2E9XA

The crystal structure of human gins core complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
144
structure length
144
Chain Sequence
MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSVLPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA replication complex GINS protein PSF1
publication title Structure of the human GINS complex and its assembly and functional interface in replication initiation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
total genus 55
structure length 144
sequence length 144
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1030 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2e9xA01
2Q9QC 2EHOB 2EHOA 2E9XA 2E9XD 2Q9QB 3JC6D 3ANWA
chains in the Genus database with same CATH superfamily
4UELA 1QUUA 4OK0A 1S35A 3MXZA 1FJGT 4QXBB 2E8IA 1Z0PA 5FL0A 3KBUA 4LF6T 4TUYE 2BS3A 1US7B 2CMRA 3I9YA 1BR4A 4IDOA 3R6NA 3UT5E 4HN9A 3ZJ2A 2D2SA 4KHZF 3B5MA 1ZKEA 4LMKA 3PUYF 5EZYE 2PBIA 3MZKB 2KINB 4LFCT 3FB2A 4O4JE 3TLVA 1J5WA 2FJEA 3OYXA 1YW0A 2W63A 2XM1A 4HWFA 2YU2A 4HTEA 2J62A 5ABFB 2X51A 2CWYA 2BZBA 4IGUA 3AE4A 1IBLT 3CQGB 3ZCIA 5LHHB 4CN1A 2VWAA 1G8XA 3EDUA 1WLXA 4P0AA 3SFEA 3HKDE 3UUMA 3LSVA 4EB6E 1LVKA 3AEGA 5L3EB 2Y48B 2N1GA 4DMWA 4YHHT 4DV0T 4WNKA 4WBOA 3PV0F 3AEAA 3A5XA 4O2BE 4AQFA 3PUQA 5LXTE 5AQSB 2H89A 3ZKRA 3N2OA 4X5TA 3N9QA 4UF0A 3W15B 3ONLC 2I59A 2ZLYA 3CMLA 4JUYA 4DIDB 1MIYA 1M7KA 4H9QC 2XUEA 2NTXA 2LE8A 2AXDS 3MKDA 4IREA 5M4YA 4G2AA 2DWKA 5LHIB 3OKQA 4EXTA 3AECA 4MALA 1ZHCA 4IE6A 3C51A 3UU4A 1WR0A 4AKGA 1WRDA 5FVKA 5IYZE 4V1Av 3H3AA 3ZSSA 3LBXB 4H63V 4PK6A 4OYJA 2IDOB 4ANJA 3Q5WA 1IBMT 4DMVA 3FHNA 4DV5T 3PU3A 4KHPT 4YSXA 4E7ZA 3AAAB 4B3TT 3CX8B 2ODVA 2UUAT 2V5CA 4EAHA 1XZYA 2VK9A 3N9OA 4K0UA 2JQKA 3UU8A 2YINA 3PUZF 4JI3T 5C8YE 4HWIB 1FMVA 3SS1A 5C2TA 2LKGA 2DLRA 3CX7B 4IDNA 3CWZB 3RKOA 2A3DA 2A72A 3E0ZA 5IUXA 1HNXT 3VKGA 2JJ9A 5FY0A 4I43B 3PUXF 4EIWA 4OHFA 5FXWA 2YOEA 3KFWX 4CI1B 4HFDA 5HEOA 4NXMT 3AE5A 3X1DA 3NRYA 1CUNA 3AEDA 3RC8A 4GKKT 4CQIA 5HCJA 1XNRT 1HTJF 3N9LA 4N78D 4MBQA 2CLYB 2K24A 2V5DA 3C4XA 1OEDA 2A9UA 4YFSA 3HKBE 3AVSA 1UGOA 2VVSA 2NR4A 3VR9A 4JBWF 3AE1A 3TLUA 3RYHE 3PU8A 5JR9B 4ZZBA 5AQRB 5JDGA 3RIAA 3IA3A 4YHJA 2Y8DA 3UQ4A 4ILUA 4QKNA 3LK2B 1W09A 5H6RB 1LKXA 4X1KE 3OVUA 5JQGE 3AE6A 5CB4E 4ZS2A 2NOXA 2NW7A 4QXHB 2XASB 4X62T 3ZEFB 3NZPA 1EZ3A 4C91A 3UULA 2DWGA 4KMCA 3NBXX 3HA4A 5IWAT 3VR8A 3SOLA 1N32T 5HWXA 4ZI3D 3MK7C 4TX5A 4PJJA 4ZOLE 4HWCA 3NRXA 1NENA 1WCRA 1HX1B 2X66A 2XPKA 3MJXA 4H9OC 4QH1A 5KMGP 4CXWA 2XTLA 4DR2T 2M6IA 3PUGA 4XZCA 2V6XA 1W0AA 3ZYKA 4EZHA 4GOUA 2BG9A 1XNQT 3PUWF 2LHRA 4WYVA 2L9QA 2XQ9A 2V7IA 5A1LA 5JTGA 4UV8B 2LT3A 4G63A 2WDVA 5CA0E 5JDLA 4WW0A 2I6HA 4QWNB 4H9SE 5AQGB 4ZHQE 1DU2A 4Z8XA 4IHJE 4X64T 2OV9A 3CKDA 2E9XA 1T8BA 4U3CA 3HKCE 1YQ3A 1W0BA 1YKEB 3OBVE 1I6ZA 5HXRA 2WS3A 5ABGA 2UXCT 2QVAA 4TV9E 2BKNA 3ZMTB 4JI1T 1IJ5A 1YKHB 4ASKA 4JLEA 4YXDA 2EHOC 1AJ3A 3WAJA 4HGAA 2WCAA 5L2LA 4DV1T 4F6RC 5L3CB 1B7TA 2RP4A 2QYWA 2KWHA 4KUMB 2WQYA 1HX8A 3I0OA 4HFCA 5ABEA 3P4QA 3PE0A 1WYCA 4EGWA 3ZYLA 3JC6C 3ANWB 5HEJA 3AEBA 4ILBA 4IL4A 2EHOD 4DV3T 4L5GA 3RPUA 4MLKA 2JQ9A 4EYUA 1U4QA 3KVAA 1ZOYA 3GN5A 2IMLA 3BQKA 1MNEA 5KX5E 2VURA 2P9BA 4DR1T 2FJDA 2EHOB 3FZHB 5ABHA 3ZT5A 1D0YA 4KBMB 3ZJ1A 5AQFB 4PW8A 4JI0T 2R6GF 2XAHB 2UXDT 4PFOA 5KDMC 3OYZA 1VRBA 1ZEEA 5ETWA 1MMGA 3GMIA 2M6BA 5EK4A 4YJ3E 2VQFT 4LF5T 1MIWA 1WR6A 4PK5A 4AQFC 1Y64B 2I0MA 4KX6A 2WZHA 5AFUL 2LOSA 2H7OA 3K3NA 4DR5T 2KZ7B 1NAFA 4P1NA 4JYAT 3O4XE 2QRXA 2L3LA 4X1IE 3FBZA 2IIUA 3P4SA 3L09A 2ZM0A 5L3GB 2VKDA 1X79A 2XQ6A 3C4ZA 5HXHA 4IDQA 2C5KT 2XQ4A 3UTKA 5JREA 1J1JA 5J2TE 3RQWA 3AB3B 2V6YA 3RGLA 3P4RA 1UURA 2B76A 5C3JA 5L3DB 3AEFA 1HS7A 4A56A 1UUSA 4MHCA 1T72A 2IC9A 2VASA 3BQLA 3LDQB 2RA1A 1N36T 2H7VC 3ETVA 3T8OA 2PFVA 2KXPB 1LVFA 4IDPA 2Y6XA 3RX6A 3C4WA 5AQLB 2MTQA 4HKAA 3OTOT 4FJOA 4AKRB 4NUVA 3N5LA 3ZMUB 3KV4A 2Q9QC 5JRCB 3N9PA 3I1AA 3ONJA 1LRZA 4DNDA 2XHEB 2C5JA 2ES0A 3AXJB 2OLTA 4JI7T 2XAJB 4X1YE 4UVCB 3EVYA 3FBLA 3CVRA 5DABA 4PNIA 4JI2T 3CPZA 2JPFA 4ZI2C 4HWHA 3ETUA 5FXVA 1YXRA 3RHWA 4EV6A 2V7KA 5HYAA 2BKPA 3CQXC 2WM9A 2JMHA 4HFIA 5F5WA 5AQHB 2Q9QD 4YY3T 5ABFA 3H37A 2CHNA 2QA7A 3WAKA 4PK4A 4TN7B 4XBFB 1HF8A 2HH7A 4IE4A 1L0VA 4NXNT 5H6QB 4LF7T 3IHRA 5JVDE 4PFPA 3HI2A 5J2UE 2MOZA 4PJMA 2D5UA 2IW5B 2IC6A 1X9BA 2E5VA 2V1DB 4AQGA 4NIQA 2Q9QB 1CHUA 4LFAT 4L0RA 5AQOB 4DVDA 2WWVA 3UQ7A 2LHNA 2SPCA 1VOMA 2BDEA 2CPTA 4HWDA 3SWHA 3KV6A 3I9WA 4A5XA 5LG3A 2KNDA 4I50E 5HEHA 3OJAA 1XMOT 4JI5T 2LM9A 3PTRB 4J2CA 2W66A 3JADA 4GYSA 2ACXA 3ZMZB 2NW8A 3RIUA 4DR3T 4UXNB 3UU3A 1SHZC 2XQ7A 3LFMA 4JV5T 3O1IA 1N33T 1KK7A 1ZP0A 3ZCJA 2N2NA 4AKHA 5HXSA 4DBQA 3LBXA 3PUVF 4EEDA 3GA8A 3TLWA 4DBRA 1OEDE 2J4GA 1E1HB 2X68A 3ESLA 3FZFB 2JQQA 2LJLA 2WAUA 2MBGA 1HR0T 2UXNB 4B3MT 2BG9C 3ZMSB 1UX4A 3K1SA 2FUPA 3G06A 2M67A 2DNXA 3EI0A 3O9XA 3RQUA 3UFGA 3RRCA 3ZC0A 2XQ3A 2B1EA 4CZZB 3KDSE 2VKJA 4GYRA 2X0YA 4UEMA 2YEVC 1HG5A 4O4IE 4U2YA 5FXXA 2E9XC 5BR8T 1V9DA 2UXBT 1SE7A 5LBMA 2JMKA 3RH3A 1XMQT 2LSIA 2VL8A 1HFAA 4WZXA 2WDQA 2D0UA 3RKGA 5LNKA 4PAGA 2H3RA 1BR2A 2WP9A 2J47A 5FY1A 3RC3A 4UVAB 3N2GE 4JI8T 3DTOA 4DV7T 5F3JA 5J1GA 3M3ZB 4LFBT 2XQ8A 3LG7A 4IE5A 3RF1A 3LK42 5JR9A 2V8SV 1G73A 2WMNA 5CGMA 3P8CD 3TLSA 5AQIB 1D1CA 5FYMA 5L3BB 3C64A 2MYSA 4DUYT 4H9NC 4C90A 5LHGB 3PJAA 3FZKB 4NPPA 2Z6EA 2CCQA 4OFZA 4UVBB 4YJ2E 3KBTA 4EOZB 2GK9A 1Z8UA 2BG9E 2LKHA 4BA9A 4Q25A 3ZYMA 2LSGA 2LSJA 2ZM6T 1KNZA 5FVLA 5DJQC 5LP6E 1N34T 2BS4A 3AE2A 2G0UA 3CK6A 2LEHA 3VKHA 1IJ6A 3HKEE 3KV5A 4LF9T 2FJAA 1NWMX 2WU5A 3Q2MA 2YDSA 4CXXA 3AEEA 3T1YT 5CJ5A 3L8RA 4AKLA 2YN6A 4ZI7E 3CX6B 3P4PA 3ZPOA 5HEUA 2BVLA 2KT9A 4HE8A 2LM2A 3AE9A 2V7MA 4YTNA 1FEWA 2LLYA 3V5UA 4A98A 1OWAA 3RYCE 4IIJE 4BAYB 3CIRA 3QB5A 5LJNA 2UUCT 2E5LT 4IL9A 5FXZA 4PJNA 4AKIA 5FL1A 4GK5E 3U78A 2WMOA 5AQMB 4AISA 4P0BA 1D1AA 3ABVA 2LSKA 5LGNB 3UFEA 4QHOA 3VRBA 4TNWA 1BR0A 5GONE 3N2KE 3EABA 3ZT7A 1S94A 2BKOA 2CXFA 5J0ZA 4Z90A 3UUNA 4YT0A 3E08A 3AA6B 4WBNE 4AQYT 1KEYA 2DHRA 2X9XA 4O4LE 5L4EA 3E22E 3ZSTA 3JC6D 5HCMA 3PJAJ 3IEEA 5LA6E 3AVRA 4YTMA 2K3WA 3SRZA 4DV6T 3UUXB 1IBKT 2N9DA 2WZIA 4B3ST 3AA7B 3RI5A 2ZM2A 2W62A 5LYJE 3ZT6A 3N9MA 2W0GA 3ANWA 4AI6A 3Q5DA 3Q9DA 3UUBA 1Y01A 3A8YC 3F2EA 2XSBA 3J7Yq 2HHHT 4ILCA 5FY7A 2NWBA 2XJ7A 2XQAA 3NWIA 3RYIE 4Z91A 4O4HE 2BS2A 2CBJA 5DQVA 2MPKA 1YQ4A 2EHOA 5E0OA 5LMNT 3VRAA 3QNUA 1MIVA 4QX7B 4TZ4C 5LMUT 3U3IA 4KI0F 2AE9A 3QUJA 3K3OA 2E2AA 3ZMVB 4CI2B 2WSSV 3BQIA 3H3MA 3ZLIA 3P7IA 3V5SA 2W2UA 3LJCA 3OPCA 1UK5A 4YTPA 2D9DA 5HWYA 3T1HT 2X9WA 2NW9A 3F57A 4EEBA 4UF0B 4CN6A 5JDMA 2CRBA 3L39A 4H9RC 2X9HA 3TLTA 2D0TA 3VU7H 4LF4T 4LMLA 2HN1A 1KNRA 4GIWA 1T98A 2HPJA 3RIUC 3HL6A 3QOFA 4I55E 2CEAA 1T7SA 3RRWA 3PUAA 2X0HA 3NZQA 4HFVA 1HG2A 2RPAA 1QSDA 2IHR1 2J1DG 3MACA 5L3FB 3ZN1B 1IZNB 2ZM8A 4IDZA 3DJBA 4LF8T 3JCFA 4I4TE 2F4VT 2V7LA 1U5PA 3AAEB 4B6XA 1WYBA 2BBHA 4U7YA 4DR7T 4O2AE 1W9RA 1OEDC 3P50A 4U33A 2V26A 4UIGA 5FKYA 5CA1E 4JI4T 2YDQA 1FIOA 5FNVE 3EUHA 1YD8G 4KP3C 4ZI2D 2CWOA 4YSZA 2XAQB 3AA1B 2MAWA 3TKLB 4UR9A 5JRCA 4QX8B 1KFYA 2UUBT 1I94T 3AE8A 4QH4A 3HR0A 4U74A 2KLQA 3I0QA 3IBPA 5HEGA 3AXJA 1M62A 5LCYA 2QGSA 3WI3A 4JI6T 4CI3B 4JEUB 1UCUA 4H9PC 3QC9A 5L4HA 1SUMB 3DP7A 3UU5A 4EYYR 2K5BB 2CLYC 1OEDB 2PJQA 4H63H 2XAFB 2VVNA 2XZEA 2DL1A 2X9YA 4ERRA 1IAPA 1KNPA 3N9NA 4ZZCA 3KV9A 5JR9C 2ZMAA 2BBJA 3KVBA 3PURA 2XY8B 1H7CA 2Q9QA 3MA9A 4PJLA 2JRKA 2DI4A 4BJNA 2W67A 2DCFA 4ISSA 4CXYA 3EHZA 2HPLA 2YDRA 5ADXL 5F8PA 2X67A 3L3PA 3J9X1 4DR4T 5KXJA 5LG4A 3B13A 3NVOA 4OX9T 5AQQB 2JIWA 3ZN0B 4COFA 3FZLB 2KSRA 2LSYA 4L9IA 2A2FX 4ILAA 2W00A 2LRKA 4U31A 1VCSA 5JDFA 1XDOA 2IUBA 2L8KA 1MMAA 3AAIA 1XDPA 4HFHA 4GK0E 4QH5A 3KINB 1MNDA 5FP3A 4DR6T 4M1PA 3K3QC 3PDYA 1SA0E 3ONXA 4HFBA 1MMDA 1GQEA 1JNZA 5EK2A 5AQVB 5LGUB 4K0KT 4YSYA 2XQ5A 4YLHA 1R8IA 4IE7A 4P09A 4ZI3C 4FI5A 2CE7A 5AQKB 2NP9A 2CXLA 2E9XD 2CHOA 2WY2A 2BG9B 4HFEA 4U2ZA 3IF8B 2X0LB 5IHYA 4X65T 2WU2A 2XQYA 4A97A 5JDHA 2PTFA 1JNRA 5LJMA 1HCIA 5CFBA 2KWIB 4IT4A 3GWHA 4X20E 3JAFA 3FXEB 4ISTA 2WWUA 4AIUA 2E9XB 3AE7A 3P4WA 5AQPB 4GKJT 4DO0A 4U72A 3RLFF 2C0SA 2LOPA 2UXXB 4MFRA 3K8PC 2UU9T 4CN4A 5JDQA 2VKHA 2HN2A 2H88A 2VKOA 3Q5XA 2CXDA 1QLBA 5FMNA 2XAGB 1BR1A 5HAXA 4ZS3A 5LGTB 1ZV4X 2K48A 4UV9B 2NTYA 3VHLA 5L47A 3UU6A 2ODUA 1VCTA 4ADZA 4X66T 3EAMA 2CM0A 3S4UA 5HXEA 2W4XA 5HXCA 2VL0A 4JEHB 3A7MA 1D0XA 4O8SA 2W61A 1E2AA 1UX5A 2PG8A 2FJBA 4F8HA 2YU1A 2VB6A 4TWFA 4OYKA 3ZC1A 1D0ZA 4BJMA 3NKZA 3R84B 2IAKA 3AE3A 2LRLA 5TAOA 5DQWA 3BK9A 3GN5B 1OXZA 2WDRA 3O1JA 3EDVA 2C5IT 5LB7B 3CQCB 4EZ4A 4DUZT 1WFDA 2XM2A 1D1BA 3Q5EA 2BVMA 3JAEA 5AQNB 3PUSA 3RYFE 1XWMA 5LOVE 3O1HA 1KF6A 4AXPA 3SFDA 1HNWT 4TWHA 3AA0B 1E7PA 3D0TA 3FZMB 5AQJB 2YK0A 4IE0A 3LK3B 2JQHA 5AQTB 2K9AA 4NUUA 2WB5A 4HEAA 5JDNA 3FXDB 5JH7E 2VQET 4TV8E 4DV4T 5BMVE 2CBIA 4LMJA 2OA5A 2YKSA 4U7IA 5EK3A 5AQUB 1O3XA 2FBWA 3C98B 3C50A 3QK6A 4TNVA 1HNZT 4QXCB 2V6YB 3B57A 3QB5K 4ZXLA 2KMFA 4DV2T 4XAXB 1MMNA 2WBLA 5LBQB 2V7JA 2ACZA 2CA5A 1FMWA 4ZEYA 4B3RT 3RIFA 4TWDA 3F31A 4I0UA 1NEKA 1J5ET 4E7SA 2XSAA 3M65A
chains in the Genus database with same CATH topology
1V9DA 2XAQB 5LBMA 4UELA 3ZMTB 1QUUA 3AA1B 1IJ5A 4OK0A 1YKHB 3TKLB 4ASKA 1S35A 3MXZA 2JMKA 4JLEA 3VKGA 5JRCA 4QX8B 4QXBB 2E8IA 2EHOC 1Z0PA 3RH3A 3KBUA 2LSIA 1AJ3A 2VL8A 1HFAA 3HR0A 3WAJA 4TUYE 1US7B 4HGAA 4U74A 5L2LA 2KLQA 3I0QA 2D0UA 3IBPA 4F6RC 2CMRA 3I9YA 5LNKA 1BR4A 5L3CB 4PAGA 1B7TA 5LCYA 2QGSA 2RP4A 3WI3A 4CI3B 2H3RA 2KWHA 3R6NA 4KUMB 3UT5E 1BR2A 4JEUB 1HX8A 3I0OA 4HN9A 3ZJ2A 1UCUA 2D2SA 5FY1A 1ZKEA 4H9PC 3QC9A 3RC3A 4UVAB 5EZYE 2PBIA 3DP7A 3N2GE 3MZKB 2KINB 3PE0A 4EYYR 1WYCA 3FB2A 2K5BB 2CLYC 3DTOA 4O4JE 3ZYLA 2PJQA 4H63H 3JC6C 3ANWB 5J1GA 5F3JA 2XAFB 3LG7A 2EHOD 3OYXA 4IE5A 1YW0A 2W63A 3LK42 4L5GA 5JR9A 2X9YA 2YU2A 3RPUA 1G73A 4ERRA 4HTEA 4MLKA 2WMNA 2X51A 4EYUA 1U4QA 1IAPA 3P8CD 2CWYA 3N9NA 3KVAA 3KV9A 1D1CA 2BZBA 5FYMA 5L3BB 4IGUA 3C64A 2MYSA 3BQKA 3GN5A 1MNEA 5JR9C 4H9NC 4C90A 2ZMAA 5LHGB 3CQGB 3ZCIA 5LHHB 2Z6EA 2VWAA 2CCQA 1G8XA 3KVBA 3PURA 3EDUA 4OFZA 4UVBB 1WLXA 3KBTA 4EOZB 1H7CA 2P9BA 2Q9QA 4YJ2E 2GK9A 4P0AA 3MA9A 4PJLA 2EHOB 3HKDE 3UUMA 4EB6E 1D0YA 1LVKA 4KBMB 4BA9A 2JRKA 3ZJ1A 5L3EB 2Y48B 3ZYMA 2DI4A 2LSGA 4BJNA 2LSJA 2DCFA 4PW8A 1KNZA 2N1GA 4DMWA 5DJQC 5LP6E 5KX5E 4ISSA 2XAHB 4CXYA 2HPLA 2G0UA 4PFOA 5KDMC 4WNKA 5ADXL 2LEHA 4WBOA 5F8PA 3OYZA 3VKHA 1VRBA 1ZEEA 2X67A 1IJ6A 3A5XA 3HKEE 4O2BE 5ETWA 4AQFA 3PUQA 3KV5A 1MMGA 5LXTE 3L3PA 3GMIA 3J9X1 5EK4A 1NWMX 5LG4A 3Q2MA 3N2OA 4CXXA 3B13A 4YJ3E 3N9QA 4UF0A 3W15B 1MIWA 1WR6A 4PK5A 2I59A 3ZN0B 2ZLYA 4AQFC 1Y64B 3CMLA 4AKLA 2LSYA 4JUYA 4L9IA 4ZI7E 3CX6B 5AFUL 2A2FX 1MIYA 2W00A 2LOSA 2H7OA 5JDFA 3K3NA 3ZPOA 2KZ7B 1NAFA 2L8KA 1MMAA 3AAIA 2BVLA 4H9QC 2KT9A 4GK0E 3KINB 2XUEA 4HE8A 3O4XE 1MNDA 2V7MA 1FEWA 2NTXA 2LE8A 5FP3A 3V5UA 2L3LA 3MKDA 4X1IE 3FBZA 1OWAA 5M4YA 4M1PA 3L09A 3RYCE 2ZM0A 4IIJE 5L3GB 3K3QC 2VKDA 4G2AA 2DWKA 1X79A 3OKQA 3PDYA 5LHIB 1SA0E 4EXTA 3ONXA 3C4ZA 5HXHA 4MALA 4BAYB 1ZHCA 1MMDA 5EK2A 5LJNA 5LGUB 4IE6A 3C51A 2C5KT 3UTKA 4AKGA 4YLHA 5JREA 5J2TE 1WRDA 5IYZE 5FXZA 4IE7A 4PJNA 4AKIA 3AB3B 4P09A 4ZI3C 4GK5E 3U78A 4V1Av 2WMOA 3H3AA 4FI5A 3LBXB 4H63V 2CE7A 4PK6A 4OYJA 2NP9A 2CXLA 2E9XD 3Q5WA 4ANJA 4DMVA 3FHNA 5L3DB 4P0BA 3PU3A 3IF8B 2X0LB 5IHYA 1D1AA 1HS7A 4E7ZA 2XQYA 4A56A 2LSKA 3AAAB 3UFEA 4QHOA 5JDHA 5LGNB 3CX8B 2ODVA 5LJMA 4MHCA 1HCIA 1BR0A 5GONE 3N2KE 2IC9A 4EAHA 2VK9A 2KWIB 2VASA 3N9OA 1S94A 3BQLA 3GWHA 4K0UA 4X20E 2CXFA 2YINA 2RA1A 2H7VC 3ETVA 3FXEB 4ISTA 5C8YE 2WWUA 1FMVA 3SS1A 3T8OA 3UUNA 2E9XB 3E08A 2DLRA 3AA6B 4WBNE 2PFVA 3CX7B 2KXPB 2DHRA 1LVFA 2Y6XA 4DO0A 4U72A 3RX6A 3C4WA 3CWZB 3RKOA 2X9XA 2A3DA 2A72A 3E0ZA 4O4LE 2MTQA 2C0SA 2LOPA 4HKAA 2JJ9A 2UXXB 3E22E 4FJOA 4MFRA 3K8PC 4I43B 5FY0A 4EIWA 4OHFA 5JDQA 2VKHA 3JC6D 4AKRB 5FXWA 4NUVA 3N5LA 2VKOA 3IEEA 3Q5XA 3ZMUB 2CXDA 5LA6E 5FMNA 3KV4A 3KFWX 3AVRA 2XAGB 4CI1B 3SRZA 2Q9QC 1BR1A 5HAXA 5JRCB 3N9PA 3UUXB 4ZS3A 5LGTB 1ZV4X 2K48A 4UV9B 2NTYA 3I1AA 3VHLA 3NRYA 1CUNA 2ODUA 3RC8A 1LRZA 4ADZA 4CQIA 4DNDA 2N9DA 2XHEB 2C5JA 1HTJF 2ES0A 2XAJB 3N9LA 4N78D 2CM0A 3AA7B 4UVCB 4X1YE 3S4UA 2ZM2A 3EVYA 3FBLA 4MBQA 5HXEA 3CVRA 2CLYB 2K24A 2W62A 4PNIA 5DABA 3C4XA 3CPZA 2JPFA 5HXCA 5LYJE 4ZI2C 3ETUA 3N9MA 4JEHB 2W0GA 3ANWA 5FXVA 1D0XA 4AI6A 4YFSA 4O8SA 2W61A 3HKBE 3AVSA 1UX5A 3M65A 3Q9DA 2V7KA 3F2EA 5HYAA 2PG8A 3J7Yq 3CQXC 2WM9A 2JMHA 2Q9QD 2YU1A 2VB6A 3H37A 2QA7A 3WAKA 4OYKA 5FY7A 2NWBA 4PK4A 4TN7B 3RYHE 4XBFB 3ZC1A 1D0ZA 1HF8A 3PU8A 2HH7A 5JR9B 3RYIE 4IE4A 5JDGA 4BJMA 4O4HE 5H6QB 3R84B 4YHJA 2IAKA 2Y8DA 5TAOA 4ILUA 5DQWA 3BK9A 5DQVA 3GN5B 3IHRA 4QKNA 1OXZA 5JVDE 3O1JA 4PFPA 2EHOA 3HI2A 5E0OA 3LK2B 3EDVA 2MOZA 4PJMA 2D5UA 2C5IT 5J2UE 2IW5B 5H6RB 2IC6A 3CQCB 4EZ4A 2V1DB 4AQGA 1MIVA 4QX7B 2Q9QB 4TZ4C 1D1BA 3U3IA 2BVMA 1LKXA 4X1KE 3QUJA 4L0RA 3K3OA 5JQGE 4DVDA 3ZMVB 4CI2B 5CB4E 4ZS2A 2WSSV 2NOXA 3BQIA 3PUSA 2NW7A 2LHNA 2SPCA 3ZLIA 1VOMA 3P7IA 3RYFE 4QXHB 2BDEA 2XASB 3ZEFB 5LOVE 3V5SA 3O1HA 3SWHA 3LJCA 3NZPA 1EZ3A 3KV6A 4C91A 3I9WA 3UULA 4AXPA 5HWYA 2DWGA 2X9WA 2KNDA 4KMCA 4I50E 3NBXX 3HA4A 3OJAA 3AA0B 2NW9A 3F57A 2LM9A 3D0TA 3PTRB 4J2CA 4UF0B 3SOLA 5HWXA 4ZI3D 3MK7C 2YK0A 4IE0A 5JDMA 4GYSA 4TX5A 2ACXA 3LK3B 3ZMZB 2NW8A 4PJJA 4H9RC 4ZOLE 2K9AA 2X9HA 4NUUA 4UXNB 2D0TA 3NRXA 1SHZC 3VU7H 3LFMA 3O1IA 4HEAA 5JDNA 3FXDB 5JH7E 1KK7A 2X66A 2N2NA 4GIWA 3MJXA 3ZCJA 4TV8E 1T98A 4AKHA 2HPJA 4H9OC 5KMGP 5HXSA 3HL6A 4DBQA 4CXWA 2XTLA 5BMVE 4I55E 2CEAA 3RRWA 3PUGA 3PUAA 2OA5A 4XZCA 3NZQA 4HFVA 5EK3A 1O3XA 1HG2A 1QSDA 3LBXA 3ZYKA 3GA8A 2J1DG 4EZHA 3MACA 3C98B 3C50A 3QK6A 4DBRA 5L3FB 4GOUA 3ZN1B 1IZNB 2ZM8A 4IDZA 4QXCB 2LHRA 3DJBA 2L9QA 1E1HB 2X68A 4I4TE 2V7IA 3B57A 5A1LA 3ESLA 2V7LA 4UV8B 2JQQA 2LJLA 2KMFA 2LT3A 2WAUA 2MBGA 1U5PA 3AAEB 4G63A 4B6XA 1WYBA 2UXNB 1MMNA 2WBLA 4XAXB 5CA0E 5JDLA 4WW0A 4O2AE 4QWNB 5LBQB 3ZMSB 2V7JA 4H9SE 4ZHQE 1UX4A 2CA5A 1FMWA 2M67A 2DNXA 4Z8XA 4IHJE 3O9XA 2V26A 3RRCA 3CKDA 4UIGA 2E9XA 3F31A 5CA1E 3ZC0A 2B1EA 4CZZB 3KDSE 2VKJA 4GYRA 1FIOA 4UEMA 2YEVC 4E7SA 3HKCE 1HG5A 3OBVE 4O4IE 1YKEB 5FNVE 5FXXA 3EUHA 1YD8G 5HXRA 4KP3C 2E9XC 2CWOA 4ZI2D 4TV9E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q9Q C;  2EHO B;  2EHO A;  2E9X A;  2E9X D;  2Q9Q B;  3JC6 D;  3ANW A; 
#chains in the Genus database with same CATH topology
 4UEL A;  1QUU A;  4OK0 A;  1S35 A;  3MXZ A;  1FJG T;  4QXB B;  2E8I A;  1Z0P A;  5FL0 A;  3KBU A;  4LF6 T;  4TUY E;  2BS3 A;  1US7 B;  2CMR A;  3I9Y A;  1BR4 A;  4IDO A;  3R6N A;  3UT5 E;  4HN9 A;  3ZJ2 A;  2D2S A;  4KHZ F;  3B5M A;  1ZKE A;  4LMK A;  3PUY F;  5EZY E;  2PBI A;  3MZK B;  2KIN B;  4LFC T;  3FB2 A;  4O4J E;  3TLV A;  1J5W A;  2FJE A;  3OYX A;  1YW0 A;  2W63 A;  2XM1 A;  4HWF A;  2YU2 A;  4HTE A;  2J62 A;  5ABF B;  2X51 A;  2CWY A;  2BZB A;  4IGU A;  3AE4 A;  1IBL T;  3CQG B;  3ZCI A;  5LHH B;  4CN1 A;  2VWA A;  1G8X A;  3EDU A;  1WLX A;  4P0A A;  3SFE A;  3HKD E;  3UUM A;  3LSV A;  4EB6 E;  1LVK A;  3AEG A;  5L3E B;  2Y48 B;  2N1G A;  4DMW A;  4YHH T;  4DV0 T;  4WNK A;  4WBO A;  3PV0 F;  3AEA A;  3A5X A;  4O2B E;  4AQF A;  3PUQ A;  5LXT E;  5AQS B;  2H89 A;  3ZKR A;  3N2O A;  4X5T A;  3N9Q A;  4UF0 A;  3W15 B;  3ONL C;  2I59 A;  2ZLY A;  3CML A;  4JUY A;  4DID B;  1MIY A;  1M7K A;  4H9Q C;  2XUE A;  2NTX A;  2LE8 A;  2AXD S;  3MKD A;  4IRE A;  5M4Y A;  4G2A A;  2DWK A;  5LHI B;  3OKQ A;  4EXT A;  3AEC A;  4MAL A;  1ZHC A;  4IE6 A;  3C51 A;  3UU4 A;  1WR0 A;  4AKG A;  1WRD A;  5FVK A;  5IYZ E;  4V1A v;  3H3A A;  3ZSS A;  3LBX B;  4H63 V;  4PK6 A;  4OYJ A;  2IDO B;  4ANJ A;  3Q5W A;  1IBM T;  4DMV A;  3FHN A;  4DV5 T;  3PU3 A;  4KHP T;  4YSX A;  4E7Z A;  3AAA B;  4B3T T;  3CX8 B;  2ODV A;  2UUA T;  2V5C A;  4EAH A;  1XZY A;  2VK9 A;  3N9O A;  4K0U A;  2JQK A;  3UU8 A;  2YIN A;  3PUZ F;  4JI3 T;  5C8Y E;  4HWI B;  1FMV A;  3SS1 A;  5C2T A;  2LKG A;  2DLR A;  3CX7 B;  4IDN A;  3CWZ B;  3RKO A;  2A3D A;  2A72 A;  3E0Z A;  5IUX A;  1HNX T;  3VKG A;  2JJ9 A;  5FY0 A;  4I43 B;  3PUX F;  4EIW A;  4OHF A;  5FXW A;  2YOE A;  3KFW X;  4CI1 B;  4HFD A;  5HEO A;  4NXM T;  3AE5 A;  3X1D A;  3NRY A;  1CUN A;  3AED A;  3RC8 A;  4GKK T;  4CQI A;  5HCJ A;  1XNR T;  1HTJ F;  3N9L A;  4N78 D;  4MBQ A;  2CLY B;  2K24 A;  2V5D A;  3C4X A;  1OED A;  2A9U A;  4YFS A;  3HKB E;  3AVS A;  1UGO A;  2VVS A;  2NR4 A;  3VR9 A;  4JBW F;  3AE1 A;  3TLU A;  3RYH E;  3PU8 A;  5JR9 B;  4ZZB A;  5AQR B;  5JDG A;  3RIA A;  3IA3 A;  4YHJ A;  2Y8D A;  3UQ4 A;  4ILU A;  4QKN A;  3LK2 B;  1W09 A;  5H6R B;  1LKX A;  4X1K E;  3OVU A;  5JQG E;  3AE6 A;  5CB4 E;  4ZS2 A;  2NOX A;  2NW7 A;  4QXH B;  2XAS B;  4X62 T;  3ZEF B;  3NZP A;  1EZ3 A;  4C91 A;  3UUL A;  2DWG A;  4KMC A;  3NBX X;  3HA4 A;  5IWA T;  3VR8 A;  3SOL A;  1N32 T;  5HWX A;  4ZI3 D;  3MK7 C;  4TX5 A;  4PJJ A;  4ZOL E;  4HWC A;  3NRX A;  1NEN A;  1WCR A;  1HX1 B;  2X66 A;  2XPK A;  3MJX A;  4H9O C;  4QH1 A;  5KMG P;  4CXW A;  2XTL A;  4DR2 T;  2M6I A;  3PUG A;  4XZC A;  2V6X A;  1W0A A;  3ZYK A;  4EZH A;  4GOU A;  2BG9 A;  1XNQ T;  3PUW F;  2LHR A;  4WYV A;  2L9Q A;  2XQ9 A;  2V7I A;  5A1L A;  5JTG A;  4UV8 B;  2LT3 A;  4G63 A;  2WDV A;  5CA0 E;  5JDL A;  4WW0 A;  2I6H A;  4QWN B;  4H9S E;  5AQG B;  4ZHQ E;  1DU2 A;  4Z8X A;  4IHJ E;  4X64 T;  2OV9 A;  3CKD A;  2E9X A;  1T8B A;  4U3C A;  3HKC E;  1YQ3 A;  1W0B A;  1YKE B;  3OBV E;  1I6Z A;  5HXR A;  2WS3 A;  5ABG A;  2UXC T;  2QVA A;  4TV9 E;  2BKN A;  3ZMT B;  4JI1 T;  1IJ5 A;  1YKH B;  4ASK A;  4JLE A;  4YXD A;  2EHO C;  1AJ3 A;  3WAJ A;  4HGA A;  2WCA A;  5L2L A;  4DV1 T;  4F6R C;  5L3C B;  1B7T A;  2RP4 A;  2QYW A;  2KWH A;  4KUM B;  2WQY A;  1HX8 A;  3I0O A;  4HFC A;  5ABE A;  3P4Q A;  3PE0 A;  1WYC A;  4EGW A;  3ZYL A;  3JC6 C;  3ANW B;  5HEJ A;  3AEB A;  4ILB A;  4IL4 A;  2EHO D;  4DV3 T;  4L5G A;  3RPU A;  4MLK A;  2JQ9 A;  4EYU A;  1U4Q A;  3KVA A;  1ZOY A;  3GN5 A;  2IML A;  3BQK A;  1MNE A;  5KX5 E;  2VUR A;  2P9B A;  4DR1 T;  2FJD A;  2EHO B;  3FZH B;  5ABH A;  3ZT5 A;  1D0Y A;  4KBM B;  3ZJ1 A;  5AQF B;  4PW8 A;  4JI0 T;  2R6G F;  2XAH B;  2UXD T;  4PFO A;  5KDM C;  3OYZ A;  1VRB A;  1ZEE A;  5ETW A;  1MMG A;  3GMI A;  2M6B A;  5EK4 A;  4YJ3 E;  2VQF T;  4LF5 T;  1MIW A;  1WR6 A;  4PK5 A;  4AQF C;  1Y64 B;  2I0M A;  4KX6 A;  2WZH A;  5AFU L;  2LOS A;  2H7O A;  3K3N A;  4DR5 T;  2KZ7 B;  1NAF A;  4P1N A;  4JYA T;  3O4X E;  2QRX A;  2L3L A;  4X1I E;  3FBZ A;  2IIU A;  3P4S A;  3L09 A;  2ZM0 A;  5L3G B;  2VKD A;  1X79 A;  2XQ6 A;  3C4Z A;  5HXH A;  4IDQ A;  2C5K T;  2XQ4 A;  3UTK A;  5JRE A;  1J1J A;  5J2T E;  3RQW A;  3AB3 B;  2V6Y A;  3RGL A;  3P4R A;  1UUR A;  2B76 A;  5C3J A;  5L3D B;  3AEF A;  1HS7 A;  4A56 A;  1UUS A;  4MHC A;  1T72 A;  2IC9 A;  2VAS A;  3BQL A;  3LDQ B;  2RA1 A;  1N36 T;  2H7V C;  3ETV A;  3T8O A;  2PFV A;  2KXP B;  1LVF A;  4IDP A;  2Y6X A;  3RX6 A;  3C4W A;  5AQL B;  2MTQ A;  4HKA A;  3OTO T;  4FJO A;  4AKR B;  4NUV A;  3N5L A;  3ZMU B;  3KV4 A;  2Q9Q C;  5JRC B;  3N9P A;  3I1A A;  3ONJ A;  1LRZ A;  4DND A;  2XHE B;  2C5J A;  2ES0 A;  3AXJ B;  2OLT A;  4JI7 T;  2XAJ B;  4X1Y E;  4UVC B;  3EVY A;  3FBL A;  3CVR A;  5DAB A;  4PNI A;  4JI2 T;  3CPZ A;  2JPF A;  4ZI2 C;  4HWH A;  3ETU A;  5FXV A;  1YXR A;  3RHW A;  4EV6 A;  2V7K A;  5HYA A;  2BKP A;  3CQX C;  2WM9 A;  2JMH A;  4HFI A;  5F5W A;  5AQH B;  2Q9Q D;  4YY3 T;  5ABF A;  3H37 A;  2CHN A;  2QA7 A;  3WAK A;  4PK4 A;  4TN7 B;  4XBF B;  1HF8 A;  2HH7 A;  4IE4 A;  1L0V A;  4NXN T;  5H6Q B;  4LF7 T;  3IHR A;  5JVD E;  4PFP A;  3HI2 A;  5J2U E;  2MOZ A;  4PJM A;  2D5U A;  2IW5 B;  2IC6 A;  1X9B A;  2E5V A;  2V1D B;  4AQG A;  4NIQ A;  2Q9Q B;  1CHU A;  4LFA T;  4L0R A;  5AQO B;  4DVD A;  2WWV A;  3UQ7 A;  2LHN A;  2SPC A;  1VOM A;  2BDE A;  2CPT A;  4HWD A;  3SWH A;  3KV6 A;  3I9W A;  4A5X A;  5LG3 A;  2KND A;  4I50 E;  5HEH A;  3OJA A;  1XMO T;  4JI5 T;  2LM9 A;  3PTR B;  4J2C A;  2W66 A;  3JAD A;  4GYS A;  2ACX A;  3ZMZ B;  2NW8 A;  3RIU A;  4DR3 T;  4UXN B;  3UU3 A;  1SHZ C;  2XQ7 A;  3LFM A;  4JV5 T;  3O1I A;  1N33 T;  1KK7 A;  1ZP0 A;  3ZCJ A;  2N2N A;  4AKH A;  5HXS A;  4DBQ A;  3LBX A;  3PUV F;  4EED A;  3GA8 A;  3TLW A;  4DBR A;  1OED E;  2J4G A;  1E1H B;  2X68 A;  3ESL A;  3FZF B;  2JQQ A;  2LJL A;  2WAU A;  2MBG A;  1HR0 T;  2UXN B;  4B3M T;  2BG9 C;  3ZMS B;  1UX4 A;  3K1S A;  2FUP A;  3G06 A;  2M67 A;  2DNX A;  3EI0 A;  3O9X A;  3RQU A;  3UFG A;  3RRC A;  3ZC0 A;  2XQ3 A;  2B1E A;  4CZZ B;  3KDS E;  2VKJ A;  4GYR A;  2X0Y A;  4UEM A;  2YEV C;  1HG5 A;  4O4I E;  4U2Y A;  5FXX A;  2E9X C;  5BR8 T;  1V9D A;  2UXB T;  1SE7 A;  5LBM A;  2JMK A;  3RH3 A;  1XMQ T;  2LSI A;  2VL8 A;  1HFA A;  4WZX A;  2WDQ A;  2D0U A;  3RKG A;  5LNK A;  4PAG A;  2H3R A;  1BR2 A;  2WP9 A;  2J47 A;  5FY1 A;  3RC3 A;  4UVA B;  3N2G E;  4JI8 T;  3DTO A;  4DV7 T;  5F3J A;  5J1G A;  3M3Z B;  4LFB T;  2XQ8 A;  3LG7 A;  4IE5 A;  3RF1 A;  3LK4 2;  5JR9 A;  2V8S V;  1G73 A;  2WMN A;  5CGM A;  3P8C D;  3TLS A;  5AQI B;  1D1C A;  5FYM A;  5L3B B;  3C64 A;  2MYS A;  4DUY T;  4H9N C;  4C90 A;  5LHG B;  3PJA A;  3FZK B;  4NPP A;  2Z6E A;  2CCQ A;  4OFZ A;  4UVB B;  4YJ2 E;  3KBT A;  4EOZ B;  2GK9 A;  1Z8U A;  2BG9 E;  2LKH A;  4BA9 A;  4Q25 A;  3ZYM A;  2LSG A;  2LSJ A;  2ZM6 T;  1KNZ A;  5FVL A;  5DJQ C;  5LP6 E;  1N34 T;  2BS4 A;  3AE2 A;  2G0U A;  3CK6 A;  2LEH A;  3VKH A;  1IJ6 A;  3HKE E;  3KV5 A;  4LF9 T;  2FJA A;  1NWM X;  2WU5 A;  3Q2M A;  2YDS A;  4CXX A;  3AEE A;  3T1Y T;  5CJ5 A;  3L8R A;  4AKL A;  2YN6 A;  4ZI7 E;  3CX6 B;  3P4P A;  3ZPO A;  5HEU A;  2BVL A;  2KT9 A;  4HE8 A;  2LM2 A;  3AE9 A;  2V7M A;  4YTN A;  1FEW A;  2LLY A;  3V5U A;  4A98 A;  1OWA A;  3RYC E;  4IIJ E;  4BAY B;  3CIR A;  3QB5 A;  5LJN A;  2UUC T;  2E5L T;  4IL9 A;  5FXZ A;  4PJN A;  4AKI A;  5FL1 A;  4GK5 E;  3U78 A;  2WMO A;  5AQM B;  4AIS A;  4P0B A;  1D1A A;  3ABV A;  2LSK A;  5LGN B;  3UFE A;  4QHO A;  3VRB A;  4TNW A;  1BR0 A;  5GON E;  3N2K E;  3EAB A;  3ZT7 A;  1S94 A;  2BKO A;  2CXF A;  5J0Z A;  4Z90 A;  3UUN A;  4YT0 A;  3E08 A;  3AA6 B;  4WBN E;  4AQY T;  1KEY A;  2DHR A;  2X9X A;  4O4L E;  5L4E A;  3E22 E;  3ZST A;  3JC6 D;  5HCM A;  3PJA J;  3IEE A;  5LA6 E;  3AVR A;  4YTM A;  2K3W A;  3SRZ A;  4DV6 T;  3UUX B;  1IBK T;  2N9D A;  2WZI A;  4B3S T;  3AA7 B;  3RI5 A;  2ZM2 A;  2W62 A;  5LYJ E;  3ZT6 A;  3N9M A;  2W0G A;  3ANW A;  4AI6 A;  3Q5D A;  3Q9D A;  3UUB A;  1Y01 A;  3A8Y C;  3F2E A;  2XSB A;  3J7Y q;  2HHH T;  4ILC A;  5FY7 A;  2NWB A;  2XJ7 A;  2XQA A;  3NWI A;  3RYI E;  4Z91 A;  4O4H E;  2BS2 A;  2CBJ A;  5DQV A;  2MPK A;  1YQ4 A;  2EHO A;  5E0O A;  5LMN T;  3VRA A;  3QNU A;  1MIV A;  4QX7 B;  4TZ4 C;  5LMU T;  3U3I A;  4KI0 F;  2AE9 A;  3QUJ A;  3K3O A;  2E2A A;  3ZMV B;  4CI2 B;  2WSS V;  3BQI A;  3H3M A;  3ZLI A;  3P7I A;  3V5S A;  2W2U A;  3LJC A;  3OPC A;  1UK5 A;  4YTP A;  2D9D A;  5HWY A;  3T1H T;  2X9W A;  2NW9 A;  3F57 A;  4EEB A;  4UF0 B;  4CN6 A;  5JDM A;  2CRB A;  3L39 A;  4H9R C;  2X9H A;  3TLT A;  2D0T A;  3VU7 H;  4LF4 T;  4LML A;  2HN1 A;  1KNR A;  4GIW A;  1T98 A;  2HPJ A;  3RIU C;  3HL6 A;  3QOF A;  4I55 E;  2CEA A;  1T7S A;  3RRW A;  3PUA A;  2X0H A;  3NZQ A;  4HFV A;  1HG2 A;  2RPA A;  1QSD A;  2IHR 1;  2J1D G;  3MAC A;  5L3F B;  3ZN1 B;  1IZN B;  2ZM8 A;  4IDZ A;  3DJB A;  4LF8 T;  3JCF A;  4I4T E;  2F4V T;  2V7L A;  1U5P A;  3AAE B;  4B6X A;  1WYB A;  2BBH A;  4U7Y A;  4DR7 T;  4O2A E;  1W9R A;  1OED C;  3P50 A;  4U33 A;  2V26 A;  4UIG A;  5FKY A;  5CA1 E;  4JI4 T;  2YDQ A;  1FIO A;  5FNV E;  3EUH A;  1YD8 G;  4KP3 C;  4ZI2 D;  2CWO A;  4YSZ A;  2XAQ B;  3AA1 B;  2MAW A;  3TKL B;  4UR9 A;  5JRC A;  4QX8 B;  1KFY A;  2UUB T;  1I94 T;  3AE8 A;  4QH4 A;  3HR0 A;  4U74 A;  2KLQ A;  3I0Q A;  3IBP A;  5HEG A;  3AXJ A;  1M62 A;  5LCY A;  2QGS A;  3WI3 A;  4JI6 T;  4CI3 B;  4JEU B;  1UCU A;  4H9P C;  3QC9 A;  5L4H A;  1SUM B;  3DP7 A;  3UU5 A;  4EYY R;  2K5B B;  2CLY C;  1OED B;  2PJQ A;  4H63 H;  2XAF B;  2VVN A;  2XZE A;  2DL1 A;  2X9Y A;  4ERR A;  1IAP A;  1KNP A;  3N9N A;  4ZZC A;  3KV9 A;  5JR9 C;  2ZMA A;  2BBJ A;  3KVB A;  3PUR A;  2XY8 B;  1H7C A;  2Q9Q A;  3MA9 A;  4PJL A;  2JRK A;  2DI4 A;  4BJN A;  2W67 A;  2DCF A;  4ISS A;  4CXY A;  3EHZ A;  2HPL A;  2YDR A;  5ADX L;  5F8P A;  2X67 A;  3L3P A;  3J9X 1;  4DR4 T;  5KXJ A;  5LG4 A;  3B13 A;  3NVO A;  4OX9 T;  5AQQ B;  2JIW A;  3ZN0 B;  4COF A;  3FZL B;  2KSR A;  2LSY A;  4L9I A;  2A2F X;  4ILA A;  2W00 A;  2LRK A;  4U31 A;  1VCS A;  5JDF A;  1XDO A;  2IUB A;  2L8K A;  1MMA A;  3AAI A;  1XDP A;  4HFH A;  4GK0 E;  4QH5 A;  3KIN B;  1MND A;  5FP3 A;  4DR6 T;  4M1P A;  3K3Q C;  3PDY A;  1SA0 E;  3ONX A;  4HFB A;  1MMD A;  1GQE A;  1JNZ A;  5EK2 A;  5AQV B;  5LGU B;  4K0K T;  4YSY A;  2XQ5 A;  4YLH A;  1R8I A;  4IE7 A;  4P09 A;  4ZI3 C;  4FI5 A;  2CE7 A;  5AQK B;  2NP9 A;  2CXL A;  2E9X D;  2CHO A;  2WY2 A;  2BG9 B;  4HFE A;  4U2Z A;  3IF8 B;  2X0L B;  5IHY A;  4X65 T;  2WU2 A;  2XQY A;  4A97 A;  5JDH A;  2PTF A;  1JNR A;  5LJM A;  1HCI A;  5CFB A;  2KWI B;  4IT4 A;  3GWH A;  4X20 E;  3JAF A;  3FXE B;  4IST A;  2WWU A;  4AIU A;  2E9X B;  3AE7 A;  3P4W A;  5AQP B;  4GKJ T;  4DO0 A;  4U72 A;  3RLF F;  2C0S A;  2LOP A;  2UXX B;  4MFR A;  3K8P C;  2UU9 T;  4CN4 A;  5JDQ A;  2VKH A;  2HN2 A;  2H88 A;  2VKO A;  3Q5X A;  2CXD A;  1QLB A;  5FMN A;  2XAG B;  1BR1 A;  5HAX A;  4ZS3 A;  5LGT B;  1ZV4 X;  2K48 A;  4UV9 B;  2NTY A;  3VHL A;  5L47 A;  3UU6 A;  2ODU A;  1VCT A;  4ADZ A;  4X66 T;  3EAM A;  2CM0 A;  3S4U A;  5HXE A;  2W4X A;  5HXC A;  2VL0 A;  4JEH B;  3A7M A;  1D0X A;  4O8S A;  2W61 A;  1E2A A;  1UX5 A;  2PG8 A;  2FJB A;  4F8H A;  2YU1 A;  2VB6 A;  4TWF A;  4OYK A;  3ZC1 A;  1D0Z A;  4BJM A;  3NKZ A;  3R84 B;  2IAK A;  3AE3 A;  2LRL A;  5TAO A;  5DQW A;  3BK9 A;  3GN5 B;  1OXZ A;  2WDR A;  3O1J A;  3EDV A;  2C5I T;  5LB7 B;  3CQC B;  4EZ4 A;  4DUZ T;  1WFD A;  2XM2 A;  1D1B A;  3Q5E A;  2BVM A;  3JAE A;  5AQN B;  3PUS A;  3RYF E;  1XWM A;  5LOV E;  3O1H A;  1KF6 A;  4AXP A;  3SFD A;  1HNW T;  4TWH A;  3AA0 B;  1E7P A;  3D0T A;  3FZM B;  5AQJ B;  2YK0 A;  4IE0 A;  3LK3 B;  2JQH A;  5AQT B;  2K9A A;  4NUU A;  2WB5 A;  4HEA A;  5JDN A;  3FXD B;  5JH7 E;  2VQE T;  4TV8 E;  4DV4 T;  5BMV E;  2CBI A;  4LMJ A;  2OA5 A;  2YKS A;  4U7I A;  5EK3 A;  5AQU B;  1O3X A;  2FBW A;  3C98 B;  3C50 A;  3QK6 A;  4TNV A;  1HNZ T;  4QXC B;  2V6Y B;  3B57 A;  3QB5 K;  4ZXL A;  2KMF A;  4DV2 T;  4XAX B;  1MMN A;  2WBL A;  5LBQ B;  2V7J A;  2ACZ A;  2CA5 A;  1FMW A;  4ZEY A;  4B3R T;  3RIF A;  4TWD A;  3F31 A;  4I0U A;  1NEK A;  1J5E T;  4E7S A;  2XSA A;  3M65 A; 
#chains in the Genus database with same CATH homology
 1V9D A;  2XAQ B;  5LBM A;  4UEL A;  3ZMT B;  1QUU A;  3AA1 B;  1IJ5 A;  4OK0 A;  1YKH B;  3TKL B;  4ASK A;  1S35 A;  3MXZ A;  2JMK A;  4JLE A;  3VKG A;  5JRC A;  4QX8 B;  4QXB B;  2E8I A;  2EHO C;  1Z0P A;  3RH3 A;  3KBU A;  2LSI A;  1AJ3 A;  2VL8 A;  1HFA A;  3HR0 A;  3WAJ A;  4TUY E;  1US7 B;  4HGA A;  4U74 A;  5L2L A;  2KLQ A;  3I0Q A;  2D0U A;  3IBP A;  4F6R C;  2CMR A;  3I9Y A;  5LNK A;  1BR4 A;  5L3C B;  4PAG A;  1B7T A;  5LCY A;  2QGS A;  2RP4 A;  3WI3 A;  4CI3 B;  2H3R A;  2KWH A;  3R6N A;  4KUM B;  3UT5 E;  1BR2 A;  4JEU B;  1HX8 A;  3I0O A;  4HN9 A;  3ZJ2 A;  1UCU A;  2D2S A;  5FY1 A;  1ZKE A;  4H9P C;  3QC9 A;  3RC3 A;  4UVA B;  5EZY E;  2PBI A;  3DP7 A;  3N2G E;  3MZK B;  2KIN B;  3PE0 A;  4EYY R;  1WYC A;  3FB2 A;  2K5B B;  2CLY C;  3DTO A;  4O4J E;  3ZYL A;  2PJQ A;  4H63 H;  3JC6 C;  3ANW B;  5J1G A;  5F3J A;  2XAF B;  3LG7 A;  2EHO D;  3OYX A;  4IE5 A;  1YW0 A;  2W63 A;  3LK4 2;  4L5G A;  5JR9 A;  2X9Y A;  2YU2 A;  3RPU A;  1G73 A;  4ERR A;  4HTE A;  4MLK A;  2WMN A;  2X51 A;  4EYU A;  1U4Q A;  1IAP A;  3P8C D;  2CWY A;  3N9N A;  3KVA A;  3KV9 A;  1D1C A;  2BZB A;  5FYM A;  5L3B B;  4IGU A;  3C64 A;  2MYS A;  3BQK A;  3GN5 A;  1MNE A;  5JR9 C;  4H9N C;  4C90 A;  2ZMA A;  5LHG B;  3CQG B;  3ZCI A;  5LHH B;  2Z6E A;  2VWA A;  2CCQ A;  1G8X A;  3KVB A;  3PUR A;  3EDU A;  4OFZ A;  4UVB B;  1WLX A;  3KBT A;  4EOZ B;  1H7C A;  2P9B A;  2Q9Q A;  4YJ2 E;  2GK9 A;  4P0A A;  3MA9 A;  4PJL A;  2EHO B;  3HKD E;  3UUM A;  4EB6 E;  1D0Y A;  1LVK A;  4KBM B;  4BA9 A;  2JRK A;  3ZJ1 A;  5L3E B;  2Y48 B;  3ZYM A;  2DI4 A;  2LSG A;  4BJN A;  2LSJ A;  2DCF A;  4PW8 A;  1KNZ A;  2N1G A;  4DMW A;  5DJQ C;  5LP6 E;  5KX5 E;  4ISS A;  2XAH B;  4CXY A;  2HPL A;  2G0U A;  4PFO A;  5KDM C;  4WNK A;  5ADX L;  2LEH A;  4WBO A;  5F8P A;  3OYZ A;  3VKH A;  1VRB A;  1ZEE A;  2X67 A;  1IJ6 A;  3A5X A;  3HKE E;  4O2B E;  5ETW A;  4AQF A;  3PUQ A;  3KV5 A;  1MMG A;  5LXT E;  3L3P A;  3GMI A;  3J9X 1;  5EK4 A;  1NWM X;  5LG4 A;  3Q2M A;  3N2O A;  4CXX A;  3B13 A;  4YJ3 E;  3N9Q A;  4UF0 A;  3W15 B;  1MIW A;  1WR6 A;  4PK5 A;  2I59 A;  3ZN0 B;  2ZLY A;  4AQF C;  1Y64 B;  3CML A;  4AKL A;  2LSY A;  4JUY A;  4L9I A;  4ZI7 E;  3CX6 B;  5AFU L;  2A2F X;  1MIY A;  2W00 A;  2LOS A;  2H7O A;  5JDF A;  3K3N A;  3ZPO A;  2KZ7 B;  1NAF A;  2L8K A;  1MMA A;  3AAI A;  2BVL A;  4H9Q C;  2KT9 A;  4GK0 E;  3KIN B;  2XUE A;  4HE8 A;  3O4X E;  1MND A;  2V7M A;  1FEW A;  2NTX A;  2LE8 A;  5FP3 A;  3V5U A;  2L3L A;  3MKD A;  4X1I E;  3FBZ A;  1OWA A;  5M4Y A;  4M1P A;  3L09 A;  3RYC E;  2ZM0 A;  4IIJ E;  5L3G B;  3K3Q C;  2VKD A;  4G2A A;  2DWK A;  1X79 A;  3OKQ A;  3PDY A;  5LHI B;  1SA0 E;  4EXT A;  3ONX A;  3C4Z A;  5HXH A;  4MAL A;  4BAY B;  1ZHC A;  1MMD A;  5EK2 A;  5LJN A;  5LGU B;  4IE6 A;  3C51 A;  2C5K T;  3UTK A;  4AKG A;  4YLH A;  5JRE A;  5J2T E;  1WRD A;  5IYZ E;  5FXZ A;  4IE7 A;  4PJN A;  4AKI A;  3AB3 B;  4P09 A;  4ZI3 C;  4GK5 E;  3U78 A;  4V1A v;  2WMO A;  3H3A A;  4FI5 A;  3LBX B;  4H63 V;  2CE7 A;  4PK6 A;  4OYJ A;  2NP9 A;  2CXL A;  2E9X D;  3Q5W A;  4ANJ A;  4DMV A;  3FHN A;  5L3D B;  4P0B A;  3PU3 A;  3IF8 B;  2X0L B;  5IHY A;  1D1A A;  1HS7 A;  4E7Z A;  2XQY A;  4A56 A;  2LSK A;  3AAA B;  3UFE A;  4QHO A;  5JDH A;  5LGN B;  3CX8 B;  2ODV A;  5LJM A;  4MHC A;  1HCI A;  1BR0 A;  5GON E;  3N2K E;  2IC9 A;  4EAH A;  2VK9 A;  2KWI B;  2VAS A;  3N9O A;  1S94 A;  3BQL A;  3GWH A;  4K0U A;  4X20 E;  2CXF A;  2YIN A;  2RA1 A;  2H7V C;  3ETV A;  3FXE B;  4IST A;  5C8Y E;  2WWU A;  1FMV A;  3SS1 A;  3T8O A;  3UUN A;  2E9X B;  3E08 A;  2DLR A;  3AA6 B;  4WBN E;  2PFV A;  3CX7 B;  2KXP B;  2DHR A;  1LVF A;  2Y6X A;  4DO0 A;  4U72 A;  3RX6 A;  3C4W A;  3CWZ B;  3RKO A;  2X9X A;  2A3D A;  2A72 A;  3E0Z A;  4O4L E;  2MTQ A;  2C0S A;  2LOP A;  4HKA A;  2JJ9 A;  2UXX B;  3E22 E;  4FJO A;  4MFR A;  3K8P C;  4I43 B;  5FY0 A;  4EIW A;  4OHF A;  5JDQ A;  2VKH A;  3JC6 D;  4AKR B;  5FXW A;  4NUV A;  3N5L A;  2VKO A;  3IEE A;  3Q5X A;  3ZMU B;  2CXD A;  5LA6 E;  5FMN A;  3KV4 A;  3KFW X;  3AVR A;  2XAG B;  4CI1 B;  3SRZ A;  2Q9Q C;  1BR1 A;  5HAX A;  5JRC B;  3N9P A;  3UUX B;  4ZS3 A;  5LGT B;  1ZV4 X;  2K48 A;  4UV9 B;  2NTY A;  3I1A A;  3VHL A;  3NRY A;  1CUN A;  2ODU A;  3RC8 A;  1LRZ A;  4ADZ A;  4CQI A;  4DND A;  2N9D A;  2XHE B;  2C5J A;  1HTJ F;  2ES0 A;  2XAJ B;  3N9L A;  4N78 D;  2CM0 A;  3AA7 B;  4UVC B;  4X1Y E;  3S4U A;  2ZM2 A;  3EVY A;  3FBL A;  4MBQ A;  5HXE A;  3CVR A;  2CLY B;  2K24 A;  2W62 A;  4PNI A;  5DAB A;  3C4X A;  3CPZ A;  2JPF A;  5HXC A;  5LYJ E;  4ZI2 C;  3ETU A;  3N9M A;  4JEH B;  2W0G A;  3ANW A;  5FXV A;  1D0X A;  4AI6 A;  4YFS A;  4O8S A;  2W61 A;  3HKB E;  3AVS A;  1UX5 A;  3M65 A;  3Q9D A;  2V7K A;  3F2E A;  5HYA A;  2PG8 A;  3J7Y q;  3CQX C;  2WM9 A;  2JMH A;  2Q9Q D;  2YU1 A;  2VB6 A;  3H37 A;  2QA7 A;  3WAK A;  4OYK A;  5FY7 A;  2NWB A;  4PK4 A;  4TN7 B;  3RYH E;  4XBF B;  3ZC1 A;  1D0Z A;  1HF8 A;  3PU8 A;  2HH7 A;  5JR9 B;  3RYI E;  4IE4 A;  5JDG A;  4BJM A;  4O4H E;  5H6Q B;  3R84 B;  4YHJ A;  2IAK A;  2Y8D A;  5TAO A;  4ILU A;  5DQW A;  3BK9 A;  5DQV A;  3GN5 B;  3IHR A;  4QKN A;  1OXZ A;  5JVD E;  3O1J A;  4PFP A;  2EHO A;  3HI2 A;  5E0O A;  3LK2 B;  3EDV A;  2MOZ A;  4PJM A;  2D5U A;  2C5I T;  5J2U E;  2IW5 B;  5H6R B;  2IC6 A;  3CQC B;  4EZ4 A;  2V1D B;  4AQG A;  1MIV A;  4QX7 B;  2Q9Q B;  4TZ4 C;  1D1B A;  3U3I A;  2BVM A;  1LKX A;  4X1K E;  3QUJ A;  4L0R A;  3K3O A;  5JQG E;  4DVD A;  3ZMV B;  4CI2 B;  5CB4 E;  4ZS2 A;  2WSS V;  2NOX A;  3BQI A;  3PUS A;  2NW7 A;  2LHN A;  2SPC A;  3ZLI A;  1VOM A;  3P7I A;  3RYF E;  4QXH B;  2BDE A;  2XAS B;  3ZEF B;  5LOV E;  3V5S A;  3O1H A;  3SWH A;  3LJC A;  3NZP A;  1EZ3 A;  3KV6 A;  4C91 A;  3I9W A;  3UUL A;  4AXP A;  5HWY A;  2DWG A;  2X9W A;  2KND A;  4KMC A;  4I50 E;  3NBX X;  3HA4 A;  3OJA A;  3AA0 B;  2NW9 A;  3F57 A;  2LM9 A;  3D0T A;  3PTR B;  4J2C A;  4UF0 B;  3SOL A;  5HWX A;  4ZI3 D;  3MK7 C;  2YK0 A;  4IE0 A;  5JDM A;  4GYS A;  4TX5 A;  2ACX A;  3LK3 B;  3ZMZ B;  2NW8 A;  4PJJ A;  4H9R C;  4ZOL E;  2K9A A;  2X9H A;  4NUU A;  4UXN B;  2D0T A;  3NRX A;  1SHZ C;  3VU7 H;  3LFM A;  3O1I A;  4HEA A;  5JDN A;  3FXD B;  5JH7 E;  1KK7 A;  2X66 A;  2N2N A;  4GIW A;  3MJX A;  3ZCJ A;  4TV8 E;  1T98 A;  4AKH A;  2HPJ A;  4H9O C;  5KMG P;  5HXS A;  3HL6 A;  4DBQ A;  4CXW A;  2XTL A;  5BMV E;  4I55 E;  2CEA A;  3RRW A;  3PUG A;  3PUA A;  2OA5 A;  4XZC A;  3NZQ A;  4HFV A;  5EK3 A;  1O3X A;  1HG2 A;  1QSD A;  3LBX A;  3ZYK A;  3GA8 A;  2J1D G;  4EZH A;  3MAC A;  3C98 B;  3C50 A;  3QK6 A;  4DBR A;  5L3F B;  4GOU A;  3ZN1 B;  1IZN B;  2ZM8 A;  4IDZ A;  4QXC B;  2LHR A;  3DJB A;  2L9Q A;  1E1H B;  2X68 A;  4I4T E;  2V7I A;  3B57 A;  5A1L A;  3ESL A;  2V7L A;  4UV8 B;  2JQQ A;  2LJL A;  2KMF A;  2LT3 A;  2WAU A;  2MBG A;  1U5P A;  3AAE B;  4G63 A;  4B6X A;  1WYB A;  2UXN B;  1MMN A;  2WBL A;  4XAX B;  5CA0 E;  5JDL A;  4WW0 A;  4O2A E;  4QWN B;  5LBQ B;  3ZMS B;  2V7J A;  4H9S E;  4ZHQ E;  1UX4 A;  2CA5 A;  1FMW A;  2M67 A;  2DNX A;  4Z8X A;  4IHJ E;  3O9X A;  2V26 A;  3RRC A;  3CKD A;  4UIG A;  2E9X A;  3F31 A;  5CA1 E;  3ZC0 A;  2B1E A;  4CZZ B;  3KDS E;  2VKJ A;  4GYR A;  1FIO A;  4UEM A;  2YEV C;  4E7S A;  3HKC E;  1HG5 A;  3OBV E;  4O4I E;  1YKE B;  5FNV E;  5FXX A;  3EUH A;  1YD8 G;  5HXR A;  4KP3 C;  2E9X C;  2CWO A;  4ZI2 D;  4TV9 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...