4OYKA

Structure of hoip pub domain bound to otulin pim
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
173
structure length
173
Chain Sequence
ERAFLVAREELASALRRDSGQAFSLEQLRPLLASSLPLAARYLQLDAARLVRCNAHGEPRNYLNTLSTALNILEKYGRNLLSPQRPRYWRGVKFNNPVFRSTVDAVQGGRDVLRLYGYTEEQPDGLSFPEGQEEPDEHQVATVTLEVLLLRTELSLLLQNTHPRQQALEQLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase RNF31
publication title Molecular Basis and Regulation of OTULIN-LUBAC Interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 54
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2014-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09409 PUB PUB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4oykA00
2HPLA 4P09A 2HPJA 4OYKA 4OYJA 2CCQA 2D5UA 4JUYA 5LJMA 4P0BA 4P0AA 5LJNA 2CM0A
chains in the Genus database with same CATH superfamily
3NKZA 1I94T 5H6QB 5AFUL 2YN6A 3RC8A 1WR6A 2OA5A 2C5JA 3GN5B 2X0LB 5AQJB 3ONJA 4XBFB 2C5KT 2I0MA 4TZ4C 4KBMB 2NP9A 4P09A 2V8SV 3LBXB 3O4XE 2X9YA 5FXZA 2NTXA 1WLXA 2H88A 5FL0A 2H3RA 1XWMA 1G73A 2OLTA 1KEYA 3AA0B 4MALA 4NUVA 2XAGB 4WYVA 3CX8B 4QXBB 4G2AA 2A3DA 2IHR1 3ZYMA 2C5IT 5FP3A 2E9XD 4H9OC 4NUUA 3NVOA 5TAOA 4AQFA 3O1HA 1B7TA 2WBLA 3AE6A 3Q5EA 2A2FX 4L0RA 4AQYT 5CB4E 2ZM6T 2ACZA 5KX5E 3Q5XA 5HCMA 5LP6E 2X66A 3C4WA 2BG9A 5AQTB 3SFDA 3V5UA 1KNZA 2H7VC 2PG8A 5FXXA 4TV9E 4HGAA 1WRDA 4O4HE 3WAJA 4DV5T 3EUHA 3PTRB 3ZKRA 2X51A 3LK2B 3Q5WA 2L3LA 5LGUB 4FI5A 2V5CA 2LJLA 4NIQA 5AQGB 4X64T 5FYMA 4IGUA 3TLTA 5KXJA 2YKSA 4YSZA 4LMJA 2WS3A 4IDQA 4JEHB 3EDUA 1HG5A 1OEDA 3OYXA 4UF0A 5J1GA 3RRCA 1EZ3A 3FXEB 3HKCE 3FXDB 1H7CA 3AE4A 3IBPA 5LGNB 2WQYA 2V7IA 2NW9A 4JBWF 4EB6E 5C3JA 3W15B 2M6IA 4CN1A 4UEMA 5LJMA 1D1BA 4KUMB 5LGTB 3P7IA 5JDFA 2VQET 3PUSA 2BG9E 2LSGA 3AE3A 2ODUA 4WBOA 5JR9A 4AQFC 3MZKB 2QGSA 1XMQT 2BKPA 2LSJA 2LRLA 2D2SA 4HFDA 1Z8UA 3KV9A 4JI1T 3CMLA 2ACXA 1KK7A 1W9RA 5HXRA 4KHZF 3A5XA 5LMUT 3ZYKA 2V6XA 3KV6A 2W4XA 3UU5A 4DBQA 2K24A 4OHFA 2V7KA 2CBIA 1HG2A 3MJXA 1MMNA 1OEDE 1YXRA 3PUAA 5L3GB 4ADZA 1JNZA 2LOSA 2D0TA 4MLKA 3ZMZB 4EXTA 2VURA 2MTQA 4HFBA 4OX9T 3ZEFB 2JQKA 3HKBE 2JMHA 3EHZA 4GIWA 1V9DA 3L3PA 3PURA 5CA0E 1FMWA 2XSBA 2LEHA 3K8PC 2DCFA 3X1DA 3I9YA 5J2UE 2WDQA 2VKHA 2BKNA 4AKIA 5LJNA 2XAJB 3RF1A 4P1NA 4O4LE 3F2EA 3QNUA 5FMNA 3CQCB 2E9XB 3JC6D 1T8BA 5L4HA 2VVSA 3AE7A 3BQLA 1UK5A 2CXLA 3B57A 3NBXX 4IL9A 4CQIA 2EHOC 4MHCA 3AXJB 2WCAA 5HXEA 5JR9C 3N9NA 3SWHA 3PU8A 5EK4A 4GKJT 3ZSTA 1J5WA 5EZYE 4IDOA 4NXMT 5AQLB 3HKDE 5DJQC 3N9PA 4UXNB 4EOZB 3P8CD 1HTJF 2DL1A 4U74A 5LMNT 2BVMA 3ZMTB 3OKQA 4WNKA 1VCTA 2HN1A 1HFAA 2PJQA 3ZJ2A 3ETVA 3PUGA 4HWFA 4YLHA 5HCJA 4BA9A 1U5PA 3RKGA 2KT9A 4TNWA 1OXZA 4PNIA 2IUBA 1FIOA 2G0UA 5FVKA 4UVCB 5H6RB 4HEAA 3L8RA 4JI6T 3AE1A 3C51A 5IWAT 3ETUA 2XQ9A 1XZYA 1SUMB 4QHOA 3ZT6A 2X68A 2ZM8A 3E08A 4IDPA 3SS1A 5DQVA 4DV4T 4KI0F 3N2OA 2XHEB 1DU2A 3UULA 1BR2A 3EVYA 2KLQA 1O3XA 2NOXA 3CQGB 3U78A 2RP4A 4YTPA 1IJ5A 5LCYA 4IREA 3S4UA 2ODVA 4HWCA 2SPCA 1Y64B 4X1IE 2N1GA 5HEUA 2VQFT 3UT5E 3RYHE 3KDSE 4DR4T 4B3TT 1WR0A 2YU2A 5HXHA 4CI2B 3UUXB 3PV0F 2W2UA 4EIWA 3VKHA 3B13A 4O2AE 4PFPA 3RIFA 3ABVA 4COFA 3ZPOA 3OJAA 4QXCB 2XM1A 2VVNA 5C2TA 4LF7T 1MMDA 3N2GE 2JRKA 1N34T 4TV8E 2ZM2A 2YDSA 3P4WA 3ZLIA 4I0UA 5KDMC 3R6NA 4ZI2D 2JQ9A 1Y01A 5HEHA 3Q9DA 3P4PA 2KMFA 4F8HA 4X20E 3K3OA 2VKDA 2E5VA 4LF4T 1CUNA 4JI0T 4ASKA 2V6YB 2HPJA 3U3IA 2BKOA 2YEVC 4ILBA 1X79A 3P50A 1Z0PA 5J0ZA 2JMKA 2CA5A 3FZHB 3PUVF 2MAWA 2VK9A 3MACA 3PUZF 2B76A 1D0YA 2NW7A 4YFSA 3RGLA 3N9LA 4P0AA 5JREA 1FJGT 2IIUA 3G06A 2XQ3A 5JDNA 1QSDA 2N2NA 4L9IA 2IDOB 1HNWT 4DMVA 1UURA 2I59A 3K3NA 3OPCA 2IW5B 2CBJA 4UVBB 1D1CA 4JI4T 2D5UA 4PK6A 1MNDA 4LF6T 3DP7A 5LA6E 4LFCT 4H9RC 3EI0A 1YD8G 2HHHT 2X9XA 3ZC0A 4OYJA 2CEAA 2BS4A 3JAEA 4B3RT 3DJBA 3PJAA 4EYUA 1W09A 4U2YA 3KV4A 5L3DB 2YINA 3C4ZA 3QC9A 4NPPA 2IC9A 3B5MA 3BQKA 1YQ4A 3QUJA 2VWAA 3T1YT 1ZHCA 2LKGA 3IF8B 3KFWX 4YTMA 2Y8DA 2X67A 4DV7T 3NZQA 3UU3A 3CX6B 3UTKA 5IHYA 2HN2A 3UUBA 3GA8A 3ZT7A 1NEKA 3NZPA 3BK9A 2JQHA 3UU6A 1ZEEA 5AQMB 2XSAA 4ZI3D 4DV1T 3EDVA 3FZFB 4CZZB 2CE7A 4CXXA 2BS3A 5ABFA 3LFMA 5JDQA 1XNRT 3PUWF 5ABEA 4C91A 4LFAT 2CHOA 4U7YA 5FXVA 5BR8T 3HR0A 4HWIB 4HFEA 3UQ4A 2AXDS 4J2CA 1N32T 3RKOA 2V7JA 2M67A 2XJ7A 5L2LA 3TKLB 4AKGA 2WB5A 4QH5A 5L47A 3HKEE 3KVBA 5GONE 4X1YE 2ES0A 5JQGE 1UX4A 2J1DG 4TWDA 3SFEA 2NTYA 3P4RA 3CVRA 4HWHA 4L5GA 4DUYT 2W00A 2W0GA 1CHUA 4GK5E 5L3FB 4EZ4A 2DWGA 4WZXA 2LHRA 4XZCA 3UQ7A 2FJDA 2WWUA 4HFHA 3LK42 4KP3C 4IE5A 5AQHB 2QA7A 4U33A 5LHHB 4X1KE 4PJMA 2BBJA 2EHOA 2QYWA 5L3BB 3AEAA 2XQ7A 2UXXB 4ISSA 4QXHB 4X62T 2WDVA 2WM9A 3OYZA 3AXJA 4KHPT 2CWYA 3N9OA 3CX7B 3OTOT 2BBHA 4G63A 4IE7A 4I50E 5EK2A 5JRCA 2CRBA 2AE9A 3AEBA 3FHNA 4ZZCA 5ETWA 3LG7A 2N9DA 1E1HB 2DLRA 2BG9B 3KBUA 1J5ET 5JDLA 5LHIB 1YKHB 4AKHA 4ZHQE 1VCSA 3ANWA 2CWOA 3L09A 5AQPB 4LMKA 3ZMSB 1ZKEA 1GQEA 2XTLA 3AE5A 4UELA 4XAXB 2K9AA 4PFOA 4O2BE 4DUZT 4HFCA 5AQNB 3RRWA 2WU2A 3ZN0B 3HA4A 3JCFA 3ZCIA 1WFDA 2B1EA 1YW0A 1HNXT 2KINB 3OBVE 2BS2A 2XQ4A 2XQ5A 4DR6T 4ERRA 1OEDB 2QRXA 4DV6T 5AQIB 4UF0B 3UUNA 3PJAJ 2UXBT 3UU8A 5ABHA 2KSRA 2R6GF 2Q9QD 2E9XC 3KBTA 4DBRA 2E5LT 3RX6A 3K3QC 3AEEA 4Z8XA 1L0VA 1T72A 1W0AA 4IL4A 4DR7T 4OYKA 4PK4A 3CQXC 1N36T 4DNDA 2KXPB 2XUEA 3AEDA 4GYSA 3RPUA 4ZZBA 1ZOYA 4ZXLA 1LRZA 3I0QA 4PAGA 4LFBT 2WMNA 3J9X1 4A56A 3RIUA 2FJBA 4KMCA 1W0BA 3ZSSA 4YT0A 2KWIB 1U4QA 2FBWA 2LKHA 2VL8A 2RPAA 3AE2A 4Q25A 4EGWA 2J62A 3AVRA 3RI5A 3MK7C 4ZOLE 4JLEA 4H9PC 3ZMVB 3KV5A 4JI3T 3I9WA 4TX5A 2Y48B 2LLYA 2UXNB 4BJMA 5HEJA 5M4YA 3AE8A 4H63V 4PJNA 3MKDA 3RYFE 2V6YA 2IMLA 1YQ3A 5L3EB 3H3MA 4ZS2A 2V5DA 5HWXA 4PJLA 4BJNA 2XASB 2W61A 3EAMA 2FUPA 5HWYA 2CLYB 5IYZE 4AI6A 3PU3A 3VRBA 2K48A 3QK6A 2XQAA 3C64A 4TNVA 4TUYE 3CWZB 4X65T 3PDYA 4AIUA 1SHZC 3I1AA 4H9NC 5CJ5A 3A7MA 3GN5A 4YSXA 2UXDT 4AQGA 3SOLA 2W66A 5AQVB 2DNXA 3RQWA 5DABA 2D9DA 4YJ3E 2HH7A 2CXFA 3M65A 3QB5K 4CN6A 3AVSA 4PW8A 3LBXA 3RIUC 3IHRA 5FL1A 1NWMX 3NRXA 3DTOA 4GK0E 4ILAA 4AXPA 1BR0A 1FMVA 2J4GA 5AQUB 2CHNA 2LSIA 4DIDB 3AAAB 4GOUA 2KZ7B 3N2KE 2JPFA 5AQQB 3CPZA 2LOPA 2XZEA 4UIGA 5AQFB 5LYJE 3P4SA 2XAQB 1D0XA 2WWVA 1FEWA 2UUBT 3Q2MA 1E2AA 2RA1A 4O8SA 5JDGA 3ONLC 3O1IA 2XM2A 2Z6EA 2VB6A 5DQWA 2Q9QB 3PUYF 5HYAA 2UUAT 3JC6C 2D0UA 5CA1E 2MOZA 1IJ6A 2PFVA 2Q9QC 3FZKB 2V26A 3JADA 3AA7B 1YKEB 4A5XA 5LG3A 3AEFA 3O9XA 4LMLA 3VR8A 3N9QA 3LK3B 5FY0A 1J1JA 3TLSA 4U72A 1D1AA 3RYCE 1MIYA 3VKGA 3PUQA 5AQOB 1M62A 2XAFB 3FBZA 1LVKA 4DV0T 4GYRA 2NW8A 4BAYB 5JDMA 2LSYA 4CXYA 1US7B 3C50A 5HEGA 1MIVA 1S94A 4DR1T 4HE8A 1N33T 1WYCA 1KNPA 2NR4A 3F57A 2BVLA 1HS7A 1IBLT 4HWDA 4Z91A 5HAXA 4UR9A 5F3JA 3UFGA 2WP9A 1MMAA 3CKDA 3EABA 5LBMA 4UVAB 4WW0A 4U7IA 3AB3B 5L3CB 2EHOD 4PJJA 5A1LA 4DV3T 3AECA 1LKXA 5JTGA 4EEBA 2CMRA 2WZHA 3HL6A 5F8PA 1I6ZA 2HPLA 1HF8A 3VR9A 3QOFA 3UU4A 2WSSV 2UXCT 2NWBA 3WAKA 2H7OA 1BR1A 1WCRA 1MIWA 4JYAT 1D0ZA 4DV2T 3H3AA 2V7MA 4IHJE 2C0SA 4DR2T 4U31A 3J7Yq 3P4QA 1UX5A 2YK0A 4CI3B 2XQYA 4HKAA 4OK0A 4DVDA 3ZJ1A 3VU7H 4HFIA 2CM0A 4LF9T 3AAIA 3Q5DA 3IEEA 3N9MA 4CXWA 4ZI2C 4DMWA 4I4TE 1XDPA 4PK5A 4QH4A 5LXTE 2WDRA 2CPTA 2DHRA 2ZMAA 3C98B 2E9XA 3F31A 1IBMT 2YDRA 2WY2A 1T98A 4B3ST 5HXCA 4UV9B 2LT3A 4A97A 1SA0E 4LF5T 5AQRB 3PUXF 2MBGA 3IA3A 5F5WA 2CXDA 3JAFA 2LSKA 4HN9A 3SRZA 1R8IA 4ISTA 3FB2A 2X9WA 3R84B 4U3CA 2LHNA 3AE9A 3E22E 4C90A 2A9UA 1G8XA 4TWHA 2PBIA 4IIJE 4H9QC 1VRBA 4O4JE 3N5LA 4JI8T 5ABFB 3BQIA 2PTFA 3D0TA 4JI2T 3T1HT 1ZV4X 1UCUA 3RQUA 2BG9C 4DR5T 3ESLA 1HCIA 2UUCT 1M7KA 2LE8A 1SE7A 3O1JA 3AEGA 4IDNA 3ZC1A 3M3ZB 4EYYR 2WU5A 1ZP0A 5IUXA 2K3WA 4M1PA 4CI1B 4NXNT 4QX8B 4YSYA 2X0YA 2JIWA 1E7PA 4EZHA 5KMGP 4DR3T 4A98A 1NAFA 3K1SA 3TLUA 3A8YC 3FZLB 3RLFF 5ABGA 4TN7B 3NRYA 1XNQT 1OEDC 2XQ6A 5JDHA 4K0UA 3ZYLA 3I0OA 2W63A 1S35A 4ILCA 3OVUA 2YU1A 5AQSB 5LOVE 1QUUA 2I6HA 3CIRA 5EK3A 1IBKT 4ZEYA 5L4EA 4IE4A 4QH1A 1AJ3A 5LBQB 5BMVE 4E7ZA 2EHOB 4GKKT 2W62A 3AAEB 2VL0A 5JR9B 5FNVE 4QWNB 1WYBA 4ZS3A 3CK6A 5LHGB 3C4XA 5FY1A 4ZI3C 3ZT5A 5CFBA 4JI7T 5E0OA 5JRCB 3LJCA 2E8IA 3ZCJA 3QB5A 2DWKA 5AQKB 2FJEA 3RIAA 4AKLA 5FKYA 1KNRA 3ANWB 4QX7B 4JV5T 4I55E 4EV6A 4JUYA 4MFRA 2J47A 2QVAA 4HFVA 4EAHA 2MYSA 1MNEA 3UFEA 2JQQA 2KNDA 4U2ZA 2CCQA 4IE6A 1UUSA 2IAKA 1JNRA 4IDZA 2W67A 4YHHT 3MXZA 4ZI7E 4N78D 1OWAA 4X66T 4B3MT 4P0BA 3H37A 3L39A 4HTEA 4IE0A 2YOEA 3WI3A 4LF8T 4YJ2E 4MBQA 1HNZT 3E0ZA 4IT4A 4ILUA 4CN4A 2JJ9A 2YDQA 3VRAA 5LNKA 4K0KT 1QLBA 1X9BA 2H89A 3GWHA 2Q9QA 3MA9A 1HX1B 5FVLA 1KFYA 2CLYC 2V1DB 5J2TE 2F4VT 4JI5T 4YY3T 2Y6XA 2M6BA 3AA1B 2GK9A 3ZMUB 3V5SA 5JH7E 4AKRB 2WMOA 3FBLA 2IC6A 4EEDA 4F6RC 4ANJA 1IAPA 5CGMA 3UUMA 3FZMB 4I43B 2V7LA 4TWFA 2FJAA 4YTNA 1T7SA 3VHLA 3KINB 3T8OA 2KWHA 1VOMA 3LDQB 2ZLYA 2VKJA 2X9HA 5FXWA 4Z90A 5LB7B 3NWIA 1NENA 5JVDE 2L8KA 1MMGA 4YHJA 4QKNA 2XPKA 2VASA 2BDEA 2ZM0A 2X0HA 4FJOA 3TLWA 2A72A 3GMIA 2P9BA 4O4IE 3RC3A 2XQ8A 5FY7A 3TLVA 4UV8B 1XMOT 2UU9T 3HI2A 2OV9A 4JEUB 3AA6B 2L9QA 4YXDA 4B6XA 5ADXL 3ZN1B 5HEOA 1HR0T 2VKOA 2WZIA 3KVAA 2LM9A 2LM2A 3RYIE 3RHWA 4X5TA 4H63H 5C8YE 2LRKA 1KF6A 2MPKA 1LVFA 4H9SE 2XY8B 2DI4A 5LG4A 4KX6A 1IZNB 4V1Av 1HX8A 2E2AA 2XAHB 4WBNE 3ONXA 1UGOA 5HXSA 2BZBA 4DO0A 4AISA 1BR4A 2K5BB 3PE0A 3LSVA 2WAUA 3RH3A 1XDOA 4OFZA 4E7SA
chains in the Genus database with same CATH topology
3UT5E 3RYHE 4UF0B 4DVDA 3KDSE 3ZJ1A 3UUNA 3VU7H 5H6QB 5AFUL 2CM0A 3AAIA 2YU2A 3IEEA 3RC8A 1WR6A 2OA5A 2C5JA 5HXHA 3N9MA 4CXWA 3GN5B 4CI2B 4ZI2C 3UUXB 2X0LB 4DMWA 4XBFB 2C5KT 4EIWA 3VKHA 3B13A 4O2AE 4PFPA 4TZ4C 4KBMB 2Q9QD 4I4TE 2E9XC 3KBTA 4DBRA 4PK5A 3ZPOA 5LXTE 3OJAA 2NP9A 4QXCB 2DHRA 2ZMAA 3C98B 4P09A 3RX6A 2E9XA 3LBXB 2X9YA 3O4XE 3F31A 3K3QC 1MMDA 4Z8XA 1T98A 3N2GE 5FXZA 2JRKA 2NTXA 5HXCA 1WLXA 4UV9B 4TV8E 2H3RA 1G73A 2LT3A 3AA0B 1SA0E 4MALA 4OYKA 4PK4A 2MBGA 3CQXC 2ZM2A 4DNDA 2CXDA 2KXPB 2XUEA 3ZLIA 4GYSA 4NUVA 3RPUA 4HN9A 2LSKA 2XAGB 3SRZA 1LRZA 4ISTA 3CX8B 3I0QA 5KDMC 4PAGA 3R6NA 2WMNA 4QXBB 4G2AA 4ZI2D 2A3DA 3FB2A 3J9X1 3Q9DA 4A56A 2X9WA 2KMFA 3ZYMA 3R84B 2C5IT 2LHNA 5FP3A 2E9XD 4H9OC 3E22E 4NUUA 4KMCA 4C90A 4X20E 1G8XA 5TAOA 2KWIB 4AQFA 3K3OA 1U4QA 2PBIA 2VKDA 4IIJE 2VL8A 4H9QC 1VRBA 3O1HA 4O4JE 1B7TA 3N5LA 1CUNA 2WBLA 3BQIA 3AVRA 3D0TA 4ASKA 1ZV4X 1UCUA 3MK7C 4ZOLE 4JLEA 2HPJA 4H9PC 2A2FX 3U3IA 3ZMVB 3KV5A 2YEVC 4L0RA 3I9WA 5CB4E 4TX5A 5KX5E 3ESLA 2Y48B 1HCIA 3Q5XA 1X79A 5LP6E 2X66A 1Z0PA 3C4WA 2UXNB 4BJMA 2LE8A 3O1JA 2JMKA 5M4YA 3ZC1A 2CA5A 3V5UA 4EYYR 2H7VC 1KNZA 2PG8A 4H63V 4PJNA 2VK9A 3MKDA 3MACA 4TV9E 5FXXA 4HGAA 3RYFE 4M1PA 1WRDA 4O4HE 5L3EB 4CI1B 1D0YA 3WAJA 4ZS2A 2NW7A 4YFSA 4QX8B 5HWXA 3EUHA 3PTRB 2X51A 4EZHA 5KMGP 3LK2B 3Q5WA 4PJLA 3N9LA 4BJNA 4P0AA 2XASB 2W61A 1NAFA 5JREA 5HWYA 2CLYB 2L3LA 5IYZE 5LGUB 4FI5A 4AI6A 5JDNA 2LJLA 3PU3A 2K48A 4TN7B 3QK6A 3NRYA 5FYMA 1QSDA 4IGUA 2N2NA 4L9IA 4DMVA 3C64A 2I59A 3K3NA 2IW5B 5JDHA 4K0UA 4UVBB 3ZYLA 1D1CA 4TUYE 3I0OA 2W63A 4JEHB 1S35A 2D5UA 3EDUA 1MNDA 4PK6A 1HG5A 2YU1A 3OYXA 3CWZB 3DP7A 5LOVE 3PDYA 4UF0A 1QUUA 5J1GA 3RRCA 5LA6E 1EZ3A 3FXEB 5EK3A 3HKCE 1SHZC 4IE4A 3FXDB 3I1AA 1H7CA 5LBQB 4H9NC 1AJ3A 4H9RC 5BMVE 1YD8G 4E7ZA 2EHOB 3IBPA 2X9XA 3GN5A 5LGNB 4AQGA 2W62A 3ZC0A 3SOLA 2DNXA 2CEAA 2V7IA 4OYJA 5DABA 3AAEB 2NW9A 4EB6E 5JR9B 5FNVE 4YJ3E 3W15B 2HH7A 3DJBA 2CXFA 4UEMA 5LJMA 4EYUA 4QWNB 1WYBA 1D1BA 4KUMB 5LGTB 3M65A 3P7IA 5JDFA 4ZS3A 3AVSA 5LHGB 4PW8A 3C4XA 3PUSA 5FY1A 3KV4A 5L3DB 2YINA 3C4ZA 4ZI3C 3LBXA 3IHRA 2LSGA 3QC9A 5E0OA 1NWMX 3NRXA 2IC9A 3DTOA 4GK0E 5JRCB 3LJCA 2ODUA 4WBOA 5JR9A 2E8IA 3ZCJA 3BQKA 4AQFC 3MZKB 2QGSA 4AXPA 1BR0A 3QUJA 1FMVA 2VWAA 1ZHCA 2LSJA 2D2SA 2DWKA 3IF8B 2LSIA 3KFWX 2Y8DA 3KV9A 2X67A 3AAAB 3NZQA 4GOUA 3CMLA 2ACXA 2KZ7B 3N2KE 1KK7A 4AKLA 2JPFA 5HXRA 3CPZA 3CX6B 3ANWB 4QX7B 2LOPA 3A5XA 4I55E 3UTKA 4JUYA 4MFRA 5IHYA 3ZYKA 3GA8A 3KV6A 4HFVA 4UIGA 5LYJE 4EAHA 2MYSA 3NZPA 1MNEA 3BK9A 3UFEA 2JQQA 2KNDA 2XAQB 1D0XA 2K24A 4DBQA 1FEWA 4OHFA 2CCQA 1ZEEA 2V7KA 4IE6A 2IAKA 3Q2MA 4IDZA 4ZI3D 1HG2A 2RA1A 3MJXA 4O8SA 3EDVA 3MXZA 5JDGA 4CZZB 2CE7A 4N78D 4CXXA 4ZI7E 1OWAA 1MMNA 3LFMA 3O1IA 2Z6EA 5JDQA 4P0BA 2VB6A 4C91A 3H37A 3PUAA 5DQWA 5L3GB 2Q9QB 4ADZA 5HYAA 5FXVA 4HTEA 4IE0A 3WI3A 2LOSA 2D0TA 3JC6C 3HR0A 4MLKA 4MBQA 4YJ2E 2D0UA 3ZMZB 4EXTA 5CA1E 2MOZA 4J2CA 3E0ZA 1IJ6A 2MTQA 2PFVA 3ZEFB 4ILUA 3RKOA 3HKBE 2Q9QC 2JJ9A 2JMHA 4GIWA 2V7JA 1V9DA 2M67A 3L3PA 5LNKA 2V26A 3PURA 5CA0E 1FMWA 5L2LA 3TKLB 3AA7B 1YKEB 3GWHA 2LEHA 2Q9QA 3K8PC 4AKGA 2DCFA 3MA9A 3HKEE 3KVBA 3O9XA 2CLYC 4X1YE 5GONE 3N9QA 3LK3B 3I9YA 2V1DB 5J2UE 5J2TE 5FY0A 2VKHA 2ES0A 2Y6XA 5JQGE 4U72A 1UX4A 4AKIA 2J1DG 3AA1B 1D1AA 2GK9A 3ZMUB 5LJNA 3RYCE 2XAJB 3V5SA 5JH7E 4AKRB 1MIYA 3VKGA 3PUQA 4O4LE 2WMOA 3FBLA 2IC6A 2NTYA 3CVRA 2XAFB 3F2EA 5FMNA 3FBZA 4L5GA 3CQCB 2W00A 2E9XB 1LVKA 4F6RC 4ANJA 1IAPA 2W0GA 3JC6D 4GYRA 2NW8A 4BAYB 3UUMA 5JDMA 4I43B 2V7LA 4GK5E 2LSYA 5L3FB 1US7B 4EZ4A 4CXYA 2DWGA 3BQLA 3C50A 1MIVA 2CXLA 2LHRA 3B57A 1S94A 4XZCA 3NBXX 3VHLA 3KINB 4CQIA 2KWHA 1VOMA 2EHOC 2WWUA 4MHCA 3T8OA 3LK42 4HE8A 2ZLYA 2VKJA 4KP3C 4IE5A 2X9HA 5FXWA 1WYCA 5HXEA 5JR9C 2QA7A 5LHHB 3N9NA 4X1KE 4PJMA 3SWHA 5JVDE 3PU8A 5EK4A 2L8KA 2EHOA 1MMGA 3F57A 4YHJA 2BVLA 5L3BB 1HS7A 4QKNA 2VASA 2BDEA 2UXXB 2ZM0A 4ISSA 4QXHB 5HAXA 2WM9A 5EZYE 3OYZA 4FJOA 3HKDE 5DJQC 3N9PA 2A72A 4UXNB 3GMIA 2P9BA 4EOZB 3P8CD 5F3JA 1HTJF 4U74A 2CWYA 2BVMA 4O4IE 3N9OA 3OKQA 4WNKA 3RC3A 2PJQA 1HFAA 3CX7B 5FY7A 3ZMTB 4UV8B 3ZJ2A 4G63A 3ETVA 3HI2A 3PUGA 4IE7A 1MMAA 4I50E 3CKDA 5EK2A 5JRCA 4YLHA 4JEUB 3AA6B 2L9QA 5LBMA 4BA9A 1U5PA 4UVAB 4B6XA 4WW0A 2KT9A 5ADXL 3FHNA 3AB3B 1OXZA 5ETWA 4PNIA 5L3CB 3ZN1B 1FIOA 2EHOD 2G0UA 4PJJA 4UVCB 2VKOA 3KVAA 2LM9A 5H6RB 3LG7A 5A1LA 3RYIE 4HEAA 3C51A 2N9DA 1E1HB 2DLRA 4H63H 3ETUA 3KBUA 1LKXA 4QHOA 5JDLA 5LHIB 1YKHB 2X68A 2ZM8A 5C8YE 4AKHA 3E08A 4ZHQE 3ANWA 3SS1A 2CMRA 2CWOA 5DQVA 3HL6A 5F8PA 3L09A 2HPLA 3N2OA 1HF8A 1LVFA 2WSSV 4H9SE 2NWBA 3WAKA 2XHEB 2H7OA 3UULA 1BR2A 1BR1A 2DI4A 3ZMSB 5LG4A 3EVYA 1ZKEA 2KLQA 1O3XA 2NOXA 1MIWA 1IZNB 3CQGB 2XTLA 3U78A 4V1Av 1HX8A 1D0ZA 2RP4A 4UELA 4XAXB 2XAHB 2K9AA 4WBNE 1IJ5A 3H3AA 3ONXA 4PFOA 5LCYA 4O2BE 5HXSA 2BZBA 3S4UA 2V7MA 4DO0A 2ODVA 3RRWA 1BR4A 2K5BB 3ZN0B 3HA4A 3PE0A 3ZCIA 2WAUA 4IHJE 2C0SA 3RH3A 2B1EA 1YW0A 2KINB 4OFZA 3J7Yq 2SPCA 1UX5A 1Y64B 4E7SA 2YK0A 4X1IE 4CI3B 2N1GA 2XQYA 3OBVE 4HKAA 4OK0A 4ERRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HPL A;  4P09 A;  2HPJ A;  4OYK A;  4OYJ A;  2CCQ A;  2D5U A;  4JUY A;  5LJM A;  4P0B A;  4P0A A;  5LJN A;  2CM0 A; 
#chains in the Genus database with same CATH topology
 3NKZ A;  1I94 T;  5H6Q B;  5AFU L;  2YN6 A;  3RC8 A;  1WR6 A;  2OA5 A;  2C5J A;  3GN5 B;  2X0L B;  5AQJ B;  3ONJ A;  4XBF B;  2C5K T;  2I0M A;  4TZ4 C;  4KBM B;  2NP9 A;  4P09 A;  2V8S V;  3LBX B;  3O4X E;  2X9Y A;  5FXZ A;  2NTX A;  1WLX A;  2H88 A;  5FL0 A;  2H3R A;  1XWM A;  1G73 A;  2OLT A;  1KEY A;  3AA0 B;  4MAL A;  4NUV A;  2XAG B;  4WYV A;  3CX8 B;  4QXB B;  4G2A A;  2A3D A;  2IHR 1;  3ZYM A;  2C5I T;  5FP3 A;  2E9X D;  4H9O C;  4NUU A;  3NVO A;  5TAO A;  4AQF A;  3O1H A;  1B7T A;  2WBL A;  3AE6 A;  3Q5E A;  2A2F X;  4L0R A;  4AQY T;  5CB4 E;  2ZM6 T;  2ACZ A;  5KX5 E;  3Q5X A;  5HCM A;  5LP6 E;  2X66 A;  3C4W A;  2BG9 A;  5AQT B;  3SFD A;  3V5U A;  1KNZ A;  2H7V C;  2PG8 A;  5FXX A;  4TV9 E;  4HGA A;  1WRD A;  4O4H E;  3WAJ A;  4DV5 T;  3EUH A;  3PTR B;  3ZKR A;  2X51 A;  3LK2 B;  3Q5W A;  2L3L A;  5LGU B;  4FI5 A;  2V5C A;  2LJL A;  4NIQ A;  5AQG B;  4X64 T;  5FYM A;  4IGU A;  3TLT A;  5KXJ A;  2YKS A;  4YSZ A;  4LMJ A;  2WS3 A;  4IDQ A;  4JEH B;  3EDU A;  1HG5 A;  1OED A;  3OYX A;  4UF0 A;  5J1G A;  3RRC A;  1EZ3 A;  3FXE B;  3HKC E;  3FXD B;  1H7C A;  3AE4 A;  3IBP A;  5LGN B;  2WQY A;  2V7I A;  2NW9 A;  4JBW F;  4EB6 E;  5C3J A;  3W15 B;  2M6I A;  4CN1 A;  4UEM A;  5LJM A;  1D1B A;  4KUM B;  5LGT B;  3P7I A;  5JDF A;  2VQE T;  3PUS A;  2BG9 E;  2LSG A;  3AE3 A;  2ODU A;  4WBO A;  5JR9 A;  4AQF C;  3MZK B;  2QGS A;  1XMQ T;  2BKP A;  2LSJ A;  2LRL A;  2D2S A;  4HFD A;  1Z8U A;  3KV9 A;  4JI1 T;  3CML A;  2ACX A;  1KK7 A;  1W9R A;  5HXR A;  4KHZ F;  3A5X A;  5LMU T;  3ZYK A;  2V6X A;  3KV6 A;  2W4X A;  3UU5 A;  4DBQ A;  2K24 A;  4OHF A;  2V7K A;  2CBI A;  1HG2 A;  3MJX A;  1MMN A;  1OED E;  1YXR A;  3PUA A;  5L3G B;  4ADZ A;  1JNZ A;  2LOS A;  2D0T A;  4MLK A;  3ZMZ B;  4EXT A;  2VUR A;  2MTQ A;  4HFB A;  4OX9 T;  3ZEF B;  2JQK A;  3HKB E;  2JMH A;  3EHZ A;  4GIW A;  1V9D A;  3L3P A;  3PUR A;  5CA0 E;  1FMW A;  2XSB A;  2LEH A;  3K8P C;  2DCF A;  3X1D A;  3I9Y A;  5J2U E;  2WDQ A;  2VKH A;  2BKN A;  4AKI A;  5LJN A;  2XAJ B;  3RF1 A;  4P1N A;  4O4L E;  3F2E A;  3QNU A;  5FMN A;  3CQC B;  2E9X B;  3JC6 D;  1T8B A;  5L4H A;  2VVS A;  3AE7 A;  3BQL A;  1UK5 A;  2CXL A;  3B57 A;  3NBX X;  4IL9 A;  4CQI A;  2EHO C;  4MHC A;  3AXJ B;  2WCA A;  5HXE A;  5JR9 C;  3N9N A;  3SWH A;  3PU8 A;  5EK4 A;  4GKJ T;  3ZST A;  1J5W A;  5EZY E;  4IDO A;  4NXM T;  5AQL B;  3HKD E;  5DJQ C;  3N9P A;  4UXN B;  4EOZ B;  3P8C D;  1HTJ F;  2DL1 A;  4U74 A;  5LMN T;  2BVM A;  3ZMT B;  3OKQ A;  4WNK A;  1VCT A;  2HN1 A;  1HFA A;  2PJQ A;  3ZJ2 A;  3ETV A;  3PUG A;  4HWF A;  4YLH A;  5HCJ A;  4BA9 A;  1U5P A;  3RKG A;  2KT9 A;  4TNW A;  1OXZ A;  4PNI A;  2IUB A;  1FIO A;  2G0U A;  5FVK A;  4UVC B;  5H6R B;  4HEA A;  3L8R A;  4JI6 T;  3AE1 A;  3C51 A;  5IWA T;  3ETU A;  2XQ9 A;  1XZY A;  1SUM B;  4QHO A;  3ZT6 A;  2X68 A;  2ZM8 A;  3E08 A;  4IDP A;  3SS1 A;  5DQV A;  4DV4 T;  4KI0 F;  3N2O A;  2XHE B;  1DU2 A;  3UUL A;  1BR2 A;  3EVY A;  2KLQ A;  1O3X A;  2NOX A;  3CQG B;  3U78 A;  2RP4 A;  4YTP A;  1IJ5 A;  5LCY A;  4IRE A;  3S4U A;  2ODV A;  4HWC A;  2SPC A;  1Y64 B;  4X1I E;  2N1G A;  5HEU A;  2VQF T;  3UT5 E;  3RYH E;  3KDS E;  4DR4 T;  4B3T T;  1WR0 A;  2YU2 A;  5HXH A;  4CI2 B;  3UUX B;  3PV0 F;  2W2U A;  4EIW A;  3VKH A;  3B13 A;  4O2A E;  4PFP A;  3RIF A;  3ABV A;  4COF A;  3ZPO A;  3OJA A;  4QXC B;  2XM1 A;  2VVN A;  5C2T A;  4LF7 T;  1MMD A;  3N2G E;  2JRK A;  1N34 T;  4TV8 E;  2ZM2 A;  2YDS A;  3P4W A;  3ZLI A;  4I0U A;  5KDM C;  3R6N A;  4ZI2 D;  2JQ9 A;  1Y01 A;  5HEH A;  3Q9D A;  3P4P A;  2KMF A;  4F8H A;  4X20 E;  3K3O A;  2VKD A;  2E5V A;  4LF4 T;  1CUN A;  4JI0 T;  4ASK A;  2V6Y B;  2HPJ A;  3U3I A;  2BKO A;  2YEV C;  4ILB A;  1X79 A;  3P50 A;  1Z0P A;  5J0Z A;  2JMK A;  2CA5 A;  3FZH B;  3PUV F;  2MAW A;  2VK9 A;  3MAC A;  3PUZ F;  2B76 A;  1D0Y A;  2NW7 A;  4YFS A;  3RGL A;  3N9L A;  4P0A A;  5JRE A;  1FJG T;  2IIU A;  3G06 A;  2XQ3 A;  5JDN A;  1QSD A;  2N2N A;  4L9I A;  2IDO B;  1HNW T;  4DMV A;  1UUR A;  2I59 A;  3K3N A;  3OPC A;  2IW5 B;  2CBJ A;  4UVB B;  1D1C A;  4JI4 T;  2D5U A;  4PK6 A;  1MND A;  4LF6 T;  3DP7 A;  5LA6 E;  4LFC T;  4H9R C;  3EI0 A;  1YD8 G;  2HHH T;  2X9X A;  3ZC0 A;  4OYJ A;  2CEA A;  2BS4 A;  3JAE A;  4B3R T;  3DJB A;  3PJA A;  4EYU A;  1W09 A;  4U2Y A;  3KV4 A;  5L3D B;  2YIN A;  3C4Z A;  3QC9 A;  4NPP A;  2IC9 A;  3B5M A;  3BQK A;  1YQ4 A;  3QUJ A;  2VWA A;  3T1Y T;  1ZHC A;  2LKG A;  3IF8 B;  3KFW X;  4YTM A;  2Y8D A;  2X67 A;  4DV7 T;  3NZQ A;  3UU3 A;  3CX6 B;  3UTK A;  5IHY A;  2HN2 A;  3UUB A;  3GA8 A;  3ZT7 A;  1NEK A;  3NZP A;  3BK9 A;  2JQH A;  3UU6 A;  1ZEE A;  5AQM B;  2XSA A;  4ZI3 D;  4DV1 T;  3EDV A;  3FZF B;  4CZZ B;  2CE7 A;  4CXX A;  2BS3 A;  5ABF A;  3LFM A;  5JDQ A;  1XNR T;  3PUW F;  5ABE A;  4C91 A;  4LFA T;  2CHO A;  4U7Y A;  5FXV A;  5BR8 T;  3HR0 A;  4HWI B;  4HFE A;  3UQ4 A;  2AXD S;  4J2C A;  1N32 T;  3RKO A;  2V7J A;  2M67 A;  2XJ7 A;  5L2L A;  3TKL B;  4AKG A;  2WB5 A;  4QH5 A;  5L47 A;  3HKE E;  3KVB A;  5GON E;  4X1Y E;  2ES0 A;  5JQG E;  1UX4 A;  2J1D G;  4TWD A;  3SFE A;  2NTY A;  3P4R A;  3CVR A;  4HWH A;  4L5G A;  4DUY T;  2W00 A;  2W0G A;  1CHU A;  4GK5 E;  5L3F B;  4EZ4 A;  2DWG A;  4WZX A;  2LHR A;  4XZC A;  3UQ7 A;  2FJD A;  2WWU A;  4HFH A;  3LK4 2;  4KP3 C;  4IE5 A;  5AQH B;  2QA7 A;  4U33 A;  5LHH B;  4X1K E;  4PJM A;  2BBJ A;  2EHO A;  2QYW A;  5L3B B;  3AEA A;  2XQ7 A;  2UXX B;  4ISS A;  4QXH B;  4X62 T;  2WDV A;  2WM9 A;  3OYZ A;  3AXJ A;  4KHP T;  2CWY A;  3N9O A;  3CX7 B;  3OTO T;  2BBH A;  4G63 A;  4IE7 A;  4I50 E;  5EK2 A;  5JRC A;  2CRB A;  2AE9 A;  3AEB A;  3FHN A;  4ZZC A;  5ETW A;  3LG7 A;  2N9D A;  1E1H B;  2DLR A;  2BG9 B;  3KBU A;  1J5E T;  5JDL A;  5LHI B;  1YKH B;  4AKH A;  4ZHQ E;  1VCS A;  3ANW A;  2CWO A;  3L09 A;  5AQP B;  4LMK A;  3ZMS B;  1ZKE A;  1GQE A;  2XTL A;  3AE5 A;  4UEL A;  4XAX B;  2K9A A;  4PFO A;  4O2B E;  4DUZ T;  4HFC A;  5AQN B;  3RRW A;  2WU2 A;  3ZN0 B;  3HA4 A;  3JCF A;  3ZCI A;  1WFD A;  2B1E A;  1YW0 A;  1HNX T;  2KIN B;  3OBV E;  2BS2 A;  2XQ4 A;  2XQ5 A;  4DR6 T;  4ERR A;  1OED B;  2QRX A;  4DV6 T;  5AQI B;  4UF0 B;  3UUN A;  3PJA J;  2UXB T;  3UU8 A;  5ABH A;  2KSR A;  2R6G F;  2Q9Q D;  2E9X C;  3KBT A;  4DBR A;  2E5L T;  3RX6 A;  3K3Q C;  3AEE A;  4Z8X A;  1L0V A;  1T72 A;  1W0A A;  4IL4 A;  4DR7 T;  4OYK A;  4PK4 A;  3CQX C;  1N36 T;  4DND A;  2KXP B;  2XUE A;  3AED A;  4GYS A;  3RPU A;  4ZZB A;  1ZOY A;  4ZXL A;  1LRZ A;  3I0Q A;  4PAG A;  4LFB T;  2WMN A;  3J9X 1;  4A56 A;  3RIU A;  2FJB A;  4KMC A;  1W0B A;  3ZSS A;  4YT0 A;  2KWI B;  1U4Q A;  2FBW A;  2LKH A;  2VL8 A;  2RPA A;  3AE2 A;  4Q25 A;  4EGW A;  2J62 A;  3AVR A;  3RI5 A;  3MK7 C;  4ZOL E;  4JLE A;  4H9P C;  3ZMV B;  3KV5 A;  4JI3 T;  3I9W A;  4TX5 A;  2Y48 B;  2LLY A;  2UXN B;  4BJM A;  5HEJ A;  5M4Y A;  3AE8 A;  4H63 V;  4PJN A;  3MKD A;  3RYF E;  2V6Y A;  2IML A;  1YQ3 A;  5L3E B;  3H3M A;  4ZS2 A;  2V5D A;  5HWX A;  4PJL A;  4BJN A;  2XAS B;  2W61 A;  3EAM A;  2FUP A;  5HWY A;  2CLY B;  5IYZ E;  4AI6 A;  3PU3 A;  3VRB A;  2K48 A;  3QK6 A;  2XQA A;  3C64 A;  4TNV A;  4TUY E;  3CWZ B;  4X65 T;  3PDY A;  4AIU A;  1SHZ C;  3I1A A;  4H9N C;  5CJ5 A;  3A7M A;  3GN5 A;  4YSX A;  2UXD T;  4AQG A;  3SOL A;  2W66 A;  5AQV B;  2DNX A;  3RQW A;  5DAB A;  2D9D A;  4YJ3 E;  2HH7 A;  2CXF A;  3M65 A;  3QB5 K;  4CN6 A;  3AVS A;  4PW8 A;  3LBX A;  3RIU C;  3IHR A;  5FL1 A;  1NWM X;  3NRX A;  3DTO A;  4GK0 E;  4ILA A;  4AXP A;  1BR0 A;  1FMV A;  2J4G A;  5AQU B;  2CHN A;  2LSI A;  4DID B;  3AAA B;  4GOU A;  2KZ7 B;  3N2K E;  2JPF A;  5AQQ B;  3CPZ A;  2LOP A;  2XZE A;  4UIG A;  5AQF B;  5LYJ E;  3P4S A;  2XAQ B;  1D0X A;  2WWV A;  1FEW A;  2UUB T;  3Q2M A;  1E2A A;  2RA1 A;  4O8S A;  5JDG A;  3ONL C;  3O1I A;  2XM2 A;  2Z6E A;  2VB6 A;  5DQW A;  2Q9Q B;  3PUY F;  5HYA A;  2UUA T;  3JC6 C;  2D0U A;  5CA1 E;  2MOZ A;  1IJ6 A;  2PFV A;  2Q9Q C;  3FZK B;  2V26 A;  3JAD A;  3AA7 B;  1YKE B;  4A5X A;  5LG3 A;  3AEF A;  3O9X A;  4LML A;  3VR8 A;  3N9Q A;  3LK3 B;  5FY0 A;  1J1J A;  3TLS A;  4U72 A;  1D1A A;  3RYC E;  1MIY A;  3VKG A;  3PUQ A;  5AQO B;  1M62 A;  2XAF B;  3FBZ A;  1LVK A;  4DV0 T;  4GYR A;  2NW8 A;  4BAY B;  5JDM A;  2LSY A;  4CXY A;  1US7 B;  3C50 A;  5HEG A;  1MIV A;  1S94 A;  4DR1 T;  4HE8 A;  1N33 T;  1WYC A;  1KNP A;  2NR4 A;  3F57 A;  2BVL A;  1HS7 A;  1IBL T;  4HWD A;  4Z91 A;  5HAX A;  4UR9 A;  5F3J A;  3UFG A;  2WP9 A;  1MMA A;  3CKD A;  3EAB A;  5LBM A;  4UVA B;  4WW0 A;  4U7I A;  3AB3 B;  5L3C B;  2EHO D;  4PJJ A;  5A1L A;  4DV3 T;  3AEC A;  1LKX A;  5JTG A;  4EEB A;  2CMR A;  2WZH A;  3HL6 A;  5F8P A;  1I6Z A;  2HPL A;  1HF8 A;  3VR9 A;  3QOF A;  3UU4 A;  2WSS V;  2UXC T;  2NWB A;  3WAK A;  2H7O A;  1BR1 A;  1WCR A;  1MIW A;  4JYA T;  1D0Z A;  4DV2 T;  3H3A A;  2V7M A;  4IHJ E;  2C0S A;  4DR2 T;  4U31 A;  3J7Y q;  3P4Q A;  1UX5 A;  2YK0 A;  4CI3 B;  2XQY A;  4HKA A;  4OK0 A;  4DVD A;  3ZJ1 A;  3VU7 H;  4HFI A;  2CM0 A;  4LF9 T;  3AAI A;  3Q5D A;  3IEE A;  3N9M A;  4CXW A;  4ZI2 C;  4DMW A;  4I4T E;  1XDP A;  4PK5 A;  4QH4 A;  5LXT E;  2WDR A;  2CPT A;  2DHR A;  2ZMA A;  3C98 B;  2E9X A;  3F31 A;  1IBM T;  2YDR A;  2WY2 A;  1T98 A;  4B3S T;  5HXC A;  4UV9 B;  2LT3 A;  4A97 A;  1SA0 E;  4LF5 T;  5AQR B;  3PUX F;  2MBG A;  3IA3 A;  5F5W A;  2CXD A;  3JAF A;  2LSK A;  4HN9 A;  3SRZ A;  1R8I A;  4IST A;  3FB2 A;  2X9W A;  3R84 B;  4U3C A;  2LHN A;  3AE9 A;  3E22 E;  4C90 A;  2A9U A;  1G8X A;  4TWH A;  2PBI A;  4IIJ E;  4H9Q C;  1VRB A;  4O4J E;  3N5L A;  4JI8 T;  5ABF B;  3BQI A;  2PTF A;  3D0T A;  4JI2 T;  3T1H T;  1ZV4 X;  1UCU A;  3RQU A;  2BG9 C;  4DR5 T;  3ESL A;  1HCI A;  2UUC T;  1M7K A;  2LE8 A;  1SE7 A;  3O1J A;  3AEG A;  4IDN A;  3ZC1 A;  3M3Z B;  4EYY R;  2WU5 A;  1ZP0 A;  5IUX A;  2K3W A;  4M1P A;  4CI1 B;  4NXN T;  4QX8 B;  4YSY A;  2X0Y A;  2JIW A;  1E7P A;  4EZH A;  5KMG P;  4DR3 T;  4A98 A;  1NAF A;  3K1S A;  3TLU A;  3A8Y C;  3FZL B;  3RLF F;  5ABG A;  4TN7 B;  3NRY A;  1XNQ T;  1OED C;  2XQ6 A;  5JDH A;  4K0U A;  3ZYL A;  3I0O A;  2W63 A;  1S35 A;  4ILC A;  3OVU A;  2YU1 A;  5AQS B;  5LOV E;  1QUU A;  2I6H A;  3CIR A;  5EK3 A;  1IBK T;  4ZEY A;  5L4E A;  4IE4 A;  4QH1 A;  1AJ3 A;  5LBQ B;  5BMV E;  4E7Z A;  2EHO B;  4GKK T;  2W62 A;  3AAE B;  2VL0 A;  5JR9 B;  5FNV E;  4QWN B;  1WYB A;  4ZS3 A;  3CK6 A;  5LHG B;  3C4X A;  5FY1 A;  4ZI3 C;  3ZT5 A;  5CFB A;  4JI7 T;  5E0O A;  5JRC B;  3LJC A;  2E8I A;  3ZCJ A;  3QB5 A;  2DWK A;  5AQK B;  2FJE A;  3RIA A;  4AKL A;  5FKY A;  1KNR A;  3ANW B;  4QX7 B;  4JV5 T;  4I55 E;  4EV6 A;  4JUY A;  4MFR A;  2J47 A;  2QVA A;  4HFV A;  4EAH A;  2MYS A;  1MNE A;  3UFE A;  2JQQ A;  2KND A;  4U2Z A;  2CCQ A;  4IE6 A;  1UUS A;  2IAK A;  1JNR A;  4IDZ A;  2W67 A;  4YHH T;  3MXZ A;  4ZI7 E;  4N78 D;  1OWA A;  4X66 T;  4B3M T;  4P0B A;  3H37 A;  3L39 A;  4HTE A;  4IE0 A;  2YOE A;  3WI3 A;  4LF8 T;  4YJ2 E;  4MBQ A;  1HNZ T;  3E0Z A;  4IT4 A;  4ILU A;  4CN4 A;  2JJ9 A;  2YDQ A;  3VRA A;  5LNK A;  4K0K T;  1QLB A;  1X9B A;  2H89 A;  3GWH A;  2Q9Q A;  3MA9 A;  1HX1 B;  5FVL A;  1KFY A;  2CLY C;  2V1D B;  5J2T E;  2F4V T;  4JI5 T;  4YY3 T;  2Y6X A;  2M6B A;  3AA1 B;  2GK9 A;  3ZMU B;  3V5S A;  5JH7 E;  4AKR B;  2WMO A;  3FBL A;  2IC6 A;  4EED A;  4F6R C;  4ANJ A;  1IAP A;  5CGM A;  3UUM A;  3FZM B;  4I43 B;  2V7L A;  4TWF A;  2FJA A;  4YTN A;  1T7S A;  3VHL A;  3KIN B;  3T8O A;  2KWH A;  1VOM A;  3LDQ B;  2ZLY A;  2VKJ A;  2X9H A;  5FXW A;  4Z90 A;  5LB7 B;  3NWI A;  1NEN A;  5JVD E;  2L8K A;  1MMG A;  4YHJ A;  4QKN A;  2XPK A;  2VAS A;  2BDE A;  2ZM0 A;  2X0H A;  4FJO A;  3TLW A;  2A72 A;  3GMI A;  2P9B A;  4O4I E;  3RC3 A;  2XQ8 A;  5FY7 A;  3TLV A;  4UV8 B;  1XMO T;  2UU9 T;  3HI2 A;  2OV9 A;  4JEU B;  3AA6 B;  2L9Q A;  4YXD A;  4B6X A;  5ADX L;  3ZN1 B;  5HEO A;  1HR0 T;  2VKO A;  2WZI A;  3KVA A;  2LM9 A;  2LM2 A;  3RYI E;  3RHW A;  4X5T A;  4H63 H;  5C8Y E;  2LRK A;  1KF6 A;  2MPK A;  1LVF A;  4H9S E;  2XY8 B;  2DI4 A;  5LG4 A;  4KX6 A;  1IZN B;  4V1A v;  1HX8 A;  2E2A A;  2XAH B;  4WBN E;  3ONX A;  1UGO A;  5HXS A;  2BZB A;  4DO0 A;  4AIS A;  1BR4 A;  2K5B B;  3PE0 A;  3LSV A;  2WAU A;  3RH3 A;  1XDO A;  4OFZ A;  4E7S A; 
#chains in the Genus database with same CATH homology
 3UT5 E;  3RYH E;  4UF0 B;  4DVD A;  3KDS E;  3ZJ1 A;  3UUN A;  3VU7 H;  5H6Q B;  5AFU L;  2CM0 A;  3AAI A;  2YU2 A;  3IEE A;  3RC8 A;  1WR6 A;  2OA5 A;  2C5J A;  5HXH A;  3N9M A;  4CXW A;  3GN5 B;  4CI2 B;  4ZI2 C;  3UUX B;  2X0L B;  4DMW A;  4XBF B;  2C5K T;  4EIW A;  3VKH A;  3B13 A;  4O2A E;  4PFP A;  4TZ4 C;  4KBM B;  2Q9Q D;  4I4T E;  2E9X C;  3KBT A;  4DBR A;  4PK5 A;  3ZPO A;  5LXT E;  3OJA A;  2NP9 A;  4QXC B;  2DHR A;  2ZMA A;  3C98 B;  4P09 A;  3RX6 A;  2E9X A;  3LBX B;  2X9Y A;  3O4X E;  3F31 A;  3K3Q C;  1MMD A;  4Z8X A;  1T98 A;  3N2G E;  5FXZ A;  2JRK A;  2NTX A;  5HXC A;  1WLX A;  4UV9 B;  4TV8 E;  2H3R A;  1G73 A;  2LT3 A;  3AA0 B;  1SA0 E;  4MAL A;  4OYK A;  4PK4 A;  2MBG A;  3CQX C;  2ZM2 A;  4DND A;  2CXD A;  2KXP B;  2XUE A;  3ZLI A;  4GYS A;  4NUV A;  3RPU A;  4HN9 A;  2LSK A;  2XAG B;  3SRZ A;  1LRZ A;  4IST A;  3CX8 B;  3I0Q A;  5KDM C;  4PAG A;  3R6N A;  2WMN A;  4QXB B;  4G2A A;  4ZI2 D;  2A3D A;  3FB2 A;  3J9X 1;  3Q9D A;  4A56 A;  2X9W A;  2KMF A;  3ZYM A;  3R84 B;  2C5I T;  2LHN A;  5FP3 A;  2E9X D;  4H9O C;  3E22 E;  4NUU A;  4KMC A;  4C90 A;  4X20 E;  1G8X A;  5TAO A;  2KWI B;  4AQF A;  3K3O A;  1U4Q A;  2PBI A;  2VKD A;  4IIJ E;  2VL8 A;  4H9Q C;  1VRB A;  3O1H A;  4O4J E;  1B7T A;  3N5L A;  1CUN A;  2WBL A;  3BQI A;  3AVR A;  3D0T A;  4ASK A;  1ZV4 X;  1UCU A;  3MK7 C;  4ZOL E;  4JLE A;  2HPJ A;  4H9P C;  2A2F X;  3U3I A;  3ZMV B;  3KV5 A;  2YEV C;  4L0R A;  3I9W A;  5CB4 E;  4TX5 A;  5KX5 E;  3ESL A;  2Y48 B;  1HCI A;  3Q5X A;  1X79 A;  5LP6 E;  2X66 A;  1Z0P A;  3C4W A;  2UXN B;  4BJM A;  2LE8 A;  3O1J A;  2JMK A;  5M4Y A;  3ZC1 A;  2CA5 A;  3V5U A;  4EYY R;  2H7V C;  1KNZ A;  2PG8 A;  4H63 V;  4PJN A;  2VK9 A;  3MKD A;  3MAC A;  4TV9 E;  5FXX A;  4HGA A;  3RYF E;  4M1P A;  1WRD A;  4O4H E;  5L3E B;  4CI1 B;  1D0Y A;  3WAJ A;  4ZS2 A;  2NW7 A;  4YFS A;  4QX8 B;  5HWX A;  3EUH A;  3PTR B;  2X51 A;  4EZH A;  5KMG P;  3LK2 B;  3Q5W A;  4PJL A;  3N9L A;  4BJN A;  4P0A A;  2XAS B;  2W61 A;  1NAF A;  5JRE A;  5HWY A;  2CLY B;  2L3L A;  5IYZ E;  5LGU B;  4FI5 A;  4AI6 A;  5JDN A;  2LJL A;  3PU3 A;  2K48 A;  4TN7 B;  3QK6 A;  3NRY A;  5FYM A;  1QSD A;  4IGU A;  2N2N A;  4L9I A;  4DMV A;  3C64 A;  2I59 A;  3K3N A;  2IW5 B;  5JDH A;  4K0U A;  4UVB B;  3ZYL A;  1D1C A;  4TUY E;  3I0O A;  2W63 A;  4JEH B;  1S35 A;  2D5U A;  3EDU A;  1MND A;  4PK6 A;  1HG5 A;  2YU1 A;  3OYX A;  3CWZ B;  3DP7 A;  5LOV E;  3PDY A;  4UF0 A;  1QUU A;  5J1G A;  3RRC A;  5LA6 E;  1EZ3 A;  3FXE B;  5EK3 A;  3HKC E;  1SHZ C;  4IE4 A;  3FXD B;  3I1A A;  1H7C A;  5LBQ B;  4H9N C;  1AJ3 A;  4H9R C;  5BMV E;  1YD8 G;  4E7Z A;  2EHO B;  3IBP A;  2X9X A;  3GN5 A;  5LGN B;  4AQG A;  2W62 A;  3ZC0 A;  3SOL A;  2DNX A;  2CEA A;  2V7I A;  4OYJ A;  5DAB A;  3AAE B;  2NW9 A;  4EB6 E;  5JR9 B;  5FNV E;  4YJ3 E;  3W15 B;  2HH7 A;  3DJB A;  2CXF A;  4UEM A;  5LJM A;  4EYU A;  4QWN B;  1WYB A;  1D1B A;  4KUM B;  5LGT B;  3M65 A;  3P7I A;  5JDF A;  4ZS3 A;  3AVS A;  5LHG B;  4PW8 A;  3C4X A;  3PUS A;  5FY1 A;  3KV4 A;  5L3D B;  2YIN A;  3C4Z A;  4ZI3 C;  3LBX A;  3IHR A;  2LSG A;  3QC9 A;  5E0O A;  1NWM X;  3NRX A;  2IC9 A;  3DTO A;  4GK0 E;  5JRC B;  3LJC A;  2ODU A;  4WBO A;  5JR9 A;  2E8I A;  3ZCJ A;  3BQK A;  4AQF C;  3MZK B;  2QGS A;  4AXP A;  1BR0 A;  3QUJ A;  1FMV A;  2VWA A;  1ZHC A;  2LSJ A;  2D2S A;  2DWK A;  3IF8 B;  2LSI A;  3KFW X;  2Y8D A;  3KV9 A;  2X67 A;  3AAA B;  3NZQ A;  4GOU A;  3CML A;  2ACX A;  2KZ7 B;  3N2K E;  1KK7 A;  4AKL A;  2JPF A;  5HXR A;  3CPZ A;  3CX6 B;  3ANW B;  4QX7 B;  2LOP A;  3A5X A;  4I55 E;  3UTK A;  4JUY A;  4MFR A;  5IHY A;  3ZYK A;  3GA8 A;  3KV6 A;  4HFV A;  4UIG A;  5LYJ E;  4EAH A;  2MYS A;  3NZP A;  1MNE A;  3BK9 A;  3UFE A;  2JQQ A;  2KND A;  2XAQ B;  1D0X A;  2K24 A;  4DBQ A;  1FEW A;  4OHF A;  2CCQ A;  1ZEE A;  2V7K A;  4IE6 A;  2IAK A;  3Q2M A;  4IDZ A;  4ZI3 D;  1HG2 A;  2RA1 A;  3MJX A;  4O8S A;  3EDV A;  3MXZ A;  5JDG A;  4CZZ B;  2CE7 A;  4N78 D;  4CXX A;  4ZI7 E;  1OWA A;  1MMN A;  3LFM A;  3O1I A;  2Z6E A;  5JDQ A;  4P0B A;  2VB6 A;  4C91 A;  3H37 A;  3PUA A;  5DQW A;  5L3G B;  2Q9Q B;  4ADZ A;  5HYA A;  5FXV A;  4HTE A;  4IE0 A;  3WI3 A;  2LOS A;  2D0T A;  3JC6 C;  3HR0 A;  4MLK A;  4MBQ A;  4YJ2 E;  2D0U A;  3ZMZ B;  4EXT A;  5CA1 E;  2MOZ A;  4J2C A;  3E0Z A;  1IJ6 A;  2MTQ A;  2PFV A;  3ZEF B;  4ILU A;  3RKO A;  3HKB E;  2Q9Q C;  2JJ9 A;  2JMH A;  4GIW A;  2V7J A;  1V9D A;  2M67 A;  3L3P A;  5LNK A;  2V26 A;  3PUR A;  5CA0 E;  1FMW A;  5L2L A;  3TKL B;  3AA7 B;  1YKE B;  3GWH A;  2LEH A;  2Q9Q A;  3K8P C;  4AKG A;  2DCF A;  3MA9 A;  3HKE E;  3KVB A;  3O9X A;  2CLY C;  4X1Y E;  5GON E;  3N9Q A;  3LK3 B;  3I9Y A;  2V1D B;  5J2U E;  5J2T E;  5FY0 A;  2VKH A;  2ES0 A;  2Y6X A;  5JQG E;  4U72 A;  1UX4 A;  4AKI A;  2J1D G;  3AA1 B;  1D1A A;  2GK9 A;  3ZMU B;  5LJN A;  3RYC E;  2XAJ B;  3V5S A;  5JH7 E;  4AKR B;  1MIY A;  3VKG A;  3PUQ A;  4O4L E;  2WMO A;  3FBL A;  2IC6 A;  2NTY A;  3CVR A;  2XAF B;  3F2E A;  5FMN A;  3FBZ A;  4L5G A;  3CQC B;  2W00 A;  2E9X B;  1LVK A;  4F6R C;  4ANJ A;  1IAP A;  2W0G A;  3JC6 D;  4GYR A;  2NW8 A;  4BAY B;  3UUM A;  5JDM A;  4I43 B;  2V7L A;  4GK5 E;  2LSY A;  5L3F B;  1US7 B;  4EZ4 A;  4CXY A;  2DWG A;  3BQL A;  3C50 A;  1MIV A;  2CXL A;  2LHR A;  3B57 A;  1S94 A;  4XZC A;  3NBX X;  3VHL A;  3KIN B;  4CQI A;  2KWH A;  1VOM A;  2EHO C;  2WWU A;  4MHC A;  3T8O A;  3LK4 2;  4HE8 A;  2ZLY A;  2VKJ A;  4KP3 C;  4IE5 A;  2X9H A;  5FXW A;  1WYC A;  5HXE A;  5JR9 C;  2QA7 A;  5LHH B;  3N9N A;  4X1K E;  4PJM A;  3SWH A;  5JVD E;  3PU8 A;  5EK4 A;  2L8K A;  2EHO A;  1MMG A;  3F57 A;  4YHJ A;  2BVL A;  5L3B B;  1HS7 A;  4QKN A;  2VAS A;  2BDE A;  2UXX B;  2ZM0 A;  4ISS A;  4QXH B;  5HAX A;  2WM9 A;  5EZY E;  3OYZ A;  4FJO A;  3HKD E;  5DJQ C;  3N9P A;  2A72 A;  4UXN B;  3GMI A;  2P9B A;  4EOZ B;  3P8C D;  5F3J A;  1HTJ F;  4U74 A;  2CWY A;  2BVM A;  4O4I E;  3N9O A;  3OKQ A;  4WNK A;  3RC3 A;  2PJQ A;  1HFA A;  3CX7 B;  5FY7 A;  3ZMT B;  4UV8 B;  3ZJ2 A;  4G63 A;  3ETV A;  3HI2 A;  3PUG A;  4IE7 A;  1MMA A;  4I50 E;  3CKD A;  5EK2 A;  5JRC A;  4YLH A;  4JEU B;  3AA6 B;  2L9Q A;  5LBM A;  4BA9 A;  1U5P A;  4UVA B;  4B6X A;  4WW0 A;  2KT9 A;  5ADX L;  3FHN A;  3AB3 B;  1OXZ A;  5ETW A;  4PNI A;  5L3C B;  3ZN1 B;  1FIO A;  2EHO D;  2G0U A;  4PJJ A;  4UVC B;  2VKO A;  3KVA A;  2LM9 A;  5H6R B;  3LG7 A;  5A1L A;  3RYI E;  4HEA A;  3C51 A;  2N9D A;  1E1H B;  2DLR A;  4H63 H;  3ETU A;  3KBU A;  1LKX A;  4QHO A;  5JDL A;  5LHI B;  1YKH B;  2X68 A;  2ZM8 A;  5C8Y E;  4AKH A;  3E08 A;  4ZHQ E;  3ANW A;  3SS1 A;  2CMR A;  2CWO A;  5DQV A;  3HL6 A;  5F8P A;  3L09 A;  2HPL A;  3N2O A;  1HF8 A;  1LVF A;  2WSS V;  4H9S E;  2NWB A;  3WAK A;  2XHE B;  2H7O A;  3UUL A;  1BR2 A;  1BR1 A;  2DI4 A;  3ZMS B;  5LG4 A;  3EVY A;  1ZKE A;  2KLQ A;  1O3X A;  2NOX A;  1MIW A;  1IZN B;  3CQG B;  2XTL A;  3U78 A;  4V1A v;  1HX8 A;  1D0Z A;  2RP4 A;  4UEL A;  4XAX B;  2XAH B;  2K9A A;  4WBN E;  1IJ5 A;  3H3A A;  3ONX A;  4PFO A;  5LCY A;  4O2B E;  5HXS A;  2BZB A;  3S4U A;  2V7M A;  4DO0 A;  2ODV A;  3RRW A;  1BR4 A;  2K5B B;  3ZN0 B;  3HA4 A;  3PE0 A;  3ZCI A;  2WAU A;  4IHJ E;  2C0S A;  3RH3 A;  2B1E A;  1YW0 A;  2KIN B;  4OFZ A;  3J7Y q;  2SPC A;  1UX5 A;  1Y64 B;  4E7S A;  2YK0 A;  4X1I E;  4CI3 B;  2N1G A;  2XQY A;  3OBV E;  4HKA A;  4OK0 A;  4ERR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...