2E9XA

The crystal structure of human gins core complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
144
structure length
144
Chain Sequence
b'MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSVLPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA replication complex GINS protein PSF1
publication title Structure of the human GINS complex and its assembly and functional interface in replication initiation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
total genus 55
structure length 144
sequence length 144
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1030 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2e9xA01
2Q9QB 2E9XA 2E9XD 3ANWA 2EHOB 3JC6D 2Q9QC 2EHOA
chains in the Genus database with same CATH superfamily
3EDUA 4KHPT 4CI1B 2LSGA 3ZT7A 2B76A 4H63V 4ZI2C 2EHOD 5LGUB 3RH3A 4ISSA 2W4XA 5M4YA 2UUCT 2XQ6A 3UFEA 2X0YA 2X66A 4MLKA 4NUUA 5FVLA 1XMQT 3LBXB 3ZMZB 3EVYA 4DR3T 2YEVC 4X5TA 3PU8A 3PURA 5LMNT 3IHRA 5L3FB 3LK42 2NW9A 2NW7A 5LHIB 4I4TE 2W0GA 2LHRA 1Y64B 2QYWA 3ZMTB 1SE7A 3HKEE 2RA1A 2KWHA 1FIOA 5H6RB 1UX5A 1E2AA 2NW8A 2XHEB 1ZV4X 2M6BA 3P4WA 3I9YA 4LF4T 3RC3A 4YHJA 1V9DA 2YN6A 2DNXA 5H6QB 3ZSTA 4AKHA 3HA4A 2H89A 4QXCB 3OBVE 5HXHA 3Q9DA 2ZM8A 5F8PA 4PJMA 3AE7A 4UIGA 3LFMA 4NUVA 2K48A 5FXZA 5LHHB 3NRYA 1Z8UA 2BS2A 1N34T 5F3JA 3VR9A 4YJ2E 4AIUA 2MPKA 3RC8A 4U7IA 4TNVA 5FXVA 3NRXA 2E9XC 1UUSA 5HCJA 3C4XA 4H9RC 3KBUA 2DWGA 5FYMA 4GK5E 3VU7H 2XQ5A 1MNDA 2DL1A 2CHNA 1KNPA 3I0OA 2YDQA 4ZHQE 3AEGA 3N9OA 4QX7B 3K3QC 4KMCA 2R6GF 4HTEA 3AVSA 4X1IE 3UQ7A 3JAEA 3QNUA 3EUHA 2VURA 4KX6A 2A9UA 4NIQA 3PTRB 3OTOT 4CXWA 2PBIA 3KDSE 5HEHA 3P4SA 4JI6T 3AE9A 3UFGA 2WB5A 4N78D 2YDSA 3UULA 2KT9A 2CPTA 2XJ7A 4JLEA 4WW0A 4JI5T 4G63A 2VKOA 3TKLB 2EHOC 1VOMA 2CEAA 2YOEA 5IHYA 5AQKB 4IE7A 3P8CD 4DBRA 2W62A 3R6NA 3OPCA 4HGAA 3ZT5A 2VQET 2KMFA 2UUAT 3ZC1A 2I0MA 3TLSA 2MYSA 2CRBA 4IDQA 1N33T 4DMWA 3L8RA 3ZN1B 1KEYA 4A97A 2FJEA 2D0UA 1KNZA 4TV8E 5BMVE 3SRZA 2WQYA 1KK7A 4CXXA 1WRDA 1VRBA 2V6XA 4DMVA 5HXSA 5KMGP 2XQ4A 4UVBB 4AKRB 3RRWA 1YXRA 2VKHA 2H88A 2LE8A 2N9DA 4LF5T 4DR4T 2V5CA 2LSYA 2ZLYA 1QSDA 1BR2A 2CCQA 3A7MA 2VVSA 4BA9A 2CXDA 2PJQA 4LFCT 2IAKA 2BG9A 2RP4A 4ASKA 3IA3A 3UU5A 2WP9A 2L9QA 3RLFF 3O1JA 1M62A 5LGTB 3BK9A 2JMKA 3OKQA 3NZQA 2H7VC 1OWAA 3PE0A 3I1AA 3C50A 5E0OA 3IEEA 1YKHB 5FKYA 5ABHA 5LHGB 3PUSA 2RPAA 1D0YA 5L3CB 1G73A 5ABFA 1XWMA 5HXCA 2NWBA 4EYYR 2BZBA 2CXFA 4JBWF 4P0BA 2Z6EA 4PK6A 2XAFB 4QXHB 3RYCE 5LP6E 1HG5A 3VKGA 4LF6T 2B1EA 3QOFA 4ADZA 3F2EA 4EOZB 4O4IE 3ANWA 2UXXB 1ZOYA 3ZSSA 2DCFA 3ZC0A 5LJNA 5LYJE 3RI5A 4X64T 3T1YT 2C5JA 3GA8A 4IREA 2BG9B 1HTJF 2BDEA 3AEBA 4YLHA 2WWVA 4EIWA 4DR7T 5ETWA 4IHJE 3RRCA 4HFIA 3VKHA 3SFEA 2X9XA 4PK4A 4YXDA 5J1GA 4X20E 3UUNA 2CBIA 1D1BA 4EB6E 1WFDA 5AQIB 3NWIA 4O8SA 2WWUA 2UU9T 4C90A 2I6HA 2XPKA 3LSVA 4ANJA 4HFCA 3E0ZA 3RF1A 3KVBA 2YU2A 1T98A 2VKJA 2VKDA 4OK0A 1SHZC 2JQKA 1E7PA 2WY2A 5HWXA 3RYIE 3N9PA 3H3AA 3EAMA 1OEDA 4EXTA 1MMDA 2V7LA 5LG4A 3ZEFB 2NOXA 4O4HE 5CA0E 4DV6T 1WR0A 5HEOA 3PUVF 3M3ZB 4I0UA 1O3XA 2UUBT 2G0UA 4XZCA 2C5IT 2UXBT 3HL6A 3ZN0B 1XDPA 1XZYA 5HXRA 1NEKA 1CHUA 3W15B 5L3BB 4GYRA 2Y48B 2CBJA 1N32T 3O4XE 2E5VA 2X0LB 4GOUA 4DR5T 1FJGT 1NENA 1YD8G 1X79A 4PFPA 5LBMA 4JEHB 5CB4E 4NXMT 4U72A 4NXNT 5C2TA 2WZIA 3RX6A 2WDQA 1OEDE 4IDNA 4PK5A 5L3GB 3LG7A 3RYFE 2JQQA 4EEBA 3E22E 1T7SA 3ONJA 1LRZA 2YDRA 2XAGB 2I59A 3WI3A 4LFBT 3P7IA 1VCSA 5FXXA 1R8IA 3HKBE 1WR6A 4XBFB 3ETUA 1G8XA 3FBLA 3A5XA 2W66A 1HNXT 4HFVA 2VVNA 2V7IA 5JRCA 4JI7T 4YSZA 5AFUL 4UVCB 2CE7A 2LSJA 2ACZA 3ONXA 2BS4A 3B57A 4M1PA 4Z90A 1J1JA 5AQHB 2M67A 5EK3A 5FL0A 1HG2A 3JAFA 2WM9A 4Q25A 2XQYA 4UXNB 4QXBB 4QWNB 3AA7B 5TAOA 3J9X1 4ERRA 2KZ7B 1LKXA 2E8IA 5AQMB 1XNRT 1GQEA 2ODVA 4G2AA 4DR1T 2XY8B 4GKJT 2HN1A 4HWDA 1HX8A 4ILAA 3MJXA 5J2UE 1D1CA 5AQPB 5HXEA 1XNQT 3NKZA 1YW0A 2WZHA 3UU6A 1UCUA 4ZS2A 2CWOA 4HE8A 2ODUA 1N36T 5KDMC 3QUJA 2WU2A 4ZEYA 1Z0PA 1HFAA 4WZXA 2IC6A 2YU1A 1JNRA 2VK9A 3EI0A 4YTMA 4U3CA 3O1IA 5JRCB 2XM1A 4Z8XA 4CZZB 2HH7A 1I94T 2IHR1 4Z91A 1J5ET 4P0AA 3WAJA 4QH1A 3P4PA 1T72A 3V5SA 2X9YA 4UR9A 1KNRA 5A1LA 4OYKA 4U7YA 2XUEA 4H9PC 1VCTA 4A5XA 2AE9A 2X67A 5C8YE 4LMKA 3GN5A 4AKLA 4K0KT 3FHNA 1YKEB 3P4RA 5FY0A 4AQGA 3CMLA 5F5WA 4ZI7E 2YK0A 5JDHA 3N9NA 2IMLA 3K3NA 3QK6A 3RIFA 3PUZF 3NVOA 2WDRA 4YSXA 3QB5K 2V7JA 2HPLA 1EZ3A 1HCIA 3C4ZA 1WYCA 3JCFA 4O2AE 5L3DB 2NTYA 4E7ZA 2YKSA 5CA1E 4YTNA 4HWFA 5LGNB 1OEDC 1H7CA 2XAHB 5L4EA 4C91A 3K3OA 3AXJB 3KBTA 3AE1A 1JNZA 1DU2A 3AE6A 5LB7B 2D2SA 4PJNA 3ESLA 1MMAA 3ZJ2A 3PUQA 3PUAA 2BBHA 1HR0T 2XM2A 4UV9B 4IGUA 4IE5A 1UURA 2Y6XA 3GN5B 3PUYF 2WSSV 3FXEB 3Q5WA 3BQKA 2LM9A 1IBKT 4U74A 1D1AA 3K1SA 2H3RA 3AEDA 2W67A 4UV8B 4JI4T 3N9LA 4X1YE 2JMHA 4YHHT 2IIUA 2X9HA 3N2OA 3V5UA 5AQOB 2LLYA 2IW5B 1AJ3A 4AKIA 4IE6A 1W0BA 4AXPA 3B13A 5LBQB 3AE8A 4O4JE 3KFWX 3Q5XA 2K3WA 3AE3A 3AA6B 4LFAT 3E08A 5FXWA 2OA5A 2WAUA 4U2ZA 5L2LA 1IBLT 3AAAB 2FUPA 5EZYE 2JJ9A 2A72A 3R84B 4CI3B 1UK5A 2LSIA 2XQ3A 4DV2T 4ZOLE 2L8KA 2LRLA 2W61A 4IDPA 2ES0A 4YT0A 2CHOA 1U4QA 5JR9A 1WCRA 5KX5E 4WNKA 3JC6D 2VL0A 5AQJB 5DQVA 4JI3T 3CX6B 5HEUA 4QHOA 2OLTA 3OYXA 1BR4A 4ILBA 4JUYA 2D0TA 4WBOA 3UUXB 2J4GA 3M65A 2BG9E 3OVUA 2UXCT 1SA0E 1D0ZA 4DBQA 4WYVA 3ETVA 4BJNA 2MOZA 4JEUB 2W00A 3AAIA 4H9OC 3ZCIA 4B6XA 2JIWA 2LOPA 4O4LE 2VWAA 3ZCJA 3LK2B 4PFOA 4DV1T 2J1DG 5JDFA 3FZHB 1WLXA 1UGOA 2BVLA 4LMLA 4YFSA 5CFBA 1ZP0A 3SWHA 4IE4A 4LF9T 5FMNA 5FL1A 1MIYA 2WDVA 1IZNB 2UXDT 1MMGA 3QB5A 5FNVE 3RPUA 5JR9B 3RHWA 2KWIB 5LA6E 3P50A 3AB3B 3JADA 3EABA 1WYBA 4ZS3A 4GIWA 5AQUB 2MBGA 5HWYA 5JDLA 5AQLB 1QUUA 4UELA 1ZKEA 2KXPB 3F31A 3N5LA 3EHZA 2LJLA 4J2CA 3N9QA 1BR0A 5EK4A 3DTOA 2E9XB 4CQIA 2ZMAA 4TWHA 2V7KA 5JQGE 3MXZA 4CXYA 3QC9A 3CKDA 2ZM2A 4DNDA 1W09A 1LVFA 1XDOA 2NP9A 2W63A 2HN2A 5C3JA 1MMNA 3PJAJ 5HAXA 2LKGA 3JC6C 3VR8A 4EEDA 2QVAA 4YY3T 4FJOA 4P09A 4DV4T 5ADXL 4AQFA 2CWYA 2KSRA 3FB2A 4HWCA 2N2NA 2ZM6T 3L39A 2QA7A 2IC9A 1NWMX 2CXLA 4PW8A 4CN1A 4X62T 4GYSA 2DWKA 3AE5A 2CMRA 1SUMB 5J2TE 3AEAA 1M7KA 1FMVA 4EV6A 3UU4A 2LEHA 2AXDS 1S94A 3SFDA 5JVDE 3KV5A 2PTFA 3RIAA 2XSBA 4PJJA 5ABGA 3P4QA 2LSKA 4JI2T 4A98A 4KP3C 2OV9A 4HKAA 2XQ9A 3C51A 1U5PA 3I9WA 3ZT6A 3MA9A 4EZHA 2BG9C 3RGLA 4K0UA 2F4VT 2XZEA 4MBQA 3OYZA 3RYHE 4AI6A 4ZZBA 4QX8B 1FMWA 3O1HA 4TNWA 2XQ8A 3KV9A 4JI1T 5DABA 4GKKT 3ZJ1A 1E1HB 4ILUA 1LVKA 2VQFT 3FZFB 3CQGB 4HWIB 3RQUA 5HEJA 2QRXA 3N2KE 3VRAA 2V26A 4PAGA 4IL9A 3IBPA 3U78A 2L3LA 2IDOB 1Y01A 4TUYE 3BQIA 5JDNA 4P1NA 3EDVA 1KFYA 3UU8A 3LDQB 2V1DB 4JI0T 3D0TA 2WU5A 4HEAA 5FP3A 2VL8A 3S4UA 4HWHA 3AA0B 3I0QA 5AQNB 2CLYB 4H9SE 3CVRA 2W2UA 3CK6A 2E2AA 1T8BA 3LJCA 3K8PC 5JR9C 3PDYA 2J62A 1OXZA 2LRKA 2DI4A 3AXJA 4X65T 5AQRB 4TX5A 5FY1A 3AE2A 3PUWF 2V6YB 2GK9A 4EZ4A 2Q9QA 2LOSA 4U2YA 4F6RC 3BQLA 4H9NC 1L0VA 1HNWT 2Y8DA 3AEFA 5FVKA 4YSYA 3ABVA 4TWFA 3AAEB 3FZLB 3GMIA 5ABEA 3HI2A 3KV4A 3UUBA 2J47A 2LM2A 3TLUA 5CGMA 4JI8T 5LOVE 3LK3B 1HF8A 5L47A 2XQAA 2E5LT 4JYAT 5HCMA 3UU3A 5JH7E 1NAFA 4L0RA 4DV7T 4OX9T 2XTLA 3AA1B 2FBWA 3RIUA 4U33A 3SOLA 1FEWA 3ZKRA 3AECA 4DUZT 2D5UA 3ZYMA 1IJ6A 2WMOA 3O9XA 4CN4A 2XAJB 1HS7A 3H37A 1I6ZA 2FJBA 4AQYT 2MAWA 3NZPA 3RQWA 3L3PA 4IIJE 1W0AA 4UVAB 4KI0F 3N9MA 3RKGA 1CUNA 2BKNA 2ZM0A 5HEGA 4UF0A 4HFEA 4MALA 1W9RA 4BJMA 2Q9QB 2D9DA 3KVAA 3AEEA 2KINB 2BKPA 4IDOA 3DP7A 4DR2T 2WCAA 1YQ3A 4NPPA 4DV3T 4IT4A 3A8YC 2IUBA 4F8HA 3U3IA 3UT5E 4OHFA 1J5WA 1ZHCA 2X9WA 5AQSB 1QLBA 3ZMSB 3NBXX 2JPFA 3C4WA 4KHZF 3WAKA 5DQWA 3ZLIA 5BR8T 2BS3A 1D0XA 3ZMVB 5JREA 3F57A 4KUMB 2MTQA 3Q2MA 2JQ9A 4EYUA 4DO0A 2KNDA 5DJQC 3C64A 4COFA 3RKOA 1MIVA 3ZMUB 4DVDA 2K24A 5AQGB 4HFBA 2XASB 2FJAA 3CIRA 2Q9QD 4TZ4C 4ILCA 4QKNA 2C5KT 3TLTA 5LG3A 4AQFC 4MHCA 3DJBA 3FZKB 5J0ZA 1UX4A 3B5MA 3TLVA 3ZYKA 4UF0B 3Q5DA 4U31A 5JDGA 4V1Av 4QH5A 5IYZE 2A3DA 3PU3A 5CJ5A 4LF8T 2KLQA 4BAYB 4A56A 2FJDA 2C0SA 3MK7C 3CX8B 5IUXA 1IBMT 4DUYT 2LKHA 3ZYLA 2K5BB 2CLYC 2SPCA 3SS1A 4AISA 3MKDA 4TN7B 3KV6A 4DR6T 2CA5A 3VHLA 2X0HA 3CQCB 5AQQB 2XQ7A 2WBLA 3G06A 4LF7T 3CWZB 4H63H 4IDZA 2DLRA 4XAXB 5AQFB 4X66T 2A2FX 2HPJA 4OYJA 4OFZA 5KXJA 5IWAT 2HHHT 2E9XA 4ZI3D 1HNZT 2N1GA 3X1DA 2BBJA 5L4HA 4DIDB 3PJAA 4PJLA 2X51A 2XAQB 3CQXC 5L3EB 3FXDB 2M6IA 3UQ4A 2V5DA 3FZMB 2X68A 4AKGA 2XSAA 4WBNE 4YJ3E 4YTPA 4HFHA 5JTGA 3HKDE 2WS3A 2BVMA 1S35A 4I43B 5JDQA 5EK2A 3MACA 2H7OA 5ABFB 4QH4A 4TWDA 2EHOA 3PV0F 4TV9E 1US7B 3L09A 2YINA 4ZI2D 3MZKB 3TLWA 2VB6A 3PUGA 4KBMB 3VRBA 3ONLC 1HX1B 3AVRA 2Q9QC 3HKCE 3HR0A 1ZEEA 3T8OA 3H3MA 3IF8B 4I55E 4ZXLA 4IL4A 4FI5A 5GONE 3ANWB 4IE0A 5LJMA 1B7TA 2K9AA 4O2BE 4LMJA 1IJ5A 2NR4A 4X1KE 2DHRA 4B3TT 3AE4A 3FBZA 2JQHA 3UTKA 3OJAA 4PNIA 2PFVA 1X9BA 3CPZA 3KINB 5LCYA 2PG8A 4EGWA 1MIWA 4ISTA 4B3MT 2VASA 3RIUC 4ZZCA 3J7Yq 2QGSA 3LBXA 4UEMA 2WMNA 4B3ST 1KF6A 4L9IA 2JRKA 2NTXA 4CN6A 3C98B 2UXNB 3CX7B 5JDMA 2P9BA 2EHOB 4ZI3C 3Q5EA 4DV5T 1MNEA 4I50E 4JV5T 2E9XD 5AQVB 4HFDA 3UUMA 1IAPA 3GWHA 2V8SV 2LT3A 4B3RT 1XMOT 5LMUT 5LNKA 4EAHA 1OEDB 4CI2B 3PUXF 4MFRA 4GK0E 5HYAA 4L5GA 5LXTE 2LHNA 2BKOA 2V7MA 2CM0A 5AQTB 1BR1A 4HN9A 2ACXA 4H9QC 4DV0T 1YQ4A 3T1HT 3ZPOA 4E7SA 2V6YA 5FY7A 3N2GE
chains in the Genus database with same CATH topology
3N9PA 5LBQB 4O4JE 5LOVE 3H3AA 1HF8A 3EDUA 3KFWX 3LK3B 3Q5XA 4EXTA 3AA6B 3E08A 1MMDA 2V7LA 5LG4A 5JH7E 5FXWA 4CI1B 1NAFA 2LSGA 4L0RA 3ZEFB 2OA5A 2NOXA 2WAUA 4H63V 4ZI2C 2EHOD 5L2LA 5LGUB 3RH3A 4O4HE 4ISSA 2XTLA 3AA1B 5M4YA 3AAAB 3SOLA 5CA0E 1FEWA 5EZYE 2JJ9A 2X66A 4MLKA 4NUUA 3UFEA 3LBXB 3ZMZB 3EVYA 2D5UA 3ZYMA 1IJ6A 2WMOA 2A72A 2YEVC 3R84B 4CI3B 3O9XA 2XAJB 3PU8A 3H37A 3PURA 1HS7A 2LSIA 3NZPA 1O3XA 3IHRA 2G0UA 4XZCA 2C5IT 4ZOLE 2L8KA 3L3PA 5L3FB 3LK42 3HL6A 4IIJE 2W61A 2NW9A 3ZN0B 2ES0A 2NW7A 5HXRA 5LHIB 1U4QA 4I4TE 4UVAB 2W0GA 5JR9A 2LHRA 1Y64B 3N9MA 1CUNA 3ZMTB 3W15B 5L3BB 3HKEE 2RA1A 4GYRA 2ZM0A 4UF0A 2KWHA 2Y48B 5KX5E 1FIOA 5H6RB 4WNKA 4MALA 3JC6D 1UX5A 3O4XE 4BJMA 2Q9QB 3KVAA 2NW8A 5DQVA 2XHEB 3CX6B 1ZV4X 2KINB 4QHOA 3DP7A 3OYXA 1BR4A 3I9YA 4JUYA 3RC3A 2D0TA 4YHJA 1V9DA 2DNXA 4WBOA 3UUXB 5H6QB 2X0LB 3M65A 3U3IA 4AKHA 4GOUA 3UT5E 4OHFA 1SA0E 1ZHCA 3HA4A 1D0ZA 2X9WA 4DBQA 4QXCB 3OBVE 5HXHA 3Q9DA 2ZM8A 1YD8G 1X79A 4PFPA 5F8PA 3ETVA 5LBMA 3ZMSB 4JEHB 5CB4E 4BJNA 4PJMA 2MOZA 3NBXX 4UIGA 4JEUB 3LFMA 2JPFA 2W00A 3AAIA 4NUVA 4H9OC 2K48A 3ZCIA 3C4WA 3WAKA 4B6XA 2LOPA 5FXZA 4U72A 5DQWA 5LHHB 3ZLIA 4O4LE 2VWAA 3NRYA 1D0XA 3ZMVB 3RX6A 3ZCJA 5F3JA 5JREA 3F57A 4YJ2E 3LK2B 4PFOA 4KUMB 3RC8A 4PK5A 5L3GB 2MTQA 3LG7A 2J1DG 5JDFA 5FXVA 3Q2MA 3RYFE 2JQQA 3NRXA 2E9XC 1WLXA 4EYUA 2BVLA 3E22E 4DO0A 2KNDA 3C4XA 5DJQC 4YFSA 3C64A 4H9RC 3RKOA 1LRZA 1MIVA 2XAGB 2I59A 3KBUA 2DWGA 5FYMA 3WI3A 4GK5E 3SWHA 3VU7H 3ZMUB 4DVDA 1MNDA 2K24A 2XASB 3I0OA 3P7IA 4ZHQE 2Q9QD 4TZ4C 4IE4A 4QKNA 2C5KT 5FXXA 3HKBE 3N9OA 1WR6A 4QX7B 4XBFB 3K3QC 3ETUA 5FMNA 4KMCA 1G8XA 4AQFC 1MIYA 4MHCA 4HTEA 1IZNB 3FBLA 3A5XA 1MMGA 3AVSA 4HFVA 3DJBA 4X1IE 5FNVE 3RPUA 5JR9B 1UX4A 2V7IA 2KWIB 5LA6E 3EUHA 3AB3B 5JRCA 3ZYKA 4UF0B 1WYBA 4ZS3A 3PTRB 4GIWA 5AFUL 4UVCB 2CE7A 5JDGA 4V1Av 2MBGA 5HWYA 5JDLA 4CXWA 5IYZE 2PBIA 1QUUA 2A3DA 3KDSE 4UELA 1ZKEA 2KXPB 3PU3A 2LSJA 3F31A 3N5LA 2LJLA 2KLQA 4BAYB 3ONXA 4A56A 2C0SA 3MK7C 4J2CA 3B57A 3CX8B 3N9QA 4M1PA 4N78D 1BR0A 5EK4A 3DTOA 2KT9A 2E9XB 2M67A 2ZMAA 5EK3A 3UULA 3ZYLA 4JLEA 2K5BB 4WW0A 4CQIA 4G63A 1HG2A 2CLYC 2V7KA 2VKOA 3TKLB 5JQGE 2WM9A 2SPCA 2EHOC 3SS1A 1VOMA 2XQYA 2CEAA 3MXZA 3MKDA 4UXNB 4QXBB 5IHYA 4QWNB 4IE7A 4TN7B 3P8CD 3KV6A 4DBRA 2CA5A 3AA7B 3VHLA 3CQCB 4CXYA 3QC9A 5TAOA 3CKDA 2W62A 3J9X1 2WBLA 2ZM2A 4ERRA 3CWZB 2KZ7B 4H63H 4IDZA 3R6NA 1LKXA 4HGAA 2E8IA 2KMFA 2DLRA 2ODVA 4XAXB 4DNDA 4G2AA 1LVFA 2NP9A 2A2FX 1HX8A 2HPJA 4OYJA 4OFZA 2W63A 3MJXA 3ZC1A 5J2UE 1D1CA 5HXEA 2E9XA 2MYSA 4ZI3D 1YW0A 1MMNA 4DMWA 5HAXA 3ZN1B 2N1GA 1UCUA 4ZS2A 2CWOA 2D0UA 1KNZA 4HE8A 4TV8E 5BMVE 3JC6C 4PJLA 3SRZA 2ODUA 1KK7A 2X51A 5KDMC 3QUJA 4CXXA 4FJOA 1WRDA 1VRBA 4P09A 5ADXL 4AQFA 1Z0PA 1HFAA 2XAQB 3CQXC 4DMVA 5HXSA 5KMGP 2IC6A 3FXDB 2CWYA 3FB2A 2YU1A 5L3EB 4UVBB 2N2NA 2VK9A 4AKRB 3RRWA 2X68A 4AKGA 2VKHA 4WBNE 2QA7A 2LE8A 4YJ3E 3O1IA 5JRCB 4Z8XA 4CZZB 2N9DA 2IC9A 1NWMX 2CXLA 2HH7A 3HKDE 2LSYA 4P0AA 2ZLYA 4PW8A 3WAJA 1QSDA 2BVMA 4GYSA 1S35A 3V5SA 1BR2A 2CCQA 4I43B 2DWKA 2CMRA 2X9YA 5JDQA 5J2TE 5EK2A 4BA9A 4OYKA 2CXDA 5A1LA 2PJQA 3MACA 2H7OA 1FMVA 2IAKA 2XUEA 2LEHA 2RP4A 4ASKA 1S94A 4H9PC 2L9QA 3O1JA 2EHOA 4TV9E 2X67A 5JVDE 1US7B 3KV5A 5C8YE 3L09A 5LGTB 3GN5A 4AKLA 2YINA 4ZI2D 3MZKB 3BK9A 3FHNA 1YKEB 5FY0A 2VB6A 4AQGA 2JMKA 3OKQA 3CMLA 3PUGA 4ZI7E 3NZQA 2H7VC 4KBMB 1OWAA 2YK0A 3PE0A 4PJJA 3I1AA 2LSKA 3AVRA 3C50A 5JDHA 3N9NA 4KP3C 5E0OA 2Q9QC 3K3NA 3HKCE 3QK6A 3HR0A 3IEEA 1YKHB 4HKAA 1ZEEA 3T8OA 5LHGB 3PUSA 3C51A 1U5PA 3I9WA 1D0YA 5L3CB 1G73A 3IF8B 4I55E 3MA9A 4FI5A 4EZHA 5GONE 3ANWB 4IE0A 4K0UA 2V7JA 5LJMA 2HPLA 1B7TA 1EZ3A 1HCIA 2K9AA 3OYZA 3C4ZA 4MBQA 4O2BE 5HXCA 3RYHE 4AI6A 4QX8B 1FMWA 1IJ5A 2NWBA 3O1HA 1WYCA 4EYYR 4O2AE 5L3DB 2BZBA 4X1KE 2NTYA 2CXFA 4E7ZA 3KV9A 2DHRA 5DABA 3ZJ1A 4P0BA 2Z6EA 1E1HB 4PK6A 3FBZA 3UTKA 5CA1E 4ILUA 3OJAA 1LVKA 4PNIA 2PFVA 2XAFB 3CQGB 4QXHB 3RYCE 3CPZA 5LGNB 5LP6E 1HG5A 3N2KE 3VKGA 3KINB 1H7CA 2XAHB 5LCYA 2B1EA 4ADZA 2V26A 2PG8A 3F2EA 4PAGA 3IBPA 3U78A 2L3LA 3K3OA 4C91A 1MIWA 4EOZB 4ISTA 4O4IE 3KBTA 3ANWA 2UXXB 4TUYE 3ZC0A 2DCFA 2VASA 3BQIA 5JDNA 3EDVA 5LJNA 3J7Yq 5LYJE 2QGSA 2D2SA 4PJNA 3LBXA 4UEMA 2WMNA 3ESLA 2V1DB 4L9IA 1MMAA 2JRKA 3D0TA 4HEAA 2C5JA 2NTXA 5FP3A 2VL8A 3S4UA 3ZJ2A 3C98B 3GA8A 3PUQA 2UXNB 3PUAA 1HTJF 2BDEA 3AA0B 4YLHA 3CX7B 3I0QA 2CLYB 4H9SE 3CVRA 4IGUA 2P9BA 4UV9B 5JDMA 2EHOB 4ZI3C 4EIWA 3LJCA 1MNEA 4I50E 3K8PC 4IE5A 5ETWA 5JR9C 3PDYA 4IHJE 3RRCA 2Y6XA 2E9XD 1OXZA 3GN5B 3VKHA 2DI4A 3UUMA 2WSSV 2X9XA 3FXEB 4PK4A 1IAPA 3BQKA 3Q5WA 4TX5A 4X20E 2LM9A 5FY1A 5J1GA 4U74A 3GWHA 3UUNA 2LT3A 3RYIE 1D1BA 2GK9A 1D1AA 4EZ4A 4EB6E 2Q9QA 2LOSA 2H3RA 5LNKA 4F6RC 3BQLA 4H9NC 4O8SA 4EAHA 4UV8B 4CI2B 2WWUA 3N9LA 4MFRA 4X1YE 2Y8DA 4GK0E 2JMHA 5HYAA 4L5GA 4C90A 5LXTE 3AAEB 2LHNA 3GMIA 4ANJA 2V7MA 2CM0A 3E0ZA 2X9HA 3N2OA 3V5UA 1BR1A 3HI2A 3KV4A 3KVBA 2IW5B 1AJ3A 4HN9A 2YU2A 1T98A 2ACXA 2VKJA 2VKDA 4OK0A 4H9QC 1SHZC 4AKIA 3ZPOA 4IE6A 4E7SA 4AXPA 5FY7A 5HWXA 3B13A 3N2GE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q9Q B;  2E9X A;  2E9X D;  3ANW A;  2EHO B;  3JC6 D;  2Q9Q C;  2EHO A; 
#chains in the Genus database with same CATH topology
 3EDU A;  4KHP T;  4CI1 B;  2LSG A;  3ZT7 A;  2B76 A;  4H63 V;  4ZI2 C;  2EHO D;  5LGU B;  3RH3 A;  4ISS A;  2W4X A;  5M4Y A;  2UUC T;  2XQ6 A;  3UFE A;  2X0Y A;  2X66 A;  4MLK A;  4NUU A;  5FVL A;  1XMQ T;  3LBX B;  3ZMZ B;  3EVY A;  4DR3 T;  2YEV C;  4X5T A;  3PU8 A;  3PUR A;  5LMN T;  3IHR A;  5L3F B;  3LK4 2;  2NW9 A;  2NW7 A;  5LHI B;  4I4T E;  2W0G A;  2LHR A;  1Y64 B;  2QYW A;  3ZMT B;  1SE7 A;  3HKE E;  2RA1 A;  2KWH A;  1FIO A;  5H6R B;  1UX5 A;  1E2A A;  2NW8 A;  2XHE B;  1ZV4 X;  2M6B A;  3P4W A;  3I9Y A;  4LF4 T;  3RC3 A;  4YHJ A;  1V9D A;  2YN6 A;  2DNX A;  5H6Q B;  3ZST A;  4AKH A;  3HA4 A;  2H89 A;  4QXC B;  3OBV E;  5HXH A;  3Q9D A;  2ZM8 A;  5F8P A;  4PJM A;  3AE7 A;  4UIG A;  3LFM A;  4NUV A;  2K48 A;  5FXZ A;  5LHH B;  3NRY A;  1Z8U A;  2BS2 A;  1N34 T;  5F3J A;  3VR9 A;  4YJ2 E;  4AIU A;  2MPK A;  3RC8 A;  4U7I A;  4TNV A;  5FXV A;  3NRX A;  2E9X C;  1UUS A;  5HCJ A;  3C4X A;  4H9R C;  3KBU A;  2DWG A;  5FYM A;  4GK5 E;  3VU7 H;  2XQ5 A;  1MND A;  2DL1 A;  2CHN A;  1KNP A;  3I0O A;  2YDQ A;  4ZHQ E;  3AEG A;  3N9O A;  4QX7 B;  3K3Q C;  4KMC A;  2R6G F;  4HTE A;  3AVS A;  4X1I E;  3UQ7 A;  3JAE A;  3QNU A;  3EUH A;  2VUR A;  4KX6 A;  2A9U A;  4NIQ A;  3PTR B;  3OTO T;  4CXW A;  2PBI A;  3KDS E;  5HEH A;  3P4S A;  4JI6 T;  3AE9 A;  3UFG A;  2WB5 A;  4N78 D;  2YDS A;  3UUL A;  2KT9 A;  2CPT A;  2XJ7 A;  4JLE A;  4WW0 A;  4JI5 T;  4G63 A;  2VKO A;  3TKL B;  2EHO C;  1VOM A;  2CEA A;  2YOE A;  5IHY A;  5AQK B;  4IE7 A;  3P8C D;  4DBR A;  2W62 A;  3R6N A;  3OPC A;  4HGA A;  3ZT5 A;  2VQE T;  2KMF A;  2UUA T;  3ZC1 A;  2I0M A;  3TLS A;  2MYS A;  2CRB A;  4IDQ A;  1N33 T;  4DMW A;  3L8R A;  3ZN1 B;  1KEY A;  4A97 A;  2FJE A;  2D0U A;  1KNZ A;  4TV8 E;  5BMV E;  3SRZ A;  2WQY A;  1KK7 A;  4CXX A;  1WRD A;  1VRB A;  2V6X A;  4DMV A;  5HXS A;  5KMG P;  2XQ4 A;  4UVB B;  4AKR B;  3RRW A;  1YXR A;  2VKH A;  2H88 A;  2LE8 A;  2N9D A;  4LF5 T;  4DR4 T;  2V5C A;  2LSY A;  2ZLY A;  1QSD A;  1BR2 A;  2CCQ A;  3A7M A;  2VVS A;  4BA9 A;  2CXD A;  2PJQ A;  4LFC T;  2IAK A;  2BG9 A;  2RP4 A;  4ASK A;  3IA3 A;  3UU5 A;  2WP9 A;  2L9Q A;  3RLF F;  3O1J A;  1M62 A;  5LGT B;  3BK9 A;  2JMK A;  3OKQ A;  3NZQ A;  2H7V C;  1OWA A;  3PE0 A;  3I1A A;  3C50 A;  5E0O A;  3IEE A;  1YKH B;  5FKY A;  5ABH A;  5LHG B;  3PUS A;  2RPA A;  1D0Y A;  5L3C B;  1G73 A;  5ABF A;  1XWM A;  5HXC A;  2NWB A;  4EYY R;  2BZB A;  2CXF A;  4JBW F;  4P0B A;  2Z6E A;  4PK6 A;  2XAF B;  4QXH B;  3RYC E;  5LP6 E;  1HG5 A;  3VKG A;  4LF6 T;  2B1E A;  3QOF A;  4ADZ A;  3F2E A;  4EOZ B;  4O4I E;  3ANW A;  2UXX B;  1ZOY A;  3ZSS A;  2DCF A;  3ZC0 A;  5LJN A;  5LYJ E;  3RI5 A;  4X64 T;  3T1Y T;  2C5J A;  3GA8 A;  4IRE A;  2BG9 B;  1HTJ F;  2BDE A;  3AEB A;  4YLH A;  2WWV A;  4EIW A;  4DR7 T;  5ETW A;  4IHJ E;  3RRC A;  4HFI A;  3VKH A;  3SFE A;  2X9X A;  4PK4 A;  4YXD A;  5J1G A;  4X20 E;  3UUN A;  2CBI A;  1D1B A;  4EB6 E;  1WFD A;  5AQI B;  3NWI A;  4O8S A;  2WWU A;  2UU9 T;  4C90 A;  2I6H A;  2XPK A;  3LSV A;  4ANJ A;  4HFC A;  3E0Z A;  3RF1 A;  3KVB A;  2YU2 A;  1T98 A;  2VKJ A;  2VKD A;  4OK0 A;  1SHZ C;  2JQK A;  1E7P A;  2WY2 A;  5HWX A;  3RYI E;  3N9P A;  3H3A A;  3EAM A;  1OED A;  4EXT A;  1MMD A;  2V7L A;  5LG4 A;  3ZEF B;  2NOX A;  4O4H E;  5CA0 E;  4DV6 T;  1WR0 A;  5HEO A;  3PUV F;  3M3Z B;  4I0U A;  1O3X A;  2UUB T;  2G0U A;  4XZC A;  2C5I T;  2UXB T;  3HL6 A;  3ZN0 B;  1XDP A;  1XZY A;  5HXR A;  1NEK A;  1CHU A;  3W15 B;  5L3B B;  4GYR A;  2Y48 B;  2CBJ A;  1N32 T;  3O4X E;  2E5V A;  2X0L B;  4GOU A;  4DR5 T;  1FJG T;  1NEN A;  1YD8 G;  1X79 A;  4PFP A;  5LBM A;  4JEH B;  5CB4 E;  4NXM T;  4U72 A;  4NXN T;  5C2T A;  2WZI A;  3RX6 A;  2WDQ A;  1OED E;  4IDN A;  4PK5 A;  5L3G B;  3LG7 A;  3RYF E;  2JQQ A;  4EEB A;  3E22 E;  1T7S A;  3ONJ A;  1LRZ A;  2YDR A;  2XAG B;  2I59 A;  3WI3 A;  4LFB T;  3P7I A;  1VCS A;  5FXX A;  1R8I A;  3HKB E;  1WR6 A;  4XBF B;  3ETU A;  1G8X A;  3FBL A;  3A5X A;  2W66 A;  1HNX T;  4HFV A;  2VVN A;  2V7I A;  5JRC A;  4JI7 T;  4YSZ A;  5AFU L;  4UVC B;  2CE7 A;  2LSJ A;  2ACZ A;  3ONX A;  2BS4 A;  3B57 A;  4M1P A;  4Z90 A;  1J1J A;  5AQH B;  2M67 A;  5EK3 A;  5FL0 A;  1HG2 A;  3JAF A;  2WM9 A;  4Q25 A;  2XQY A;  4UXN B;  4QXB B;  4QWN B;  3AA7 B;  5TAO A;  3J9X 1;  4ERR A;  2KZ7 B;  1LKX A;  2E8I A;  5AQM B;  1XNR T;  1GQE A;  2ODV A;  4G2A A;  4DR1 T;  2XY8 B;  4GKJ T;  2HN1 A;  4HWD A;  1HX8 A;  4ILA A;  3MJX A;  5J2U E;  1D1C A;  5AQP B;  5HXE A;  1XNQ T;  3NKZ A;  1YW0 A;  2WZH A;  3UU6 A;  1UCU A;  4ZS2 A;  2CWO A;  4HE8 A;  2ODU A;  1N36 T;  5KDM C;  3QUJ A;  2WU2 A;  4ZEY A;  1Z0P A;  1HFA A;  4WZX A;  2IC6 A;  2YU1 A;  1JNR A;  2VK9 A;  3EI0 A;  4YTM A;  4U3C A;  3O1I A;  5JRC B;  2XM1 A;  4Z8X A;  4CZZ B;  2HH7 A;  1I94 T;  2IHR 1;  4Z91 A;  1J5E T;  4P0A A;  3WAJ A;  4QH1 A;  3P4P A;  1T72 A;  3V5S A;  2X9Y A;  4UR9 A;  1KNR A;  5A1L A;  4OYK A;  4U7Y A;  2XUE A;  4H9P C;  1VCT A;  4A5X A;  2AE9 A;  2X67 A;  5C8Y E;  4LMK A;  3GN5 A;  4AKL A;  4K0K T;  3FHN A;  1YKE B;  3P4R A;  5FY0 A;  4AQG A;  3CML A;  5F5W A;  4ZI7 E;  2YK0 A;  5JDH A;  3N9N A;  2IML A;  3K3N A;  3QK6 A;  3RIF A;  3PUZ F;  3NVO A;  2WDR A;  4YSX A;  3QB5 K;  2V7J A;  2HPL A;  1EZ3 A;  1HCI A;  3C4Z A;  1WYC A;  3JCF A;  4O2A E;  5L3D B;  2NTY A;  4E7Z A;  2YKS A;  5CA1 E;  4YTN A;  4HWF A;  5LGN B;  1OED C;  1H7C A;  2XAH B;  5L4E A;  4C91 A;  3K3O A;  3AXJ B;  3KBT A;  3AE1 A;  1JNZ A;  1DU2 A;  3AE6 A;  5LB7 B;  2D2S A;  4PJN A;  3ESL A;  1MMA A;  3ZJ2 A;  3PUQ A;  3PUA A;  2BBH A;  1HR0 T;  2XM2 A;  4UV9 B;  4IGU A;  4IE5 A;  1UUR A;  2Y6X A;  3GN5 B;  3PUY F;  2WSS V;  3FXE B;  3Q5W A;  3BQK A;  2LM9 A;  1IBK T;  4U74 A;  1D1A A;  3K1S A;  2H3R A;  3AED A;  2W67 A;  4UV8 B;  4JI4 T;  3N9L A;  4X1Y E;  2JMH A;  4YHH T;  2IIU A;  2X9H A;  3N2O A;  3V5U A;  5AQO B;  2LLY A;  2IW5 B;  1AJ3 A;  4AKI A;  4IE6 A;  1W0B A;  4AXP A;  3B13 A;  5LBQ B;  3AE8 A;  4O4J E;  3KFW X;  3Q5X A;  2K3W A;  3AE3 A;  3AA6 B;  4LFA T;  3E08 A;  5FXW A;  2OA5 A;  2WAU A;  4U2Z A;  5L2L A;  1IBL T;  3AAA B;  2FUP A;  5EZY E;  2JJ9 A;  2A72 A;  3R84 B;  4CI3 B;  1UK5 A;  2LSI A;  2XQ3 A;  4DV2 T;  4ZOL E;  2L8K A;  2LRL A;  2W61 A;  4IDP A;  2ES0 A;  4YT0 A;  2CHO A;  1U4Q A;  5JR9 A;  1WCR A;  5KX5 E;  4WNK A;  3JC6 D;  2VL0 A;  5AQJ B;  5DQV A;  4JI3 T;  3CX6 B;  5HEU A;  4QHO A;  2OLT A;  3OYX A;  1BR4 A;  4ILB A;  4JUY A;  2D0T A;  4WBO A;  3UUX B;  2J4G A;  3M65 A;  2BG9 E;  3OVU A;  2UXC T;  1SA0 E;  1D0Z A;  4DBQ A;  4WYV A;  3ETV A;  4BJN A;  2MOZ A;  4JEU B;  2W00 A;  3AAI A;  4H9O C;  3ZCI A;  4B6X A;  2JIW A;  2LOP A;  4O4L E;  2VWA A;  3ZCJ A;  3LK2 B;  4PFO A;  4DV1 T;  2J1D G;  5JDF A;  3FZH B;  1WLX A;  1UGO A;  2BVL A;  4LML A;  4YFS A;  5CFB A;  1ZP0 A;  3SWH A;  4IE4 A;  4LF9 T;  5FMN A;  5FL1 A;  1MIY A;  2WDV A;  1IZN B;  2UXD T;  1MMG A;  3QB5 A;  5FNV E;  3RPU A;  5JR9 B;  3RHW A;  2KWI B;  5LA6 E;  3P50 A;  3AB3 B;  3JAD A;  3EAB A;  1WYB A;  4ZS3 A;  4GIW A;  5AQU B;  2MBG A;  5HWY A;  5JDL A;  5AQL B;  1QUU A;  4UEL A;  1ZKE A;  2KXP B;  3F31 A;  3N5L A;  3EHZ A;  2LJL A;  4J2C A;  3N9Q A;  1BR0 A;  5EK4 A;  3DTO A;  2E9X B;  4CQI A;  2ZMA A;  4TWH A;  2V7K A;  5JQG E;  3MXZ A;  4CXY A;  3QC9 A;  3CKD A;  2ZM2 A;  4DND A;  1W09 A;  1LVF A;  1XDO A;  2NP9 A;  2W63 A;  2HN2 A;  5C3J A;  1MMN A;  3PJA J;  5HAX A;  2LKG A;  3JC6 C;  3VR8 A;  4EED A;  2QVA A;  4YY3 T;  4FJO A;  4P09 A;  4DV4 T;  5ADX L;  4AQF A;  2CWY A;  2KSR A;  3FB2 A;  4HWC A;  2N2N A;  2ZM6 T;  3L39 A;  2QA7 A;  2IC9 A;  1NWM X;  2CXL A;  4PW8 A;  4CN1 A;  4X62 T;  4GYS A;  2DWK A;  3AE5 A;  2CMR A;  1SUM B;  5J2T E;  3AEA A;  1M7K A;  1FMV A;  4EV6 A;  3UU4 A;  2LEH A;  2AXD S;  1S94 A;  3SFD A;  5JVD E;  3KV5 A;  2PTF A;  3RIA A;  2XSB A;  4PJJ A;  5ABG A;  3P4Q A;  2LSK A;  4JI2 T;  4A98 A;  4KP3 C;  2OV9 A;  4HKA A;  2XQ9 A;  3C51 A;  1U5P A;  3I9W A;  3ZT6 A;  3MA9 A;  4EZH A;  2BG9 C;  3RGL A;  4K0U A;  2F4V T;  2XZE A;  4MBQ A;  3OYZ A;  3RYH E;  4AI6 A;  4ZZB A;  4QX8 B;  1FMW A;  3O1H A;  4TNW A;  2XQ8 A;  3KV9 A;  4JI1 T;  5DAB A;  4GKK T;  3ZJ1 A;  1E1H B;  4ILU A;  1LVK A;  2VQF T;  3FZF B;  3CQG B;  4HWI B;  3RQU A;  5HEJ A;  2QRX A;  3N2K E;  3VRA A;  2V26 A;  4PAG A;  4IL9 A;  3IBP A;  3U78 A;  2L3L A;  2IDO B;  1Y01 A;  4TUY E;  3BQI A;  5JDN A;  4P1N A;  3EDV A;  1KFY A;  3UU8 A;  3LDQ B;  2V1D B;  4JI0 T;  3D0T A;  2WU5 A;  4HEA A;  5FP3 A;  2VL8 A;  3S4U A;  4HWH A;  3AA0 B;  3I0Q A;  5AQN B;  2CLY B;  4H9S E;  3CVR A;  2W2U A;  3CK6 A;  2E2A A;  1T8B A;  3LJC A;  3K8P C;  5JR9 C;  3PDY A;  2J62 A;  1OXZ A;  2LRK A;  2DI4 A;  3AXJ A;  4X65 T;  5AQR B;  4TX5 A;  5FY1 A;  3AE2 A;  3PUW F;  2V6Y B;  2GK9 A;  4EZ4 A;  2Q9Q A;  2LOS A;  4U2Y A;  4F6R C;  3BQL A;  4H9N C;  1L0V A;  1HNW T;  2Y8D A;  3AEF A;  5FVK A;  4YSY A;  3ABV A;  4TWF A;  3AAE B;  3FZL B;  3GMI A;  5ABE A;  3HI2 A;  3KV4 A;  3UUB A;  2J47 A;  2LM2 A;  3TLU A;  5CGM A;  4JI8 T;  5LOV E;  3LK3 B;  1HF8 A;  5L47 A;  2XQA A;  2E5L T;  4JYA T;  5HCM A;  3UU3 A;  5JH7 E;  1NAF A;  4L0R A;  4DV7 T;  4OX9 T;  2XTL A;  3AA1 B;  2FBW A;  3RIU A;  4U33 A;  3SOL A;  1FEW A;  3ZKR A;  3AEC A;  4DUZ T;  2D5U A;  3ZYM A;  1IJ6 A;  2WMO A;  3O9X A;  4CN4 A;  2XAJ B;  1HS7 A;  3H37 A;  1I6Z A;  2FJB A;  4AQY T;  2MAW A;  3NZP A;  3RQW A;  3L3P A;  4IIJ E;  1W0A A;  4UVA B;  4KI0 F;  3N9M A;  3RKG A;  1CUN A;  2BKN A;  2ZM0 A;  5HEG A;  4UF0 A;  4HFE A;  4MAL A;  1W9R A;  4BJM A;  2Q9Q B;  2D9D A;  3KVA A;  3AEE A;  2KIN B;  2BKP A;  4IDO A;  3DP7 A;  4DR2 T;  2WCA A;  1YQ3 A;  4NPP A;  4DV3 T;  4IT4 A;  3A8Y C;  2IUB A;  4F8H A;  3U3I A;  3UT5 E;  4OHF A;  1J5W A;  1ZHC A;  2X9W A;  5AQS B;  1QLB A;  3ZMS B;  3NBX X;  2JPF A;  3C4W A;  4KHZ F;  3WAK A;  5DQW A;  3ZLI A;  5BR8 T;  2BS3 A;  1D0X A;  3ZMV B;  5JRE A;  3F57 A;  4KUM B;  2MTQ A;  3Q2M A;  2JQ9 A;  4EYU A;  4DO0 A;  2KND A;  5DJQ C;  3C64 A;  4COF A;  3RKO A;  1MIV A;  3ZMU B;  4DVD A;  2K24 A;  5AQG B;  4HFB A;  2XAS B;  2FJA A;  3CIR A;  2Q9Q D;  4TZ4 C;  4ILC A;  4QKN A;  2C5K T;  3TLT A;  5LG3 A;  4AQF C;  4MHC A;  3DJB A;  3FZK B;  5J0Z A;  1UX4 A;  3B5M A;  3TLV A;  3ZYK A;  4UF0 B;  3Q5D A;  4U31 A;  5JDG A;  4V1A v;  4QH5 A;  5IYZ E;  2A3D A;  3PU3 A;  5CJ5 A;  4LF8 T;  2KLQ A;  4BAY B;  4A56 A;  2FJD A;  2C0S A;  3MK7 C;  3CX8 B;  5IUX A;  1IBM T;  4DUY T;  2LKH A;  3ZYL A;  2K5B B;  2CLY C;  2SPC A;  3SS1 A;  4AIS A;  3MKD A;  4TN7 B;  3KV6 A;  4DR6 T;  2CA5 A;  3VHL A;  2X0H A;  3CQC B;  5AQQ B;  2XQ7 A;  2WBL A;  3G06 A;  4LF7 T;  3CWZ B;  4H63 H;  4IDZ A;  2DLR A;  4XAX B;  5AQF B;  4X66 T;  2A2F X;  2HPJ A;  4OYJ A;  4OFZ A;  5KXJ A;  5IWA T;  2HHH T;  2E9X A;  4ZI3 D;  1HNZ T;  2N1G A;  3X1D A;  2BBJ A;  5L4H A;  4DID B;  3PJA A;  4PJL A;  2X51 A;  2XAQ B;  3CQX C;  5L3E B;  3FXD B;  2M6I A;  3UQ4 A;  2V5D A;  3FZM B;  2X68 A;  4AKG A;  2XSA A;  4WBN E;  4YJ3 E;  4YTP A;  4HFH A;  5JTG A;  3HKD E;  2WS3 A;  2BVM A;  1S35 A;  4I43 B;  5JDQ A;  5EK2 A;  3MAC A;  2H7O A;  5ABF B;  4QH4 A;  4TWD A;  2EHO A;  3PV0 F;  4TV9 E;  1US7 B;  3L09 A;  2YIN A;  4ZI2 D;  3MZK B;  3TLW A;  2VB6 A;  3PUG A;  4KBM B;  3VRB A;  3ONL C;  1HX1 B;  3AVR A;  2Q9Q C;  3HKC E;  3HR0 A;  1ZEE A;  3T8O A;  3H3M A;  3IF8 B;  4I55 E;  4ZXL A;  4IL4 A;  4FI5 A;  5GON E;  3ANW B;  4IE0 A;  5LJM A;  1B7T A;  2K9A A;  4O2B E;  4LMJ A;  1IJ5 A;  2NR4 A;  4X1K E;  2DHR A;  4B3T T;  3AE4 A;  3FBZ A;  2JQH A;  3UTK A;  3OJA A;  4PNI A;  2PFV A;  1X9B A;  3CPZ A;  3KIN B;  5LCY A;  2PG8 A;  4EGW A;  1MIW A;  4IST A;  4B3M T;  2VAS A;  3RIU C;  4ZZC A;  3J7Y q;  2QGS A;  3LBX A;  4UEM A;  2WMN A;  4B3S T;  1KF6 A;  4L9I A;  2JRK A;  2NTX A;  4CN6 A;  3C98 B;  2UXN B;  3CX7 B;  5JDM A;  2P9B A;  2EHO B;  4ZI3 C;  3Q5E A;  4DV5 T;  1MNE A;  4I50 E;  4JV5 T;  2E9X D;  5AQV B;  4HFD A;  3UUM A;  1IAP A;  3GWH A;  2V8S V;  2LT3 A;  4B3R T;  1XMO T;  5LMU T;  5LNK A;  4EAH A;  1OED B;  4CI2 B;  3PUX F;  4MFR A;  4GK0 E;  5HYA A;  4L5G A;  5LXT E;  2LHN A;  2BKO A;  2V7M A;  2CM0 A;  5AQT B;  1BR1 A;  4HN9 A;  2ACX A;  4H9Q C;  4DV0 T;  1YQ4 A;  3T1H T;  3ZPO A;  4E7S A;  2V6Y A;  5FY7 A;  3N2G E; 
#chains in the Genus database with same CATH homology
 3N9P A;  5LBQ B;  4O4J E;  5LOV E;  3H3A A;  1HF8 A;  3EDU A;  3KFW X;  3LK3 B;  3Q5X A;  4EXT A;  3AA6 B;  3E08 A;  1MMD A;  2V7L A;  5LG4 A;  5JH7 E;  5FXW A;  4CI1 B;  1NAF A;  2LSG A;  4L0R A;  3ZEF B;  2OA5 A;  2NOX A;  2WAU A;  4H63 V;  4ZI2 C;  2EHO D;  5L2L A;  5LGU B;  3RH3 A;  4O4H E;  4ISS A;  2XTL A;  3AA1 B;  5M4Y A;  3AAA B;  3SOL A;  5CA0 E;  1FEW A;  5EZY E;  2JJ9 A;  2X66 A;  4MLK A;  4NUU A;  3UFE A;  3LBX B;  3ZMZ B;  3EVY A;  2D5U A;  3ZYM A;  1IJ6 A;  2WMO A;  2A72 A;  2YEV C;  3R84 B;  4CI3 B;  3O9X A;  2XAJ B;  3PU8 A;  3H37 A;  3PUR A;  1HS7 A;  2LSI A;  3NZP A;  1O3X A;  3IHR A;  2G0U A;  4XZC A;  2C5I T;  4ZOL E;  2L8K A;  3L3P A;  5L3F B;  3LK4 2;  3HL6 A;  4IIJ E;  2W61 A;  2NW9 A;  3ZN0 B;  2ES0 A;  2NW7 A;  5HXR A;  5LHI B;  1U4Q A;  4I4T E;  4UVA B;  2W0G A;  5JR9 A;  2LHR A;  1Y64 B;  3N9M A;  1CUN A;  3ZMT B;  3W15 B;  5L3B B;  3HKE E;  2RA1 A;  4GYR A;  2ZM0 A;  4UF0 A;  2KWH A;  2Y48 B;  5KX5 E;  1FIO A;  5H6R B;  4WNK A;  4MAL A;  3JC6 D;  1UX5 A;  3O4X E;  4BJM A;  2Q9Q B;  3KVA A;  2NW8 A;  5DQV A;  2XHE B;  3CX6 B;  1ZV4 X;  2KIN B;  4QHO A;  3DP7 A;  3OYX A;  1BR4 A;  3I9Y A;  4JUY A;  3RC3 A;  2D0T A;  4YHJ A;  1V9D A;  2DNX A;  4WBO A;  3UUX B;  5H6Q B;  2X0L B;  3M65 A;  3U3I A;  4AKH A;  4GOU A;  3UT5 E;  4OHF A;  1SA0 E;  1ZHC A;  3HA4 A;  1D0Z A;  2X9W A;  4DBQ A;  4QXC B;  3OBV E;  5HXH A;  3Q9D A;  2ZM8 A;  1YD8 G;  1X79 A;  4PFP A;  5F8P A;  3ETV A;  5LBM A;  3ZMS B;  4JEH B;  5CB4 E;  4BJN A;  4PJM A;  2MOZ A;  3NBX X;  4UIG A;  4JEU B;  3LFM A;  2JPF A;  2W00 A;  3AAI A;  4NUV A;  4H9O C;  2K48 A;  3ZCI A;  3C4W A;  3WAK A;  4B6X A;  2LOP A;  5FXZ A;  4U72 A;  5DQW A;  5LHH B;  3ZLI A;  4O4L E;  2VWA A;  3NRY A;  1D0X A;  3ZMV B;  3RX6 A;  3ZCJ A;  5F3J A;  5JRE A;  3F57 A;  4YJ2 E;  3LK2 B;  4PFO A;  4KUM B;  3RC8 A;  4PK5 A;  5L3G B;  2MTQ A;  3LG7 A;  2J1D G;  5JDF A;  5FXV A;  3Q2M A;  3RYF E;  2JQQ A;  3NRX A;  2E9X C;  1WLX A;  4EYU A;  2BVL A;  3E22 E;  4DO0 A;  2KND A;  3C4X A;  5DJQ C;  4YFS A;  3C64 A;  4H9R C;  3RKO A;  1LRZ A;  1MIV A;  2XAG B;  2I59 A;  3KBU A;  2DWG A;  5FYM A;  3WI3 A;  4GK5 E;  3SWH A;  3VU7 H;  3ZMU B;  4DVD A;  1MND A;  2K24 A;  2XAS B;  3I0O A;  3P7I A;  4ZHQ E;  2Q9Q D;  4TZ4 C;  4IE4 A;  4QKN A;  2C5K T;  5FXX A;  3HKB E;  3N9O A;  1WR6 A;  4QX7 B;  4XBF B;  3K3Q C;  3ETU A;  5FMN A;  4KMC A;  1G8X A;  4AQF C;  1MIY A;  4MHC A;  4HTE A;  1IZN B;  3FBL A;  3A5X A;  1MMG A;  3AVS A;  4HFV A;  3DJB A;  4X1I E;  5FNV E;  3RPU A;  5JR9 B;  1UX4 A;  2V7I A;  2KWI B;  5LA6 E;  3EUH A;  3AB3 B;  5JRC A;  3ZYK A;  4UF0 B;  1WYB A;  4ZS3 A;  3PTR B;  4GIW A;  5AFU L;  4UVC B;  2CE7 A;  5JDG A;  4V1A v;  2MBG A;  5HWY A;  5JDL A;  4CXW A;  5IYZ E;  2PBI A;  1QUU A;  2A3D A;  3KDS E;  4UEL A;  1ZKE A;  2KXP B;  3PU3 A;  2LSJ A;  3F31 A;  3N5L A;  2LJL A;  2KLQ A;  4BAY B;  3ONX A;  4A56 A;  2C0S A;  3MK7 C;  4J2C A;  3B57 A;  3CX8 B;  3N9Q A;  4M1P A;  4N78 D;  1BR0 A;  5EK4 A;  3DTO A;  2KT9 A;  2E9X B;  2M67 A;  2ZMA A;  5EK3 A;  3UUL A;  3ZYL A;  4JLE A;  2K5B B;  4WW0 A;  4CQI A;  4G63 A;  1HG2 A;  2CLY C;  2V7K A;  2VKO A;  3TKL B;  5JQG E;  2WM9 A;  2SPC A;  2EHO C;  3SS1 A;  1VOM A;  2XQY A;  2CEA A;  3MXZ A;  3MKD A;  4UXN B;  4QXB B;  5IHY A;  4QWN B;  4IE7 A;  4TN7 B;  3P8C D;  3KV6 A;  4DBR A;  2CA5 A;  3AA7 B;  3VHL A;  3CQC B;  4CXY A;  3QC9 A;  5TAO A;  3CKD A;  2W62 A;  3J9X 1;  2WBL A;  2ZM2 A;  4ERR A;  3CWZ B;  2KZ7 B;  4H63 H;  4IDZ A;  3R6N A;  1LKX A;  4HGA A;  2E8I A;  2KMF A;  2DLR A;  2ODV A;  4XAX B;  4DND A;  4G2A A;  1LVF A;  2NP9 A;  2A2F X;  1HX8 A;  2HPJ A;  4OYJ A;  4OFZ A;  2W63 A;  3MJX A;  3ZC1 A;  5J2U E;  1D1C A;  5HXE A;  2E9X A;  2MYS A;  4ZI3 D;  1YW0 A;  1MMN A;  4DMW A;  5HAX A;  3ZN1 B;  2N1G A;  1UCU A;  4ZS2 A;  2CWO A;  2D0U A;  1KNZ A;  4HE8 A;  4TV8 E;  5BMV E;  3JC6 C;  4PJL A;  3SRZ A;  2ODU A;  1KK7 A;  2X51 A;  5KDM C;  3QUJ A;  4CXX A;  4FJO A;  1WRD A;  1VRB A;  4P09 A;  5ADX L;  4AQF A;  1Z0P A;  1HFA A;  2XAQ B;  3CQX C;  4DMV A;  5HXS A;  5KMG P;  2IC6 A;  3FXD B;  2CWY A;  3FB2 A;  2YU1 A;  5L3E B;  4UVB B;  2N2N A;  2VK9 A;  4AKR B;  3RRW A;  2X68 A;  4AKG A;  2VKH A;  4WBN E;  2QA7 A;  2LE8 A;  4YJ3 E;  3O1I A;  5JRC B;  4Z8X A;  4CZZ B;  2N9D A;  2IC9 A;  1NWM X;  2CXL A;  2HH7 A;  3HKD E;  2LSY A;  4P0A A;  2ZLY A;  4PW8 A;  3WAJ A;  1QSD A;  2BVM A;  4GYS A;  1S35 A;  3V5S A;  1BR2 A;  2CCQ A;  4I43 B;  2DWK A;  2CMR A;  2X9Y A;  5JDQ A;  5J2T E;  5EK2 A;  4BA9 A;  4OYK A;  2CXD A;  5A1L A;  2PJQ A;  3MAC A;  2H7O A;  1FMV A;  2IAK A;  2XUE A;  2LEH A;  2RP4 A;  4ASK A;  1S94 A;  4H9P C;  2L9Q A;  3O1J A;  2EHO A;  4TV9 E;  2X67 A;  5JVD E;  1US7 B;  3KV5 A;  5C8Y E;  3L09 A;  5LGT B;  3GN5 A;  4AKL A;  2YIN A;  4ZI2 D;  3MZK B;  3BK9 A;  3FHN A;  1YKE B;  5FY0 A;  2VB6 A;  4AQG A;  2JMK A;  3OKQ A;  3CML A;  3PUG A;  4ZI7 E;  3NZQ A;  2H7V C;  4KBM B;  1OWA A;  2YK0 A;  3PE0 A;  4PJJ A;  3I1A A;  2LSK A;  3AVR A;  3C50 A;  5JDH A;  3N9N A;  4KP3 C;  5E0O A;  2Q9Q C;  3K3N A;  3HKC E;  3QK6 A;  3HR0 A;  3IEE A;  1YKH B;  4HKA A;  1ZEE A;  3T8O A;  5LHG B;  3PUS A;  3C51 A;  1U5P A;  3I9W A;  1D0Y A;  5L3C B;  1G73 A;  3IF8 B;  4I55 E;  3MA9 A;  4FI5 A;  4EZH A;  5GON E;  3ANW B;  4IE0 A;  4K0U A;  2V7J A;  5LJM A;  2HPL A;  1B7T A;  1EZ3 A;  1HCI A;  2K9A A;  3OYZ A;  3C4Z A;  4MBQ A;  4O2B E;  5HXC A;  3RYH E;  4AI6 A;  4QX8 B;  1FMW A;  1IJ5 A;  2NWB A;  3O1H A;  1WYC A;  4EYY R;  4O2A E;  5L3D B;  2BZB A;  4X1K E;  2NTY A;  2CXF A;  4E7Z A;  3KV9 A;  2DHR A;  5DAB A;  3ZJ1 A;  4P0B A;  2Z6E A;  1E1H B;  4PK6 A;  3FBZ A;  3UTK A;  5CA1 E;  4ILU A;  3OJA A;  1LVK A;  4PNI A;  2PFV A;  2XAF B;  3CQG B;  4QXH B;  3RYC E;  3CPZ A;  5LGN B;  5LP6 E;  1HG5 A;  3N2K E;  3VKG A;  3KIN B;  1H7C A;  2XAH B;  5LCY A;  2B1E A;  4ADZ A;  2V26 A;  2PG8 A;  3F2E A;  4PAG A;  3IBP A;  3U78 A;  2L3L A;  3K3O A;  4C91 A;  1MIW A;  4EOZ B;  4IST A;  4O4I E;  3KBT A;  3ANW A;  2UXX B;  4TUY E;  3ZC0 A;  2DCF A;  2VAS A;  3BQI A;  5JDN A;  3EDV A;  5LJN A;  3J7Y q;  5LYJ E;  2QGS A;  2D2S A;  4PJN A;  3LBX A;  4UEM A;  2WMN A;  3ESL A;  2V1D B;  4L9I A;  1MMA A;  2JRK A;  3D0T A;  4HEA A;  2C5J A;  2NTX A;  5FP3 A;  2VL8 A;  3S4U A;  3ZJ2 A;  3C98 B;  3GA8 A;  3PUQ A;  2UXN B;  3PUA A;  1HTJ F;  2BDE A;  3AA0 B;  4YLH A;  3CX7 B;  3I0Q A;  2CLY B;  4H9S E;  3CVR A;  4IGU A;  2P9B A;  4UV9 B;  5JDM A;  2EHO B;  4ZI3 C;  4EIW A;  3LJC A;  1MNE A;  4I50 E;  3K8P C;  4IE5 A;  5ETW A;  5JR9 C;  3PDY A;  4IHJ E;  3RRC A;  2Y6X A;  2E9X D;  1OXZ A;  3GN5 B;  3VKH A;  2DI4 A;  3UUM A;  2WSS V;  2X9X A;  3FXE B;  4PK4 A;  1IAP A;  3BQK A;  3Q5W A;  4TX5 A;  4X20 E;  2LM9 A;  5FY1 A;  5J1G A;  4U74 A;  3GWH A;  3UUN A;  2LT3 A;  3RYI E;  1D1B A;  2GK9 A;  1D1A A;  4EZ4 A;  4EB6 E;  2Q9Q A;  2LOS A;  2H3R A;  5LNK A;  4F6R C;  3BQL A;  4H9N C;  4O8S A;  4EAH A;  4UV8 B;  4CI2 B;  2WWU A;  3N9L A;  4MFR A;  4X1Y E;  2Y8D A;  4GK0 E;  2JMH A;  5HYA A;  4L5G A;  4C90 A;  5LXT E;  3AAE B;  2LHN A;  3GMI A;  4ANJ A;  2V7M A;  2CM0 A;  3E0Z A;  2X9H A;  3N2O A;  3V5U A;  1BR1 A;  3HI2 A;  3KV4 A;  3KVB A;  2IW5 B;  1AJ3 A;  4HN9 A;  2YU2 A;  1T98 A;  2ACX A;  2VKJ A;  2VKD A;  4OK0 A;  4H9Q C;  1SHZ C;  4AKI A;  3ZPO A;  4IE6 A;  4E7S A;  4AXP A;  5FY7 A;  5HWX A;  3B13 A;  3N2G E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...