DVDA 2N9DA 2X0LB 3GMIA 1IJ6A 4IE5A 4PAGA 3AVSA 3DJBA 3AB3B 3UU3A 2IDOB 2KNDA 4YFSA 2QRXA 2WBLA 2HPJA 4COFA 3N9QA 5JR9A 1G73A 1HX1B 2JJ9A 2FUPA 5ABEA 2YKSA 3OYXA 5AQJB 3EAMA 5ABFA 3J7Yq 5JQGE 5JDMA 1QUUA 4N78D 4HTEA 3TLTA 3TLUA 2V7JA 3KVAA 3KV4A 2X68A 3ZMZB 2VQFT 2XY8B 4KHPT 3FB2A 3AEFA 1YQ3A 3LBXA 5HXHA 2BKPA 2KXPB 2JMKA 3GWHA 1NWMX 4U7IA 4BJMA 2DWKA 2ODUA 4HFVA 3ONLC 4GOUA 3N9MA 2UUAT 3N9LA 1HFAA 3AA0B 4DV5T 3UU6A 2LOSA 2UU9T 3AEAA 3JCFA 3FXEB 2LJLA 3ZC0A 2CPTA 3IBPA 2BBJA 5F3JA 2NOXA 4DR5T 4DBQA 4AQYT 1WR0A 1HG2A 4UVBB 3V5SA 4IE6A 3QB5K 2AXDS 4YHHT 5JDFA 3ZMTB 1XNQT 2VL0A 1XDPA 1L0VA 4YJ3E 4L9IA 5IHYA 2EHOA 5HXEA 2XAHB 3J9X1 4AISA 3PUXF 2J62A 4IE7A 1FEWA 3ZT6A 4IIJE 4AQGA 1N36T 5LHGB 2Y48B 1HNXT 2UXXB 3KINB 3CIRA 2PFVA 2KSRA 4IDQA 3PUGA 2PJQA 4ZS3A 2MTQA 4TWHA 2NWBA 3AE3A 3LFMA 2CMRA 4H9PC 3NWIA 2BS3A 4LF7T 4UEMA 1OEDC 3ZCIA 3PV0F 3KFWX 1W0BA 4U3CA 3HI2A 1SA0E 4UV9B 1T7SA 2XUEA 2YDRA 2IC6A 5ADXL 4UELA 2Q9QB 4CI3B 2MBGA 3ZMUB 4DNDA 3EDVA 2PBIA 5L3CB 2YOEA 4QH4A 2BZBA 1UURA 1FJGT 3P4WA 3FZMB 2GK9A 3PUQA 5LP6E 1U4QA 2CHNA 5HCJA 1R8IA 3AXJB 5CB4E 3K3NA 2Q9QD 2MAWA 2XAJB 5HEOA 5L47A 3ZYMA 1UX4A 1OEDB 3AE7A 3CX6B 4OYJA 1WYBA 2LM9A 4GK0E 3Q5XA 5AQLB 4FJOA 3FHNA 4PJJA 1MNDA 4EAHA 3VU7H 3B5MA 4DO0A 4X62T 3KBTA 1VOMA 4IDPA 3GN5A 2LRKA 2X9YA 5LBMA 1NENA 1M62A 4O2BE 4CN6A 1ZEEA 4I55E 1ZOYA 2MPKA 3NVOA 2CEAA 4PK6A 2EHOD 3ZN0B 2NW9A 2VB6A 2YN6A 3I0QA 4H63V 2E2AA 2XHEB 3AEEA 4ILBA 2XAFB 3MA9A 3IF8B 3Q5DA 3UUXB 5HXSA 3S4UA 1CUNA 3AE9A 1LKXA 5LGUB 3SFEA 1FIOA 2CXDA 4O2AE 4JLEA 4LF6T 3AE6A 2CA5A 4JYAT 2W00A 3ZJ1A 3JC6C 4G63A 3JADA 3OYZA 4IE4A 2QYWA 3CWZB 4H9NC 4YXDA 1N34T 4AKHA 3N9OA 4JI0T 3PUZF 4Z8XA 4IGUA 3N9PA 4AQFC 2RP4A 5HAXA 5ABHA 3WI3A 1GQEA 4WZXA 4X65T 2E9XA 4F6RC 4DUYT 1MIYA 2KZ7B 3L39A 4EYUA 1MMAA 3JAEA 4IL4A 1ZV4X 2IHR1 4E7SA 2A3DA 4O8SA 4NXNT 5H6QB 4I0UA 2VASA 3FZKB 4QX7B 4ZI2D 2ZMAA 1LVKA 3N9NA 1D0ZA 2QVAA 1D0YA 1E7PA 3L8RA 4IT4A 4TX5A 5EK2A 2CLYB 2HN2A 2WM9A 2NTYA 5JREA 2OLTA 3P4PA 1IBMT 2BVLA 1ZP0A 2D2SA 4HFCA 2D0UA 2XQAA 1HR0T 4TWFA 1WR6A 1CHUA 2X9WA 2XZEA 5L3DB 3Q5EA 5M4YA 5J2TE 5HEJA 1ZKEA 3CX8B 3ZMVB 3RRWA 2X9XA 4MHCA 4P0AA 1JNRA 5JDQA 3B57A 3NZQA 4AXPA 5F8PA 1FMWA 5HWYA 2C5JA 3RX6A 2WWUA 1KNZA 5AQIB 2LSYA 2BDEA 2Y8DA 3O1JA 2DHRA 4PJLA 4CI2B 4UVCB 1ZHCA 5LB7B 3OKQA 4QX8B 3NRYA 1HF8A 3F57A 4GYSA 3QC9A 5JRCA 4A97A 2A72A 5LCYA 5J2UE 4NIQA 5AQOB 3ESLA 2VWAA 2D0TA 1UGOA 5FL0A 1EZ3A 4ILAA 2M67A 4ZI7E 2XM1A 4B3ST 3EUHA 4WYVA 3P7IA 2V5DA 3N2KE 2W63A 2V6YB 4DV4T 4YTNA 3T8OA 3A8YC 1J5WA 3DTOA 5AFUL 4ZZBA 4EEDA 2NW7A 2LRLA 3LJCA 4O4IE 3UUMA 3F2EA 4B3TT 2XQ3A 2WDQA 3CQXC 3VKHA 3TKLB 2XQ9A 4EGWA 3R6NA 4GKJT 3FZLB 1IBLT 4H9QC 3NZPA 4LFAT 1IAPA 4JI8T 4IREA 2CRBA 2WMOA 2IMLA 1MIVA 2LKHA 3AECA 1AJ3A 1WLXA 2WAUA 2K9AA 1BR0A 3PUYF 2E5LT 1KEYA 2PG8A 2RA1A 1W09A 3IA3A 5CA1E 1I94T 1T72A 5J0ZA 2L8KA 2I59A 3NRXA 1IBKT 3VR8A 2W61A 2B1EA 5DJQC 2KINB 3PJAA 4ANJA 4GYRA 3VRBA 3LK2B 4DBRA 4QH1A 5LOVE 1XMQT 4CN4A 3CQGB 2XQ8A 3FZFB 2WWVA 3RI5A 4OX9T 1BR1A 4KBMB 2LLYA 1X79A 2UUCT 2SPCA 2L3LA 4I50E 4WBOA 3I9YA 1SUMB 3WAKA 2Y6XA 2ACZA 1VCSA 3UUBA 3PJAJ 2XQ6A 5FXXA 3RPUA 5ETWA 3OJAA 2H3RA 1KK7A 4HFEA 4QWNB 4DR3T 1MIWA 4G2AA 5KDMC 4EB6E 3TLVA 2X51A 2WCAA 2VKHA 3CMLA 1D1CA 2H7OA 2R6GF 2DL1A 4JI2T 3RH3A 3AA6B 5JDNA 3HL6A 2CM0A 3HA4A 5DABA 5JR9B 3PUVF 3MJXA 2Q9QC 3HKDE 1YD8G 5ABFB 1DU2A 1KFYA 2NP9A 5FY0A 2XQ5A 4IL9A 4BJNA 3RRCA 4H9SE 4EXTA 5C3JA 2CE7A 3B13A 2WU5A 2W62A 3ANWA 5AQTB 2V5CA 3P4RA 5FY1A 5HXCA 2JQQA 4HEAA 4J2CA 4TNVA 3LBXB 5L3BB 3ZYKA 2BS4A 4DV6T 2WDVA 2X67A 2IC9A 3FBLA 4IDOA 3RYFE 3CKDA 1VCTA 4ADZA 4HWCA 5L4EA 4GKKT 4JV5T 1X9BA 2A9UA 3CPZA 5AQVB 3UU5A 2LKGA 2BG9A 2DI4A 2QGSA 5IWAT 4CXWA 4PJMA 4H9OC 2V8SV 4JI6T 2FJDA 2YEVC 2V7LA 3RHWA 1OXZA 3MKDA 2B76A 3IEEA 2ACXA 5LBQB 3CK6A 1IJ5A 3ZPOA 3O1HA 3MZKB 1XZYA 4UF0A 3ZEFB 3LDQB 4ZS2A 2XM2A 2VQET 5KMGP 4TNWA 2EHOB 4WW0A 1KNPA 3UU4A 5LG3A 5LHHB 1XMOT 3PDYA 4ZI3C 5IUXA 5CGMA 4YJ2E 4DV2T 3L3PA 3O1IA 4O4JE 5EK3A 4ZZCA 3EABA 3AE8A 5LMNT 2OA5A 2MOZA 4YT0A 4DV1T 1XWMA 3W15B 5FMNA 4DV3T 3P4SA 5LXTE 5FY7A 4ZXLA 4IDNA 2KMFA 4HFHA 1YKEB 3X1DA 4X1YE 4ZI2C 1HNZT 4DV7T 4L5GA 4Z91A 3T1YT 4YLHA 5AQFB 4X64T 4I43B 3C4ZA 4EV6A 4YTMA 4IE0A 2F4VT 4XZCA 2YINA 3PU3A 5L3EB 5A1LA 2A2FX 3ZJ2A 3RIFA 3UFEA 3AA1B 4OK0A 4CXXA 1S94A 4LF4T 4U2YA 4QXCB 4UVAB 1YQ4A 4DR6T 4K0KT 2BVMA 5FNVE 5CA0E 2CLYC 2JQKA 4IHJE 2G0UA 1W9RA 4AIUA 3RQUA 1FMVA 2C5IT 3IHRA 2IIUA 4AKGA 2J4GA 5LNKA 5JDGA 2HN1A 1E1HB 2HHHT 4QH5A 3T1HT 4B3MT 3F31A 4X20E 2DLRA 2CCQA 3GN5B 3PURA 4CI1B 3SS1A 4JI3T 4PJNA 3CVRA 3ONJA 4HWFA 1YW0A 1MMDA 5LYJE 1QSDA 3NKZA 4UV8B 2LOPA 3N2GE 3E0ZA 2VL8A 2VK9A 2YK0A 2VKOA 2JQ9A 4AI6A 3ZCJA 3AEBA 2VVNA 4KHZF 2DWGA 1T8BA 3MK7C 5HXRA 4HWDA 3SWHA 2RPAA 2D9DA 2BG9E 4WBNE 2CWOA 4EEBA 3RGLA 2X0HA 2LE8A 4TN7B 3SFDA 4YHJA 4DIDB 1W0AA 2CHOA 3LG7A 4OYKA 4DV0T 3Q2MA 4UXNB 3KDSE 4TWDA 3ZT5A 5AQNB 4E7ZA 4GK5E 5L3GB 1HX8A 1MMGA 3I9WA 5H6RB 3E22E 2V6XA 5L3FB 3HKBE 3PUSA 1B7TA 2XSAA 2ZM8A 4KX6A 2MYSA 4HE8A 2E9XB 3ZLIA 3K3QC 3D0TA 4JEHB 2IUBA 1HCIA 3RC3A 4MALA 2C0SA 4X1IE 3PU8A 4ZOLE 4CZZB 3RIUA 4EZHA 3P4QA 4L0RA 5TAOA 4LF9T 5LMUT 5FVKA 2IW5B 4KP3C 3RYHE 3UULA 4HFIA 3AE4A 5LHIB 2W66A 2DCFA 4YY3T 4O4HE 5DQWA 3EDUA 2E9XD 4IDZA 3C50A 4ERRA 5C2TA 1N32T 3QB5A 1WFDA 4ILUA 2E8IA 4I4TE 5HEUA 2H7VC 3RYIE 2BBHA 3C4WA 3E08A 4B3RT 1E2AA 4Q25A 3KVBA 4AKRB 1OWAA 3I0OA 2K5BB 3K8PC 5C8YE 3ETUA 2AE9A 2X0YA 1M7KA 2LHNA 2DNXA 4A5XA 4U7YA 2Z6EA 1JNZA 3VRAA 1WYCA 4JI5T 4LFBT 4HGAA 4U33A 4PFPA 5AQUB 4HKAA 1O3XA 2WU2A 3UQ7A 4LF8T 5JVDE 2UXNB 2WSSV 5LG4A 2X9HA 4PFOA 3M3ZB 2YU2A 5AQKB 2YU1A 3Q5WA 2V7MA 2N1GA 3G06A 5JRCB 1I6ZA 5CJ5A 1U5PA 3QUJA 3RF1A 4UIGA 3VHLA 2XJ7A 4TV9E 3MACA 3AEDA 2XSBA 3OBVE 2WZHA 4U72A
chains in the Genus database with same CATH topology
1YKHB 3IF8B 3LBXB 5L3BB 1MMNA 2LEHA 3UUXB 3KV6A 3ZYKA 5HWXA 3M65A 5HXSA 3S4UA 2KWIB 2K24A 1CUNA 4NUUA 4PW8A 4KMCA 1D0XA 2V1DB 1LKXA 3P8CD 5LGUB 3BQKA 1FIOA 2X67A 2IC9A 2LSJA 2CXDA 3RKOA 4O2AE 5L2LA 4JLEA 4AKIA 3FBLA 4H9RC 3RYFE 2XAQB 3HR0A 2CA5A 3CKDA 2KLQA 1UX5A 2W00A 3ZJ1A 5J1GA 4ADZA 1Y64B 3JC6C 4G63A 2LSKA 4AKLA 3CPZA 2CXFA 3OYZA 4IE4A 5JR9C 3CWZB 4H9NC 3MXZA 4O4LE 2DI4A 2QGSA 4AKHA 3N9OA 4EYYR 4CXWA 3FBZA 4PJMA 3FXDB 4Z8XA 4H9OC 2KT9A 3K3OA 3HKEE 2XTLA 4IGUA 3N9PA 1HTJF 5JDHA 3ZYLA 3GA8A 3PTRB 4JEUB 3AAIA 2RP4A 1UCUA 4PK5A 4AQFC 2NTXA 2ZM0A 5FXZA 5HAXA 3N2OA 2YEVC 2J1DG 2V7LA 3WI3A 5GONE 3PUAA 1G8XA 1OXZA 3MKDA 3ONXA 5HYAA 3IEEA 2E9XA 5LJMA 1LRZA 4F6RC 2ACXA 3DP7A 4MBQA 1MIYA 1WRDA 2KZ7B 4WNKA 4EYUA 3H37A 5LBQB 3BQLA 1IJ5A 2N2NA 3ZPOA 1MMAA 3MZKB 3O1HA 5IYZE 3ZN1B 4XAXB 4UF0A 2Q9QA 3ZEFB 1D1AA 4ZS2A 2KWHA 5LJNA 1ZV4X 3NBXX 5KMGP 4E7SA 3I1AA 3BQIA 4TUYE 3VKGA 2EHOB 4WW0A 2IAKA 4CQIA 2A3DA 3KV5A 5LA6E 4O8SA 3RYCE 3UT5E 1US7B 2HH7A 5H6QB 2VASA 4QX7B 4ZI2D 5LHHB 5EZYE 2ZMAA 1LVKA 3Q9DA 3N5LA 3PDYA 3N9NA 4A56A 1D0ZA 4ZI3C 3H3AA 5FXVA 4P0BA 4XBFB 3A5XA 1D0YA 4YJ2E 3L09A 4TX5A 5EK2A 2CLYB 3L3PA 4DVDA 3SOLA 3O1IA 4O4JE 3O9XA 2N9DA 2X0LB 5EK3A 2WM9A 2V26A 4ASKA 2NTYA 4HN9A 5JREA 3GMIA 1IJ6A 4P09A 4IE5A 2BVLA 2OA5A 2MOZA 3W15B 2D2SA 5FMNA 4PAGA 3C64A 5KX5E 2D0UA 3AVSA 1LVFA 3DJBA 1IZNB 5FY7A 5LXTE 3C51A 2JRKA 3AB3B 2K48A 1WR6A 2KMFA 1YKEB 2X9WA 2CXLA 5L3DB 4X1YE 5M4YA 1Z0PA 5J2TE 4ZI2C 1ZKEA 2KNDA 3CX8B 3ZMVB 3RRWA 2X9XA 4L5GA 4MFRA 4YFSA 4MHCA 4P0AA 4YLHA 4ZHQE 5JDQA 3B57A 2WBLA 3NZQA 2HPJA 4I43B 3N9QA 5JR9A 1G73A 2JJ9A 4AXPA 5F8PA 3C4ZA 1FMWA 4IE0A 5HWYA 2C5JA 3RX6A 2WWUA 3BK9A 1KNZA 5EK4A 3OYXA 4XZCA 2LSYA 2BDEA 2YINA 3PU3A 3J7Yq 2Y8DA 3O1JA 5L3EB 2DHRA 4PJLA 5A1LA 3ETVA 5JDMA 5JQGE 1QUUA 2EHOC 2A2FX 4CI2B 4UVCB 4N78D 3ZJ2A 1ZHCA 3OKQA 4QX8B 3NRYA 4HTEA 3UFEA 1HF8A 3AA1B 3F57A 4GYSA 3QC9A 2V7JA 3KVAA 3KV4A 5JRCA 1HG5A 2LSIA 2A72A 2X68A 4OK0A 5LCYA 4CXXA 5J2UE 1S94A 3PE0A 3AAAB 3ZMZB 3ESLA 2VWAA 4QXCB 3UUNA 2D0TA 4UVAB 2BVMA 3FB2A 5FNVE 5CA0E 2CLYC 3LBXA 1EZ3A 5HXHA 4QXHB 4IHJE 2G0UA 2M67A 2JMHA 4OHFA 2V7IA 4ZI7E 3EUHA 2P9BA 1FMVA 3P7IA 3N2KE 1BR4A 2KXPB 2C5IT 2LSGA 2W63A 3IHRA 4AKGA 2JMKA 3T8OA 3GWHA 5LNKA 1NWMX 5JDGA 3DTOA 3U3IA 5AFUL 4TV8E 4BAYB 4BJMA 2L9QA 3AA7B 1E1HB 1VRBA 2DWKA 2ODUA 4HFVA 4GOUA 4X1KE 3N9MA 2NW7A 3F31A 3LJCA 3UTKA 4X20E 4C90A 2DLRA 2CCQA 3GN5B 2QA7A 4O4IE 3PURA 3N9LA 5LGTB 3UUMA 1HFAA 3AA0B 3C98B 3F2EA 4CI1B 3SS1A 3CQXC 4PJNA 3VKHA 3TKLB 2LOSA 3CVRA 4M1PA 2ZLYA 3FXEB 2LJLA 3ZC0A 1YW0A 2WMNA 1MMDA 5E0OA 5JH7E 5LYJE 1QSDA 4EZ4A 1MNEA 3IBPA 4UV8B 3R6NA 2LOPA 3ANWB 3N2GE 3E0ZA 2VL8A 2VK9A 5F3JA 2YK0A 4ISTA 2NOXA 4FI5A 3CQCB 2VKOA 4DBQA 3O4XE 4H9QC 3NZPA 4AI6A 1IAPA 1HG2A 4NUVA 4UVBB 3ZCJA 3V5SA 4IE6A 2WMOA 3C4XA 2DWGA 3MK7C 1MIVA 2ODVA 1SHZC 5HXRA 5JDFA 3ZMTB 3SWHA 1AJ3A 3ZC1A 1WLXA 2WAUA 4OFZA 4WBNE 2K9AA 3LK3B 1BR0A 3QK6A 2CWOA 2W0GA 4YJ3E 4L9IA 2X66A 2NW8A 5IHYA 2EHOA 2PG8A 5FXWA 5HXEA 2XAHB 2RA1A 3J9X1 2LE8A 1NAFA 4TN7B 4IE7A 2ZM2A 1FEWA 4IIJE 5CA1E 4YHJA 2XAGB 3LG7A 4OYKA 4AQGA 1H7CA 2L8KA 2I59A 2VKDA 3NRXA 4KUMB 3Q2MA 5LHGB 2Y48B 3HKCE 2UXXB 4UXNB 4BA9A 3KINB 2PFVA 4K0UA 2W61A 3AVRA 3KDSE 3PUGA 2B1EA 2PJQA 4QXBB 4ZS3A 4V1Av 4E7ZA 4GK5E 5L3GB 5DJQC 2KINB 2MTQA 1HX8A 3WAJA 4ANJA 1D1BA 2NWBA 4GYRA 1MMGA 4AQFA 3KBUA 3LFMA 3I9WA 2CMRA 3E22E 4H9PC 5H6RB 5L3FB 3HKBE 1V9DA 3PUSA 4UEMA 1B7TA 4PK4A 3LK2B 4DBRA 3ZCIA 2ZM8A 4H63H 3KFWX 5DQVA 5LOVE 2MYSA 3HI2A 2E9XB 3CX7B 4HE8A 3ZLIA 3K3QC 3D0TA 1SA0E 3CQGB 3RC8A 4JEHB 4UV9B 2XUEA 2IC6A 1HCIA 4QKNA 3RC3A 5ADXL 3ZMSB 4MALA 2C0SA 4X1IE 1BR1A 4KBMB 4UELA 3PU8A 2ES0A 4ZOLE 4UF0B 2Q9QB 4CZZB 1X79A 4CI3B 2SPCA 2MBGA 2L3LA 2LT3A 3ZMUB 4EZHA 4DNDA 4I50E 3KV9A 3EDVA 4WBOA 2PBIA 5L3CB 2HPLA 4L0RA 5TAOA 4MLKA 3I9YA 2BZBA 2V7KA 4U74A 2IW5B 4KP3C 3RYHE 3WAKA 3UULA 2Y6XA 3AAEB 5LHIB 4C91A 3R84B 2DCFA 1BR2A 2XASB 2GK9A 4O4HE 5DQWA 3EDUA 3PUQA 5FXXA 4TZ4C 5LP6E 2D5UA 2E9XD 4IDZA 3C50A 4ERRA 4PNIA 3LK42 1U4QA 3RPUA 5ETWA 5JDLA 4ILUA 2E8IA 4I4TE 3OJAA 4GIWA 2H7VC 2XQYA 4ZI3D 3RYIE 2H3RA 3C4WA 3E08A 5CB4E 3K3NA 2Q9QD 2XAJB 1KK7A 3KVBA 4AKRB 4QWNB 1OWAA 3I0OA 2K5BB 3K8PC 5BMVE 3ZYMA 1MIWA 1UX4A 4G2AA 5KDMC 5C8YE 3ETUA 4EB6E 2X51A 3CX6B 2VKHA 4OYJA 1WYBA 4EIWA 3CMLA 1D1CA 4EOZB 2LM9A 4GK0E 2LHNA 3Q5XA 1T98A 2H7OA 2DNXA 2Z6EA 2LHRA 4FJOA 3FHNA 4PJJA 1MNDA 2VKJA 3RH3A 3AA6B 5LGNB 4DMVA 4EAHA 5JDNA 1WYCA 3VU7H 3HL6A 4DO0A 2CM0A 4HGAA 4PFPA 2E9XC 3HA4A 5DABA 4ISSA 5JR9B 4HKAA 3KBTA 1VOMA 3GN5A 1O3XA 4JUYA 2X9YA 5LBMA 3MJXA 2Q9QC 5JVDE 3HKDE 1YD8G 4O2BE 2UXNB 4QHOA 2WSSV 5LG4A 4B6XA 2X9HA 1S35A 1ZEEA 4I55E 4PFOA 2NP9A 2YU2A 5FY0A 3EVYA 2YU1A 2JPFA 3Q5WA 2V7MA 3U78A 4BJNA 2CEAA 4PK6A 3RRCA 4H9SE 2N1GA 1HS7A 4EXTA 2EHOD 5JRCB 3ZN0B 1U5PA 2CE7A 3QUJA 3B13A 4DMWA 2NW9A 2W62A 3ANWA 2VB6A 4UIGA 3VHLA 3JC6D 3I0QA 2CWYA 5FYMA 5FY1A 5HXCA 3V5UA 4CXYA 2JQQA 4H63V 4HEAA 2C5KT 4TV9E 3SRZA 2XHEB 3MACA 5FP3A 4J2CA 3OBVE 2XAFB 3MA9A 4U72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MA9 A;  2CMR A;  3MAC A; 
#chains in the Genus database with same CATH topology
 1YKH B;  1MMN A;  2LEH A;  3KV6 A;  5HWX A;  4NUU A;  4PW8 A;  2V1D B;  4YSY A;  3P8C D;  3RKO A;  5FVL A;  4AKI A;  5FL1 A;  2UUB T;  2XAQ B;  3HR0 A;  2JIW A;  3H3M A;  4YTP A;  5KXJ A;  5JR9 C;  2H88 A;  3MXZ A;  5F5W A;  3RQW A;  2WQY A;  3FBZ A;  2XPK A;  3FXD B;  4A98 A;  3HKE E;  3GA8 A;  3PTR B;  4JEU B;  3AAI A;  2ZM0 A;  5FXZ A;  3N2O A;  2J1D G;  5GON E;  3ONX A;  3LSV A;  3DP7 A;  4MBQ A;  4CN1 A;  2N2N A;  5IYZ E;  4XAX B;  1UK5 A;  2Q9Q A;  3K1S A;  2KWH A;  2PTF A;  5LJN A;  1UUS A;  2IAK A;  4CQI A;  1Z8U A;  3UQ4 A;  3AE1 A;  2HH7 A;  5EZY E;  3N5L A;  3ZT7 A;  2M6B A;  2WP9 A;  4P0B A;  4XBF B;  1J1J A;  5HEH A;  3A5X A;  4LMJ A;  2UXB T;  2CBJ A;  3SOL A;  3AXJ A;  3O9X A;  4UR9 A;  2V26 A;  4ASK A;  4HN9 A;  4P09 A;  1QLB A;  2WDR A;  3C64 A;  5KX5 E;  1LVF A;  1OED A;  1IZN B;  3C51 A;  2XQ7 A;  2JRK A;  2LM2 A;  3UFG A;  2K48 A;  3TLW A;  5AQG B;  2CXL A;  4LFC T;  1Z0P A;  3RLF F;  5AQH B;  5AQS B;  2VUR A;  5ABG A;  4MFR A;  4ZHQ E;  2K3W A;  2UXD T;  3QNU A;  3BK9 A;  3FZH B;  4HFB A;  5EK4 A;  3ETV A;  2EHO C;  2NR4 A;  5AQM B;  1HG5 A;  2LSI A;  3PE0 A;  5CFB A;  3AAA B;  3UUN A;  4HFD A;  4LF5 T;  4YSX A;  4QXH B;  4OHF A;  2JMH A;  2V7I A;  2P9B A;  1BR4 A;  4X66 T;  3VR9 A;  2LSG A;  2W2U A;  2OV9 A;  3U3I A;  4TV8 E;  4BAY B;  2L9Q A;  3AA7 B;  1VRB A;  4X1K E;  1N33 T;  4JI1 T;  3UTK A;  1XNR T;  4C90 A;  4P1N A;  5AQP B;  2QA7 A;  5LGT B;  3C98 B;  4JBW F;  4M1P A;  2ZLY A;  2WMN A;  2BG9 C;  5E0O A;  5JH7 E;  2FBW A;  4EZ4 A;  1MNE A;  3ANW B;  4IST A;  4FI5 A;  3CQC B;  3O4X E;  4NUV A;  2JQH A;  3C4X A;  2ODV A;  1SHZ C;  3ZC1 A;  4OFZ A;  3LK3 B;  3QK6 A;  3A7M A;  2W0G A;  4NXM T;  2X66 A;  3UU8 A;  2NW8 A;  5FXW A;  4JI4 T;  2I0M A;  1NAF A;  2ZM2 A;  2XAG B;  3AE5 A;  4F8H A;  4DR7 T;  1H7C A;  2VKD A;  4KUM B;  4Z90 A;  3RKG A;  2BG9 B;  3HKC E;  4BA9 A;  4K0U A;  3AVR A;  5HCM A;  4QXB B;  4V1A v;  3WAJ A;  1D1B A;  4AQF A;  3KBU A;  1V9D A;  3P50 A;  4NPP A;  4PK4 A;  2YDS A;  4H63 H;  5DQV A;  3ZKR A;  3CX7 B;  2FJB A;  3RC8 A;  4QKN A;  3ZMS B;  2ES0 A;  2W67 A;  4UF0 B;  2LT3 A;  5BR8 T;  2J47 A;  3KV9 A;  2HPL A;  3JAF A;  4MLK A;  3OPC A;  2V7K A;  2FJE A;  4U74 A;  3ZST A;  3AAE B;  4C91 A;  3R84 B;  1BR2 A;  1OED E;  3AE2 A;  2BKN A;  1NEK A;  2XAS B;  3EI0 A;  5HEG A;  4TZ4 C;  2D5U A;  4PNI A;  3LK4 2;  5JDL A;  4GIW A;  2W4X A;  2XQY A;  4ZI3 D;  4LML A;  2WS3 A;  1SE7 A;  3ZSS A;  4U31 A;  5BMV E;  4ILC A;  1XDO A;  3RIA A;  4EIW A;  4EOZ B;  1KF6 A;  4YSZ A;  1KNR A;  1T98 A;  2V6Y A;  2LHR A;  2VKJ A;  5LGN B;  4DMV A;  1HNW T;  2E9X C;  4KI0 F;  5AQQ B;  2XQ4 A;  4ISS A;  5JTG A;  4LMK A;  4JUY A;  4QHO A;  4B6X A;  1S35 A;  4JI7 T;  4HWH A;  3EVY A;  2JPF A;  3U78 A;  2UXC T;  1HS7 A;  2H89 A;  2WY2 A;  3ABV A;  3TLS A;  4DMW A;  3JC6 D;  2CWY A;  5FYM A;  2M6I A;  3V5U A;  4CXY A;  2FJA A;  2C5K T;  3SRZ A;  5FP3 A;  4DR4 T;  3M65 A;  2KWI B;  2K24 A;  4KMC A;  1D0X A;  2CBI A;  3PUW F;  3BQK A;  2LSJ A;  5L2L A;  4H9R C;  2KLQ A;  1UX5 A;  5J1G A;  2BS2 A;  1Y64 B;  1J5E T;  2LSK A;  4AKL A;  2CXF A;  3AEG A;  4O4L E;  3QOF A;  4EYY R;  4DR1 T;  4HWI B;  1Y01 A;  2KT9 A;  3K3O A;  3OVU A;  2XTL A;  2I6H A;  1HTJ F;  5JDH A;  3ZYL A;  4PK5 A;  1UCU A;  2NTX A;  4DUZ T;  3PUA A;  1G8X A;  4ZEY A;  5HYA A;  2WB5 A;  5LJM A;  4U2Z A;  1LRZ A;  5FKY A;  2ZM6 T;  1WRD A;  4WNK A;  4DR2 T;  3H37 A;  3BQL A;  1WCR A;  3ZN1 B;  3OTO T;  2YDQ A;  1D1A A;  3NBX X;  3RIU C;  3I1A A;  3BQI A;  4TUY E;  5L4H A;  3VKG A;  2VVS A;  3KV5 A;  3EHZ A;  5LA6 E;  2BKO A;  3RYC E;  3UT5 E;  1US7 B;  1YXR A;  2WZI A;  3Q9D A;  4A56 A;  2E5V A;  4X5T A;  3H3A A;  5FXV A;  3L09 A;  5AQR B;  4DVD A;  2N9D A;  2X0L B;  3GMI A;  1IJ6 A;  4IE5 A;  4PAG A;  3AVS A;  3DJB A;  3AB3 B;  3UU3 A;  2IDO B;  2KND A;  4YFS A;  2QRX A;  2WBL A;  2HPJ A;  4COF A;  3N9Q A;  5JR9 A;  1G73 A;  1HX1 B;  2JJ9 A;  2FUP A;  5ABE A;  2YKS A;  3OYX A;  5AQJ B;  3EAM A;  5ABF A;  3J7Y q;  5JQG E;  5JDM A;  1QUU A;  4N78 D;  4HTE A;  3TLT A;  3TLU A;  2V7J A;  3KVA A;  3KV4 A;  2X68 A;  3ZMZ B;  2VQF T;  2XY8 B;  4KHP T;  3FB2 A;  3AEF A;  1YQ3 A;  3LBX A;  5HXH A;  2BKP A;  2KXP B;  2JMK A;  3GWH A;  1NWM X;  4U7I A;  4BJM A;  2DWK A;  2ODU A;  4HFV A;  3ONL C;  4GOU A;  3N9M A;  2UUA T;  3N9L A;  1HFA A;  3AA0 B;  4DV5 T;  3UU6 A;  2LOS A;  2UU9 T;  3AEA A;  3JCF A;  3FXE B;  2LJL A;  3ZC0 A;  2CPT A;  3IBP A;  2BBJ A;  5F3J A;  2NOX A;  4DR5 T;  4DBQ A;  4AQY T;  1WR0 A;  1HG2 A;  4UVB B;  3V5S A;  4IE6 A;  3QB5 K;  2AXD S;  4YHH T;  5JDF A;  3ZMT B;  1XNQ T;  2VL0 A;  1XDP A;  1L0V A;  4YJ3 E;  4L9I A;  5IHY A;  2EHO A;  5HXE A;  2XAH B;  3J9X 1;  4AIS A;  3PUX F;  2J62 A;  4IE7 A;  1FEW A;  3ZT6 A;  4IIJ E;  4AQG A;  1N36 T;  5LHG B;  2Y48 B;  1HNX T;  2UXX B;  3KIN B;  3CIR A;  2PFV A;  2KSR A;  4IDQ A;  3PUG A;  2PJQ A;  4ZS3 A;  2MTQ A;  4TWH A;  2NWB A;  3AE3 A;  3LFM A;  2CMR A;  4H9P C;  3NWI A;  2BS3 A;  4LF7 T;  4UEM A;  1OED C;  3ZCI A;  3PV0 F;  3KFW X;  1W0B A;  4U3C A;  3HI2 A;  1SA0 E;  4UV9 B;  1T7S A;  2XUE A;  2YDR A;  2IC6 A;  5ADX L;  4UEL A;  2Q9Q B;  4CI3 B;  2MBG A;  3ZMU B;  4DND A;  3EDV A;  2PBI A;  5L3C B;  2YOE A;  4QH4 A;  2BZB A;  1UUR A;  1FJG T;  3P4W A;  3FZM B;  2GK9 A;  3PUQ A;  5LP6 E;  1U4Q A;  2CHN A;  5HCJ A;  1R8I A;  3AXJ B;  5CB4 E;  3K3N A;  2Q9Q D;  2MAW A;  2XAJ B;  5HEO A;  5L47 A;  3ZYM A;  1UX4 A;  1OED B;  3AE7 A;  3CX6 B;  4OYJ A;  1WYB A;  2LM9 A;  4GK0 E;  3Q5X A;  5AQL B;  4FJO A;  3FHN A;  4PJJ A;  1MND A;  4EAH A;  3VU7 H;  3B5M A;  4DO0 A;  4X62 T;  3KBT A;  1VOM A;  4IDP A;  3GN5 A;  2LRK A;  2X9Y A;  5LBM A;  1NEN A;  1M62 A;  4O2B E;  4CN6 A;  1ZEE A;  4I55 E;  1ZOY A;  2MPK A;  3NVO A;  2CEA A;  4PK6 A;  2EHO D;  3ZN0 B;  2NW9 A;  2VB6 A;  2YN6 A;  3I0Q A;  4H63 V;  2E2A A;  2XHE B;  3AEE A;  4ILB A;  2XAF B;  3MA9 A;  3IF8 B;  3Q5D A;  3UUX B;  5HXS A;  3S4U A;  1CUN A;  3AE9 A;  1LKX A;  5LGU B;  3SFE A;  1FIO A;  2CXD A;  4O2A E;  4JLE A;  4LF6 T;  3AE6 A;  2CA5 A;  4JYA T;  2W00 A;  3ZJ1 A;  3JC6 C;  4G63 A;  3JAD A;  3OYZ A;  4IE4 A;  2QYW A;  3CWZ B;  4H9N C;  4YXD A;  1N34 T;  4AKH A;  3N9O A;  4JI0 T;  3PUZ F;  4Z8X A;  4IGU A;  3N9P A;  4AQF C;  2RP4 A;  5HAX A;  5ABH A;  3WI3 A;  1GQE A;  4WZX A;  4X65 T;  2E9X A;  4F6R C;  4DUY T;  1MIY A;  2KZ7 B;  3L39 A;  4EYU A;  1MMA A;  3JAE A;  4IL4 A;  1ZV4 X;  2IHR 1;  4E7S A;  2A3D A;  4O8S A;  4NXN T;  5H6Q B;  4I0U A;  2VAS A;  3FZK B;  4QX7 B;  4ZI2 D;  2ZMA A;  1LVK A;  3N9N A;  1D0Z A;  2QVA A;  1D0Y A;  1E7P A;  3L8R A;  4IT4 A;  4TX5 A;  5EK2 A;  2CLY B;  2HN2 A;  2WM9 A;  2NTY A;  5JRE A;  2OLT A;  3P4P A;  1IBM T;  2BVL A;  1ZP0 A;  2D2S A;  4HFC A;  2D0U A;  2XQA A;  1HR0 T;  4TWF A;  1WR6 A;  1CHU A;  2X9W A;  2XZE A;  5L3D B;  3Q5E A;  5M4Y A;  5J2T E;  5HEJ A;  1ZKE A;  3CX8 B;  3ZMV B;  3RRW A;  2X9X A;  4MHC A;  4P0A A;  1JNR A;  5JDQ A;  3B57 A;  3NZQ A;  4AXP A;  5F8P A;  1FMW A;  5HWY A;  2C5J A;  3RX6 A;  2WWU A;  1KNZ A;  5AQI B;  2LSY A;  2BDE A;  2Y8D A;  3O1J A;  2DHR A;  4PJL A;  4CI2 B;  4UVC B;  1ZHC A;  5LB7 B;  3OKQ A;  4QX8 B;  3NRY A;  1HF8 A;  3F57 A;  4GYS A;  3QC9 A;  5JRC A;  4A97 A;  2A72 A;  5LCY A;  5J2U E;  4NIQ A;  5AQO B;  3ESL A;  2VWA A;  2D0T A;  1UGO A;  5FL0 A;  1EZ3 A;  4ILA A;  2M67 A;  4ZI7 E;  2XM1 A;  4B3S T;  3EUH A;  4WYV A;  3P7I A;  2V5D A;  3N2K E;  2W63 A;  2V6Y B;  4DV4 T;  4YTN A;  3T8O A;  3A8Y C;  1J5W A;  3DTO A;  5AFU L;  4ZZB A;  4EED A;  2NW7 A;  2LRL A;  3LJC A;  4O4I E;  3UUM A;  3F2E A;  4B3T T;  2XQ3 A;  2WDQ A;  3CQX C;  3VKH A;  3TKL B;  2XQ9 A;  4EGW A;  3R6N A;  4GKJ T;  3FZL B;  1IBL T;  4H9Q C;  3NZP A;  4LFA T;  1IAP A;  4JI8 T;  4IRE A;  2CRB A;  2WMO A;  2IML A;  1MIV A;  2LKH A;  3AEC A;  1AJ3 A;  1WLX A;  2WAU A;  2K9A A;  1BR0 A;  3PUY F;  2E5L T;  1KEY A;  2PG8 A;  2RA1 A;  1W09 A;  3IA3 A;  5CA1 E;  1I94 T;  1T72 A;  5J0Z A;  2L8K A;  2I59 A;  3NRX A;  1IBK T;  3VR8 A;  2W61 A;  2B1E A;  5DJQ C;  2KIN B;  3PJA A;  4ANJ A;  4GYR A;  3VRB A;  3LK2 B;  4DBR A;  4QH1 A;  5LOV E;  1XMQ T;  4CN4 A;  3CQG B;  2XQ8 A;  3FZF B;  2WWV A;  3RI5 A;  4OX9 T;  1BR1 A;  4KBM B;  2LLY A;  1X79 A;  2UUC T;  2SPC A;  2L3L A;  4I50 E;  4WBO A;  3I9Y A;  1SUM B;  3WAK A;  2Y6X A;  2ACZ A;  1VCS A;  3UUB A;  3PJA J;  2XQ6 A;  5FXX A;  3RPU A;  5ETW A;  3OJA A;  2H3R A;  1KK7 A;  4HFE A;  4QWN B;  4DR3 T;  1MIW A;  4G2A A;  5KDM C;  4EB6 E;  3TLV A;  2X51 A;  2WCA A;  2VKH A;  3CML A;  1D1C A;  2H7O A;  2R6G F;  2DL1 A;  4JI2 T;  3RH3 A;  3AA6 B;  5JDN A;  3HL6 A;  2CM0 A;  3HA4 A;  5DAB A;  5JR9 B;  3PUV F;  3MJX A;  2Q9Q C;  3HKD E;  1YD8 G;  5ABF B;  1DU2 A;  1KFY A;  2NP9 A;  5FY0 A;  2XQ5 A;  4IL9 A;  4BJN A;  3RRC A;  4H9S E;  4EXT A;  5C3J A;  2CE7 A;  3B13 A;  2WU5 A;  2W62 A;  3ANW A;  5AQT B;  2V5C A;  3P4R A;  5FY1 A;  5HXC A;  2JQQ A;  4HEA A;  4J2C A;  4TNV A;  3LBX B;  5L3B B;  3ZYK A;  2BS4 A;  4DV6 T;  2WDV A;  2X67 A;  2IC9 A;  3FBL A;  4IDO A;  3RYF E;  3CKD A;  1VCT A;  4ADZ A;  4HWC A;  5L4E A;  4GKK T;  4JV5 T;  1X9B A;  2A9U A;  3CPZ A;  5AQV B;  3UU5 A;  2LKG A;  2BG9 A;  2DI4 A;  2QGS A;  5IWA T;  4CXW A;  4PJM A;  4H9O C;  2V8S V;  4JI6 T;  2FJD A;  2YEV C;  2V7L A;  3RHW A;  1OXZ A;  3MKD A;  2B76 A;  3IEE A;  2ACX A;  5LBQ B;  3CK6 A;  1IJ5 A;  3ZPO A;  3O1H A;  3MZK B;  1XZY A;  4UF0 A;  3ZEF B;  3LDQ B;  4ZS2 A;  2XM2 A;  2VQE T;  5KMG P;  4TNW A;  2EHO B;  4WW0 A;  1KNP A;  3UU4 A;  5LG3 A;  5LHH B;  1XMO T;  3PDY A;  4ZI3 C;  5IUX A;  5CGM A;  4YJ2 E;  4DV2 T;  3L3P A;  3O1I A;  4O4J E;  5EK3 A;  4ZZC A;  3EAB A;  3AE8 A;  5LMN T;  2OA5 A;  2MOZ A;  4YT0 A;  4DV1 T;  1XWM A;  3W15 B;  5FMN A;  4DV3 T;  3P4S A;  5LXT E;  5FY7 A;  4ZXL A;  4IDN A;  2KMF A;  4HFH A;  1YKE B;  3X1D A;  4X1Y E;  4ZI2 C;  1HNZ T;  4DV7 T;  4L5G A;  4Z91 A;  3T1Y T;  4YLH A;  5AQF B;  4X64 T;  4I43 B;  3C4Z A;  4EV6 A;  4YTM A;  4IE0 A;  2F4V T;  4XZC A;  2YIN A;  3PU3 A;  5L3E B;  5A1L A;  2A2F X;  3ZJ2 A;  3RIF A;  3UFE A;  3AA1 B;  4OK0 A;  4CXX A;  1S94 A;  4LF4 T;  4U2Y A;  4QXC B;  4UVA B;  1YQ4 A;  4DR6 T;  4K0K T;  2BVM A;  5FNV E;  5CA0 E;  2CLY C;  2JQK A;  4IHJ E;  2G0U A;  1W9R A;  4AIU A;  3RQU A;  1FMV A;  2C5I T;  3IHR A;  2IIU A;  4AKG A;  2J4G A;  5LNK A;  5JDG A;  2HN1 A;  1E1H B;  2HHH T;  4QH5 A;  3T1H T;  4B3M T;  3F31 A;  4X20 E;  2DLR A;  2CCQ A;  3GN5 B;  3PUR A;  4CI1 B;  3SS1 A;  4JI3 T;  4PJN A;  3CVR A;  3ONJ A;  4HWF A;  1YW0 A;  1MMD A;  5LYJ E;  1QSD A;  3NKZ A;  4UV8 B;  2LOP A;  3N2G E;  3E0Z A;  2VL8 A;  2VK9 A;  2YK0 A;  2VKO A;  2JQ9 A;  4AI6 A;  3ZCJ A;  3AEB A;  2VVN A;  4KHZ F;  2DWG A;  1T8B A;  3MK7 C;  5HXR A;  4HWD A;  3SWH A;  2RPA A;  2D9D A;  2BG9 E;  4WBN E;  2CWO A;  4EEB A;  3RGL A;  2X0H A;  2LE8 A;  4TN7 B;  3SFD A;  4YHJ A;  4DID B;  1W0A A;  2CHO A;  3LG7 A;  4OYK A;  4DV0 T;  3Q2M A;  4UXN B;  3KDS E;  4TWD A;  3ZT5 A;  5AQN B;  4E7Z A;  4GK5 E;  5L3G B;  1HX8 A;  1MMG A;  3I9W A;  5H6R B;  3E22 E;  2V6X A;  5L3F B;  3HKB E;  3PUS A;  1B7T A;  2XSA A;  2ZM8 A;  4KX6 A;  2MYS A;  4HE8 A;  2E9X B;  3ZLI A;  3K3Q C;  3D0T A;  4JEH B;  2IUB A;  1HCI A;  3RC3 A;  4MAL A;  2C0S A;  4X1I E;  3PU8 A;  4ZOL E;  4CZZ B;  3RIU A;  4EZH A;  3P4Q A;  4L0R A;  5TAO A;  4LF9 T;  5LMU T;  5FVK A;  2IW5 B;  4KP3 C;  3RYH E;  3UUL A;  4HFI A;  3AE4 A;  5LHI B;  2W66 A;  2DCF A;  4YY3 T;  4O4H E;  5DQW A;  3EDU A;  2E9X D;  4IDZ A;  3C50 A;  4ERR A;  5C2T A;  1N32 T;  3QB5 A;  1WFD A;  4ILU A;  2E8I A;  4I4T E;  5HEU A;  2H7V C;  3RYI E;  2BBH A;  3C4W A;  3E08 A;  4B3R T;  1E2A A;  4Q25 A;  3KVB A;  4AKR B;  1OWA A;  3I0O A;  2K5B B;  3K8P C;  5C8Y E;  3ETU A;  2AE9 A;  2X0Y A;  1M7K A;  2LHN A;  2DNX A;  4A5X A;  4U7Y A;  2Z6E A;  1JNZ A;  3VRA A;  1WYC A;  4JI5 T;  4LFB T;  4HGA A;  4U33 A;  4PFP A;  5AQU B;  4HKA A;  1O3X A;  2WU2 A;  3UQ7 A;  4LF8 T;  5JVD E;  2UXN B;  2WSS V;  5LG4 A;  2X9H A;  4PFO A;  3M3Z B;  2YU2 A;  5AQK B;  2YU1 A;  3Q5W A;  2V7M A;  2N1G A;  3G06 A;  5JRC B;  1I6Z A;  5CJ5 A;  1U5P A;  3QUJ A;  3RF1 A;  4UIG A;  3VHL A;  2XJ7 A;  4TV9 E;  3MAC A;  3AED A;  2XSB A;  3OBV E;  2WZH A;  4U72 A; 
#chains in the Genus database with same CATH homology
 1YKH B;  3IF8 B;  3LBX B;  5L3B B;  1MMN A;  2LEH A;  3UUX B;  3KV6 A;  3ZYK A;  5HWX A;  3M65 A;  5HXS A;  3S4U A;  2KWI B;  2K24 A;  1CUN A;  4NUU A;  4PW8 A;  4KMC A;  1D0X A;  2V1D B;  1LKX A;  3P8C D;  5LGU B;  3BQK A;  1FIO A;  2X67 A;  2IC9 A;  2LSJ A;  2CXD A;  3RKO A;  4O2A E;  5L2L A;  4JLE A;  4AKI A;  3FBL A;  4H9R C;  3RYF E;  2XAQ B;  3HR0 A;  2CA5 A;  3CKD A;  2KLQ A;  1UX5 A;  2W00 A;  3ZJ1 A;  5J1G A;  4ADZ A;  1Y64 B;  3JC6 C;  4G63 A;  2LSK A;  4AKL A;  3CPZ A;  2CXF A;  3OYZ A;  4IE4 A;  5JR9 C;  3CWZ B;  4H9N C;  3MXZ A;  4O4L E;  2DI4 A;  2QGS A;  4AKH A;  3N9O A;  4EYY R;  4CXW A;  3FBZ A;  4PJM A;  3FXD B;  4Z8X A;  4H9O C;  2KT9 A;  3K3O A;  3HKE E;  2XTL A;  4IGU A;  3N9P A;  1HTJ F;  5JDH A;  3ZYL A;  3GA8 A;  3PTR B;  4JEU B;  3AAI A;  2RP4 A;  1UCU A;  4PK5 A;  4AQF C;  2NTX A;  2ZM0 A;  5FXZ A;  5HAX A;  3N2O A;  2YEV C;  2J1D G;  2V7L A;  3WI3 A;  5GON E;  3PUA A;  1G8X A;  1OXZ A;  3MKD A;  3ONX A;  5HYA A;  3IEE A;  2E9X A;  5LJM A;  1LRZ A;  4F6R C;  2ACX A;  3DP7 A;  4MBQ A;  1MIY A;  1WRD A;  2KZ7 B;  4WNK A;  4EYU A;  3H37 A;  5LBQ B;  3BQL A;  1IJ5 A;  2N2N A;  3ZPO A;  1MMA A;  3MZK B;  3O1H A;  5IYZ E;  3ZN1 B;  4XAX B;  4UF0 A;  2Q9Q A;  3ZEF B;  1D1A A;  4ZS2 A;  2KWH A;  5LJN A;  1ZV4 X;  3NBX X;  5KMG P;  4E7S A;  3I1A A;  3BQI A;  4TUY E;  3VKG A;  2EHO B;  4WW0 A;  2IAK A;  4CQI A;  2A3D A;  3KV5 A;  5LA6 E;  4O8S A;  3RYC E;  3UT5 E;  1US7 B;  2HH7 A;  5H6Q B;  2VAS A;  4QX7 B;  4ZI2 D;  5LHH B;  5EZY E;  2ZMA A;  1LVK A;  3Q9D A;  3N5L A;  3PDY A;  3N9N A;  4A56 A;  1D0Z A;  4ZI3 C;  3H3A A;  5FXV A;  4P0B A;  4XBF B;  3A5X A;  1D0Y A;  4YJ2 E;  3L09 A;  4TX5 A;  5EK2 A;  2CLY B;  3L3P A;  4DVD A;  3SOL A;  3O1I A;  4O4J E;  3O9X A;  2N9D A;  2X0L B;  5EK3 A;  2WM9 A;  2V26 A;  4ASK A;  2NTY A;  4HN9 A;  5JRE A;  3GMI A;  1IJ6 A;  4P09 A;  4IE5 A;  2BVL A;  2OA5 A;  2MOZ A;  3W15 B;  2D2S A;  5FMN A;  4PAG A;  3C64 A;  5KX5 E;  2D0U A;  3AVS A;  1LVF A;  3DJB A;  1IZN B;  5FY7 A;  5LXT E;  3C51 A;  2JRK A;  3AB3 B;  2K48 A;  1WR6 A;  2KMF A;  1YKE B;  2X9W A;  2CXL A;  5L3D B;  4X1Y E;  5M4Y A;  1Z0P A;  5J2T E;  4ZI2 C;  1ZKE A;  2KND A;  3CX8 B;  3ZMV B;  3RRW A;  2X9X A;  4L5G A;  4MFR A;  4YFS A;  4MHC A;  4P0A A;  4YLH A;  4ZHQ E;  5JDQ A;  3B57 A;  2WBL A;  3NZQ A;  2HPJ A;  4I43 B;  3N9Q A;  5JR9 A;  1G73 A;  2JJ9 A;  4AXP A;  5F8P A;  3C4Z A;  1FMW A;  4IE0 A;  5HWY A;  2C5J A;  3RX6 A;  2WWU A;  3BK9 A;  1KNZ A;  5EK4 A;  3OYX A;  4XZC A;  2LSY A;  2BDE A;  2YIN A;  3PU3 A;  3J7Y q;  2Y8D A;  3O1J A;  5L3E B;  2DHR A;  4PJL A;  5A1L A;  3ETV A;  5JDM A;  5JQG E;  1QUU A;  2EHO C;  2A2F X;  4CI2 B;  4UVC B;  4N78 D;  3ZJ2 A;  1ZHC A;  3OKQ A;  4QX8 B;  3NRY A;  4HTE A;  3UFE A;  1HF8 A;  3AA1 B;  3F57 A;  4GYS A;  3QC9 A;  2V7J A;  3KVA A;  3KV4 A;  5JRC A;  1HG5 A;  2LSI A;  2A72 A;  2X68 A;  4OK0 A;  5LCY A;  4CXX A;  5J2U E;  1S94 A;  3PE0 A;  3AAA B;  3ZMZ B;  3ESL A;  2VWA A;  4QXC B;  3UUN A;  2D0T A;  4UVA B;  2BVM A;  3FB2 A;  5FNV E;  5CA0 E;  2CLY C;  3LBX A;  1EZ3 A;  5HXH A;  4QXH B;  4IHJ E;  2G0U A;  2M67 A;  2JMH A;  4OHF A;  2V7I A;  4ZI7 E;  3EUH A;  2P9B A;  1FMV A;  3P7I A;  3N2K E;  1BR4 A;  2KXP B;  2C5I T;  2LSG A;  2W63 A;  3IHR A;  4AKG A;  2JMK A;  3T8O A;  3GWH A;  5LNK A;  1NWM X;  5JDG A;  3DTO A;  3U3I A;  5AFU L;  4TV8 E;  4BAY B;  4BJM A;  2L9Q A;  3AA7 B;  1E1H B;  1VRB A;  2DWK A;  2ODU A;  4HFV A;  4GOU A;  4X1K E;  3N9M A;  2NW7 A;  3F31 A;  3LJC A;  3UTK A;  4X20 E;  4C90 A;  2DLR A;  2CCQ A;  3GN5 B;  2QA7 A;  4O4I E;  3PUR A;  3N9L A;  5LGT B;  3UUM A;  1HFA A;  3AA0 B;  3C98 B;  3F2E A;  4CI1 B;  3SS1 A;  3CQX C;  4PJN A;  3VKH A;  3TKL B;  2LOS A;  3CVR A;  4M1P A;  2ZLY A;  3FXE B;  2LJL A;  3ZC0 A;  1YW0 A;  2WMN A;  1MMD A;  5E0O A;  5JH7 E;  5LYJ E;  1QSD A;  4EZ4 A;  1MNE A;  3IBP A;  4UV8 B;  3R6N A;  2LOP A;  3ANW B;  3N2G E;  3E0Z A;  2VL8 A;  2VK9 A;  5F3J A;  2YK0 A;  4IST A;  2NOX A;  4FI5 A;  3CQC B;  2VKO A;  4DBQ A;  3O4X E;  4H9Q C;  3NZP A;  4AI6 A;  1IAP A;  1HG2 A;  4NUV A;  4UVB B;  3ZCJ A;  3V5S A;  4IE6 A;  2WMO A;  3C4X A;  2DWG A;  3MK7 C;  1MIV A;  2ODV A;  1SHZ C;  5HXR A;  5JDF A;  3ZMT B;  3SWH A;  1AJ3 A;  3ZC1 A;  1WLX A;  2WAU A;  4OFZ A;  4WBN E;  2K9A A;  3LK3 B;  1BR0 A;  3QK6 A;  2CWO A;  2W0G A;  4YJ3 E;  4L9I A;  2X66 A;  2NW8 A;  5IHY A;  2EHO A;  2PG8 A;  5FXW A;  5HXE A;  2XAH B;  2RA1 A;  3J9X 1;  2LE8 A;  1NAF A;  4TN7 B;  4IE7 A;  2ZM2 A;  1FEW A;  4IIJ E;  5CA1 E;  4YHJ A;  2XAG B;  3LG7 A;  4OYK A;  4AQG A;  1H7C A;  2L8K A;  2I59 A;  2VKD A;  3NRX A;  4KUM B;  3Q2M A;  5LHG B;  2Y48 B;  3HKC E;  2UXX B;  4UXN B;  4BA9 A;  3KIN B;  2PFV A;  4K0U A;  2W61 A;  3AVR A;  3KDS E;  3PUG A;  2B1E A;  2PJQ A;  4QXB B;  4ZS3 A;  4V1A v;  4E7Z A;  4GK5 E;  5L3G B;  5DJQ C;  2KIN B;  2MTQ A;  1HX8 A;  3WAJ A;  4ANJ A;  1D1B A;  2NWB A;  4GYR A;  1MMG A;  4AQF A;  3KBU A;  3LFM A;  3I9W A;  2CMR A;  3E22 E;  4H9P C;  5H6R B;  5L3F B;  3HKB E;  1V9D A;  3PUS A;  4UEM A;  1B7T A;  4PK4 A;  3LK2 B;  4DBR A;  3ZCI A;  2ZM8 A;  4H63 H;  3KFW X;  5DQV A;  5LOV E;  2MYS A;  3HI2 A;  2E9X B;  3CX7 B;  4HE8 A;  3ZLI A;  3K3Q C;  3D0T A;  1SA0 E;  3CQG B;  3RC8 A;  4JEH B;  4UV9 B;  2XUE A;  2IC6 A;  1HCI A;  4QKN A;  3RC3 A;  5ADX L;  3ZMS B;  4MAL A;  2C0S A;  4X1I E;  1BR1 A;  4KBM B;  4UEL A;  3PU8 A;  2ES0 A;  4ZOL E;  4UF0 B;  2Q9Q B;  4CZZ B;  1X79 A;  4CI3 B;  2SPC A;  2MBG A;  2L3L A;  2LT3 A;  3ZMU B;  4EZH A;  4DND A;  4I50 E;  3KV9 A;  3EDV A;  4WBO A;  2PBI A;  5L3C B;  2HPL A;  4L0R A;  5TAO A;  4MLK A;  3I9Y A;  2BZB A;  2V7K A;  4U74 A;  2IW5 B;  4KP3 C;  3RYH E;  3WAK A;  3UUL A;  2Y6X A;  3AAE B;  5LHI B;  4C91 A;  3R84 B;  2DCF A;  1BR2 A;  2XAS B;  2GK9 A;  4O4H E;  5DQW A;  3EDU A;  3PUQ A;  5FXX A;  4TZ4 C;  5LP6 E;  2D5U A;  2E9X D;  4IDZ A;  3C50 A;  4ERR A;  4PNI A;  3LK4 2;  1U4Q A;  3RPU A;  5ETW A;  5JDL A;  4ILU A;  2E8I A;  4I4T E;  3OJA A;  4GIW A;  2H7V C;  2XQY A;  4ZI3 D;  3RYI E;  2H3R A;  3C4W A;  3E08 A;  5CB4 E;  3K3N A;  2Q9Q D;  2XAJ B;  1KK7 A;  3KVB A;  4AKR B;  4QWN B;  1OWA A;  3I0O A;  2K5B B;  3K8P C;  5BMV E;  3ZYM A;  1MIW A;  1UX4 A;  4G2A A;  5KDM C;  5C8Y E;  3ETU A;  4EB6 E;  2X51 A;  3CX6 B;  2VKH A;  4OYJ A;  1WYB A;  4EIW A;  3CML A;  1D1C A;  4EOZ B;  2LM9 A;  4GK0 E;  2LHN A;  3Q5X A;  1T98 A;  2H7O A;  2DNX A;  2Z6E A;  2LHR A;  4FJO A;  3FHN A;  4PJJ A;  1MND A;  2VKJ A;  3RH3 A;  3AA6 B;  5LGN B;  4DMV A;  4EAH A;  5JDN A;  1WYC A;  3VU7 H;  3HL6 A;  4DO0 A;  2CM0 A;  4HGA A;  4PFP A;  2E9X C;  3HA4 A;  5DAB A;  4ISS A;  5JR9 B;  4HKA A;  3KBT A;  1VOM A;  3GN5 A;  1O3X A;  4JUY A;  2X9Y A;  5LBM A;  3MJX A;  2Q9Q C;  5JVD E;  3HKD E;  1YD8 G;  4O2B E;  2UXN B;  4QHO A;  2WSS V;  5LG4 A;  4B6X A;  2X9H A;  1S35 A;  1ZEE A;  4I55 E;  4PFO A;  2NP9 A;  2YU2 A;  5FY0 A;  3EVY A;  2YU1 A;  2JPF A;  3Q5W A;  2V7M A;  3U78 A;  4BJN A;  2CEA A;  4PK6 A;  3RRC A;  4H9S E;  2N1G A;  1HS7 A;  4EXT A;  2EHO D;  5JRC B;  3ZN0 B;  1U5P A;  2CE7 A;  3QUJ A;  3B13 A;  4DMW A;  2NW9 A;  2W62 A;  3ANW A;  2VB6 A;  4UIG A;  3VHL A;  3JC6 D;  3I0Q A;  2CWY A;  5FYM A;  5FY1 A;  5HXC A;  3V5U A;  4CXY A;  2JQQ A;  4H63 V;  4HEA A;  2C5K T;  4TV9 E;  3SRZ A;  2XHE B;  3MAC A;  5FP3 A;  4J2C A;  3OBV E;  2XAF B;  3MA9 A;  4U72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...