4OYKA

Structure of hoip pub domain bound to otulin pim
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
173
structure length
173
Chain Sequence
ERAFLVAREELASALRRDSGQAFSLEQLRPLLASSLPLAARYLQLDAARLVRCNAHGEPRNYLNTLSTALNILEKYGRNLLSPQRPRYWRGVKFNNPVFRSTVDAVQGGRDVLRLYGYTEEQPDGLSFPEGQEEPDEHQVATVTLEVLLLRTELSLLLQNTHPRQQALEQLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase RNF31
publication title Molecular Basis and Regulation of OTULIN-LUBAC Interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 54
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2014-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09409 PUB PUB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4oykA00
4OYJA 4P0AA 2HPJA 2CM0A 4P09A 4JUYA 4P0BA 2CCQA 2HPLA 4OYKA 5LJNA 2D5UA 5LJMA
chains in the Genus database with same CATH superfamily
4IGUA 4WBNE 2XPKA 2KINB 3AAIA 2N2NA 2J4GA 3RX6A 1E1HB 4PJLA 2Z6EA 2CBIA 1U4QA 4ZHQE 3RC3A 1ZHCA 1FJGT 2XTLA 3JC6C 4JI8T 2BG9C 4PJNA 2XJ7A 3TLUA 3DTOA 5IHYA 3EDVA 4U2ZA 2XASB 3KV9A 1J5WA 4KI0F 4LMLA 4QKNA 3ZYKA 4H9RC 3PJAJ 2UUBT 2BVMA 4DV0T 2YN6A 4E7ZA 1QSDA 2YDSA 3F2EA 1KNPA 1YXRA 3UU8A 3AEBA 5HXEA 1UK5A 3ZC1A 4YJ3E 5JDGA 4DR7T 4X1YE 2IC9A 3NKZA 2X67A 3AA6B 3T1YT 5JREA 4B3MT 3ZMSB 2D5UA 4B3RT 5FP3A 2BZBA 1E2AA 5LG3A 5FY0A 3ETUA 1VCTA 3FBLA 4B3ST 3KBUA 2JQKA 1NWMX 4JI5T 1MIWA 4EIWA 3FZHB 1E7PA 2CXFA 4QX8B 3AVSA 4LFAT 2VURA 3PUZF 4QXBB 4XBFB 4ILUA 1N32T 3G06A 3CQXC 3EHZA 3ONJA 3W15B 2E5VA 4LF5T 5LG4A 4P1NA 2E9XD 2IMLA 2E9XA 3GMIA 3SFEA 4K0KT 3DJBA 2WS3A 3RIUC 4DVDA 3JAFA 4HFVA 4ISSA 2HH7A 4HGAA 3LK2B 4EXTA 3L3PA 4HWCA 4IDNA 3E0ZA 1WFDA 3UTKA 4JI7T 4BA9A 1V9DA 5JTGA 2V8SV 2M67A 4B6XA 2HPJA 4O4LE 3OJAA 2OV9A 3UUNA 4N78D 5ABHA 2H3RA 5DABA 5AQOB 3VU7H 4DV2T 2IAKA 1W0AA 4AQFC 3C64A 2X51A 2L9QA 4CI3B 2LRKA 5EK4A 4UR9A 4YSYA 3WAKA 3P7IA 1XDOA 2KWIB 2WMNA 4DV5T 3LG7A 1VCSA 3LK42 3Q5WA 3AE6A 1HS7A 1SE7A 5HWYA 3AE2A 5JDLA 5JR9A 2EHOC 5L3EB 2QRXA 4OK0A 2L3LA 5L4EA 3ZCJA 3AA7B 4Z91A 2LEHA 4YT0A 2WB5A 2YDQA 1CUNA 2UXDT 4MHCA 2LM9A 4PK5A 4GK0E 4KMCA 5HXRA 4JI4T 3NVOA 2JMHA 4DV7T 3ZYMA 3I0OA 4NIQA 4IDQA 3RPUA 3RGLA 4TX5A 2X0LB 4DMVA 2NW7A 1UURA 1KEYA 2DWGA 2BKOA 4IDZA 1YQ3A 3HKCE 2H88A 4TV9E 2CXDA 3AE8A 1MMNA 3CIRA 1HX1B 4IL9A 4U3CA 3RHWA 2WWVA 3B5MA 3N9PA 1FEWA 5HXHA 4JEHB 4KHPT 2IIUA 4ERRA 4NUUA 1UX4A 3PU8A 5ABGA 3ANWA 5KDMC 1HTJF 3K3OA 4UVAB 1CHUA 2BS3A 4EGWA 2KZ7B 3PDYA 2LOSA 5FMNA 1D0YA 2X9HA 4GYSA 3QNUA 2JJ9A 4NXNT 1SA0E 4U7IA 3UQ4A 4X1KE 2HN1A 3I0QA 4EAHA 3VKGA 2XQ5A 5H6QB 1O3XA 2ZMAA 2ZLYA 3QB5K 2WM9A 4YXDA 2Y6XA 1NAFA 3AXJA 3LDQB 2JRKA 4KBMB 1T72A 5BMVE 3PUSA 1ZP0A 2FJBA 3K3NA 1LKXA 3T8OA 4UV9B 2WZHA 3AE3A 5CA0E 2VKOA 4IHJE 4YJ2E 1OEDB 4WYVA 2UXXB 2BG9E 4I43B 2V6YA 3I1AA 1US7B 1KNRA 3AEAA 3PUQA 2VWAA 1IBKT 3ZKRA 2LE8A 2MYSA 2W63A 2XQ3A 3P4SA 2NP9A 4IT4A 2C5JA 5C3JA 2LT3A 3BK9A 3ZMZB 4LMJA 3UFEA 2MBGA 4KHZF 3UFGA 3GN5B 2FUPA 4QXHB 5ABFA 3N9QA 4K0UA 2QGSA 1NENA 2PTFA 4H63V 4LFBT 3O4XE 1KK7A 5FXVA 1KNZA 4PK6A 4ZZCA 2BDEA 5FXZA 3PE0A 1WYBA 4LMKA 1YD8G 2I6HA 3LFMA 2RA1A 5AQVB 4H9PC 4ILAA 2B76A 4OYKA 3UUXB 5HWXA 4EV6A 3KV5A 4YLHA 2N1GA 4X1IE 1NEKA 3TLTA 1DU2A 4UVCB 5AQMB 1U5PA 2JIWA 2SPCA 3RIAA 2KWHA 3N5LA 3CQGB 5HEJA 3J9X1 4Z8XA 5L2LA 1XWMA 3PURA 3RQUA 4KUMB 3O1IA 2XQ7A 1J1JA 3LJCA 4DBRA 4YSXA 5LB7B 1WYCA 5FVKA 4IE7A 4AIUA 4U2YA 3HA4A 3FZMB 5F3JA 2CPTA 2J62A 2KMFA 2W67A 3NZPA 4FI5A 2NW8A 3ZT5A 4ZZBA 5FY1A 2XAQB 3EDUA 2OLTA 4CN1A 3BQLA 2IDOB 3ZEFB 4HWDA 4DV1T 4O4JE 3GWHA 3AE5A 3TLSA 2E5LT 4AKLA 4UF0A 2D0TA 3RRWA 3Q5DA 1L0VA 3J7Yq 3E08A 3C4XA 1ZOYA 3VHLA 2WCAA 1VOMA 5DQVA 4GKJT 4OYJA 3IF8B 3CKDA 3D0TA 3DP7A 4HN9A 5LXTE 5J2UE 2BBJA 2K5BB 1N36T 2LSKA 5JQGE 1BR0A 4F6RC 5HEOA 3HKBE 5F8PA 2XQ6A 4YTMA 4C90A 5AQNB 1OXZA 3PTRB 3M3ZB 4ZI3C 3KFWX 2PBIA 3ZN0B 4DIDB 5J0ZA 2W66A 4A5XA 5IYZE 5AQKB 1FMWA 3ZT7A 3ZLIA 3ONLC 2KT9A 2DHRA 3AE9A 3NBXX 2D9DA 2WDRA 1N34T 4EYYR 2FJEA 3R84B 3P4QA 2E9XB 3C4ZA 3SOLA 5JRCA 4CN6A 5AQTB 3OBVE 4IREA 3VRBA 2WDVA 4UEMA 2I0MA 4PNIA 4BAYB 3PUGA 4U74A 3AE7A 2XQ8A 4MFRA 2NR4A 2WBLA 4I0UA 5L3FB 4OFZA 3MKDA 3PV0F 4YSZA 4TN7B 2FJAA 3HI2A 2M6BA 3KV6A 2D0UA 2XAFB 3OTOT 2JQ9A 5HXCA 3CWZB 4YTPA 2ACZA 4ZI2D 5JDNA 2R6GF 4DV6T 2UXNB 5AQHB 2LKGA 2DLRA 3UU4A 4DMWA 4AI6A 3UUMA 3QUJA 3X1DA 5C8YE 3RIFA 1HNZT 5L3GB 4CI1B 2UXCT 4I50E 2D2SA 4HE8A 1UUSA 3P4WA 4YTNA 1FMVA 5JR9B 2UXBT 4IE6A 2VQFT 2X9YA 2UU9T 5KX5E 4O4HE 4Q25A 1IJ5A 3KV4A 4P09A 4JUYA 5AQIB 3FXDB 4IE5A 1N33T 3TLVA 3ESLA 4TNWA 3AVRA 1KF6A 1MMAA 5H6RB 2ES0A 4IDPA 2J47A 2A9UA 2BKNA 2V7KA 4BJNA 4X66T 4X62T 2YEVC 3FB2A 2LLYA 4LF8T 2DCFA 3EVYA 1T7SA 4OHFA 4AXPA 3O9XA 3JC6D 1MNDA 4X64T 2BG9A 2X9XA 3UU6A 2K48A 5BR8T 2Q9QB 3ABVA 2LOPA 2WU2A 2B1EA 1IAPA 5LNKA 3L8RA 5IWAT 3WAJA 5FL1A 3RYCE 4J2CA 4V1Av 5LP6E 3NWIA 2CRBA 1LRZA 2K9AA 4Z90A 4QHOA 4HWIB 4EYUA 2V7MA 2NW9A 2MAWA 3ANWB 4ASKA 5JVDE 1YW0A 3RF1A 3FZFB 4X65T 1OEDC 4LF4T 2VVSA 2W61A 1HF8A 4CXXA 2VKHA 5FNVE 3B13A 3RC8A 4JI2T 2CA5A 2LRLA 3IA3A 4PAGA 2GK9A 2V7JA 3Q2MA 3N2KE 4ZOLE 4JI3T 2VKDA 3ZJ1A 2X9WA 5AQLB 1FIOA 2YKSA 2XQ9A 5CFBA 3VRAA 3MACA 2CE7A 4JBWF 4U72A 3AXJB 4HFIA 2VVNA 3PJAA 2G0UA 3P4RA 1WCRA 1HNWT 3RQWA 1IBLT 1W09A 3HKDE 3T1HT 4WW0A 1HG2A 1HFAA 4IL4A 3O1HA 2C5IT 1D0XA 4ADZA 2V6YB 2CM0A 1G8XA 5CJ5A 1SUMB 4HFCA 1QUUA 1W9RA 2VL8A 4PFPA 4P0AA 3RIUA 2BS4A 1LVFA 5HYAA 2WDQA 4MALA 4DUZT 3LBXA 3CK6A 3PU3A 4ILCA 2K3WA 1ZKEA 5L3CB 1S94A 4UV8B 2ODUA 5LHHB 2HHHT 4EZHA 1LVKA 2PFVA 2Y8DA 2X66A 2UUCT 2J1DG 4AQFA 2CWOA 3AAEB 4ZS3A 2MOZA 4TWHA 3FBZA 3GA8A 3KVAA 5LJNA 4QX7B 4L0RA 3RYIE 5AQPB 4U7YA 1XMOT 5LGUB 2EHOD 2VQET 2EHOA 4TZ4C 5LYJE 2BKPA 4WBOA 1BR2A 2NTXA 5ABEA 2OA5A 2CXLA 1W0BA 4TWFA 5JDHA 1D0ZA 4UVBB 3QOFA 4EEDA 4FJOA 4CN4A 3UUBA 2WY2A 4ZXLA 5FXXA 3RRCA 3IEEA 4JEUB 1HX8A 4ZI7E 1IJ6A 1YQ4A 2RP4A 5EK3A 3UT5E 4TUYE 2V7IA 5C2TA 2NWBA 4UELA 3ZMUB 3SWHA 5HEHA 2PJQA 3AE1A 3CQCB 2NOXA 4GKKT 2KNDA 2XZEA 3BQKA 4HFHA 3EI0A 4H9OC 4U33A 3LK3B 4YY3T 5DQWA 3CVRA 1Y64B 3MZKB 3UU5A 1B7TA 2CLYB 2XAGB 5FVLA 5JDQA 1AJ3A 3ZSTA 5KXJA 4WZXA 2JMKA 4GOUA 5LMUT 1Z8UA 2X68A 1UGOA 4MLKA 3C50A 5JH7E 4GK5E 4A56A 5HEGA 2DWKA 2E9XC 4ZS2A 3CPZA 3VR9A 1GQEA 4YFSA 2YDRA 5LMNT 5AQGB 3KBTA 2H7VC 4JLEA 3SRZA 3FHNA 2CHOA 3ZYLA 2CBJA 4E7SA 1M62A 2MTQA 2A2FX 5ADXL 2W4XA 5LGTB 3CX6B 3ETVA 5L3DB 1I94T 4P0BA 3ZSSA 3B57A 4ZEYA 3VR8A 2QVAA 3OVUA 4CI2B 2LKHA 2LSJA 4PJMA 1Z0PA 2E2AA 2CEAA 2WWUA 4AKRB 2KXPB 5A1LA 4DBQA 4NXMT 5J1GA 1XDPA 3QK6A 1YKEB 3ZMTB 2VB6A 3SS1A 1QLBA 2H89A 3AAAB 4JI6T 3N2GE 2DI4A 4AQYT 5JRCB 5HCMA 5GONE 3KVBA 3KDSE 2FJDA 3MA9A 4BJMA 4ISTA 4DUYT 1WLXA 2W62A 4KP3C 5JR9C 3NRXA 1Y01A 4QH4A 3N9NA 3K1SA 3C51A 5FY7A 4XZCA 4H9SE 3ZT6A 4L9IA 4AKGA 3N9LA 4H63H 4JI1T 4CXWA 2WMOA 2LJLA 3HL6A 2Y48B 3C4WA 3EUHA 3OYXA 2KSRA 2A72A 5M4YA 1BR4A 2YU2A 4HFEA 4WNKA 5AFUL 3RH3A 3QC9A 2VL0A 5CGMA 3MK7C 4U31A 5ETWA 5AQUB 1OEDE 1MMGA 1VRBA 2ZM0A 3CMLA 5HAXA 4LF7T 2DNXA 5FXWA 1HR0T 5LBMA 4IDOA 3OPCA 4LFCT 3P50A 5L3BB 3IHRA 4DO0A 2E8IA 2XQAA 2Q9QC 3N9OA 4H9QC 4LF9T 4GYRA 2VK9A 3AE4A 2C0SA 5HXSA 4YHHT 5AQFB 3A5XA 2IW5B 3ZJ2A 1T8BA 2DL1A 3PUAA 4A97A 4EOZB 4PFOA 5LBQB 1KFYA 3Q5EA 5CA1E 2BBHA 3H3MA 3P4PA 2WQYA 2XHEB 2YOEA 4HWHA 3UQ7A 3WI3A 3BQIA 5LJMA 1ZEEA 5LHGB 2LHNA 3MXZA 4I4TE 3P8CD 1XNQT 3UULA 2BG9B 4NUVA 3ZPOA 1T98A 2JQHA 2L8KA 3AA1B 3U78A 4F8HA 4NPPA 3F57A 5AQSB 1XMQT 2H7OA 3O1JA 1WRDA 1HG5A 1YKHB 3AA0B 2ZM6T 3M65A 4DR5T 3PUVF 2F4VT 3R6NA 2V5CA 2WAUA 2CWYA 1IBMT 3QB5A 3LSVA 3ZMVB 3VKHA 2QA7A 3C98B 4X5TA 4PJJA 1HNXT 2I59A 3I9YA 1WR6A 4AKHA 4DR6T 2X0YA 2WSSV 2IHR1 4DV3T 3F31A 2QYWA 4IE0A 1S35A 2XY8B 3RYFE 3I9WA 4HEAA 4UIGA 4ZI3D 3MJXA 3UU3A 2VASA 3N2OA 2LHRA 2K24A 2CMRA 3NZQA 4EB6E 3E22E 4DNDA 3KINB 2YU1A 3Q9DA 3JADA 1XZYA 3NRYA 4GIWA 3EABA 2XUEA 3TKLB 5EK2A 1X79A 3A7MA 3RLFF 3U3IA 5FYMA 1OWAA 3ZN1B 1I6ZA 3EAMA 4YHJA 4O2BE 4MBQA 1BR1A 3ZCIA 2HN2A 3RYHE 2LSIA 1ZV4X 2Q9QD 2Q9QA 4JV5T 3V5UA 2XAHB 1D1CA 3OYZA 4O2AE 3LBXB 4O8SA 2N9DA 1JNRA 4G2AA 4DR4T 4DV4T 1IZNB 4ANJA 5AQJB 2V6XA 1D1BA 2LM2A 2ZM2A 3AEFA 4I55E 3H37A 4QH5A 2XM2A 2XQYA 1UX5A 2YINA 3K8PC 5LA6E 3ZC0A 2W00A 2FBWA 3L39A 1R8IA 4C91A 5E0OA 4H9NC 4CXYA 3RKOA 5JDMA 2M6IA 4L5GA 3A8YC 3HKEE 4HWFA 5ABFB 5HEUA 1UCUA 3TLWA 3H3AA 2EHOB 3FXEB 3PUYF 4JYAT 2CLYC 3JCFA 4A98A 1JNZA 2IUBA 4OX9T 3S4UA 4X20E 2XSBA 5F5WA 3K3QC 5AQQB 3AECA 1H7CA 2LSGA 3ONXA 4XAXB 2LSYA 1SHZC 4DR2T 3V5SA 2YK0A 1X9BA 4HFBA 3CX7B 2XQ4A 4DR1T 4ILBA 2ZM8A 3OKQA 4UXNB 1HCIA 1MIYA 4TNVA 4QH1A 4HTEA 5JDFA 5CB4E 2V1DB 3AEEA 2PG8A 4TWDA 4IE4A 2NTYA 5L4HA 4G63A 5EZYE 4PK4A 2A3DA 5LCYA 4AQGA 2JPFA 2KLQA 3AEDA 1J5ET 5DJQC 4QWNB 4TV8E 4HFDA 5HCJA 4B3TT 4O4IE 4AKIA 1XNRT 1OEDA 2HPLA 4LF6T 1EZ3A 2WZIA 5TAOA 5J2TE 5LOVE 2P9BA 5FL0A 4JI0T 3N9MA 5IUXA 1D1AA 3FZLB 2VKJA 4CZZB 4EZ4A 4UF0B 2W2UA 4QXCB 1MNEA 4COFA 2XM1A 4KX6A 3SFDA 1G73A 3GN5A 2C5KT 3CX8B 3RI5A 3Q5XA 3HR0A 5LHIB 1WR0A 2JQQA 4ZI2C 5AQRB 2W0GA 2CHNA 2V7LA 3PUXF 2UUAT 3IBPA 5KMGP 5LGNB 2ODVA 2ACXA 3AB3B 5L47A 2XAJB 4AISA 2V26A 3RKGA 4IIJE 2AXDS 4HKAA 3FZKB 2MPKA 3L09A 4DR3T 5FKYA 3AEGA 2IC6A 2XSAA 1MIVA 2BS2A 1MMDA 4M1PA 2V5DA 3JAEA 4PW8A 2X0HA 2BVLA 4EEBA 1M7KA 4CQIA 2AE9A 2WP9A 2RPAA 2CCQA 3PUWF 2WU5A
chains in the Genus database with same CATH topology
1ZEEA 4IGUA 5FNVE 5LHGB 2LHNA 4WBNE 3MXZA 3B13A 3GN5B 2KINB 3P8CD 4I4TE 4QXHB 3RC8A 3AAIA 2N2NA 3N9QA 2CA5A 3RX6A 4K0UA 1E1HB 4PAGA 2GK9A 3UULA 4NUVA 2QGSA 4PJLA 4H63V 2V7JA 2Z6EA 3Q2MA 1U4QA 3N2KE 3O4XE 4ZOLE 2VKDA 3ZPOA 1T98A 4ZHQE 3RC3A 2L8KA 1KK7A 1ZHCA 5FXVA 3ZJ1A 2X9WA 1FIOA 3AA1B 2XTLA 3U78A 3JC6C 3F57A 4PJNA 1KNZA 3MACA 2CE7A 4PK6A 4U72A 2BDEA 5FXZA 3PE0A 2H7OA 1WYBA 3DTOA 5IHYA 1YD8G 3O1JA 3EDVA 1WRDA 2G0UA 3LFMA 1HG5A 2RA1A 2XASB 3KV9A 1YKHB 3AA0B 3M65A 3HKDE 4H9PC 3R6NA 4QKNA 4WW0A 2WAUA 3ZYKA 4H9RC 1HG2A 1HFAA 3O1HA 2C5IT 2BVMA 4OYKA 1D0XA 3UUXB 4ADZA 5HWXA 3ZMVB 3VKHA 4E7ZA 1QSDA 3KV5A 2CM0A 2QA7A 1G8XA 3C98B 4YLHA 2N1GA 4X1IE 4PJJA 4UVCB 1QUUA 3F2EA 2VL8A 2I59A 3I9YA 1WR6A 4PFPA 4AKHA 4P0AA 1U5PA 2SPCA 2KWHA 3N5LA 3CQGB 3J9X1 4Z8XA 1LVFA 5HYAA 5L2LA 2WSSV 3F31A 3PURA 5HXEA 4IE0A 4KUMB 3O1IA 3ZC1A 1S35A 4YJ3E 5JDGA 4MALA 3LJCA 3RYFE 4X1YE 2IC9A 3I9WA 2X67A 4DBRA 4HEAA 1WYCA 4UIGA 4ZI3D 3AA6B 3MJXA 3LBXA 4IE7A 3PU3A 2VASA 1ZKEA 3N2OA 5L3CB 1S94A 2LHRA 3HA4A 5JREA 3ZMSB 2D5UA 5F3JA 2KMFA 4UV8B 3NZPA 2K24A 2CMRA 4FI5A 2ODUA 5LHHB 3NZQA 4EB6E 3E22E 5FP3A 4DNDA 2BZBA 3KINB 2NW8A 2YU1A 3Q9DA 5FY0A 4EZHA 3ETUA 1LVKA 2PFVA 5FY1A 2Y8DA 2X66A 2XAQB 3EDUA 3FBLA 2MBGA 2J1DG 3KBUA 1NWMX 3NRYA 4AQFA 2CWOA 3BQLA 4GIWA 2XUEA 3AAEB 3ZEFB 4O4JE 3GWHA 3TKLB 5EK2A 1MIWA 4ZS3A 2MOZA 4EIWA 1X79A 3FBZA 3GA8A 4AKLA 3U3IA 2CXFA 3KVAA 4QX8B 3AVSA 2D0TA 1OWAA 4QX7B 4UF0A 5FYMA 3RRWA 5LJNA 3J7Yq 4QXBB 3E08A 3ZN1B 3C4XA 4L0RA 4XBFB 3RYIE 4ILUA 3VHLA 1VOMA 3CQXC 4YHJA 3W15B 5LGUB 2EHOD 5DQVA 4O2BE 4MBQA 1BR1A 2EHOA 4OYJA 3ZCIA 4TZ4C 3RYHE 5LG4A 2LSIA 5LYJE 3IF8B 4WBOA 2E9XD 1BR2A 3CKDA 2E9XA 2NTXA 3D0TA 3GMIA 3DP7A 2OA5A 1ZV4X 3DJBA 2Q9QD 2CXLA 4DVDA 4HN9A 2Q9QA 5LXTE 5JDHA 1D0ZA 2K5BB 5J2UE 4UVBB 2LSKA 4FJOA 4HFVA 3V5UA 4ISSA 5JQGE 2XAHB 1D1CA 5FXXA 1BR0A 3OYZA 2HH7A 4HGAA 4O2AE 3LK2B 4F6RC 3LBXB 3RRCA 4EXTA 3L3PA 4O8SA 3IEEA 2N9DA 3HKBE 3E0ZA 5F8PA 3UTKA 4G2AA 4JEUB 4BA9A 1HX8A 1V9DA 4ZI7E 1IJ6A 4C90A 2RP4A 1OXZA 5EK3A 3PTRB 2M67A 3UT5E 4B6XA 2HPJA 4TUYE 1IZNB 4O4LE 3OJAA 2V7IA 4ZI3C 4ANJA 3KFWX 2PBIA 1D1BA 3ZN0B 2ZM2A 2NWBA 4UELA 4I55E 3H37A 2XQYA 1UX5A 2YINA 3ZMUB 3SWHA 3K8PC 5LA6E 3ZC0A 2PJQA 4N78D 3UUNA 2H3RA 2W00A 3CQCB 2NOXA 5IYZE 5DABA 2KNDA 4C91A 5E0OA 3VU7H 3BQKA 2IAKA 4H9OC 1FMWA 3ZLIA 4AQFC 3LK3B 3C64A 2X51A 4H9NC 3CVRA 5DQWA 4CXYA 3RKOA 2L9QA 2KT9A 5JDMA 2DHRA 4L5GA 1Y64B 3MZKB 4CI3B 3NBXX 5EK4A 3HKEE 1B7TA 2CLYB 1UCUA 2XAGB 5JDQA 3WAKA 1AJ3A 3P7IA 2KWIB 2WMNA 4EYYR 3H3AA 2EHOB 3LG7A 3LK42 3FXEB 3Q5WA 3R84B 2JMKA 1HS7A 4GOUA 5HWYA 2X68A 2CLYC 2E9XB 3C4ZA 3SOLA 5JDLA 5JRCA 4MLKA 5JR9A 3C50A 3OBVE 2EHOC 5JH7E 4GK5E 3S4UA 4X20E 5L3EB 4A56A 4OK0A 4UEMA 2L3LA 2DWKA 4PNIA 3ZCJA 2E9XC 4BAYB 3PUGA 4U74A 3K3QC 3AA7B 4MFRA 2LEHA 3CPZA 1H7CA 4ZS2A 4YFSA 2LSGA 2WBLA 3ONXA 3KBTA 5L3FB 4OFZA 2H7VC 4XAXB 4JLEA 3MKDA 3SRZA 4TN7B 2LSYA 1CUNA 3FHNA 3HI2A 4MHCA 2LM9A 1SHZC 3ZYLA 4PK5A 4E7SA 4GK0E 4KMCA 5HXRA 3V5SA 2YK0A 3KV6A 2D0UA 2XAFB 5ADXL 2MTQA 2A2FX 2JMHA 3CX7B 3ZYMA 3CX6B 3ETVA 3CWZB 5HXCA 5L3DB 3I0OA 5LGTB 4P0BA 4ZI2D 2ZM8A 5JDNA 3OKQA 3B57A 4UXNB 1HCIA 1MIYA 2UXNB 3RPUA 4CI2B 4TX5A 2DLRA 2X0LB 4HTEA 2NW7A 5JDFA 4DMVA 2LSJA 4PJMA 5CB4E 1Z0PA 4DMWA 2V1DB 4AI6A 3UUMA 2DWGA 2CEAA 2WWUA 2PG8A 3QUJA 4IE4A 2NTYA 4AKRB 4G63A 2KXPB 5EZYE 5A1LA 4DBQA 4IDZA 4PK4A 5J1GA 3QK6A 1YKEB 3ZMTB 5C8YE 2VB6A 3SS1A 2A3DA 5LCYA 3HKCE 4TV9E 2CXDA 5L3GB 4AQGA 4CI1B 2JPFA 4I50E 1MMNA 2D2SA 2KLQA 3AAAB 4HE8A 3N2GE 5DJQC 4QWNB 4TV8E 2DI4A 3N9PA 5JRCB 5GONE 1FEWA 3KVBA 5HXHA 1FMVA 5JR9B 4JEHB 4IE6A 4O4IE 4AKIA 4ERRA 4NUUA 3KDSE 1UX4A 2X9YA 3PU8A 3MA9A 4O4HE 4BJMA 4ISTA 5KX5E 1IJ5A 3KV4A 4P09A 4JUYA 2HPLA 1WLXA 3FXDB 2W62A 4KP3C 3ANWA 4IE5A 1EZ3A 5KDMC 1HTJF 3K3OA 4UVAB 5JR9C 3NRXA 5TAOA 5J2TE 5LOVE 3N9NA 3ESLA 3AVRA 3C51A 5FY7A 4XZCA 2P9BA 4H9SE 1MMAA 2KZ7B 3PDYA 2LOSA 3N9MA 2ES0A 4L9IA 5FMNA 5H6RB 4AKGA 1D1AA 3N9LA 1D0YA 2VKJA 4H63H 4CZZB 4EZ4A 2V7KA 2WMOA 2LJLA 4CXWA 3HL6A 2X9HA 4UF0B 4BJNA 2Y48B 3C4WA 4QXCB 1MNEA 3EUHA 3OYXA 2A72A 2YEVC 5M4YA 4GYSA 1BR4A 1G73A 2JJ9A 2YU2A 1SA0E 3FB2A 3GN5A 2C5KT 3CX8B 2DCFA 4X1KE 4WNKA 5AFUL 3RH3A 3EVYA 3QC9A 4OHFA 4AXPA 3O9XA 3Q5XA 3I0QA 3HR0A 3JC6D 1MNDA 3MK7C 5LHIB 2JQQA 4EAHA 2X9XA 5ETWA 3VKGA 1MMGA 1VRBA 4ZI2C 2ZM0A 3CMLA 2W0GA 2K48A 5HAXA 5H6QB 2V7LA 3IBPA 2Q9QB 5KMGP 1O3XA 2DNXA 2LOPA 2ZLYA 2ODVA 2ZMAA 5FXWA 2B1EA 5LGNB 2ACXA 2WM9A 1IAPA 3AB3B 5LNKA 2XAJB 1NAFA 2Y6XA 3WAJA 2V26A 5LBMA 4IIJE 5L3BB 3IHRA 3RYCE 4DO0A 4HKAA 2E8IA 2JRKA 4J2CA 4KBMB 5BMVE 3PUSA 2Q9QC 3N9OA 4V1Av 5LP6E 4H9QC 1LRZA 2K9AA 3L09A 4GYRA 2VK9A 3K3NA 1LKXA 3T8OA 4UV9B 5CA0E 4QHOA 4EYUA 2VKOA 2V7MA 2IC6A 2NW9A 2C0SA 5HXSA 4IHJE 4YJ2E 2UXXB 1MIVA 3ANWB 4ASKA 3A5XA 2IW5B 4I43B 5JVDE 1YW0A 3ZJ2A 3I1AA 1MMDA 4M1PA 3PUAA 1US7B 4PW8A 3PUQA 2BVLA 2VWAA 4EOZB 2W61A 4PFOA 1HF8A 5LBQB 2LE8A 2MYSA 2W63A 5CA1E 4CQIA 2NP9A 2XHEB 2C5JA 2LT3A 3WI3A 3BK9A 3ZMZB 3UFEA 2CCQA 4CXXA 2VKHA 3BQIA 2CWYA 5LJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OYJ A;  4P0A A;  2HPJ A;  2CM0 A;  4P09 A;  4JUY A;  4P0B A;  2CCQ A;  2HPL A;  4OYK A;  5LJN A;  2D5U A;  5LJM A; 
#chains in the Genus database with same CATH topology
 4IGU A;  4WBN E;  2XPK A;  2KIN B;  3AAI A;  2N2N A;  2J4G A;  3RX6 A;  1E1H B;  4PJL A;  2Z6E A;  2CBI A;  1U4Q A;  4ZHQ E;  3RC3 A;  1ZHC A;  1FJG T;  2XTL A;  3JC6 C;  4JI8 T;  2BG9 C;  4PJN A;  2XJ7 A;  3TLU A;  3DTO A;  5IHY A;  3EDV A;  4U2Z A;  2XAS B;  3KV9 A;  1J5W A;  4KI0 F;  4LML A;  4QKN A;  3ZYK A;  4H9R C;  3PJA J;  2UUB T;  2BVM A;  4DV0 T;  2YN6 A;  4E7Z A;  1QSD A;  2YDS A;  3F2E A;  1KNP A;  1YXR A;  3UU8 A;  3AEB A;  5HXE A;  1UK5 A;  3ZC1 A;  4YJ3 E;  5JDG A;  4DR7 T;  4X1Y E;  2IC9 A;  3NKZ A;  2X67 A;  3AA6 B;  3T1Y T;  5JRE A;  4B3M T;  3ZMS B;  2D5U A;  4B3R T;  5FP3 A;  2BZB A;  1E2A A;  5LG3 A;  5FY0 A;  3ETU A;  1VCT A;  3FBL A;  4B3S T;  3KBU A;  2JQK A;  1NWM X;  4JI5 T;  1MIW A;  4EIW A;  3FZH B;  1E7P A;  2CXF A;  4QX8 B;  3AVS A;  4LFA T;  2VUR A;  3PUZ F;  4QXB B;  4XBF B;  4ILU A;  1N32 T;  3G06 A;  3CQX C;  3EHZ A;  3ONJ A;  3W15 B;  2E5V A;  4LF5 T;  5LG4 A;  4P1N A;  2E9X D;  2IML A;  2E9X A;  3GMI A;  3SFE A;  4K0K T;  3DJB A;  2WS3 A;  3RIU C;  4DVD A;  3JAF A;  4HFV A;  4ISS A;  2HH7 A;  4HGA A;  3LK2 B;  4EXT A;  3L3P A;  4HWC A;  4IDN A;  3E0Z A;  1WFD A;  3UTK A;  4JI7 T;  4BA9 A;  1V9D A;  5JTG A;  2V8S V;  2M67 A;  4B6X A;  2HPJ A;  4O4L E;  3OJA A;  2OV9 A;  3UUN A;  4N78 D;  5ABH A;  2H3R A;  5DAB A;  5AQO B;  3VU7 H;  4DV2 T;  2IAK A;  1W0A A;  4AQF C;  3C64 A;  2X51 A;  2L9Q A;  4CI3 B;  2LRK A;  5EK4 A;  4UR9 A;  4YSY A;  3WAK A;  3P7I A;  1XDO A;  2KWI B;  2WMN A;  4DV5 T;  3LG7 A;  1VCS A;  3LK4 2;  3Q5W A;  3AE6 A;  1HS7 A;  1SE7 A;  5HWY A;  3AE2 A;  5JDL A;  5JR9 A;  2EHO C;  5L3E B;  2QRX A;  4OK0 A;  2L3L A;  5L4E A;  3ZCJ A;  3AA7 B;  4Z91 A;  2LEH A;  4YT0 A;  2WB5 A;  2YDQ A;  1CUN A;  2UXD T;  4MHC A;  2LM9 A;  4PK5 A;  4GK0 E;  4KMC A;  5HXR A;  4JI4 T;  3NVO A;  2JMH A;  4DV7 T;  3ZYM A;  3I0O A;  4NIQ A;  4IDQ A;  3RPU A;  3RGL A;  4TX5 A;  2X0L B;  4DMV A;  2NW7 A;  1UUR A;  1KEY A;  2DWG A;  2BKO A;  4IDZ A;  1YQ3 A;  3HKC E;  2H88 A;  4TV9 E;  2CXD A;  3AE8 A;  1MMN A;  3CIR A;  1HX1 B;  4IL9 A;  4U3C A;  3RHW A;  2WWV A;  3B5M A;  3N9P A;  1FEW A;  5HXH A;  4JEH B;  4KHP T;  2IIU A;  4ERR A;  4NUU A;  1UX4 A;  3PU8 A;  5ABG A;  3ANW A;  5KDM C;  1HTJ F;  3K3O A;  4UVA B;  1CHU A;  2BS3 A;  4EGW A;  2KZ7 B;  3PDY A;  2LOS A;  5FMN A;  1D0Y A;  2X9H A;  4GYS A;  3QNU A;  2JJ9 A;  4NXN T;  1SA0 E;  4U7I A;  3UQ4 A;  4X1K E;  2HN1 A;  3I0Q A;  4EAH A;  3VKG A;  2XQ5 A;  5H6Q B;  1O3X A;  2ZMA A;  2ZLY A;  3QB5 K;  2WM9 A;  4YXD A;  2Y6X A;  1NAF A;  3AXJ A;  3LDQ B;  2JRK A;  4KBM B;  1T72 A;  5BMV E;  3PUS A;  1ZP0 A;  2FJB A;  3K3N A;  1LKX A;  3T8O A;  4UV9 B;  2WZH A;  3AE3 A;  5CA0 E;  2VKO A;  4IHJ E;  4YJ2 E;  1OED B;  4WYV A;  2UXX B;  2BG9 E;  4I43 B;  2V6Y A;  3I1A A;  1US7 B;  1KNR A;  3AEA A;  3PUQ A;  2VWA A;  1IBK T;  3ZKR A;  2LE8 A;  2MYS A;  2W63 A;  2XQ3 A;  3P4S A;  2NP9 A;  4IT4 A;  2C5J A;  5C3J A;  2LT3 A;  3BK9 A;  3ZMZ B;  4LMJ A;  3UFE A;  2MBG A;  4KHZ F;  3UFG A;  3GN5 B;  2FUP A;  4QXH B;  5ABF A;  3N9Q A;  4K0U A;  2QGS A;  1NEN A;  2PTF A;  4H63 V;  4LFB T;  3O4X E;  1KK7 A;  5FXV A;  1KNZ A;  4PK6 A;  4ZZC A;  2BDE A;  5FXZ A;  3PE0 A;  1WYB A;  4LMK A;  1YD8 G;  2I6H A;  3LFM A;  2RA1 A;  5AQV B;  4H9P C;  4ILA A;  2B76 A;  4OYK A;  3UUX B;  5HWX A;  4EV6 A;  3KV5 A;  4YLH A;  2N1G A;  4X1I E;  1NEK A;  3TLT A;  1DU2 A;  4UVC B;  5AQM B;  1U5P A;  2JIW A;  2SPC A;  3RIA A;  2KWH A;  3N5L A;  3CQG B;  5HEJ A;  3J9X 1;  4Z8X A;  5L2L A;  1XWM A;  3PUR A;  3RQU A;  4KUM B;  3O1I A;  2XQ7 A;  1J1J A;  3LJC A;  4DBR A;  4YSX A;  5LB7 B;  1WYC A;  5FVK A;  4IE7 A;  4AIU A;  4U2Y A;  3HA4 A;  3FZM B;  5F3J A;  2CPT A;  2J62 A;  2KMF A;  2W67 A;  3NZP A;  4FI5 A;  2NW8 A;  3ZT5 A;  4ZZB A;  5FY1 A;  2XAQ B;  3EDU A;  2OLT A;  4CN1 A;  3BQL A;  2IDO B;  3ZEF B;  4HWD A;  4DV1 T;  4O4J E;  3GWH A;  3AE5 A;  3TLS A;  2E5L T;  4AKL A;  4UF0 A;  2D0T A;  3RRW A;  3Q5D A;  1L0V A;  3J7Y q;  3E08 A;  3C4X A;  1ZOY A;  3VHL A;  2WCA A;  1VOM A;  5DQV A;  4GKJ T;  4OYJ A;  3IF8 B;  3CKD A;  3D0T A;  3DP7 A;  4HN9 A;  5LXT E;  5J2U E;  2BBJ A;  2K5B B;  1N36 T;  2LSK A;  5JQG E;  1BR0 A;  4F6R C;  5HEO A;  3HKB E;  5F8P A;  2XQ6 A;  4YTM A;  4C90 A;  5AQN B;  1OXZ A;  3PTR B;  3M3Z B;  4ZI3 C;  3KFW X;  2PBI A;  3ZN0 B;  4DID B;  5J0Z A;  2W66 A;  4A5X A;  5IYZ E;  5AQK B;  1FMW A;  3ZT7 A;  3ZLI A;  3ONL C;  2KT9 A;  2DHR A;  3AE9 A;  3NBX X;  2D9D A;  2WDR A;  1N34 T;  4EYY R;  2FJE A;  3R84 B;  3P4Q A;  2E9X B;  3C4Z A;  3SOL A;  5JRC A;  4CN6 A;  5AQT B;  3OBV E;  4IRE A;  3VRB A;  2WDV A;  4UEM A;  2I0M A;  4PNI A;  4BAY B;  3PUG A;  4U74 A;  3AE7 A;  2XQ8 A;  4MFR A;  2NR4 A;  2WBL A;  4I0U A;  5L3F B;  4OFZ A;  3MKD A;  3PV0 F;  4YSZ A;  4TN7 B;  2FJA A;  3HI2 A;  2M6B A;  3KV6 A;  2D0U A;  2XAF B;  3OTO T;  2JQ9 A;  5HXC A;  3CWZ B;  4YTP A;  2ACZ A;  4ZI2 D;  5JDN A;  2R6G F;  4DV6 T;  2UXN B;  5AQH B;  2LKG A;  2DLR A;  3UU4 A;  4DMW A;  4AI6 A;  3UUM A;  3QUJ A;  3X1D A;  5C8Y E;  3RIF A;  1HNZ T;  5L3G B;  4CI1 B;  2UXC T;  4I50 E;  2D2S A;  4HE8 A;  1UUS A;  3P4W A;  4YTN A;  1FMV A;  5JR9 B;  2UXB T;  4IE6 A;  2VQF T;  2X9Y A;  2UU9 T;  5KX5 E;  4O4H E;  4Q25 A;  1IJ5 A;  3KV4 A;  4P09 A;  4JUY A;  5AQI B;  3FXD B;  4IE5 A;  1N33 T;  3TLV A;  3ESL A;  4TNW A;  3AVR A;  1KF6 A;  1MMA A;  5H6R B;  2ES0 A;  4IDP A;  2J47 A;  2A9U A;  2BKN A;  2V7K A;  4BJN A;  4X66 T;  4X62 T;  2YEV C;  3FB2 A;  2LLY A;  4LF8 T;  2DCF A;  3EVY A;  1T7S A;  4OHF A;  4AXP A;  3O9X A;  3JC6 D;  1MND A;  4X64 T;  2BG9 A;  2X9X A;  3UU6 A;  2K48 A;  5BR8 T;  2Q9Q B;  3ABV A;  2LOP A;  2WU2 A;  2B1E A;  1IAP A;  5LNK A;  3L8R A;  5IWA T;  3WAJ A;  5FL1 A;  3RYC E;  4J2C A;  4V1A v;  5LP6 E;  3NWI A;  2CRB A;  1LRZ A;  2K9A A;  4Z90 A;  4QHO A;  4HWI B;  4EYU A;  2V7M A;  2NW9 A;  2MAW A;  3ANW B;  4ASK A;  5JVD E;  1YW0 A;  3RF1 A;  3FZF B;  4X65 T;  1OED C;  4LF4 T;  2VVS A;  2W61 A;  1HF8 A;  4CXX A;  2VKH A;  5FNV E;  3B13 A;  3RC8 A;  4JI2 T;  2CA5 A;  2LRL A;  3IA3 A;  4PAG A;  2GK9 A;  2V7J A;  3Q2M A;  3N2K E;  4ZOL E;  4JI3 T;  2VKD A;  3ZJ1 A;  2X9W A;  5AQL B;  1FIO A;  2YKS A;  2XQ9 A;  5CFB A;  3VRA A;  3MAC A;  2CE7 A;  4JBW F;  4U72 A;  3AXJ B;  4HFI A;  2VVN A;  3PJA A;  2G0U A;  3P4R A;  1WCR A;  1HNW T;  3RQW A;  1IBL T;  1W09 A;  3HKD E;  3T1H T;  4WW0 A;  1HG2 A;  1HFA A;  4IL4 A;  3O1H A;  2C5I T;  1D0X A;  4ADZ A;  2V6Y B;  2CM0 A;  1G8X A;  5CJ5 A;  1SUM B;  4HFC A;  1QUU A;  1W9R A;  2VL8 A;  4PFP A;  4P0A A;  3RIU A;  2BS4 A;  1LVF A;  5HYA A;  2WDQ A;  4MAL A;  4DUZ T;  3LBX A;  3CK6 A;  3PU3 A;  4ILC A;  2K3W A;  1ZKE A;  5L3C B;  1S94 A;  4UV8 B;  2ODU A;  5LHH B;  2HHH T;  4EZH A;  1LVK A;  2PFV A;  2Y8D A;  2X66 A;  2UUC T;  2J1D G;  4AQF A;  2CWO A;  3AAE B;  4ZS3 A;  2MOZ A;  4TWH A;  3FBZ A;  3GA8 A;  3KVA A;  5LJN A;  4QX7 B;  4L0R A;  3RYI E;  5AQP B;  4U7Y A;  1XMO T;  5LGU B;  2EHO D;  2VQE T;  2EHO A;  4TZ4 C;  5LYJ E;  2BKP A;  4WBO A;  1BR2 A;  2NTX A;  5ABE A;  2OA5 A;  2CXL A;  1W0B A;  4TWF A;  5JDH A;  1D0Z A;  4UVB B;  3QOF A;  4EED A;  4FJO A;  4CN4 A;  3UUB A;  2WY2 A;  4ZXL A;  5FXX A;  3RRC A;  3IEE A;  4JEU B;  1HX8 A;  4ZI7 E;  1IJ6 A;  1YQ4 A;  2RP4 A;  5EK3 A;  3UT5 E;  4TUY E;  2V7I A;  5C2T A;  2NWB A;  4UEL A;  3ZMU B;  3SWH A;  5HEH A;  2PJQ A;  3AE1 A;  3CQC B;  2NOX A;  4GKK T;  2KND A;  2XZE A;  3BQK A;  4HFH A;  3EI0 A;  4H9O C;  4U33 A;  3LK3 B;  4YY3 T;  5DQW A;  3CVR A;  1Y64 B;  3MZK B;  3UU5 A;  1B7T A;  2CLY B;  2XAG B;  5FVL A;  5JDQ A;  1AJ3 A;  3ZST A;  5KXJ A;  4WZX A;  2JMK A;  4GOU A;  5LMU T;  1Z8U A;  2X68 A;  1UGO A;  4MLK A;  3C50 A;  5JH7 E;  4GK5 E;  4A56 A;  5HEG A;  2DWK A;  2E9X C;  4ZS2 A;  3CPZ A;  3VR9 A;  1GQE A;  4YFS A;  2YDR A;  5LMN T;  5AQG B;  3KBT A;  2H7V C;  4JLE A;  3SRZ A;  3FHN A;  2CHO A;  3ZYL A;  2CBJ A;  4E7S A;  1M62 A;  2MTQ A;  2A2F X;  5ADX L;  2W4X A;  5LGT B;  3CX6 B;  3ETV A;  5L3D B;  1I94 T;  4P0B A;  3ZSS A;  3B57 A;  4ZEY A;  3VR8 A;  2QVA A;  3OVU A;  4CI2 B;  2LKH A;  2LSJ A;  4PJM A;  1Z0P A;  2E2A A;  2CEA A;  2WWU A;  4AKR B;  2KXP B;  5A1L A;  4DBQ A;  4NXM T;  5J1G A;  1XDP A;  3QK6 A;  1YKE B;  3ZMT B;  2VB6 A;  3SS1 A;  1QLB A;  2H89 A;  3AAA B;  4JI6 T;  3N2G E;  2DI4 A;  4AQY T;  5JRC B;  5HCM A;  5GON E;  3KVB A;  3KDS E;  2FJD A;  3MA9 A;  4BJM A;  4IST A;  4DUY T;  1WLX A;  2W62 A;  4KP3 C;  5JR9 C;  3NRX A;  1Y01 A;  4QH4 A;  3N9N A;  3K1S A;  3C51 A;  5FY7 A;  4XZC A;  4H9S E;  3ZT6 A;  4L9I A;  4AKG A;  3N9L A;  4H63 H;  4JI1 T;  4CXW A;  2WMO A;  2LJL A;  3HL6 A;  2Y48 B;  3C4W A;  3EUH A;  3OYX A;  2KSR A;  2A72 A;  5M4Y A;  1BR4 A;  2YU2 A;  4HFE A;  4WNK A;  5AFU L;  3RH3 A;  3QC9 A;  2VL0 A;  5CGM A;  3MK7 C;  4U31 A;  5ETW A;  5AQU B;  1OED E;  1MMG A;  1VRB A;  2ZM0 A;  3CML A;  5HAX A;  4LF7 T;  2DNX A;  5FXW A;  1HR0 T;  5LBM A;  4IDO A;  3OPC A;  4LFC T;  3P50 A;  5L3B B;  3IHR A;  4DO0 A;  2E8I A;  2XQA A;  2Q9Q C;  3N9O A;  4H9Q C;  4LF9 T;  4GYR A;  2VK9 A;  3AE4 A;  2C0S A;  5HXS A;  4YHH T;  5AQF B;  3A5X A;  2IW5 B;  3ZJ2 A;  1T8B A;  2DL1 A;  3PUA A;  4A97 A;  4EOZ B;  4PFO A;  5LBQ B;  1KFY A;  3Q5E A;  5CA1 E;  2BBH A;  3H3M A;  3P4P A;  2WQY A;  2XHE B;  2YOE A;  4HWH A;  3UQ7 A;  3WI3 A;  3BQI A;  5LJM A;  1ZEE A;  5LHG B;  2LHN A;  3MXZ A;  4I4T E;  3P8C D;  1XNQ T;  3UUL A;  2BG9 B;  4NUV A;  3ZPO A;  1T98 A;  2JQH A;  2L8K A;  3AA1 B;  3U78 A;  4F8H A;  4NPP A;  3F57 A;  5AQS B;  1XMQ T;  2H7O A;  3O1J A;  1WRD A;  1HG5 A;  1YKH B;  3AA0 B;  2ZM6 T;  3M65 A;  4DR5 T;  3PUV F;  2F4V T;  3R6N A;  2V5C A;  2WAU A;  2CWY A;  1IBM T;  3QB5 A;  3LSV A;  3ZMV B;  3VKH A;  2QA7 A;  3C98 B;  4X5T A;  4PJJ A;  1HNX T;  2I59 A;  3I9Y A;  1WR6 A;  4AKH A;  4DR6 T;  2X0Y A;  2WSS V;  2IHR 1;  4DV3 T;  3F31 A;  2QYW A;  4IE0 A;  1S35 A;  2XY8 B;  3RYF E;  3I9W A;  4HEA A;  4UIG A;  4ZI3 D;  3MJX A;  3UU3 A;  2VAS A;  3N2O A;  2LHR A;  2K24 A;  2CMR A;  3NZQ A;  4EB6 E;  3E22 E;  4DND A;  3KIN B;  2YU1 A;  3Q9D A;  3JAD A;  1XZY A;  3NRY A;  4GIW A;  3EAB A;  2XUE A;  3TKL B;  5EK2 A;  1X79 A;  3A7M A;  3RLF F;  3U3I A;  5FYM A;  1OWA A;  3ZN1 B;  1I6Z A;  3EAM A;  4YHJ A;  4O2B E;  4MBQ A;  1BR1 A;  3ZCI A;  2HN2 A;  3RYH E;  2LSI A;  1ZV4 X;  2Q9Q D;  2Q9Q A;  4JV5 T;  3V5U A;  2XAH B;  1D1C A;  3OYZ A;  4O2A E;  3LBX B;  4O8S A;  2N9D A;  1JNR A;  4G2A A;  4DR4 T;  4DV4 T;  1IZN B;  4ANJ A;  5AQJ B;  2V6X A;  1D1B A;  2LM2 A;  2ZM2 A;  3AEF A;  4I55 E;  3H37 A;  4QH5 A;  2XM2 A;  2XQY A;  1UX5 A;  2YIN A;  3K8P C;  5LA6 E;  3ZC0 A;  2W00 A;  2FBW A;  3L39 A;  1R8I A;  4C91 A;  5E0O A;  4H9N C;  4CXY A;  3RKO A;  5JDM A;  2M6I A;  4L5G A;  3A8Y C;  3HKE E;  4HWF A;  5ABF B;  5HEU A;  1UCU A;  3TLW A;  3H3A A;  2EHO B;  3FXE B;  3PUY F;  4JYA T;  2CLY C;  3JCF A;  4A98 A;  1JNZ A;  2IUB A;  4OX9 T;  3S4U A;  4X20 E;  2XSB A;  5F5W A;  3K3Q C;  5AQQ B;  3AEC A;  1H7C A;  2LSG A;  3ONX A;  4XAX B;  2LSY A;  1SHZ C;  4DR2 T;  3V5S A;  2YK0 A;  1X9B A;  4HFB A;  3CX7 B;  2XQ4 A;  4DR1 T;  4ILB A;  2ZM8 A;  3OKQ A;  4UXN B;  1HCI A;  1MIY A;  4TNV A;  4QH1 A;  4HTE A;  5JDF A;  5CB4 E;  2V1D B;  3AEE A;  2PG8 A;  4TWD A;  4IE4 A;  2NTY A;  5L4H A;  4G63 A;  5EZY E;  4PK4 A;  2A3D A;  5LCY A;  4AQG A;  2JPF A;  2KLQ A;  3AED A;  1J5E T;  5DJQ C;  4QWN B;  4TV8 E;  4HFD A;  5HCJ A;  4B3T T;  4O4I E;  4AKI A;  1XNR T;  1OED A;  2HPL A;  4LF6 T;  1EZ3 A;  2WZI A;  5TAO A;  5J2T E;  5LOV E;  2P9B A;  5FL0 A;  4JI0 T;  3N9M A;  5IUX A;  1D1A A;  3FZL B;  2VKJ A;  4CZZ B;  4EZ4 A;  4UF0 B;  2W2U A;  4QXC B;  1MNE A;  4COF A;  2XM1 A;  4KX6 A;  3SFD A;  1G73 A;  3GN5 A;  2C5K T;  3CX8 B;  3RI5 A;  3Q5X A;  3HR0 A;  5LHI B;  1WR0 A;  2JQQ A;  4ZI2 C;  5AQR B;  2W0G A;  2CHN A;  2V7L A;  3PUX F;  2UUA T;  3IBP A;  5KMG P;  5LGN B;  2ODV A;  2ACX A;  3AB3 B;  5L47 A;  2XAJ B;  4AIS A;  2V26 A;  3RKG A;  4IIJ E;  2AXD S;  4HKA A;  3FZK B;  2MPK A;  3L09 A;  4DR3 T;  5FKY A;  3AEG A;  2IC6 A;  2XSA A;  1MIV A;  2BS2 A;  1MMD A;  4M1P A;  2V5D A;  3JAE A;  4PW8 A;  2X0H A;  2BVL A;  4EEB A;  1M7K A;  4CQI A;  2AE9 A;  2WP9 A;  2RPA A;  2CCQ A;  3PUW F;  2WU5 A; 
#chains in the Genus database with same CATH homology
 1ZEE A;  4IGU A;  5FNV E;  5LHG B;  2LHN A;  4WBN E;  3MXZ A;  3B13 A;  3GN5 B;  2KIN B;  3P8C D;  4I4T E;  4QXH B;  3RC8 A;  3AAI A;  2N2N A;  3N9Q A;  2CA5 A;  3RX6 A;  4K0U A;  1E1H B;  4PAG A;  2GK9 A;  3UUL A;  4NUV A;  2QGS A;  4PJL A;  4H63 V;  2V7J A;  2Z6E A;  3Q2M A;  1U4Q A;  3N2K E;  3O4X E;  4ZOL E;  2VKD A;  3ZPO A;  1T98 A;  4ZHQ E;  3RC3 A;  2L8K A;  1KK7 A;  1ZHC A;  5FXV A;  3ZJ1 A;  2X9W A;  1FIO A;  3AA1 B;  2XTL A;  3U78 A;  3JC6 C;  3F57 A;  4PJN A;  1KNZ A;  3MAC A;  2CE7 A;  4PK6 A;  4U72 A;  2BDE A;  5FXZ A;  3PE0 A;  2H7O A;  1WYB A;  3DTO A;  5IHY A;  1YD8 G;  3O1J A;  3EDV A;  1WRD A;  2G0U A;  3LFM A;  1HG5 A;  2RA1 A;  2XAS B;  3KV9 A;  1YKH B;  3AA0 B;  3M65 A;  3HKD E;  4H9P C;  3R6N A;  4QKN A;  4WW0 A;  2WAU A;  3ZYK A;  4H9R C;  1HG2 A;  1HFA A;  3O1H A;  2C5I T;  2BVM A;  4OYK A;  1D0X A;  3UUX B;  4ADZ A;  5HWX A;  3ZMV B;  3VKH A;  4E7Z A;  1QSD A;  3KV5 A;  2CM0 A;  2QA7 A;  1G8X A;  3C98 B;  4YLH A;  2N1G A;  4X1I E;  4PJJ A;  4UVC B;  1QUU A;  3F2E A;  2VL8 A;  2I59 A;  3I9Y A;  1WR6 A;  4PFP A;  4AKH A;  4P0A A;  1U5P A;  2SPC A;  2KWH A;  3N5L A;  3CQG B;  3J9X 1;  4Z8X A;  1LVF A;  5HYA A;  5L2L A;  2WSS V;  3F31 A;  3PUR A;  5HXE A;  4IE0 A;  4KUM B;  3O1I A;  3ZC1 A;  1S35 A;  4YJ3 E;  5JDG A;  4MAL A;  3LJC A;  3RYF E;  4X1Y E;  2IC9 A;  3I9W A;  2X67 A;  4DBR A;  4HEA A;  1WYC A;  4UIG A;  4ZI3 D;  3AA6 B;  3MJX A;  3LBX A;  4IE7 A;  3PU3 A;  2VAS A;  1ZKE A;  3N2O A;  5L3C B;  1S94 A;  2LHR A;  3HA4 A;  5JRE A;  3ZMS B;  2D5U A;  5F3J A;  2KMF A;  4UV8 B;  3NZP A;  2K24 A;  2CMR A;  4FI5 A;  2ODU A;  5LHH B;  3NZQ A;  4EB6 E;  3E22 E;  5FP3 A;  4DND A;  2BZB A;  3KIN B;  2NW8 A;  2YU1 A;  3Q9D A;  5FY0 A;  4EZH A;  3ETU A;  1LVK A;  2PFV A;  5FY1 A;  2Y8D A;  2X66 A;  2XAQ B;  3EDU A;  3FBL A;  2MBG A;  2J1D G;  3KBU A;  1NWM X;  3NRY A;  4AQF A;  2CWO A;  3BQL A;  4GIW A;  2XUE A;  3AAE B;  3ZEF B;  4O4J E;  3GWH A;  3TKL B;  5EK2 A;  1MIW A;  4ZS3 A;  2MOZ A;  4EIW A;  1X79 A;  3FBZ A;  3GA8 A;  4AKL A;  3U3I A;  2CXF A;  3KVA A;  4QX8 B;  3AVS A;  2D0T A;  1OWA A;  4QX7 B;  4UF0 A;  5FYM A;  3RRW A;  5LJN A;  3J7Y q;  4QXB B;  3E08 A;  3ZN1 B;  3C4X A;  4L0R A;  4XBF B;  3RYI E;  4ILU A;  3VHL A;  1VOM A;  3CQX C;  4YHJ A;  3W15 B;  5LGU B;  2EHO D;  5DQV A;  4O2B E;  4MBQ A;  1BR1 A;  2EHO A;  4OYJ A;  3ZCI A;  4TZ4 C;  3RYH E;  5LG4 A;  2LSI A;  5LYJ E;  3IF8 B;  4WBO A;  2E9X D;  1BR2 A;  3CKD A;  2E9X A;  2NTX A;  3D0T A;  3GMI A;  3DP7 A;  2OA5 A;  1ZV4 X;  3DJB A;  2Q9Q D;  2CXL A;  4DVD A;  4HN9 A;  2Q9Q A;  5LXT E;  5JDH A;  1D0Z A;  2K5B B;  5J2U E;  4UVB B;  2LSK A;  4FJO A;  4HFV A;  3V5U A;  4ISS A;  5JQG E;  2XAH B;  1D1C A;  5FXX A;  1BR0 A;  3OYZ A;  2HH7 A;  4HGA A;  4O2A E;  3LK2 B;  4F6R C;  3LBX B;  3RRC A;  4EXT A;  3L3P A;  4O8S A;  3IEE A;  2N9D A;  3HKB E;  3E0Z A;  5F8P A;  3UTK A;  4G2A A;  4JEU B;  4BA9 A;  1HX8 A;  1V9D A;  4ZI7 E;  1IJ6 A;  4C90 A;  2RP4 A;  1OXZ A;  5EK3 A;  3PTR B;  2M67 A;  3UT5 E;  4B6X A;  2HPJ A;  4TUY E;  1IZN B;  4O4L E;  3OJA A;  2V7I A;  4ZI3 C;  4ANJ A;  3KFW X;  2PBI A;  1D1B A;  3ZN0 B;  2ZM2 A;  2NWB A;  4UEL A;  4I55 E;  3H37 A;  2XQY A;  1UX5 A;  2YIN A;  3ZMU B;  3SWH A;  3K8P C;  5LA6 E;  3ZC0 A;  2PJQ A;  4N78 D;  3UUN A;  2H3R A;  2W00 A;  3CQC B;  2NOX A;  5IYZ E;  5DAB A;  2KND A;  4C91 A;  5E0O A;  3VU7 H;  3BQK A;  2IAK A;  4H9O C;  1FMW A;  3ZLI A;  4AQF C;  3LK3 B;  3C64 A;  2X51 A;  4H9N C;  3CVR A;  5DQW A;  4CXY A;  3RKO A;  2L9Q A;  2KT9 A;  5JDM A;  2DHR A;  4L5G A;  1Y64 B;  3MZK B;  4CI3 B;  3NBX X;  5EK4 A;  3HKE E;  1B7T A;  2CLY B;  1UCU A;  2XAG B;  5JDQ A;  3WAK A;  1AJ3 A;  3P7I A;  2KWI B;  2WMN A;  4EYY R;  3H3A A;  2EHO B;  3LG7 A;  3LK4 2;  3FXE B;  3Q5W A;  3R84 B;  2JMK A;  1HS7 A;  4GOU A;  5HWY A;  2X68 A;  2CLY C;  2E9X B;  3C4Z A;  3SOL A;  5JDL A;  5JRC A;  4MLK A;  5JR9 A;  3C50 A;  3OBV E;  2EHO C;  5JH7 E;  4GK5 E;  3S4U A;  4X20 E;  5L3E B;  4A56 A;  4OK0 A;  4UEM A;  2L3L A;  2DWK A;  4PNI A;  3ZCJ A;  2E9X C;  4BAY B;  3PUG A;  4U74 A;  3K3Q C;  3AA7 B;  4MFR A;  2LEH A;  3CPZ A;  1H7C A;  4ZS2 A;  4YFS A;  2LSG A;  2WBL A;  3ONX A;  3KBT A;  5L3F B;  4OFZ A;  2H7V C;  4XAX B;  4JLE A;  3MKD A;  3SRZ A;  4TN7 B;  2LSY A;  1CUN A;  3FHN A;  3HI2 A;  4MHC A;  2LM9 A;  1SHZ C;  3ZYL A;  4PK5 A;  4E7S A;  4GK0 E;  4KMC A;  5HXR A;  3V5S A;  2YK0 A;  3KV6 A;  2D0U A;  2XAF B;  5ADX L;  2MTQ A;  2A2F X;  2JMH A;  3CX7 B;  3ZYM A;  3CX6 B;  3ETV A;  3CWZ B;  5HXC A;  5L3D B;  3I0O A;  5LGT B;  4P0B A;  4ZI2 D;  2ZM8 A;  5JDN A;  3OKQ A;  3B57 A;  4UXN B;  1HCI A;  1MIY A;  2UXN B;  3RPU A;  4CI2 B;  4TX5 A;  2DLR A;  2X0L B;  4HTE A;  2NW7 A;  5JDF A;  4DMV A;  2LSJ A;  4PJM A;  5CB4 E;  1Z0P A;  4DMW A;  2V1D B;  4AI6 A;  3UUM A;  2DWG A;  2CEA A;  2WWU A;  2PG8 A;  3QUJ A;  4IE4 A;  2NTY A;  4AKR B;  4G63 A;  2KXP B;  5EZY E;  5A1L A;  4DBQ A;  4IDZ A;  4PK4 A;  5J1G A;  3QK6 A;  1YKE B;  3ZMT B;  5C8Y E;  2VB6 A;  3SS1 A;  2A3D A;  5LCY A;  3HKC E;  4TV9 E;  2CXD A;  5L3G B;  4AQG A;  4CI1 B;  2JPF A;  4I50 E;  1MMN A;  2D2S A;  2KLQ A;  3AAA B;  4HE8 A;  3N2G E;  5DJQ C;  4QWN B;  4TV8 E;  2DI4 A;  3N9P A;  5JRC B;  5GON E;  1FEW A;  3KVB A;  5HXH A;  1FMV A;  5JR9 B;  4JEH B;  4IE6 A;  4O4I E;  4AKI A;  4ERR A;  4NUU A;  3KDS E;  1UX4 A;  2X9Y A;  3PU8 A;  3MA9 A;  4O4H E;  4BJM A;  4IST A;  5KX5 E;  1IJ5 A;  3KV4 A;  4P09 A;  4JUY A;  2HPL A;  1WLX A;  3FXD B;  2W62 A;  4KP3 C;  3ANW A;  4IE5 A;  1EZ3 A;  5KDM C;  1HTJ F;  3K3O A;  4UVA B;  5JR9 C;  3NRX A;  5TAO A;  5J2T E;  5LOV E;  3N9N A;  3ESL A;  3AVR A;  3C51 A;  5FY7 A;  4XZC A;  2P9B A;  4H9S E;  1MMA A;  2KZ7 B;  3PDY A;  2LOS A;  3N9M A;  2ES0 A;  4L9I A;  5FMN A;  5H6R B;  4AKG A;  1D1A A;  3N9L A;  1D0Y A;  2VKJ A;  4H63 H;  4CZZ B;  4EZ4 A;  2V7K A;  2WMO A;  2LJL A;  4CXW A;  3HL6 A;  2X9H A;  4UF0 B;  4BJN A;  2Y48 B;  3C4W A;  4QXC B;  1MNE A;  3EUH A;  3OYX A;  2A72 A;  2YEV C;  5M4Y A;  4GYS A;  1BR4 A;  1G73 A;  2JJ9 A;  2YU2 A;  1SA0 E;  3FB2 A;  3GN5 A;  2C5K T;  3CX8 B;  2DCF A;  4X1K E;  4WNK A;  5AFU L;  3RH3 A;  3EVY A;  3QC9 A;  4OHF A;  4AXP A;  3O9X A;  3Q5X A;  3I0Q A;  3HR0 A;  3JC6 D;  1MND A;  3MK7 C;  5LHI B;  2JQQ A;  4EAH A;  2X9X A;  5ETW A;  3VKG A;  1MMG A;  1VRB A;  4ZI2 C;  2ZM0 A;  3CML A;  2W0G A;  2K48 A;  5HAX A;  5H6Q B;  2V7L A;  3IBP A;  2Q9Q B;  5KMG P;  1O3X A;  2DNX A;  2LOP A;  2ZLY A;  2ODV A;  2ZMA A;  5FXW A;  2B1E A;  5LGN B;  2ACX A;  2WM9 A;  1IAP A;  3AB3 B;  5LNK A;  2XAJ B;  1NAF A;  2Y6X A;  3WAJ A;  2V26 A;  5LBM A;  4IIJ E;  5L3B B;  3IHR A;  3RYC E;  4DO0 A;  4HKA A;  2E8I A;  2JRK A;  4J2C A;  4KBM B;  5BMV E;  3PUS A;  2Q9Q C;  3N9O A;  4V1A v;  5LP6 E;  4H9Q C;  1LRZ A;  2K9A A;  3L09 A;  4GYR A;  2VK9 A;  3K3N A;  1LKX A;  3T8O A;  4UV9 B;  5CA0 E;  4QHO A;  4EYU A;  2VKO A;  2V7M A;  2IC6 A;  2NW9 A;  2C0S A;  5HXS A;  4IHJ E;  4YJ2 E;  2UXX B;  1MIV A;  3ANW B;  4ASK A;  3A5X A;  2IW5 B;  4I43 B;  5JVD E;  1YW0 A;  3ZJ2 A;  3I1A A;  1MMD A;  4M1P A;  3PUA A;  1US7 B;  4PW8 A;  3PUQ A;  2BVL A;  2VWA A;  4EOZ B;  2W61 A;  4PFO A;  1HF8 A;  5LBQ B;  2LE8 A;  2MYS A;  2W63 A;  5CA1 E;  4CQI A;  2NP9 A;  2XHE B;  2C5J A;  2LT3 A;  3WI3 A;  3BK9 A;  3ZMZ B;  3UFE A;  2CCQ A;  4CXX A;  2VKH A;  3BQI A;  2CWY A;  5LJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...