4KHPT

Structure of the thermus thermophilus 30s ribosomal subunit in complex with de-6-msa-pactamycin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Crystal Structure of a Bioactive Pactamycin Analog Bound to the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 33
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4khpT00
4DR4T 4DV1T 1HNWT 4DV6T 4JI6T 4DV3T 4NXMT 4AQYT 4JI4T 4DV0T 1HR0T 1N36T 2ZM6T 5IWAT 5BR8T 1HNZT 4LFBT 4JI7T 4LF9T 4DUYT 4LF4T 4YHHT 4B3ST 4DR5T 1N34T 4X62T 1IBKT 4LF7T 4OX9T 4B3MT 2UXBT 2VQFT 1FJGT 4DV4T 1XNRT 2UU9T 4JI5T 3T1HT 4NXNT 4X64T 2E5LT 2F4VT 3OTOT 4DR6T 1I94T 4K0KT 4B3TT 2UXDT 2UXCT 4JI3T 4LFCT 5LMUT 4DR7T 4LF5T 4B3RT 4GKKT 4DV2T 1HNXT 1N32T 1IBLT 2UUCT 4LFAT 4JV5T 1IBMT 4JI8T 4LF8T 4JI0T 4X66T 4DV5T 3T1YT 4DV7T 1XMOT 2UUBT 1XMQT 4GKJT 4DR3T 4YY3T 5LMNT 2HHHT 1N33T 4DUZT 4DR2T 4LF6T 2VQET 4KHPT 4X65T 4JI1T 4JI2T 4JYAT 2UUAT 4DR1T 1J5ET 1XNQT
chains in the Genus database with same CATH superfamily
3CQCB 2N2NA 4DV1T 2M67A 1SE7A 3AVSA 2WMNA 2CE7A 1OWAA 3AE5A 3R6NA 3VU7H 4AQYT 2XQ6A 4U7YA 4O2BE 2YU2A 3O9XA 3EHZA 1MMDA 1HX8A 1LVKA 4I50E 4P0BA 3AB3B 1HF8A 3ZYLA 3PJAJ 4HFDA 4Q25A 5CJ5A 2F4VT 2WSSV 4EV6A 4EEBA 3SOLA 3ANWB 4I55E 3TLSA 1NWMX 2CWYA 3K1SA 2LRKA 4PJLA 4X1IE 4MLKA 1N32T 3CVRA 4QH4A 4O4IE 4IREA 3O4XE 4LF8T 2RP4A 3UFGA 1SUMB 3Q5XA 3OPCA 1FMVA 4X66T 1Z8UA 4DV5T 5HWXA 2W4XA 2XAHB 3CQGB 4DR2T 2XAJB 5CB4E 3ZT7A 2LOSA 1YD8G 1DU2A 3AE1A 1OEDB 4X1KE 3AVRA 2V5CA 4L0RA 1M62A 1D1AA 5IUXA 3MA9A 2AE9A 5LG4A 3C51A 5HYAA 3RX6A 5AQUB 1GQEA 2LT3A 1ZKEA 4L5GA 1U4QA 3P8CD 3UTKA 4UELA 4OX9T 2PBIA 2ODUA 3RRWA 2VK9A 2UXBT 3KINB 3VRBA 4M1PA 1HFAA 1IJ6A 2NTXA 3PU8A 5ADXL 4IL4A 2EHOA 3BQKA 1NAFA 4YHJA 2UXDT 4JI3T 5FY1A 5J1GA 4CXWA 2J1DG 1W0AA 2NW9A 5LJMA 2NWBA 3QNUA 2V7KA 5AQPB 4GYSA 4XAXB 2JPFA 5CFBA 5L3CB 2K24A 4HWHA 2WMOA 3K3NA 3H3MA 1OXZA 1BR4A 4UEMA 2DCFA 3EABA 4DR3T 4X65T 2K48A 2RA1A 2KSRA 3VHLA 3ZT6A 1OEDE 4I4TE 3UU5A 1R8IA 4GYRA 1ZV4X 5LNKA 3CWZB 4PK4A 5HWYA 5LHGB 3SRZA 4PJMA 3KV4A 1MIWA 4YTPA 2QYWA 1N36T 4CQIA 4MALA 1WRDA 4O8SA 4I0UA 2WQYA 2JQQA 4LF4T 4ZXLA 4EEDA 4K0UA 4N78D 2LHRA 2CBIA 3KVAA 4X62T 3AEGA 3ZJ2A 3EI0A 1FJGT 2PG8A 2LSJA 1WLXA 3ZT5A 4HFIA 3PU3A 5LXTE 2DLRA 3RKOA 3Q5WA 5FNVE 4AKHA 5AQJB 4GKKT 2I59A 2X66A 5EK4A 3AEFA 5ABFA 2ZM8A 3K3OA 5F5WA 2QVAA 1WR0A 3J9X1 5H6QB 1QUUA 3HI2A 4OK0A 3RYIE 5DJQC 2V7LA 4J2CA 3AE4A 2MOZA 4HWIB 2XSBA 3P4RA 1XMOT 2V8SV 3TLVA 2DNXA 4IE4A 2P9BA 3KV6A 2W0GA 5JRCB 4DUZT 3DP7A 3LBXB 3AA0B 5LB7B 2FJAA 2LRLA 4ZI7E 5FMNA 1KNPA 3OKQA 2WB5A 2MYSA 4AKGA 3K8PC 5LG3A 1LRZA 1FMWA 1KFYA 4YLHA 4F8HA 3B13A 2BBHA 2BG9B 3U3IA 3N9NA 2ZM0A 1ZHCA 2BVMA 5JDNA 3EDVA 3MK7C 2VQFT 5LOVE 4DV4T 3PURA 4G63A 4MBQA 2NR4A 4KI0F 2MTQA 2YDSA 4HWDA 1S35A 4CN1A 4ANJA 4TN7B 3V5SA 4QXHB 4ERRA 1HNXT 3UUMA 2BS4A 2RPAA 4A98A 5GONE 3CX8B 4PFOA 3IHRA 2VKHA 1EZ3A 1T98A 3LG7A 1UURA 3RRCA 4TZ4C 5JREA 5AQNB 3FZKB 4HWFA 1QLBA 3T1YT 4DV7T 1NEKA 4KP3C 4EZHA 3AAAB 3M65A 5ABEA 2W61A 3FBLA 3MXZA 4FI5A 5JQGE 3JCFA 1G8XA 3C4WA 4H63H 1T72A 3GA8A 2E8IA 3UU6A 3NZQA 3AE3A 2E9XB 1NENA 2YN6A 3I1AA 3UU8A 1US7B 4CI1B 1M7KA 3A7MA 3AE7A 3QC9A 2V1DB 4BJMA 2K9AA 3E0ZA 5AFUL 2EHOC 4DUYT 4MHCA 3CX7B 1L0VA 1XZYA 2C5JA 3TLWA 4TWFA 2VKDA 3EUHA 5LYJE 2E9XD 4NPPA 2FJDA 3FXDB 4JI5T 3T1HT 4KHZF 4QWNB 5EK2A 2E5LT 3KBTA 3FXEB 3TLUA 2CLYB 1Z0PA 3SFDA 2A72A 2WWUA 3KDSE 4A56A 2IC9A 4B6XA 2IIUA 2XAQB 3ETVA 3C4ZA 4EB6E 3N9MA 3RYCE 4UVAB 4GIWA 3ZEFB 3RF1A 5JR9B 5FP3A 3ZYMA 5KX5E 3LDQB 2WBLA 2IMLA 2ES0A 3BQLA 4Z8XA 3AXJB 3QB5K 1UK5A 2HHHT 1N33T 3JAEA 3GMIA 2IC6A 4QX7B 1MMGA 2D5UA 3UUXB 4DV3T 4H9NC 3QK6A 4A97A 2D9DA 1HNWT 5JTGA 2X51A 3N2KE 4OHFA 2C5IT 3OYXA 3RHWA 2B76A 4U2ZA 5FKYA 4YJ3E 2ACXA 1KNRA 4O2AE 4LFBT 4AI6A 2VASA 4PK5A 3AE8A 5LGUB 2WS3A 5LHHB 2VWAA 5J0ZA 2HPLA 2W2UA 3AA1B 1QSDA 2Q9QA 2X0HA 1XDOA 4AKRB 4EYYR 2H88A 3CPZA 2M6IA 3OTOT 3ZMZB 4KBMB 1VOMA 3NVOA 2L9QA 3NBXX 4B3TT 3AA6B 3PV0F 5LMUT 4X5TA 2K5BB 2BVLA 3GN5A 3GWHA 4A5XA 2C0SA 2Z6EA 4LMJA 3KVBA 1J1JA 2ZMAA 3AE2A 4ZI3C 3OBVE 2V6XA 3C64A 5L3EB 4HFCA 1UCUA 3KBUA 4TV8E 3QUJA 5CA0E 3VKHA 4AISA 2W66A 4KX6A 4YSXA 5ABGA 3A8YC 2X67A 2CEAA 4P09A 5AQSB 4JYAT 2FUPA 4IHJE 1D1BA 2J62A 4EGWA 3C4XA 3KV5A 4HE8A 1LVFA 2XJ7A 3ABVA 2YINA 3BQIA 4ISSA 1XWMA 2BS3A 2ZM6T 4ZEYA 5CGMA 3OYZA 3MJXA 4U31A 5LGTB 3IA3A 1D0XA 3O1JA 4TUYE 4ZI2C 3HL6A 4JEHB 2YDQA 2XQ9A 3A5XA 3RIUA 3VKGA 4LF7T 4H9PC 5C8YE 3E08A 1U5PA 2XQAA 3CIRA 3HA4A 4WZXA 3ZC1A 3PUQA 3ONXA 2BBJA 5FXWA 4C90A 3PE0A 3N9PA 4TNVA 1WYBA 3O1IA 2HN1A 5JDHA 2UUCT 3I9WA 2XQ7A 4P1NA 1IAPA 3LK3B 5AQKB 4AXPA 1X79A 4GOUA 5C3JA 1HCIA 2LM9A 2V5DA 4H9QC 2CPTA 3TKLB 3KFWX 2VQET 2NW8A 3RYHE 3PUYF 4JI2T 3UUNA 2W00A 3G06A 5KXJA 4DV0T 3O1HA 3F31A 3HKDE 4DR4T 4HKAA 5HEJA 4JI6T 2LE8A 5HCMA 5AQHB 2LEHA 4EXTA 4JI4T 2WZHA 5L3DB 4EAHA 3HKCE 2WY2A 5ABHA 2V6YA 2ACZA 4TWDA 4CI2B 4LF9T 3C98B 2CHNA 2LSGA 4DR5T 5IYZE 2XASB 2SPCA 4JUYA 2Y8DA 2ZM2A 2XQ5A 2JQKA 4BJNA 4UXNB 3BK9A 3C50A 5JH7E 3WAJA 3PUAA 3RLFF 4HFVA 4OYKA 1IBLT 4NUVA 1OEDC 2H7OA 4ASKA 4WW0A 4PJJA 2IDOB 3T8OA 4JI0T 2V7MA 4UF0A 4HTEA 4WBOA 2KT9A 3W15B 3PUSA 1HS7A 1UUSA 5AQOB 3FB2A 5HEOA 2KXPB 3HKEE 3NWIA 2DL1A 2JMHA 4YTNA 4YY3T 5LMNT 1T8BA 3AAEB 5F8PA 3FZLB 2X9HA 2N1GA 2WCAA 1SHZC 3N9OA 3F2EA 5BMVE 2KZ7B 4O4LE 4DMWA 5HAXA 3LFMA 1HG2A 2VL0A 3RC8A 2Q9QC 2LHNA 2PFVA 5BR8T 4QX8B 1YQ4A 3EAMA 2BDEA 5M4YA 1UX5A 4JLEA 3P4PA 4G2AA 2DWKA 1KK7A 4P0AA 4CN6A 4U72A 2EHOB 2QGSA 3VR8A 5FXZA 4LMKA 4DR6T 4IE7A 2CA5A 4EZ4A 5LBMA 1YXRA 2R6GF 5FYMA 4H9RC 3UQ7A 1CHUA 3AEBA 3CKDA 3FZHB 4HFBA 4B3RT 3WAKA 2W63A 1SA0E 2KMFA 1ZP0A 4JV5T 2XUEA 2NP9A 2EHOD 1HG5A 1I6ZA 2VVSA 1ZEEA 2NTYA 3P4SA 2XM2A 2ODVA 3L8RA 4GKJT 4XBFB 4QH1A 2IHR1 4GK5E 3RQUA 5L4HA 3LSVA 2KINB 3LJCA 2WU2A 2D0TA 2MAWA 3RIUC 1WR6A 5FL1A 4H9OC 4O4JE 3ZYKA 3EVYA 4LMLA 3RGLA 2XSAA 2IUBA 2UXNB 5AQQB 3HR0A 2VL8A 3JC6D 5IHYA 1YKEB 3ZSTA 4B3MT 2XPKA 3M3ZB 1HTJF 2XQYA 2UU9T 5FXVA 4AQGA 4UVBB 1E1HB 2X9YA 1Y01A 5ABFB 3ZC0A 4LFCT 1E2AA 2BG9E 2WU5A 4CN4A 4E7ZA 2GK9A 5L4EA 3RPUA 3UFEA 4PAGA 4NUUA 3ANWA 3N9LA 3SS1A 1ZOYA 1MMAA 3NZPA 2WZIA 4ILBA 4Z90A 3Q9DA 2G0UA 4IE6A 3L3PA 3ZKRA 1FEWA 3L39A 2CBJA 3B5MA 2K3WA 4KHPT 2LSYA 4JI1T 4HWCA 2QRXA 4IDNA 1XNQT 3IF8B 3AE6A 5FL0A 3VR9A 2UXXB 1JNZA 4UV9B 1OEDA 4ZI3D 5IWAT 1J5WA 2D2SA 5AQGB 2Y48B 4AKIA 2YKSA 4CXYA 5LHIB 4TNWA 4UR9A 5LP6E 2CRBA 2I0MA 1D1CA 1UX4A 3ZCJA 3QB5A 3PUGA 2X0YA 3L09A 4PJNA 3LK42 5F3JA 4DVDA 3PDYA 2YEVC 2JQ9A 5LGNB 4H9SE 3V5UA 2E9XC 4EYUA 4IDQA 4EIWA 4QKNA 2FJBA 3OVUA 4IDOA 3VRAA 1Y64B 3X1DA 2BZBA 4ZS2A 1KF6A 2W62A 2XAFB 2YDRA 3AECA 2UUAT 5HXRA 4DNDA 2HPJA 5ETWA 2VVNA 2LLYA 4IDPA 5AQLB 2CLYC 4NXMT 2DHRA 1KEYA 1B7TA 2LM2A 3TLTA 4YTMA 2LSIA 1X9BA 3FBZA 1HNZT 4IE5A 3ZCIA 4C91A 5L3GB 3N2GE 4ISTA 3I0QA 3ONLC 4TWHA 4ILCA 1HX1B 5FY7A 4B3ST 3AEDA 3ZJ1A 2M6BA 3FHNA 1D0ZA 1V9DA 5JR9C 2XQ3A 4NXNT 2BKOA 4IIJE 5L3FB 5KDMC 4UV8B 4K0KT 1W9RA 2E2AA 4IL9A 4JBWF 4KUMB 1BR0A 4X20E 5AQMB 2MBGA 2IAKA 4ILAA 4LFAT 1IBMT 5KMGP 3CX6B 5A1LA 3Q5DA 4BAYB 4OFZA 5LBQB 1G73A 4V1Av 2FBWA 3P4QA 5LCYA 4U7IA 2KNDA 1W0BA 3P7IA 3MKDA 3DTOA 4PNIA 3ESLA 3AEAA 5L3BB 5AQRB 4ILUA 3RYFE 3DJBA 3Q5EA 4WBNE 2LKHA 1WFDA 2A3DA 5JRCA 3FZMB 4DV6T 2JQHA 2WP9A 3LBXA 2XTLA 4AQFA 4UIGA 1MMNA 3H37A 3MACA 3OJAA 3PTRB 5DABA 1W09A 3ZSSA 2JJ9A 2Q9QB 4TX5A 3JADA 5JDQA 1JNRA 4YHHT 2C5KT 4NIQA 1IBKT 3SFEA 3NRXA 4EOZB 5HXHA 3RC3A 3RH3A 3GN5B 1VCTA 4X64T 2BG9A 3AE9A 3ZN1B 1I94T 1IJ5A 3FZFB 2BKNA 2KWHA 4HEAA 4OYJA 2JMKA 4DR7T 2CHOA 3RIAA 5JDGA 2QA7A 3Q2MA 4ADZA 2X9WA 4F6RC 4IDZA 2Q9QD 3UULA 1LKXA 2ZLYA 5FY0A 4JI8T 4IGUA 4IE0A 3PUZF 4ZOLE 5E0OA 2OV9A 2WAUA 2XY8B 5HEHA 2YOEA 3ZMUB 2UUBT 2NW7A 3J7Yq 2OA5A 4U3CA 2LKGA 2YK0A 5HEUA 4YXDA 5AQFB 3K3QC 4UVCB 2CXDA 4ZS3A 2WWVA 3RQWA 3D0TA 2A9UA 2JRKA 2LSKA 2V26A 4ZZBA 2B1EA 5LJNA 5EZYE 3RI5A 1HR0T 2L8KA 3AAIA 2E9XA 4QHOA 1XDPA 3UU3A 4KMCA 4JI7T 3UQ4A 4DMVA 4HN9A 2WM9A 5HXSA 2HN2A 3EDUA 1WYCA 2N9DA 4FJOA 5AQTB 3SWHA 1YW0A 1CUNA 3KV9A 2BKPA 2KWIB 3PUXF 5JDMA 4AIUA 4CZZB 2XQ4A 4YJ2E 2X68A 5AQVB 4HFHA 2J4GA 4LF5T 3R84B 4DIDB 4DV2T 3RKGA 4L9IA 4PW8A 3I9YA 2FJEA 1O3XA 4HGAA 2WDRA 4X1YE 2XM1A 2CM0A 4Z91A 3UT5E 5J2UE 4DBQA 4CXXA 1WCRA 3ZMTB 5L2LA 4AKLA 3PUWF 2WDVA 4WNKA 5HEGA 1T7SA 5JR9A 1FIOA 3IBPA 3NKZA 2Y6XA 1VCSA 5EK3A 2CXLA 2IW5B 1YQ3A 1D0YA 4ZZCA 4YSYA 2MPKA 4YSZA 3AXJA 3JAFA 2CXFA 5DQWA 2V6YB 3U78A 3F57A 3AEEA 2DWGA 5FVLA 1MIVA 4E7SA 4PK6A 2J47A 2I6HA 2XHEB 2NOXA 4CI3B 4U33A 3I0OA 3RIFA 4PFPA 1N34T 3H3AA 4MFRA 2CCQA 5FVKA 1XNRT 4QXBB 5JDLA 3PJAA 1UGOA 4O4HE 5JDFA 4WYVA 3P50A 4COFA 1BR1A 3NRYA 1MNEA 3HKBE 4I43B 4IT4A 3N2OA 4UF0B 2PJQA 2H7VC 4QXCB 2CMRA 3WI3A 2XAGB 1AJ3A 5J2TE 3CQXC 2LJLA 3P4WA 4U2YA 3ZMSB 1KNZA 3LK2B 1MIYA 3ZMVB 5H6RB 1XMQT 4AQFC 3MZKB 3N5LA 3ZLIA 5HCJA 2E5VA 3ETUA 3B57A 5TAOA 2W67A 2VB6A 2V7IA 4YFSA 4DR1T 1J5ET 2H3RA 2YU1A 2WDQA 2HH7A 4U74A 2X0LB 4DBRA 2D0UA 3PUVF 2BS2A 4GK0E 4JEUB 2VURA 4YT0A 4TV9E 4QH5A 5CA1E 2DI4A 2BG9C 3IEEA 3AA7B 4BA9A 3E22E 2XQ8A 5JVDE 1VRBA 2H89A 1IZNB 2CWOA 3ONJA 5HXCA 4DO0A 2VKOA 2XZEA 2VKJA 4H63V 4ZHQE 2UXCT 5C2TA 3JC6C 1BR2A 4XZCA 3UU4A 2AXDS 5LA6E 5DQVA 3N9QA 1E7PA 2OLTA 2JIWA 5AQIB 1S94A 2KLQA 3S4UA 2L3LA 5FXXA 1MNDA 2PTFA 3CK6A 2A2FX 1YKHB 3ZPOA 3UUBA 2X9XA 3ZN0B 1H7CA 3CMLA 2V7JA 3QOFA 5HXEA 2LOPA 4LF6T 4HFEA 5L47A 4ZI2D
chains in the Genus database with same CATH topology
4DR4T 4DV1T 1HNWT 4DV6T 4JI6T 4DV3T 4NXMT 4AQYT 4JI4T 4DV0T 1HR0T 1N36T 2ZM6T 5IWAT 5BR8T 1HNZT 4LFBT 4JI7T 4LF9T 4DUYT 4LF4T 4YHHT 4B3ST 4DR5T 1N34T 4X62T 1IBKT 4LF7T 4OX9T 4B3MT 2UXBT 2VQFT 1FJGT 4DV4T 1XNRT 2UU9T 4JI5T 3T1HT 4NXNT 4X64T 2E5LT 2F4VT 3OTOT 4DR6T 1I94T 4K0KT 4B3TT 2UXDT 2UXCT 4JI3T 4LFCT 5LMUT 4DR7T 4LF5T 4B3RT 4GKKT 4DV2T 1HNXT 1N32T 1IBLT 2UUCT 4LFAT 4JV5T 1IBMT 4JI8T 4LF8T 4JI0T 4X66T 4DV5T 3T1YT 4DV7T 1XMOT 2UUBT 1XMQT 4GKJT 4DR3T 4YY3T 5LMNT 2HHHT 1N33T 4DUZT 4DR2T 4LF6T 2VQET 4KHPT 4X65T 4JI1T 4JI2T 4JYAT 2UUAT 4DR1T 1J5ET 1XNQT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR4 T;  4DV1 T;  1HNW T;  4DV6 T;  4JI6 T;  4DV3 T;  4NXM T;  4AQY T;  4JI4 T;  4DV0 T;  1HR0 T;  1N36 T;  2ZM6 T;  5IWA T;  5BR8 T;  1HNZ T;  4LFB T;  4JI7 T;  4LF9 T;  4DUY T;  4LF4 T;  4YHH T;  4B3S T;  4DR5 T;  1N34 T;  4X62 T;  1IBK T;  4LF7 T;  4OX9 T;  4B3M T;  2UXB T;  2VQF T;  1FJG T;  4DV4 T;  1XNR T;  2UU9 T;  4JI5 T;  3T1H T;  4NXN T;  4X64 T;  2E5L T;  2F4V T;  3OTO T;  4DR6 T;  1I94 T;  4K0K T;  4B3T T;  2UXD T;  2UXC T;  4JI3 T;  4LFC T;  5LMU T;  4DR7 T;  4LF5 T;  4B3R T;  4GKK T;  4DV2 T;  1HNX T;  1N32 T;  1IBL T;  2UUC T;  4LFA T;  4JV5 T;  1IBM T;  4JI8 T;  4LF8 T;  4JI0 T;  4X66 T;  4DV5 T;  3T1Y T;  4DV7 T;  1XMO T;  2UUB T;  1XMQ T;  4GKJ T;  4DR3 T;  4YY3 T;  5LMN T;  2HHH T;  1N33 T;  4DUZ T;  4DR2 T;  4LF6 T;  2VQE T;  4KHP T;  4X65 T;  4JI1 T;  4JI2 T;  4JYA T;  2UUA T;  4DR1 T;  1J5E T;  1XNQ T; 
#chains in the Genus database with same CATH topology
 3CQC B;  2N2N A;  4DV1 T;  2M67 A;  1SE7 A;  3AVS A;  2WMN A;  2CE7 A;  1OWA A;  3AE5 A;  3R6N A;  3VU7 H;  4AQY T;  2XQ6 A;  4U7Y A;  4O2B E;  2YU2 A;  3O9X A;  3EHZ A;  1MMD A;  1HX8 A;  1LVK A;  4I50 E;  4P0B A;  3AB3 B;  1HF8 A;  3ZYL A;  3PJA J;  4HFD A;  4Q25 A;  5CJ5 A;  2F4V T;  2WSS V;  4EV6 A;  4EEB A;  3SOL A;  3ANW B;  4I55 E;  3TLS A;  1NWM X;  2CWY A;  3K1S A;  2LRK A;  4PJL A;  4X1I E;  4MLK A;  1N32 T;  3CVR A;  4QH4 A;  4O4I E;  4IRE A;  3O4X E;  4LF8 T;  2RP4 A;  3UFG A;  1SUM B;  3Q5X A;  3OPC A;  1FMV A;  4X66 T;  1Z8U A;  4DV5 T;  5HWX A;  2W4X A;  2XAH B;  3CQG B;  4DR2 T;  2XAJ B;  5CB4 E;  3ZT7 A;  2LOS A;  1YD8 G;  1DU2 A;  3AE1 A;  1OED B;  4X1K E;  3AVR A;  2V5C A;  4L0R A;  1M62 A;  1D1A A;  5IUX A;  3MA9 A;  2AE9 A;  5LG4 A;  3C51 A;  5HYA A;  3RX6 A;  5AQU B;  1GQE A;  2LT3 A;  1ZKE A;  4L5G A;  1U4Q A;  3P8C D;  3UTK A;  4UEL A;  4OX9 T;  2PBI A;  2ODU A;  3RRW A;  2VK9 A;  2UXB T;  3KIN B;  3VRB A;  4M1P A;  1HFA A;  1IJ6 A;  2NTX A;  3PU8 A;  5ADX L;  4IL4 A;  2EHO A;  3BQK A;  1NAF A;  4YHJ A;  2UXD T;  4JI3 T;  5FY1 A;  5J1G A;  4CXW A;  2J1D G;  1W0A A;  2NW9 A;  5LJM A;  2NWB A;  3QNU A;  2V7K A;  5AQP B;  4GYS A;  4XAX B;  2JPF A;  5CFB A;  5L3C B;  2K24 A;  4HWH A;  2WMO A;  3K3N A;  3H3M A;  1OXZ A;  1BR4 A;  4UEM A;  2DCF A;  3EAB A;  4DR3 T;  4X65 T;  2K48 A;  2RA1 A;  2KSR A;  3VHL A;  3ZT6 A;  1OED E;  4I4T E;  3UU5 A;  1R8I A;  4GYR A;  1ZV4 X;  5LNK A;  3CWZ B;  4PK4 A;  5HWY A;  5LHG B;  3SRZ A;  4PJM A;  3KV4 A;  1MIW A;  4YTP A;  2QYW A;  1N36 T;  4CQI A;  4MAL A;  1WRD A;  4O8S A;  4I0U A;  2WQY A;  2JQQ A;  4LF4 T;  4ZXL A;  4EED A;  4K0U A;  4N78 D;  2LHR A;  2CBI A;  3KVA A;  4X62 T;  3AEG A;  3ZJ2 A;  3EI0 A;  1FJG T;  2PG8 A;  2LSJ A;  1WLX A;  3ZT5 A;  4HFI A;  3PU3 A;  5LXT E;  2DLR A;  3RKO A;  3Q5W A;  5FNV E;  4AKH A;  5AQJ B;  4GKK T;  2I59 A;  2X66 A;  5EK4 A;  3AEF A;  5ABF A;  2ZM8 A;  3K3O A;  5F5W A;  2QVA A;  1WR0 A;  3J9X 1;  5H6Q B;  1QUU A;  3HI2 A;  4OK0 A;  3RYI E;  5DJQ C;  2V7L A;  4J2C A;  3AE4 A;  2MOZ A;  4HWI B;  2XSB A;  3P4R A;  1XMO T;  2V8S V;  3TLV A;  2DNX A;  4IE4 A;  2P9B A;  3KV6 A;  2W0G A;  5JRC B;  4DUZ T;  3DP7 A;  3LBX B;  3AA0 B;  5LB7 B;  2FJA A;  2LRL A;  4ZI7 E;  5FMN A;  1KNP A;  3OKQ A;  2WB5 A;  2MYS A;  4AKG A;  3K8P C;  5LG3 A;  1LRZ A;  1FMW A;  1KFY A;  4YLH A;  4F8H A;  3B13 A;  2BBH A;  2BG9 B;  3U3I A;  3N9N A;  2ZM0 A;  1ZHC A;  2BVM A;  5JDN A;  3EDV A;  3MK7 C;  2VQF T;  5LOV E;  4DV4 T;  3PUR A;  4G63 A;  4MBQ A;  2NR4 A;  4KI0 F;  2MTQ A;  2YDS A;  4HWD A;  1S35 A;  4CN1 A;  4ANJ A;  4TN7 B;  3V5S A;  4QXH B;  4ERR A;  1HNX T;  3UUM A;  2BS4 A;  2RPA A;  4A98 A;  5GON E;  3CX8 B;  4PFO A;  3IHR A;  2VKH A;  1EZ3 A;  1T98 A;  3LG7 A;  1UUR A;  3RRC A;  4TZ4 C;  5JRE A;  5AQN B;  3FZK B;  4HWF A;  1QLB A;  3T1Y T;  4DV7 T;  1NEK A;  4KP3 C;  4EZH A;  3AAA B;  3M65 A;  5ABE A;  2W61 A;  3FBL A;  3MXZ A;  4FI5 A;  5JQG E;  3JCF A;  1G8X A;  3C4W A;  4H63 H;  1T72 A;  3GA8 A;  2E8I A;  3UU6 A;  3NZQ A;  3AE3 A;  2E9X B;  1NEN A;  2YN6 A;  3I1A A;  3UU8 A;  1US7 B;  4CI1 B;  1M7K A;  3A7M A;  3AE7 A;  3QC9 A;  2V1D B;  4BJM A;  2K9A A;  3E0Z A;  5AFU L;  2EHO C;  4DUY T;  4MHC A;  3CX7 B;  1L0V A;  1XZY A;  2C5J A;  3TLW A;  4TWF A;  2VKD A;  3EUH A;  5LYJ E;  2E9X D;  4NPP A;  2FJD A;  3FXD B;  4JI5 T;  3T1H T;  4KHZ F;  4QWN B;  5EK2 A;  2E5L T;  3KBT A;  3FXE B;  3TLU A;  2CLY B;  1Z0P A;  3SFD A;  2A72 A;  2WWU A;  3KDS E;  4A56 A;  2IC9 A;  4B6X A;  2IIU A;  2XAQ B;  3ETV A;  3C4Z A;  4EB6 E;  3N9M A;  3RYC E;  4UVA B;  4GIW A;  3ZEF B;  3RF1 A;  5JR9 B;  5FP3 A;  3ZYM A;  5KX5 E;  3LDQ B;  2WBL A;  2IML A;  2ES0 A;  3BQL A;  4Z8X A;  3AXJ B;  3QB5 K;  1UK5 A;  2HHH T;  1N33 T;  3JAE A;  3GMI A;  2IC6 A;  4QX7 B;  1MMG A;  2D5U A;  3UUX B;  4DV3 T;  4H9N C;  3QK6 A;  4A97 A;  2D9D A;  1HNW T;  5JTG A;  2X51 A;  3N2K E;  4OHF A;  2C5I T;  3OYX A;  3RHW A;  2B76 A;  4U2Z A;  5FKY A;  4YJ3 E;  2ACX A;  1KNR A;  4O2A E;  4LFB T;  4AI6 A;  2VAS A;  4PK5 A;  3AE8 A;  5LGU B;  2WS3 A;  5LHH B;  2VWA A;  5J0Z A;  2HPL A;  2W2U A;  3AA1 B;  1QSD A;  2Q9Q A;  2X0H A;  1XDO A;  4AKR B;  4EYY R;  2H88 A;  3CPZ A;  2M6I A;  3OTO T;  3ZMZ B;  4KBM B;  1VOM A;  3NVO A;  2L9Q A;  3NBX X;  4B3T T;  3AA6 B;  3PV0 F;  5LMU T;  4X5T A;  2K5B B;  2BVL A;  3GN5 A;  3GWH A;  4A5X A;  2C0S A;  2Z6E A;  4LMJ A;  3KVB A;  1J1J A;  2ZMA A;  3AE2 A;  4ZI3 C;  3OBV E;  2V6X A;  3C64 A;  5L3E B;  4HFC A;  1UCU A;  3KBU A;  4TV8 E;  3QUJ A;  5CA0 E;  3VKH A;  4AIS A;  2W66 A;  4KX6 A;  4YSX A;  5ABG A;  3A8Y C;  2X67 A;  2CEA A;  4P09 A;  5AQS B;  4JYA T;  2FUP A;  4IHJ E;  1D1B A;  2J62 A;  4EGW A;  3C4X A;  3KV5 A;  4HE8 A;  1LVF A;  2XJ7 A;  3ABV A;  2YIN A;  3BQI A;  4ISS A;  1XWM A;  2BS3 A;  2ZM6 T;  4ZEY A;  5CGM A;  3OYZ A;  3MJX A;  4U31 A;  5LGT B;  3IA3 A;  1D0X A;  3O1J A;  4TUY E;  4ZI2 C;  3HL6 A;  4JEH B;  2YDQ A;  2XQ9 A;  3A5X A;  3RIU A;  3VKG A;  4LF7 T;  4H9P C;  5C8Y E;  3E08 A;  1U5P A;  2XQA A;  3CIR A;  3HA4 A;  4WZX A;  3ZC1 A;  3PUQ A;  3ONX A;  2BBJ A;  5FXW A;  4C90 A;  3PE0 A;  3N9P A;  4TNV A;  1WYB A;  3O1I A;  2HN1 A;  5JDH A;  2UUC T;  3I9W A;  2XQ7 A;  4P1N A;  1IAP A;  3LK3 B;  5AQK B;  4AXP A;  1X79 A;  4GOU A;  5C3J A;  1HCI A;  2LM9 A;  2V5D A;  4H9Q C;  2CPT A;  3TKL B;  3KFW X;  2VQE T;  2NW8 A;  3RYH E;  3PUY F;  4JI2 T;  3UUN A;  2W00 A;  3G06 A;  5KXJ A;  4DV0 T;  3O1H A;  3F31 A;  3HKD E;  4DR4 T;  4HKA A;  5HEJ A;  4JI6 T;  2LE8 A;  5HCM A;  5AQH B;  2LEH A;  4EXT A;  4JI4 T;  2WZH A;  5L3D B;  4EAH A;  3HKC E;  2WY2 A;  5ABH A;  2V6Y A;  2ACZ A;  4TWD A;  4CI2 B;  4LF9 T;  3C98 B;  2CHN A;  2LSG A;  4DR5 T;  5IYZ E;  2XAS B;  2SPC A;  4JUY A;  2Y8D A;  2ZM2 A;  2XQ5 A;  2JQK A;  4BJN A;  4UXN B;  3BK9 A;  3C50 A;  5JH7 E;  3WAJ A;  3PUA A;  3RLF F;  4HFV A;  4OYK A;  1IBL T;  4NUV A;  1OED C;  2H7O A;  4ASK A;  4WW0 A;  4PJJ A;  2IDO B;  3T8O A;  4JI0 T;  2V7M A;  4UF0 A;  4HTE A;  4WBO A;  2KT9 A;  3W15 B;  3PUS A;  1HS7 A;  1UUS A;  5AQO B;  3FB2 A;  5HEO A;  2KXP B;  3HKE E;  3NWI A;  2DL1 A;  2JMH A;  4YTN A;  4YY3 T;  5LMN T;  1T8B A;  3AAE B;  5F8P A;  3FZL B;  2X9H A;  2N1G A;  2WCA A;  1SHZ C;  3N9O A;  3F2E A;  5BMV E;  2KZ7 B;  4O4L E;  4DMW A;  5HAX A;  3LFM A;  1HG2 A;  2VL0 A;  3RC8 A;  2Q9Q C;  2LHN A;  2PFV A;  5BR8 T;  4QX8 B;  1YQ4 A;  3EAM A;  2BDE A;  5M4Y A;  1UX5 A;  4JLE A;  3P4P A;  4G2A A;  2DWK A;  1KK7 A;  4P0A A;  4CN6 A;  4U72 A;  2EHO B;  2QGS A;  3VR8 A;  5FXZ A;  4LMK A;  4DR6 T;  4IE7 A;  2CA5 A;  4EZ4 A;  5LBM A;  1YXR A;  2R6G F;  5FYM A;  4H9R C;  3UQ7 A;  1CHU A;  3AEB A;  3CKD A;  3FZH B;  4HFB A;  4B3R T;  3WAK A;  2W63 A;  1SA0 E;  2KMF A;  1ZP0 A;  4JV5 T;  2XUE A;  2NP9 A;  2EHO D;  1HG5 A;  1I6Z A;  2VVS A;  1ZEE A;  2NTY A;  3P4S A;  2XM2 A;  2ODV A;  3L8R A;  4GKJ T;  4XBF B;  4QH1 A;  2IHR 1;  4GK5 E;  3RQU A;  5L4H A;  3LSV A;  2KIN B;  3LJC A;  2WU2 A;  2D0T A;  2MAW A;  3RIU C;  1WR6 A;  5FL1 A;  4H9O C;  4O4J E;  3ZYK A;  3EVY A;  4LML A;  3RGL A;  2XSA A;  2IUB A;  2UXN B;  5AQQ B;  3HR0 A;  2VL8 A;  3JC6 D;  5IHY A;  1YKE B;  3ZST A;  4B3M T;  2XPK A;  3M3Z B;  1HTJ F;  2XQY A;  2UU9 T;  5FXV A;  4AQG A;  4UVB B;  1E1H B;  2X9Y A;  1Y01 A;  5ABF B;  3ZC0 A;  4LFC T;  1E2A A;  2BG9 E;  2WU5 A;  4CN4 A;  4E7Z A;  2GK9 A;  5L4E A;  3RPU A;  3UFE A;  4PAG A;  4NUU A;  3ANW A;  3N9L A;  3SS1 A;  1ZOY A;  1MMA A;  3NZP A;  2WZI A;  4ILB A;  4Z90 A;  3Q9D A;  2G0U A;  4IE6 A;  3L3P A;  3ZKR A;  1FEW A;  3L39 A;  2CBJ A;  3B5M A;  2K3W A;  4KHP T;  2LSY A;  4JI1 T;  4HWC A;  2QRX A;  4IDN A;  1XNQ T;  3IF8 B;  3AE6 A;  5FL0 A;  3VR9 A;  2UXX B;  1JNZ A;  4UV9 B;  1OED A;  4ZI3 D;  5IWA T;  1J5W A;  2D2S A;  5AQG B;  2Y48 B;  4AKI A;  2YKS A;  4CXY A;  5LHI B;  4TNW A;  4UR9 A;  5LP6 E;  2CRB A;  2I0M A;  1D1C A;  1UX4 A;  3ZCJ A;  3QB5 A;  3PUG A;  2X0Y A;  3L09 A;  4PJN A;  3LK4 2;  5F3J A;  4DVD A;  3PDY A;  2YEV C;  2JQ9 A;  5LGN B;  4H9S E;  3V5U A;  2E9X C;  4EYU A;  4IDQ A;  4EIW A;  4QKN A;  2FJB A;  3OVU A;  4IDO A;  3VRA A;  1Y64 B;  3X1D A;  2BZB A;  4ZS2 A;  1KF6 A;  2W62 A;  2XAF B;  2YDR A;  3AEC A;  2UUA T;  5HXR A;  4DND A;  2HPJ A;  5ETW A;  2VVN A;  2LLY A;  4IDP A;  5AQL B;  2CLY C;  4NXM T;  2DHR A;  1KEY A;  1B7T A;  2LM2 A;  3TLT A;  4YTM A;  2LSI A;  1X9B A;  3FBZ A;  1HNZ T;  4IE5 A;  3ZCI A;  4C91 A;  5L3G B;  3N2G E;  4IST A;  3I0Q A;  3ONL C;  4TWH A;  4ILC A;  1HX1 B;  5FY7 A;  4B3S T;  3AED A;  3ZJ1 A;  2M6B A;  3FHN A;  1D0Z A;  1V9D A;  5JR9 C;  2XQ3 A;  4NXN T;  2BKO A;  4IIJ E;  5L3F B;  5KDM C;  4UV8 B;  4K0K T;  1W9R A;  2E2A A;  4IL9 A;  4JBW F;  4KUM B;  1BR0 A;  4X20 E;  5AQM B;  2MBG A;  2IAK A;  4ILA A;  4LFA T;  1IBM T;  5KMG P;  3CX6 B;  5A1L A;  3Q5D A;  4BAY B;  4OFZ A;  5LBQ B;  1G73 A;  4V1A v;  2FBW A;  3P4Q A;  5LCY A;  4U7I A;  2KND A;  1W0B A;  3P7I A;  3MKD A;  3DTO A;  4PNI A;  3ESL A;  3AEA A;  5L3B B;  5AQR B;  4ILU A;  3RYF E;  3DJB A;  3Q5E A;  4WBN E;  2LKH A;  1WFD A;  2A3D A;  5JRC A;  3FZM B;  4DV6 T;  2JQH A;  2WP9 A;  3LBX A;  2XTL A;  4AQF A;  4UIG A;  1MMN A;  3H37 A;  3MAC A;  3OJA A;  3PTR B;  5DAB A;  1W09 A;  3ZSS A;  2JJ9 A;  2Q9Q B;  4TX5 A;  3JAD A;  5JDQ A;  1JNR A;  4YHH T;  2C5K T;  4NIQ A;  1IBK T;  3SFE A;  3NRX A;  4EOZ B;  5HXH A;  3RC3 A;  3RH3 A;  3GN5 B;  1VCT A;  4X64 T;  2BG9 A;  3AE9 A;  3ZN1 B;  1I94 T;  1IJ5 A;  3FZF B;  2BKN A;  2KWH A;  4HEA A;  4OYJ A;  2JMK A;  4DR7 T;  2CHO A;  3RIA A;  5JDG A;  2QA7 A;  3Q2M A;  4ADZ A;  2X9W A;  4F6R C;  4IDZ A;  2Q9Q D;  3UUL A;  1LKX A;  2ZLY A;  5FY0 A;  4JI8 T;  4IGU A;  4IE0 A;  3PUZ F;  4ZOL E;  5E0O A;  2OV9 A;  2WAU A;  2XY8 B;  5HEH A;  2YOE A;  3ZMU B;  2UUB T;  2NW7 A;  3J7Y q;  2OA5 A;  4U3C A;  2LKG A;  2YK0 A;  5HEU A;  4YXD A;  5AQF B;  3K3Q C;  4UVC B;  2CXD A;  4ZS3 A;  2WWV A;  3RQW A;  3D0T A;  2A9U A;  2JRK A;  2LSK A;  2V26 A;  4ZZB A;  2B1E A;  5LJN A;  5EZY E;  3RI5 A;  1HR0 T;  2L8K A;  3AAI A;  2E9X A;  4QHO A;  1XDP A;  3UU3 A;  4KMC A;  4JI7 T;  3UQ4 A;  4DMV A;  4HN9 A;  2WM9 A;  5HXS A;  2HN2 A;  3EDU A;  1WYC A;  2N9D A;  4FJO A;  5AQT B;  3SWH A;  1YW0 A;  1CUN A;  3KV9 A;  2BKP A;  2KWI B;  3PUX F;  5JDM A;  4AIU A;  4CZZ B;  2XQ4 A;  4YJ2 E;  2X68 A;  5AQV B;  4HFH A;  2J4G A;  4LF5 T;  3R84 B;  4DID B;  4DV2 T;  3RKG A;  4L9I A;  4PW8 A;  3I9Y A;  2FJE A;  1O3X A;  4HGA A;  2WDR A;  4X1Y E;  2XM1 A;  2CM0 A;  4Z91 A;  3UT5 E;  5J2U E;  4DBQ A;  4CXX A;  1WCR A;  3ZMT B;  5L2L A;  4AKL A;  3PUW F;  2WDV A;  4WNK A;  5HEG A;  1T7S A;  5JR9 A;  1FIO A;  3IBP A;  3NKZ A;  2Y6X A;  1VCS A;  5EK3 A;  2CXL A;  2IW5 B;  1YQ3 A;  1D0Y A;  4ZZC A;  4YSY A;  2MPK A;  4YSZ A;  3AXJ A;  3JAF A;  2CXF A;  5DQW A;  2V6Y B;  3U78 A;  3F57 A;  3AEE A;  2DWG A;  5FVL A;  1MIV A;  4E7S A;  4PK6 A;  2J47 A;  2I6H A;  2XHE B;  2NOX A;  4CI3 B;  4U33 A;  3I0O A;  3RIF A;  4PFP A;  1N34 T;  3H3A A;  4MFR A;  2CCQ A;  5FVK A;  1XNR T;  4QXB B;  5JDL A;  3PJA A;  1UGO A;  4O4H E;  5JDF A;  4WYV A;  3P50 A;  4COF A;  1BR1 A;  3NRY A;  1MNE A;  3HKB E;  4I43 B;  4IT4 A;  3N2O A;  4UF0 B;  2PJQ A;  2H7V C;  4QXC B;  2CMR A;  3WI3 A;  2XAG B;  1AJ3 A;  5J2T E;  3CQX C;  2LJL A;  3P4W A;  4U2Y A;  3ZMS B;  1KNZ A;  3LK2 B;  1MIY A;  3ZMV B;  5H6R B;  1XMQ T;  4AQF C;  3MZK B;  3N5L A;  3ZLI A;  5HCJ A;  2E5V A;  3ETU A;  3B57 A;  5TAO A;  2W67 A;  2VB6 A;  2V7I A;  4YFS A;  4DR1 T;  1J5E T;  2H3R A;  2YU1 A;  2WDQ A;  2HH7 A;  4U74 A;  2X0L B;  4DBR A;  2D0U A;  3PUV F;  2BS2 A;  4GK0 E;  4JEU B;  2VUR A;  4YT0 A;  4TV9 E;  4QH5 A;  5CA1 E;  2DI4 A;  2BG9 C;  3IEE A;  3AA7 B;  4BA9 A;  3E22 E;  2XQ8 A;  5JVD E;  1VRB A;  2H89 A;  1IZN B;  2CWO A;  3ONJ A;  5HXC A;  4DO0 A;  2VKO A;  2XZE A;  2VKJ A;  4H63 V;  4ZHQ E;  2UXC T;  5C2T A;  3JC6 C;  1BR2 A;  4XZC A;  3UU4 A;  2AXD S;  5LA6 E;  5DQV A;  3N9Q A;  1E7P A;  2OLT A;  2JIW A;  5AQI B;  1S94 A;  2KLQ A;  3S4U A;  2L3L A;  5FXX A;  1MND A;  2PTF A;  3CK6 A;  2A2F X;  1YKH B;  3ZPO A;  3UUB A;  2X9X A;  3ZN0 B;  1H7C A;  3CML A;  2V7J A;  3QOF A;  5HXE A;  2LOP A;  4LF6 T;  4HFE A;  5L47 A;  4ZI2 D; 
#chains in the Genus database with same CATH homology
 4DR4 T;  4DV1 T;  1HNW T;  4DV6 T;  4JI6 T;  4DV3 T;  4NXM T;  4AQY T;  4JI4 T;  4DV0 T;  1HR0 T;  1N36 T;  2ZM6 T;  5IWA T;  5BR8 T;  1HNZ T;  4LFB T;  4JI7 T;  4LF9 T;  4DUY T;  4LF4 T;  4YHH T;  4B3S T;  4DR5 T;  1N34 T;  4X62 T;  1IBK T;  4LF7 T;  4OX9 T;  4B3M T;  2UXB T;  2VQF T;  1FJG T;  4DV4 T;  1XNR T;  2UU9 T;  4JI5 T;  3T1H T;  4NXN T;  4X64 T;  2E5L T;  2F4V T;  3OTO T;  4DR6 T;  1I94 T;  4K0K T;  4B3T T;  2UXD T;  2UXC T;  4JI3 T;  4LFC T;  5LMU T;  4DR7 T;  4LF5 T;  4B3R T;  4GKK T;  4DV2 T;  1HNX T;  1N32 T;  1IBL T;  2UUC T;  4LFA T;  4JV5 T;  1IBM T;  4JI8 T;  4LF8 T;  4JI0 T;  4X66 T;  4DV5 T;  3T1Y T;  4DV7 T;  1XMO T;  2UUB T;  1XMQ T;  4GKJ T;  4DR3 T;  4YY3 T;  5LMN T;  2HHH T;  1N33 T;  4DUZ T;  4DR2 T;  4LF6 T;  2VQE T;  4KHP T;  4X65 T;  4JI1 T;  4JI2 T;  4JYA T;  2UUA T;  4DR1 T;  1J5E T;  1XNQ T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...