4OYKA

Structure of hoip pub domain bound to otulin pim
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
173
structure length
173
Chain Sequence
ERAFLVAREELASALRRDSGQAFSLEQLRPLLASSLPLAARYLQLDAARLVRCNAHGEPRNYLNTLSTALNILEKYGRNLLSPQRPRYWRGVKFNNPVFRSTVDAVQGGRDVLRLYGYTEEQPDGLSFPEGQEEPDEHQVATVTLEVLLLRTELSLLLQNTHPRQQALEQLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase RNF31
publication title Molecular Basis and Regulation of OTULIN-LUBAC Interaction.
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2014-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09409 PUB PUB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4oykA00
2D5UA 4P09A 4JUYA 4OYJA 5LJMA 4P0AA 2HPJA 4P0BA 5LJNA 2CCQA 4OYKA 2CM0A 2HPLA
chains in the Genus database with same CATH superfamily
3HR0A 2E5LT 5AQMB 3OVUA 2XAQB 1OEDA 3NBXX 3KVAA 3RH3A 2D9DA 3ANWB 2Y48B 1US7B 5L3FB 2NR4A 3Q9DA 3CVRA 3SFDA 4LF8T 3NZPA 2FJEA 3RX6A 2BG9A 3IA3A 1UX4A 4WYVA 3VR8A 2VKJA 3MZKB 5JR9B 4HWFA 1FIOA 3ZCIA 5HXCA 2BZBA 3PUYF 4CXWA 5HEHA 4LFCT 2K24A 4PW8A 5CFBA 1HNXT 3ZYKA 4COFA 3LSVA 2LSIA 4DR5T 1X79A 2X0HA 2CCQA 1MNEA 5FVKA 2A2FX 5AQVB 2W61A 2LSJA 5LA6E 2FJAA 2EHOB 2LT3A 3H3AA 4I55E 2J47A 4PJNA 3LJCA 1QLBA 4PFOA 3ZPOA 2Y6XA 4ZI7E 4ERRA 4B3ST 4LFBT 2K48A 2MTQA 4ILAA 3FZHB 3HKDE 3RC8A 4IT4A 1WR6A 5DQVA 4DMWA 5AQOB 3N9QA 1SUMB 1KEYA 2Q9QB 3ETVA 4DV2T 1Y64B 2UXBT 2DI4A 1B7TA 2IHR1 3P8CD 2W63A 3AE1A 2X68A 3V5UA 2L3LA 4ZI2C 4XBFB 3CX8B 3FXDB 1JNRA 2PTFA 2LSGA 3CKDA 4L9IA 4ZHQE 3AEEA 5LP6E 4WBNE 4WZXA 2ODVA 2NOXA 2ZM0A 3KINB 4H9NC 5KX5E 3HL6A 4YT0A 1QUUA 3C4XA 3P4RA 3OPCA 2MAWA 5AQLB 2IIUA 5LMNT 3MA9A 4HGAA 3FZKB 4U2ZA 4TWHA 3LBXA 1I94T 2XQ6A 1V9DA 3JADA 5F8PA 4TNWA 1MMNA 4B3TT 2K9AA 3RQWA 3HKEE 4DIDB 3CQGB 4XZCA 4UXNB 2H7OA 3RRWA 1HX8A 3PUZF 2C5IT 4X5TA 3LFMA 4O2BE 1E7PA 3UU5A 2ZMAA 4DV6T 3RYCE 2MPKA 3P4SA 5JDLA 2X67A 4MLKA 3RLFF 4ZS3A 4O4JE 3LG7A 5FXVA 2XTLA 5ABGA 2CEAA 4DVDA 4M1PA 5JVDE 3JC6C 4O2AE 3AEAA 2V7JA 3C98B 3PTRB 3ZT7A 3FXEB 5CA0E 3KV6A 1CHUA 5AQFB 3TLSA 5L3CB 5HXSA 1H7CA 2V7KA 1IAPA 2JQ9A 2XQ8A 3FBLA 3GN5A 2WS3A 1W09A 4P0AA 3OJAA 1G73A 3NRYA 3U78A 4UVAB 1LVKA 4H63V 5LB7B 4DR1T 1YKHB 1D0ZA 3Q5XA 5JTGA 4AQGA 2E9XA 3OKQA 5LXTE 5HEGA 4OHFA 4E7ZA 4JI5T 4IE0A 3EI0A 4HWHA 2ZLYA 4CI2B 1OEDB 3ZJ1A 4J2CA 4IDPA 3AECA 1QSDA 4NXMT 2WAUA 1XDOA 3AE2A 4ISSA 3RI5A 3V5SA 4LMJA 3A7MA 5LMUT 2Q9QD 3UU8A 1HTJF 1EZ3A 4H9QC 2C0SA 5EK4A 5LHGB 4DV3T 4LF9T 3I9YA 1XNQT 4X1IE 4EAHA 5HXRA 4JYAT 5JDHA 3I0OA 5BR8T 3SRZA 3PJAA 4DBQA 1AJ3A 3ZT6A 3K3NA 5DQWA 2VQFT 2CXLA 2IUBA 2FJDA 2R6GF 2KLQA 4O4IE 4HWIB 4JI1T 4WNKA 4X1YE 4PK4A 1OEDC 2JJ9A 5H6RB 1UX5A 3AEBA 2BDEA 4FI5A 3TKLB 2YU1A 5JDGA 2XY8B 4A56A 5L3DB 4UIGA 2CPTA 2BG9C 3JCFA 5L3EB 5JDMA 5JDNA 1YKEB 2XUEA 3TLUA 2UUBT 4GYRA 4QXCB 3RC3A 3ZYMA 4NUVA 3C50A 2PJQA 2L8KA 5IWAT 2V7LA 2JRKA 1MIWA 2YKSA 3BQLA 1XMQT 3IEEA 4AKRB 1IBKT 3IHRA 2W66A 5KXJA 1WRDA 2LJLA 1YW0A 4HWCA 2V7MA 2WWUA 1IZNB 3RYFE 3ZSSA 3L09A 5FL0A 3K8PC 1LRZA 2VASA 3FZLB 4UELA 3LBXB 3HKCE 3VKGA 1XDPA 2XQYA 3CK6A 3L39A 4X64T 4NXNT 4HN9A 5LOVE 4QH5A 4AKIA 2W67A 1L0VA 5LGNB 3CQXC 3PE0A 3PUXF 2KT9A 2C5JA 2LM2A 2BKOA 3NZQA 3C4WA 1U4QA 2L9QA 4H9SE 4YFSA 5AQSB 3JAEA 2N2NA 4MHCA 4Q25A 1KK7A 4YJ3E 4IDQA 3AAIA 4YSXA 1WFDA 3FB2A 4B6XA 1OEDE 1M62A 2WZIA 2W2UA 4AISA 3MXZA 4NPPA 4NIQA 2K5BB 4LMKA 3PDYA 5C2TA 2BG9E 2ZM6T 1J5WA 3RYHE 1U5PA 3MACA 2D0UA 5FMNA 4TV9E 5F5WA 4YTMA 4KUMB 3K3OA 3Q5EA 4DUZT 2VK9A 2V1DB 2CMRA 3GA8A 5LYJE 1ZOYA 3A5XA 2D0TA 2X66A 1MMDA 4KP3C 1IJ5A 5AQGB 3RQUA 2E9XB 2BBHA 3QB5A 1T98A 2P9BA 3B13A 1WYCA 3EDVA 2D5UA 4PAGA 2X51A 1T72A 1W0AA 4PJLA 1NWMX 2W0GA 2W62A 2KINB 2XQ7A 2HHHT 2WQYA 4JI4T 2UXCT 4Z90A 1G8XA 3AEFA 5LG4A 4HFIA 3FZFB 4PNIA 1IJ6A 2J62A 5CB4E 1HG5A 3IBPA 3KV4A 1IBMT 3GWHA 2VKOA 2QRXA 5IYZE 2YDSA 2HPLA 4YSYA 4EYUA 3P7IA 4DV5T 3ZMVB 4DO0A 2LEHA 5BMVE 4CN4A 1WCRA 4EXTA 4H63H 3KVBA 1E2AA 4JI7T 5AQQB 2A9UA 2E9XC 5FXXA 1Z0PA 4LMLA 2LOSA 3SFEA 2WDQA 4UVBB 2UXNB 4JLEA 2V6YA 4HFEA 5AQTB 4IL4A 5AQKB 1T7SA 2CXDA 2QYWA 2YDQA 3EVYA 1YQ4A 2BKNA 1N33T 3AVRA 4DR6T 2WM9A 5FP3A 3IF8B 3A8YC 4IE6A 5ABFA 4A97A 2LLYA 4XAXB 4GYSA 4I50E 2YN6A 5FXWA 3ZEFB 5JDQA 4DV4T 4A5XA 3ZC1A 1WR0A 5LHIB 3QK6A 4TUYE 4EIWA 3CMLA 4JBWF 1NEKA 4NUUA 4YY3T 4X1KE 3PUAA 3MJXA 3O1JA 3Q5WA 2IDOB 1D0YA 3BK9A 4JV5T 4QKNA 3CWZB 3N2GE 4DR7T 5KDMC 3QUJA 5M4YA 5AFUL 2NP9A 2XQ4A 1XZYA 5E0OA 1OWAA 5KMGP 4DV7T 5FY1A 4ILBA 5L3GB 4JEHB 3P4QA 2H7VC 3C64A 5JREA 3I9WA 3WAKA 5AQPB 4O8SA 2IC9A 3I0QA 4C91A 2QA7A 5LBQB 5LHHB 2E8IA 3LDQB 2VL0A 2E9XD 3O1IA 2AXDS 3X1DA 4FJOA 2VKDA 5L4HA 2NW7A 5CA1E 4CZZB 5J1GA 3OBVE 2KWIB 1HNZT 5ADXL 3ZMTB 1UK5A 2X9XA 4IDNA 1KNRA 1KNZA 3B5MA 3N9PA 1LVFA 4ZI2D 4HFVA 2XSBA 3PUGA 2CRBA 1E1HB 3NWIA 3AE4A 3Q5DA 3AXJA 3H3MA 5FY0A 1BR2A 5L2LA 3C51A 2VURA 4TN7B 1XNRT 2V8SV 4LF6T 4QXBB 2KSRA 3RGLA 4PFPA 3J9X1 3T8OA 2LSKA 2XQ3A 4HFBA 4MALA 2BS2A 2NW8A 1SHZC 4QX8B 2LRKA 4QWNB 1T8BA 3KV5A 2MYSA 5JQGE 4O4LE 3AB3B 4PJJA 4LF5T 1NAFA 5FNVE 4WBOA 3RIFA 4EEBA 2PG8A 4JI2T 2X9HA 2BG9B 2DWGA 5LJMA 1D1BA 4AIUA 4CN1A 5L4EA 1HCIA 4PJMA 3ZMSB 3E0ZA 1YD8G 3PV0F 4IE4A 5HCMA 4GKKT 4HE8A 2PFVA 4YJ2E 3Q2MA 2NWBA 4HFCA 4TWDA 4IHJE 2YEVC 3JC6D 2NTYA 3R84B 3L8RA 3ZT5A 4IE5A 4HEAA 2EHOA 3RIAA 4UEMA 5AQUB 1Z8UA 2CLYC 4JI6T 2VKHA 2F4VT 2JQKA 1HFAA 3FZMB 5C8YE 4IL9A 3ESLA 2V6XA 1IBLT 2V6YB 2H88A 2AE9A 4ZI3C 3CX6B 3AEGA 1ZHCA 4EB6E 2M67A 4DMVA 2KNDA 3PURA 2VB6A 3NRXA 3O4XE 2IAKA 2M6IA 5ABFB 3T1HT 2KZ7B 2BKPA 5L47A 4DR3T 2PBIA 2CWOA 5FL1A 3SS1A 3ETUA 4B3MT 2B1EA 5LCYA 2VQET 1ZV4X 2V26A 4UF0A 1XMOT 5HXEA 3DP7A 5DABA 4HKAA 1CUNA 4CI3B 3RYIE 3AE5A 3PUWF 3B57A 2FUPA 4QXHB 3RKOA 4KHPT 3I1AA 3UFEA 1VOMA 3O9XA 3H37A 2X0LB 3BQIA 2V5DA 4GKJT 4H9RC 2X9WA 2UXXB 3AA0B 3D0TA 2DL1A 3AA6B 1FJGT 3PUQA 4OX9T 4MFRA 2C5KT 3EDUA 2WZHA 1FMVA 2BS3A 3AE8A 2WP9A 2XM1A 1W0BA 3RF1A 2RA1A 4OK0A 1BR1A 4TZ4C 4ZZCA 3PUVF 3NKZA 2WSSV 3VKHA 3OYZA 4JEUB 2ES0A 5HWXA 2VL8A 4DV0T 2Z6EA 3ZN0B 2RPAA 3CPZA 1HF8A 3T1YT 5A1LA 5LGTB 3AEDA 2CHOA 2UUCT 2CBJA 5HXHA 2I0MA 3GN5B 4AXPA 2DWKA 3AXJB 4K0KT 2WCAA 3N9MA 3N9OA 2ODUA 1D1AA 2WDVA 2XAFB 4IGUA 3AAAB 3UTKA 4IIJE 1R8IA 1O3XA 3UU6A 2BS4A 4U3CA 5HWYA 2XPKA 3N9NA 3ZKRA 2N1GA 1N34T 2W4XA 5TAOA 3F2EA 4U74A 3O1HA 3M3ZB 4YTPA 1S94A 1UUSA 4EYYR 1ZP0A 4HWDA 2WU2A 2GK9A 4ISTA 4UR9A 3ZMZB 4BJMA 5EK3A 3EUHA 1D0XA 4F6RC 2G0UA 3CX7B 4O4HE 4V1Av 2XQ5A 3ZYLA 4K0UA 2J4GA 2WWVA 3VHLA 5JRCA 2JMKA 4MBQA 4QHOA 3ZCJA 1Y01A 2LE8A 5LBMA 3HI2A 4TV8E 3FHNA 1MIYA 3UUXB 2XQAA 4GK0E 2QGSA 2XASB 4I4TE 4DNDA 3PUSA 2KWHA 4AQYT 4ASKA 4Z91A 1WLXA 2LOPA 3ZC0A 2XAGB 3U3IA 3ZJ2A 2YINA 1HG2A 3CIRA 5FYMA 5GONE 2HN2A 4ZEYA 2IMLA 3K1SA 1J5ET 2XAHB 3QNUA 4C90A 2KMFA 3TLTA 2CM0A 2JPFA 4HFDA 4AI6A 1MIVA 2WY2A 3UQ4A 4X20E 5L3BB 2LSYA 3UUNA 3RIUC 4H9PC 4HFHA 2J1DG 5JR9C 4CXXA 2BVMA 2YU2A 2X0YA 3N2KE 4ADZA 2IC6A 2WMOA 3W15B 3F57A 4U7IA 2LHRA 2DNXA 1X9BA 4N78D 2OV9A 5LJNA 1UURA 2XJ7A 2A3DA 3M65A 3N5LA 2JMHA 5HEUA 5HCJA 4LF7T 1UGOA 2M6BA 3KDSE 3RPUA 2CWYA 4GIWA 3VU7H 5C3JA 3NVOA 4UF0B 4QH1A 2V7IA 4X65T 3DTOA 2EHOC 2JQHA 5F3JA 4EZ4A 1MMAA 4AQFA 4AKGA 2WMNA 4UV8B 1DU2A 3E08A 3PU8A 3MK7C 4KHZF 4KBMB 3P4WA 4QH4A 4IE7A 3ZN1B 5AQIB 2XAJB 1W9RA 3P4PA 4DV1T 3F31A 4EGWA 4JI3T 2YOEA 4EV6A 5LG3A 4P0BA 4H9OC 3AE6A 4UVCB 2Q9QC 1OXZA 2VWAA 1KFYA 5J0ZA 3RKGA 2V5CA 1GQEA 3L3PA 4ZZBA 1FEWA 2CA5A 2WB5A 3UT5E 4EOZB 5AQHB 2CHNA 3R6NA 3HKBE 5HYAA 4QX7B 3EAMA 2DCFA 4YTNA 1KF6A 3TLWA 4JI0T 2FJBA 5EK2A 3GMIA 2HH7A 4YXDA 4BA9A 3ONJA 4ILUA 2UU9T 2MBGA 4GOUA 3K3QC 1HX1B 2MOZA 2B76A 2LM9A 3RRCA 3RHWA 3N9LA 2XHEB 4BAYB 5AQJB 3AE3A 3MKDA 3OYXA 2VVSA 2CXFA 4OYJA 1J1JA 2CLYB 2EHOD 2ZM2A 5ABEA 5HEOA 5CJ5A 3KFWX 1VCTA 4HTEA 3UU3A 3QOFA 4UV9B 5JDFA 3ANWA 2JQQA 5FY7A 1SE7A 4LF4T 2YDRA 5AQRB 1LKXA 3AA1B 3AAEB 4EEDA 4IDOA 2KXPB 3N2OA 3RIUA 4LFAT 2DLRA 2ACXA 3VRBA 3UULA 4DUYT 1HR0T 3FBZA 5JR9A 1WYBA 4KMCA 1XWMA 4WW0A 2BVLA 4IREA 4U7YA 2I6HA 3WI3A 4CQIA 3UQ7A 4AKHA 2OLTA 2D2SA 4CXYA 1I6ZA 5JRCB 1YXRA 3TLVA 3EABA 2K3WA 2FBWA 3LK3B 4KI0F 3UUBA 1MMGA 1ZEEA 4L0RA 1KNPA 4BJNA 3S4UA 2RP4A 2XZEA 3E22E 5CGMA 1YQ3A 2H3RA 4OYKA 4DR2T 2SPCA 2LHNA 5EZYE 2WU5A 4JI8T 4ILCA 5DJQC 2UUAT 4KX6A 3C4ZA 4DBRA 5J2UE 3WAJA 4TWFA 3AA7B 4F8HA 3VRAA 5HEJA 3ABVA 3EHZA 2HPJA 3KBTA 2Q9QA 3DJBA 2WBLA 4X62T 5ETWA 4U33A 4ANJA 4IDZA 2N9DA 3QC9A 5ABHA 5IUXA 3AVSA 5JH7E 4A98A 2W00A 3HA4A 3CQCB 1HS7A 3AE9A 2XSAA 4GK5E 2HN1A 4P09A 4ZXLA 3QB5K 1MNDA 2I59A 1S35A 4G2AA 1M7KA 2UXDT 2JIWA 2ZM8A 4CI1B 2LKGA 3G06A 5AQNB 2LKHA 3PU3A 1VRBA 5IHYA 5H6QB 2CBIA 2XM2A 4DR4T 2BBJA 4TNVA 2NW9A 1N32T 4B3RT 3ONXA 3ZSTA 4I0UA 1N36T 3SOLA 1NENA 4AKLA 4U31A 1SA0E 3ZLIA 3SWHA 3P50A 3ONLC 4ZS2A 4G63A 3LK42 3KV9A 1ZKEA 2OA5A 2E5VA 1D1CA 1BR0A 4PK6A 5J2TE 3ZMUB 4YSZA 1VCSA 3UUMA 4TX5A 4ZI3D 2VVNA 3UU4A 4YHHT 4E7SA 4YHJA 2XQ9A 2Y8DA 2LRLA 5FKYA 3PJAJ 3JAFA 4ZOLE 2WDRA 4Z8XA 2QVAA 1HNWT 4U2YA 5FXZA 3BQKA 3UFGA 4EZHA 4X66T 3AE7A 2CE7A 3VR9A 4AQFC 4YLHA 1JNZA 5LNKA 2E2AA 4I43B 3OTOT 2H89A 1UCUA 2ACZA 3LK2B 2X9YA 2IW5B 3KBUA 4P1NA 4OFZA 1BR4A 1FMWA 4PK5A 2DHRA 4U72A 5HAXA 4L5GA 2NTXA 3J7Yq 4CN6A 4JUYA 2YK0A 5LGUB 2A72A 5FVLA
chains in the Genus database with same CATH topology
3KDSE 4AKRB 3HR0A 3KV5A 2MYSA 3RPUA 2XAQB 3IHRA 2CWYA 4GIWA 3NBXX 3VU7H 5JQGE 3KVAA 4O4LE 3RH3A 3AB3B 4PJJA 4UF0B 1WRDA 3ANWB 1NAFA 2LJLA 5FNVE 2V7IA 3DTOA 2Y48B 4WBOA 1YW0A 2V7MA 1US7B 5L3FB 2WWUA 2EHOC 5F3JA 1IZNB 2PG8A 4EZ4A 1MMAA 3Q9DA 3CVRA 2X9HA 3NZPA 4AQFA 4AKGA 2WMNA 3RYFE 3RX6A 4UV8B 3E08A 3L09A 3PU8A 3MK7C 1UX4A 3K8PC 2DWGA 5LJMA 1D1BA 2VKJA 3MZKB 5JR9B 1LRZA 2VASA 4KBMB 1FIOA 4UELA 3ZCIA 3LBXB 5HXCA 3HKCE 3VKGA 2BZBA 2XQYA 1HCIA 4CXWA 4IE7A 3ZN1B 4PJMA 3ZMSB 2K24A 2XAJB 4PW8A 3E0ZA 1YD8G 4IE4A 4HN9A 5LOVE 3ZYKA 4HE8A 3F31A 2PFVA 4YJ2E 3Q2MA 2NWBA 4AKIA 5LGNB 3CQXC 2LSIA 3PE0A 4IHJE 2YEVC 4P0BA 1X79A 3JC6D 4H9OC 2CCQA 2KT9A 1MNEA 2C5JA 2NTYA 2A2FX 4UVCB 2Q9QC 3R84B 3NZQA 1OXZA 3C4WA 1U4QA 2L9QA 2W61A 2VWAA 2LSJA 4H9SE 4YFSA 4IE5A 4HEAA 5LA6E 2EHOB 2EHOA 2LT3A 4UEMA 3H3AA 2N2NA 3L3PA 4I55E 1FEWA 2CA5A 4MHCA 3UT5E 4EOZB 4PJNA 1KK7A 2CLYC 2VKHA 4YJ3E 3HKBE 3R6NA 5HYAA 3LJCA 4QX7B 3AAIA 2DCFA 4PFOA 1HFAA 3FB2A 4B6XA 3ZPOA 5C8YE 5EK2A 2Y6XA 3GMIA 4ZI7E 2HH7A 4ERRA 3ESLA 4BA9A 4ILUA 2K48A 2MTQA 2MBGA 3MXZA 4GOUA 2K5BB 3K3QC 4ZI3C 3HKDE 2MOZA 3RC8A 3CX6B 3PDYA 1WR6A 3RYHE 5DQVA 4DMWA 2LM9A 1U5PA 3RRCA 1ZHCA 4EB6E 2M67A 3N9QA 3N9LA 4DMVA 2KNDA 3PURA 2Q9QB 2VB6A 2XHEB 3MACA 3NRXA 3ETVA 4BAYB 1Y64B 2D0UA 3O4XE 5FMNA 2IAKA 2DI4A 4TV9E 1B7TA 3P8CD 2W63A 2X68A 2KZ7B 3V5UA 3MKDA 4KUMB 3OYXA 2L3LA 3K3OA 2CXFA 2PBIA 4OYJA 4ZI2C 4XBFB 3CX8B 3FXDB 2VK9A 2CWOA 2CLYB 3SS1A 2V1DB 2CMRA 2EHOD 2ZM2A 3ETUA 3GA8A 5LYJE 2LSGA 3CKDA 4L9IA 2B1EA 4ZHQE 3KFWX 5LP6E 5LCYA 4HTEA 1ZV4X 2V26A 4WBNE 3A5XA 2D0TA 2X66A 4UV9B 2ODVA 5JDFA 1MMDA 4KP3C 1IJ5A 4UF0A 3ANWA 5HXEA 2E9XB 3DP7A 5DABA 2JQQA 2NOXA 4HKAA 5FY7A 1CUNA 1T98A 4CI3B 3RYIE 2ZM0A 3KINB 2P9BA 3B13A 4H9NC 5KX5E 3HL6A 1WYCA 3EDVA 2D5UA 4PAGA 1QUUA 1LKXA 2X51A 3AA1B 3AAEB 3C4XA 2KXPB 4PJLA 3B57A 1NWMX 2W0GA 3N2OA 4QXHB 3RKOA 2DLRA 2ACXA 2W62A 2KINB 3I1AA 3UULA 3FBZA 5JR9A 3MA9A 1VOMA 1WYBA 3UFEA 4KMCA 4HGAA 4WW0A 3LBXA 2BVLA 1G8XA 5LG4A 3O9XA 3H37A 4PNIA 1IJ6A 3WI3A 2X0LB 4CQIA 3BQIA 5CB4E 1HG5A 4AKHA 1V9DA 2D2SA 4CXYA 5F8PA 1MMNA 4H9RC 2K9AA 3IBPA 2X9WA 2UXXB 3AA0B 3KV4A 5JRCB 3D0TA 3HKEE 3GWHA 3CQGB 3AA6B 4XZCA 2VKOA 4UXNB 2H7OA 5IYZE 3PUQA 3RRWA 4MFRA 2C5KT 1HX8A 2HPLA 3LK3B 3P7IA 4EYUA 3EDUA 2C5IT 1FMVA 3ZMVB 3LFMA 4DO0A 4O2BE 2RA1A 4OK0A 2LEHA 5BMVE 1MMGA 1ZEEA 2ZMAA 4L0RA 4BJNA 3RYCE 1BR1A 4EXTA 4H63H 3KVBA 5JDLA 3S4UA 2X67A 2RP4A 4TZ4C 4MLKA 3E22E 4ZS3A 2WSSV 4O4JE 3LG7A 5FXVA 3VKHA 2XTLA 2E9XC 2H3RA 3OYZA 2CEAA 1Z0PA 4OYKA 5FXXA 4DVDA 4JEUB 2LOSA 4M1PA 2SPCA 2LHNA 5JVDE 3JC6C 4O2AE 2V7JA 4UVBB 2UXNB 2ES0A 3C98B 4JLEA 5EZYE 3PTRB 5HWXA 5DJQC 3FXEB 2VL8A 3C4ZA 4DBRA 5J2UE 3WAJA 5CA0E 3KV6A 2Z6EA 3ZN0B 3CPZA 1HF8A 2CXDA 5A1LA 5LGTB 3AA7B 5L3CB 3EVYA 5HXHA 2HPJA 3AVRA 5HXSA 1H7CA 3KBTA 2V7KA 1IAPA 2Q9QA 3FBLA 2WM9A 3GN5B 3DJBA 3GN5A 5FP3A 2WBLA 4AXPA 3IF8B 4IE6A 5ETWA 2DWKA 4ANJA 4IDZA 4P0AA 3OJAA 1G73A 3NRYA 4XAXB 2N9DA 3U78A 4UVAB 4GYSA 4I50E 3N9MA 1LVKA 4H63V 3QC9A 5FXWA 3ZEFB 3AVSA 5JDQA 5JH7E 3N9OA 1YKHB 2ODUA 2W00A 1D1AA 1D0ZA 3Q5XA 3ZC1A 3HA4A 3CQCB 2XAFB 1HS7A 4IGUA 3AAAB 3UTKA 5LHIB 4GK5E 4IIJE 4AQGA 2E9XA 3QK6A 1O3XA 4P09A 3OKQA 4TUYE 4EIWA 5LXTE 1MNDA 5HWYA 3CMLA 4OHFA 4QWNB 2I59A 4E7ZA 1S35A 4G2AA 4IE0A 4NUUA 2ZM8A 3N9NA 2N1GA 2ZLYA 4X1KE 3PUAA 5TAOA 3F2EA 3MJXA 3O1JA 4CI1B 4U74A 4CI2B 3Q5WA 3O1HA 3ZJ1A 1D0YA 4J2CA 3BK9A 1S94A 3PU3A 4QKNA 4EYYR 1VRBA 3CWZB 3N2GE 5IHYA 5KDMC 1QSDA 5H6QB 2WAUA 4ISSA 3QUJA 3V5SA 5M4YA 2GK9A 2NP9A 4ISTA 5AFUL 3ZMZB 5E0OA 2NW9A 4BJMA 1OWAA 5KMGP 5FY1A 5EK3A 3EUHA 2Q9QD 5L3GB 1D0XA 4F6RC 2G0UA 1HTJF 3CX7B 4JEHB 4O4HE 4V1Av 3ZYLA 4K0UA 3ONXA 1EZ3A 3VHLA 2H7VC 3C64A 5JREA 4H9QC 5JRCA 2JMKA 3I9WA 4MBQA 2C0SA 4QHOA 5EK4A 3WAKA 3SOLA 3ZCJA 2LE8A 5LHGB 4O8SA 2IC9A 4AKLA 5LBMA 3I0QA 4C91A 1SA0E 3I9YA 2QA7A 3ZLIA 3SWHA 5LBQB 3HI2A 4X1IE 5LHHB 4TV8E 2E8IA 3FHNA 4G63A 4ZS2A 1MIYA 3UUXB 4GK0E 2QGSA 4EAHA 2XASB 5HXRA 3LK42 2E9XD 4I4TE 3KV9A 4DNDA 3PUSA 5JDHA 1ZKEA 2KWHA 3I0OA 3O1IA 3SRZA 2OA5A 4ASKA 1D1CA 4FJOA 2VKDA 1WLXA 1BR0A 4PK6A 4DBQA 5J2TE 2NW7A 2LOPA 3ZMUB 5CA1E 4CZZB 1AJ3A 3UUMA 4TX5A 4ZI3D 3ZC0A 5J1GA 2XAGB 3K3NA 5DQWA 3U3IA 2CXLA 3ZJ2A 2YINA 4E7SA 5LGUB 3OBVE 2KWIB 4YHJA 2KLQA 4O4IE 1HG2A 5ADXL 2Y8DA 5FYMA 3ZMTB 5GONE 4WNKA 2X9XA 4X1YE 4PK4A 1KNZA 2JJ9A 4ZOLE 2XAHB 3N9PA 4Z8XA 5H6RB 1LVFA 1UX5A 4ZI2D 4HFVA 3PUGA 4C90A 2KMFA 5FXZA 3BQKA 2BDEA 4FI5A 4EZHA 2CM0A 3TKLB 2YU1A 1E1HB 5JDGA 2CE7A 4A56A 2JPFA 4AI6A 4AQFC 1MIVA 5L3DB 4UIGA 4YLHA 5LNKA 4I43B 4X20E 5L3BB 1UCUA 2LSYA 3UUNA 4H9PC 5L3EB 3LK2B 5JDMA 5JDNA 2X9YA 5FY0A 2J1DG 2IW5B 1YKEB 1BR2A 4CXXA 5JR9C 5L2LA 3C51A 2BVMA 3KBUA 2YU2A 2XUEA 3N2KE 4ADZA 2IC6A 2WMOA 4TN7B 4OFZA 3W15B 1BR4A 4GYRA 4QXBB 4QXCB 1FMWA 3RC3A 4PK5A 3F57A 3ZYMA 4NUVA 2DHRA 2LHRA 4PFPA 2DNXA 3C50A 4N78D 2PJQA 2L8KA 4U72A 5HAXA 3J9X1 4L5GA 3T8OA 2LSKA 2NTXA 2V7LA 5LJNA 3J7Yq 2JRKA 2A3DA 1MIWA 3M65A 3N5LA 2JMHA 4MALA 4JUYA 2NW8A 1SHZC 2YK0A 3BQLA 4QX8B 3IEEA 2A72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D5U A;  4P09 A;  4JUY A;  4OYJ A;  5LJM A;  4P0A A;  2HPJ A;  4P0B A;  5LJN A;  2CCQ A;  4OYK A;  2CM0 A;  2HPL A; 
#chains in the Genus database with same CATH topology
 3HR0 A;  2E5L T;  5AQM B;  3OVU A;  2XAQ B;  1OED A;  3NBX X;  3KVA A;  3RH3 A;  2D9D A;  3ANW B;  2Y48 B;  1US7 B;  5L3F B;  2NR4 A;  3Q9D A;  3CVR A;  3SFD A;  4LF8 T;  3NZP A;  2FJE A;  3RX6 A;  2BG9 A;  3IA3 A;  1UX4 A;  4WYV A;  3VR8 A;  2VKJ A;  3MZK B;  5JR9 B;  4HWF A;  1FIO A;  3ZCI A;  5HXC A;  2BZB A;  3PUY F;  4CXW A;  5HEH A;  4LFC T;  2K24 A;  4PW8 A;  5CFB A;  1HNX T;  3ZYK A;  4COF A;  3LSV A;  2LSI A;  4DR5 T;  1X79 A;  2X0H A;  2CCQ A;  1MNE A;  5FVK A;  2A2F X;  5AQV B;  2W61 A;  2LSJ A;  5LA6 E;  2FJA A;  2EHO B;  2LT3 A;  3H3A A;  4I55 E;  2J47 A;  4PJN A;  3LJC A;  1QLB A;  4PFO A;  3ZPO A;  2Y6X A;  4ZI7 E;  4ERR A;  4B3S T;  4LFB T;  2K48 A;  2MTQ A;  4ILA A;  3FZH B;  3HKD E;  3RC8 A;  4IT4 A;  1WR6 A;  5DQV A;  4DMW A;  5AQO B;  3N9Q A;  1SUM B;  1KEY A;  2Q9Q B;  3ETV A;  4DV2 T;  1Y64 B;  2UXB T;  2DI4 A;  1B7T A;  2IHR 1;  3P8C D;  2W63 A;  3AE1 A;  2X68 A;  3V5U A;  2L3L A;  4ZI2 C;  4XBF B;  3CX8 B;  3FXD B;  1JNR A;  2PTF A;  2LSG A;  3CKD A;  4L9I A;  4ZHQ E;  3AEE A;  5LP6 E;  4WBN E;  4WZX A;  2ODV A;  2NOX A;  2ZM0 A;  3KIN B;  4H9N C;  5KX5 E;  3HL6 A;  4YT0 A;  1QUU A;  3C4X A;  3P4R A;  3OPC A;  2MAW A;  5AQL B;  2IIU A;  5LMN T;  3MA9 A;  4HGA A;  3FZK B;  4U2Z A;  4TWH A;  3LBX A;  1I94 T;  2XQ6 A;  1V9D A;  3JAD A;  5F8P A;  4TNW A;  1MMN A;  4B3T T;  2K9A A;  3RQW A;  3HKE E;  4DID B;  3CQG B;  4XZC A;  4UXN B;  2H7O A;  3RRW A;  1HX8 A;  3PUZ F;  2C5I T;  4X5T A;  3LFM A;  4O2B E;  1E7P A;  3UU5 A;  2ZMA A;  4DV6 T;  3RYC E;  2MPK A;  3P4S A;  5JDL A;  2X67 A;  4MLK A;  3RLF F;  4ZS3 A;  4O4J E;  3LG7 A;  5FXV A;  2XTL A;  5ABG A;  2CEA A;  4DVD A;  4M1P A;  5JVD E;  3JC6 C;  4O2A E;  3AEA A;  2V7J A;  3C98 B;  3PTR B;  3ZT7 A;  3FXE B;  5CA0 E;  3KV6 A;  1CHU A;  5AQF B;  3TLS A;  5L3C B;  5HXS A;  1H7C A;  2V7K A;  1IAP A;  2JQ9 A;  2XQ8 A;  3FBL A;  3GN5 A;  2WS3 A;  1W09 A;  4P0A A;  3OJA A;  1G73 A;  3NRY A;  3U78 A;  4UVA B;  1LVK A;  4H63 V;  5LB7 B;  4DR1 T;  1YKH B;  1D0Z A;  3Q5X A;  5JTG A;  4AQG A;  2E9X A;  3OKQ A;  5LXT E;  5HEG A;  4OHF A;  4E7Z A;  4JI5 T;  4IE0 A;  3EI0 A;  4HWH A;  2ZLY A;  4CI2 B;  1OED B;  3ZJ1 A;  4J2C A;  4IDP A;  3AEC A;  1QSD A;  4NXM T;  2WAU A;  1XDO A;  3AE2 A;  4ISS A;  3RI5 A;  3V5S A;  4LMJ A;  3A7M A;  5LMU T;  2Q9Q D;  3UU8 A;  1HTJ F;  1EZ3 A;  4H9Q C;  2C0S A;  5EK4 A;  5LHG B;  4DV3 T;  4LF9 T;  3I9Y A;  1XNQ T;  4X1I E;  4EAH A;  5HXR A;  4JYA T;  5JDH A;  3I0O A;  5BR8 T;  3SRZ A;  3PJA A;  4DBQ A;  1AJ3 A;  3ZT6 A;  3K3N A;  5DQW A;  2VQF T;  2CXL A;  2IUB A;  2FJD A;  2R6G F;  2KLQ A;  4O4I E;  4HWI B;  4JI1 T;  4WNK A;  4X1Y E;  4PK4 A;  1OED C;  2JJ9 A;  5H6R B;  1UX5 A;  3AEB A;  2BDE A;  4FI5 A;  3TKL B;  2YU1 A;  5JDG A;  2XY8 B;  4A56 A;  5L3D B;  4UIG A;  2CPT A;  2BG9 C;  3JCF A;  5L3E B;  5JDM A;  5JDN A;  1YKE B;  2XUE A;  3TLU A;  2UUB T;  4GYR A;  4QXC B;  3RC3 A;  3ZYM A;  4NUV A;  3C50 A;  2PJQ A;  2L8K A;  5IWA T;  2V7L A;  2JRK A;  1MIW A;  2YKS A;  3BQL A;  1XMQ T;  3IEE A;  4AKR B;  1IBK T;  3IHR A;  2W66 A;  5KXJ A;  1WRD A;  2LJL A;  1YW0 A;  4HWC A;  2V7M A;  2WWU A;  1IZN B;  3RYF E;  3ZSS A;  3L09 A;  5FL0 A;  3K8P C;  1LRZ A;  2VAS A;  3FZL B;  4UEL A;  3LBX B;  3HKC E;  3VKG A;  1XDP A;  2XQY A;  3CK6 A;  3L39 A;  4X64 T;  4NXN T;  4HN9 A;  5LOV E;  4QH5 A;  4AKI A;  2W67 A;  1L0V A;  5LGN B;  3CQX C;  3PE0 A;  3PUX F;  2KT9 A;  2C5J A;  2LM2 A;  2BKO A;  3NZQ A;  3C4W A;  1U4Q A;  2L9Q A;  4H9S E;  4YFS A;  5AQS B;  3JAE A;  2N2N A;  4MHC A;  4Q25 A;  1KK7 A;  4YJ3 E;  4IDQ A;  3AAI A;  4YSX A;  1WFD A;  3FB2 A;  4B6X A;  1OED E;  1M62 A;  2WZI A;  2W2U A;  4AIS A;  3MXZ A;  4NPP A;  4NIQ A;  2K5B B;  4LMK A;  3PDY A;  5C2T A;  2BG9 E;  2ZM6 T;  1J5W A;  3RYH E;  1U5P A;  3MAC A;  2D0U A;  5FMN A;  4TV9 E;  5F5W A;  4YTM A;  4KUM B;  3K3O A;  3Q5E A;  4DUZ T;  2VK9 A;  2V1D B;  2CMR A;  3GA8 A;  5LYJ E;  1ZOY A;  3A5X A;  2D0T A;  2X66 A;  1MMD A;  4KP3 C;  1IJ5 A;  5AQG B;  3RQU A;  2E9X B;  2BBH A;  3QB5 A;  1T98 A;  2P9B A;  3B13 A;  1WYC A;  3EDV A;  2D5U A;  4PAG A;  2X51 A;  1T72 A;  1W0A A;  4PJL A;  1NWM X;  2W0G A;  2W62 A;  2KIN B;  2XQ7 A;  2HHH T;  2WQY A;  4JI4 T;  2UXC T;  4Z90 A;  1G8X A;  3AEF A;  5LG4 A;  4HFI A;  3FZF B;  4PNI A;  1IJ6 A;  2J62 A;  5CB4 E;  1HG5 A;  3IBP A;  3KV4 A;  1IBM T;  3GWH A;  2VKO A;  2QRX A;  5IYZ E;  2YDS A;  2HPL A;  4YSY A;  4EYU A;  3P7I A;  4DV5 T;  3ZMV B;  4DO0 A;  2LEH A;  5BMV E;  4CN4 A;  1WCR A;  4EXT A;  4H63 H;  3KVB A;  1E2A A;  4JI7 T;  5AQQ B;  2A9U A;  2E9X C;  5FXX A;  1Z0P A;  4LML A;  2LOS A;  3SFE A;  2WDQ A;  4UVB B;  2UXN B;  4JLE A;  2V6Y A;  4HFE A;  5AQT B;  4IL4 A;  5AQK B;  1T7S A;  2CXD A;  2QYW A;  2YDQ A;  3EVY A;  1YQ4 A;  2BKN A;  1N33 T;  3AVR A;  4DR6 T;  2WM9 A;  5FP3 A;  3IF8 B;  3A8Y C;  4IE6 A;  5ABF A;  4A97 A;  2LLY A;  4XAX B;  4GYS A;  4I50 E;  2YN6 A;  5FXW A;  3ZEF B;  5JDQ A;  4DV4 T;  4A5X A;  3ZC1 A;  1WR0 A;  5LHI B;  3QK6 A;  4TUY E;  4EIW A;  3CML A;  4JBW F;  1NEK A;  4NUU A;  4YY3 T;  4X1K E;  3PUA A;  3MJX A;  3O1J A;  3Q5W A;  2IDO B;  1D0Y A;  3BK9 A;  4JV5 T;  4QKN A;  3CWZ B;  3N2G E;  4DR7 T;  5KDM C;  3QUJ A;  5M4Y A;  5AFU L;  2NP9 A;  2XQ4 A;  1XZY A;  5E0O A;  1OWA A;  5KMG P;  4DV7 T;  5FY1 A;  4ILB A;  5L3G B;  4JEH B;  3P4Q A;  2H7V C;  3C64 A;  5JRE A;  3I9W A;  3WAK A;  5AQP B;  4O8S A;  2IC9 A;  3I0Q A;  4C91 A;  2QA7 A;  5LBQ B;  5LHH B;  2E8I A;  3LDQ B;  2VL0 A;  2E9X D;  3O1I A;  2AXD S;  3X1D A;  4FJO A;  2VKD A;  5L4H A;  2NW7 A;  5CA1 E;  4CZZ B;  5J1G A;  3OBV E;  2KWI B;  1HNZ T;  5ADX L;  3ZMT B;  1UK5 A;  2X9X A;  4IDN A;  1KNR A;  1KNZ A;  3B5M A;  3N9P A;  1LVF A;  4ZI2 D;  4HFV A;  2XSB A;  3PUG A;  2CRB A;  1E1H B;  3NWI A;  3AE4 A;  3Q5D A;  3AXJ A;  3H3M A;  5FY0 A;  1BR2 A;  5L2L A;  3C51 A;  2VUR A;  4TN7 B;  1XNR T;  2V8S V;  4LF6 T;  4QXB B;  2KSR A;  3RGL A;  4PFP A;  3J9X 1;  3T8O A;  2LSK A;  2XQ3 A;  4HFB A;  4MAL A;  2BS2 A;  2NW8 A;  1SHZ C;  4QX8 B;  2LRK A;  4QWN B;  1T8B A;  3KV5 A;  2MYS A;  5JQG E;  4O4L E;  3AB3 B;  4PJJ A;  4LF5 T;  1NAF A;  5FNV E;  4WBO A;  3RIF A;  4EEB A;  2PG8 A;  4JI2 T;  2X9H A;  2BG9 B;  2DWG A;  5LJM A;  1D1B A;  4AIU A;  4CN1 A;  5L4E A;  1HCI A;  4PJM A;  3ZMS B;  3E0Z A;  1YD8 G;  3PV0 F;  4IE4 A;  5HCM A;  4GKK T;  4HE8 A;  2PFV A;  4YJ2 E;  3Q2M A;  2NWB A;  4HFC A;  4TWD A;  4IHJ E;  2YEV C;  3JC6 D;  2NTY A;  3R84 B;  3L8R A;  3ZT5 A;  4IE5 A;  4HEA A;  2EHO A;  3RIA A;  4UEM A;  5AQU B;  1Z8U A;  2CLY C;  4JI6 T;  2VKH A;  2F4V T;  2JQK A;  1HFA A;  3FZM B;  5C8Y E;  4IL9 A;  3ESL A;  2V6X A;  1IBL T;  2V6Y B;  2H88 A;  2AE9 A;  4ZI3 C;  3CX6 B;  3AEG A;  1ZHC A;  4EB6 E;  2M67 A;  4DMV A;  2KND A;  3PUR A;  2VB6 A;  3NRX A;  3O4X E;  2IAK A;  2M6I A;  5ABF B;  3T1H T;  2KZ7 B;  2BKP A;  5L47 A;  4DR3 T;  2PBI A;  2CWO A;  5FL1 A;  3SS1 A;  3ETU A;  4B3M T;  2B1E A;  5LCY A;  2VQE T;  1ZV4 X;  2V26 A;  4UF0 A;  1XMO T;  5HXE A;  3DP7 A;  5DAB A;  4HKA A;  1CUN A;  4CI3 B;  3RYI E;  3AE5 A;  3PUW F;  3B57 A;  2FUP A;  4QXH B;  3RKO A;  4KHP T;  3I1A A;  3UFE A;  1VOM A;  3O9X A;  3H37 A;  2X0L B;  3BQI A;  2V5D A;  4GKJ T;  4H9R C;  2X9W A;  2UXX B;  3AA0 B;  3D0T A;  2DL1 A;  3AA6 B;  1FJG T;  3PUQ A;  4OX9 T;  4MFR A;  2C5K T;  3EDU A;  2WZH A;  1FMV A;  2BS3 A;  3AE8 A;  2WP9 A;  2XM1 A;  1W0B A;  3RF1 A;  2RA1 A;  4OK0 A;  1BR1 A;  4TZ4 C;  4ZZC A;  3PUV F;  3NKZ A;  2WSS V;  3VKH A;  3OYZ A;  4JEU B;  2ES0 A;  5HWX A;  2VL8 A;  4DV0 T;  2Z6E A;  3ZN0 B;  2RPA A;  3CPZ A;  1HF8 A;  3T1Y T;  5A1L A;  5LGT B;  3AED A;  2CHO A;  2UUC T;  2CBJ A;  5HXH A;  2I0M A;  3GN5 B;  4AXP A;  2DWK A;  3AXJ B;  4K0K T;  2WCA A;  3N9M A;  3N9O A;  2ODU A;  1D1A A;  2WDV A;  2XAF B;  4IGU A;  3AAA B;  3UTK A;  4IIJ E;  1R8I A;  1O3X A;  3UU6 A;  2BS4 A;  4U3C A;  5HWY A;  2XPK A;  3N9N A;  3ZKR A;  2N1G A;  1N34 T;  2W4X A;  5TAO A;  3F2E A;  4U74 A;  3O1H A;  3M3Z B;  4YTP A;  1S94 A;  1UUS A;  4EYY R;  1ZP0 A;  4HWD A;  2WU2 A;  2GK9 A;  4IST A;  4UR9 A;  3ZMZ B;  4BJM A;  5EK3 A;  3EUH A;  1D0X A;  4F6R C;  2G0U A;  3CX7 B;  4O4H E;  4V1A v;  2XQ5 A;  3ZYL A;  4K0U A;  2J4G A;  2WWV A;  3VHL A;  5JRC A;  2JMK A;  4MBQ A;  4QHO A;  3ZCJ A;  1Y01 A;  2LE8 A;  5LBM A;  3HI2 A;  4TV8 E;  3FHN A;  1MIY A;  3UUX B;  2XQA A;  4GK0 E;  2QGS A;  2XAS B;  4I4T E;  4DND A;  3PUS A;  2KWH A;  4AQY T;  4ASK A;  4Z91 A;  1WLX A;  2LOP A;  3ZC0 A;  2XAG B;  3U3I A;  3ZJ2 A;  2YIN A;  1HG2 A;  3CIR A;  5FYM A;  5GON E;  2HN2 A;  4ZEY A;  2IML A;  3K1S A;  1J5E T;  2XAH B;  3QNU A;  4C90 A;  2KMF A;  3TLT A;  2CM0 A;  2JPF A;  4HFD A;  4AI6 A;  1MIV A;  2WY2 A;  3UQ4 A;  4X20 E;  5L3B B;  2LSY A;  3UUN A;  3RIU C;  4H9P C;  4HFH A;  2J1D G;  5JR9 C;  4CXX A;  2BVM A;  2YU2 A;  2X0Y A;  3N2K E;  4ADZ A;  2IC6 A;  2WMO A;  3W15 B;  3F57 A;  4U7I A;  2LHR A;  2DNX A;  1X9B A;  4N78 D;  2OV9 A;  5LJN A;  1UUR A;  2XJ7 A;  2A3D A;  3M65 A;  3N5L A;  2JMH A;  5HEU A;  5HCJ A;  4LF7 T;  1UGO A;  2M6B A;  3KDS E;  3RPU A;  2CWY A;  4GIW A;  3VU7 H;  5C3J A;  3NVO A;  4UF0 B;  4QH1 A;  2V7I A;  4X65 T;  3DTO A;  2EHO C;  2JQH A;  5F3J A;  4EZ4 A;  1MMA A;  4AQF A;  4AKG A;  2WMN A;  4UV8 B;  1DU2 A;  3E08 A;  3PU8 A;  3MK7 C;  4KHZ F;  4KBM B;  3P4W A;  4QH4 A;  4IE7 A;  3ZN1 B;  5AQI B;  2XAJ B;  1W9R A;  3P4P A;  4DV1 T;  3F31 A;  4EGW A;  4JI3 T;  2YOE A;  4EV6 A;  5LG3 A;  4P0B A;  4H9O C;  3AE6 A;  4UVC B;  2Q9Q C;  1OXZ A;  2VWA A;  1KFY A;  5J0Z A;  3RKG A;  2V5C A;  1GQE A;  3L3P A;  4ZZB A;  1FEW A;  2CA5 A;  2WB5 A;  3UT5 E;  4EOZ B;  5AQH B;  2CHN A;  3R6N A;  3HKB E;  5HYA A;  4QX7 B;  3EAM A;  2DCF A;  4YTN A;  1KF6 A;  3TLW A;  4JI0 T;  2FJB A;  5EK2 A;  3GMI A;  2HH7 A;  4YXD A;  4BA9 A;  3ONJ A;  4ILU A;  2UU9 T;  2MBG A;  4GOU A;  3K3Q C;  1HX1 B;  2MOZ A;  2B76 A;  2LM9 A;  3RRC A;  3RHW A;  3N9L A;  2XHE B;  4BAY B;  5AQJ B;  3AE3 A;  3MKD A;  3OYX A;  2VVS A;  2CXF A;  4OYJ A;  1J1J A;  2CLY B;  2EHO D;  2ZM2 A;  5ABE A;  5HEO A;  5CJ5 A;  3KFW X;  1VCT A;  4HTE A;  3UU3 A;  3QOF A;  4UV9 B;  5JDF A;  3ANW A;  2JQQ A;  5FY7 A;  1SE7 A;  4LF4 T;  2YDR A;  5AQR B;  1LKX A;  3AA1 B;  3AAE B;  4EED A;  4IDO A;  2KXP B;  3N2O A;  3RIU A;  4LFA T;  2DLR A;  2ACX A;  3VRB A;  3UUL A;  4DUY T;  1HR0 T;  3FBZ A;  5JR9 A;  1WYB A;  4KMC A;  1XWM A;  4WW0 A;  2BVL A;  4IRE A;  4U7Y A;  2I6H A;  3WI3 A;  4CQI A;  3UQ7 A;  4AKH A;  2OLT A;  2D2S A;  4CXY A;  1I6Z A;  5JRC B;  1YXR A;  3TLV A;  3EAB A;  2K3W A;  2FBW A;  3LK3 B;  4KI0 F;  3UUB A;  1MMG A;  1ZEE A;  4L0R A;  1KNP A;  4BJN A;  3S4U A;  2RP4 A;  2XZE A;  3E22 E;  5CGM A;  1YQ3 A;  2H3R A;  4OYK A;  4DR2 T;  2SPC A;  2LHN A;  5EZY E;  2WU5 A;  4JI8 T;  4ILC A;  5DJQ C;  2UUA T;  4KX6 A;  3C4Z A;  4DBR A;  5J2U E;  3WAJ A;  4TWF A;  3AA7 B;  4F8H A;  3VRA A;  5HEJ A;  3ABV A;  3EHZ A;  2HPJ A;  3KBT A;  2Q9Q A;  3DJB A;  2WBL A;  4X62 T;  5ETW A;  4U33 A;  4ANJ A;  4IDZ A;  2N9D A;  3QC9 A;  5ABH A;  5IUX A;  3AVS A;  5JH7 E;  4A98 A;  2W00 A;  3HA4 A;  3CQC B;  1HS7 A;  3AE9 A;  2XSA A;  4GK5 E;  2HN1 A;  4P09 A;  4ZXL A;  3QB5 K;  1MND A;  2I59 A;  1S35 A;  4G2A A;  1M7K A;  2UXD T;  2JIW A;  2ZM8 A;  4CI1 B;  2LKG A;  3G06 A;  5AQN B;  2LKH A;  3PU3 A;  1VRB A;  5IHY A;  5H6Q B;  2CBI A;  2XM2 A;  4DR4 T;  2BBJ A;  4TNV A;  2NW9 A;  1N32 T;  4B3R T;  3ONX A;  3ZST A;  4I0U A;  1N36 T;  3SOL A;  1NEN A;  4AKL A;  4U31 A;  1SA0 E;  3ZLI A;  3SWH A;  3P50 A;  3ONL C;  4ZS2 A;  4G63 A;  3LK4 2;  3KV9 A;  1ZKE A;  2OA5 A;  2E5V A;  1D1C A;  1BR0 A;  4PK6 A;  5J2T E;  3ZMU B;  4YSZ A;  1VCS A;  3UUM A;  4TX5 A;  4ZI3 D;  2VVN A;  3UU4 A;  4YHH T;  4E7S A;  4YHJ A;  2XQ9 A;  2Y8D A;  2LRL A;  5FKY A;  3PJA J;  3JAF A;  4ZOL E;  2WDR A;  4Z8X A;  2QVA A;  1HNW T;  4U2Y A;  5FXZ A;  3BQK A;  3UFG A;  4EZH A;  4X66 T;  3AE7 A;  2CE7 A;  3VR9 A;  4AQF C;  4YLH A;  1JNZ A;  5LNK A;  2E2A A;  4I43 B;  3OTO T;  2H89 A;  1UCU A;  2ACZ A;  3LK2 B;  2X9Y A;  2IW5 B;  3KBU A;  4P1N A;  4OFZ A;  1BR4 A;  1FMW A;  4PK5 A;  2DHR A;  4U72 A;  5HAX A;  4L5G A;  2NTX A;  3J7Y q;  4CN6 A;  4JUY A;  2YK0 A;  5LGU B;  2A72 A;  5FVL A; 
#chains in the Genus database with same CATH homology
 3KDS E;  4AKR B;  3HR0 A;  3KV5 A;  2MYS A;  3RPU A;  2XAQ B;  3IHR A;  2CWY A;  4GIW A;  3NBX X;  3VU7 H;  5JQG E;  3KVA A;  4O4L E;  3RH3 A;  3AB3 B;  4PJJ A;  4UF0 B;  1WRD A;  3ANW B;  1NAF A;  2LJL A;  5FNV E;  2V7I A;  3DTO A;  2Y48 B;  4WBO A;  1YW0 A;  2V7M A;  1US7 B;  5L3F B;  2WWU A;  2EHO C;  5F3J A;  1IZN B;  2PG8 A;  4EZ4 A;  1MMA A;  3Q9D A;  3CVR A;  2X9H A;  3NZP A;  4AQF A;  4AKG A;  2WMN A;  3RYF E;  3RX6 A;  4UV8 B;  3E08 A;  3L09 A;  3PU8 A;  3MK7 C;  1UX4 A;  3K8P C;  2DWG A;  5LJM A;  1D1B A;  2VKJ A;  3MZK B;  5JR9 B;  1LRZ A;  2VAS A;  4KBM B;  1FIO A;  4UEL A;  3ZCI A;  3LBX B;  5HXC A;  3HKC E;  3VKG A;  2BZB A;  2XQY A;  1HCI A;  4CXW A;  4IE7 A;  3ZN1 B;  4PJM A;  3ZMS B;  2K24 A;  2XAJ B;  4PW8 A;  3E0Z A;  1YD8 G;  4IE4 A;  4HN9 A;  5LOV E;  3ZYK A;  4HE8 A;  3F31 A;  2PFV A;  4YJ2 E;  3Q2M A;  2NWB A;  4AKI A;  5LGN B;  3CQX C;  2LSI A;  3PE0 A;  4IHJ E;  2YEV C;  4P0B A;  1X79 A;  3JC6 D;  4H9O C;  2CCQ A;  2KT9 A;  1MNE A;  2C5J A;  2NTY A;  2A2F X;  4UVC B;  2Q9Q C;  3R84 B;  3NZQ A;  1OXZ A;  3C4W A;  1U4Q A;  2L9Q A;  2W61 A;  2VWA A;  2LSJ A;  4H9S E;  4YFS A;  4IE5 A;  4HEA A;  5LA6 E;  2EHO B;  2EHO A;  2LT3 A;  4UEM A;  3H3A A;  2N2N A;  3L3P A;  4I55 E;  1FEW A;  2CA5 A;  4MHC A;  3UT5 E;  4EOZ B;  4PJN A;  1KK7 A;  2CLY C;  2VKH A;  4YJ3 E;  3HKB E;  3R6N A;  5HYA A;  3LJC A;  4QX7 B;  3AAI A;  2DCF A;  4PFO A;  1HFA A;  3FB2 A;  4B6X A;  3ZPO A;  5C8Y E;  5EK2 A;  2Y6X A;  3GMI A;  4ZI7 E;  2HH7 A;  4ERR A;  3ESL A;  4BA9 A;  4ILU A;  2K48 A;  2MTQ A;  2MBG A;  3MXZ A;  4GOU A;  2K5B B;  3K3Q C;  4ZI3 C;  3HKD E;  2MOZ A;  3RC8 A;  3CX6 B;  3PDY A;  1WR6 A;  3RYH E;  5DQV A;  4DMW A;  2LM9 A;  1U5P A;  3RRC A;  1ZHC A;  4EB6 E;  2M67 A;  3N9Q A;  3N9L A;  4DMV A;  2KND A;  3PUR A;  2Q9Q B;  2VB6 A;  2XHE B;  3MAC A;  3NRX A;  3ETV A;  4BAY B;  1Y64 B;  2D0U A;  3O4X E;  5FMN A;  2IAK A;  2DI4 A;  4TV9 E;  1B7T A;  3P8C D;  2W63 A;  2X68 A;  2KZ7 B;  3V5U A;  3MKD A;  4KUM B;  3OYX A;  2L3L A;  3K3O A;  2CXF A;  2PBI A;  4OYJ A;  4ZI2 C;  4XBF B;  3CX8 B;  3FXD B;  2VK9 A;  2CWO A;  2CLY B;  3SS1 A;  2V1D B;  2CMR A;  2EHO D;  2ZM2 A;  3ETU A;  3GA8 A;  5LYJ E;  2LSG A;  3CKD A;  4L9I A;  2B1E A;  4ZHQ E;  3KFW X;  5LP6 E;  5LCY A;  4HTE A;  1ZV4 X;  2V26 A;  4WBN E;  3A5X A;  2D0T A;  2X66 A;  4UV9 B;  2ODV A;  5JDF A;  1MMD A;  4KP3 C;  1IJ5 A;  4UF0 A;  3ANW A;  5HXE A;  2E9X B;  3DP7 A;  5DAB A;  2JQQ A;  2NOX A;  4HKA A;  5FY7 A;  1CUN A;  1T98 A;  4CI3 B;  3RYI E;  2ZM0 A;  3KIN B;  2P9B A;  3B13 A;  4H9N C;  5KX5 E;  3HL6 A;  1WYC A;  3EDV A;  2D5U A;  4PAG A;  1QUU A;  1LKX A;  2X51 A;  3AA1 B;  3AAE B;  3C4X A;  2KXP B;  4PJL A;  3B57 A;  1NWM X;  2W0G A;  3N2O A;  4QXH B;  3RKO A;  2DLR A;  2ACX A;  2W62 A;  2KIN B;  3I1A A;  3UUL A;  3FBZ A;  5JR9 A;  3MA9 A;  1VOM A;  1WYB A;  3UFE A;  4KMC A;  4HGA A;  4WW0 A;  3LBX A;  2BVL A;  1G8X A;  5LG4 A;  3O9X A;  3H37 A;  4PNI A;  1IJ6 A;  3WI3 A;  2X0L B;  4CQI A;  3BQI A;  5CB4 E;  1HG5 A;  4AKH A;  1V9D A;  2D2S A;  4CXY A;  5F8P A;  1MMN A;  4H9R C;  2K9A A;  3IBP A;  2X9W A;  2UXX B;  3AA0 B;  3KV4 A;  5JRC B;  3D0T A;  3HKE E;  3GWH A;  3CQG B;  3AA6 B;  4XZC A;  2VKO A;  4UXN B;  2H7O A;  5IYZ E;  3PUQ A;  3RRW A;  4MFR A;  2C5K T;  1HX8 A;  2HPL A;  3LK3 B;  3P7I A;  4EYU A;  3EDU A;  2C5I T;  1FMV A;  3ZMV B;  3LFM A;  4DO0 A;  4O2B E;  2RA1 A;  4OK0 A;  2LEH A;  5BMV E;  1MMG A;  1ZEE A;  2ZMA A;  4L0R A;  4BJN A;  3RYC E;  1BR1 A;  4EXT A;  4H63 H;  3KVB A;  5JDL A;  3S4U A;  2X67 A;  2RP4 A;  4TZ4 C;  4MLK A;  3E22 E;  4ZS3 A;  2WSS V;  4O4J E;  3LG7 A;  5FXV A;  3VKH A;  2XTL A;  2E9X C;  2H3R A;  3OYZ A;  2CEA A;  1Z0P A;  4OYK A;  5FXX A;  4DVD A;  4JEU B;  2LOS A;  4M1P A;  2SPC A;  2LHN A;  5JVD E;  3JC6 C;  4O2A E;  2V7J A;  4UVB B;  2UXN B;  2ES0 A;  3C98 B;  4JLE A;  5EZY E;  3PTR B;  5HWX A;  5DJQ C;  3FXE B;  2VL8 A;  3C4Z A;  4DBR A;  5J2U E;  3WAJ A;  5CA0 E;  3KV6 A;  2Z6E A;  3ZN0 B;  3CPZ A;  1HF8 A;  2CXD A;  5A1L A;  5LGT B;  3AA7 B;  5L3C B;  3EVY A;  5HXH A;  2HPJ A;  3AVR A;  5HXS A;  1H7C A;  3KBT A;  2V7K A;  1IAP A;  2Q9Q A;  3FBL A;  2WM9 A;  3GN5 B;  3DJB A;  3GN5 A;  5FP3 A;  2WBL A;  4AXP A;  3IF8 B;  4IE6 A;  5ETW A;  2DWK A;  4ANJ A;  4IDZ A;  4P0A A;  3OJA A;  1G73 A;  3NRY A;  4XAX B;  2N9D A;  3U78 A;  4UVA B;  4GYS A;  4I50 E;  3N9M A;  1LVK A;  4H63 V;  3QC9 A;  5FXW A;  3ZEF B;  3AVS A;  5JDQ A;  5JH7 E;  3N9O A;  1YKH B;  2ODU A;  2W00 A;  1D1A A;  1D0Z A;  3Q5X A;  3ZC1 A;  3HA4 A;  3CQC B;  2XAF B;  1HS7 A;  4IGU A;  3AAA B;  3UTK A;  5LHI B;  4GK5 E;  4IIJ E;  4AQG A;  2E9X A;  3QK6 A;  1O3X A;  4P09 A;  3OKQ A;  4TUY E;  4EIW A;  5LXT E;  1MND A;  5HWY A;  3CML A;  4OHF A;  4QWN B;  2I59 A;  4E7Z A;  1S35 A;  4G2A A;  4IE0 A;  4NUU A;  2ZM8 A;  3N9N A;  2N1G A;  2ZLY A;  4X1K E;  3PUA A;  5TAO A;  3F2E A;  3MJX A;  3O1J A;  4CI1 B;  4U74 A;  4CI2 B;  3Q5W A;  3O1H A;  3ZJ1 A;  1D0Y A;  4J2C A;  3BK9 A;  1S94 A;  3PU3 A;  4QKN A;  4EYY R;  1VRB A;  3CWZ B;  3N2G E;  5IHY A;  5KDM C;  1QSD A;  5H6Q B;  2WAU A;  4ISS A;  3QUJ A;  3V5S A;  5M4Y A;  2GK9 A;  2NP9 A;  4IST A;  5AFU L;  3ZMZ B;  5E0O A;  2NW9 A;  4BJM A;  1OWA A;  5KMG P;  5FY1 A;  5EK3 A;  3EUH A;  2Q9Q D;  5L3G B;  1D0X A;  4F6R C;  2G0U A;  1HTJ F;  3CX7 B;  4JEH B;  4O4H E;  4V1A v;  3ZYL A;  4K0U A;  3ONX A;  1EZ3 A;  3VHL A;  2H7V C;  3C64 A;  5JRE A;  4H9Q C;  5JRC A;  2JMK A;  3I9W A;  4MBQ A;  2C0S A;  4QHO A;  5EK4 A;  3WAK A;  3SOL A;  3ZCJ A;  2LE8 A;  5LHG B;  4O8S A;  2IC9 A;  4AKL A;  5LBM A;  3I0Q A;  4C91 A;  1SA0 E;  3I9Y A;  2QA7 A;  3ZLI A;  3SWH A;  5LBQ B;  3HI2 A;  4X1I E;  5LHH B;  4TV8 E;  2E8I A;  3FHN A;  4G63 A;  4ZS2 A;  1MIY A;  3UUX B;  4GK0 E;  2QGS A;  4EAH A;  2XAS B;  5HXR A;  3LK4 2;  2E9X D;  4I4T E;  3KV9 A;  4DND A;  3PUS A;  5JDH A;  1ZKE A;  2KWH A;  3I0O A;  3O1I A;  3SRZ A;  2OA5 A;  4ASK A;  1D1C A;  4FJO A;  2VKD A;  1WLX A;  1BR0 A;  4PK6 A;  4DBQ A;  5J2T E;  2NW7 A;  2LOP A;  3ZMU B;  5CA1 E;  4CZZ B;  1AJ3 A;  3UUM A;  4TX5 A;  4ZI3 D;  3ZC0 A;  5J1G A;  2XAG B;  3K3N A;  5DQW A;  3U3I A;  2CXL A;  3ZJ2 A;  2YIN A;  4E7S A;  5LGU B;  3OBV E;  2KWI B;  4YHJ A;  2KLQ A;  4O4I E;  1HG2 A;  5ADX L;  2Y8D A;  5FYM A;  3ZMT B;  5GON E;  4WNK A;  2X9X A;  4X1Y E;  4PK4 A;  1KNZ A;  2JJ9 A;  4ZOL E;  2XAH B;  3N9P A;  4Z8X A;  5H6R B;  1LVF A;  1UX5 A;  4ZI2 D;  4HFV A;  3PUG A;  4C90 A;  2KMF A;  5FXZ A;  3BQK A;  2BDE A;  4FI5 A;  4EZH A;  2CM0 A;  3TKL B;  2YU1 A;  1E1H B;  5JDG A;  2CE7 A;  4A56 A;  2JPF A;  4AI6 A;  4AQF C;  1MIV A;  5L3D B;  4UIG A;  4YLH A;  5LNK A;  4I43 B;  4X20 E;  5L3B B;  1UCU A;  2LSY A;  3UUN A;  4H9P C;  5L3E B;  3LK2 B;  5JDM A;  5JDN A;  2X9Y A;  5FY0 A;  2J1D G;  2IW5 B;  1YKE B;  1BR2 A;  4CXX A;  5JR9 C;  5L2L A;  3C51 A;  2BVM A;  3KBU A;  2YU2 A;  2XUE A;  3N2K E;  4ADZ A;  2IC6 A;  2WMO A;  4TN7 B;  4OFZ A;  3W15 B;  1BR4 A;  4GYR A;  4QXB B;  4QXC B;  1FMW A;  3RC3 A;  4PK5 A;  3F57 A;  3ZYM A;  4NUV A;  2DHR A;  2LHR A;  4PFP A;  2DNX A;  3C50 A;  4N78 D;  2PJQ A;  2L8K A;  4U72 A;  5HAX A;  3J9X 1;  4L5G A;  3T8O A;  2LSK A;  2NTX A;  2V7L A;  5LJN A;  3J7Y q;  2JRK A;  2A3D A;  1MIW A;  3M65 A;  3N5L A;  2JMH A;  4MAL A;  4JUY A;  2NW8 A;  1SHZ C;  2YK0 A;  3BQL A;  4QX8 B;  3IEE A;  2A72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...