2E9XA

The crystal structure of human gins core complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
144
structure length
144
Chain Sequence
MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSVLPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the human GINS complex and its assembly and functional interface in replication initiation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
molecule keywords DNA replication complex GINS protein PSF1
total genus 55
structure length 144
sequence length 144
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1030 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2e9xA01
2E9XD 2Q9QC 2E9XA 2Q9QB 3JC6D 2EHOB 3ANWA 2EHOA
chains in the Genus database with same CATH superfamily
2JMHA 4JI5T 1WYCA 2CMRA 2J1DG 2YK0A 1XMQT 4JI8T 3TKLB 1OEDB 3RYCE 3ZCIA 3M3ZB 2Z6EA 4HTEA 4IL4A 2XQ5A 3HKCE 4PFPA 3AEDA 2LM9A 1ZV4X 3IBPA 5LOVE 2C5IT 2X9YA 3EABA 3GWHA 2GK9A 4XAXB 4B3TT 4LF7T 2XHEB 4LMJA 2CLYB 1IZNB 4IE7A 4EOZB 1NEKA 4PJJA 3AE2A 3ZN1B 2ES0A 4HFBA 3VKGA 5LG4A 3UULA 1HG5A 4GK5E 5ADXL 3PUQA 3UU6A 4KHPT 3HKDE 3DP7A 3SFDA 4AKHA 4IDNA 3NBXX 1YKEB 3CK6A 4TV9E 5DQVA 2HPLA 2BZBA 5L3FB 1VCTA 3J9X1 3UTKA 2RPAA 5DQWA 3VHLA 5LYJE 4TV8E 4PK6A 5JH7E 5M4YA 2LHRA 1YXRA 2I6HA 1FIOA 2A9UA 2L8KA 3EAMA 4AQGA 2IMLA 2VWAA 1U5PA 2YU1A 1WR0A 3N9MA 2X9XA 2WB5A 5JDLA 4UVBB 3ANWA 1Y64B 4TZ4C 3RX6A 4YTPA 4DV7T 5AQLB 4ZEYA 2V7MA 4AQFC 1WRDA 2A2FX 2LKHA 2WDVA 1J5WA 1NWMX 5HXSA 3T1HT 5JRCA 2W67A 2SPCA 2YKSA 4HKAA 4IREA 2WU5A 3O1IA 2LOPA 3CQGB 4PAGA 4YFSA 3AXJB 3UT5E 2BS4A 2FJDA 4ZHQE 2LLYA 3PDYA 5ABFB 3ZT6A 3F31A 3AAAB 5JDFA 2L9QA 3TLWA 2KSRA 2RP4A 1D1CA 1WYBA 3JADA 2JMKA 3LDQB 4LFAT 2QYWA 2W00A 2MPKA 3N2GE 5IHYA 4ZI2D 3C4ZA 2CXFA 3JC6C 4PK5A 4QHOA 3HKEE 3NVOA 1IJ5A 2VL0A 2WCAA 3NRYA 4EYUA 5CGMA 4X66T 5JR9B 3UU8A 3HR0A 3AEFA 1KEYA 2LHNA 2OV9A 2DL1A 3UFGA 5LGTB 4E7ZA 5FYMA 3K3QC 1N33T 4QKNA 2YEVC 3RPUA 5LCYA 4CXXA 3C98B 3P8CD 4U31A 2YOEA 4WZXA 5AQKB 5HCMA 2WZIA 1D0XA 2LSGA 3RIFA 3ABVA 3P50A 1T7SA 2LOSA 3Q9DA 2WU2A 3HKBE 2LRKA 5HEGA 2XQ9A 1U4QA 3K8PC 3KVBA 4ZZCA 3B5MA 5F3JA 5KDMC 1HG2A 2HH7A 2B76A 2HPJA 4ISSA 2KMFA 3VRBA 4U7YA 3GN5A 4ZOLE 4AIUA 4DR4T 5LMNT 5LMUT 4L0RA 3PV0F 2V26A 2LSIA 5HAXA 4CXWA 3GA8A 4I4TE 2NWBA 3QNUA 2LSKA 4B3MT 4MHCA 4GKJT 4H9SE 3OBVE 2WWUA 2ACZA 4P0BA 4TN7B 5JDQA 2XAFB 3ZLIA 3RKOA 5L3EB 2RA1A 4BAYB 1YQ4A 3L39A 3N2KE 3KBTA 2KZ7B 3ZT5A 5CA0E 4FJOA 5L3BB 5LNKA 4IDQA 5AQSB 1CHUA 3Q5DA 2ZM2A 3NRXA 3ONLC 4ERRA 4XBFB 1WCRA 5FY1A 3ZC1A 4ADZA 3MK7C 4TWDA 1ZOYA 2BKOA 3AEAA 3PU3A 3PUXF 4DVDA 3FZHB 4Q25A 4LF9T 5E0OA 1W0BA 2K9AA 1MMAA 3LBXB 4NPPA 4TUYE 1D1AA 3ZJ1A 1SHZC 5LGUB 4IE4A 3AEEA 5ABGA 3AA1B 4U33A 5ABHA 2XUEA 4AKLA 4E7SA 1IAPA 4TX5A 4DMVA 1N34T 2BBHA 3ZJ2A 4ZXLA 3UU5A 5KMGP 4AXPA 3D0TA 4L9IA 3JAFA 2D0UA 3MJXA 4YT0A 3KBUA 3N9PA 2CXLA 2VKJA 2LSJA 3SOLA 4HWFA 1ZHCA 3ZMSB 2V7LA 3E08A 2CWYA 2IHR1 3CKDA 4YY3T 1X79A 3EHZA 2BG9A 4O4IE 3KV5A 4PFOA 1IBLT 2DLRA 4A5XA 3ZMVB 4PJNA 5AQMB 2FJBA 2UXNB 5HEHA 3TLSA 4DIDB 1D0YA 3PU8A 4NUVA 4JI1T 2BG9B 3KV9A 4OX9T 5F8PA 3N9QA 4IHJE 3K3OA 3CX7B 3GN5B 5FXXA 5FXZA 4WYVA 3AA0B 4IIJE 2PJQA 2E9XA 2HN2A 2JIWA 2Y48B 3H3AA 4GIWA 5IUXA 4DR6T 4IDZA 3NZQA 2VQFT 4BJNA 2DCFA 2JJ9A 3SRZA 5J2UE 1OXZA 3ZCJA 4YSXA 4I55E 3ETVA 4PNIA 4DV1T 4LF6T 1JNZA 3OYXA 3QB5K 1EZ3A 4HE8A 1MIYA 2E9XC 5C3JA 4PW8A 5L47A 1YW0A 1M7KA 2ZM6T 5HWXA 5JDHA 3DTOA 5L4HA 2EHOC 1FEWA 3I9YA 1XNQT 3C51A 4U3CA 1UK5A 5F5WA 2V7JA 2QA7A 5AQRB 3ZYMA 4AISA 4EEBA 5KX5E 5LXTE 1CUNA 2BVMA 3CQXC 2WQYA 1ZKEA 2X67A 4ILAA 4U74A 4I43B 2UU9T 2UXBT 4L5GA 3OKQA 4LF8T 4X1KE 3AAIA 3SFEA 2E9XD 2AXDS 3ONJA 5HWYA 2I59A 3P4QA 1O3XA 4G2AA 2QGSA 4WBOA 4B6XA 3K3NA 4V1Av 2I0MA 2X0YA 3EI0A 4TWHA 4EV6A 4MLKA 1US7B 3B13A 1LKXA 3C50A 3RKGA 4F8HA 4DV4T 2X9WA 2WM9A 3WAKA 2XM2A 3ZSSA 4QXBB 2IC9A 3F2EA 1KFYA 3W15B 4WBNE 2X0HA 3KDSE 5IWAT 3R84B 1LVKA 1SE7A 4H63H 4ZZBA 2BS2A 2H3RA 1XDPA 1V9DA 3FZKB 4JBWF 4QX8B 4JYAT 3AE8A 4LF4T 1BR2A 5HXRA 3ZC0A 1W9RA 2CHNA 2FJEA 1WR6A 2PTFA 2CA5A 2W4XA 3BQIA 5AQHB 5AQFB 3AEBA 2N1GA 1MIWA 2VQET 2VKDA 4ILBA 4JI7T 4QX7B 2L3LA 4EEDA 4WNKA 2XQ7A 5HEOA 2X51A 3L8RA 4LMLA 2W61A 3C4WA 5AQPB 4DNDA 2H7VC 2ACXA 4IT4A 1G8XA 2K3WA 3AA7B 4OYKA 2H89A 1VRBA 1FMWA 3RIAA 2LSYA 3G06A 3CIRA 2WSSV 2V1DB 1XDOA 3FZLB 5H6QB 2IAKA 3FZMB 4HWCA 2ODVA 2WP9A 2KWHA 4YTMA 2XM1A 1KNRA 3CQCB 3PUYF 4N78D 5FY0A 4ZI2C 5ABFA 5AQUB 1YQ3A 2KT9A 3L3PA 1OEDA 4O2AE 5L3DB 2BG9E 1QLBA 2XPKA 3CPZA 3MKDA 4KMCA 4U72A 2CRBA 4H63V 3RYHE 2QRXA 2PG8A 4ILCA 2E9XB 3IF8B 4O4JE 2WMNA 5DJQC 5HXCA 2R6GF 4DO0A 1UURA 1YD8G 3LSVA 5LA6E 1VOMA 5JRCB 2V7IA 2JQ9A 2V6YB 2XAQB 3MA9A 4I0UA 4CZZB 2BS3A 2UXCT 5JREA 5AQVB 2V5CA 4HEAA 3T1YT 3ZEFB 1HS7A 2C5KT 2CCQA 4KX6A 4PJMA 3RQWA 4A56A 3PUWF 3IHRA 4NUUA 3N9LA 3ZPOA 2UUBT 3RI5A 4WW0A 4X5TA 5AFUL 4YXDA 2D2SA 3AE4A 2D9DA 3CMLA 3RRWA 3ZMTB 4HN9A 2XAGB 3ZYLA 5J0ZA 3U3IA 2W62A 3A7MA 4OHFA 4X64T 3RGLA 2Y6XA 5AQQB 2IW5B 5HEJA 2VKHA 4GKKT 3E0ZA 3FHNA 4CI1B 2WS3A 3LFMA 4F6RC 5IYZE 3N9OA 2YINA 3JCFA 3PUGA 4OFZA 3CVRA 4B3RT 4AKIA 4UVAB 3IA3A 3AE1A 5JVDE 2V6XA 3F57A 4JLEA 4HFVA 2W63A 4OK0A 5EK4A 3UU4A 2KLQA 4EYYR 2JQQA 3I0OA 3NZPA 5LG3A 2B1EA 4YTNA 2XQAA 3LBXA 3WI3A 4YSYA 2NTXA 5HXEA 4IDOA 4AQFA 5DABA 1UCUA 4COFA 1MMDA 2YDQA 3QC9A 4NXNT 2JPFA 1IBMT 1OEDC 5JDGA 4QH5A 3J7Yq 3AVSA 3TLVA 1UGOA 2G0UA 2P9BA 3I0QA 3O1HA 2VK9A 3EDUA 3UFEA 2QVAA 2NW7A 2NW9A 5LGNB 4G63A 4KHZF 3I9WA 4Z8XA 2IUBA 4BJMA 2KXPB 4UV9B 1BR0A 1M62A 3ZN0B 4YJ2E 1S94A 1VCSA 2MAWA 3DJBA 2HN1A 2XJ7A 2BKNA 3MZKB 2F4VT 2YDRA 5FVLA 3ONXA 4IE5A 1DU2A 1QSDA 3LK3B 2CE7A 2E8IA 3N5LA 4JEUB 3SWHA 2CHOA 3ZMUB 1HR0T 4LFCT 2H88A 1T8BA 2EHOD 4Z90A 2LEHA 4KBMB 2HHHT 2AE9A 4ZS3A 2ZM0A 4YSZA 5LHGB 4EZ4A 3MACA 3O1JA 5LHHB 1FJGT 1UX5A 4CN6A 5C2TA 4BA9A 1AJ3A 4IE0A 4X1YE 2CWOA 5GONE 3TLTA 5JTGA 5AQIB 4CXYA 2KINB 4X62T 2E2AA 3UQ7A 4DV2T 2YDSA 2WAUA 5FMNA 4IGUA 3VRAA 2V8SV 4KI0F 4O4HE 3ZYKA 3FZFB 4U2ZA 4UVCB 1X9BA 3AEGA 3IEEA 4GOUA 4NIQA 4DR3T 3HL6A 4H9QC 3PURA 3PJAA 5C8YE 4UF0A 2W2UA 3Q5EA 4K0KT 1D0ZA 1HF8A 1UUSA 3A5XA 5HXHA 4KP3C 3ZMZB 2OLTA 2WY2A 2XQ6A 3ZT7A 4EB6E 4DUZT 3R6NA 1T72A 2CBJA 4FI5A 4PJLA 2XASB 3RIUC 2E5LT 4M1PA 2VB6A 3OYZA 1KNZA 4YJ3E 4LF5T 1Y01A 2IDOB 4U7IA 2NP9A 1R8IA 2C0SA 4QWNB 3UUMA 4TNVA 3BQLA 4H9RC 1G73A 2M6BA 4TNWA 3VR8A 4DR1T 2BVLA 3MXZA 3RC3A 2VKOA 3P4RA 2ZLYA 4XZCA 2DWKA 4GYRA 4UXNB 2YU2A 1HNZT 4DV6T 2C5JA 1J1JA 4HGAA 4ISTA 2CLYC 4DV3T 5EK3A 3S4UA 2UUCT 1T98A 2WBLA 4O2BE 1ZEEA 4B3ST 3B57A 3PJAJ 3AVRA 3P4WA 5FY7A 4A98A 2PFVA 3ETUA 5EZYE 2J62A 3RQUA 4JI3T 1SUMB 3P7IA 4DBQA 2LE8A 2XQYA 1MNDA 4HWHA 3KINB 3AA6B 4IE6A 4IL9A 3V5UA 4CN1A 2LJLA 2XSAA 4QXHB 3UUXB 5L3CB 1XNRT 1W0AA 1H7CA 1Z8UA 3I1AA 1IJ6A 2D5UA 3K1SA 5FXVA 4YHHT 4AKGA 3VKHA 3FXEB 2LRLA 1MMNA 3FXDB 5ABEA 2NW8A 4YHJA 1KF6A 5JR9A 5LP6E 3PUAA 4JV5T 1XMOT 5CJ5A 3JAEA 4UEMA 3OJAA 5FNVE 4JI0T 1BR1A 3RH3A 1HX8A 4J2CA 2UXDT 3N9NA 4X65T 5AQOB 5L4EA 5CFBA 4CI2B 5KXJA 4DV0T 4C90A 4CI3B 4JUYA 4ILUA 5EK2A 3P4PA 4HFHA 2PBIA 3RC8A 1E7PA 2MTQA 2WMOA 3V5SA 1OEDE 1FMVA 4U2YA 2BDEA 3ZKRA 2D0TA 2A3DA 3ESLA 3EVYA 4X20E 4UV8B 3AXJA 3RRCA 4ANJA 5LJNA 2LM2A 2M67A 2XQ8A 2H7OA 2J4GA 3PUZF 3X1DA 2KWIB 3C64A 2K48A 1LRZA 2IC6A 1E1HB 4GK0E 3RYIE 4EZHA 3CX8B 4O8SA 5HEUA 5FXWA 3OVUA 5CA1E 3FBZA 3AECA 2NTYA 2X68A 4DR5T 4P1NA 2J47A 1B7TA 3ANWB 4EGWA 1SA0E 3UUBA 2CEAA 3EUHA 2EHOA 3PUSA 4KUMB 5J1GA 2XSBA 2CBIA 2WDRA 1LVFA 4K0UA 3RYFE 4A97A 3WAJA 2XQ4A 4MBQA 4QH1A 1MMGA 4HWIB 3LK42 3NKZA 3O4XE 1HNXT 3KV6A 2LT3A 3OTOT 2WDQA 4P09A 1IBKT 4JEHB 5HYAA 3E22E 1KK7A 3N2OA 3PUVF 1GQEA 5FL1A 4AI6A 3AE9A 4CN4A 2YN6A 3P4SA 4PK4A 4EAHA 5JDNA 2XAHB 3SS1A 4QH4A 1E2AA 3H3MA 2Q9QC 1HFAA 5JQGE 2X66A 2Y8DA 5LHIB 4HFIA 2DNXA 2XAJB 1HX1B 4UIGA 3AE7A 4EXTA 1XZYA 2VL8A 3TLUA 3QK6A 1N36T 3H37A 1BR4A 3ZSTA 1L0VA 4DR2T 4ASKA 1N32T 2K5BB 4UR9A 3RF1A 2N2NA 5CB4E 2VASA 2K24A 4HFDA 2XQ3A 5A1LA 3BK9A 2BG9C 3L09A 4MFRA 1HTJF 2XZEA 4OYJA 4Z91A 1I94T 3BQKA 1D1BA 4I50E 3AE6A 3T8OA 1I6ZA 3OPCA 3U78A 2VURA 4ZI3D 3AB3B 2N9DA 2MBGA 4LMKA 2ZM8A 5L2LA 2X9HA 4ZS2A 4EIWA 4ZI7E 4TWFA 4DMWA 4DR7T 5FVKA 2Q9QB 2W66A 2VVSA 4H9PC 2W0GA 5LBQB 3VU7H 1JNRA 3LJCA 5FP3A 4CQIA 3LK2B 5JR9C 3UUNA 2FBWA 2X0LB 3Q5WA 3HI2A 2JQHA 3LG7A 1MNEA 5L3GB 5LJMA 5AQGB 1NAFA 2E5VA 2IIUA 1XWMA 2DHRA 5LB7B 3GMIA 3UU3A 3RLFF 4JI4T 3KVAA 4MALA 1KNPA 2A72A 4AKRB 1ZP0A 3PE0A 4DUYT 4O4LE 3RHWA 3AE3A 1W09A 4NXMT 1WLXA 2MOZA 3KFWX 4UELA 5FKYA 2BKPA 4HWDA 4JI2T 1Z0PA 5AQNB 3QB5A 4UF0B 4DBRA 4JI6T 5JDMA 2V5DA 1J5ET 2JQKA 2CXDA 1WFDA 3AE5A 3JC6D 2CM0A 4H9OC 5BMVE 5BR8T 2BBJA 2NOXA 2VVNA 3EDVA 3QUJA 4HFEA 4IDPA 4H9NC 1S35A 2WZHA 2V7KA 2OA5A 3UQ4A 1HNWT 3Q2MA 2FUPA 2FJAA 2Q9QD 5HCJA 2DI4A 5J2TE 3M65A 1NENA 3HA4A 5TAOA 4AQYT 3FBLA 1MIVA 3CX6B 5AQJB 2CPTA 3FB2A 4YLHA 5ETWA 4P0AA 2ZMAA 2DWGA 3C4XA 5FL0A 3KV4A 4QXCB 1HCIA 1UX4A 5AQTB 1QUUA 2ODUA 4X1IE 5H6RB 3RIUA 4C91A 3VR9A 2EHOB 2KNDA 2XY8B 2UUAT 3A8YC 3CWZB 3NWIA 2M6IA 2WWVA 2LKGA 2Q9QA 4GYSA 1OWAA 2XTLA 3PTRB 4ZI3C 1YKHB 2JRKA 3O9XA 4DV5T 2MYSA 2V6YA 3AAEB 3QOFA 4HFCA 3Q5XA 2UXXB 2NR4A 5LBMA 4LFBT
chains in the Genus database with same CATH topology
2JMHA 1WYCA 2CMRA 2J1DG 2YK0A 3TKLB 3RYCE 3ZCIA 2Z6EA 4HTEA 3HKCE 4PFPA 2LM9A 1ZV4X 3IBPA 5LOVE 2C5IT 2X9YA 3GWHA 2GK9A 4XAXB 2XHEB 2CLYB 1IZNB 4IE7A 4EOZB 4PJJA 3ZN1B 2ES0A 3VKGA 3UULA 1HG5A 4GK5E 5ADXL 3PUQA 3HKDE 3DP7A 4AKHA 3NBXX 1YKEB 4TV9E 5DQVA 2HPLA 2BZBA 5L3FB 3J9X1 3UTKA 3VHLA 5DQWA 5LYJE 4TV8E 4PK6A 5JH7E 2LHRA 1FIOA 2L8KA 4AQGA 2VWAA 2YU1A 1U5PA 3N9MA 2X9XA 5JDLA 4UVBB 3ANWA 1Y64B 4TZ4C 3RX6A 2V7MA 4AQFC 1WRDA 2A2FX 1NWMX 5HXSA 5JRCA 2SPCA 4HKAA 3O1IA 2LOPA 3CQGB 4PAGA 4YFSA 3UT5E 4ZHQE 3PDYA 3F31A 3AAAB 5JDFA 2L9QA 2RP4A 1D1CA 1WYBA 2JMKA 2W00A 5IHYA 3N2GE 4ZI2D 3C4ZA 2CXFA 3JC6C 4PK5A 4QHOA 3HKEE 1IJ5A 3NRYA 4EYUA 5JR9B 3HR0A 2LHNA 5LGTB 4E7ZA 5FYMA 3K3QC 4QKNA 2YEVC 3RPUA 5LCYA 4CXXA 3C98B 3P8CD 1D0XA 2LSGA 2LOSA 3Q9DA 4ZI7E 3HKBE 1U4QA 3K8PC 3KVBA 5F3JA 5KDMC 1HG2A 2HH7A 2HPJA 4ISSA 2KMFA 3GN5A 4ZOLE 4L0RA 2V26A 2LSIA 5HAXA 4CXWA 3GA8A 4I4TE 2NWBA 2LSKA 4MHCA 4H9SE 3OBVE 2WWUA 4TN7B 4P0BA 2XAFB 3ZLIA 3RKOA 5L3EB 2RA1A 4BAYB 3N2KE 3KBTA 2KZ7B 5CA0E 4FJOA 5L3BB 5LNKA 2ZM2A 3NRXA 4ERRA 5FY1A 3ZC1A 4ADZA 3MK7C 3PU3A 4DVDA 5E0OA 2K9AA 1MMAA 3LBXB 4TUYE 1D1AA 3ZJ1A 1SHZC 5LGUB 4IE4A 3AA1B 2XUEA 4AKLA 4E7SA 1IAPA 4TX5A 4DMVA 3ZJ2A 5KMGP 4AXPA 3D0TA 4L9IA 2D0UA 3MJXA 3KBUA 3N9PA 2CXLA 2VKJA 2LSJA 3SOLA 1ZHCA 3ZMSB 2V7LA 3E08A 2CWYA 3CKDA 1X79A 4O4IE 3KV5A 4PFOA 2DLRA 3ZMVB 4PJNA 2UXNB 1D0YA 3PU8A 4NUVA 3KV9A 5F8PA 3N9QA 4IHJE 3K3OA 3CX7B 3GN5B 5FXXA 5FXZA 3AA0B 4IIJE 2PJQA 2E9XA 2Y48B 3H3AA 4GIWA 4IDZA 3NZQA 2DCFA 2JJ9A 3SRZA 5J2UE 1OXZA 3ZCJA 4I55E 3ETVA 4PNIA 3OYXA 1EZ3A 4HE8A 1MIYA 2E9XC 4PW8A 1YW0A 5HWXA 5JDHA 3DTOA 2EHOC 1FEWA 3I9YA 3C51A 2V7JA 2QA7A 3ZYMA 5KX5E 5LXTE 5M4YA 1CUNA 2BVMA 3CQXC 1ZKEA 2X67A 4U74A 4I43B 4L5GA 3OKQA 4X1KE 3AAIA 2E9XD 5HWYA 2I59A 1O3XA 4G2AA 2QGSA 4WBOA 4B6XA 3K3NA 4V1Av 4MLKA 1US7B 3B13A 1LKXA 3C50A 2X9WA 2WM9A 3WAKA 4QXBB 2IC9A 3F2EA 4XBFB 3W15B 4WBNE 3KDSE 3R84B 1LVKA 4H63H 2H3RA 1V9DA 4QX8B 1BR2A 5HXRA 3ZC0A 3BQIA 1WR6A 2CA5A 2N1GA 1MIWA 2VKDA 4QX7B 2L3LA 4WNKA 2X51A 2W61A 3C4WA 4DNDA 2H7VC 2ACXA 1G8XA 3AA7B 4OYKA 1VRBA 1FMWA 2LSYA 2WSSV 2V1DB 5H6QB 2IAKA 2ODVA 2KWHA 3CQCB 4N78D 5FY0A 4ZI2C 3L3PA 2KT9A 5L3DB 4O2AE 4F6RC 3CPZA 3MKDA 4KMCA 4U72A 3RYHE 4H63V 2PG8A 4O4JE 2E9XB 3IF8B 2WMNA 5DJQC 5HXCA 4DO0A 1YD8G 5LA6E 5JRCB 1VOMA 2V7IA 2XAQB 3MA9A 4CZZB 5JREA 4HEAA 3ZEFB 1HS7A 2C5KT 2CCQA 4PJMA 4A56A 3IHRA 4NUUA 3N9LA 3ZPOA 4WW0A 5AFUL 2D2SA 3CMLA 3ZYLA 3RRWA 3ZMTB 4HN9A 2XAGB 3U3IA 2W62A 4OHFA 2Y6XA 2IW5B 2VKHA 3E0ZA 3FHNA 4CI1B 3LFMA 5IYZE 3N9OA 2YINA 3PUGA 4OFZA 3CVRA 4AKIA 4UVAB 5JVDE 4OK0A 3F57A 4JLEA 4HFVA 2W63A 4EYYR 5EK4A 2KLQA 2JQQA 3I0OA 3NZPA 2B1EA 3LBXA 3WI3A 2NTXA 5HXEA 4AQFA 5DABA 1UCUA 1MMDA 3QC9A 2JPFA 5JDGA 3J7Yq 3AVSA 2G0UA 2P9BA 3I0QA 3O1HA 2VK9A 3EDUA 3UFEA 2NW7A 2NW9A 5LGNB 4G63A 3I9WA 4Z8XA 4BJMA 2KXPB 4UV9B 1BR0A 3ZN0B 4YJ2E 1S94A 3DJBA 3MZKB 3ONXA 4IE5A 1QSDA 3LK3B 2CE7A 2E8IA 3N5LA 4JEUB 3SWHA 3ZMUB 2EHOD 2LEHA 4KBMB 4ZS3A 5LHGB 2ZM0A 4EZ4A 3MACA 3O1JA 5LHHB 1UX5A 4BA9A 4IE0A 4X1YE 2CWOA 5GONE 4CXYA 2KINB 2WAUA 5FMNA 4IGUA 4O4HE 3ZYKA 4UVCB 3IEEA 4GOUA 3HL6A 4H9QC 3PURA 5C8YE 4UF0A 1D0ZA 1HF8A 3A5XA 5HXHA 4KP3C 3ZMZB 4EB6E 3R6NA 4FI5A 4PJLA 2XASB 1KNZA 4M1PA 2VB6A 3OYZA 4YJ3E 2C0SA 2NP9A 3UUMA 4QWNB 3BQLA 4H9RC 1G73A 2BVLA 3MXZA 3RC3A 2VKOA 4XZCA 2ZLYA 2DWKA 4GYRA 4UXNB 2YU2A 2C5JA 4HGAA 4ISTA 2CLYC 5EK3A 3S4UA 1T98A 2WBLA 4O2BE 1ZEEA 3B57A 3AVRA 5FY7A 2PFVA 3ETUA 5EZYE 1AJ3A 3P7IA 4DBQA 2LE8A 2XQYA 1MNDA 3V5UA 3KINB 3AA6B 4IE6A 2LJLA 4QXHB 3UUXB 5L3CB 1H7CA 3I1AA 4AKGA 1IJ6A 2D5UA 5FXVA 3VKHA 3FXEB 1MMNA 3FXDB 2NW8A 4YHJA 5JR9A 5LP6E 3PUAA 4UEMA 3OJAA 5FNVE 1BR1A 3RH3A 1HX8A 4J2CA 3N9NA 4CI2B 4C90A 4CI3B 4JUYA 4ILUA 5EK2A 2PBIA 3RC8A 2MTQA 3V5SA 2WMOA 4BJNA 5LG4A 1FMVA 2BDEA 2D0TA 2A3DA 3ESLA 3EVYA 4X20E 4UV8B 3RRCA 4ANJA 5LJNA 2M67A 2H7OA 2KWIB 3C64A 2K48A 1LRZA 2IC6A 1E1HB 4GK0E 3RYIE 4EZHA 3CX8B 4O8SA 5JDQA 5FXWA 5CA1E 3FBZA 2NTYA 2X68A 1B7TA 3ANWB 1SA0E 2CEAA 3EUHA 2EHOA 3PUSA 4KUMB 5J1GA 1LVFA 4K0UA 3RYFE 3WAJA 4MBQA 1MMGA 3LK42 3O4XE 3KV6A 2LT3A 4P09A 4JEHB 5HYAA 3E22E 1KK7A 3N2OA 4AI6A 4EAHA 5JDNA 4PK4A 2XAHB 3SS1A 1HFAA 2Q9QC 5JQGE 2X66A 2Y8DA 5LHIB 2DNXA 2XAJB 4UIGA 4EXTA 2VL8A 3QK6A 3H37A 1BR4A 4ASKA 2K5BB 2N2NA 5CB4E 2VASA 2K24A 5A1LA 3BK9A 3L09A 4MFRA 1HTJF 4OYJA 3BQKA 1D1BA 4I50E 3T8OA 3U78A 4ZI3D 3AB3B 2N9DA 2MBGA 2ZM8A 5L2LA 2X9HA 4ZS2A 4EIWA 4DMWA 2Q9QB 4H9PC 5LBQB 3VU7H 2W0GA 3LJCA 5FP3A 4CQIA 3LK2B 5JR9C 3UUNA 2X0LB 3Q5WA 3HI2A 5L3GB 3LG7A 1MNEA 5LJMA 1NAFA 2DHRA 3GMIA 3KVAA 4MALA 2A72A 4AKRB 3PE0A 4O4LE 1WLXA 2MOZA 3KFWX 4UELA 1Z0PA 4DBRA 4UF0B 5JDMA 2CXDA 3JC6D 4H9OC 2CM0A 5BMVE 2NOXA 3EDVA 3QUJA 4H9NC 1S35A 2V7KA 2OA5A 3Q2MA 2Q9QD 2DI4A 5J2TE 3M65A 3HA4A 5TAOA 3FBLA 1MIVA 3CX6B 3FB2A 4YLHA 5ETWA 4P0AA 2ZMAA 2DWGA 3C4XA 3KV4A 4QXCB 1HCIA 1UX4A 1QUUA 2ODUA 4X1IE 5H6RB 4C91A 2EHOB 2KNDA 3CWZB 2Q9QA 4GYSA 1OWAA 2XTLA 3PTRB 4ZI3C 1YKHB 2JRKA 3O9XA 2MYSA 3AAEB 3Q5XA 2UXXB 5LBMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E9X D;  2Q9Q C;  2E9X A;  2Q9Q B;  3JC6 D;  2EHO B;  3ANW A;  2EHO A; 
#chains in the Genus database with same CATH topology
 2JMH A;  4JI5 T;  1WYC A;  2CMR A;  2J1D G;  2YK0 A;  1XMQ T;  4JI8 T;  3TKL B;  1OED B;  3RYC E;  3ZCI A;  3M3Z B;  2Z6E A;  4HTE A;  4IL4 A;  2XQ5 A;  3HKC E;  4PFP A;  3AED A;  2LM9 A;  1ZV4 X;  3IBP A;  5LOV E;  2C5I T;  2X9Y A;  3EAB A;  3GWH A;  2GK9 A;  4XAX B;  4B3T T;  4LF7 T;  2XHE B;  4LMJ A;  2CLY B;  1IZN B;  4IE7 A;  4EOZ B;  1NEK A;  4PJJ A;  3AE2 A;  3ZN1 B;  2ES0 A;  4HFB A;  3VKG A;  5LG4 A;  3UUL A;  1HG5 A;  4GK5 E;  5ADX L;  3PUQ A;  3UU6 A;  4KHP T;  3HKD E;  3DP7 A;  3SFD A;  4AKH A;  4IDN A;  3NBX X;  1YKE B;  3CK6 A;  4TV9 E;  5DQV A;  2HPL A;  2BZB A;  5L3F B;  1VCT A;  3J9X 1;  3UTK A;  2RPA A;  5DQW A;  3VHL A;  5LYJ E;  4TV8 E;  4PK6 A;  5JH7 E;  5M4Y A;  2LHR A;  1YXR A;  2I6H A;  1FIO A;  2A9U A;  2L8K A;  3EAM A;  4AQG A;  2IML A;  2VWA A;  1U5P A;  2YU1 A;  1WR0 A;  3N9M A;  2X9X A;  2WB5 A;  5JDL A;  4UVB B;  3ANW A;  1Y64 B;  4TZ4 C;  3RX6 A;  4YTP A;  4DV7 T;  5AQL B;  4ZEY A;  2V7M A;  4AQF C;  1WRD A;  2A2F X;  2LKH A;  2WDV A;  1J5W A;  1NWM X;  5HXS A;  3T1H T;  5JRC A;  2W67 A;  2SPC A;  2YKS A;  4HKA A;  4IRE A;  2WU5 A;  3O1I A;  2LOP A;  3CQG B;  4PAG A;  4YFS A;  3AXJ B;  3UT5 E;  2BS4 A;  2FJD A;  4ZHQ E;  2LLY A;  3PDY A;  5ABF B;  3ZT6 A;  3F31 A;  3AAA B;  5JDF A;  2L9Q A;  3TLW A;  2KSR A;  2RP4 A;  1D1C A;  1WYB A;  3JAD A;  2JMK A;  3LDQ B;  4LFA T;  2QYW A;  2W00 A;  2MPK A;  3N2G E;  5IHY A;  4ZI2 D;  3C4Z A;  2CXF A;  3JC6 C;  4PK5 A;  4QHO A;  3HKE E;  3NVO A;  1IJ5 A;  2VL0 A;  2WCA A;  3NRY A;  4EYU A;  5CGM A;  4X66 T;  5JR9 B;  3UU8 A;  3HR0 A;  3AEF A;  1KEY A;  2LHN A;  2OV9 A;  2DL1 A;  3UFG A;  5LGT B;  4E7Z A;  5FYM A;  3K3Q C;  1N33 T;  4QKN A;  2YEV C;  3RPU A;  5LCY A;  4CXX A;  3C98 B;  3P8C D;  4U31 A;  2YOE A;  4WZX A;  5AQK B;  5HCM A;  2WZI A;  1D0X A;  2LSG A;  3RIF A;  3ABV A;  3P50 A;  1T7S A;  2LOS A;  3Q9D A;  2WU2 A;  3HKB E;  2LRK A;  5HEG A;  2XQ9 A;  1U4Q A;  3K8P C;  3KVB A;  4ZZC A;  3B5M A;  5F3J A;  5KDM C;  1HG2 A;  2HH7 A;  2B76 A;  2HPJ A;  4ISS A;  2KMF A;  3VRB A;  4U7Y A;  3GN5 A;  4ZOL E;  4AIU A;  4DR4 T;  5LMN T;  5LMU T;  4L0R A;  3PV0 F;  2V26 A;  2LSI A;  5HAX A;  4CXW A;  3GA8 A;  4I4T E;  2NWB A;  3QNU A;  2LSK A;  4B3M T;  4MHC A;  4GKJ T;  4H9S E;  3OBV E;  2WWU A;  2ACZ A;  4P0B A;  4TN7 B;  5JDQ A;  2XAF B;  3ZLI A;  3RKO A;  5L3E B;  2RA1 A;  4BAY B;  1YQ4 A;  3L39 A;  3N2K E;  3KBT A;  2KZ7 B;  3ZT5 A;  5CA0 E;  4FJO A;  5L3B B;  5LNK A;  4IDQ A;  5AQS B;  1CHU A;  3Q5D A;  2ZM2 A;  3NRX A;  3ONL C;  4ERR A;  4XBF B;  1WCR A;  5FY1 A;  3ZC1 A;  4ADZ A;  3MK7 C;  4TWD A;  1ZOY A;  2BKO A;  3AEA A;  3PU3 A;  3PUX F;  4DVD A;  3FZH B;  4Q25 A;  4LF9 T;  5E0O A;  1W0B A;  2K9A A;  1MMA A;  3LBX B;  4NPP A;  4TUY E;  1D1A A;  3ZJ1 A;  1SHZ C;  5LGU B;  4IE4 A;  3AEE A;  5ABG A;  3AA1 B;  4U33 A;  5ABH A;  2XUE A;  4AKL A;  4E7S A;  1IAP A;  4TX5 A;  4DMV A;  1N34 T;  2BBH A;  3ZJ2 A;  4ZXL A;  3UU5 A;  5KMG P;  4AXP A;  3D0T A;  4L9I A;  3JAF A;  2D0U A;  3MJX A;  4YT0 A;  3KBU A;  3N9P A;  2CXL A;  2VKJ A;  2LSJ A;  3SOL A;  4HWF A;  1ZHC A;  3ZMS B;  2V7L A;  3E08 A;  2CWY A;  2IHR 1;  3CKD A;  4YY3 T;  1X79 A;  3EHZ A;  2BG9 A;  4O4I E;  3KV5 A;  4PFO A;  1IBL T;  2DLR A;  4A5X A;  3ZMV B;  4PJN A;  5AQM B;  2FJB A;  2UXN B;  5HEH A;  3TLS A;  4DID B;  1D0Y A;  3PU8 A;  4NUV A;  4JI1 T;  2BG9 B;  3KV9 A;  4OX9 T;  5F8P A;  3N9Q A;  4IHJ E;  3K3O A;  3CX7 B;  3GN5 B;  5FXX A;  5FXZ A;  4WYV A;  3AA0 B;  4IIJ E;  2PJQ A;  2E9X A;  2HN2 A;  2JIW A;  2Y48 B;  3H3A A;  4GIW A;  5IUX A;  4DR6 T;  4IDZ A;  3NZQ A;  2VQF T;  4BJN A;  2DCF A;  2JJ9 A;  3SRZ A;  5J2U E;  1OXZ A;  3ZCJ A;  4YSX A;  4I55 E;  3ETV A;  4PNI A;  4DV1 T;  4LF6 T;  1JNZ A;  3OYX A;  3QB5 K;  1EZ3 A;  4HE8 A;  1MIY A;  2E9X C;  5C3J A;  4PW8 A;  5L47 A;  1YW0 A;  1M7K A;  2ZM6 T;  5HWX A;  5JDH A;  3DTO A;  5L4H A;  2EHO C;  1FEW A;  3I9Y A;  1XNQ T;  3C51 A;  4U3C A;  1UK5 A;  5F5W A;  2V7J A;  2QA7 A;  5AQR B;  3ZYM A;  4AIS A;  4EEB A;  5KX5 E;  5LXT E;  1CUN A;  2BVM A;  3CQX C;  2WQY A;  1ZKE A;  2X67 A;  4ILA A;  4U74 A;  4I43 B;  2UU9 T;  2UXB T;  4L5G A;  3OKQ A;  4LF8 T;  4X1K E;  3AAI A;  3SFE A;  2E9X D;  2AXD S;  3ONJ A;  5HWY A;  2I59 A;  3P4Q A;  1O3X A;  4G2A A;  2QGS A;  4WBO A;  4B6X A;  3K3N A;  4V1A v;  2I0M A;  2X0Y A;  3EI0 A;  4TWH A;  4EV6 A;  4MLK A;  1US7 B;  3B13 A;  1LKX A;  3C50 A;  3RKG A;  4F8H A;  4DV4 T;  2X9W A;  2WM9 A;  3WAK A;  2XM2 A;  3ZSS A;  4QXB B;  2IC9 A;  3F2E A;  1KFY A;  3W15 B;  4WBN E;  2X0H A;  3KDS E;  5IWA T;  3R84 B;  1LVK A;  1SE7 A;  4H63 H;  4ZZB A;  2BS2 A;  2H3R A;  1XDP A;  1V9D A;  3FZK B;  4JBW F;  4QX8 B;  4JYA T;  3AE8 A;  4LF4 T;  1BR2 A;  5HXR A;  3ZC0 A;  1W9R A;  2CHN A;  2FJE A;  1WR6 A;  2PTF A;  2CA5 A;  2W4X A;  3BQI A;  5AQH B;  5AQF B;  3AEB A;  2N1G A;  1MIW A;  2VQE T;  2VKD A;  4ILB A;  4JI7 T;  4QX7 B;  2L3L A;  4EED A;  4WNK A;  2XQ7 A;  5HEO A;  2X51 A;  3L8R A;  4LML A;  2W61 A;  3C4W A;  5AQP B;  4DND A;  2H7V C;  2ACX A;  4IT4 A;  1G8X A;  2K3W A;  3AA7 B;  4OYK A;  2H89 A;  1VRB A;  1FMW A;  3RIA A;  2LSY A;  3G06 A;  3CIR A;  2WSS V;  2V1D B;  1XDO A;  3FZL B;  5H6Q B;  2IAK A;  3FZM B;  4HWC A;  2ODV A;  2WP9 A;  2KWH A;  4YTM A;  2XM1 A;  1KNR A;  3CQC B;  3PUY F;  4N78 D;  5FY0 A;  4ZI2 C;  5ABF A;  5AQU B;  1YQ3 A;  2KT9 A;  3L3P A;  1OED A;  4O2A E;  5L3D B;  2BG9 E;  1QLB A;  2XPK A;  3CPZ A;  3MKD A;  4KMC A;  4U72 A;  2CRB A;  4H63 V;  3RYH E;  2QRX A;  2PG8 A;  4ILC A;  2E9X B;  3IF8 B;  4O4J E;  2WMN A;  5DJQ C;  5HXC A;  2R6G F;  4DO0 A;  1UUR A;  1YD8 G;  3LSV A;  5LA6 E;  1VOM A;  5JRC B;  2V7I A;  2JQ9 A;  2V6Y B;  2XAQ B;  3MA9 A;  4I0U A;  4CZZ B;  2BS3 A;  2UXC T;  5JRE A;  5AQV B;  2V5C A;  4HEA A;  3T1Y T;  3ZEF B;  1HS7 A;  2C5K T;  2CCQ A;  4KX6 A;  4PJM A;  3RQW A;  4A56 A;  3PUW F;  3IHR A;  4NUU A;  3N9L A;  3ZPO A;  2UUB T;  3RI5 A;  4WW0 A;  4X5T A;  5AFU L;  4YXD A;  2D2S A;  3AE4 A;  2D9D A;  3CML A;  3RRW A;  3ZMT B;  4HN9 A;  2XAG B;  3ZYL A;  5J0Z A;  3U3I A;  2W62 A;  3A7M A;  4OHF A;  4X64 T;  3RGL A;  2Y6X A;  5AQQ B;  2IW5 B;  5HEJ A;  2VKH A;  4GKK T;  3E0Z A;  3FHN A;  4CI1 B;  2WS3 A;  3LFM A;  4F6R C;  5IYZ E;  3N9O A;  2YIN A;  3JCF A;  3PUG A;  4OFZ A;  3CVR A;  4B3R T;  4AKI A;  4UVA B;  3IA3 A;  3AE1 A;  5JVD E;  2V6X A;  3F57 A;  4JLE A;  4HFV A;  2W63 A;  4OK0 A;  5EK4 A;  3UU4 A;  2KLQ A;  4EYY R;  2JQQ A;  3I0O A;  3NZP A;  5LG3 A;  2B1E A;  4YTN A;  2XQA A;  3LBX A;  3WI3 A;  4YSY A;  2NTX A;  5HXE A;  4IDO A;  4AQF A;  5DAB A;  1UCU A;  4COF A;  1MMD A;  2YDQ A;  3QC9 A;  4NXN T;  2JPF A;  1IBM T;  1OED C;  5JDG A;  4QH5 A;  3J7Y q;  3AVS A;  3TLV A;  1UGO A;  2G0U A;  2P9B A;  3I0Q A;  3O1H A;  2VK9 A;  3EDU A;  3UFE A;  2QVA A;  2NW7 A;  2NW9 A;  5LGN B;  4G63 A;  4KHZ F;  3I9W A;  4Z8X A;  2IUB A;  4BJM A;  2KXP B;  4UV9 B;  1BR0 A;  1M62 A;  3ZN0 B;  4YJ2 E;  1S94 A;  1VCS A;  2MAW A;  3DJB A;  2HN1 A;  2XJ7 A;  2BKN A;  3MZK B;  2F4V T;  2YDR A;  5FVL A;  3ONX A;  4IE5 A;  1DU2 A;  1QSD A;  3LK3 B;  2CE7 A;  2E8I A;  3N5L A;  4JEU B;  3SWH A;  2CHO A;  3ZMU B;  1HR0 T;  4LFC T;  2H88 A;  1T8B A;  2EHO D;  4Z90 A;  2LEH A;  4KBM B;  2HHH T;  2AE9 A;  4ZS3 A;  2ZM0 A;  4YSZ A;  5LHG B;  4EZ4 A;  3MAC A;  3O1J A;  5LHH B;  1FJG T;  1UX5 A;  4CN6 A;  5C2T A;  4BA9 A;  1AJ3 A;  4IE0 A;  4X1Y E;  2CWO A;  5GON E;  3TLT A;  5JTG A;  5AQI B;  4CXY A;  2KIN B;  4X62 T;  2E2A A;  3UQ7 A;  4DV2 T;  2YDS A;  2WAU A;  5FMN A;  4IGU A;  3VRA A;  2V8S V;  4KI0 F;  4O4H E;  3ZYK A;  3FZF B;  4U2Z A;  4UVC B;  1X9B A;  3AEG A;  3IEE A;  4GOU A;  4NIQ A;  4DR3 T;  3HL6 A;  4H9Q C;  3PUR A;  3PJA A;  5C8Y E;  4UF0 A;  2W2U A;  3Q5E A;  4K0K T;  1D0Z A;  1HF8 A;  1UUS A;  3A5X A;  5HXH A;  4KP3 C;  3ZMZ B;  2OLT A;  2WY2 A;  2XQ6 A;  3ZT7 A;  4EB6 E;  4DUZ T;  3R6N A;  1T72 A;  2CBJ A;  4FI5 A;  4PJL A;  2XAS B;  3RIU C;  2E5L T;  4M1P A;  2VB6 A;  3OYZ A;  1KNZ A;  4YJ3 E;  4LF5 T;  1Y01 A;  2IDO B;  4U7I A;  2NP9 A;  1R8I A;  2C0S A;  4QWN B;  3UUM A;  4TNV A;  3BQL A;  4H9R C;  1G73 A;  2M6B A;  4TNW A;  3VR8 A;  4DR1 T;  2BVL A;  3MXZ A;  3RC3 A;  2VKO A;  3P4R A;  2ZLY A;  4XZC A;  2DWK A;  4GYR A;  4UXN B;  2YU2 A;  1HNZ T;  4DV6 T;  2C5J A;  1J1J A;  4HGA A;  4IST A;  2CLY C;  4DV3 T;  5EK3 A;  3S4U A;  2UUC T;  1T98 A;  2WBL A;  4O2B E;  1ZEE A;  4B3S T;  3B57 A;  3PJA J;  3AVR A;  3P4W A;  5FY7 A;  4A98 A;  2PFV A;  3ETU A;  5EZY E;  2J62 A;  3RQU A;  4JI3 T;  1SUM B;  3P7I A;  4DBQ A;  2LE8 A;  2XQY A;  1MND A;  4HWH A;  3KIN B;  3AA6 B;  4IE6 A;  4IL9 A;  3V5U A;  4CN1 A;  2LJL A;  2XSA A;  4QXH B;  3UUX B;  5L3C B;  1XNR T;  1W0A A;  1H7C A;  1Z8U A;  3I1A A;  1IJ6 A;  2D5U A;  3K1S A;  5FXV A;  4YHH T;  4AKG A;  3VKH A;  3FXE B;  2LRL A;  1MMN A;  3FXD B;  5ABE A;  2NW8 A;  4YHJ A;  1KF6 A;  5JR9 A;  5LP6 E;  3PUA A;  4JV5 T;  1XMO T;  5CJ5 A;  3JAE A;  4UEM A;  3OJA A;  5FNV E;  4JI0 T;  1BR1 A;  3RH3 A;  1HX8 A;  4J2C A;  2UXD T;  3N9N A;  4X65 T;  5AQO B;  5L4E A;  5CFB A;  4CI2 B;  5KXJ A;  4DV0 T;  4C90 A;  4CI3 B;  4JUY A;  4ILU A;  5EK2 A;  3P4P A;  4HFH A;  2PBI A;  3RC8 A;  1E7P A;  2MTQ A;  2WMO A;  3V5S A;  1OED E;  1FMV A;  4U2Y A;  2BDE A;  3ZKR A;  2D0T A;  2A3D A;  3ESL A;  3EVY A;  4X20 E;  4UV8 B;  3AXJ A;  3RRC A;  4ANJ A;  5LJN A;  2LM2 A;  2M67 A;  2XQ8 A;  2H7O A;  2J4G A;  3PUZ F;  3X1D A;  2KWI B;  3C64 A;  2K48 A;  1LRZ A;  2IC6 A;  1E1H B;  4GK0 E;  3RYI E;  4EZH A;  3CX8 B;  4O8S A;  5HEU A;  5FXW A;  3OVU A;  5CA1 E;  3FBZ A;  3AEC A;  2NTY A;  2X68 A;  4DR5 T;  4P1N A;  2J47 A;  1B7T A;  3ANW B;  4EGW A;  1SA0 E;  3UUB A;  2CEA A;  3EUH A;  2EHO A;  3PUS A;  4KUM B;  5J1G A;  2XSB A;  2CBI A;  2WDR A;  1LVF A;  4K0U A;  3RYF E;  4A97 A;  3WAJ A;  2XQ4 A;  4MBQ A;  4QH1 A;  1MMG A;  4HWI B;  3LK4 2;  3NKZ A;  3O4X E;  1HNX T;  3KV6 A;  2LT3 A;  3OTO T;  2WDQ A;  4P09 A;  1IBK T;  4JEH B;  5HYA A;  3E22 E;  1KK7 A;  3N2O A;  3PUV F;  1GQE A;  5FL1 A;  4AI6 A;  3AE9 A;  4CN4 A;  2YN6 A;  3P4S A;  4PK4 A;  4EAH A;  5JDN A;  2XAH B;  3SS1 A;  4QH4 A;  1E2A A;  3H3M A;  2Q9Q C;  1HFA A;  5JQG E;  2X66 A;  2Y8D A;  5LHI B;  4HFI A;  2DNX A;  2XAJ B;  1HX1 B;  4UIG A;  3AE7 A;  4EXT A;  1XZY A;  2VL8 A;  3TLU A;  3QK6 A;  1N36 T;  3H37 A;  1BR4 A;  3ZST A;  1L0V A;  4DR2 T;  4ASK A;  1N32 T;  2K5B B;  4UR9 A;  3RF1 A;  2N2N A;  5CB4 E;  2VAS A;  2K24 A;  4HFD A;  2XQ3 A;  5A1L A;  3BK9 A;  2BG9 C;  3L09 A;  4MFR A;  1HTJ F;  2XZE A;  4OYJ A;  4Z91 A;  1I94 T;  3BQK A;  1D1B A;  4I50 E;  3AE6 A;  3T8O A;  1I6Z A;  3OPC A;  3U78 A;  2VUR A;  4ZI3 D;  3AB3 B;  2N9D A;  2MBG A;  4LMK A;  2ZM8 A;  5L2L A;  2X9H A;  4ZS2 A;  4EIW A;  4ZI7 E;  4TWF A;  4DMW A;  4DR7 T;  5FVK A;  2Q9Q B;  2W66 A;  2VVS A;  4H9P C;  2W0G A;  5LBQ B;  3VU7 H;  1JNR A;  3LJC A;  5FP3 A;  4CQI A;  3LK2 B;  5JR9 C;  3UUN A;  2FBW A;  2X0L B;  3Q5W A;  3HI2 A;  2JQH A;  3LG7 A;  1MNE A;  5L3G B;  5LJM A;  5AQG B;  1NAF A;  2E5V A;  2IIU A;  1XWM A;  2DHR A;  5LB7 B;  3GMI A;  3UU3 A;  3RLF F;  4JI4 T;  3KVA A;  4MAL A;  1KNP A;  2A72 A;  4AKR B;  1ZP0 A;  3PE0 A;  4DUY T;  4O4L E;  3RHW A;  3AE3 A;  1W09 A;  4NXM T;  1WLX A;  2MOZ A;  3KFW X;  4UEL A;  5FKY A;  2BKP A;  4HWD A;  4JI2 T;  1Z0P A;  5AQN B;  3QB5 A;  4UF0 B;  4DBR A;  4JI6 T;  5JDM A;  2V5D A;  1J5E T;  2JQK A;  2CXD A;  1WFD A;  3AE5 A;  3JC6 D;  2CM0 A;  4H9O C;  5BMV E;  5BR8 T;  2BBJ A;  2NOX A;  2VVN A;  3EDV A;  3QUJ A;  4HFE A;  4IDP A;  4H9N C;  1S35 A;  2WZH A;  2V7K A;  2OA5 A;  3UQ4 A;  1HNW T;  3Q2M A;  2FUP A;  2FJA A;  2Q9Q D;  5HCJ A;  2DI4 A;  5J2T E;  3M65 A;  1NEN A;  3HA4 A;  5TAO A;  4AQY T;  3FBL A;  1MIV A;  3CX6 B;  5AQJ B;  2CPT A;  3FB2 A;  4YLH A;  5ETW A;  4P0A A;  2ZMA A;  2DWG A;  3C4X A;  5FL0 A;  3KV4 A;  4QXC B;  1HCI A;  1UX4 A;  5AQT B;  1QUU A;  2ODU A;  4X1I E;  5H6R B;  3RIU A;  4C91 A;  3VR9 A;  2EHO B;  2KND A;  2XY8 B;  2UUA T;  3A8Y C;  3CWZ B;  3NWI A;  2M6I A;  2WWV A;  2LKG A;  2Q9Q A;  4GYS A;  1OWA A;  2XTL A;  3PTR B;  4ZI3 C;  1YKH B;  2JRK A;  3O9X A;  4DV5 T;  2MYS A;  2V6Y A;  3AAE B;  3QOF A;  4HFC A;  3Q5X A;  2UXX B;  2NR4 A;  5LBM A;  4LFB T; 
#chains in the Genus database with same CATH homology
 2JMH A;  1WYC A;  2CMR A;  2J1D G;  2YK0 A;  3TKL B;  3RYC E;  3ZCI A;  2Z6E A;  4HTE A;  3HKC E;  4PFP A;  2LM9 A;  1ZV4 X;  3IBP A;  5LOV E;  2C5I T;  2X9Y A;  3GWH A;  2GK9 A;  4XAX B;  2XHE B;  2CLY B;  1IZN B;  4IE7 A;  4EOZ B;  4PJJ A;  3ZN1 B;  2ES0 A;  3VKG A;  3UUL A;  1HG5 A;  4GK5 E;  5ADX L;  3PUQ A;  3HKD E;  3DP7 A;  4AKH A;  3NBX X;  1YKE B;  4TV9 E;  5DQV A;  2HPL A;  2BZB A;  5L3F B;  3J9X 1;  3UTK A;  3VHL A;  5DQW A;  5LYJ E;  4TV8 E;  4PK6 A;  5JH7 E;  2LHR A;  1FIO A;  2L8K A;  4AQG A;  2VWA A;  2YU1 A;  1U5P A;  3N9M A;  2X9X A;  5JDL A;  4UVB B;  3ANW A;  1Y64 B;  4TZ4 C;  3RX6 A;  2V7M A;  4AQF C;  1WRD A;  2A2F X;  1NWM X;  5HXS A;  5JRC A;  2SPC A;  4HKA A;  3O1I A;  2LOP A;  3CQG B;  4PAG A;  4YFS A;  3UT5 E;  4ZHQ E;  3PDY A;  3F31 A;  3AAA B;  5JDF A;  2L9Q A;  2RP4 A;  1D1C A;  1WYB A;  2JMK A;  2W00 A;  5IHY A;  3N2G E;  4ZI2 D;  3C4Z A;  2CXF A;  3JC6 C;  4PK5 A;  4QHO A;  3HKE E;  1IJ5 A;  3NRY A;  4EYU A;  5JR9 B;  3HR0 A;  2LHN A;  5LGT B;  4E7Z A;  5FYM A;  3K3Q C;  4QKN A;  2YEV C;  3RPU A;  5LCY A;  4CXX A;  3C98 B;  3P8C D;  1D0X A;  2LSG A;  2LOS A;  3Q9D A;  4ZI7 E;  3HKB E;  1U4Q A;  3K8P C;  3KVB A;  5F3J A;  5KDM C;  1HG2 A;  2HH7 A;  2HPJ A;  4ISS A;  2KMF A;  3GN5 A;  4ZOL E;  4L0R A;  2V26 A;  2LSI A;  5HAX A;  4CXW A;  3GA8 A;  4I4T E;  2NWB A;  2LSK A;  4MHC A;  4H9S E;  3OBV E;  2WWU A;  4TN7 B;  4P0B A;  2XAF B;  3ZLI A;  3RKO A;  5L3E B;  2RA1 A;  4BAY B;  3N2K E;  3KBT A;  2KZ7 B;  5CA0 E;  4FJO A;  5L3B B;  5LNK A;  2ZM2 A;  3NRX A;  4ERR A;  5FY1 A;  3ZC1 A;  4ADZ A;  3MK7 C;  3PU3 A;  4DVD A;  5E0O A;  2K9A A;  1MMA A;  3LBX B;  4TUY E;  1D1A A;  3ZJ1 A;  1SHZ C;  5LGU B;  4IE4 A;  3AA1 B;  2XUE A;  4AKL A;  4E7S A;  1IAP A;  4TX5 A;  4DMV A;  3ZJ2 A;  5KMG P;  4AXP A;  3D0T A;  4L9I A;  2D0U A;  3MJX A;  3KBU A;  3N9P A;  2CXL A;  2VKJ A;  2LSJ A;  3SOL A;  1ZHC A;  3ZMS B;  2V7L A;  3E08 A;  2CWY A;  3CKD A;  1X79 A;  4O4I E;  3KV5 A;  4PFO A;  2DLR A;  3ZMV B;  4PJN A;  2UXN B;  1D0Y A;  3PU8 A;  4NUV A;  3KV9 A;  5F8P A;  3N9Q A;  4IHJ E;  3K3O A;  3CX7 B;  3GN5 B;  5FXX A;  5FXZ A;  3AA0 B;  4IIJ E;  2PJQ A;  2E9X A;  2Y48 B;  3H3A A;  4GIW A;  4IDZ A;  3NZQ A;  2DCF A;  2JJ9 A;  3SRZ A;  5J2U E;  1OXZ A;  3ZCJ A;  4I55 E;  3ETV A;  4PNI A;  3OYX A;  1EZ3 A;  4HE8 A;  1MIY A;  2E9X C;  4PW8 A;  1YW0 A;  5HWX A;  5JDH A;  3DTO A;  2EHO C;  1FEW A;  3I9Y A;  3C51 A;  2V7J A;  2QA7 A;  3ZYM A;  5KX5 E;  5LXT E;  5M4Y A;  1CUN A;  2BVM A;  3CQX C;  1ZKE A;  2X67 A;  4U74 A;  4I43 B;  4L5G A;  3OKQ A;  4X1K E;  3AAI A;  2E9X D;  5HWY A;  2I59 A;  1O3X A;  4G2A A;  2QGS A;  4WBO A;  4B6X A;  3K3N A;  4V1A v;  4MLK A;  1US7 B;  3B13 A;  1LKX A;  3C50 A;  2X9W A;  2WM9 A;  3WAK A;  4QXB B;  2IC9 A;  3F2E A;  4XBF B;  3W15 B;  4WBN E;  3KDS E;  3R84 B;  1LVK A;  4H63 H;  2H3R A;  1V9D A;  4QX8 B;  1BR2 A;  5HXR A;  3ZC0 A;  3BQI A;  1WR6 A;  2CA5 A;  2N1G A;  1MIW A;  2VKD A;  4QX7 B;  2L3L A;  4WNK A;  2X51 A;  2W61 A;  3C4W A;  4DND A;  2H7V C;  2ACX A;  1G8X A;  3AA7 B;  4OYK A;  1VRB A;  1FMW A;  2LSY A;  2WSS V;  2V1D B;  5H6Q B;  2IAK A;  2ODV A;  2KWH A;  3CQC B;  4N78 D;  5FY0 A;  4ZI2 C;  3L3P A;  2KT9 A;  5L3D B;  4O2A E;  4F6R C;  3CPZ A;  3MKD A;  4KMC A;  4U72 A;  3RYH E;  4H63 V;  2PG8 A;  4O4J E;  2E9X B;  3IF8 B;  2WMN A;  5DJQ C;  5HXC A;  4DO0 A;  1YD8 G;  5LA6 E;  5JRC B;  1VOM A;  2V7I A;  2XAQ B;  3MA9 A;  4CZZ B;  5JRE A;  4HEA A;  3ZEF B;  1HS7 A;  2C5K T;  2CCQ A;  4PJM A;  4A56 A;  3IHR A;  4NUU A;  3N9L A;  3ZPO A;  4WW0 A;  5AFU L;  2D2S A;  3CML A;  3ZYL A;  3RRW A;  3ZMT B;  4HN9 A;  2XAG B;  3U3I A;  2W62 A;  4OHF A;  2Y6X A;  2IW5 B;  2VKH A;  3E0Z A;  3FHN A;  4CI1 B;  3LFM A;  5IYZ E;  3N9O A;  2YIN A;  3PUG A;  4OFZ A;  3CVR A;  4AKI A;  4UVA B;  5JVD E;  4OK0 A;  3F57 A;  4JLE A;  4HFV A;  2W63 A;  4EYY R;  5EK4 A;  2KLQ A;  2JQQ A;  3I0O A;  3NZP A;  2B1E A;  3LBX A;  3WI3 A;  2NTX A;  5HXE A;  4AQF A;  5DAB A;  1UCU A;  1MMD A;  3QC9 A;  2JPF A;  5JDG A;  3J7Y q;  3AVS A;  2G0U A;  2P9B A;  3I0Q A;  3O1H A;  2VK9 A;  3EDU A;  3UFE A;  2NW7 A;  2NW9 A;  5LGN B;  4G63 A;  3I9W A;  4Z8X A;  4BJM A;  2KXP B;  4UV9 B;  1BR0 A;  3ZN0 B;  4YJ2 E;  1S94 A;  3DJB A;  3MZK B;  3ONX A;  4IE5 A;  1QSD A;  3LK3 B;  2CE7 A;  2E8I A;  3N5L A;  4JEU B;  3SWH A;  3ZMU B;  2EHO D;  2LEH A;  4KBM B;  4ZS3 A;  5LHG B;  2ZM0 A;  4EZ4 A;  3MAC A;  3O1J A;  5LHH B;  1UX5 A;  4BA9 A;  4IE0 A;  4X1Y E;  2CWO A;  5GON E;  4CXY A;  2KIN B;  2WAU A;  5FMN A;  4IGU A;  4O4H E;  3ZYK A;  4UVC B;  3IEE A;  4GOU A;  3HL6 A;  4H9Q C;  3PUR A;  5C8Y E;  4UF0 A;  1D0Z A;  1HF8 A;  3A5X A;  5HXH A;  4KP3 C;  3ZMZ B;  4EB6 E;  3R6N A;  4FI5 A;  4PJL A;  2XAS B;  1KNZ A;  4M1P A;  2VB6 A;  3OYZ A;  4YJ3 E;  2C0S A;  2NP9 A;  3UUM A;  4QWN B;  3BQL A;  4H9R C;  1G73 A;  2BVL A;  3MXZ A;  3RC3 A;  2VKO A;  4XZC A;  2ZLY A;  2DWK A;  4GYR A;  4UXN B;  2YU2 A;  2C5J A;  4HGA A;  4IST A;  2CLY C;  5EK3 A;  3S4U A;  1T98 A;  2WBL A;  4O2B E;  1ZEE A;  3B57 A;  3AVR A;  5FY7 A;  2PFV A;  3ETU A;  5EZY E;  1AJ3 A;  3P7I A;  4DBQ A;  2LE8 A;  2XQY A;  1MND A;  3V5U A;  3KIN B;  3AA6 B;  4IE6 A;  2LJL A;  4QXH B;  3UUX B;  5L3C B;  1H7C A;  3I1A A;  4AKG A;  1IJ6 A;  2D5U A;  5FXV A;  3VKH A;  3FXE B;  1MMN A;  3FXD B;  2NW8 A;  4YHJ A;  5JR9 A;  5LP6 E;  3PUA A;  4UEM A;  3OJA A;  5FNV E;  1BR1 A;  3RH3 A;  1HX8 A;  4J2C A;  3N9N A;  4CI2 B;  4C90 A;  4CI3 B;  4JUY A;  4ILU A;  5EK2 A;  2PBI A;  3RC8 A;  2MTQ A;  3V5S A;  2WMO A;  4BJN A;  5LG4 A;  1FMV A;  2BDE A;  2D0T A;  2A3D A;  3ESL A;  3EVY A;  4X20 E;  4UV8 B;  3RRC A;  4ANJ A;  5LJN A;  2M67 A;  2H7O A;  2KWI B;  3C64 A;  2K48 A;  1LRZ A;  2IC6 A;  1E1H B;  4GK0 E;  3RYI E;  4EZH A;  3CX8 B;  4O8S A;  5JDQ A;  5FXW A;  5CA1 E;  3FBZ A;  2NTY A;  2X68 A;  1B7T A;  3ANW B;  1SA0 E;  2CEA A;  3EUH A;  2EHO A;  3PUS A;  4KUM B;  5J1G A;  1LVF A;  4K0U A;  3RYF E;  3WAJ A;  4MBQ A;  1MMG A;  3LK4 2;  3O4X E;  3KV6 A;  2LT3 A;  4P09 A;  4JEH B;  5HYA A;  3E22 E;  1KK7 A;  3N2O A;  4AI6 A;  4EAH A;  5JDN A;  4PK4 A;  2XAH B;  3SS1 A;  1HFA A;  2Q9Q C;  5JQG E;  2X66 A;  2Y8D A;  5LHI B;  2DNX A;  2XAJ B;  4UIG A;  4EXT A;  2VL8 A;  3QK6 A;  3H37 A;  1BR4 A;  4ASK A;  2K5B B;  2N2N A;  5CB4 E;  2VAS A;  2K24 A;  5A1L A;  3BK9 A;  3L09 A;  4MFR A;  1HTJ F;  4OYJ A;  3BQK A;  1D1B A;  4I50 E;  3T8O A;  3U78 A;  4ZI3 D;  3AB3 B;  2N9D A;  2MBG A;  2ZM8 A;  5L2L A;  2X9H A;  4ZS2 A;  4EIW A;  4DMW A;  2Q9Q B;  4H9P C;  5LBQ B;  3VU7 H;  2W0G A;  3LJC A;  5FP3 A;  4CQI A;  3LK2 B;  5JR9 C;  3UUN A;  2X0L B;  3Q5W A;  3HI2 A;  5L3G B;  3LG7 A;  1MNE A;  5LJM A;  1NAF A;  2DHR A;  3GMI A;  3KVA A;  4MAL A;  2A72 A;  4AKR B;  3PE0 A;  4O4L E;  1WLX A;  2MOZ A;  3KFW X;  4UEL A;  1Z0P A;  4DBR A;  4UF0 B;  5JDM A;  2CXD A;  3JC6 D;  4H9O C;  2CM0 A;  5BMV E;  2NOX A;  3EDV A;  3QUJ A;  4H9N C;  1S35 A;  2V7K A;  2OA5 A;  3Q2M A;  2Q9Q D;  2DI4 A;  5J2T E;  3M65 A;  3HA4 A;  5TAO A;  3FBL A;  1MIV A;  3CX6 B;  3FB2 A;  4YLH A;  5ETW A;  4P0A A;  2ZMA A;  2DWG A;  3C4X A;  3KV4 A;  4QXC B;  1HCI A;  1UX4 A;  1QUU A;  2ODU A;  4X1I E;  5H6R B;  4C91 A;  2EHO B;  2KND A;  3CWZ B;  2Q9Q A;  4GYS A;  1OWA A;  2XTL A;  3PTR B;  4ZI3 C;  1YKH B;  2JRK A;  3O9X A;  2MYS A;  3AAE B;  3Q5X A;  2UXX B;  5LBM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...