2E9XA

The crystal structure of human gins core complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
144
structure length
144
Chain Sequence
MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSVLPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords DNA replication complex GINS protein PSF1
publication title Structure of the human GINS complex and its assembly and functional interface in replication initiation
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 144
sequence length 144
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1030 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2e9xA01
2E9XA 2E9XD 2EHOB 3ANWA 2Q9QB 2Q9QC 3JC6D 2EHOA
chains in the Genus database with same CATH superfamily
2LOSA 1IZNB 2WDRA 2JQKA 3RYHE 3ZYMA 2NW7A 3HI2A 4PJJA 2ODVA 2HPJA 4WZXA 4IGUA 2MYSA 2PBIA 5FXXA 4MBQA 3U78A 5ABFB 3N9NA 4NXMT 2UXCT 4OHFA 4PFOA 5HEOA 2XM2A 4PAGA 3T1YT 1IBMT 4F8HA 4O2AE 4HFBA 1YKEB 3I9YA 3N2GE 3ONLC 2W4XA 1YXRA 1GQEA 4HE8A 3C50A 4LF5T 2V7IA 1KK7A 3N9PA 5AQFB 3KV4A 1R8IA 1G73A 5AQJB 2XAGB 2C5IT 3EDUA 1US7B 3PUVF 3E0ZA 5KXJA 4IE0A 3P4WA 2WB5A 1B7TA 4JEUB 4U3CA 5FMNA 5LJMA 3HKEE 5FL0A 5DABA 4YFSA 4YSYA 4DV4T 5F3JA 4TV9E 4CZZB 3CKDA 1ZP0A 1HG2A 4HFCA 3CMLA 3A8YC 5C8YE 5LBQB 3GA8A 2YN6A 1KEYA 2VWAA 3OBVE 2BG9A 2DWGA 5JRCB 4GOUA 5KMGP 3AEEA 3HL6A 2A3DA 3C64A 4YTNA 2XUEA 5HEGA 4UELA 2JQHA 3FZKB 4DUYT 2CXFA 2EHOA 2QGSA 5LYJE 2QRXA 2J47A 3ZT7A 2WY2A 3PU3A 1FMWA 4UF0B 2XAFB 4TX5A 1N34T 5AQOB 2V26A 2WDVA 1D0ZA 3ZLIA 4COFA 2YOEA 5JDMA 3I9WA 2VKOA 4PFPA 5L3FB 2B76A 5JDNA 4KMCA 5HWYA 5LHHB 4LF8T 3AA1B 2MPKA 4XBFB 5HXRA 4LF7T 2BDEA 2CWOA 2LKGA 4BJNA 2M6BA 1V9DA 3K3NA 2H89A 5JVDE 3NZQA 5EK2A 3RIUA 2ZM8A 3H3MA 2NP9A 1BR0A 2BG9C 2DL1A 2G0UA 3ZJ2A 4EEBA 2RP4A 4DUZT 2VVSA 2LJLA 1SA0E 4QHOA 2MOZA 4YHJA 3NRXA 1FMVA 5JREA 2V7MA 3CIRA 2ZM0A 1XZYA 3N5LA 2I59A 2EHOC 2XQ9A 5BMVE 3ZMZB 3TLVA 2Y6XA 3FXEB 5A1LA 1YW0A 1DU2A 4AISA 3VR9A 4IE4A 4HN9A 5F5WA 5JDQA 4DV3T 5HEHA 2V6YB 4TWFA 4CI2B 4H9SE 4HFVA 3JC6C 3ANWB 2K9AA 2LLYA 3PUZF 5LA6E 3RKGA 2YEVC 5M4YA 2YDRA 3P7IA 4QH4A 2J62A 4OYJA 3JAFA 2X0YA 4ZS2A 3ETVA 4TWDA 5JH7E 4Q25A 2W63A 5DJQC 4IREA 4A98A 2VL8A 3TLUA 2LSYA 3ETUA 1MIWA 4EIWA 2KWHA 1J5WA 3RIUC 3A5XA 5ABGA 2QVAA 2KWIB 3ONJA 3QOFA 5LGNB 2MBGA 2LSKA 3P50A 1OWAA 3OYZA 4A5XA 1HNWT 3ZEFB 3Q2MA 2CHOA 4E7SA 2IAKA 2XQYA 3AXJA 2Q9QC 1NAFA 5CJ5A 4MHCA 1KNRA 3FXDB 3VKHA 4KHPT 3C4WA 5AQKB 1T8BA 3GWHA 3CX7B 5HCMA 3OYXA 3AVRA 2IUBA 4CQIA 5EZYE 2GK9A 4U33A 1X9BA 3AECA 4P0BA 4WW0A 3E08A 3UUBA 2L8KA 4IT4A 2FJAA 4G63A 4YTMA 1JNRA 3KBTA 4DR7T 2X9HA 5AQPB 2E9XA 2JQ9A 4GK0E 3VR8A 4A56A 3F31A 2BZBA 1UX5A 4JBWF 5LBMA 2DWKA 4EZ4A 3DTOA 5LHGB 2DHRA 4KP3C 2IC9A 4DBRA 5FY1A 3BQIA 5LG3A 3UU4A 1IAPA 2CMRA 1H7CA 5LCYA 5H6QB 4CI3B 5HEJA 3RX6A 1VCTA 4IL4A 3WI3A 4CXWA 4UV8B 1OEDE 3IA3A 4NIQA 4H63H 3CQXC 4B3RT 2FBWA 3LK3B 2LEHA 4GKJT 1VOMA 4GYSA 4HGAA 2VVNA 1YD8G 4PK6A 5LNKA 3LSVA 3AA6B 2XQ3A 2MTQA 2JJ9A 3RRCA 3AE6A 3RI5A 2VB6A 5FXVA 1W09A 4B3MT 2X9WA 2WWUA 4PK5A 3QNUA 3MK7C 4ZI3C 3N9QA 3JCFA 1HCIA 4Z90A 3E22E 4IL9A 2WAUA 4AKLA 4DR1T 3KV5A 3PJAJ 4TWHA 1IJ6A 3LDQB 2P9BA 5JR9B 1UUSA 1CUNA 3L3PA 2Y48B 5BR8T 3UUXB 1J1JA 3KVBA 4MLKA 1Z0PA 3RYIE 4YT0A 1WFDA 2E9XC 2R6GF 1O3XA 4LF4T 2W67A 2WMNA 4DVDA 1Y01A 5LG4A 3UU8A 2JMKA 1ZV4X 4H9QC 4BAYB 1HG5A 2BKNA 1LVFA 2W66A 3RC3A 2ODUA 3FB2A 4ZI7E 4JI3T 4X65T 4B3TT 4HWCA 1NENA 2XY8B 3UU3A 3C98B 2XQ8A 3NBXX 4KHZF 4NUUA 4TN7B 3HKBE 4CI1B 4OX9T 3LG7A 5CA1E 2XAQB 2CLYB 3ZC0A 2W62A 2CWYA 4MALA 3Q5WA 1IJ5A 5FYMA 3L09A 3ZMVB 4NUVA 1ZEEA 2X9XA 3WAJA 3QUJA 3FBZA 4IDZA 4UVAB 1LVKA 3ZCJA 2BKPA 3DJBA 2BVMA 2YDQA 3UT5E 2D5UA 3NWIA 3VU7H 3JAEA 2NWBA 2X9YA 2D2SA 3EUHA 3B57A 4WBOA 3MKDA 4KX6A 4CXXA 2V8SV 3EHZA 5AFUL 4ILAA 1HF8A 3W15B 2LE8A 5L3EB 1KF6A 2H88A 3TLWA 4YHHT 1X79A 2ACXA 3UFGA 4IE6A 2JQQA 2K5BB 4CN1A 2RPAA 4IHJE 1W0AA 1UCUA 3P4RA 3FHNA 3I0OA 4I4TE 3KBUA 1SE7A 4GYRA 4EGWA 1NEKA 2YINA 3F2EA 2W2UA 3M65A 5JDGA 4DR5T 4IDNA 4I0UA 3RIFA 1Y64B 3K3OA 3ZJ1A 4H9PC 5H6RB 5LP6E 3AE7A 3ZN0B 4QKNA 2DLRA 2WU2A 4YSZA 2UUCT 2W61A 5TAOA 5FP3A 4ZS3A 1UX4A 1E2AA 3PDYA 2J1DG 2XQAA 1S94A 4YJ2E 4ZEYA 3VKGA 2VQFT 4X64T 4QWNB 1LRZA 2BBJA 5E0OA 3Q9DA 2LSGA 4HFIA 2A2FX 3ESLA 3GN5B 3QK6A 4AKRB 5LJNA 4YSXA 1UURA 5CFBA 1WLXA 3EVYA 1EZ3A 4EZHA 4ZHQE 4JLEA 4QXHB 2ZMAA 2XQ7A 4X5TA 3AVSA 3NKZA 4J2CA 2BG9E 1N36T 4DV5T 3V5UA 4YTPA 5CA0E 3PUXF 2DCFA 1HX1B 5L3CB 4M1PA 1XMQT 2CPTA 1XDPA 1HTJF 4PNIA 3L8RA 1QLBA 4DV0T 3G06A 2MAWA 5LGUB 1ZOYA 4ZOLE 2XZEA 5KDMC 5JDLA 3UUNA 4CN4A 2LOPA 1SHZC 2Q9QA 2IC6A 4UR9A 5F8PA 3GMIA 4DV2T 2ZM6T 3FZHB 3UULA 3LBXA 1N32T 3P4PA 4UIGA 3ZC1A 3EDVA 5FVKA 2ES0A 4P1NA 3N2OA 2EHOD 1U5PA 2CRBA 5CGMA 5KX5E 1YQ4A 4AQFA 3UU5A 4DNDA 3J9X1 1SUMB 3RC8A 5AQNB 1HNZT 5FY0A 2KLQA 1OEDB 2FUPA 2OV9A 2PJQA 2WZHA 1I94T 4QXCB 3JC6D 3IBPA 4E7ZA 3FZMB 3I0QA 2N1GA 4GK5E 3EABA 4DMVA 4EYUA 2CEAA 2LHRA 3QC9A 4TNVA 3NVOA 5AQGB 1OXZA 2WQYA 3O4XE 2E9XB 2V7JA 5AQRB 1D1CA 1FEWA 2WS3A 3CQCB 4LFBT 1VCSA 5IWAT 4ZXLA 5J0ZA 1MMGA 2ZM2A 2AXDS 1MNEA 2YU2A 1AJ3A 1G8XA 4ILBA 3ZMUB 3MJXA 4X62T 3PUGA 2D0UA 3SOLA 5EK4A 1WR0A 2IMLA 4KUMB 3ZMTB 5AQMB 1UK5A 2LKHA 1BR2A 3RF1A 4DIDB 2L9QA 1J5ET 2N9DA 5ABEA 2CE7A 3B5MA 2WU5A 4H9RC 5LB7B 1S35A 2LHNA 4L0RA 4AQFC 4FJOA 2RA1A 2XPKA 4CXYA 2HN2A 3PV0F 4QH1A 3SFDA 2IIUA 2XASB 3NZPA 2VKHA 4YJ3E 2YKSA 2UXDT 4FI5A 2YDSA 2XJ7A 2LM2A 4OFZA 3Q5EA 4UXNB 3K1SA 4UV9B 2E5VA 4P09A 5JDHA 3UUMA 3PE0A 1WR6A 2J4GA 5LGTB 4QX7B 1Z8UA 5FXWA 3BQLA 3ZKRA 1KNPA 4O4JE 4I55E 4O4IE 2OLTA 4LMLA 2L3LA 2KT9A 3LFMA 4H9OC 5J2UE 4CN6A 2KMFA 1D0YA 1L0VA 5C3JA 4IDQA 5AQTB 2IW5B 2X66A 3UU6A 4DR4T 3A7MA 4X1KE 2VKJA 3CX6B 3ZT5A 2LM9A 4JI0T 5L4EA 1ZHCA 3CWZB 2CXLA 3MZKB 5FNVE 4X1IE 4AQYT 2UXBT 1BR1A 5LHIB 3IHRA 3OTOT 3RIAA 4EOZB 3PUWF 3OJAA 4ILCA 2XQ5A 3ZPOA 3OPCA 3TKLB 3AEGA 3R84B 3C51A 2X68A 3D0TA 2CHNA 5L47A 5HXCA 3N9MA 2E9XD 4K0UA 3V5SA 2OA5A 2UXNB 2VASA 3CVRA 4AI6A 3PU8A 4EB6E 4YXDA 3RHWA 3CK6A 2N2NA 4IDPA 3PUQA 5HEUA 1XWMA 4HEAA 5IUXA 4JI4T 2H7OA 3RQWA 1QUUA 5ADXL 3SRZA 2QYWA 3QB5K 3AA0B 2WDQA 2FJBA 4K0KT 5LOVE 3O9XA 4I43B 5JTGA 5AQHB 4O8SA 4OYKA 2H7VC 1I6ZA 5GONE 1WYBA 2UU9T 4Z91A 2BBHA 3P8CD 4LMKA 3RH3A 1QSDA 4ZI2C 2X67A 4AKIA 4AXPA 2IHR1 2VK9A 2FJEA 2KINB 2KXPB 1CHUA 3AE2A 4U31A 3ZMSB 4DV7T 4DR3T 3AEDA 1VRBA 2V7LA 3FBLA 2WP9A 2FJDA 3RQUA 4DV1T 5HAXA 2V7KA 2WSSV 3KDSE 5LMNT 4PJNA 5JR9A 3AE1A 2NW9A 4JV5T 2BG9B 3HKCE 4P0AA 4PW8A 4UVBB 2NOXA 2E8IA 1E7PA 3MACA 1IBKT 3T1HT 2D0TA 5L3DB 4X20E 4KI0F 4X1YE 2HHHT 4IE7A 3AE8A 3HR0A 1XMOT 2CXDA 5L2LA 3U3IA 3ZYKA 2SPCA 1HX8A 4LMJA 4KBMB 2EHOB 4ZZBA 2D9DA 3T8OA 4GKKT 2BKOA 2DI4A 1HFAA 3ZCIA 3CX8B 3N9LA 2BVLA 3VRAA 1U4QA 3OKQA 3JADA 3MA9A 3O1HA 3KV6A 3RYFE 5C2TA 2XQ6A 3UQ7A 2HH7A 3AE4A 3UFEA 4AKGA 5EK3A 3K3QC 5AQQB 1XNQT 4EEDA 1MMAA 2W00A 2X0LB 5HXHA 3RPUA 3TLTA 5ABFA 4AIUA 2W0GA 2C0SA 4ERRA 1MIVA 4TV8E 2CBJA 4TZ4C 2A9UA 3M3ZB 4LFAT 2LRLA 5AQLB 4QXBB 1D0XA 5JR9C 3HKDE 3EAMA 3AAIA 3RRWA 4A97A 5CB4E 2CBIA 4EAHA 3PTRB 2VKDA 2NR4A 2KNDA 3IEEA 4HFHA 2Q9QB 3AAEB 3H3AA 4N78D 3DP7A 3LBXB 4HWIB 2LSIA 3UTKA 4TNWA 2LSJA 3OVUA 4HWDA 4ILUA 1MIYA 5HYAA 3PUYF 4L9IA 3EI0A 3F57A 2CCQA 1KNZA 2BS3A 5LXTE 2NTYA 5L3BB 2V6XA 4JI5T 2VURA 1YKHB 4EV6A 3R6NA 1UGOA 1M7KA 4OK0A 4ZZCA 2XSBA 3N2KE 2KSRA 5HXSA 5L4HA 2CLYC 3AA7B 5DQWA 3ABVA 5JQGE 4ISTA 5HXEA 3FZFB 5JRCA 5HCJA 3LK2B 1T98A 1W0BA 2K3WA 5J1GA 2VQET 2V5CA 1FJGT 4U2YA 2UXXB 2CM0A 4O2BE 2E2AA 2UUBT 2I0MA 3ZN1B 2JRKA 2VL0A 5FVLA 4ASKA 4PJMA 3GN5A 4U7IA 4PK4A 3AEAA 4DR2T 3S4UA 4F6RC 2WWVA 4UF0A 4ANJA 5FL1A 3AXJB 3AE3A 5AQSB 2ZLYA 5ABHA 4JI1T 2V5DA 3ONXA 3AE5A 3PURA 4B3ST 1BR4A 2PG8A 3RGLA 1FIOA 3L39A 4U2ZA 4QX8B 4NXNT 1MNDA 1JNZA 5ETWA 2PFVA 2B1EA 3CQGB 2XM1A 2BS4A 4TUYE 3B13A 3C4XA 4AKHA 4WBNE 4DMWA 2NTXA 3PUAA 4MFRA 2CA5A 3LK42 4BJMA 2JIWA 3VHLA 4IE5A 3O1IA 2F4VT 3TLSA 1XDOA 3AAAB 3BK9A 4C90A 4YLHA 3WAKA 2NW8A 3KFWX 2K48A 2YK0A 4WNKA 3UQ4A 3AE9A 4LF9T 3KV9A 5FY7A 3O1JA 4AQGA 4QH5A 4HWHA 2Q9QD 3P4SA 4V1Av 5FKYA 4IDOA 4JUYA 3ZT6A 4EXTA 3K8PC 3MXZA 3IF8B 4DV6T 2WCAA 4JYAT 2BS2A 1E1HB 5AQVB 4EYYR 2C5JA 2X51A 2YU1A 3N9OA 4U72A 5L3GB 3H37A 1NWMX 4WYVA 4LF6T 4HTEA 2A72A 5IHYA 2K24A 4DO0A 3KINB 4X66T 1D1AA 1HNXT 4JEHB 2V6YA 1OEDA 4ISSA 1W9RA 1LKXA 3ANWA 2WZIA 3PUSA 2M67A 3I1AA 1HR0T 5DQVA 5AQIB 4PJLA 1ZKEA 2M6IA 3J7Yq 3ZSSA 4C91A 1M62A 4U7YA 4O4LE 2UUAT 2LT3A 4HFEA 1MMDA 2ACZA 4JI2T 2H3RA 4L5GA 2HPLA 2KZ7B 5JDFA 4GIWA 4Z8XA 4LFCT 4BA9A 2XTLA 1KFYA 3HA4A 3P4QA 3PJAA 3KVAA 3NRYA 3BQKA 1YQ3A 3Q5DA 2XSAA 4JI8T 2QA7A 3FZLB 3SS1A 4YY3T 3ZSTA 1T7SA 1T72A 4DBQA 4JI7T 4ZI3D 2WM9A 5IYZE 4DR6T 1WCRA 1XNRT 5HWXA 1MMNA 3AEFA 2XHEB 5J2TE 3AB3B 2WMOA 4H9NC 4U74A 2IDOB 4UVCB 4XAXB 2V1DB 4NPPA 1OEDC 4HKAA 4O4HE 4JI6T 4HFDA 3AEBA 2JPFA 1WYCA 4XZCA 3SWHA 2AE9A 2WBLA 2Z6EA 2XAHB 3CPZA 2HN1A 2XAJB 3QB5A 3Q5XA 1N33T 2I6HA 3RKOA 2PTFA 3X1DA 3SFEA 1WRDA 4G2AA 3LJCA 3ZYLA 1HS7A 2X0HA 4IIJE 3RYCE 1D1BA 4H63V 2Y8DA 4I50E 5AQUB 2JMHA 2C5KT 2E5LT 3C4ZA 2LRKA 4B6XA 2XQ4A 5LMUT 1IBLT 3RLFF 5FXZA 4ZI2D 4ADZA 4HWFA 2DNXA 3VRBA 4UEMA
chains in the Genus database with same CATH topology
5FY1A 2LOSA 1IZNB 3BQIA 3AAIA 3RRWA 5CB4E 5FY0A 2KLQA 1IAPA 2CMRA 1H7CA 4EAHA 3PTRB 5LCYA 5H6QB 4CI3B 2VKDA 3RX6A 2KNDA 3IEEA 3RYHE 3WI3A 2NW7A 3ZYMA 2PJQA 4UV8B 3HI2A 4CXWA 2Q9QB 4PJJA 4QXCB 3JC6D 3IBPA 2ODVA 2HPJA 3AAEB 4E7ZA 3I0QA 4H63H 3H3AA 3CQXC 4IGUA 4N78D 3DP7A 3LBXB 2MYSA 2PBIA 2N1GA 4GK5E 5FXXA 4MBQA 2LSIA 4DMVA 4EYUA 2CEAA 2LEHA 2LHRA 3LK3B 3QC9A 3UTKA 3U78A 1VOMA 2LSJA 1OXZA 4GYSA 3O4XE 4HGAA 2E9XB 1YD8G 4PK6A 5LNKA 3N9NA 2V7JA 4ILUA 1MIYA 5HYAA 1D1CA 3AA6B 1FEWA 4L9IA 2MTQA 2JJ9A 4OHFA 3RRCA 3CQCB 4PFOA 2VB6A 4PAGA 5FXVA 3F57A 2CCQA 2X9WA 2WWUA 1KNZA 4PK5A 5LXTE 2NTYA 1MMGA 3MK7C 4O2AE 2ZM2A 4ZI3C 3N9QA 5L3BB 1YKEB 3I9YA 3N2GE 1HCIA 1MNEA 2YU2A 1YKHB 1AJ3A 3R6NA 1G8XA 3C50A 3E22E 4HE8A 4OK0A 3N2KE 3ZMUB 3MJXA 5HXSA 2V7IA 2CLYC 2WAUA 3AA7B 4AKLA 1KK7A 3PUGA 3N9PA 5DQWA 2D0UA 3SOLA 5JQGE 3KV4A 3KV5A 5EK4A 1IJ6A 2P9BA 4ISTA 4KUMB 3ZMTB 5HXEA 5JR9B 1G73A 1BR2A 1CUNA 2XAGB 3L3PA 2L9QA 5JRCA 3LK2B 2Y48B 1T98A 5J1GA 2N9DA 3UUXB 2CE7A 2C5IT 3EDUA 3KVBA 1US7B 4MLKA 2UXXB 2CM0A 4O2BE 1Z0PA 3RYIE 2E9XC 3E0ZA 4IE0A 1O3XA 4H9RC 2WMNA 1B7TA 4DVDA 1S35A 3ZN1B 2JRKA 4JEUB 2LHNA 5FMNA 5LJMA 4L0RA 5LG4A 3HKEE 4AQFC 4FJOA 2RA1A 5DABA 4CXYA 4YFSA 2JMKA 1ZV4X 4H9QC 4BAYB 1HG5A 2XASB 4ASKA 3NZPA 2VKHA 4PJMA 5F3JA 4YJ3E 3GN5A 4KP3C 4TV9E 1LVFA 4PK4A 4CZZB 3RC3A 2ODUA 3CKDA 3FB2A 3S4UA 4FI5A 4F6RC 4ZI7E 1HG2A 4UF0A 3CMLA 4ANJA 5C8YE 5LBQB 4OFZA 3GA8A 4UXNB 4UV9B 2ZLYA 2VWAA 3OBVE 2DWGA 3ONXA 4P09A 5JDHA 3UUMA 3C98B 3NBXX 5JRCB 3PE0A 4GOUA 5KMGP 3PURA 4NUUA 3HL6A 4TN7B 1WR6A 3HKBE 1BR4A 2PG8A 4QX7B 5LGTB 4CI1B 1FIOA 2A3DA 3LG7A 5FXWA 5CA1E 3BQLA 4QX8B 2XAQB 2CLYB 3C64A 3ZC0A 2W62A 1MNDA 4O4JE 2XUEA 4I55E 4O4IE 2CWYA 4MALA 3Q5WA 4UELA 2PFVA 5ETWA 1IJ5A 2B1EA 2L3LA 3CQGB 2KT9A 5FYMA 3L09A 2CXFA 3ZMVB 4NUVA 4TUYE 3B13A 1ZEEA 2X9XA 3WAJA 3LFMA 3C4XA 4H9OC 3QUJA 4AKHA 5J2UE 3FBZA 2EHOA 4WBNE 2KMFA 4DMWA 2QGSA 4IDZA 5LYJE 1D0YA 2NTXA 4UVAB 3PUAA 2IW5B 4MFRA 2CA5A 1LVKA 3ZCJA 2X66A 3PU3A 3DJBA 3LK42 1FMWA 4BJMA 2BVMA 4X1KE 2VKJA 4UF0B 3VHLA 3UT5E 2D5UA 2XAFB 4IE5A 4TX5A 3CX6B 3VU7H 2LM9A 2NWBA 3O1IA 2X9YA 2D2SA 3AAAB 3EUHA 3BK9A 1ZHCA 2V26A 3CWZB 1D0ZA 2CXLA 3MZKB 5FNVE 4C90A 3B57A 3ZLIA 4YLHA 3WAKA 2NW8A 4X1IE 4WBOA 3KFWX 2K48A 1BR1A 2YK0A 3MKDA 4WNKA 5JDMA 5LHIB 3KV9A 5FY7A 4CXXA 3IHRA 5AFUL 3I9WA 1HF8A 2VKOA 2LE8A 3W15B 5L3EB 3O1JA 4PFPA 4AQGA 5L3FB 4EOZB 3OJAA 1X79A 2Q9QD 2ACXA 4KMCA 5HWYA 5JDNA 4V1Av 5LHHB 3AA1B 3ZPOA 4XBFB 4IE6A 4JUYA 2JQQA 5HXRA 3TKLB 4EXTA 3K8PC 3MXZA 2BDEA 3R84B 2CWOA 3C51A 3IF8B 2X68A 3D0TA 1E1HB 2K5BB 4EYYR 4BJNA 4IHJE 2C5JA 2X51A 2YU1A 1V9DA 3K3NA 3N9OA 5HXCA 1UCUA 4U72A 5L3GB 5JVDE 3N9MA 2E9XD 3H37A 1NWMX 3FHNA 3I0OA 3NZQA 4I4TE 4K0UA 3KBUA 3V5SA 5EK2A 4GYRA 4HTEA 2A72A 2OA5A 2UXNB 5IHYA 2K24A 4DO0A 2VASA 3CVRA 2YINA 4AI6A 3PU8A 3F2EA 2ZM8A 3KINB 4EB6E 1D1AA 3M65A 2NP9A 2N2NA 5JDGA 3PUQA 1BR0A 4JEHB 4HEAA 1Y64B 3K3OA 2G0UA 3ZJ1A 2H7OA 4H9PC 5H6RB 4ISSA 3ZJ2A 1QUUA 5LP6E 5ADXL 1LKXA 3SRZA 3ZN0B 2RP4A 3AA0B 3ANWA 3PUSA 2M67A 3I1AA 5DQVA 4QKNA 4PJLA 2LJLA 1ZKEA 1SA0E 5LOVE 4QHOA 2DLRA 3O9XA 4I43B 2MOZA 4O8SA 4OYKA 2H7VC 4YHJA 2W61A 5TAOA 5FP3A 3NRXA 4ZS3A 5GONE 3J7Yq 1FMVA 1UX4A 4C91A 1WYBA 2V7MA 5JREA 2ZM0A 3N5LA 3PDYA 4O4LE 2I59A 2J1DG 2EHOC 3P8CD 2LT3A 5BMVE 3RH3A 3ZMZB 1QSDA 1MMDA 2Y6XA 1S94A 4YJ2E 4ZI2C 3VKGA 3FXEB 2H3RA 5A1LA 2X67A 4L5GA 4AKIA 1YW0A 2HPLA 4AXPA 2KZ7B 4QWNB 5JDFA 1LRZA 2VK9A 4GIWA 2KINB 4Z8XA 2KXPB 4IE4A 3ZMSB 5E0OA 4BA9A 3Q9DA 2XTLA 4HN9A 5JDQA 2LSGA 1VRBA 3HA4A 3KVAA 3NRYA 3BQKA 4CI2B 4H9SE 2V7LA 2A2FX 3ESLA 3GN5B 4HFVA 3FBLA 3QK6A 3JC6C 5HAXA 4AKRB 5LJNA 2V7KA 2QA7A 2K9AA 2WSSV 3ANWB 5LA6E 1WLXA 3KDSE 4PJNA 3SS1A 2YEVC 5JR9A 5M4YA 3P7IA 3EVYA 1EZ3A 4OYJA 2NW9A 4EZHA 4ZS2A 3ETVA 4ZHQE 5JH7E 4JLEA 2W63A 4P0AA 3HKCE 4QXHB 2ZMAA 4PW8A 4UVBB 5DJQC 4DBQA 3AVSA 4ZI3D 2NOXA 2WM9A 4J2CA 2E8IA 2VL8A 3MACA 5IYZE 3V5UA 2D0TA 5L3DB 5CA0E 2LSYA 3ETUA 1MIWA 5HWXA 1MMNA 4X20E 4EIWA 4X1YE 2KWHA 2XHEB 4IE7A 5J2TE 3A5XA 3RC8A 2KWIB 3AB3B 5LGNB 2DCFA 3HR0A 2CXDA 5L2LA 2MBGA 2WMOA 5L3CB 4M1PA 3U3IA 4H9NC 2LSKA 4U74A 1OWAA 3ZYKA 2SPCA 1HX8A 4UVCB 4KBMB 2V1DB 4XAXB 3OYZA 2EHOB 3ZEFB 3Q2MA 1HTJF 4PNIA 4E7SA 4HKAA 2IAKA 2XQYA 3T8OA 4O4HE 2Q9QC 1NAFA 2JPFA 2DI4A 1WYCA 4MHCA 4XZCA 3SWHA 3FXDB 2WBLA 2Z6EA 1HFAA 2XAHB 3CPZA 3CX8B 3N9LA 3ZCIA 5LGUB 2BVLA 2XAJB 3VKHA 3Q5XA 4ZOLE 1U4QA 3OKQA 5KDMC 3C4WA 3RKOA 5JDLA 3MA9A 3O1HA 3KV6A 3RYFE 3UUNA 3GWHA 3CX7B 2LOPA 2HH7A 3OYXA 3AVRA 1SHZC 1WRDA 2Q9QA 3UFEA 4CQIA 4G2AA 5EZYE 2IC6A 2GK9A 3LJCA 5F8PA 4AKGA 3GMIA 3ZYLA 4P0BA 5EK3A 4WW0A 3K3QC 3UULA 3LBXA 1HS7A 3E08A 4IIJE 3RYCE 1D1BA 2L8KA 1MMAA 4H63V 2Y8DA 4G63A 2W00A 4I50E 4UIGA 2X0LB 3ZC1A 5HXHA 3EDVA 3RPUA 3KBTA 2JMHA 2C5KT 2X9HA 2W0GA 2E9XA 2ES0A 3C4ZA 2C0SA 3N2OA 1MIVA 4GK0E 4B6XA 4ERRA 4TV8E 2EHOD 4TZ4C 4A56A 1U5PA 5FXZA 3F31A 4ZI2D 4ADZA 5KX5E 2BZBA 1UX5A 5LBMA 2DNXA 4QXBB 4AQFA 2DWKA 4EZ4A 4DNDA 3J9X1 4UEMA 1D0XA 3DTOA 5LHGB 2DHRA 5JR9C 2IC9A 3HKDE 4DBRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E9X A;  2E9X D;  2EHO B;  3ANW A;  2Q9Q B;  2Q9Q C;  3JC6 D;  2EHO A; 
#chains in the Genus database with same CATH topology
 2LOS A;  1IZN B;  2WDR A;  2JQK A;  3RYH E;  3ZYM A;  2NW7 A;  3HI2 A;  4PJJ A;  2ODV A;  2HPJ A;  4WZX A;  4IGU A;  2MYS A;  2PBI A;  5FXX A;  4MBQ A;  3U78 A;  5ABF B;  3N9N A;  4NXM T;  2UXC T;  4OHF A;  4PFO A;  5HEO A;  2XM2 A;  4PAG A;  3T1Y T;  1IBM T;  4F8H A;  4O2A E;  4HFB A;  1YKE B;  3I9Y A;  3N2G E;  3ONL C;  2W4X A;  1YXR A;  1GQE A;  4HE8 A;  3C50 A;  4LF5 T;  2V7I A;  1KK7 A;  3N9P A;  5AQF B;  3KV4 A;  1R8I A;  1G73 A;  5AQJ B;  2XAG B;  2C5I T;  3EDU A;  1US7 B;  3PUV F;  3E0Z A;  5KXJ A;  4IE0 A;  3P4W A;  2WB5 A;  1B7T A;  4JEU B;  4U3C A;  5FMN A;  5LJM A;  3HKE E;  5FL0 A;  5DAB A;  4YFS A;  4YSY A;  4DV4 T;  5F3J A;  4TV9 E;  4CZZ B;  3CKD A;  1ZP0 A;  1HG2 A;  4HFC A;  3CML A;  3A8Y C;  5C8Y E;  5LBQ B;  3GA8 A;  2YN6 A;  1KEY A;  2VWA A;  3OBV E;  2BG9 A;  2DWG A;  5JRC B;  4GOU A;  5KMG P;  3AEE A;  3HL6 A;  2A3D A;  3C64 A;  4YTN A;  2XUE A;  5HEG A;  4UEL A;  2JQH A;  3FZK B;  4DUY T;  2CXF A;  2EHO A;  2QGS A;  5LYJ E;  2QRX A;  2J47 A;  3ZT7 A;  2WY2 A;  3PU3 A;  1FMW A;  4UF0 B;  2XAF B;  4TX5 A;  1N34 T;  5AQO B;  2V26 A;  2WDV A;  1D0Z A;  3ZLI A;  4COF A;  2YOE A;  5JDM A;  3I9W A;  2VKO A;  4PFP A;  5L3F B;  2B76 A;  5JDN A;  4KMC A;  5HWY A;  5LHH B;  4LF8 T;  3AA1 B;  2MPK A;  4XBF B;  5HXR A;  4LF7 T;  2BDE A;  2CWO A;  2LKG A;  4BJN A;  2M6B A;  1V9D A;  3K3N A;  2H89 A;  5JVD E;  3NZQ A;  5EK2 A;  3RIU A;  2ZM8 A;  3H3M A;  2NP9 A;  1BR0 A;  2BG9 C;  2DL1 A;  2G0U A;  3ZJ2 A;  4EEB A;  2RP4 A;  4DUZ T;  2VVS A;  2LJL A;  1SA0 E;  4QHO A;  2MOZ A;  4YHJ A;  3NRX A;  1FMV A;  5JRE A;  2V7M A;  3CIR A;  2ZM0 A;  1XZY A;  3N5L A;  2I59 A;  2EHO C;  2XQ9 A;  5BMV E;  3ZMZ B;  3TLV A;  2Y6X A;  3FXE B;  5A1L A;  1YW0 A;  1DU2 A;  4AIS A;  3VR9 A;  4IE4 A;  4HN9 A;  5F5W A;  5JDQ A;  4DV3 T;  5HEH A;  2V6Y B;  4TWF A;  4CI2 B;  4H9S E;  4HFV A;  3JC6 C;  3ANW B;  2K9A A;  2LLY A;  3PUZ F;  5LA6 E;  3RKG A;  2YEV C;  5M4Y A;  2YDR A;  3P7I A;  4QH4 A;  2J62 A;  4OYJ A;  3JAF A;  2X0Y A;  4ZS2 A;  3ETV A;  4TWD A;  5JH7 E;  4Q25 A;  2W63 A;  5DJQ C;  4IRE A;  4A98 A;  2VL8 A;  3TLU A;  2LSY A;  3ETU A;  1MIW A;  4EIW A;  2KWH A;  1J5W A;  3RIU C;  3A5X A;  5ABG A;  2QVA A;  2KWI B;  3ONJ A;  3QOF A;  5LGN B;  2MBG A;  2LSK A;  3P50 A;  1OWA A;  3OYZ A;  4A5X A;  1HNW T;  3ZEF B;  3Q2M A;  2CHO A;  4E7S A;  2IAK A;  2XQY A;  3AXJ A;  2Q9Q C;  1NAF A;  5CJ5 A;  4MHC A;  1KNR A;  3FXD B;  3VKH A;  4KHP T;  3C4W A;  5AQK B;  1T8B A;  3GWH A;  3CX7 B;  5HCM A;  3OYX A;  3AVR A;  2IUB A;  4CQI A;  5EZY E;  2GK9 A;  4U33 A;  1X9B A;  3AEC A;  4P0B A;  4WW0 A;  3E08 A;  3UUB A;  2L8K A;  4IT4 A;  2FJA A;  4G63 A;  4YTM A;  1JNR A;  3KBT A;  4DR7 T;  2X9H A;  5AQP B;  2E9X A;  2JQ9 A;  4GK0 E;  3VR8 A;  4A56 A;  3F31 A;  2BZB A;  1UX5 A;  4JBW F;  5LBM A;  2DWK A;  4EZ4 A;  3DTO A;  5LHG B;  2DHR A;  4KP3 C;  2IC9 A;  4DBR A;  5FY1 A;  3BQI A;  5LG3 A;  3UU4 A;  1IAP A;  2CMR A;  1H7C A;  5LCY A;  5H6Q B;  4CI3 B;  5HEJ A;  3RX6 A;  1VCT A;  4IL4 A;  3WI3 A;  4CXW A;  4UV8 B;  1OED E;  3IA3 A;  4NIQ A;  4H63 H;  3CQX C;  4B3R T;  2FBW A;  3LK3 B;  2LEH A;  4GKJ T;  1VOM A;  4GYS A;  4HGA A;  2VVN A;  1YD8 G;  4PK6 A;  5LNK A;  3LSV A;  3AA6 B;  2XQ3 A;  2MTQ A;  2JJ9 A;  3RRC A;  3AE6 A;  3RI5 A;  2VB6 A;  5FXV A;  1W09 A;  4B3M T;  2X9W A;  2WWU A;  4PK5 A;  3QNU A;  3MK7 C;  4ZI3 C;  3N9Q A;  3JCF A;  1HCI A;  4Z90 A;  3E22 E;  4IL9 A;  2WAU A;  4AKL A;  4DR1 T;  3KV5 A;  3PJA J;  4TWH A;  1IJ6 A;  3LDQ B;  2P9B A;  5JR9 B;  1UUS A;  1CUN A;  3L3P A;  2Y48 B;  5BR8 T;  3UUX B;  1J1J A;  3KVB A;  4MLK A;  1Z0P A;  3RYI E;  4YT0 A;  1WFD A;  2E9X C;  2R6G F;  1O3X A;  4LF4 T;  2W67 A;  2WMN A;  4DVD A;  1Y01 A;  5LG4 A;  3UU8 A;  2JMK A;  1ZV4 X;  4H9Q C;  4BAY B;  1HG5 A;  2BKN A;  1LVF A;  2W66 A;  3RC3 A;  2ODU A;  3FB2 A;  4ZI7 E;  4JI3 T;  4X65 T;  4B3T T;  4HWC A;  1NEN A;  2XY8 B;  3UU3 A;  3C98 B;  2XQ8 A;  3NBX X;  4KHZ F;  4NUU A;  4TN7 B;  3HKB E;  4CI1 B;  4OX9 T;  3LG7 A;  5CA1 E;  2XAQ B;  2CLY B;  3ZC0 A;  2W62 A;  2CWY A;  4MAL A;  3Q5W A;  1IJ5 A;  5FYM A;  3L09 A;  3ZMV B;  4NUV A;  1ZEE A;  2X9X A;  3WAJ A;  3QUJ A;  3FBZ A;  4IDZ A;  4UVA B;  1LVK A;  3ZCJ A;  2BKP A;  3DJB A;  2BVM A;  2YDQ A;  3UT5 E;  2D5U A;  3NWI A;  3VU7 H;  3JAE A;  2NWB A;  2X9Y A;  2D2S A;  3EUH A;  3B57 A;  4WBO A;  3MKD A;  4KX6 A;  4CXX A;  2V8S V;  3EHZ A;  5AFU L;  4ILA A;  1HF8 A;  3W15 B;  2LE8 A;  5L3E B;  1KF6 A;  2H88 A;  3TLW A;  4YHH T;  1X79 A;  2ACX A;  3UFG A;  4IE6 A;  2JQQ A;  2K5B B;  4CN1 A;  2RPA A;  4IHJ E;  1W0A A;  1UCU A;  3P4R A;  3FHN A;  3I0O A;  4I4T E;  3KBU A;  1SE7 A;  4GYR A;  4EGW A;  1NEK A;  2YIN A;  3F2E A;  2W2U A;  3M65 A;  5JDG A;  4DR5 T;  4IDN A;  4I0U A;  3RIF A;  1Y64 B;  3K3O A;  3ZJ1 A;  4H9P C;  5H6R B;  5LP6 E;  3AE7 A;  3ZN0 B;  4QKN A;  2DLR A;  2WU2 A;  4YSZ A;  2UUC T;  2W61 A;  5TAO A;  5FP3 A;  4ZS3 A;  1UX4 A;  1E2A A;  3PDY A;  2J1D G;  2XQA A;  1S94 A;  4YJ2 E;  4ZEY A;  3VKG A;  2VQF T;  4X64 T;  4QWN B;  1LRZ A;  2BBJ A;  5E0O A;  3Q9D A;  2LSG A;  4HFI A;  2A2F X;  3ESL A;  3GN5 B;  3QK6 A;  4AKR B;  5LJN A;  4YSX A;  1UUR A;  5CFB A;  1WLX A;  3EVY A;  1EZ3 A;  4EZH A;  4ZHQ E;  4JLE A;  4QXH B;  2ZMA A;  2XQ7 A;  4X5T A;  3AVS A;  3NKZ A;  4J2C A;  2BG9 E;  1N36 T;  4DV5 T;  3V5U A;  4YTP A;  5CA0 E;  3PUX F;  2DCF A;  1HX1 B;  5L3C B;  4M1P A;  1XMQ T;  2CPT A;  1XDP A;  1HTJ F;  4PNI A;  3L8R A;  1QLB A;  4DV0 T;  3G06 A;  2MAW A;  5LGU B;  1ZOY A;  4ZOL E;  2XZE A;  5KDM C;  5JDL A;  3UUN A;  4CN4 A;  2LOP A;  1SHZ C;  2Q9Q A;  2IC6 A;  4UR9 A;  5F8P A;  3GMI A;  4DV2 T;  2ZM6 T;  3FZH B;  3UUL A;  3LBX A;  1N32 T;  3P4P A;  4UIG A;  3ZC1 A;  3EDV A;  5FVK A;  2ES0 A;  4P1N A;  3N2O A;  2EHO D;  1U5P A;  2CRB A;  5CGM A;  5KX5 E;  1YQ4 A;  4AQF A;  3UU5 A;  4DND A;  3J9X 1;  1SUM B;  3RC8 A;  5AQN B;  1HNZ T;  5FY0 A;  2KLQ A;  1OED B;  2FUP A;  2OV9 A;  2PJQ A;  2WZH A;  1I94 T;  4QXC B;  3JC6 D;  3IBP A;  4E7Z A;  3FZM B;  3I0Q A;  2N1G A;  4GK5 E;  3EAB A;  4DMV A;  4EYU A;  2CEA A;  2LHR A;  3QC9 A;  4TNV A;  3NVO A;  5AQG B;  1OXZ A;  2WQY A;  3O4X E;  2E9X B;  2V7J A;  5AQR B;  1D1C A;  1FEW A;  2WS3 A;  3CQC B;  4LFB T;  1VCS A;  5IWA T;  4ZXL A;  5J0Z A;  1MMG A;  2ZM2 A;  2AXD S;  1MNE A;  2YU2 A;  1AJ3 A;  1G8X A;  4ILB A;  3ZMU B;  3MJX A;  4X62 T;  3PUG A;  2D0U A;  3SOL A;  5EK4 A;  1WR0 A;  2IML A;  4KUM B;  3ZMT B;  5AQM B;  1UK5 A;  2LKH A;  1BR2 A;  3RF1 A;  4DID B;  2L9Q A;  1J5E T;  2N9D A;  5ABE A;  2CE7 A;  3B5M A;  2WU5 A;  4H9R C;  5LB7 B;  1S35 A;  2LHN A;  4L0R A;  4AQF C;  4FJO A;  2RA1 A;  2XPK A;  4CXY A;  2HN2 A;  3PV0 F;  4QH1 A;  3SFD A;  2IIU A;  2XAS B;  3NZP A;  2VKH A;  4YJ3 E;  2YKS A;  2UXD T;  4FI5 A;  2YDS A;  2XJ7 A;  2LM2 A;  4OFZ A;  3Q5E A;  4UXN B;  3K1S A;  4UV9 B;  2E5V A;  4P09 A;  5JDH A;  3UUM A;  3PE0 A;  1WR6 A;  2J4G A;  5LGT B;  4QX7 B;  1Z8U A;  5FXW A;  3BQL A;  3ZKR A;  1KNP A;  4O4J E;  4I55 E;  4O4I E;  2OLT A;  4LML A;  2L3L A;  2KT9 A;  3LFM A;  4H9O C;  5J2U E;  4CN6 A;  2KMF A;  1D0Y A;  1L0V A;  5C3J A;  4IDQ A;  5AQT B;  2IW5 B;  2X66 A;  3UU6 A;  4DR4 T;  3A7M A;  4X1K E;  2VKJ A;  3CX6 B;  3ZT5 A;  2LM9 A;  4JI0 T;  5L4E A;  1ZHC A;  3CWZ B;  2CXL A;  3MZK B;  5FNV E;  4X1I E;  4AQY T;  2UXB T;  1BR1 A;  5LHI B;  3IHR A;  3OTO T;  3RIA A;  4EOZ B;  3PUW F;  3OJA A;  4ILC A;  2XQ5 A;  3ZPO A;  3OPC A;  3TKL B;  3AEG A;  3R84 B;  3C51 A;  2X68 A;  3D0T A;  2CHN A;  5L47 A;  5HXC A;  3N9M A;  2E9X D;  4K0U A;  3V5S A;  2OA5 A;  2UXN B;  2VAS A;  3CVR A;  4AI6 A;  3PU8 A;  4EB6 E;  4YXD A;  3RHW A;  3CK6 A;  2N2N A;  4IDP A;  3PUQ A;  5HEU A;  1XWM A;  4HEA A;  5IUX A;  4JI4 T;  2H7O A;  3RQW A;  1QUU A;  5ADX L;  3SRZ A;  2QYW A;  3QB5 K;  3AA0 B;  2WDQ A;  2FJB A;  4K0K T;  5LOV E;  3O9X A;  4I43 B;  5JTG A;  5AQH B;  4O8S A;  4OYK A;  2H7V C;  1I6Z A;  5GON E;  1WYB A;  2UU9 T;  4Z91 A;  2BBH A;  3P8C D;  4LMK A;  3RH3 A;  1QSD A;  4ZI2 C;  2X67 A;  4AKI A;  4AXP A;  2IHR 1;  2VK9 A;  2FJE A;  2KIN B;  2KXP B;  1CHU A;  3AE2 A;  4U31 A;  3ZMS B;  4DV7 T;  4DR3 T;  3AED A;  1VRB A;  2V7L A;  3FBL A;  2WP9 A;  2FJD A;  3RQU A;  4DV1 T;  5HAX A;  2V7K A;  2WSS V;  3KDS E;  5LMN T;  4PJN A;  5JR9 A;  3AE1 A;  2NW9 A;  4JV5 T;  2BG9 B;  3HKC E;  4P0A A;  4PW8 A;  4UVB B;  2NOX A;  2E8I A;  1E7P A;  3MAC A;  1IBK T;  3T1H T;  2D0T A;  5L3D B;  4X20 E;  4KI0 F;  4X1Y E;  2HHH T;  4IE7 A;  3AE8 A;  3HR0 A;  1XMO T;  2CXD A;  5L2L A;  3U3I A;  3ZYK A;  2SPC A;  1HX8 A;  4LMJ A;  4KBM B;  2EHO B;  4ZZB A;  2D9D A;  3T8O A;  4GKK T;  2BKO A;  2DI4 A;  1HFA A;  3ZCI A;  3CX8 B;  3N9L A;  2BVL A;  3VRA A;  1U4Q A;  3OKQ A;  3JAD A;  3MA9 A;  3O1H A;  3KV6 A;  3RYF E;  5C2T A;  2XQ6 A;  3UQ7 A;  2HH7 A;  3AE4 A;  3UFE A;  4AKG A;  5EK3 A;  3K3Q C;  5AQQ B;  1XNQ T;  4EED A;  1MMA A;  2W00 A;  2X0L B;  5HXH A;  3RPU A;  3TLT A;  5ABF A;  4AIU A;  2W0G A;  2C0S A;  4ERR A;  1MIV A;  4TV8 E;  2CBJ A;  4TZ4 C;  2A9U A;  3M3Z B;  4LFA T;  2LRL A;  5AQL B;  4QXB B;  1D0X A;  5JR9 C;  3HKD E;  3EAM A;  3AAI A;  3RRW A;  4A97 A;  5CB4 E;  2CBI A;  4EAH A;  3PTR B;  2VKD A;  2NR4 A;  2KND A;  3IEE A;  4HFH A;  2Q9Q B;  3AAE B;  3H3A A;  4N78 D;  3DP7 A;  3LBX B;  4HWI B;  2LSI A;  3UTK A;  4TNW A;  2LSJ A;  3OVU A;  4HWD A;  4ILU A;  1MIY A;  5HYA A;  3PUY F;  4L9I A;  3EI0 A;  3F57 A;  2CCQ A;  1KNZ A;  2BS3 A;  5LXT E;  2NTY A;  5L3B B;  2V6X A;  4JI5 T;  2VUR A;  1YKH B;  4EV6 A;  3R6N A;  1UGO A;  1M7K A;  4OK0 A;  4ZZC A;  2XSB A;  3N2K E;  2KSR A;  5HXS A;  5L4H A;  2CLY C;  3AA7 B;  5DQW A;  3ABV A;  5JQG E;  4IST A;  5HXE A;  3FZF B;  5JRC A;  5HCJ A;  3LK2 B;  1T98 A;  1W0B A;  2K3W A;  5J1G A;  2VQE T;  2V5C A;  1FJG T;  4U2Y A;  2UXX B;  2CM0 A;  4O2B E;  2E2A A;  2UUB T;  2I0M A;  3ZN1 B;  2JRK A;  2VL0 A;  5FVL A;  4ASK A;  4PJM A;  3GN5 A;  4U7I A;  4PK4 A;  3AEA A;  4DR2 T;  3S4U A;  4F6R C;  2WWV A;  4UF0 A;  4ANJ A;  5FL1 A;  3AXJ B;  3AE3 A;  5AQS B;  2ZLY A;  5ABH A;  4JI1 T;  2V5D A;  3ONX A;  3AE5 A;  3PUR A;  4B3S T;  1BR4 A;  2PG8 A;  3RGL A;  1FIO A;  3L39 A;  4U2Z A;  4QX8 B;  4NXN T;  1MND A;  1JNZ A;  5ETW A;  2PFV A;  2B1E A;  3CQG B;  2XM1 A;  2BS4 A;  4TUY E;  3B13 A;  3C4X A;  4AKH A;  4WBN E;  4DMW A;  2NTX A;  3PUA A;  4MFR A;  2CA5 A;  3LK4 2;  4BJM A;  2JIW A;  3VHL A;  4IE5 A;  3O1I A;  2F4V T;  3TLS A;  1XDO A;  3AAA B;  3BK9 A;  4C90 A;  4YLH A;  3WAK A;  2NW8 A;  3KFW X;  2K48 A;  2YK0 A;  4WNK A;  3UQ4 A;  3AE9 A;  4LF9 T;  3KV9 A;  5FY7 A;  3O1J A;  4AQG A;  4QH5 A;  4HWH A;  2Q9Q D;  3P4S A;  4V1A v;  5FKY A;  4IDO A;  4JUY A;  3ZT6 A;  4EXT A;  3K8P C;  3MXZ A;  3IF8 B;  4DV6 T;  2WCA A;  4JYA T;  2BS2 A;  1E1H B;  5AQV B;  4EYY R;  2C5J A;  2X51 A;  2YU1 A;  3N9O A;  4U72 A;  5L3G B;  3H37 A;  1NWM X;  4WYV A;  4LF6 T;  4HTE A;  2A72 A;  5IHY A;  2K24 A;  4DO0 A;  3KIN B;  4X66 T;  1D1A A;  1HNX T;  4JEH B;  2V6Y A;  1OED A;  4ISS A;  1W9R A;  1LKX A;  3ANW A;  2WZI A;  3PUS A;  2M67 A;  3I1A A;  1HR0 T;  5DQV A;  5AQI B;  4PJL A;  1ZKE A;  2M6I A;  3J7Y q;  3ZSS A;  4C91 A;  1M62 A;  4U7Y A;  4O4L E;  2UUA T;  2LT3 A;  4HFE A;  1MMD A;  2ACZ A;  4JI2 T;  2H3R A;  4L5G A;  2HPL A;  2KZ7 B;  5JDF A;  4GIW A;  4Z8X A;  4LFC T;  4BA9 A;  2XTL A;  1KFY A;  3HA4 A;  3P4Q A;  3PJA A;  3KVA A;  3NRY A;  3BQK A;  1YQ3 A;  3Q5D A;  2XSA A;  4JI8 T;  2QA7 A;  3FZL B;  3SS1 A;  4YY3 T;  3ZST A;  1T7S A;  1T72 A;  4DBQ A;  4JI7 T;  4ZI3 D;  2WM9 A;  5IYZ E;  4DR6 T;  1WCR A;  1XNR T;  5HWX A;  1MMN A;  3AEF A;  2XHE B;  5J2T E;  3AB3 B;  2WMO A;  4H9N C;  4U74 A;  2IDO B;  4UVC B;  4XAX B;  2V1D B;  4NPP A;  1OED C;  4HKA A;  4O4H E;  4JI6 T;  4HFD A;  3AEB A;  2JPF A;  1WYC A;  4XZC A;  3SWH A;  2AE9 A;  2WBL A;  2Z6E A;  2XAH B;  3CPZ A;  2HN1 A;  2XAJ B;  3QB5 A;  3Q5X A;  1N33 T;  2I6H A;  3RKO A;  2PTF A;  3X1D A;  3SFE A;  1WRD A;  4G2A A;  3LJC A;  3ZYL A;  1HS7 A;  2X0H A;  4IIJ E;  3RYC E;  1D1B A;  4H63 V;  2Y8D A;  4I50 E;  5AQU B;  2JMH A;  2C5K T;  2E5L T;  3C4Z A;  2LRK A;  4B6X A;  2XQ4 A;  5LMU T;  1IBL T;  3RLF F;  5FXZ A;  4ZI2 D;  4ADZ A;  4HWF A;  2DNX A;  3VRB A;  4UEM A; 
#chains in the Genus database with same CATH homology
 5FY1 A;  2LOS A;  1IZN B;  3BQI A;  3AAI A;  3RRW A;  5CB4 E;  5FY0 A;  2KLQ A;  1IAP A;  2CMR A;  1H7C A;  4EAH A;  3PTR B;  5LCY A;  5H6Q B;  4CI3 B;  2VKD A;  3RX6 A;  2KND A;  3IEE A;  3RYH E;  3WI3 A;  2NW7 A;  3ZYM A;  2PJQ A;  4UV8 B;  3HI2 A;  4CXW A;  2Q9Q B;  4PJJ A;  4QXC B;  3JC6 D;  3IBP A;  2ODV A;  2HPJ A;  3AAE B;  4E7Z A;  3I0Q A;  4H63 H;  3H3A A;  3CQX C;  4IGU A;  4N78 D;  3DP7 A;  3LBX B;  2MYS A;  2PBI A;  2N1G A;  4GK5 E;  5FXX A;  4MBQ A;  2LSI A;  4DMV A;  4EYU A;  2CEA A;  2LEH A;  2LHR A;  3LK3 B;  3QC9 A;  3UTK A;  3U78 A;  1VOM A;  2LSJ A;  1OXZ A;  4GYS A;  3O4X E;  4HGA A;  2E9X B;  1YD8 G;  4PK6 A;  5LNK A;  3N9N A;  2V7J A;  4ILU A;  1MIY A;  5HYA A;  1D1C A;  3AA6 B;  1FEW A;  4L9I A;  2MTQ A;  2JJ9 A;  4OHF A;  3RRC A;  3CQC B;  4PFO A;  2VB6 A;  4PAG A;  5FXV A;  3F57 A;  2CCQ A;  2X9W A;  2WWU A;  1KNZ A;  4PK5 A;  5LXT E;  2NTY A;  1MMG A;  3MK7 C;  4O2A E;  2ZM2 A;  4ZI3 C;  3N9Q A;  5L3B B;  1YKE B;  3I9Y A;  3N2G E;  1HCI A;  1MNE A;  2YU2 A;  1YKH B;  1AJ3 A;  3R6N A;  1G8X A;  3C50 A;  3E22 E;  4HE8 A;  4OK0 A;  3N2K E;  3ZMU B;  3MJX A;  5HXS A;  2V7I A;  2CLY C;  2WAU A;  3AA7 B;  4AKL A;  1KK7 A;  3PUG A;  3N9P A;  5DQW A;  2D0U A;  3SOL A;  5JQG E;  3KV4 A;  3KV5 A;  5EK4 A;  1IJ6 A;  2P9B A;  4IST A;  4KUM B;  3ZMT B;  5HXE A;  5JR9 B;  1G73 A;  1BR2 A;  1CUN A;  2XAG B;  3L3P A;  2L9Q A;  5JRC A;  3LK2 B;  2Y48 B;  1T98 A;  5J1G A;  2N9D A;  3UUX B;  2CE7 A;  2C5I T;  3EDU A;  3KVB A;  1US7 B;  4MLK A;  2UXX B;  2CM0 A;  4O2B E;  1Z0P A;  3RYI E;  2E9X C;  3E0Z A;  4IE0 A;  1O3X A;  4H9R C;  2WMN A;  1B7T A;  4DVD A;  1S35 A;  3ZN1 B;  2JRK A;  4JEU B;  2LHN A;  5FMN A;  5LJM A;  4L0R A;  5LG4 A;  3HKE E;  4AQF C;  4FJO A;  2RA1 A;  5DAB A;  4CXY A;  4YFS A;  2JMK A;  1ZV4 X;  4H9Q C;  4BAY B;  1HG5 A;  2XAS B;  4ASK A;  3NZP A;  2VKH A;  4PJM A;  5F3J A;  4YJ3 E;  3GN5 A;  4KP3 C;  4TV9 E;  1LVF A;  4PK4 A;  4CZZ B;  3RC3 A;  2ODU A;  3CKD A;  3FB2 A;  3S4U A;  4FI5 A;  4F6R C;  4ZI7 E;  1HG2 A;  4UF0 A;  3CML A;  4ANJ A;  5C8Y E;  5LBQ B;  4OFZ A;  3GA8 A;  4UXN B;  4UV9 B;  2ZLY A;  2VWA A;  3OBV E;  2DWG A;  3ONX A;  4P09 A;  5JDH A;  3UUM A;  3C98 B;  3NBX X;  5JRC B;  3PE0 A;  4GOU A;  5KMG P;  3PUR A;  4NUU A;  3HL6 A;  4TN7 B;  1WR6 A;  3HKB E;  1BR4 A;  2PG8 A;  4QX7 B;  5LGT B;  4CI1 B;  1FIO A;  2A3D A;  3LG7 A;  5FXW A;  5CA1 E;  3BQL A;  4QX8 B;  2XAQ B;  2CLY B;  3C64 A;  3ZC0 A;  2W62 A;  1MND A;  4O4J E;  2XUE A;  4I55 E;  4O4I E;  2CWY A;  4MAL A;  3Q5W A;  4UEL A;  2PFV A;  5ETW A;  1IJ5 A;  2B1E A;  2L3L A;  3CQG B;  2KT9 A;  5FYM A;  3L09 A;  2CXF A;  3ZMV B;  4NUV A;  4TUY E;  3B13 A;  1ZEE A;  2X9X A;  3WAJ A;  3LFM A;  3C4X A;  4H9O C;  3QUJ A;  4AKH A;  5J2U E;  3FBZ A;  2EHO A;  4WBN E;  2KMF A;  4DMW A;  2QGS A;  4IDZ A;  5LYJ E;  1D0Y A;  2NTX A;  4UVA B;  3PUA A;  2IW5 B;  4MFR A;  2CA5 A;  1LVK A;  3ZCJ A;  2X66 A;  3PU3 A;  3DJB A;  3LK4 2;  1FMW A;  4BJM A;  2BVM A;  4X1K E;  2VKJ A;  4UF0 B;  3VHL A;  3UT5 E;  2D5U A;  2XAF B;  4IE5 A;  4TX5 A;  3CX6 B;  3VU7 H;  2LM9 A;  2NWB A;  3O1I A;  2X9Y A;  2D2S A;  3AAA B;  3EUH A;  3BK9 A;  1ZHC A;  2V26 A;  3CWZ B;  1D0Z A;  2CXL A;  3MZK B;  5FNV E;  4C90 A;  3B57 A;  3ZLI A;  4YLH A;  3WAK A;  2NW8 A;  4X1I E;  4WBO A;  3KFW X;  2K48 A;  1BR1 A;  2YK0 A;  3MKD A;  4WNK A;  5JDM A;  5LHI B;  3KV9 A;  5FY7 A;  4CXX A;  3IHR A;  5AFU L;  3I9W A;  1HF8 A;  2VKO A;  2LE8 A;  3W15 B;  5L3E B;  3O1J A;  4PFP A;  4AQG A;  5L3F B;  4EOZ B;  3OJA A;  1X79 A;  2Q9Q D;  2ACX A;  4KMC A;  5HWY A;  5JDN A;  4V1A v;  5LHH B;  3AA1 B;  3ZPO A;  4XBF B;  4IE6 A;  4JUY A;  2JQQ A;  5HXR A;  3TKL B;  4EXT A;  3K8P C;  3MXZ A;  2BDE A;  3R84 B;  2CWO A;  3C51 A;  3IF8 B;  2X68 A;  3D0T A;  1E1H B;  2K5B B;  4EYY R;  4BJN A;  4IHJ E;  2C5J A;  2X51 A;  2YU1 A;  1V9D A;  3K3N A;  3N9O A;  5HXC A;  1UCU A;  4U72 A;  5L3G B;  5JVD E;  3N9M A;  2E9X D;  3H37 A;  1NWM X;  3FHN A;  3I0O A;  3NZQ A;  4I4T E;  4K0U A;  3KBU A;  3V5S A;  5EK2 A;  4GYR A;  4HTE A;  2A72 A;  2OA5 A;  2UXN B;  5IHY A;  2K24 A;  4DO0 A;  2VAS A;  3CVR A;  2YIN A;  4AI6 A;  3PU8 A;  3F2E A;  2ZM8 A;  3KIN B;  4EB6 E;  1D1A A;  3M65 A;  2NP9 A;  2N2N A;  5JDG A;  3PUQ A;  1BR0 A;  4JEH B;  4HEA A;  1Y64 B;  3K3O A;  2G0U A;  3ZJ1 A;  2H7O A;  4H9P C;  5H6R B;  4ISS A;  3ZJ2 A;  1QUU A;  5LP6 E;  5ADX L;  1LKX A;  3SRZ A;  3ZN0 B;  2RP4 A;  3AA0 B;  3ANW A;  3PUS A;  2M67 A;  3I1A A;  5DQV A;  4QKN A;  4PJL A;  2LJL A;  1ZKE A;  1SA0 E;  5LOV E;  4QHO A;  2DLR A;  3O9X A;  4I43 B;  2MOZ A;  4O8S A;  4OYK A;  2H7V C;  4YHJ A;  2W61 A;  5TAO A;  5FP3 A;  3NRX A;  4ZS3 A;  5GON E;  3J7Y q;  1FMV A;  1UX4 A;  4C91 A;  1WYB A;  2V7M A;  5JRE A;  2ZM0 A;  3N5L A;  3PDY A;  4O4L E;  2I59 A;  2J1D G;  2EHO C;  3P8C D;  2LT3 A;  5BMV E;  3RH3 A;  3ZMZ B;  1QSD A;  1MMD A;  2Y6X A;  1S94 A;  4YJ2 E;  4ZI2 C;  3VKG A;  3FXE B;  2H3R A;  5A1L A;  2X67 A;  4L5G A;  4AKI A;  1YW0 A;  2HPL A;  4AXP A;  2KZ7 B;  4QWN B;  5JDF A;  1LRZ A;  2VK9 A;  4GIW A;  2KIN B;  4Z8X A;  2KXP B;  4IE4 A;  3ZMS B;  5E0O A;  4BA9 A;  3Q9D A;  2XTL A;  4HN9 A;  5JDQ A;  2LSG A;  1VRB A;  3HA4 A;  3KVA A;  3NRY A;  3BQK A;  4CI2 B;  4H9S E;  2V7L A;  2A2F X;  3ESL A;  3GN5 B;  4HFV A;  3FBL A;  3QK6 A;  3JC6 C;  5HAX A;  4AKR B;  5LJN A;  2V7K A;  2QA7 A;  2K9A A;  2WSS V;  3ANW B;  5LA6 E;  1WLX A;  3KDS E;  4PJN A;  3SS1 A;  2YEV C;  5JR9 A;  5M4Y A;  3P7I A;  3EVY A;  1EZ3 A;  4OYJ A;  2NW9 A;  4EZH A;  4ZS2 A;  3ETV A;  4ZHQ E;  5JH7 E;  4JLE A;  2W63 A;  4P0A A;  3HKC E;  4QXH B;  2ZMA A;  4PW8 A;  4UVB B;  5DJQ C;  4DBQ A;  3AVS A;  4ZI3 D;  2NOX A;  2WM9 A;  4J2C A;  2E8I A;  2VL8 A;  3MAC A;  5IYZ E;  3V5U A;  2D0T A;  5L3D B;  5CA0 E;  2LSY A;  3ETU A;  1MIW A;  5HWX A;  1MMN A;  4X20 E;  4EIW A;  4X1Y E;  2KWH A;  2XHE B;  4IE7 A;  5J2T E;  3A5X A;  3RC8 A;  2KWI B;  3AB3 B;  5LGN B;  2DCF A;  3HR0 A;  2CXD A;  5L2L A;  2MBG A;  2WMO A;  5L3C B;  4M1P A;  3U3I A;  4H9N C;  2LSK A;  4U74 A;  1OWA A;  3ZYK A;  2SPC A;  1HX8 A;  4UVC B;  4KBM B;  2V1D B;  4XAX B;  3OYZ A;  2EHO B;  3ZEF B;  3Q2M A;  1HTJ F;  4PNI A;  4E7S A;  4HKA A;  2IAK A;  2XQY A;  3T8O A;  4O4H E;  2Q9Q C;  1NAF A;  2JPF A;  2DI4 A;  1WYC A;  4MHC A;  4XZC A;  3SWH A;  3FXD B;  2WBL A;  2Z6E A;  1HFA A;  2XAH B;  3CPZ A;  3CX8 B;  3N9L A;  3ZCI A;  5LGU B;  2BVL A;  2XAJ B;  3VKH A;  3Q5X A;  4ZOL E;  1U4Q A;  3OKQ A;  5KDM C;  3C4W A;  3RKO A;  5JDL A;  3MA9 A;  3O1H A;  3KV6 A;  3RYF E;  3UUN A;  3GWH A;  3CX7 B;  2LOP A;  2HH7 A;  3OYX A;  3AVR A;  1SHZ C;  1WRD A;  2Q9Q A;  3UFE A;  4CQI A;  4G2A A;  5EZY E;  2IC6 A;  2GK9 A;  3LJC A;  5F8P A;  4AKG A;  3GMI A;  3ZYL A;  4P0B A;  5EK3 A;  4WW0 A;  3K3Q C;  3UUL A;  3LBX A;  1HS7 A;  3E08 A;  4IIJ E;  3RYC E;  1D1B A;  2L8K A;  1MMA A;  4H63 V;  2Y8D A;  4G63 A;  2W00 A;  4I50 E;  4UIG A;  2X0L B;  3ZC1 A;  5HXH A;  3EDV A;  3RPU A;  3KBT A;  2JMH A;  2C5K T;  2X9H A;  2W0G A;  2E9X A;  2ES0 A;  3C4Z A;  2C0S A;  3N2O A;  1MIV A;  4GK0 E;  4B6X A;  4ERR A;  4TV8 E;  2EHO D;  4TZ4 C;  4A56 A;  1U5P A;  5FXZ A;  3F31 A;  4ZI2 D;  4ADZ A;  5KX5 E;  2BZB A;  1UX5 A;  5LBM A;  2DNX A;  4QXB B;  4AQF A;  2DWK A;  4EZ4 A;  4DND A;  3J9X 1;  4UEM A;  1D0X A;  3DTO A;  5LHG B;  2DHR A;  5JR9 C;  2IC9 A;  3HKD E;  4DBR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...