3MACA

Crystal structure of gp41-derived protein complexed with fab 8062
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
216
structure length
193
Chain Sequence
b'MQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILATTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLEGQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARITWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLEGQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transmembrane glycoprotein
publication title Structural Basis of HIV-1 Neutralization by Affinity Matured Fabs Directed against the Internal Trimeric Coiled-Coil of gp41.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system
total genus 96
structure length 193
sequence length 216
ec nomenclature
pdb deposition date 2010-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1860 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3macA00
3MA9A 3MACA 2CMRA
chains in the Genus database with same CATH superfamily
1W09A 2WMNA 3ZC1A 2A2FX 2C5JA 3HI2A 3KV6A 3TLVA 3O1HA 3FZKB 4EIWA 4N78D 5LJMA 2XQ6A 4JI0T 5LHIB 2W62A 2PJQA 3I1AA 4YHJA 3L8RA 3CVRA 4ADZA 5LOVE 1QSDA 4GKKT 2IC9A 2AE9A 5FXXA 3KINB 4BJNA 3ZJ1A 5LBMA 3EABA 3VRBA 3C50A 2DCFA 3ZSSA 2X9WA 3SFDA 2A72A 3R6NA 3JC6C 2NTYA 2Q9QC 4GIWA 2CXLA 1BR0A 3P4WA 4O2BE 4PAGA 3ZN0B 1U5PA 4X65T 1T8BA 2I6HA 4YJ2E 4UF0B 3IA3A 4B3ST 1Y01A 3JAFA 2B1EA 4C90A 4HGAA 5M4YA 3CIRA 4MLKA 3AAAB 4JEHB 3AE9A 1CUNA 1YXRA 2D2SA 3PUXF 5KMGP 4A98A 4AI6A 1D1AA 4YJ3E 3RYHE 4QXHB 2FBWA 4DNDA 1SA0E 4JI5T 3U78A 2E9XD 3CQCB 3PURA 2BS4A 3VHLA 1YD8G 4DIDB 1KNRA 1SHZC 4YY3T 4ZI3C 1XMOT 4HWCA 2VKOA 1UCUA 3PTRB 3I0QA 3C4ZA 3PV0F 3AXJB 1WYCA 3UU3A 4L9IA 3RIAA 4H9QC 5HYAA 4LMLA 2PG8A 4TV9E 4DO0A 2HN1A 4HWHA 4DV6T 3AA1B 3ANWA 3QUJA 2I0MA 1OEDE 1HS7A 5LBQB 3EUHA 3ZC0A 5C2TA 4AKRB 3ZMSB 4H63V 3L39A 4G63A 4AKHA 2BKPA 2V5DA 2MPKA 1ZKEA 1US7B 4WNKA 4H9SE 2N1GA 2V7LA 2QGSA 1NENA 3A7MA 1W9RA 4PFPA 5AQMB 5AQVB 2LEHA 2MTQA 1M62A 3AEDA 4DMVA 2V8SV 4JEUB 3A8YC 3G06A 4IE4A 5IWAT 1MIVA 3RC3A 4TWHA 2P9BA 3LK2B 5LGNB 2XUEA 4AIUA 2CCQA 1GQEA 4EYYR 1OWAA 2C5IT 1OEDB 2LLYA 4B6XA 4QX7B 2NP9A 3SOLA 2CA5A 2X67A 1I94T 2V7MA 5ABGA 1N33T 4JI7T 2V7IA 2HH7A 2VVSA 4U33A 1Z0PA 4HFEA 4UVCB 2XQ9A 2XQ7A 1LRZA 3J7Yq 1JNRA 2W0GA 2I59A 2Z6EA 2WQYA 3MA9A 2JQHA 4DUYT 2V6YB 4NPPA 3N5LA 4YLHA 5JH7E 3IEEA 2WB5A 4TNWA 4TX5A 4DV2T 4H9NC 1T72A 1Z8UA 2UUAT 5FY0A 2WSSV 1X9BA 3UFEA 4UF0A 2VL0A 2MAWA 5JDQA 1CHUA 4JBWF 5A1LA 4H63H 3DJBA 2BS3A 5LMUT 5L4HA 4EAHA 1E7PA 3KVAA 1D1BA 3LFMA 5JDMA 2L3LA 3AE3A 3PJAA 2H89A 2LT3A 5HWYA 5EK3A 4FJOA 3H3AA 4HFDA 2KZ7B 1WLXA 4AQFC 2ACZA 4YT0A 2X51A 4B3TT 1MMDA 2ZM8A 4ZXLA 1OXZA 5HAXA 3OPCA 2UUCT 5LP6E 3GWHA 4GKJT 2Y48B 2HPJA 1J1JA 1OEDC 4DBQA 2OA5A 3B57A 3CKDA 5LHGB 4LF6T 3SWHA 1UGOA 5IHYA 5FY1A 1VOMA 3C64A 5LA6E 4LF4T 3VKHA 2E9XA 5L4EA 3UUNA 4I43B 2OV9A 1S94A 3O9XA 4O4HE 2KWHA 5AQNB 4NUVA 3RI5A 5JDFA 3HKDE 5LXTE 1XDPA 4EGWA 4YTNA 1X79A 1ZP0A 2XAJB 4O8SA 3I9YA 2FUPA 3C4WA 4DR3T 4LFCT 1FEWA 3T1HT 1LKXA 3L09A 3K3NA 3ONJA 1XNRT 1N34T 1UX5A 3C98B 4PNIA 3NRXA 3KDSE 4ILAA 3IBPA 2M6IA 5LJNA 4CN1A 3PUYF 4BJMA 5HEGA 3ZLIA 3EDUA 2JQKA 1FJGT 1IBKT 3N2OA 1HG2A 3BQIA 2CBJA 1NWMX 2QYWA 4CXYA 2FJBA 1H7CA 2FJAA 2QVAA 2YDRA 4I55E 2C5KT 1V9DA 2L9QA 3QNUA 5FY7A 2D0UA 4WW0A 1D1CA 3ZKRA 5LHHB 2MBGA 2NOXA 3RIUA 4U7YA 4IL9A 3VKGA 1G73A 2DHRA 4IL4A 4WBNE 3ZJ2A 5L3GB 2X68A 4DR7T 2BBHA 4P0BA 4IE5A 4U72A 3TLSA 4KBMB 3QK6A 2WAUA 4H9RC 2NWBA 3VR9A 2UXNB 1D0XA 4PK4A 3ZSTA 3DP7A 3M65A 3UUBA 3RLFF 4CQIA 2VL8A 2ZM0A 3UU4A 4WZXA 3LJCA 4YSYA 5DJQC 2VWAA 5CFBA 2X66A 3AE1A 4I0UA 3FZFB 2KLQA 2XZEA 2XSAA 5HWXA 3BK9A 5DQVA 3NRYA 3FB2A 4F6RC 5F5WA 4P0AA 3RRCA 5ABFB 2NW7A 3ETVA 4IE0A 3CX7B 4O2AE 4Z8XA 4QXCB 4XZCA 2WWVA 3OKQA 4PK6A 4AQYT 1YQ3A 3ETUA 2D5UA 4YHHT 3ZPOA 1WR6A 2BG9E 1XMQT 2V7KA 5AQUB 4ZI2D 1UK5A 2LKGA 4IDZA 4G2AA 3M3ZB 2H7VC 4NXMT 4BAYB 1D0ZA 3KBTA 1WCRA 4H9OC 1VCSA 1WYBA 4ZZBA 5HCJA 5H6QB 2K48A 5CA1E 4ZEYA 3AE7A 2CPTA 3PDYA 3Q5EA 2UXCT 4K0UA 5L3BB 4EV6A 2V6XA 3OBVE 4MALA 3B5MA 3CK6A 2X0LB 5AQJB 1J5ET 1KEYA 5HXSA 4B3MT 2YU1A 4L5GA 2BG9B 1XDOA 1FMWA 2XAFB 2WY2A 3OTOT 2QRXA 4DR5T 4UVAB 2VB6A 3H37A 4JV5T 3FBLA 3MXZA 3N2KE 3AA7B 2XQ4A 3TKLB 2IC6A 4KUMB 2WWUA 5FNVE 3T8OA 1BR2A 5C8YE 3AE4A 4JLEA 3PUWF 5JREA 2LSIA 3V5UA 3T1YT 3ZYLA 4KMCA 3SRZA 5C3JA 4O4IE 3EAMA 5AQSB 2JPFA 4PJMA 5ADXL 3PE0A 4DBRA 5AQQB 2X9XA 2LHRA 2V1DB 2LRLA 4DV0T 5E0OA 4XBFB 4H9PC 2VKDA 2E8IA 3MKDA 3Q5XA 2LSKA 1KFYA 3AEEA 3KV9A 5H6RB 2WDRA 3O4XE 3UUXB 1BR4A 2XAGB 3ZEFB 2E9XB 2VVNA 4TUYE 1W0AA 4LMKA 1LVFA 2DWKA 1MMGA 4JI2T 3N2GE 4OYKA 2CWYA 5HXRA 3DTOA 3RKGA 2K24A 5ABFA 1SE7A 4PJLA 4QH4A 4IDPA 3I0OA 3QC9A 3AEFA 2W66A 3LK3B 5JVDE 3AA6B 2XHEB 4UEMA 5HXCA 2KWIB 3UQ4A 3RHWA 4LF5T 3P8CD 2PBIA 3E0ZA 2N9DA 2VQFT 4GOUA 3AA0B 3AE5A 5FL0A 2W2UA 2RA1A 1ZEEA 2N2NA 1HR0T 2DL1A 4HWFA 5LMNT 1UX4A 2JMKA 3UU8A 2CE7A 2LOSA 4X66T 2M6BA 5F3JA 2KINB 1IZNB 2E5VA 2KNDA 3WAJA 3UU6A 1DU2A 4PFOA 1UUSA 3KBUA 4X1KE 2A9UA 3GMIA 1O3XA 2C0SA 2CHOA 4EYUA 3LK42 3NWIA 5FL1A 3TLTA 5F8PA 3AE2A 2WZHA 3RPUA 3D0TA 5IYZE 3C51A 1HX1B 4QKNA 3PJAJ 5JDGA 3PUQA 4ANJA 2YOEA 2CBIA 1HG5A 4JUYA 2XY8B 5ABEA 2BKOA 5AQRB 4WYVA 3Q5WA 4TWDA 1W0BA 2BG9A 4CI1B 4LF7T 1IJ6A 4U2ZA 3ZYMA 3P50A 4AQGA 3VRAA 1HF8A 2Y8DA 5HEHA 2E9XC 4C91A 4EEBA 3ZT6A 4DVDA 5AQTB 4U7IA 4DR2T 4DV4T 2YN6A 1MMNA 2JQ9A 2G0UA 3N9NA 4M1PA 4P09A 4HFVA 1E2AA 5LG3A 3ZT7A 5JRCA 4OX9T 2AXDS 3KV5A 4LMJA 2R6GF 4LF9T 2E2AA 2YK0A 5KX5E 3JCFA 5FXZA 2CLYB 4QHOA 2EHOD 3GA8A 2IW5B 3OYXA 4EZHA 2LOPA 2NW9A 5JDNA 3HL6A 5JQGE 1U4QA 4I4TE 4PW8A 3PUZF 3PUAA 2DI4A 1VCTA 3UTKA 4TV8E 1MMAA 4Q25A 1MNEA 3AEAA 3EI0A 3KFWX 2CEAA 2WU5A 5HXEA 2X9YA 3LG7A 5AQKB 1YKHB 3HA4A 4DV5T 5CA0E 2EHOB 2UXBT 3JADA 3RRWA 2XTLA 3RGLA 3RIUC 4YXDA 3EVYA 5JR9B 2KSRA 1I6ZA 3FXDB 4LFAT 3PUGA 2LSJA 1IBLT 1M7KA 3NVOA 2Y6XA 3SFEA 4XAXB 4ILCA 3RQWA 5FMNA 2SPCA 4DV7T 2LRKA 2KXPB 2WCAA 4AKIA 4FI5A 2L8KA 2XM2A 2YDQA 2ZLYA 1KK7A 2LM9A 4IREA 5J2UE 2WS3A 3ZN1B 4IDNA 2CXFA 2W00A 5IUXA 4ZOLE 2XAHB 2ODVA 2LSYA 3E22E 2J47A 2RPAA 3AECA 4JI4T 5BR8T 1HNZT 5FXVA 3RF1A 5L3FB 5ABHA 3N9LA 1IJ5A 3JC6D 2Q9QD 2ZMAA 3IF8B 2CLYC 4COFA 2K5BB 5TAOA 3RQUA 3NZQA 3O1JA 3P4SA 4AKLA 4QH5A 1XWMA 2A3DA 3KV4A 3B13A 1YQ4A 3QB5K 4I50E 5JDHA 2GK9A 1ZHCA 3AB3B 4AXPA 4KI0F 3EHZA 2HHHT 2ZM6T 4DR4T 4AKGA 4UV8B 1VRBA 4ZS3A 4OYJA 2V7JA 1QLBA 2J62A 4O4JE 5HEUA 5HEJA 4J2CA 4NUUA 1XZYA 3RKOA 1D0YA 2CMRA 3AE6A 4YSZA 2W61A 5CGMA 4ZI3D 4IDOA 4ERRA 3KVBA 3E08A 2ODUA 4PJJA 4WBOA 5L3EB 4HWIB 1NAFA 4PK5A 5HCMA 5HXHA 2VK9A 2X9HA 3LSVA 5J2TE 3CX8B 3K8PC 4UR9A 5L3DB 2PTFA 1SUMB 2YKSA 3O1IA 2YU2A 3MJXA 4IDQA 2D0TA 3CX6B 2VKJA 2WZIA 4V1Av 2PFVA 3WI3A 4KHPT 3TLUA 1IBMT 1QUUA 2XPKA 2NW8A 4O4LE 4CN6A 4U3CA 2B76A 2EHOA 4ISTA 2YDSA 5AFUL 3ZMUB 3ZMTB 4GYSA 2M67A 2UU9T 4JI1T 5JR9A 3F2EA 2XM1A 2NR4A 2VQET 5AQGB 4P1NA 2H3RA 2BBJA 2OLTA 3LDQB 3SS1A 2BKNA 2CXDA 5L2LA 5EK2A 3FXEB 2JQQA 4GYRA 2IUBA 5AQLB 3AEBA 4YFSA 3RYIE 5CJ5A 2IIUA 5GONE 3ABVA 4NIQA 3HKCE 4UELA 3PU8A 4ZS2A 2BDEA 2LKHA 5JRCB 5HEOA 4BA9A 5FP3A 5LGUB 4IIJE 2UXXB 2HPLA 1HNWT 1UURA 1WRDA 5LB7B 3ZCIA 2WMOA 2ES0A 3CQXC 4HTEA 4CXWA 2WM9A 1G8XA 4LF8T 1B7TA 4U31A 2MYSA 1YW0A 2J1DG 4UIGA 3AEGA 1WFDA 3GN5B 5LGTB 4Z91A 4IE7A 2X0YA 5AQIB 1YKEB 3PU3A 5DABA 3R84B 5AQPB 2JMHA 3I9WA 2Q9QA 2MOZA 4MBQA 4KX6A 1FIOA 2NTXA 3ZCJA 4GK0E 5L47A 2VASA 3AVSA 2IMLA 1HFAA 4X5TA 3RH3A 3ZYKA 4ZI2C 4QWNB 1HCIA 2YINA 5LNKA 3MZKB 4YTMA 2BG9C 1ZV4X 1Y64B 3ONXA 4A56A 4CN4A 5JDLA 5L3CB 4ZHQE 4F8HA 2W67A 4U74A 3NBXX 2DNXA 4TN7B 4JYAT 3Q5DA 2H88A 3RYCE 4EZ4A 3FZHB 3PUSA 2IHR1 4DR1T 4CI2B 3BQLA 2IAKA 3S4UA 4CZZB 3RX6A 2KMFA 2IDOB 4EEDA 3ZMVB 4JI3T 1ZOYA 3K3QC 5FVKA 3X1DA 2BVMA 2DWGA 2FJDA 2K3WA 2QA7A 4HN9A 3AAIA 3CWZB 5LG4A 4X1IE 4EXTA 5DQWA 5EK4A 3L3PA 3CPZA 4MHCA 3EDVA 4QXBB 3CQGB 2BVLA 4NXNT 5LYJE 2W4XA 4U2YA 3MK7C 4ISSA 3OYZA 3LBXB 4L0RA 3NZPA 3JAEA 4CI3B 3ZMZB 3FZLB 2XASB 3TLWA 2V5CA 1IAPA 2XQYA 2RP4A 2LJLA 2JRKA 5ETWA 5BMVE 2LE8A 2JJ9A 3N9PA 3K1SA 2F4VT 3IHRA 1N32T 2CWOA 3UFGA 5AQFB 4OHFA 4TZ4C 2XJ7A 4MFRA 3AVRA 3FBZA 3K3OA 5EZYE 4KP3C 4IE6A 4JI6T 1BR1A 4PJNA 5FXWA 4DV3T 4HWDA 3N9MA 3VR8A 3H3MA 3A5XA 4HE8A 3Q9DA 1HTJF 2H7OA 2W63A 2WU2A 2D9DA 1MIYA 4ILBA 3C4XA 3GN5A 3BQKA 4E7ZA 2ZM2A 4UV9B 4DUZT 2LSGA 3V5SA 3OVUA 3AXJA 1KNPA 4QH1A 2FJEA 5AQOB 3ONLC 3RYFE 4HFHA 5LCYA 2WBLA 4HEAA 5JTGA 1S35A 4X20E 2WP9A 1N36T 4A97A 3AAEB 2XSBA 4TNVA 1EZ3A 3RC8A 4EOZB 3UU5A 4HFIA 3WAKA 4A5XA 3RIFA 3FHNA 3P4QA 5KDMC 2K9AA 3P4RA 4Z90A 1XNQT 1R8IA 4DMWA 2LHNA 5FKYA 3F31A 1FMVA 3P4PA 2CHNA 4IHJE 1MIWA 3ZT5A 2CM0A 2KT9A 4OFZA 4DV1T 4EB6E 4AQFA 3UUMA 3UT5E 5J0ZA 3AE8A 3PUVF 3U3IA 4CXXA 4AISA 3NKZA 2E5LT 2WDQA 2UXDT 4K0KT 2BS2A 2VKHA 4ZZCA 4ILUA 2XQAA 4YSXA 3N9OA 3J9X1 1KF6A 3N9QA 1OEDA 3F57A 5AQHB 5KXJA 2WDVA 4IGUA 5J1GA 3VU7H 1JNZA 4IT4A 5FYMA 2XQ8A 3QB5A 2J4GA 4HKAA 4OK0A 1AJ3A 1HX8A 1L0VA 3LBXA 5FVLA 4B3RT 4LFBT 2V6YA 3UQ7A 4QX8B 2V26A 2CRBA 4YTPA 4JI8T 4TWFA 1T98A 2Q9QB 4ZI7E 2UUBT 2XQ5A 2EHOC 2YEVC 3P7IA 3HKEE 2XAQB 3W15B 4HFCA 4X64T 2JIWA 3ANWB 1J5WA 2X0HA 4GK5E 5CB4E 5JR9C 3ESLA 1T7SA 3MACA 3HKBE 2ACXA 2HN2A 3CMLA 1MNDA 2LM2A 3Q2MA 3QOFA 1WR0A 4DR6T 1E1HB 2BZBA 4HFBA 2XQ3A 4ASKA 4KHZF 4X62T 4E7SA 4UXNB 1LVKA 3HR0A 3OJAA 3FZMB 1HNXT 3UULA 1NEKA 2DLRA 2VURA 4X1YE 1KNZA 4UVBB
chains in the Genus database with same CATH topology
1UX5A 3C98B 4PNIA 2WMNA 3NRXA 1IJ6A 3KDSE 3ZC1A 3ZYMA 2A2FX 2C5JA 4AQGA 3HI2A 3KV6A 1HF8A 1YKEB 2Y8DA 3IBPA 3PU3A 5DABA 3O1HA 2E9XC 5LJNA 3R84B 4C91A 4EIWA 4BJMA 4N78D 2JMHA 3I9WA 5LJMA 4DVDA 3ZLIA 2Q9QA 3EDUA 2MOZA 5LHIB 1MMNA 2W62A 4MBQA 2PJQA 3N2OA 2G0UA 3I1AA 3N9NA 1FIOA 4M1PA 4P09A 1HG2A 4YHJA 3BQIA 4HFVA 3CVRA 4ADZA 2NTXA 3ZCJA 1NWMX 4GK0E 2VASA 3AVSA 1QSDA 5LOVE 4CXYA 1H7CA 1HFAA 5JRCA 3RH3A 3ZYKA 3KV5A 4ZI2C 4QWNB 4I55E 2C5KT 1HCIA 2YINA 5LNKA 1V9DA 2IC9A 2YK0A 3MZKB 2L9QA 5KX5E 5FY7A 1ZV4X 2D0UA 5FXXA 1Y64B 4WW0A 1D1CA 3KINB 3ONXA 4A56A 5FXZA 4BJNA 2CLYB 3ZJ1A 4QHOA 5LBMA 2EHOD 5JDLA 3C50A 3GA8A 2IW5B 5LHHB 3OYXA 5L3CB 2MBGA 2DCFA 4EZHA 2LOPA 2NW9A 2NOXA 4ZHQE 2X9WA 4U74A 2A72A 3NBXX 5JDNA 2DNXA 3R6NA 3JC6C 3VKGA 4TN7B 3HL6A 5JQGE 1U4QA 2NTYA 4I4TE 2Q9QC 1G73A 2DHRA 4GIWA 4PW8A 2CXLA 1BR0A 4EZ4A 3RYCE 3PUAA 3PUSA 2DI4A 3ZJ2A 4WBNE 5L3GB 3UTKA 4O2BE 4CI2B 2X68A 3BQLA 2IAKA 4PAGA 4TV8E 1MMAA 3S4UA 4CZZB 1MNEA 4P0BA 4IE5A 4U72A 3RX6A 2KMFA 4KBMB 3ZN0B 3QK6A 3ZMVB 1U5PA 2WAUA 4H9RC 2NWBA 3KFWX 2UXNB 2CEAA 4YJ2E 1D0XA 3K3QC 4PK4A 2BVMA 2DWGA 5HXEA 4UF0B 2QA7A 2X9YA 3DP7A 3LG7A 4HN9A 3M65A 3AAIA 3CWZB 4CQIA 2VL8A 2B1EA 1YKHB 2ZM0A 3HA4A 5LG4A 5CA0E 4X1IE 4C90A 2EHOB 3LJCA 4HGAA 4EXTA 5M4YA 4MLKA 3AAAB 5DJQC 2VWAA 5DQWA 3RRWA 5EK4A 2X66A 3L3PA 4JEHB 2KLQA 2XTLA 3CPZA 4MHCA 5HWXA 1CUNA 3BK9A 2D2SA 3EDVA 4QXBB 3CQGB 5DQVA 3NRYA 3FB2A 2BVLA 5KMGP 3EVYA 4F6RC 4AI6A 5JR9B 5LYJE 3RRCA 4P0AA 1D1AA 2NW7A 3ETVA 4IE0A 3FXDB 4YJ3E 3RYHE 3CX7B 4O2AE 3MK7C 4Z8XA 3PUGA 2LSJA 4QXHB 4DNDA 4ISSA 1SA0E 3U78A 2E9XD 3OYZA 4QXCB 3LBXB 2Y6XA 4L0RA 3CQCB 4XAXB 3PURA 3VHLA 3NZPA 4XZCA 1YD8G 1SHZC 4CI3B 5FMNA 4ZI3C 3ZMZB 2VKOA 1UCUA 2SPCA 3PTRB 2KXPB 2XASB 3OKQA 4AKIA 1IAPA 3I0QA 3C4ZA 4FI5A 2XQYA 4PK6A 2RP4A 2LJLA 3ETUA 2D5UA 2JRKA 3ZPOA 1WYCA 2L8KA 5ETWA 1WR6A 4L9IA 5BMVE 2LE8A 5HYAA 4H9QC 2PG8A 2JJ9A 2V7KA 3N9PA 4TV9E 2ZLYA 1KK7A 4ZI2D 4DO0A 4IDZA 2LM9A 5J2UE 3ZN1B 4G2AA 3IHRA 2CXFA 2W00A 2H7VC 2CWOA 4ZOLE 3AA1B 3ANWA 4BAYB 2XAHB 4OHFA 4TZ4C 3QUJA 2ODVA 1D0ZA 2LSYA 3KBTA 4MFRA 3E22E 3AVRA 3FBZA 3K3OA 4H9OC 5EZYE 5LBQB 4KP3C 1HS7A 3EUHA 5FXVA 3ZC0A 1WYBA 4IE6A 4AKRB 3ZMSB 4H63V 3N9LA 5L3FB 1IJ5A 4G63A 3JC6D 1BR1A 4PJNA 5FXWA 5H6QB 4AKHA 2K48A 2Q9QD 2ZMAA 3IF8B 3N9MA 5CA1E 2CLYC 1ZKEA 1US7B 4WNKA 2K5BB 3A5XA 4H9SE 5TAOA 2N1GA 2V7LA 2QGSA 4HE8A 3Q9DA 3PDYA 1HTJF 2H7OA 4K0UA 3NZQA 2W63A 3O1JA 5L3BB 4AKLA 3OBVE 4PFPA 4MALA 1MIYA 2A3DA 3KV4A 3B13A 2X0LB 2LEHA 2MTQA 5HXSA 4I50E 5JDHA 2GK9A 2YU1A 4L5GA 3C4XA 1ZHCA 3AB3B 4DMVA 3GN5A 3BQKA 4AXPA 4JEUB 4E7ZA 2ZM2A 4IE4A 4UV9B 1FMWA 1MIVA 3RC3A 2XAFB 2P9BA 3LK2B 5LGNB 2LSGA 3V5SA 4AKGA 4UV8B 4UVAB 2VB6A 1VRBA 2XUEA 3H37A 3FBLA 2CCQA 3MXZA 4ZS3A 4EYYR 4OYJA 3RYFE 5LCYA 2WBLA 1OWAA 3N2KE 3AA7B 2V7JA 2C5IT 4HEAA 1S35A 4X20E 4O4JE 3TKLB 4B6XA 2IC6A 4KUMB 4QX7B 4J2CA 3AAEB 2NP9A 2WWUA 4NUUA 5FNVE 3SOLA 3RKOA 1D0YA 2CMRA 2CA5A 2X67A 3T8OA 2V7MA 2W61A 2V7IA 1BR2A 4ZI3D 2HH7A 1EZ3A 1Z0PA 5C8YE 4UVCB 3RC8A 4ERRA 4EOZB 3KVBA 3E08A 4JLEA 2ODUA 3WAKA 4PJJA 1LRZA 4WBOA 5JREA 3J7Yq 3FHNA 5KDMC 2LSIA 2K9AA 3V5UA 2W0GA 5L3EB 3ZYLA 2I59A 2Z6EA 4KMCA 1NAFA 4PK5A 3SRZA 3MA9A 4O4IE 2VK9A 5HXHA 2X9HA 2JPFA 4PJMA 5ADXL 4DMWA 2LHNA 3F31A 3PE0A 4DBRA 1FMVA 2X9XA 2LHRA 2V1DB 5J2TE 3CX8B 3K8PC 4IHJE 1MIWA 3N5LA 4YLHA 5E0OA 5JH7E 2CM0A 3IEEA 5L3DB 2KT9A 4OFZA 4XBFB 3O1IA 4EB6E 4H9PC 4AQFA 3UUMA 2VKDA 3UT5E 2YU2A 2E8IA 3MKDA 4TX5A 3Q5XA 3MJXA 2LSKA 2D0TA 4H9NC 3CX6B 2VKJA 3U3IA 5FY0A 4CXXA 3KV9A 5H6RB 4V1Av 2WSSV 2PFVA 3O4XE 3UUXB 1BR4A 3WI3A 2VKHA 2XAGB 4ILUA 3ZEFB 1QUUA 3UFEA 2E9XB 4UF0A 5JDQA 2NW8A 3N9OA 3J9X1 4TUYE 5A1LA 4H63H 4O4LE 3DJBA 3N9QA 4EAHA 3F57A 3KVAA 2EHOA 1LVFA 1D1BA 4ISTA 4IGUA 5J1GA 2DWKA 3LFMA 5JDMA 1MMGA 5AFUL 3ZMUB 2L3LA 3ZMTB 3N2GE 4OYKA 3VU7H 4GYSA 2CWYA 5HXRA 2LT3A 3DTOA 2M67A 5HWYA 2K24A 5EK3A 5JR9A 5FYMA 3F2EA 4FJOA 4PJLA 3H3AA 2KZ7B 1WLXA 3I0OA 3QC9A 4AQFC 4HKAA 2H3RA 3LK3B 4OK0A 1AJ3A 1HX8A 5JVDE 3AA6B 2XHEB 3LBXA 3SS1A 2X51A 4UEMA 5HXCA 2CXDA 1MMDA 5L2LA 2KWIB 5EK2A 2ZM8A 3FXEB 3P8CD 2PBIA 3E0ZA 2JQQA 1OXZA 2N9DA 5HAXA 4QX8B 2V26A 4GYRA 5LP6E 4GOUA 3GWHA 2Y48B 2HPJA 3AA0B 2RA1A 1ZEEA 2N2NA 1UX4A 2JMKA 1T98A 4YFSA 2Q9QB 3RYIE 4ZI7E 2CE7A 2LOSA 5GONE 5F3JA 2EHOC 4DBQA 2OA5A 3B57A 2KINB 1IZNB 3CKDA 5LHGB 2YEVC 3P7IA 3SWHA 3HKEE 3HKCE 2XAQB 2KNDA 4UELA 3W15B 3WAJA 5IHYA 4PFOA 3PU8A 5FY1A 1VOMA 4ZS2A 3C64A 5LA6E 2BDEA 3KBUA 3ANWB 4X1KE 3GMIA 1O3XA 3VKHA 4GK5E 5CB4E 5JR9C 2E9XA 5JRCB 2C0SA 4EYUA 3ESLA 3LK42 3MACA 3UUNA 4I43B 4BA9A 5FP3A 5LGUB 5F8PA 4IIJE 1S94A 2UXXB 3O9XA 3HKBE 4O4HE 2KWHA 2ACXA 3RPUA 3CMLA 2HPLA 4NUVA 1MNDA 1WRDA 5JDFA 3D0TA 5IYZE 3C51A 3Q2MA 3ZCIA 2WMOA 3HKDE 5LXTE 2ES0A 1E1HB 2BZBA 3CQXC 4HTEA 4ASKA 1X79A 4QKNA 2XAJB 5JDGA 3PUQA 4CXWA 4ANJA 4O8SA 2WM9A 1G8XA 3I9YA 3C4WA 4E7SA 1HG5A 4UXNB 1LVKA 3HR0A 1B7TA 1FEWA 4JUYA 2MYSA 1YW0A 1LKXA 3OJAA 2J1DG 3UULA 3L09A 4UIGA 2DLRA 3K3NA 3Q5WA 3GN5B 5LGTB 4X1YE 4CI1B 1KNZA 4UVBB 4IE7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MA9 A;  3MAC A;  2CMR A; 
#chains in the Genus database with same CATH topology
 1W09 A;  2WMN A;  3ZC1 A;  2A2F X;  2C5J A;  3HI2 A;  3KV6 A;  3TLV A;  3O1H A;  3FZK B;  4EIW A;  4N78 D;  5LJM A;  2XQ6 A;  4JI0 T;  5LHI B;  2W62 A;  2PJQ A;  3I1A A;  4YHJ A;  3L8R A;  3CVR A;  4ADZ A;  5LOV E;  1QSD A;  4GKK T;  2IC9 A;  2AE9 A;  5FXX A;  3KIN B;  4BJN A;  3ZJ1 A;  5LBM A;  3EAB A;  3VRB A;  3C50 A;  2DCF A;  3ZSS A;  2X9W A;  3SFD A;  2A72 A;  3R6N A;  3JC6 C;  2NTY A;  2Q9Q C;  4GIW A;  2CXL A;  1BR0 A;  3P4W A;  4O2B E;  4PAG A;  3ZN0 B;  1U5P A;  4X65 T;  1T8B A;  2I6H A;  4YJ2 E;  4UF0 B;  3IA3 A;  4B3S T;  1Y01 A;  3JAF A;  2B1E A;  4C90 A;  4HGA A;  5M4Y A;  3CIR A;  4MLK A;  3AAA B;  4JEH B;  3AE9 A;  1CUN A;  1YXR A;  2D2S A;  3PUX F;  5KMG P;  4A98 A;  4AI6 A;  1D1A A;  4YJ3 E;  3RYH E;  4QXH B;  2FBW A;  4DND A;  1SA0 E;  4JI5 T;  3U78 A;  2E9X D;  3CQC B;  3PUR A;  2BS4 A;  3VHL A;  1YD8 G;  4DID B;  1KNR A;  1SHZ C;  4YY3 T;  4ZI3 C;  1XMO T;  4HWC A;  2VKO A;  1UCU A;  3PTR B;  3I0Q A;  3C4Z A;  3PV0 F;  3AXJ B;  1WYC A;  3UU3 A;  4L9I A;  3RIA A;  4H9Q C;  5HYA A;  4LML A;  2PG8 A;  4TV9 E;  4DO0 A;  2HN1 A;  4HWH A;  4DV6 T;  3AA1 B;  3ANW A;  3QUJ A;  2I0M A;  1OED E;  1HS7 A;  5LBQ B;  3EUH A;  3ZC0 A;  5C2T A;  4AKR B;  3ZMS B;  4H63 V;  3L39 A;  4G63 A;  4AKH A;  2BKP A;  2V5D A;  2MPK A;  1ZKE A;  1US7 B;  4WNK A;  4H9S E;  2N1G A;  2V7L A;  2QGS A;  1NEN A;  3A7M A;  1W9R A;  4PFP A;  5AQM B;  5AQV B;  2LEH A;  2MTQ A;  1M62 A;  3AED A;  4DMV A;  2V8S V;  4JEU B;  3A8Y C;  3G06 A;  4IE4 A;  5IWA T;  1MIV A;  3RC3 A;  4TWH A;  2P9B A;  3LK2 B;  5LGN B;  2XUE A;  4AIU A;  2CCQ A;  1GQE A;  4EYY R;  1OWA A;  2C5I T;  1OED B;  2LLY A;  4B6X A;  4QX7 B;  2NP9 A;  3SOL A;  2CA5 A;  2X67 A;  1I94 T;  2V7M A;  5ABG A;  1N33 T;  4JI7 T;  2V7I A;  2HH7 A;  2VVS A;  4U33 A;  1Z0P A;  4HFE A;  4UVC B;  2XQ9 A;  2XQ7 A;  1LRZ A;  3J7Y q;  1JNR A;  2W0G A;  2I59 A;  2Z6E A;  2WQY A;  3MA9 A;  2JQH A;  4DUY T;  2V6Y B;  4NPP A;  3N5L A;  4YLH A;  5JH7 E;  3IEE A;  2WB5 A;  4TNW A;  4TX5 A;  4DV2 T;  4H9N C;  1T72 A;  1Z8U A;  2UUA T;  5FY0 A;  2WSS V;  1X9B A;  3UFE A;  4UF0 A;  2VL0 A;  2MAW A;  5JDQ A;  1CHU A;  4JBW F;  5A1L A;  4H63 H;  3DJB A;  2BS3 A;  5LMU T;  5L4H A;  4EAH A;  1E7P A;  3KVA A;  1D1B A;  3LFM A;  5JDM A;  2L3L A;  3AE3 A;  3PJA A;  2H89 A;  2LT3 A;  5HWY A;  5EK3 A;  4FJO A;  3H3A A;  4HFD A;  2KZ7 B;  1WLX A;  4AQF C;  2ACZ A;  4YT0 A;  2X51 A;  4B3T T;  1MMD A;  2ZM8 A;  4ZXL A;  1OXZ A;  5HAX A;  3OPC A;  2UUC T;  5LP6 E;  3GWH A;  4GKJ T;  2Y48 B;  2HPJ A;  1J1J A;  1OED C;  4DBQ A;  2OA5 A;  3B57 A;  3CKD A;  5LHG B;  4LF6 T;  3SWH A;  1UGO A;  5IHY A;  5FY1 A;  1VOM A;  3C64 A;  5LA6 E;  4LF4 T;  3VKH A;  2E9X A;  5L4E A;  3UUN A;  4I43 B;  2OV9 A;  1S94 A;  3O9X A;  4O4H E;  2KWH A;  5AQN B;  4NUV A;  3RI5 A;  5JDF A;  3HKD E;  5LXT E;  1XDP A;  4EGW A;  4YTN A;  1X79 A;  1ZP0 A;  2XAJ B;  4O8S A;  3I9Y A;  2FUP A;  3C4W A;  4DR3 T;  4LFC T;  1FEW A;  3T1H T;  1LKX A;  3L09 A;  3K3N A;  3ONJ A;  1XNR T;  1N34 T;  1UX5 A;  3C98 B;  4PNI A;  3NRX A;  3KDS E;  4ILA A;  3IBP A;  2M6I A;  5LJN A;  4CN1 A;  3PUY F;  4BJM A;  5HEG A;  3ZLI A;  3EDU A;  2JQK A;  1FJG T;  1IBK T;  3N2O A;  1HG2 A;  3BQI A;  2CBJ A;  1NWM X;  2QYW A;  4CXY A;  2FJB A;  1H7C A;  2FJA A;  2QVA A;  2YDR A;  4I55 E;  2C5K T;  1V9D A;  2L9Q A;  3QNU A;  5FY7 A;  2D0U A;  4WW0 A;  1D1C A;  3ZKR A;  5LHH B;  2MBG A;  2NOX A;  3RIU A;  4U7Y A;  4IL9 A;  3VKG A;  1G73 A;  2DHR A;  4IL4 A;  4WBN E;  3ZJ2 A;  5L3G B;  2X68 A;  4DR7 T;  2BBH A;  4P0B A;  4IE5 A;  4U72 A;  3TLS A;  4KBM B;  3QK6 A;  2WAU A;  4H9R C;  2NWB A;  3VR9 A;  2UXN B;  1D0X A;  4PK4 A;  3ZST A;  3DP7 A;  3M65 A;  3UUB A;  3RLF F;  4CQI A;  2VL8 A;  2ZM0 A;  3UU4 A;  4WZX A;  3LJC A;  4YSY A;  5DJQ C;  2VWA A;  5CFB A;  2X66 A;  3AE1 A;  4I0U A;  3FZF B;  2KLQ A;  2XZE A;  2XSA A;  5HWX A;  3BK9 A;  5DQV A;  3NRY A;  3FB2 A;  4F6R C;  5F5W A;  4P0A A;  3RRC A;  5ABF B;  2NW7 A;  3ETV A;  4IE0 A;  3CX7 B;  4O2A E;  4Z8X A;  4QXC B;  4XZC A;  2WWV A;  3OKQ A;  4PK6 A;  4AQY T;  1YQ3 A;  3ETU A;  2D5U A;  4YHH T;  3ZPO A;  1WR6 A;  2BG9 E;  1XMQ T;  2V7K A;  5AQU B;  4ZI2 D;  1UK5 A;  2LKG A;  4IDZ A;  4G2A A;  3M3Z B;  2H7V C;  4NXM T;  4BAY B;  1D0Z A;  3KBT A;  1WCR A;  4H9O C;  1VCS A;  1WYB A;  4ZZB A;  5HCJ A;  5H6Q B;  2K48 A;  5CA1 E;  4ZEY A;  3AE7 A;  2CPT A;  3PDY A;  3Q5E A;  2UXC T;  4K0U A;  5L3B B;  4EV6 A;  2V6X A;  3OBV E;  4MAL A;  3B5M A;  3CK6 A;  2X0L B;  5AQJ B;  1J5E T;  1KEY A;  5HXS A;  4B3M T;  2YU1 A;  4L5G A;  2BG9 B;  1XDO A;  1FMW A;  2XAF B;  2WY2 A;  3OTO T;  2QRX A;  4DR5 T;  4UVA B;  2VB6 A;  3H37 A;  4JV5 T;  3FBL A;  3MXZ A;  3N2K E;  3AA7 B;  2XQ4 A;  3TKL B;  2IC6 A;  4KUM B;  2WWU A;  5FNV E;  3T8O A;  1BR2 A;  5C8Y E;  3AE4 A;  4JLE A;  3PUW F;  5JRE A;  2LSI A;  3V5U A;  3T1Y T;  3ZYL A;  4KMC A;  3SRZ A;  5C3J A;  4O4I E;  3EAM A;  5AQS B;  2JPF A;  4PJM A;  5ADX L;  3PE0 A;  4DBR A;  5AQQ B;  2X9X A;  2LHR A;  2V1D B;  2LRL A;  4DV0 T;  5E0O A;  4XBF B;  4H9P C;  2VKD A;  2E8I A;  3MKD A;  3Q5X A;  2LSK A;  1KFY A;  3AEE A;  3KV9 A;  5H6R B;  2WDR A;  3O4X E;  3UUX B;  1BR4 A;  2XAG B;  3ZEF B;  2E9X B;  2VVN A;  4TUY E;  1W0A A;  4LMK A;  1LVF A;  2DWK A;  1MMG A;  4JI2 T;  3N2G E;  4OYK A;  2CWY A;  5HXR A;  3DTO A;  3RKG A;  2K24 A;  5ABF A;  1SE7 A;  4PJL A;  4QH4 A;  4IDP A;  3I0O A;  3QC9 A;  3AEF A;  2W66 A;  3LK3 B;  5JVD E;  3AA6 B;  2XHE B;  4UEM A;  5HXC A;  2KWI B;  3UQ4 A;  3RHW A;  4LF5 T;  3P8C D;  2PBI A;  3E0Z A;  2N9D A;  2VQF T;  4GOU A;  3AA0 B;  3AE5 A;  5FL0 A;  2W2U A;  2RA1 A;  1ZEE A;  2N2N A;  1HR0 T;  2DL1 A;  4HWF A;  5LMN T;  1UX4 A;  2JMK A;  3UU8 A;  2CE7 A;  2LOS A;  4X66 T;  2M6B A;  5F3J A;  2KIN B;  1IZN B;  2E5V A;  2KND A;  3WAJ A;  3UU6 A;  1DU2 A;  4PFO A;  1UUS A;  3KBU A;  4X1K E;  2A9U A;  3GMI A;  1O3X A;  2C0S A;  2CHO A;  4EYU A;  3LK4 2;  3NWI A;  5FL1 A;  3TLT A;  5F8P A;  3AE2 A;  2WZH A;  3RPU A;  3D0T A;  5IYZ E;  3C51 A;  1HX1 B;  4QKN A;  3PJA J;  5JDG A;  3PUQ A;  4ANJ A;  2YOE A;  2CBI A;  1HG5 A;  4JUY A;  2XY8 B;  5ABE A;  2BKO A;  5AQR B;  4WYV A;  3Q5W A;  4TWD A;  1W0B A;  2BG9 A;  4CI1 B;  4LF7 T;  1IJ6 A;  4U2Z A;  3ZYM A;  3P50 A;  4AQG A;  3VRA A;  1HF8 A;  2Y8D A;  5HEH A;  2E9X C;  4C91 A;  4EEB A;  3ZT6 A;  4DVD A;  5AQT B;  4U7I A;  4DR2 T;  4DV4 T;  2YN6 A;  1MMN A;  2JQ9 A;  2G0U A;  3N9N A;  4M1P A;  4P09 A;  4HFV A;  1E2A A;  5LG3 A;  3ZT7 A;  5JRC A;  4OX9 T;  2AXD S;  3KV5 A;  4LMJ A;  2R6G F;  4LF9 T;  2E2A A;  2YK0 A;  5KX5 E;  3JCF A;  5FXZ A;  2CLY B;  4QHO A;  2EHO D;  3GA8 A;  2IW5 B;  3OYX A;  4EZH A;  2LOP A;  2NW9 A;  5JDN A;  3HL6 A;  5JQG E;  1U4Q A;  4I4T E;  4PW8 A;  3PUZ F;  3PUA A;  2DI4 A;  1VCT A;  3UTK A;  4TV8 E;  1MMA A;  4Q25 A;  1MNE A;  3AEA A;  3EI0 A;  3KFW X;  2CEA A;  2WU5 A;  5HXE A;  2X9Y A;  3LG7 A;  5AQK B;  1YKH B;  3HA4 A;  4DV5 T;  5CA0 E;  2EHO B;  2UXB T;  3JAD A;  3RRW A;  2XTL A;  3RGL A;  3RIU C;  4YXD A;  3EVY A;  5JR9 B;  2KSR A;  1I6Z A;  3FXD B;  4LFA T;  3PUG A;  2LSJ A;  1IBL T;  1M7K A;  3NVO A;  2Y6X A;  3SFE A;  4XAX B;  4ILC A;  3RQW A;  5FMN A;  2SPC A;  4DV7 T;  2LRK A;  2KXP B;  2WCA A;  4AKI A;  4FI5 A;  2L8K A;  2XM2 A;  2YDQ A;  2ZLY A;  1KK7 A;  2LM9 A;  4IRE A;  5J2U E;  2WS3 A;  3ZN1 B;  4IDN A;  2CXF A;  2W00 A;  5IUX A;  4ZOL E;  2XAH B;  2ODV A;  2LSY A;  3E22 E;  2J47 A;  2RPA A;  3AEC A;  4JI4 T;  5BR8 T;  1HNZ T;  5FXV A;  3RF1 A;  5L3F B;  5ABH A;  3N9L A;  1IJ5 A;  3JC6 D;  2Q9Q D;  2ZMA A;  3IF8 B;  2CLY C;  4COF A;  2K5B B;  5TAO A;  3RQU A;  3NZQ A;  3O1J A;  3P4S A;  4AKL A;  4QH5 A;  1XWM A;  2A3D A;  3KV4 A;  3B13 A;  1YQ4 A;  3QB5 K;  4I50 E;  5JDH A;  2GK9 A;  1ZHC A;  3AB3 B;  4AXP A;  4KI0 F;  3EHZ A;  2HHH T;  2ZM6 T;  4DR4 T;  4AKG A;  4UV8 B;  1VRB A;  4ZS3 A;  4OYJ A;  2V7J A;  1QLB A;  2J62 A;  4O4J E;  5HEU A;  5HEJ A;  4J2C A;  4NUU A;  1XZY A;  3RKO A;  1D0Y A;  2CMR A;  3AE6 A;  4YSZ A;  2W61 A;  5CGM A;  4ZI3 D;  4IDO A;  4ERR A;  3KVB A;  3E08 A;  2ODU A;  4PJJ A;  4WBO A;  5L3E B;  4HWI B;  1NAF A;  4PK5 A;  5HCM A;  5HXH A;  2VK9 A;  2X9H A;  3LSV A;  5J2T E;  3CX8 B;  3K8P C;  4UR9 A;  5L3D B;  2PTF A;  1SUM B;  2YKS A;  3O1I A;  2YU2 A;  3MJX A;  4IDQ A;  2D0T A;  3CX6 B;  2VKJ A;  2WZI A;  4V1A v;  2PFV A;  3WI3 A;  4KHP T;  3TLU A;  1IBM T;  1QUU A;  2XPK A;  2NW8 A;  4O4L E;  4CN6 A;  4U3C A;  2B76 A;  2EHO A;  4IST A;  2YDS A;  5AFU L;  3ZMU B;  3ZMT B;  4GYS A;  2M67 A;  2UU9 T;  4JI1 T;  5JR9 A;  3F2E A;  2XM1 A;  2NR4 A;  2VQE T;  5AQG B;  4P1N A;  2H3R A;  2BBJ A;  2OLT A;  3LDQ B;  3SS1 A;  2BKN A;  2CXD A;  5L2L A;  5EK2 A;  3FXE B;  2JQQ A;  4GYR A;  2IUB A;  5AQL B;  3AEB A;  4YFS A;  3RYI E;  5CJ5 A;  2IIU A;  5GON E;  3ABV A;  4NIQ A;  3HKC E;  4UEL A;  3PU8 A;  4ZS2 A;  2BDE A;  2LKH A;  5JRC B;  5HEO A;  4BA9 A;  5FP3 A;  5LGU B;  4IIJ E;  2UXX B;  2HPL A;  1HNW T;  1UUR A;  1WRD A;  5LB7 B;  3ZCI A;  2WMO A;  2ES0 A;  3CQX C;  4HTE A;  4CXW A;  2WM9 A;  1G8X A;  4LF8 T;  1B7T A;  4U31 A;  2MYS A;  1YW0 A;  2J1D G;  4UIG A;  3AEG A;  1WFD A;  3GN5 B;  5LGT B;  4Z91 A;  4IE7 A;  2X0Y A;  5AQI B;  1YKE B;  3PU3 A;  5DAB A;  3R84 B;  5AQP B;  2JMH A;  3I9W A;  2Q9Q A;  2MOZ A;  4MBQ A;  4KX6 A;  1FIO A;  2NTX A;  3ZCJ A;  4GK0 E;  5L47 A;  2VAS A;  3AVS A;  2IML A;  1HFA A;  4X5T A;  3RH3 A;  3ZYK A;  4ZI2 C;  4QWN B;  1HCI A;  2YIN A;  5LNK A;  3MZK B;  4YTM A;  2BG9 C;  1ZV4 X;  1Y64 B;  3ONX A;  4A56 A;  4CN4 A;  5JDL A;  5L3C B;  4ZHQ E;  4F8H A;  2W67 A;  4U74 A;  3NBX X;  2DNX A;  4TN7 B;  4JYA T;  3Q5D A;  2H88 A;  3RYC E;  4EZ4 A;  3FZH B;  3PUS A;  2IHR 1;  4DR1 T;  4CI2 B;  3BQL A;  2IAK A;  3S4U A;  4CZZ B;  3RX6 A;  2KMF A;  2IDO B;  4EED A;  3ZMV B;  4JI3 T;  1ZOY A;  3K3Q C;  5FVK A;  3X1D A;  2BVM A;  2DWG A;  2FJD A;  2K3W A;  2QA7 A;  4HN9 A;  3AAI A;  3CWZ B;  5LG4 A;  4X1I E;  4EXT A;  5DQW A;  5EK4 A;  3L3P A;  3CPZ A;  4MHC A;  3EDV A;  4QXB B;  3CQG B;  2BVL A;  4NXN T;  5LYJ E;  2W4X A;  4U2Y A;  3MK7 C;  4ISS A;  3OYZ A;  3LBX B;  4L0R A;  3NZP A;  3JAE A;  4CI3 B;  3ZMZ B;  3FZL B;  2XAS B;  3TLW A;  2V5C A;  1IAP A;  2XQY A;  2RP4 A;  2LJL A;  2JRK A;  5ETW A;  5BMV E;  2LE8 A;  2JJ9 A;  3N9P A;  3K1S A;  2F4V T;  3IHR A;  1N32 T;  2CWO A;  3UFG A;  5AQF B;  4OHF A;  4TZ4 C;  2XJ7 A;  4MFR A;  3AVR A;  3FBZ A;  3K3O A;  5EZY E;  4KP3 C;  4IE6 A;  4JI6 T;  1BR1 A;  4PJN A;  5FXW A;  4DV3 T;  4HWD A;  3N9M A;  3VR8 A;  3H3M A;  3A5X A;  4HE8 A;  3Q9D A;  1HTJ F;  2H7O A;  2W63 A;  2WU2 A;  2D9D A;  1MIY A;  4ILB A;  3C4X A;  3GN5 A;  3BQK A;  4E7Z A;  2ZM2 A;  4UV9 B;  4DUZ T;  2LSG A;  3V5S A;  3OVU A;  3AXJ A;  1KNP A;  4QH1 A;  2FJE A;  5AQO B;  3ONL C;  3RYF E;  4HFH A;  5LCY A;  2WBL A;  4HEA A;  5JTG A;  1S35 A;  4X20 E;  2WP9 A;  1N36 T;  4A97 A;  3AAE B;  2XSB A;  4TNV A;  1EZ3 A;  3RC8 A;  4EOZ B;  3UU5 A;  4HFI A;  3WAK A;  4A5X A;  3RIF A;  3FHN A;  3P4Q A;  5KDM C;  2K9A A;  3P4R A;  4Z90 A;  1XNQ T;  1R8I A;  4DMW A;  2LHN A;  5FKY A;  3F31 A;  1FMV A;  3P4P A;  2CHN A;  4IHJ E;  1MIW A;  3ZT5 A;  2CM0 A;  2KT9 A;  4OFZ A;  4DV1 T;  4EB6 E;  4AQF A;  3UUM A;  3UT5 E;  5J0Z A;  3AE8 A;  3PUV F;  3U3I A;  4CXX A;  4AIS A;  3NKZ A;  2E5L T;  2WDQ A;  2UXD T;  4K0K T;  2BS2 A;  2VKH A;  4ZZC A;  4ILU A;  2XQA A;  4YSX A;  3N9O A;  3J9X 1;  1KF6 A;  3N9Q A;  1OED A;  3F57 A;  5AQH B;  5KXJ A;  2WDV A;  4IGU A;  5J1G A;  3VU7 H;  1JNZ A;  4IT4 A;  5FYM A;  2XQ8 A;  3QB5 A;  2J4G A;  4HKA A;  4OK0 A;  1AJ3 A;  1HX8 A;  1L0V A;  3LBX A;  5FVL A;  4B3R T;  4LFB T;  2V6Y A;  3UQ7 A;  4QX8 B;  2V26 A;  2CRB A;  4YTP A;  4JI8 T;  4TWF A;  1T98 A;  2Q9Q B;  4ZI7 E;  2UUB T;  2XQ5 A;  2EHO C;  2YEV C;  3P7I A;  3HKE E;  2XAQ B;  3W15 B;  4HFC A;  4X64 T;  2JIW A;  3ANW B;  1J5W A;  2X0H A;  4GK5 E;  5CB4 E;  5JR9 C;  3ESL A;  1T7S A;  3MAC A;  3HKB E;  2ACX A;  2HN2 A;  3CML A;  1MND A;  2LM2 A;  3Q2M A;  3QOF A;  1WR0 A;  4DR6 T;  1E1H B;  2BZB A;  4HFB A;  2XQ3 A;  4ASK A;  4KHZ F;  4X62 T;  4E7S A;  4UXN B;  1LVK A;  3HR0 A;  3OJA A;  3FZM B;  1HNX T;  3UUL A;  1NEK A;  2DLR A;  2VUR A;  4X1Y E;  1KNZ A;  4UVB B; 
#chains in the Genus database with same CATH homology
 1UX5 A;  3C98 B;  4PNI A;  2WMN A;  3NRX A;  1IJ6 A;  3KDS E;  3ZC1 A;  3ZYM A;  2A2F X;  2C5J A;  4AQG A;  3HI2 A;  3KV6 A;  1HF8 A;  1YKE B;  2Y8D A;  3IBP A;  3PU3 A;  5DAB A;  3O1H A;  2E9X C;  5LJN A;  3R84 B;  4C91 A;  4EIW A;  4BJM A;  4N78 D;  2JMH A;  3I9W A;  5LJM A;  4DVD A;  3ZLI A;  2Q9Q A;  3EDU A;  2MOZ A;  5LHI B;  1MMN A;  2W62 A;  4MBQ A;  2PJQ A;  3N2O A;  2G0U A;  3I1A A;  3N9N A;  1FIO A;  4M1P A;  4P09 A;  1HG2 A;  4YHJ A;  3BQI A;  4HFV A;  3CVR A;  4ADZ A;  2NTX A;  3ZCJ A;  1NWM X;  4GK0 E;  2VAS A;  3AVS A;  1QSD A;  5LOV E;  4CXY A;  1H7C A;  1HFA A;  5JRC A;  3RH3 A;  3ZYK A;  3KV5 A;  4ZI2 C;  4QWN B;  4I55 E;  2C5K T;  1HCI A;  2YIN A;  5LNK A;  1V9D A;  2IC9 A;  2YK0 A;  3MZK B;  2L9Q A;  5KX5 E;  5FY7 A;  1ZV4 X;  2D0U A;  5FXX A;  1Y64 B;  4WW0 A;  1D1C A;  3KIN B;  3ONX A;  4A56 A;  5FXZ A;  4BJN A;  2CLY B;  3ZJ1 A;  4QHO A;  5LBM A;  2EHO D;  5JDL A;  3C50 A;  3GA8 A;  2IW5 B;  5LHH B;  3OYX A;  5L3C B;  2MBG A;  2DCF A;  4EZH A;  2LOP A;  2NW9 A;  2NOX A;  4ZHQ E;  2X9W A;  4U74 A;  2A72 A;  3NBX X;  5JDN A;  2DNX A;  3R6N A;  3JC6 C;  3VKG A;  4TN7 B;  3HL6 A;  5JQG E;  1U4Q A;  2NTY A;  4I4T E;  2Q9Q C;  1G73 A;  2DHR A;  4GIW A;  4PW8 A;  2CXL A;  1BR0 A;  4EZ4 A;  3RYC E;  3PUA A;  3PUS A;  2DI4 A;  3ZJ2 A;  4WBN E;  5L3G B;  3UTK A;  4O2B E;  4CI2 B;  2X68 A;  3BQL A;  2IAK A;  4PAG A;  4TV8 E;  1MMA A;  3S4U A;  4CZZ B;  1MNE A;  4P0B A;  4IE5 A;  4U72 A;  3RX6 A;  2KMF A;  4KBM B;  3ZN0 B;  3QK6 A;  3ZMV B;  1U5P A;  2WAU A;  4H9R C;  2NWB A;  3KFW X;  2UXN B;  2CEA A;  4YJ2 E;  1D0X A;  3K3Q C;  4PK4 A;  2BVM A;  2DWG A;  5HXE A;  4UF0 B;  2QA7 A;  2X9Y A;  3DP7 A;  3LG7 A;  4HN9 A;  3M65 A;  3AAI A;  3CWZ B;  4CQI A;  2VL8 A;  2B1E A;  1YKH B;  2ZM0 A;  3HA4 A;  5LG4 A;  5CA0 E;  4X1I E;  4C90 A;  2EHO B;  3LJC A;  4HGA A;  4EXT A;  5M4Y A;  4MLK A;  3AAA B;  5DJQ C;  2VWA A;  5DQW A;  3RRW A;  5EK4 A;  2X66 A;  3L3P A;  4JEH B;  2KLQ A;  2XTL A;  3CPZ A;  4MHC A;  5HWX A;  1CUN A;  3BK9 A;  2D2S A;  3EDV A;  4QXB B;  3CQG B;  5DQV A;  3NRY A;  3FB2 A;  2BVL A;  5KMG P;  3EVY A;  4F6R C;  4AI6 A;  5JR9 B;  5LYJ E;  3RRC A;  4P0A A;  1D1A A;  2NW7 A;  3ETV A;  4IE0 A;  3FXD B;  4YJ3 E;  3RYH E;  3CX7 B;  4O2A E;  3MK7 C;  4Z8X A;  3PUG A;  2LSJ A;  4QXH B;  4DND A;  4ISS A;  1SA0 E;  3U78 A;  2E9X D;  3OYZ A;  4QXC B;  3LBX B;  2Y6X A;  4L0R A;  3CQC B;  4XAX B;  3PUR A;  3VHL A;  3NZP A;  4XZC A;  1YD8 G;  1SHZ C;  4CI3 B;  5FMN A;  4ZI3 C;  3ZMZ B;  2VKO A;  1UCU A;  2SPC A;  3PTR B;  2KXP B;  2XAS B;  3OKQ A;  4AKI A;  1IAP A;  3I0Q A;  3C4Z A;  4FI5 A;  2XQY A;  4PK6 A;  2RP4 A;  2LJL A;  3ETU A;  2D5U A;  2JRK A;  3ZPO A;  1WYC A;  2L8K A;  5ETW A;  1WR6 A;  4L9I A;  5BMV E;  2LE8 A;  5HYA A;  4H9Q C;  2PG8 A;  2JJ9 A;  2V7K A;  3N9P A;  4TV9 E;  2ZLY A;  1KK7 A;  4ZI2 D;  4DO0 A;  4IDZ A;  2LM9 A;  5J2U E;  3ZN1 B;  4G2A A;  3IHR A;  2CXF A;  2W00 A;  2H7V C;  2CWO A;  4ZOL E;  3AA1 B;  3ANW A;  4BAY B;  2XAH B;  4OHF A;  4TZ4 C;  3QUJ A;  2ODV A;  1D0Z A;  2LSY A;  3KBT A;  4MFR A;  3E22 E;  3AVR A;  3FBZ A;  3K3O A;  4H9O C;  5EZY E;  5LBQ B;  4KP3 C;  1HS7 A;  3EUH A;  5FXV A;  3ZC0 A;  1WYB A;  4IE6 A;  4AKR B;  3ZMS B;  4H63 V;  3N9L A;  5L3F B;  1IJ5 A;  4G63 A;  3JC6 D;  1BR1 A;  4PJN A;  5FXW A;  5H6Q B;  4AKH A;  2K48 A;  2Q9Q D;  2ZMA A;  3IF8 B;  3N9M A;  5CA1 E;  2CLY C;  1ZKE A;  1US7 B;  4WNK A;  2K5B B;  3A5X A;  4H9S E;  5TAO A;  2N1G A;  2V7L A;  2QGS A;  4HE8 A;  3Q9D A;  3PDY A;  1HTJ F;  2H7O A;  4K0U A;  3NZQ A;  2W63 A;  3O1J A;  5L3B B;  4AKL A;  3OBV E;  4PFP A;  4MAL A;  1MIY A;  2A3D A;  3KV4 A;  3B13 A;  2X0L B;  2LEH A;  2MTQ A;  5HXS A;  4I50 E;  5JDH A;  2GK9 A;  2YU1 A;  4L5G A;  3C4X A;  1ZHC A;  3AB3 B;  4DMV A;  3GN5 A;  3BQK A;  4AXP A;  4JEU B;  4E7Z A;  2ZM2 A;  4IE4 A;  4UV9 B;  1FMW A;  1MIV A;  3RC3 A;  2XAF B;  2P9B A;  3LK2 B;  5LGN B;  2LSG A;  3V5S A;  4AKG A;  4UV8 B;  4UVA B;  2VB6 A;  1VRB A;  2XUE A;  3H37 A;  3FBL A;  2CCQ A;  3MXZ A;  4ZS3 A;  4EYY R;  4OYJ A;  3RYF E;  5LCY A;  2WBL A;  1OWA A;  3N2K E;  3AA7 B;  2V7J A;  2C5I T;  4HEA A;  1S35 A;  4X20 E;  4O4J E;  3TKL B;  4B6X A;  2IC6 A;  4KUM B;  4QX7 B;  4J2C A;  3AAE B;  2NP9 A;  2WWU A;  4NUU A;  5FNV E;  3SOL A;  3RKO A;  1D0Y A;  2CMR A;  2CA5 A;  2X67 A;  3T8O A;  2V7M A;  2W61 A;  2V7I A;  1BR2 A;  4ZI3 D;  2HH7 A;  1EZ3 A;  1Z0P A;  5C8Y E;  4UVC B;  3RC8 A;  4ERR A;  4EOZ B;  3KVB A;  3E08 A;  4JLE A;  2ODU A;  3WAK A;  4PJJ A;  1LRZ A;  4WBO A;  5JRE A;  3J7Y q;  3FHN A;  5KDM C;  2LSI A;  2K9A A;  3V5U A;  2W0G A;  5L3E B;  3ZYL A;  2I59 A;  2Z6E A;  4KMC A;  1NAF A;  4PK5 A;  3SRZ A;  3MA9 A;  4O4I E;  2VK9 A;  5HXH A;  2X9H A;  2JPF A;  4PJM A;  5ADX L;  4DMW A;  2LHN A;  3F31 A;  3PE0 A;  4DBR A;  1FMV A;  2X9X A;  2LHR A;  2V1D B;  5J2T E;  3CX8 B;  3K8P C;  4IHJ E;  1MIW A;  3N5L A;  4YLH A;  5E0O A;  5JH7 E;  2CM0 A;  3IEE A;  5L3D B;  2KT9 A;  4OFZ A;  4XBF B;  3O1I A;  4EB6 E;  4H9P C;  4AQF A;  3UUM A;  2VKD A;  3UT5 E;  2YU2 A;  2E8I A;  3MKD A;  4TX5 A;  3Q5X A;  3MJX A;  2LSK A;  2D0T A;  4H9N C;  3CX6 B;  2VKJ A;  3U3I A;  5FY0 A;  4CXX A;  3KV9 A;  5H6R B;  4V1A v;  2WSS V;  2PFV A;  3O4X E;  3UUX B;  1BR4 A;  3WI3 A;  2VKH A;  2XAG B;  4ILU A;  3ZEF B;  1QUU A;  3UFE A;  2E9X B;  4UF0 A;  5JDQ A;  2NW8 A;  3N9O A;  3J9X 1;  4TUY E;  5A1L A;  4H63 H;  4O4L E;  3DJB A;  3N9Q A;  4EAH A;  3F57 A;  3KVA A;  2EHO A;  1LVF A;  1D1B A;  4IST A;  4IGU A;  5J1G A;  2DWK A;  3LFM A;  5JDM A;  1MMG A;  5AFU L;  3ZMU B;  2L3L A;  3ZMT B;  3N2G E;  4OYK A;  3VU7 H;  4GYS A;  2CWY A;  5HXR A;  2LT3 A;  3DTO A;  2M67 A;  5HWY A;  2K24 A;  5EK3 A;  5JR9 A;  5FYM A;  3F2E A;  4FJO A;  4PJL A;  3H3A A;  2KZ7 B;  1WLX A;  3I0O A;  3QC9 A;  4AQF C;  4HKA A;  2H3R A;  3LK3 B;  4OK0 A;  1AJ3 A;  1HX8 A;  5JVD E;  3AA6 B;  2XHE B;  3LBX A;  3SS1 A;  2X51 A;  4UEM A;  5HXC A;  2CXD A;  1MMD A;  5L2L A;  2KWI B;  5EK2 A;  2ZM8 A;  3FXE B;  3P8C D;  2PBI A;  3E0Z A;  2JQQ A;  1OXZ A;  2N9D A;  5HAX A;  4QX8 B;  2V26 A;  4GYR A;  5LP6 E;  4GOU A;  3GWH A;  2Y48 B;  2HPJ A;  3AA0 B;  2RA1 A;  1ZEE A;  2N2N A;  1UX4 A;  2JMK A;  1T98 A;  4YFS A;  2Q9Q B;  3RYI E;  4ZI7 E;  2CE7 A;  2LOS A;  5GON E;  5F3J A;  2EHO C;  4DBQ A;  2OA5 A;  3B57 A;  2KIN B;  1IZN B;  3CKD A;  5LHG B;  2YEV C;  3P7I A;  3SWH A;  3HKE E;  3HKC E;  2XAQ B;  2KND A;  4UEL A;  3W15 B;  3WAJ A;  5IHY A;  4PFO A;  3PU8 A;  5FY1 A;  1VOM A;  4ZS2 A;  3C64 A;  5LA6 E;  2BDE A;  3KBU A;  3ANW B;  4X1K E;  3GMI A;  1O3X A;  3VKH A;  4GK5 E;  5CB4 E;  5JR9 C;  2E9X A;  5JRC B;  2C0S A;  4EYU A;  3ESL A;  3LK4 2;  3MAC A;  3UUN A;  4I43 B;  4BA9 A;  5FP3 A;  5LGU B;  5F8P A;  4IIJ E;  1S94 A;  2UXX B;  3O9X A;  3HKB E;  4O4H E;  2KWH A;  2ACX A;  3RPU A;  3CML A;  2HPL A;  4NUV A;  1MND A;  1WRD A;  5JDF A;  3D0T A;  5IYZ E;  3C51 A;  3Q2M A;  3ZCI A;  2WMO A;  3HKD E;  5LXT E;  2ES0 A;  1E1H B;  2BZB A;  3CQX C;  4HTE A;  4ASK A;  1X79 A;  4QKN A;  2XAJ B;  5JDG A;  3PUQ A;  4CXW A;  4ANJ A;  4O8S A;  2WM9 A;  1G8X A;  3I9Y A;  3C4W A;  4E7S A;  1HG5 A;  4UXN B;  1LVK A;  3HR0 A;  1B7T A;  1FEW A;  4JUY A;  2MYS A;  1YW0 A;  1LKX A;  3OJA A;  2J1D G;  3UUL A;  3L09 A;  4UIG A;  2DLR A;  3K3N A;  3Q5W A;  3GN5 B;  5LGT B;  4X1Y E;  4CI1 B;  1KNZ A;  4UVB B;  4IE7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...