3MACA

Crystal structure of gp41-derived protein complexed with fab 8062
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
216
structure length
193
Chain Sequence
MQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILATTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLEGQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARITWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLEGQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transmembrane glycoprotein
publication title Structural Basis of HIV-1 Neutralization by Affinity Matured Fabs Directed against the Internal Trimeric Coiled-Coil of gp41.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system
total genus 96
structure length 193
sequence length 216
ec nomenclature
pdb deposition date 2010-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1860 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3macA00
3MA9A 2CMRA 3MACA
chains in the Genus database with same CATH superfamily
2BS2A 2CXDA 3OTOT 4J2CA 1Y01A 2XQ3A 3PJAA 3VU7H 4AKHA 4EEDA 4DV5T 1Y64B 2WS3A 4O4HE 4X1KE 3RYHE 5H6RB 5FVKA 4XZCA 4JI5T 5JDLA 2V7IA 2BBJA 3ZMUB 1NENA 3LDQB 5ABGA 2VKHA 4IDPA 4PW8A 4IE7A 3P4RA 4AKLA 4YJ3E 5F8PA 1KFYA 4OYKA 5HEUA 3G06A 5ABFB 3ZEFB 2V5DA 4TWHA 4P0BA 2KWHA 5FY7A 2V7KA 4U74A 4HFDA 5FXXA 2XASB 3LK3B 2XQ8A 3FXDB 5IHYA 3KVBA 3P4QA 3V5SA 4DUYT 2X9HA 2L8KA 4U72A 3PUQA 5JR9B 4UVAB 4X64T 4DR4T 2C5KT 3L09A 1D0YA 2J1DG 3JC6C 4IGUA 4E7SA 2Q9QC 4Z8XA 1HTJF 4OHFA 5E0OA 2E9XD 2WMNA 5AQSB 2XM1A 1MIVA 2AE9A 4CXYA 1E2AA 1UX5A 5CA1E 1WFDA 3U78A 5C3JA 2FJDA 3ABVA 5IUXA 2XPKA 3BQIA 3DTOA 2BG9C 2WDRA 2CLYB 5AQKB 1U4QA 4EYYR 4U2ZA 2CRBA 1CHUA 3PU8A 4JLEA 2KINB 4EZHA 4PJJA 4BJMA 2WY2A 1ZKEA 1ZV4X 2YEVC 4LMLA 4JI3T 3I0OA 2OV9A 4NIQA 2KXPB 3VR9A 3DJBA 3PUGA 4EZ4A 1N32T 3NRXA 1D1AA 2F4VT 5M4YA 2YDSA 2LOPA 5FKYA 4DR3T 4JEUB 2BS3A 4H9OC 4CXWA 4EV6A 2D0UA 4UV8B 5HEJA 4QKNA 4LF6T 3O4XE 5HCMA 4A98A 3PUAA 1US7B 2WZIA 1KNRA 3RQUA 4YT0A 4YXDA 3RQWA 3K3QC 2VURA 4H63V 5HAXA 3UTKA 3F31A 3EHZA 5AQQB 2W61A 5J2UE 4PK4A 2JQQA 1LRZA 2DNXA 2I59A 3PUZF 3AE8A 3ZJ1A 4EAHA 2XAQB 4JI2T 4NXNT 3RYIE 5LXTE 2WAUA 5LNKA 2CEAA 3N5LA 5ABEA 2UXDT 5L3DB 4X20E 3HKCE 3RC8A 4CN6A 3C51A 4CN1A 4V1Av 1BR2A 4IHJE 2LE8A 2BS4A 2XM2A 3J7Yq 4DR2T 2N9DA 4GKKT 4YTPA 4AISA 1MIYA 1W0AA 4IDNA 2Q9QA 5JDNA 4HE8A 3AEAA 5AQPB 3K1SA 4HFIA 5L3GB 2UUAT 2J47A 2QA7A 1MNEA 1SUMB 2C0SA 2H88A 4H9SE 1U5PA 3A5XA 3AVSA 3AE9A 3AEFA 3FZMB 4GKJT 1KNZA 4PJLA 1YKHB 5HEOA 1J5WA 5LHHB 3D0TA 3AEGA 4NUUA 3L39A 2QGSA 2M6BA 5ADXL 3P8CD 2LM9A 4PAGA 3N9NA 4ZS3A 3P50A 1L0VA 4DIDB 2WP9A 3VRAA 2V6YA 1R8IA 2LM2A 5BR8T 3N9PA 4LF9T 5FL0A 3QOFA 5GONE 3PE0A 4C90A 1HR0T 4DBQA 3J9X1 1XDOA 2WU2A 2WZHA 1NWMX 2DI4A 3A7MA 4IE5A 1HNXT 2D9DA 3KV5A 5JRCB 3E22E 3RIUC 4CQIA 2W2UA 4JEHB 3V5UA 1G73A 2NTYA 2B1EA 2FJAA 3FZHB 3GA8A 2LOSA 3ZN0B 2D5UA 2BDEA 3R84B 3RLFF 1UCUA 4EIWA 2LSYA 4WZXA 2MAWA 5FXZA 4COFA 3N2KE 3EDUA 5LGNB 1EZ3A 3CQCB 3MA9A 2XQAA 2V7MA 1ZHCA 1N36T 3RKGA 3I0QA 4CN4A 4HWHA 2HPJA 4YY3T 4ASKA 4IE4A 4JI1T 2UU9T 4AKRB 3NRYA 3RHWA 3IBPA 1N34T 2CWOA 2HPLA 4LF5T 2V5CA 3N9QA 2CWYA 3ONLC 2AXDS 1HG5A 2WQYA 2XSAA 5FXVA 3NZPA 5FP3A 2NR4A 2VKDA 5J2TE 1H7CA 5CGMA 3OVUA 4TN7B 2CPTA 2ACXA 4NUVA 1WR6A 4IDOA 4AKGA 4YJ2E 3N9OA 2E9XA 4JI4T 4CXXA 4ZZCA 2EHOB 3PU3A 3KV6A 2LSIA 3TLWA 4LF8T 1XMQT 1LKXA 4HWIB 4HN9A 3AEDA 5H6QB 4UF0B 2XAFB 1M62A 2MOZA 3UUMA 3LK42 2LJLA 2NW9A 2WM9A 3RKOA 3MACA 2LHNA 3OYXA 2BBHA 2LSGA 3E0ZA 1T98A 2K5BB 3FB2A 3VKHA 4IT4A 4I43B 4JUYA 4LMKA 1OEDB 1FMWA 4OK0A 4IE0A 2X9YA 5EK4A 4GK0E 3EDVA 4L9IA 4TV9E 2X9WA 3WAKA 2XQ6A 2XHEB 3RH3A 4EXTA 2PFVA 3T1HT 5AFUL 2E8IA 2CE7A 4QX7B 3KBTA 2LT3A 3C98B 1OEDE 3HR0A 2BKNA 1FMVA 4YSZA 4IIJE 4WW0A 1IBMT 3AAAB 2SPCA 4EGWA 4ZI2C 3EUHA 4AQGA 4M1PA 3PTRB 2DWGA 3CIRA 5DABA 2Z6EA 3S4UA 2RA1A 4F6RC 5JREA 3CWZB 3RIUA 3JAFA 3AE2A 5DQWA 5IYZE 2V1DB 2X0HA 5HCJA 4KUMB 4HWFA 5LG3A 4LF4T 2HH7A 5KDMC 3RC3A 5JH7E 2FJEA 4HFCA 5J0ZA 3ZJ2A 4X65T 4KP3C 3UU3A 3EAMA 5KXJA 5JR9C 5A1LA 3TLSA 4C91A 2IIUA 2JQ9A 2LKGA 4X1IE 5LHIB 4I0UA 3AEEA 1X79A 2DCFA 5LJNA 4QH1A 3SWHA 4X1YE 5LB7B 3ZMTB 3LG7A 4XAXB 2K24A 5AQVB 3LFMA 3OYZA 4UV9B 3AXJA 3IF8B 3B5MA 2CLYC 1UUSA 5AQTB 4O2AE 3Q9DA 4HTEA 4IDQA 3ONXA 3F57A 5FXWA 1G8XA 4B3TT 2P9BA 3O1JA 4ISSA 2D0TA 3CVRA 3UUXB 3ANWA 3FZFB 2Y8DA 4MLKA 1J1JA 5HXCA 3MK7C 2VVNA 2QVAA 2BVLA 3H3AA 4EB6E 1YXRA 2LKHA 2BG9B 3AAIA 5TAOA 5HXEA 2W62A 4YSXA 4ZOLE 4N78D 3TLVA 2ES0A 4KHPT 3SOLA 4QXCB 5HEGA 4YHHT 3C4WA 4JI7T 3AAEB 3O9XA 4GIWA 2BG9E 2W66A 3FBLA 2WMOA 2PG8A 3ZMVB 4X5TA 2R6GF 4BAYB 4YSYA 4ANJA 2CHNA 5LHGB 2KWIB 4UXNB 3ETVA 3Q5XA 2X67A 1JNRA 4ILBA 5LA6E 3VRBA 1BR0A 2ZMAA 4B3RT 4DV1T 2W00A 3UUBA 3ESLA 1B7TA 2LEHA 3KV4A 3R6NA 5LG4A 3OBVE 4PJMA 4DV6T 2N2NA 3ZPOA 2CMRA 2NP9A 2VQFT 4PNIA 4ZHQE 1MMDA 4KI0F 5JDMA 3N9LA 4MBQA 1VCTA 2YU1A 1IBLT 1ZEEA 5AQFB 2LSKA 5ABFA 5LMNT 2WDQA 3LBXB 2DLRA 1YD8G 3AA1B 4GOUA 2E9XC 4O2BE 3BK9A 3NZQA 2V7LA 3EABA 1CUNA 3TKLB 5C8YE 2NW8A 2CBJA 1KEYA 2XJ7A 4DV4T 2MPKA 4EOZB 2W0GA 5JR9A 4ZI3C 4B3MT 2VKJA 1N33T 3CX7B 4H63H 3H37A 5FMNA 1HNWT 4BA9A 4EEBA 2X66A 2VB6A 3C4ZA 2IUBA 3EI0A 3RRCA 3KVAA 2NTXA 2EHOD 3RRWA 3K3OA 3TLUA 4P09A 4QX8B 3OPCA 3CX8B 4UIGA 3FHNA 2NOXA 3SRZA 3RGLA 2IAKA 2YK0A 4B6XA 3CMLA 4U7IA 3AE1A 4LFAT 4ZXLA 1UGOA 3PUVF 4FI5A 3T8OA 3VKGA 2XY8B 4HFHA 5L4HA 3UQ7A 4ZZBA 3L8RA 3QC9A 5JQGE 1KK7A 3HKEE 2A2FX 1X9BA 1XNRT 3ETUA 3KV9A 4P1NA 4K0KT 2UXBT 2A9UA 1MMNA 3VR8A 4O4LE 4A56A 5KMGP 5LOVE 3GN5B 4ILCA 2FBWA 5HWXA 3KDSE 4YTMA 4IREA 2JPFA 1KF6A 1WCRA 2VK9A 3JCFA 2XQ5A 1BR4A 3KINB 1NAFA 4AQFC 3C50A 3ZC0A 3AE3A 3K8PC 4ZEYA 4G63A 3ZC1A 3FZLB 3GMIA 2LSJA 2WDVA 4JI8T 1LVKA 4EYUA 3K3NA 2MTQA 4TUYE 4Z90A 3PJAJ 2JMKA 5LGTB 3JAEA 4O4IE 2A3DA 2XQ7A 3RPUA 4OYJA 2ZM6T 3LJCA 2B76A 2K3WA 4GK5E 3ZT6A 1E7PA 1XZYA 4GYRA 2V6XA 5AQOB 3RYFE 1ZOYA 4OFZA 1HCIA 1HFAA 4ADZA 3PV0F 5AQGB 1IJ6A 2I6HA 1YKEB 1DU2A 4DV0T 2N1GA 4WBOA 1V9DA 2X0LB 3QNUA 3ZT5A 4AQYT 2IC9A 2GK9A 3B57A 3C4XA 3FXEB 3UU4A 1HS7A 4KHZF 3UU6A 2V26A 4HWDA 5FVLA 4ZS2A 3GWHA 4JI0T 2W4XA 2YDQA 2OLTA 4LF7T 4U2YA 2V8SV 5C2TA 3CX6B 5EK3A 2A72A 3UULA 3JC6D 3NWIA 2Q9QD 2VQET 3F2EA 4H9QC 2KLQA 2W67A 3UFGA 3FZKB 2VWAA 1SE7A 3Q5WA 1HNZT 2XAHB 2D2SA 2H7OA 1QLBA 4CI1B 4PFPA 2CXFA 2IHR1 2UXNB 1W09A 3CQGB 5AQJB 4OX9T 2M67A 4IDZA 5FNVE 3I9YA 2Y6XA 1XDPA 2WBLA 3IA3A 3MZKB 1J5ET 2J62A 5F5WA 1WRDA 4O4JE 3ZLIA 3ZCJA 1Z8UA 2WU5A 5CB4E 3KFWX 5DJQC 2PBIA 5AQHB 1NEKA 4DR6T 4A97A 3AECA 3ZYKA 2YDRA 1M7KA 2RPAA 2W63A 4A5XA 5JRCA 4TNWA 2HHHT 3QK6A 4PK6A 4JI6T 2E5LT 4DVDA 3RIFA 2X68A 2JQKA 4E7ZA 2MBGA 4AQFA 3HI2A 5KX5E 5AQRB 1VRBA 4QHOA 1SHZC 2UXXB 3ZMSB 4FJOA 2K48A 4F8HA 3MJXA 4HEAA 5J1GA 4LMJA 3RX6A 1XNQT 4UVBB 5ETWA 2Y48B 4X66T 4O8SA 4KBMB 5ABHA 3O1HA 3CQXC 1XMOT 2XQYA 3RIAA 4DO0A 2LHRA 3SS1A 4XBFB 3AE6A 2ODUA 3O1IA 2WCAA 2WSSV 4HFBA 4PFOA 4YTNA 2VASA 4U3CA 4L0RA 1D1BA 4HKAA 3AE5A 3FBZA 5LMUT 4QXHB 4G2AA 2CHOA 5JVDE 5LP6E 4PK5A 5AQIB 4U31A 2NWBA 4DMVA 3UQ4A 2JIWA 1MNDA 2IC6A 2IW5B 2MYSA 1UK5A 3CKDA 4LFBT 2H7VC 2ODVA 1YW0A 3ZMZB 3E08A 5CFBA 1OWAA 5HYAA 5CJ5A 3VHLA 2Q9QB 2RP4A 2H3RA 3MXZA 3BQKA 3M65A 3P4WA 5LBMA 4U7YA 2XQ9A 4QWNB 2VVSA 5JDHA 2EHOA 5L4EA 3N2GE 2WB5A 3I1AA 2CCQA 4WNKA 3EVYA 3N2OA 2YKSA 1HX8A 5HXSA 1WLXA 2X51A 4AKIA 4TV8E 4I4TE 4UF0A 2X9XA 4ZI3D 3UU8A 1JNZA 3JADA 1FIOA 4CI2B 3ZN1B 2UXCT 2ACZA 1S94A 2CM0A 4IL4A 5HWYA 2ZM8A 1FJGT 2V6YB 2C5JA 1T7SA 2WWVA 3Q5DA 2IMLA 2PJQA 4ILAA 1OEDA 3AA0B 2CA5A 5LBQB 3SFEA 2WWUA 1FEWA 1WR0A 5L2LA 2NW7A 4TWFA 3AEBA 3UT5E 3PUYF 4I50E 2M6IA 3QB5A 4DR1T 4YLHA 1MMGA 3HL6A 5FYMA 2QRXA 4MALA 1ZP0A 5JDGA 3X1DA 2L9QA 4JV5T 4DNDA 1QUUA 2BZBA 2LRKA 3CPZA 5L3EB 1SA0E 1BR1A 1YQ3A 3ZKRA 1HG2A 4QXBB 5HXHA 1MMAA 3AA6B 2FJBA 4QH4A 2XQ4A 4TZ4C 4B3ST 4JYAT 1WYCA 3T1YT 4NPPA 1T8BA 2H89A 1VOMA 2VL0A 5HEHA 5AQMB 2KNDA 4KX6A 4TNVA 5L47A 3BQLA 4HGAA 1S35A 3RYCE 2YOEA 3DP7A 5IWAT 3OKQA 2XAJB 2BKOA 4HFEA 2LRLA 2E9XB 3QUJA 5FL1A 2KSRA 4DR5T 4AIUA 2ZM0A 4TX5A 5LYJE 2ZM2A 2V7JA 3U3IA 3ZYLA 5FY0A 2C5IT 5F3JA 1QSDA 3TLTA 5L3CB 1D0XA 4IL9A 5BMVE 2DHRA 3HKDE 3ONJA 3L3PA 4KMCA 3WI3A 2KMFA 4UR9A 4DMWA 3B13A 4UVCB 3M3ZB 3P4PA 5LCYA 5CA0E 2CBIA 3PURA 4YHJA 5L3FB 2XUEA 2BG9A 4DBRA 2JQHA 1HF8A 2E5VA 3NKZA 4U33A 5DQVA 1AJ3A 1IJ5A 2HN2A 2L3LA 2JJ9A 2KZ7B 4LFCT 2XSBA 3IEEA 1KNPA 4YFSA 2UUBT 1LVFA 4JBWF 1I94T 1YQ4A 3A8YC 1I6ZA 3ZSSA 3LK2B 3ZCIA 3UUNA 2HN1A 2CXLA 4QH5A 4BJNA 4Q25A 4IE6A 3PDYA 3N9MA 5JDQA 5AQUB 1GQEA 4DV2T 2OA5A 1UX4A 4HFVA 3Q2MA 1O3XA 4HWCA 4MFRA 2FUPA 2YINA 3H3MA 4NXMT 4UEMA 4ZI2D 4K0UA 4GYSA 3AVRA 2BKPA 1WYBA 3C64A 4H9NC 3ZSTA 5EZYE 2X0YA 2IDOB 1D0ZA 3W15B 2YU2A 4L5GA 3PUSA 4PJNA 1UURA 4ILUA 2UUCT 5FY1A 4P0AA 3WAJA 3UFEA 4MHCA 3LBXA 2DL1A 1W0BA 2XTLA 3HKBE 4DV7T 3AB3B 1W9RA 3RI5A 2QYWA 2YN6A 2EHOC 3AE4A 2PTFA 5LGUB 5EK2A 3P4SA 3AE7A 3AXJB 1HX1B 3SFDA 3IHRA 2KT9A 3Q5EA 4ZI7E 2VKOA 4H9RC 3RF1A 4I55E 3CK6A 4UELA 4DV3T 3NVOA 2VL8A 1MIWA 1IAPA 5JTGA 3HA4A 2XAGB 5LJMA 2JMHA 3KBUA 5L3BB 4WBNE 2I0MA 3UU5A 4DUZT 1OEDC 3ANWB 3I9WA 4TWDA 2DWKA 1XWMA 2BVMA 4AI6A 1IBKT 2G0UA 1OXZA 2K9AA 4CZZB 4ISTA 1IZNB 3NBXX 4AXPA 4Z91A 2ZLYA 1D1CA 3PUWF 1T72A 4ERRA 1E1HB 4WYVA 5AQNB 2J4GA 3ZT7A 4H9PC 1Z0PA 2XZEA 3ZYMA 3PUXF 3AA7B 3GN5A 4X62T 1VCSA 2LLYA 5AQLB 5HXRA 3LSVA 5JDFA 3OJAA 4CI3B 3MKDA 2E2AA 2JRKA 3P7IA 3QB5K 4DR7T
chains in the Genus database with same CATH topology
2CXDA 3I0QA 2C5JA 4BA9A 4J2CA 2X66A 2HPJA 2VB6A 2PJQA 4ASKA 3C4ZA 4IE4A 3AA0B 3RRCA 3KVAA 3VU7H 4AKHA 4AKRB 2NTXA 3NRYA 2EHOD 2CA5A 3IBPA 3RRWA 1Y64B 4O4HE 3K3OA 4X1KE 5LBQB 3RYHE 2CWOA 4P09A 2HPLA 4QX8B 5H6RB 3CX8B 2WWUA 3N9QA 4UIGA 1FEWA 4XZCA 2CWYA 3FHNA 5JDLA 1HG5A 2NOXA 3SRZA 2IAKA 5FXVA 2V7IA 3ZMUB 2YK0A 4B6XA 3CMLA 5L2LA 2NW7A 3NZPA 2VKHA 5FP3A 4PW8A 4IE7A 3UT5E 4I50E 2VKDA 4FI5A 5J2TE 1H7CA 4AKLA 4YJ3E 5F8PA 3T8OA 3VKGA 4TN7B 4OYKA 2ACXA 4NUVA 3ZEFB 4YLHA 1WR6A 1MMGA 4AKGA 4YJ2E 3N9OA 2E9XA 4P0BA 3HL6A 2KWHA 5FY7A 5FYMA 3QC9A 4CXXA 2V7KA 4U74A 2EHOB 5FXXA 2XASB 5JQGE 1KK7A 3PU3A 3HKEE 3LK3B 2A2FX 3KV6A 4MALA 2LSIA 3ETUA 3FXDB 5JDGA 5IHYA 1LKXA 2L9QA 3KV9A 3KVBA 3V5SA 4DNDA 4HN9A 2X9HA 1QUUA 2L8KA 1MMNA 4U72A 5H6QB 4O4LE 4UF0B 4A56A 5LOVE 2BZBA 2XAFB 3GN5B 5KMGP 3CPZA 3PUQA 2MOZA 5L3EB 5JR9B 3UUMA 3LK42 2LJLA 5HWXA 4UVAB 1SA0E 3KDSE 1BR1A 2NW9A 2JPFA 2C5KT 2VK9A 1HG2A 3L09A 1D0YA 2J1DG 3JC6C 4IGUA 4E7SA 2WM9A 3RKOA 4QXBB 2Q9QC 3MACA 5HXHA 1MMAA 1BR4A 3AA6B 4Z8XA 2LHNA 3OYXA 1HTJF 2LSGA 3E0ZA 1NAFA 3KINB 1T98A 2K5BB 3FB2A 4AQFC 3C50A 3ZC0A 4TZ4C 3K8PC 4OHFA 3VKHA 4G63A 3ZC1A 1WYCA 5E0OA 4I43B 3GMIA 2E9XD 2WMNA 4JUYA 1FMWA 4OK0A 2LSJA 4IE0A 1MIVA 2X9YA 5EK4A 1VOMA 4CXYA 1LVKA 4GK0E 1UX5A 4EYUA 5CA1E 3U78A 3EDVA 3K3NA 4L9IA 2MTQA 4TUYE 4TV9E 2X9WA 3WAKA 2JMKA 2KNDA 2XHEB 5LGTB 3BQIA 3DTOA 3RH3A 4O4IE 2PFVA 3BQLA 4EXTA 2A3DA 4HGAA 5AFUL 2CLYB 2E8IA 3RPUA 1U4QA 4OYJA 1S35A 3RYCE 3LJCA 4GK5E 4EYYR 2CE7A 3DP7A 4QX7B 3KBTA 4GYRA 2LT3A 3OKQA 2XAJB 3C98B 3PU8A 3RYFE 3HR0A 4OFZA 1FMVA 1HCIA 1HFAA 4IIJE 2E9XB 4WW0A 3QUJA 3AAAB 4ADZA 2SPCA 4JLEA 4ZI2C 3EUHA 1IJ6A 1YKEB 4AQGA 2KINB 4M1PA 2ZM0A 4TX5A 4EZHA 5LYJE 2ZM2A 2V7JA 4PJJA 2N1GA 2DWGA 3PTRB 4BJMA 5DABA 4WBOA 1V9DA 2Z6EA 2X0LB 3S4UA 2RA1A 3U3IA 3ZYLA 4F6RC 5FY0A 1ZKEA 1ZV4X 5JREA 2C5IT 2YEVC 3CWZB 5F3JA 1QSDA 2IC9A 5L3CB 2GK9A 1D0XA 3I0OA 3B57A 3C4XA 3FXEB 5DQWA 5IYZE 5BMVE 2DHRA 2KXPB 2V1DB 3HKDE 4KUMB 3DJBA 3PUGA 3L3PA 4KMCA 4EZ4A 3WI3A 3NRXA 2KMFA 4DMWA 1HS7A 3B13A 2V26A 1D1AA 4UVCB 5M4YA 4ZS2A 5LCYA 5CA0E 3GWHA 2HH7A 5KDMC 3RC3A 5JH7E 2LOPA 3PURA 4YHJA 5L3FB 2XUEA 4JEUB 3ZJ2A 4KP3C 5JR9C 4H9OC 4CXWA 5A1LA 3CX6B 4DBRA 5EK3A 2A72A 2D0UA 4UV8B 4C91A 1HF8A 4QKNA 3UULA 3JC6D 5DQVA 1AJ3A 1IJ5A 2Q9QD 3O4XE 2L3LA 2JJ9A 3PUAA 2KZ7B 3F2EA 4H9QC 1US7B 2KLQA 4X1IE 5LHIB 3IEEA 1X79A 4YFSA 2DCFA 5LJNA 1LVFA 2VWAA 3SWHA 4X1YE 3Q5WA 3ZMTB 3K3QC 3LG7A 4H63V 4XAXB 2K24A 5HAXA 3LK2B 2XAHB 3ZCIA 3LFMA 2D2SA 3OYZA 3UTKA 3F31A 3UUNA 2H7OA 2CXLA 2W61A 4BJNA 4UV9B 4CI1B 4PK4A 2JQQA 5J2UE 4PFPA 4IE6A 2CXFA 3PDYA 3N9MA 5JDQA 3IF8B 1LRZA 2CLYC 2UXNB 3CQGB 2OA5A 2DNXA 2I59A 1UX4A 2M67A 4HFVA 4IDZA 3ZJ1A 4O2AE 5FNVE 3Q9DA 3Q2MA 4EAHA 2XAQB 4HTEA 1O3XA 3I9YA 3ONXA 3F57A 5FXWA 1G8XA 2Y6XA 3RYIE 5LXTE 2WBLA 4MFRA 2P9BA 3MZKB 2WAUA 2YINA 3O1JA 5LNKA 2CEAA 3N5LA 4ISSA 5L3DB 1WRDA 2D0TA 4O4JE 3ZLIA 3CVRA 4UEMA 3UUXB 4ZI2D 4K0UA 4GYSA 3ZCJA 3AVRA 3ANWA 1WYBA 3C64A 4X20E 4H9NC 2Y8DA 5CB4E 3KFWX 4MLKA 5DJQC 2PBIA 3HKCE 3RC8A 5HXCA 3MK7C 3C51A 5EZYE 2BVLA 3H3AA 4EB6E 3ZYKA 4V1Av 1BR2A 4IHJE 2W63A 3AAIA 2LE8A 5TAOA 5HXEA 5JRCA 2W62A 3J7Yq 3QK6A 4PK6A 1D0ZA 3W15B 2N9DA 2YU2A 4DVDA 4L5GA 3PUSA 1MIYA 4PJNA 4ZOLE 2X68A 4N78D 2Q9QA 4ILUA 5JDNA 4HE8A 2ES0A 3SOLA 5FY1A 4P0AA 4QXCB 4E7ZA 2MBGA 3WAJA 3UFEA 4AQFA 3HI2A 4MHCA 5KX5E 5L3GB 3C4WA 3LBXA 2QA7A 3AAEB 1MNEA 1VRBA 2XTLA 2C0SA 1SHZC 3AB3B 3HKBE 4QHOA 2UXXB 3ZMSB 4FJOA 4H9SE 3O9XA 2K48A 4GIWA 1U5PA 3A5XA 3AVSA 3MJXA 2EHOC 3FBLA 4HEAA 5J1GA 2WMOA 5LGUB 1KNZA 3RX6A 5EK2A 4PJLA 2PG8A 3ZMVB 1YKHB 4UVBB 5ETWA 4BAYB 2Y48B 4O8SA 4ANJA 5LHHB 3D0TA 4KBMB 3IHRA 2KT9A 4NUUA 3O1HA 4ZI7E 2VKOA 3CQXC 2KWIB 5LHGB 2QGSA 2XQYA 4H9RC 5ADXL 4UXNB 3P8CD 2LM9A 3ETVA 4I55E 4DO0A 4PAGA 3N9NA 4ZS3A 2LHRA 3Q5XA 2X67A 4UELA 3SS1A 4XBFB 2VL8A 2ODUA 3O1IA 5LA6E 1MIWA 1BR0A 2ZMAA 1IAPA 2WSSV 4PFOA 3HA4A 2VASA 2W00A 2XAGB 3ESLA 5LJMA 2JMHA 1B7TA 3N9PA 3KBUA 4L0RA 1D1BA 2LEHA 4HKAA 3KV4A 3R6NA 5LG4A 3OBVE 4PJMA 3FBZA 5L3BB 4WBNE 2N2NA 5GONE 4QXHB 3PE0A 4C90A 3ANWB 3ZPOA 4G2AA 5JVDE 2CMRA 4PK5A 5LP6E 4DBQA 3I9WA 3J9X1 2NP9A 4PNIA 2NWBA 4ZHQE 1MMDA 2DWKA 4DMVA 1NWMX 5JDMA 2DI4A 1MNDA 4IE5A 2IC6A 3N9LA 2IW5B 2BVMA 3KV5A 4MBQA 5JRCB 2YU1A 2MYSA 3E22E 3CKDA 1ZEEA 2H7VC 4AI6A 2ODVA 2G0UA 1OXZA 2K9AA 1YW0A 3ZMZB 3E08A 2LSKA 4CQIA 1OWAA 4CZZB 5HYAA 3VHLA 2Q9QB 4ISTA 2RP4A 2H3RA 3MXZA 1IZNB 4JEHB 3BQKA 3V5UA 3NBXX 3M65A 1G73A 4AXPA 2NTYA 5LBMA 2B1EA 3LBXB 2DLRA 2ZLYA 1D1CA 1YD8G 3AA1B 4GOUA 4QWNB 2E9XC 5JDHA 2EHOA 4O2BE 3N2GE 3I1AA 2CCQA 3BK9A 3EVYA 3NZQA 4WNKA 3N2OA 4ERRA 1E1HB 2V7LA 3GA8A 1HX8A 5HXSA 2LOSA 4H9PC 1WLXA 2X51A 3ZN0B 2D5UA 1CUNA 1Z0PA 4AKIA 4TV8E 3ZYMA 3TKLB 2BDEA 5C8YE 2NW8A 3AA7B 3R84B 4I4TE 4UF0A 1UCUA 3GN5A 4EIWA 2X9XA 4ZI3D 2LSYA 5FXZA 2W0GA 1FIOA 5JR9A 4EOZB 5HXRA 4CI2B 3ZN1B 5JDFA 3OJAA 1S94A 4CI3B 2CM0A 3N2KE 3MKDA 4ZI3C 3EDUA 5LGNB 1EZ3A 3CQCB 2VKJA 3MA9A 2V7MA 2JRKA 3P7IA 5HWYA 2ZM8A 1ZHCA 3CX7B 4H63H 3H37A 5FMNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MA9 A;  2CMR A;  3MAC A; 
#chains in the Genus database with same CATH topology
 2BS2 A;  2CXD A;  3OTO T;  4J2C A;  1Y01 A;  2XQ3 A;  3PJA A;  3VU7 H;  4AKH A;  4EED A;  4DV5 T;  1Y64 B;  2WS3 A;  4O4H E;  4X1K E;  3RYH E;  5H6R B;  5FVK A;  4XZC A;  4JI5 T;  5JDL A;  2V7I A;  2BBJ A;  3ZMU B;  1NEN A;  3LDQ B;  5ABG A;  2VKH A;  4IDP A;  4PW8 A;  4IE7 A;  3P4R A;  4AKL A;  4YJ3 E;  5F8P A;  1KFY A;  4OYK A;  5HEU A;  3G06 A;  5ABF B;  3ZEF B;  2V5D A;  4TWH A;  4P0B A;  2KWH A;  5FY7 A;  2V7K A;  4U74 A;  4HFD A;  5FXX A;  2XAS B;  3LK3 B;  2XQ8 A;  3FXD B;  5IHY A;  3KVB A;  3P4Q A;  3V5S A;  4DUY T;  2X9H A;  2L8K A;  4U72 A;  3PUQ A;  5JR9 B;  4UVA B;  4X64 T;  4DR4 T;  2C5K T;  3L09 A;  1D0Y A;  2J1D G;  3JC6 C;  4IGU A;  4E7S A;  2Q9Q C;  4Z8X A;  1HTJ F;  4OHF A;  5E0O A;  2E9X D;  2WMN A;  5AQS B;  2XM1 A;  1MIV A;  2AE9 A;  4CXY A;  1E2A A;  1UX5 A;  5CA1 E;  1WFD A;  3U78 A;  5C3J A;  2FJD A;  3ABV A;  5IUX A;  2XPK A;  3BQI A;  3DTO A;  2BG9 C;  2WDR A;  2CLY B;  5AQK B;  1U4Q A;  4EYY R;  4U2Z A;  2CRB A;  1CHU A;  3PU8 A;  4JLE A;  2KIN B;  4EZH A;  4PJJ A;  4BJM A;  2WY2 A;  1ZKE A;  1ZV4 X;  2YEV C;  4LML A;  4JI3 T;  3I0O A;  2OV9 A;  4NIQ A;  2KXP B;  3VR9 A;  3DJB A;  3PUG A;  4EZ4 A;  1N32 T;  3NRX A;  1D1A A;  2F4V T;  5M4Y A;  2YDS A;  2LOP A;  5FKY A;  4DR3 T;  4JEU B;  2BS3 A;  4H9O C;  4CXW A;  4EV6 A;  2D0U A;  4UV8 B;  5HEJ A;  4QKN A;  4LF6 T;  3O4X E;  5HCM A;  4A98 A;  3PUA A;  1US7 B;  2WZI A;  1KNR A;  3RQU A;  4YT0 A;  4YXD A;  3RQW A;  3K3Q C;  2VUR A;  4H63 V;  5HAX A;  3UTK A;  3F31 A;  3EHZ A;  5AQQ B;  2W61 A;  5J2U E;  4PK4 A;  2JQQ A;  1LRZ A;  2DNX A;  2I59 A;  3PUZ F;  3AE8 A;  3ZJ1 A;  4EAH A;  2XAQ B;  4JI2 T;  4NXN T;  3RYI E;  5LXT E;  2WAU A;  5LNK A;  2CEA A;  3N5L A;  5ABE A;  2UXD T;  5L3D B;  4X20 E;  3HKC E;  3RC8 A;  4CN6 A;  3C51 A;  4CN1 A;  4V1A v;  1BR2 A;  4IHJ E;  2LE8 A;  2BS4 A;  2XM2 A;  3J7Y q;  4DR2 T;  2N9D A;  4GKK T;  4YTP A;  4AIS A;  1MIY A;  1W0A A;  4IDN A;  2Q9Q A;  5JDN A;  4HE8 A;  3AEA A;  5AQP B;  3K1S A;  4HFI A;  5L3G B;  2UUA T;  2J47 A;  2QA7 A;  1MNE A;  1SUM B;  2C0S A;  2H88 A;  4H9S E;  1U5P A;  3A5X A;  3AVS A;  3AE9 A;  3AEF A;  3FZM B;  4GKJ T;  1KNZ A;  4PJL A;  1YKH B;  5HEO A;  1J5W A;  5LHH B;  3D0T A;  3AEG A;  4NUU A;  3L39 A;  2QGS A;  2M6B A;  5ADX L;  3P8C D;  2LM9 A;  4PAG A;  3N9N A;  4ZS3 A;  3P50 A;  1L0V A;  4DID B;  2WP9 A;  3VRA A;  2V6Y A;  1R8I A;  2LM2 A;  5BR8 T;  3N9P A;  4LF9 T;  5FL0 A;  3QOF A;  5GON E;  3PE0 A;  4C90 A;  1HR0 T;  4DBQ A;  3J9X 1;  1XDO A;  2WU2 A;  2WZH A;  1NWM X;  2DI4 A;  3A7M A;  4IE5 A;  1HNX T;  2D9D A;  3KV5 A;  5JRC B;  3E22 E;  3RIU C;  4CQI A;  2W2U A;  4JEH B;  3V5U A;  1G73 A;  2NTY A;  2B1E A;  2FJA A;  3FZH B;  3GA8 A;  2LOS A;  3ZN0 B;  2D5U A;  2BDE A;  3R84 B;  3RLF F;  1UCU A;  4EIW A;  2LSY A;  4WZX A;  2MAW A;  5FXZ A;  4COF A;  3N2K E;  3EDU A;  5LGN B;  1EZ3 A;  3CQC B;  3MA9 A;  2XQA A;  2V7M A;  1ZHC A;  1N36 T;  3RKG A;  3I0Q A;  4CN4 A;  4HWH A;  2HPJ A;  4YY3 T;  4ASK A;  4IE4 A;  4JI1 T;  2UU9 T;  4AKR B;  3NRY A;  3RHW A;  3IBP A;  1N34 T;  2CWO A;  2HPL A;  4LF5 T;  2V5C A;  3N9Q A;  2CWY A;  3ONL C;  2AXD S;  1HG5 A;  2WQY A;  2XSA A;  5FXV A;  3NZP A;  5FP3 A;  2NR4 A;  2VKD A;  5J2T E;  1H7C A;  5CGM A;  3OVU A;  4TN7 B;  2CPT A;  2ACX A;  4NUV A;  1WR6 A;  4IDO A;  4AKG A;  4YJ2 E;  3N9O A;  2E9X A;  4JI4 T;  4CXX A;  4ZZC A;  2EHO B;  3PU3 A;  3KV6 A;  2LSI A;  3TLW A;  4LF8 T;  1XMQ T;  1LKX A;  4HWI B;  4HN9 A;  3AED A;  5H6Q B;  4UF0 B;  2XAF B;  1M62 A;  2MOZ A;  3UUM A;  3LK4 2;  2LJL A;  2NW9 A;  2WM9 A;  3RKO A;  3MAC A;  2LHN A;  3OYX A;  2BBH A;  2LSG A;  3E0Z A;  1T98 A;  2K5B B;  3FB2 A;  3VKH A;  4IT4 A;  4I43 B;  4JUY A;  4LMK A;  1OED B;  1FMW A;  4OK0 A;  4IE0 A;  2X9Y A;  5EK4 A;  4GK0 E;  3EDV A;  4L9I A;  4TV9 E;  2X9W A;  3WAK A;  2XQ6 A;  2XHE B;  3RH3 A;  4EXT A;  2PFV A;  3T1H T;  5AFU L;  2E8I A;  2CE7 A;  4QX7 B;  3KBT A;  2LT3 A;  3C98 B;  1OED E;  3HR0 A;  2BKN A;  1FMV A;  4YSZ A;  4IIJ E;  4WW0 A;  1IBM T;  3AAA B;  2SPC A;  4EGW A;  4ZI2 C;  3EUH A;  4AQG A;  4M1P A;  3PTR B;  2DWG A;  3CIR A;  5DAB A;  2Z6E A;  3S4U A;  2RA1 A;  4F6R C;  5JRE A;  3CWZ B;  3RIU A;  3JAF A;  3AE2 A;  5DQW A;  5IYZ E;  2V1D B;  2X0H A;  5HCJ A;  4KUM B;  4HWF A;  5LG3 A;  4LF4 T;  2HH7 A;  5KDM C;  3RC3 A;  5JH7 E;  2FJE A;  4HFC A;  5J0Z A;  3ZJ2 A;  4X65 T;  4KP3 C;  3UU3 A;  3EAM A;  5KXJ A;  5JR9 C;  5A1L A;  3TLS A;  4C91 A;  2IIU A;  2JQ9 A;  2LKG A;  4X1I E;  5LHI B;  4I0U A;  3AEE A;  1X79 A;  2DCF A;  5LJN A;  4QH1 A;  3SWH A;  4X1Y E;  5LB7 B;  3ZMT B;  3LG7 A;  4XAX B;  2K24 A;  5AQV B;  3LFM A;  3OYZ A;  4UV9 B;  3AXJ A;  3IF8 B;  3B5M A;  2CLY C;  1UUS A;  5AQT B;  4O2A E;  3Q9D A;  4HTE A;  4IDQ A;  3ONX A;  3F57 A;  5FXW A;  1G8X A;  4B3T T;  2P9B A;  3O1J A;  4ISS A;  2D0T A;  3CVR A;  3UUX B;  3ANW A;  3FZF B;  2Y8D A;  4MLK A;  1J1J A;  5HXC A;  3MK7 C;  2VVN A;  2QVA A;  2BVL A;  3H3A A;  4EB6 E;  1YXR A;  2LKH A;  2BG9 B;  3AAI A;  5TAO A;  5HXE A;  2W62 A;  4YSX A;  4ZOL E;  4N78 D;  3TLV A;  2ES0 A;  4KHP T;  3SOL A;  4QXC B;  5HEG A;  4YHH T;  3C4W A;  4JI7 T;  3AAE B;  3O9X A;  4GIW A;  2BG9 E;  2W66 A;  3FBL A;  2WMO A;  2PG8 A;  3ZMV B;  4X5T A;  2R6G F;  4BAY B;  4YSY A;  4ANJ A;  2CHN A;  5LHG B;  2KWI B;  4UXN B;  3ETV A;  3Q5X A;  2X67 A;  1JNR A;  4ILB A;  5LA6 E;  3VRB A;  1BR0 A;  2ZMA A;  4B3R T;  4DV1 T;  2W00 A;  3UUB A;  3ESL A;  1B7T A;  2LEH A;  3KV4 A;  3R6N A;  5LG4 A;  3OBV E;  4PJM A;  4DV6 T;  2N2N A;  3ZPO A;  2CMR A;  2NP9 A;  2VQF T;  4PNI A;  4ZHQ E;  1MMD A;  4KI0 F;  5JDM A;  3N9L A;  4MBQ A;  1VCT A;  2YU1 A;  1IBL T;  1ZEE A;  5AQF B;  2LSK A;  5ABF A;  5LMN T;  2WDQ A;  3LBX B;  2DLR A;  1YD8 G;  3AA1 B;  4GOU A;  2E9X C;  4O2B E;  3BK9 A;  3NZQ A;  2V7L A;  3EAB A;  1CUN A;  3TKL B;  5C8Y E;  2NW8 A;  2CBJ A;  1KEY A;  2XJ7 A;  4DV4 T;  2MPK A;  4EOZ B;  2W0G A;  5JR9 A;  4ZI3 C;  4B3M T;  2VKJ A;  1N33 T;  3CX7 B;  4H63 H;  3H37 A;  5FMN A;  1HNW T;  4BA9 A;  4EEB A;  2X66 A;  2VB6 A;  3C4Z A;  2IUB A;  3EI0 A;  3RRC A;  3KVA A;  2NTX A;  2EHO D;  3RRW A;  3K3O A;  3TLU A;  4P09 A;  4QX8 B;  3OPC A;  3CX8 B;  4UIG A;  3FHN A;  2NOX A;  3SRZ A;  3RGL A;  2IAK A;  2YK0 A;  4B6X A;  3CML A;  4U7I A;  3AE1 A;  4LFA T;  4ZXL A;  1UGO A;  3PUV F;  4FI5 A;  3T8O A;  3VKG A;  2XY8 B;  4HFH A;  5L4H A;  3UQ7 A;  4ZZB A;  3L8R A;  3QC9 A;  5JQG E;  1KK7 A;  3HKE E;  2A2F X;  1X9B A;  1XNR T;  3ETU A;  3KV9 A;  4P1N A;  4K0K T;  2UXB T;  2A9U A;  1MMN A;  3VR8 A;  4O4L E;  4A56 A;  5KMG P;  5LOV E;  3GN5 B;  4ILC A;  2FBW A;  5HWX A;  3KDS E;  4YTM A;  4IRE A;  2JPF A;  1KF6 A;  1WCR A;  2VK9 A;  3JCF A;  2XQ5 A;  1BR4 A;  3KIN B;  1NAF A;  4AQF C;  3C50 A;  3ZC0 A;  3AE3 A;  3K8P C;  4ZEY A;  4G63 A;  3ZC1 A;  3FZL B;  3GMI A;  2LSJ A;  2WDV A;  4JI8 T;  1LVK A;  4EYU A;  3K3N A;  2MTQ A;  4TUY E;  4Z90 A;  3PJA J;  2JMK A;  5LGT B;  3JAE A;  4O4I E;  2A3D A;  2XQ7 A;  3RPU A;  4OYJ A;  2ZM6 T;  3LJC A;  2B76 A;  2K3W A;  4GK5 E;  3ZT6 A;  1E7P A;  1XZY A;  4GYR A;  2V6X A;  5AQO B;  3RYF E;  1ZOY A;  4OFZ A;  1HCI A;  1HFA A;  4ADZ A;  3PV0 F;  5AQG B;  1IJ6 A;  2I6H A;  1YKE B;  1DU2 A;  4DV0 T;  2N1G A;  4WBO A;  1V9D A;  2X0L B;  3QNU A;  3ZT5 A;  4AQY T;  2IC9 A;  2GK9 A;  3B57 A;  3C4X A;  3FXE B;  3UU4 A;  1HS7 A;  4KHZ F;  3UU6 A;  2V26 A;  4HWD A;  5FVL A;  4ZS2 A;  3GWH A;  4JI0 T;  2W4X A;  2YDQ A;  2OLT A;  4LF7 T;  4U2Y A;  2V8S V;  5C2T A;  3CX6 B;  5EK3 A;  2A72 A;  3UUL A;  3JC6 D;  3NWI A;  2Q9Q D;  2VQE T;  3F2E A;  4H9Q C;  2KLQ A;  2W67 A;  3UFG A;  3FZK B;  2VWA A;  1SE7 A;  3Q5W A;  1HNZ T;  2XAH B;  2D2S A;  2H7O A;  1QLB A;  4CI1 B;  4PFP A;  2CXF A;  2IHR 1;  2UXN B;  1W09 A;  3CQG B;  5AQJ B;  4OX9 T;  2M67 A;  4IDZ A;  5FNV E;  3I9Y A;  2Y6X A;  1XDP A;  2WBL A;  3IA3 A;  3MZK B;  1J5E T;  2J62 A;  5F5W A;  1WRD A;  4O4J E;  3ZLI A;  3ZCJ A;  1Z8U A;  2WU5 A;  5CB4 E;  3KFW X;  5DJQ C;  2PBI A;  5AQH B;  1NEK A;  4DR6 T;  4A97 A;  3AEC A;  3ZYK A;  2YDR A;  1M7K A;  2RPA A;  2W63 A;  4A5X A;  5JRC A;  4TNW A;  2HHH T;  3QK6 A;  4PK6 A;  4JI6 T;  2E5L T;  4DVD A;  3RIF A;  2X68 A;  2JQK A;  4E7Z A;  2MBG A;  4AQF A;  3HI2 A;  5KX5 E;  5AQR B;  1VRB A;  4QHO A;  1SHZ C;  2UXX B;  3ZMS B;  4FJO A;  2K48 A;  4F8H A;  3MJX A;  4HEA A;  5J1G A;  4LMJ A;  3RX6 A;  1XNQ T;  4UVB B;  5ETW A;  2Y48 B;  4X66 T;  4O8S A;  4KBM B;  5ABH A;  3O1H A;  3CQX C;  1XMO T;  2XQY A;  3RIA A;  4DO0 A;  2LHR A;  3SS1 A;  4XBF B;  3AE6 A;  2ODU A;  3O1I A;  2WCA A;  2WSS V;  4HFB A;  4PFO A;  4YTN A;  2VAS A;  4U3C A;  4L0R A;  1D1B A;  4HKA A;  3AE5 A;  3FBZ A;  5LMU T;  4QXH B;  4G2A A;  2CHO A;  5JVD E;  5LP6 E;  4PK5 A;  5AQI B;  4U31 A;  2NWB A;  4DMV A;  3UQ4 A;  2JIW A;  1MND A;  2IC6 A;  2IW5 B;  2MYS A;  1UK5 A;  3CKD A;  4LFB T;  2H7V C;  2ODV A;  1YW0 A;  3ZMZ B;  3E08 A;  5CFB A;  1OWA A;  5HYA A;  5CJ5 A;  3VHL A;  2Q9Q B;  2RP4 A;  2H3R A;  3MXZ A;  3BQK A;  3M65 A;  3P4W A;  5LBM A;  4U7Y A;  2XQ9 A;  4QWN B;  2VVS A;  5JDH A;  2EHO A;  5L4E A;  3N2G E;  2WB5 A;  3I1A A;  2CCQ A;  4WNK A;  3EVY A;  3N2O A;  2YKS A;  1HX8 A;  5HXS A;  1WLX A;  2X51 A;  4AKI A;  4TV8 E;  4I4T E;  4UF0 A;  2X9X A;  4ZI3 D;  3UU8 A;  1JNZ A;  3JAD A;  1FIO A;  4CI2 B;  3ZN1 B;  2UXC T;  2ACZ A;  1S94 A;  2CM0 A;  4IL4 A;  5HWY A;  2ZM8 A;  1FJG T;  2V6Y B;  2C5J A;  1T7S A;  2WWV A;  3Q5D A;  2IML A;  2PJQ A;  4ILA A;  1OED A;  3AA0 B;  2CA5 A;  5LBQ B;  3SFE A;  2WWU A;  1FEW A;  1WR0 A;  5L2L A;  2NW7 A;  4TWF A;  3AEB A;  3UT5 E;  3PUY F;  4I50 E;  2M6I A;  3QB5 A;  4DR1 T;  4YLH A;  1MMG A;  3HL6 A;  5FYM A;  2QRX A;  4MAL A;  1ZP0 A;  5JDG A;  3X1D A;  2L9Q A;  4JV5 T;  4DND A;  1QUU A;  2BZB A;  2LRK A;  3CPZ A;  5L3E B;  1SA0 E;  1BR1 A;  1YQ3 A;  3ZKR A;  1HG2 A;  4QXB B;  5HXH A;  1MMA A;  3AA6 B;  2FJB A;  4QH4 A;  2XQ4 A;  4TZ4 C;  4B3S T;  4JYA T;  1WYC A;  3T1Y T;  4NPP A;  1T8B A;  2H89 A;  1VOM A;  2VL0 A;  5HEH A;  5AQM B;  2KND A;  4KX6 A;  4TNV A;  5L47 A;  3BQL A;  4HGA A;  1S35 A;  3RYC E;  2YOE A;  3DP7 A;  5IWA T;  3OKQ A;  2XAJ B;  2BKO A;  4HFE A;  2LRL A;  2E9X B;  3QUJ A;  5FL1 A;  2KSR A;  4DR5 T;  4AIU A;  2ZM0 A;  4TX5 A;  5LYJ E;  2ZM2 A;  2V7J A;  3U3I A;  3ZYL A;  5FY0 A;  2C5I T;  5F3J A;  1QSD A;  3TLT A;  5L3C B;  1D0X A;  4IL9 A;  5BMV E;  2DHR A;  3HKD E;  3ONJ A;  3L3P A;  4KMC A;  3WI3 A;  2KMF A;  4UR9 A;  4DMW A;  3B13 A;  4UVC B;  3M3Z B;  3P4P A;  5LCY A;  5CA0 E;  2CBI A;  3PUR A;  4YHJ A;  5L3F B;  2XUE A;  2BG9 A;  4DBR A;  2JQH A;  1HF8 A;  2E5V A;  3NKZ A;  4U33 A;  5DQV A;  1AJ3 A;  1IJ5 A;  2HN2 A;  2L3L A;  2JJ9 A;  2KZ7 B;  4LFC T;  2XSB A;  3IEE A;  1KNP A;  4YFS A;  2UUB T;  1LVF A;  4JBW F;  1I94 T;  1YQ4 A;  3A8Y C;  1I6Z A;  3ZSS A;  3LK2 B;  3ZCI A;  3UUN A;  2HN1 A;  2CXL A;  4QH5 A;  4BJN A;  4Q25 A;  4IE6 A;  3PDY A;  3N9M A;  5JDQ A;  5AQU B;  1GQE A;  4DV2 T;  2OA5 A;  1UX4 A;  4HFV A;  3Q2M A;  1O3X A;  4HWC A;  4MFR A;  2FUP A;  2YIN A;  3H3M A;  4NXM T;  4UEM A;  4ZI2 D;  4K0U A;  4GYS A;  3AVR A;  2BKP A;  1WYB A;  3C64 A;  4H9N C;  3ZST A;  5EZY E;  2X0Y A;  2IDO B;  1D0Z A;  3W15 B;  2YU2 A;  4L5G A;  3PUS A;  4PJN A;  1UUR A;  4ILU A;  2UUC T;  5FY1 A;  4P0A A;  3WAJ A;  3UFE A;  4MHC A;  3LBX A;  2DL1 A;  1W0B A;  2XTL A;  3HKB E;  4DV7 T;  3AB3 B;  1W9R A;  3RI5 A;  2QYW A;  2YN6 A;  2EHO C;  3AE4 A;  2PTF A;  5LGU B;  5EK2 A;  3P4S A;  3AE7 A;  3AXJ B;  1HX1 B;  3SFD A;  3IHR A;  2KT9 A;  3Q5E A;  4ZI7 E;  2VKO A;  4H9R C;  3RF1 A;  4I55 E;  3CK6 A;  4UEL A;  4DV3 T;  3NVO A;  2VL8 A;  1MIW A;  1IAP A;  5JTG A;  3HA4 A;  2XAG B;  5LJM A;  2JMH A;  3KBU A;  5L3B B;  4WBN E;  2I0M A;  3UU5 A;  4DUZ T;  1OED C;  3ANW B;  3I9W A;  4TWD A;  2DWK A;  1XWM A;  2BVM A;  4AI6 A;  1IBK T;  2G0U A;  1OXZ A;  2K9A A;  4CZZ B;  4IST A;  1IZN B;  3NBX X;  4AXP A;  4Z91 A;  2ZLY A;  1D1C A;  3PUW F;  1T72 A;  4ERR A;  1E1H B;  4WYV A;  5AQN B;  2J4G A;  3ZT7 A;  4H9P C;  1Z0P A;  2XZE A;  3ZYM A;  3PUX F;  3AA7 B;  3GN5 A;  4X62 T;  1VCS A;  2LLY A;  5AQL B;  5HXR A;  3LSV A;  5JDF A;  3OJA A;  4CI3 B;  3MKD A;  2E2A A;  2JRK A;  3P7I A;  3QB5 K;  4DR7 T; 
#chains in the Genus database with same CATH homology
 2CXD A;  3I0Q A;  2C5J A;  4BA9 A;  4J2C A;  2X66 A;  2HPJ A;  2VB6 A;  2PJQ A;  4ASK A;  3C4Z A;  4IE4 A;  3AA0 B;  3RRC A;  3KVA A;  3VU7 H;  4AKH A;  4AKR B;  2NTX A;  3NRY A;  2EHO D;  2CA5 A;  3IBP A;  3RRW A;  1Y64 B;  4O4H E;  3K3O A;  4X1K E;  5LBQ B;  3RYH E;  2CWO A;  4P09 A;  2HPL A;  4QX8 B;  5H6R B;  3CX8 B;  2WWU A;  3N9Q A;  4UIG A;  1FEW A;  4XZC A;  2CWY A;  3FHN A;  5JDL A;  1HG5 A;  2NOX A;  3SRZ A;  2IAK A;  5FXV A;  2V7I A;  3ZMU B;  2YK0 A;  4B6X A;  3CML A;  5L2L A;  2NW7 A;  3NZP A;  2VKH A;  5FP3 A;  4PW8 A;  4IE7 A;  3UT5 E;  4I50 E;  2VKD A;  4FI5 A;  5J2T E;  1H7C A;  4AKL A;  4YJ3 E;  5F8P A;  3T8O A;  3VKG A;  4TN7 B;  4OYK A;  2ACX A;  4NUV A;  3ZEF B;  4YLH A;  1WR6 A;  1MMG A;  4AKG A;  4YJ2 E;  3N9O A;  2E9X A;  4P0B A;  3HL6 A;  2KWH A;  5FY7 A;  5FYM A;  3QC9 A;  4CXX A;  2V7K A;  4U74 A;  2EHO B;  5FXX A;  2XAS B;  5JQG E;  1KK7 A;  3PU3 A;  3HKE E;  3LK3 B;  2A2F X;  3KV6 A;  4MAL A;  2LSI A;  3ETU A;  3FXD B;  5JDG A;  5IHY A;  1LKX A;  2L9Q A;  3KV9 A;  3KVB A;  3V5S A;  4DND A;  4HN9 A;  2X9H A;  1QUU A;  2L8K A;  1MMN A;  4U72 A;  5H6Q B;  4O4L E;  4UF0 B;  4A56 A;  5LOV E;  2BZB A;  2XAF B;  3GN5 B;  5KMG P;  3CPZ A;  3PUQ A;  2MOZ A;  5L3E B;  5JR9 B;  3UUM A;  3LK4 2;  2LJL A;  5HWX A;  4UVA B;  1SA0 E;  3KDS E;  1BR1 A;  2NW9 A;  2JPF A;  2C5K T;  2VK9 A;  1HG2 A;  3L09 A;  1D0Y A;  2J1D G;  3JC6 C;  4IGU A;  4E7S A;  2WM9 A;  3RKO A;  4QXB B;  2Q9Q C;  3MAC A;  5HXH A;  1MMA A;  1BR4 A;  3AA6 B;  4Z8X A;  2LHN A;  3OYX A;  1HTJ F;  2LSG A;  3E0Z A;  1NAF A;  3KIN B;  1T98 A;  2K5B B;  3FB2 A;  4AQF C;  3C50 A;  3ZC0 A;  4TZ4 C;  3K8P C;  4OHF A;  3VKH A;  4G63 A;  3ZC1 A;  1WYC A;  5E0O A;  4I43 B;  3GMI A;  2E9X D;  2WMN A;  4JUY A;  1FMW A;  4OK0 A;  2LSJ A;  4IE0 A;  1MIV A;  2X9Y A;  5EK4 A;  1VOM A;  4CXY A;  1LVK A;  4GK0 E;  1UX5 A;  4EYU A;  5CA1 E;  3U78 A;  3EDV A;  3K3N A;  4L9I A;  2MTQ A;  4TUY E;  4TV9 E;  2X9W A;  3WAK A;  2JMK A;  2KND A;  2XHE B;  5LGT B;  3BQI A;  3DTO A;  3RH3 A;  4O4I E;  2PFV A;  3BQL A;  4EXT A;  2A3D A;  4HGA A;  5AFU L;  2CLY B;  2E8I A;  3RPU A;  1U4Q A;  4OYJ A;  1S35 A;  3RYC E;  3LJC A;  4GK5 E;  4EYY R;  2CE7 A;  3DP7 A;  4QX7 B;  3KBT A;  4GYR A;  2LT3 A;  3OKQ A;  2XAJ B;  3C98 B;  3PU8 A;  3RYF E;  3HR0 A;  4OFZ A;  1FMV A;  1HCI A;  1HFA A;  4IIJ E;  2E9X B;  4WW0 A;  3QUJ A;  3AAA B;  4ADZ A;  2SPC A;  4JLE A;  4ZI2 C;  3EUH A;  1IJ6 A;  1YKE B;  4AQG A;  2KIN B;  4M1P A;  2ZM0 A;  4TX5 A;  4EZH A;  5LYJ E;  2ZM2 A;  2V7J A;  4PJJ A;  2N1G A;  2DWG A;  3PTR B;  4BJM A;  5DAB A;  4WBO A;  1V9D A;  2Z6E A;  2X0L B;  3S4U A;  2RA1 A;  3U3I A;  3ZYL A;  4F6R C;  5FY0 A;  1ZKE A;  1ZV4 X;  5JRE A;  2C5I T;  2YEV C;  3CWZ B;  5F3J A;  1QSD A;  2IC9 A;  5L3C B;  2GK9 A;  1D0X A;  3I0O A;  3B57 A;  3C4X A;  3FXE B;  5DQW A;  5IYZ E;  5BMV E;  2DHR A;  2KXP B;  2V1D B;  3HKD E;  4KUM B;  3DJB A;  3PUG A;  3L3P A;  4KMC A;  4EZ4 A;  3WI3 A;  3NRX A;  2KMF A;  4DMW A;  1HS7 A;  3B13 A;  2V26 A;  1D1A A;  4UVC B;  5M4Y A;  4ZS2 A;  5LCY A;  5CA0 E;  3GWH A;  2HH7 A;  5KDM C;  3RC3 A;  5JH7 E;  2LOP A;  3PUR A;  4YHJ A;  5L3F B;  2XUE A;  4JEU B;  3ZJ2 A;  4KP3 C;  5JR9 C;  4H9O C;  4CXW A;  5A1L A;  3CX6 B;  4DBR A;  5EK3 A;  2A72 A;  2D0U A;  4UV8 B;  4C91 A;  1HF8 A;  4QKN A;  3UUL A;  3JC6 D;  5DQV A;  1AJ3 A;  1IJ5 A;  2Q9Q D;  3O4X E;  2L3L A;  2JJ9 A;  3PUA A;  2KZ7 B;  3F2E A;  4H9Q C;  1US7 B;  2KLQ A;  4X1I E;  5LHI B;  3IEE A;  1X79 A;  4YFS A;  2DCF A;  5LJN A;  1LVF A;  2VWA A;  3SWH A;  4X1Y E;  3Q5W A;  3ZMT B;  3K3Q C;  3LG7 A;  4H63 V;  4XAX B;  2K24 A;  5HAX A;  3LK2 B;  2XAH B;  3ZCI A;  3LFM A;  2D2S A;  3OYZ A;  3UTK A;  3F31 A;  3UUN A;  2H7O A;  2CXL A;  2W61 A;  4BJN A;  4UV9 B;  4CI1 B;  4PK4 A;  2JQQ A;  5J2U E;  4PFP A;  4IE6 A;  2CXF A;  3PDY A;  3N9M A;  5JDQ A;  3IF8 B;  1LRZ A;  2CLY C;  2UXN B;  3CQG B;  2OA5 A;  2DNX A;  2I59 A;  1UX4 A;  2M67 A;  4HFV A;  4IDZ A;  3ZJ1 A;  4O2A E;  5FNV E;  3Q9D A;  3Q2M A;  4EAH A;  2XAQ B;  4HTE A;  1O3X A;  3I9Y A;  3ONX A;  3F57 A;  5FXW A;  1G8X A;  2Y6X A;  3RYI E;  5LXT E;  2WBL A;  4MFR A;  2P9B A;  3MZK B;  2WAU A;  2YIN A;  3O1J A;  5LNK A;  2CEA A;  3N5L A;  4ISS A;  5L3D B;  1WRD A;  2D0T A;  4O4J E;  3ZLI A;  3CVR A;  4UEM A;  3UUX B;  4ZI2 D;  4K0U A;  4GYS A;  3ZCJ A;  3AVR A;  3ANW A;  1WYB A;  3C64 A;  4X20 E;  4H9N C;  2Y8D A;  5CB4 E;  3KFW X;  4MLK A;  5DJQ C;  2PBI A;  3HKC E;  3RC8 A;  5HXC A;  3MK7 C;  3C51 A;  5EZY E;  2BVL A;  3H3A A;  4EB6 E;  3ZYK A;  4V1A v;  1BR2 A;  4IHJ E;  2W63 A;  3AAI A;  2LE8 A;  5TAO A;  5HXE A;  5JRC A;  2W62 A;  3J7Y q;  3QK6 A;  4PK6 A;  1D0Z A;  3W15 B;  2N9D A;  2YU2 A;  4DVD A;  4L5G A;  3PUS A;  1MIY A;  4PJN A;  4ZOL E;  2X68 A;  4N78 D;  2Q9Q A;  4ILU A;  5JDN A;  4HE8 A;  2ES0 A;  3SOL A;  5FY1 A;  4P0A A;  4QXC B;  4E7Z A;  2MBG A;  3WAJ A;  3UFE A;  4AQF A;  3HI2 A;  4MHC A;  5KX5 E;  5L3G B;  3C4W A;  3LBX A;  2QA7 A;  3AAE B;  1MNE A;  1VRB A;  2XTL A;  2C0S A;  1SHZ C;  3AB3 B;  3HKB E;  4QHO A;  2UXX B;  3ZMS B;  4FJO A;  4H9S E;  3O9X A;  2K48 A;  4GIW A;  1U5P A;  3A5X A;  3AVS A;  3MJX A;  2EHO C;  3FBL A;  4HEA A;  5J1G A;  2WMO A;  5LGU B;  1KNZ A;  3RX6 A;  5EK2 A;  4PJL A;  2PG8 A;  3ZMV B;  1YKH B;  4UVB B;  5ETW A;  4BAY B;  2Y48 B;  4O8S A;  4ANJ A;  5LHH B;  3D0T A;  4KBM B;  3IHR A;  2KT9 A;  4NUU A;  3O1H A;  4ZI7 E;  2VKO A;  3CQX C;  2KWI B;  5LHG B;  2QGS A;  2XQY A;  4H9R C;  5ADX L;  4UXN B;  3P8C D;  2LM9 A;  3ETV A;  4I55 E;  4DO0 A;  4PAG A;  3N9N A;  4ZS3 A;  2LHR A;  3Q5X A;  2X67 A;  4UEL A;  3SS1 A;  4XBF B;  2VL8 A;  2ODU A;  3O1I A;  5LA6 E;  1MIW A;  1BR0 A;  2ZMA A;  1IAP A;  2WSS V;  4PFO A;  3HA4 A;  2VAS A;  2W00 A;  2XAG B;  3ESL A;  5LJM A;  2JMH A;  1B7T A;  3N9P A;  3KBU A;  4L0R A;  1D1B A;  2LEH A;  4HKA A;  3KV4 A;  3R6N A;  5LG4 A;  3OBV E;  4PJM A;  3FBZ A;  5L3B B;  4WBN E;  2N2N A;  5GON E;  4QXH B;  3PE0 A;  4C90 A;  3ANW B;  3ZPO A;  4G2A A;  5JVD E;  2CMR A;  4PK5 A;  5LP6 E;  4DBQ A;  3I9W A;  3J9X 1;  2NP9 A;  4PNI A;  2NWB A;  4ZHQ E;  1MMD A;  2DWK A;  4DMV A;  1NWM X;  5JDM A;  2DI4 A;  1MND A;  4IE5 A;  2IC6 A;  3N9L A;  2IW5 B;  2BVM A;  3KV5 A;  4MBQ A;  5JRC B;  2YU1 A;  2MYS A;  3E22 E;  3CKD A;  1ZEE A;  2H7V C;  4AI6 A;  2ODV A;  2G0U A;  1OXZ A;  2K9A A;  1YW0 A;  3ZMZ B;  3E08 A;  2LSK A;  4CQI A;  1OWA A;  4CZZ B;  5HYA A;  3VHL A;  2Q9Q B;  4IST A;  2RP4 A;  2H3R A;  3MXZ A;  1IZN B;  4JEH B;  3BQK A;  3V5U A;  3NBX X;  3M65 A;  1G73 A;  4AXP A;  2NTY A;  5LBM A;  2B1E A;  3LBX B;  2DLR A;  2ZLY A;  1D1C A;  1YD8 G;  3AA1 B;  4GOU A;  4QWN B;  2E9X C;  5JDH A;  2EHO A;  4O2B E;  3N2G E;  3I1A A;  2CCQ A;  3BK9 A;  3EVY A;  3NZQ A;  4WNK A;  3N2O A;  4ERR A;  1E1H B;  2V7L A;  3GA8 A;  1HX8 A;  5HXS A;  2LOS A;  4H9P C;  1WLX A;  2X51 A;  3ZN0 B;  2D5U A;  1CUN A;  1Z0P A;  4AKI A;  4TV8 E;  3ZYM A;  3TKL B;  2BDE A;  5C8Y E;  2NW8 A;  3AA7 B;  3R84 B;  4I4T E;  4UF0 A;  1UCU A;  3GN5 A;  4EIW A;  2X9X A;  4ZI3 D;  2LSY A;  5FXZ A;  2W0G A;  1FIO A;  5JR9 A;  4EOZ B;  5HXR A;  4CI2 B;  3ZN1 B;  5JDF A;  3OJA A;  1S94 A;  4CI3 B;  2CM0 A;  3N2K E;  3MKD A;  4ZI3 C;  3EDU A;  5LGN B;  1EZ3 A;  3CQC B;  2VKJ A;  3MA9 A;  2V7M A;  2JRK A;  3P7I A;  5HWY A;  2ZM8 A;  1ZHC A;  3CX7 B;  4H63 H;  3H37 A;  5FMN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...