4KHPT

Structure of the thermus thermophilus 30s ribosomal subunit in complex with de-6-msa-pactamycin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Bioactive Pactamycin Analog Bound to the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S Ribosomal RNA
total genus 33
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4khpT00
5LMNT 1FJGT 4DR7T 3OTOT 4K0KT 1XMQT 4B3MT 5BR8T 4X64T 1N34T 4JI5T 4B3TT 1HNWT 4JI2T 4DR2T 4JI7T 2UXDT 4GKKT 1HNZT 2UUAT 4DV3T 4LFAT 4JI3T 1N36T 1J5ET 4DV1T 1I94T 1IBMT 4LF7T 4DUYT 4JI8T 4X65T 4LF6T 4YHHT 4JI0T 1HNXT 3T1HT 4JYAT 4DV7T 4GKJT 2UUBT 4DUZT 4KHPT 2HHHT 4JI1T 4NXNT 1IBKT 4B3RT 3T1YT 4LF5T 4LFBT 4LFCT 2E5LT 4YY3T 4X66T 2UU9T 4DV4T 2UUCT 2UXCT 2ZM6T 4LF8T 2VQET 1N32T 4X62T 4AQYT 1XNQT 1N33T 1XNRT 2F4VT 4DR4T 2VQFT 1HR0T 4JV5T 4DR6T 4NXMT 2UXBT 4DV2T 5IWAT 4JI6T 4LF4T 4DV6T 5LMUT 4DR1T 4OX9T 1IBLT 4B3ST 1XMOT 4JI4T 4DR3T 4DV0T 4DV5T 4DR5T 4LF9T
chains in the Genus database with same CATH superfamily
1WLXA 2CCQA 3ESLA 3TLVA 4DUYT 2NW7A 3EAMA 2C5JA 2W61A 4DR7T 2WQYA 3PUVF 4AKHA 5JTGA 3Q9DA 1XMQT 4PAGA 3MZKB 4B3MT 3ZSSA 3CVRA 5HCMA 3FZFB 3ONJA 4DNDA 2I6HA 5HEUA 3I9YA 2V7KA 5EK3A 4PFPA 5LGNB 3SWHA 4YJ3E 5FYMA 1HX1B 3P4PA 5JVDE 3ZLIA 3A5XA 3AE1A 3I9WA 4HFCA 4TUYE 3NZPA 4YTMA 5FL1A 2LT3A 2VKOA 2XUEA 2GK9A 3BK9A 3HKEE 1KEYA 5LHIB 3K1SA 3AE5A 2IC9A 3N9PA 4JI5T 3ETUA 1MNEA 1GQEA 2OA5A 2WB5A 3ETVA 4EGWA 2LHNA 3CKDA 2HPJA 2G0UA 4DR2T 4KX6A 3RLFF 5LB7B 2MBGA 4EB6E 2VURA 4ILBA 5LGUB 2W63A 2XHEB 1FEWA 2X9YA 5E0OA 2NP9A 5CA0E 3UU5A 4LMKA 4M1PA 4KUMB 3K8PC 4CI3B 3AECA 4KBMB 1U5PA 3BQIA 1HS7A 2MPKA 5HEGA 3ZN1B 3E08A 2WBLA 2H3RA 2LSIA 2PFVA 2ZMAA 4QH1A 2YU2A 4IDNA 2NWBA 3EHZA 1SUMB 1VCTA 1X79A 3QC9A 1D0YA 5AQRB 1YD8G 3VHLA 4EV6A 1I94T 1OEDA 3PDYA 2QYWA 4LF7T 5JDGA 2VKDA 3ABVA 2CA5A 3RIUA 3TLTA 4IDOA 3OVUA 4UR9A 3NZQA 4P0BA 3I0OA 2V6YA 3VU7H 5L3BB 2AE9A 4CQIA 4ISTA 4IE7A 3N9QA 4NPPA 1MMDA 4ZI3C 3FZKB 4JYAT 2ACXA 1S35A 3PJAJ 5HEJA 2XQ6A 5F8PA 1KF6A 5FXWA 4IDZA 4KHPT 5LA6E 3KDSE 2ACZA 5AFUL 4OHFA 4ZI2C 5L2LA 2D0TA 2YDQA 3C98B 2JQ9A 4JI1T 4NIQA 3NVOA 3GA8A 2JRKA 4TX5A 3ZT5A 4PK5A 5LHGB 4MLKA 5A1LA 4IDQA 1MMNA 3J7Yq 4EYUA 3AAEB 2DCFA 3K3NA 5HXCA 1J5WA 1U4QA 2JQKA 2J47A 3CX8B 2WWVA 5AQHB 3W15B 4YY3T 4X66T 1ZHCA 2K9AA 4HWHA 2XY8B 4WBOA 3IF8B 2QRXA 4H9NC 4H9QC 3AA1B 2WDRA 1WFDA 3FBZA 5AQIB 5AQQB 2DNXA 4GOUA 3RPUA 3MKDA 5HXEA 4IDPA 2DI4A 4LF8T 1JNZA 4K0UA 3UT5E 3ZPOA 1OWAA 1XNRT 4L9IA 1KFYA 5FKYA 3X1DA 4Q25A 5KXJA 3EDUA 3O1HA 3AEBA 5JH7E 5JR9B 3T8OA 3OKQA 3RRWA 5FY1A 2CMRA 5HEOA 2XJ7A 1YW0A 4ZHQE 2K3WA 2W0GA 2W4XA 2LE8A 3PUWF 3VRBA 3K3QC 3C4ZA 3ZYMA 5AQFB 1HCIA 2QGSA 3CWZB 2FJAA 2CBIA 4I55E 4PJJA 5AQKB 5F5WA 5FL0A 3ZJ2A 1UURA 4EAHA 2K24A 5HXSA 5IWAT 4JI6T 2X9HA 2BKNA 3Q5XA 4I50E 2LOSA 5JREA 3WI3A 2ES0A 3LBXB 4I4TE 2KINB 2Z6EA 4IE4A 3FB2A 4IT4A 2M6BA 4DR1T 4X20E 5LGTB 3ZT6A 4HFEA 2XQ8A 4DVDA 1YQ4A 4AI6A 2Q9QD 2Y48B 3ZMUB 3RQUA 4UEMA 4U2ZA 2BVMA 4BJNA 4P1NA 4IL9A 2J4GA 3RHWA 2KZ7B 4HWCA 2X0LB 5AQGB 2C5KT 4CN1A 2Q9QC 4EYYR 3ZMVB 4LF9T 1I6ZA 1KNPA 3G06A 3HKBE 4PW8A 1QUUA 5AQVB 2J1DG 2VB6A 3O1JA 3AE4A 4U31A 1WR0A 3L39A 4CI1B 1Y01A 2CLYC 5LXTE 1BR4A 2V26A 1KNZA 4F8HA 5EK2A 2D9DA 2UXXB 2UXNB 4KI0F 4OK0A 1BR0A 5CFBA 1NEKA 2H7VC 4ZS3A 4TV9E 2IHR1 3UFEA 3EVYA 2EHOB 3GN5B 4QKNA 3FZLB 2BG9B 4X1YE 3CQXC 2V7MA 4G63A 4Z91A 5ABFA 2LHRA 4PFOA 5LG4A 4U7IA 4H63V 3QOFA 2X0HA 5FXXA 2PBIA 2KMFA 2IIUA 4PNIA 5LHHB 2E2AA 2BKPA 2YDRA 3ANWB 4ZEYA 2IUBA 2FJEA 1WR6A 3IA3A 4UELA 5FVLA 1VRBA 4PJNA 3QB5K 3RYFE 3V5UA 2LSYA 3QK6A 3ZMZB 5HAXA 1XDOA 3B57A 5JDLA 3AEEA 2FBWA 3SFEA 5DJQC 3JAFA 4IGUA 4ILCA 5EZYE 4HFDA 3C4XA 2CXDA 3F2EA 3LK42 1OEDC 2WS3A 3AAAB 4TWFA 4JEUB 2V7IA 5FNVE 2DHRA 2XAHB 3KVBA 3OPCA 2L8KA 1UK5A 1V9DA 4IREA 5HEHA 3JC6C 2V7LA 3VRAA 4EZ4A 4LFAT 1O3XA 1E7PA 2DL1A 2OV9A 4PK6A 4BA9A 1UX5A 3N9LA 3ZYLA 2WZIA 3I1AA 2YINA 4QXBB 4YJ2E 2IMLA 5FXZA 2XAQB 3ANWA 1YQ3A 5LCYA 2ZM0A 4X65T 5J2TE 4U7YA 2B1EA 5J1GA 2V7JA 4TNVA 2JMKA 1XZYA 2A72A 3C64A 3ONLC 3AXJA 3ZCJA 5ETWA 2LKHA 3U3IA 4ZI3D 1HNXT 3VKHA 3BQLA 2WMNA 3ZEFB 1T7SA 2UUBT 3FZHB 1CHUA 4DUZT 1NWMX 2WCAA 2HN1A 2XQ7A 4GIWA 4I43B 5DQWA 2FJDA 4JEHB 4WYVA 4DBRA 2HHHT 4CN4A 5HYAA 4ASKA 2DLRA 2VL8A 5IUXA 3RQWA 3AVSA 3PURA 2BBJA 3FXDB 2P9BA 1L0VA 4AKRB 3AA0B 4AQFA 3OBVE 5AQJB 4LMJA 1UCUA 2E5VA 1BR2A 1WRDA 1YKEB 2QVAA 4FI5A 4DMWA 2FUPA 2V5DA 3CK6A 3H37A 3EABA 5L3CB 5C2TA 1IJ5A 1MIVA 3NWIA 4IIJE 4TZ4C 3FBLA 4ILUA 4CI2B 2JIWA 2N1GA 2XM1A 3VR9A 4AISA 2UXCT 4OYKA 5LP6E 3GMIA 3AE7A 2VQET 1D1AA 2WMOA 3H3AA 4AQYT 1XNQT 4P0AA 2N2NA 3LFMA 4EEDA 2FJBA 1XDPA 1M7KA 2WAUA 2CE7A 1JNRA 2WU2A 3C4WA 2F4VT 4DR4T 5JDHA 5KX5E 3PJAA 2E8IA 2VQFT 1FIOA 3SFDA 2YOEA 2M67A 4ILAA 2CHNA 2X68A 4V1Av 5LJMA 4CN6A 3ZMTB 4JV5T 5CA1E 4CXYA 4DR6T 2UXBT 3CX7B 1MIYA 1VOMA 3CQCB 1SHZC 3N9OA 4O2AE 4QXHB 3ZN0B 2BS2A 3UUNA 5FP3A 3GWHA 5L3DB 4DV6T 3KVAA 1S94A 3SS1A 3AEFA 3OYXA 2AXDS 2Q9QA 2XAFB 4QXCB 5LMUT 2D0UA 3RRCA 5C8YE 4OX9T 3RIUC 3AXJB 3Q5DA 3D0TA 4QWNB 3RIFA 2XQ9A 1H7CA 1OXZA 2LRLA 3LG7A 3RYCE 1MNDA 4AXPA 4HGAA 5FY0A 4DV0T 4H9SE 3DP7A 3ZT7A 4DV5T 3Q2MA 3AE9A 3N9MA 4HFVA 4ZXLA 4X5TA 3RIAA 4MFRA 4ZI7E 5LG3A 2IC6A 4HTEA 5JR9A 2IW5B 5M4YA 4XZCA 4HN9A 1SE7A 1FJGT 2YU1A 3CIRA 1B7TA 2KWIB 2YK0A 5EK4A 5FMNA 3AA7B 5C3JA 4JLEA 4O4JE 3RYHE 3E0ZA 3JC6D 3V5SA 2HN2A 3CQGB 2C0SA 4UF0A 3RX6A 4YSXA 3H3MA 4X64T 1QLBA 1FMWA 3MXZA 5HCJA 2I59A 1UGOA 4O4IE 1NENA 3M65A 2BG9E 5J0ZA 4AQFC 2WZHA 4YTNA 2JMHA 4P09A 4QX7B 4JI7T 2V1DB 1Z8UA 2X9XA 2XAGB 3P50A 1W09A 4I0UA 4A97A 2UXDT 2A3DA 3CPZA 3C51A 2CHOA 2HH7A 1HNZT 2PG8A 5FY7A 4HWFA 2W00A 5KDMC 2BVLA 2KWHA 2NTYA 2X67A 3A8YC 4HFHA 4O4HE 1D1CA 2A9UA 1MMGA 2LLYA 2XASB 2YEVC 4DV3T 4HWIB 2D2SA 3UQ7A 2XAJB 4H9RC 4PK4A 4A56A 1J5ET 2Y8DA 3PTRB 2SPCA 3LK3B 4KP3C 1IBMT 2DWGA 2XZEA 1KK7A 3AE6A 3NKZA 2XQ5A 4UIGA 2BG9C 4ERRA 4YHHT 1WYCA 2WDVA 2BZBA 4IE0A 4L0RA 3UUBA 2KT9A 4QH4A 1US7B 2JJ9A 2ODUA 1G8XA 2BS3A 3F31A 2LKGA 3PUSA 5LOVE 4YSYA 4GKJT 3OJAA 2CBJA 2PTFA 4AKGA 3ZSTA 3QB5A 2NTXA 5J2UE 3J9X1 4GK0E 2Q9QB 4IE5A 4GK5E 1R8IA 3ZC0A 4PJMA 4WNKA 3PU3A 1ZV4X 2H88A 3PUYF 5JQGE 5L3GB 3O9XA 1IBKT 4B3RT 3Q5WA 3RH3A 4YFSA 4B6XA 3T1YT 2WDQA 2VKHA 2BDEA 2ODVA 2ZM8A 3L09A 4HE8A 3R84B 3PU8A 2QA7A 5L4EA 3TLUA 3PUAA 3VR8A 3QUJA 1M62A 2LJLA 2A2FX 2JPFA 5AQOB 2X51A 4IE6A 4DV4T 2UUCT 1HX8A 5FXVA 1LRZA 4C90A 2YKSA 5HWXA 1VCSA 3ZKRA 2C5IT 2EHOD 5TAOA 2VWAA 2VASA 2XTLA 4X62T 1ZP0A 5LBQB 1N33T 1W0AA 4J2CA 5GONE 4IL4A 3UU8A 4UV9B 3RC8A 1D1BA 4E7ZA 1SA0E 2WWUA 2WY2A 5JRCA 2RP4A 4U72A 3JADA 3P4RA 4CXXA 3UQ4A 5ABHA 3SRZA 4Z8XA 1G73A 4A98A 1HR0T 2W66A 2OLTA 4TWDA 3FXEB 3L3PA 4IHJE 3N2OA 3O1IA 3IBPA 4YLHA 3RF1A 1T98A 3P4WA 3N2KE 5FVKA 1OEDE 2L9QA 2MYSA 4LF4T 4X1IE 3P8CD 4AQGA 3M3ZB 5LBMA 2WP9A 2E9XC 5DQVA 2KNDA 3U78A 4TNWA 4HWDA 4U2YA 4ZI2D 4JUYA 2YN6A 1XWMA 3UULA 1HG5A 3ZJ1A 3LSVA 4F6RC 4E7SA 1IBLT 1ZOYA 4AKIA 4KMCA 4EIWA 3VKGA 4UVBB 5IYZE 2PJQA 5HXHA 4B3ST 2XSBA 1LVKA 3JCFA 2NW9A 3UUMA 4OYJA 4EEBA 2VK9A 3EUHA 4DR3T 3AB3B 3IEEA 4WW0A 3EI0A 1IJ6A 4HFBA 4H9PC 2XQYA 2NOXA 3AEAA 4ZOLE 4UVAB 2BG9A 3S4UA 4YXDA 5LYJE 5CGMA 5L3FB 5LMNT 2V6XA 2E9XD 3OTOT 4YT0A 2LRKA 2BBHA 4QX8B 4K0KT 1YKHB 1J1JA 4YHJA 1AJ3A 1X9BA 3R6NA 2I0MA 5JDFA 2WSSV 1D0XA 5AQSB 3ZMSB 4ZZCA 5BR8T 2MAWA 3N2GE 5ADXL 3BQKA 5JDMA 2VKJA 4OFZA 5BMVE 3P4QA 5L47A 2KLQA 2Y6XA 2X0YA 3RGLA 1N34T 3P4SA 3K3OA 2V5CA 4Z90A 1NAFA 3KV9A 1MMAA 2CWYA 2BS4A 3UFGA 4CZZB 3C50A 3Q5EA 3RI5A 3KBTA 3LDQB 5AQTB 2X66A 3PUZF 1IAPA 5H6QB 5L4HA 4B3TT 5JDNA 5HXRA 2JQHA 2CM0A 3CX6B 1UUSA 3AE8A 3MJXA 4U33A 3AVRA 4DO0A 2MOZA 3KFWX 4JI2T 1HF8A 1HNWT 5JRCB 2EHOC 3UU3A 1LKXA 4HKAA 4QHOA 2ZM2A 3AEGA 5CB4E 4GKKT 2JQQA 3LBXA 4LMLA 2KSRA 2LSJA 3QNUA 4JBWF 4L5GA 4TN7B 2MTQA 4YSZA 5HWYA 4PJLA 4A5XA 2CEAA 4C91A 5LNKA 2W62A 2CLYB 1W0BA 2XSAA 3UUXB 3B13A 4KHZF 2UUAT 1DU2A 2LM2A 2XQ4A 4BJMA 4O8SA 1HTJF 4DIDB 2LEHA 2VVNA 4ISSA 5ABGA 2YDSA 3NBXX 5JDQA 2CWOA 2XQAA 3ZYKA 3N5LA 1T8BA 2DWKA 3E22E 5LJNA 3PE0A 2ZLYA 4DMVA 4YTPA 5CJ5A 3WAJA 4JI3T 4JI8T 3KV4A 3N9NA 1N36T 3I0QA 3PV0F 3B5MA 4O4LE 4DV1T 2XPKA 4TV8E 2RA1A 4XAXB 3A7MA 4LF6T 1W9RA 1ZEEA 2H89A 2WM9A 3HR0A 4EZHA 2B76A 2VL0A 4GYSA 4H63H 4DBQA 2M6IA 4JI0T 5AQUB 3NRYA 3T1HT 1IZNB 4TWHA 4DV7T 3HI2A 3OYZA 2E9XA 4EOZB 2V8SV 5F3JA 1YXRA 1WYBA 1D0ZA 2K5BB 4AIUA 1FMVA 1BR1A 2KXPB 2BKOA 2XM2A 4FJOA 1ZKEA 3ZCIA 4MHCA 5JR9C 2L3LA 3HA4A 2WU5A 5KMGP 5AQNB 4ZS2A 1QSDA 2LOPA 4UF0B 4UVCB 3UTKA 4NXNT 3PUGA 3AE2A 3TKLB 4AKLA 2W67A 2CXFA 4NXMT 2RPAA 3FHNA 3ZC1A 4LF5T 4U3CA 2CXLA 3DTOA 3EDVA 2X9WA 3ONXA 4LFBT 4ZZBA 4LFCT 2R6GF 2IDOB 2E5LT 2UU9T 2XQ3A 2LM9A 3HL6A 1LVFA 2LSKA 5DABA 5IHYA 1HG2A 3CMLA 4G2AA 4QH5A 4DR5T 3RKOA 1CUNA 3TLSA 2D5UA 4UXNB 5AQMB 2ZM6T 2V6YB 4WZXA 3TLWA 4HFIA 5ABEA 1N32T 3MK7C 3L8RA 3JAEA 2VVSA 2IAKA 3WAKA 4UV8B 1OEDB 2H7OA 3PUQA 3MACA 2CRBA 3LJCA 2CPTA 1HFAA 1T72A 3HKDE 3KBUA 3KV5A 4COFA 3AEDA 3FZMB 4X1KE 2HPLA 2NW8A 3AA6B 1EZ3A 1Z0PA 3RC3A 5L3EB 4DV2T 2EHOA 1KNRA 3GN5A 4HEAA 4NUUA 4ANJA 4CXWA 4GYRA 1Y64B 5H6RB 1UX4A 3UU6A 4ADZA 4N78D 3HKCE 4XBFB 5AQPB 3SOLA 3PUXF 3KV6A 3AE3A 1WCRA 2E9XB 2NR4A 3UU4A 4O2BE 2W2UA 2K48A 3AAIA 2J62A 3DJBA 3NRXA 4MALA 3RKGA 3RYIE 3KINB 3F57A 4NUVA 1E2AA 4MBQA 5AQLB 3MA9A 3O4XE 3IHRA 5ABFB 4EXTA 1XMOT 3LK2B 1E1HB 4BAYB 4JI4T 4H9OC 2N9DA 2LSGA 3P7IA 1MIWA 4U74A 4WBNE
chains in the Genus database with same CATH topology
5LMNT 1FJGT 4DR7T 3OTOT 4K0KT 1XMQT 4B3MT 5BR8T 4X64T 1N34T 4JI5T 4B3TT 1HNWT 4JI2T 4DR2T 4JI7T 2UXDT 4GKKT 1HNZT 2UUAT 4DV3T 4LFAT 4JI3T 1N36T 1J5ET 4DV1T 1I94T 1IBMT 4LF7T 4DUYT 4JI8T 4X65T 4LF6T 4YHHT 4JI0T 1HNXT 3T1HT 4JYAT 4DV7T 4GKJT 2UUBT 4DUZT 4KHPT 2HHHT 4JI1T 4NXNT 1IBKT 4B3RT 3T1YT 4LF5T 4LFBT 4LFCT 2E5LT 4YY3T 4X66T 2UU9T 4DV4T 2UUCT 2UXCT 2ZM6T 4LF8T 2VQET 1N32T 4X62T 4AQYT 1XNQT 1N33T 1XNRT 2F4VT 4DR4T 2VQFT 1HR0T 4JV5T 4DR6T 4NXMT 2UXBT 4DV2T 5IWAT 4JI6T 4LF4T 4DV6T 5LMUT 4DR1T 4OX9T 1IBLT 4B3ST 1XMOT 4JI4T 4DR3T 4DV0T 4DV5T 4DR5T 4LF9T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMN T;  1FJG T;  4DR7 T;  3OTO T;  4K0K T;  1XMQ T;  4B3M T;  5BR8 T;  4X64 T;  1N34 T;  4JI5 T;  4B3T T;  1HNW T;  4JI2 T;  4DR2 T;  4JI7 T;  2UXD T;  4GKK T;  1HNZ T;  2UUA T;  4DV3 T;  4LFA T;  4JI3 T;  1N36 T;  1J5E T;  4DV1 T;  1I94 T;  1IBM T;  4LF7 T;  4DUY T;  4JI8 T;  4X65 T;  4LF6 T;  4YHH T;  4JI0 T;  1HNX T;  3T1H T;  4JYA T;  4DV7 T;  4GKJ T;  2UUB T;  4DUZ T;  4KHP T;  2HHH T;  4JI1 T;  4NXN T;  1IBK T;  4B3R T;  3T1Y T;  4LF5 T;  4LFB T;  4LFC T;  2E5L T;  4YY3 T;  4X66 T;  2UU9 T;  4DV4 T;  2UUC T;  2UXC T;  2ZM6 T;  4LF8 T;  2VQE T;  1N32 T;  4X62 T;  4AQY T;  1XNQ T;  1N33 T;  1XNR T;  2F4V T;  4DR4 T;  2VQF T;  1HR0 T;  4JV5 T;  4DR6 T;  4NXM T;  2UXB T;  4DV2 T;  5IWA T;  4JI6 T;  4LF4 T;  4DV6 T;  5LMU T;  4DR1 T;  4OX9 T;  1IBL T;  4B3S T;  1XMO T;  4JI4 T;  4DR3 T;  4DV0 T;  4DV5 T;  4DR5 T;  4LF9 T; 
#chains in the Genus database with same CATH topology
 1WLX A;  2CCQ A;  3ESL A;  3TLV A;  4DUY T;  2NW7 A;  3EAM A;  2C5J A;  2W61 A;  4DR7 T;  2WQY A;  3PUV F;  4AKH A;  5JTG A;  3Q9D A;  1XMQ T;  4PAG A;  3MZK B;  4B3M T;  3ZSS A;  3CVR A;  5HCM A;  3FZF B;  3ONJ A;  4DND A;  2I6H A;  5HEU A;  3I9Y A;  2V7K A;  5EK3 A;  4PFP A;  5LGN B;  3SWH A;  4YJ3 E;  5FYM A;  1HX1 B;  3P4P A;  5JVD E;  3ZLI A;  3A5X A;  3AE1 A;  3I9W A;  4HFC A;  4TUY E;  3NZP A;  4YTM A;  5FL1 A;  2LT3 A;  2VKO A;  2XUE A;  2GK9 A;  3BK9 A;  3HKE E;  1KEY A;  5LHI B;  3K1S A;  3AE5 A;  2IC9 A;  3N9P A;  4JI5 T;  3ETU A;  1MNE A;  1GQE A;  2OA5 A;  2WB5 A;  3ETV A;  4EGW A;  2LHN A;  3CKD A;  2HPJ A;  2G0U A;  4DR2 T;  4KX6 A;  3RLF F;  5LB7 B;  2MBG A;  4EB6 E;  2VUR A;  4ILB A;  5LGU B;  2W63 A;  2XHE B;  1FEW A;  2X9Y A;  5E0O A;  2NP9 A;  5CA0 E;  3UU5 A;  4LMK A;  4M1P A;  4KUM B;  3K8P C;  4CI3 B;  3AEC A;  4KBM B;  1U5P A;  3BQI A;  1HS7 A;  2MPK A;  5HEG A;  3ZN1 B;  3E08 A;  2WBL A;  2H3R A;  2LSI A;  2PFV A;  2ZMA A;  4QH1 A;  2YU2 A;  4IDN A;  2NWB A;  3EHZ A;  1SUM B;  1VCT A;  1X79 A;  3QC9 A;  1D0Y A;  5AQR B;  1YD8 G;  3VHL A;  4EV6 A;  1I94 T;  1OED A;  3PDY A;  2QYW A;  4LF7 T;  5JDG A;  2VKD A;  3ABV A;  2CA5 A;  3RIU A;  3TLT A;  4IDO A;  3OVU A;  4UR9 A;  3NZQ A;  4P0B A;  3I0O A;  2V6Y A;  3VU7 H;  5L3B B;  2AE9 A;  4CQI A;  4IST A;  4IE7 A;  3N9Q A;  4NPP A;  1MMD A;  4ZI3 C;  3FZK B;  4JYA T;  2ACX A;  1S35 A;  3PJA J;  5HEJ A;  2XQ6 A;  5F8P A;  1KF6 A;  5FXW A;  4IDZ A;  4KHP T;  5LA6 E;  3KDS E;  2ACZ A;  5AFU L;  4OHF A;  4ZI2 C;  5L2L A;  2D0T A;  2YDQ A;  3C98 B;  2JQ9 A;  4JI1 T;  4NIQ A;  3NVO A;  3GA8 A;  2JRK A;  4TX5 A;  3ZT5 A;  4PK5 A;  5LHG B;  4MLK A;  5A1L A;  4IDQ A;  1MMN A;  3J7Y q;  4EYU A;  3AAE B;  2DCF A;  3K3N A;  5HXC A;  1J5W A;  1U4Q A;  2JQK A;  2J47 A;  3CX8 B;  2WWV A;  5AQH B;  3W15 B;  4YY3 T;  4X66 T;  1ZHC A;  2K9A A;  4HWH A;  2XY8 B;  4WBO A;  3IF8 B;  2QRX A;  4H9N C;  4H9Q C;  3AA1 B;  2WDR A;  1WFD A;  3FBZ A;  5AQI B;  5AQQ B;  2DNX A;  4GOU A;  3RPU A;  3MKD A;  5HXE A;  4IDP A;  2DI4 A;  4LF8 T;  1JNZ A;  4K0U A;  3UT5 E;  3ZPO A;  1OWA A;  1XNR T;  4L9I A;  1KFY A;  5FKY A;  3X1D A;  4Q25 A;  5KXJ A;  3EDU A;  3O1H A;  3AEB A;  5JH7 E;  5JR9 B;  3T8O A;  3OKQ A;  3RRW A;  5FY1 A;  2CMR A;  5HEO A;  2XJ7 A;  1YW0 A;  4ZHQ E;  2K3W A;  2W0G A;  2W4X A;  2LE8 A;  3PUW F;  3VRB A;  3K3Q C;  3C4Z A;  3ZYM A;  5AQF B;  1HCI A;  2QGS A;  3CWZ B;  2FJA A;  2CBI A;  4I55 E;  4PJJ A;  5AQK B;  5F5W A;  5FL0 A;  3ZJ2 A;  1UUR A;  4EAH A;  2K24 A;  5HXS A;  5IWA T;  4JI6 T;  2X9H A;  2BKN A;  3Q5X A;  4I50 E;  2LOS A;  5JRE A;  3WI3 A;  2ES0 A;  3LBX B;  4I4T E;  2KIN B;  2Z6E A;  4IE4 A;  3FB2 A;  4IT4 A;  2M6B A;  4DR1 T;  4X20 E;  5LGT B;  3ZT6 A;  4HFE A;  2XQ8 A;  4DVD A;  1YQ4 A;  4AI6 A;  2Q9Q D;  2Y48 B;  3ZMU B;  3RQU A;  4UEM A;  4U2Z A;  2BVM A;  4BJN A;  4P1N A;  4IL9 A;  2J4G A;  3RHW A;  2KZ7 B;  4HWC A;  2X0L B;  5AQG B;  2C5K T;  4CN1 A;  2Q9Q C;  4EYY R;  3ZMV B;  4LF9 T;  1I6Z A;  1KNP A;  3G06 A;  3HKB E;  4PW8 A;  1QUU A;  5AQV B;  2J1D G;  2VB6 A;  3O1J A;  3AE4 A;  4U31 A;  1WR0 A;  3L39 A;  4CI1 B;  1Y01 A;  2CLY C;  5LXT E;  1BR4 A;  2V26 A;  1KNZ A;  4F8H A;  5EK2 A;  2D9D A;  2UXX B;  2UXN B;  4KI0 F;  4OK0 A;  1BR0 A;  5CFB A;  1NEK A;  2H7V C;  4ZS3 A;  4TV9 E;  2IHR 1;  3UFE A;  3EVY A;  2EHO B;  3GN5 B;  4QKN A;  3FZL B;  2BG9 B;  4X1Y E;  3CQX C;  2V7M A;  4G63 A;  4Z91 A;  5ABF A;  2LHR A;  4PFO A;  5LG4 A;  4U7I A;  4H63 V;  3QOF A;  2X0H A;  5FXX A;  2PBI A;  2KMF A;  2IIU A;  4PNI A;  5LHH B;  2E2A A;  2BKP A;  2YDR A;  3ANW B;  4ZEY A;  2IUB A;  2FJE A;  1WR6 A;  3IA3 A;  4UEL A;  5FVL A;  1VRB A;  4PJN A;  3QB5 K;  3RYF E;  3V5U A;  2LSY A;  3QK6 A;  3ZMZ B;  5HAX A;  1XDO A;  3B57 A;  5JDL A;  3AEE A;  2FBW A;  3SFE A;  5DJQ C;  3JAF A;  4IGU A;  4ILC A;  5EZY E;  4HFD A;  3C4X A;  2CXD A;  3F2E A;  3LK4 2;  1OED C;  2WS3 A;  3AAA B;  4TWF A;  4JEU B;  2V7I A;  5FNV E;  2DHR A;  2XAH B;  3KVB A;  3OPC A;  2L8K A;  1UK5 A;  1V9D A;  4IRE A;  5HEH A;  3JC6 C;  2V7L A;  3VRA A;  4EZ4 A;  4LFA T;  1O3X A;  1E7P A;  2DL1 A;  2OV9 A;  4PK6 A;  4BA9 A;  1UX5 A;  3N9L A;  3ZYL A;  2WZI A;  3I1A A;  2YIN A;  4QXB B;  4YJ2 E;  2IML A;  5FXZ A;  2XAQ B;  3ANW A;  1YQ3 A;  5LCY A;  2ZM0 A;  4X65 T;  5J2T E;  4U7Y A;  2B1E A;  5J1G A;  2V7J A;  4TNV A;  2JMK A;  1XZY A;  2A72 A;  3C64 A;  3ONL C;  3AXJ A;  3ZCJ A;  5ETW A;  2LKH A;  3U3I A;  4ZI3 D;  1HNX T;  3VKH A;  3BQL A;  2WMN A;  3ZEF B;  1T7S A;  2UUB T;  3FZH B;  1CHU A;  4DUZ T;  1NWM X;  2WCA A;  2HN1 A;  2XQ7 A;  4GIW A;  4I43 B;  5DQW A;  2FJD A;  4JEH B;  4WYV A;  4DBR A;  2HHH T;  4CN4 A;  5HYA A;  4ASK A;  2DLR A;  2VL8 A;  5IUX A;  3RQW A;  3AVS A;  3PUR A;  2BBJ A;  3FXD B;  2P9B A;  1L0V A;  4AKR B;  3AA0 B;  4AQF A;  3OBV E;  5AQJ B;  4LMJ A;  1UCU A;  2E5V A;  1BR2 A;  1WRD A;  1YKE B;  2QVA A;  4FI5 A;  4DMW A;  2FUP A;  2V5D A;  3CK6 A;  3H37 A;  3EAB A;  5L3C B;  5C2T A;  1IJ5 A;  1MIV A;  3NWI A;  4IIJ E;  4TZ4 C;  3FBL A;  4ILU A;  4CI2 B;  2JIW A;  2N1G A;  2XM1 A;  3VR9 A;  4AIS A;  2UXC T;  4OYK A;  5LP6 E;  3GMI A;  3AE7 A;  2VQE T;  1D1A A;  2WMO A;  3H3A A;  4AQY T;  1XNQ T;  4P0A A;  2N2N A;  3LFM A;  4EED A;  2FJB A;  1XDP A;  1M7K A;  2WAU A;  2CE7 A;  1JNR A;  2WU2 A;  3C4W A;  2F4V T;  4DR4 T;  5JDH A;  5KX5 E;  3PJA A;  2E8I A;  2VQF T;  1FIO A;  3SFD A;  2YOE A;  2M67 A;  4ILA A;  2CHN A;  2X68 A;  4V1A v;  5LJM A;  4CN6 A;  3ZMT B;  4JV5 T;  5CA1 E;  4CXY A;  4DR6 T;  2UXB T;  3CX7 B;  1MIY A;  1VOM A;  3CQC B;  1SHZ C;  3N9O A;  4O2A E;  4QXH B;  3ZN0 B;  2BS2 A;  3UUN A;  5FP3 A;  3GWH A;  5L3D B;  4DV6 T;  3KVA A;  1S94 A;  3SS1 A;  3AEF A;  3OYX A;  2AXD S;  2Q9Q A;  2XAF B;  4QXC B;  5LMU T;  2D0U A;  3RRC A;  5C8Y E;  4OX9 T;  3RIU C;  3AXJ B;  3Q5D A;  3D0T A;  4QWN B;  3RIF A;  2XQ9 A;  1H7C A;  1OXZ A;  2LRL A;  3LG7 A;  3RYC E;  1MND A;  4AXP A;  4HGA A;  5FY0 A;  4DV0 T;  4H9S E;  3DP7 A;  3ZT7 A;  4DV5 T;  3Q2M A;  3AE9 A;  3N9M A;  4HFV A;  4ZXL A;  4X5T A;  3RIA A;  4MFR A;  4ZI7 E;  5LG3 A;  2IC6 A;  4HTE A;  5JR9 A;  2IW5 B;  5M4Y A;  4XZC A;  4HN9 A;  1SE7 A;  1FJG T;  2YU1 A;  3CIR A;  1B7T A;  2KWI B;  2YK0 A;  5EK4 A;  5FMN A;  3AA7 B;  5C3J A;  4JLE A;  4O4J E;  3RYH E;  3E0Z A;  3JC6 D;  3V5S A;  2HN2 A;  3CQG B;  2C0S A;  4UF0 A;  3RX6 A;  4YSX A;  3H3M A;  4X64 T;  1QLB A;  1FMW A;  3MXZ A;  5HCJ A;  2I59 A;  1UGO A;  4O4I E;  1NEN A;  3M65 A;  2BG9 E;  5J0Z A;  4AQF C;  2WZH A;  4YTN A;  2JMH A;  4P09 A;  4QX7 B;  4JI7 T;  2V1D B;  1Z8U A;  2X9X A;  2XAG B;  3P50 A;  1W09 A;  4I0U A;  4A97 A;  2UXD T;  2A3D A;  3CPZ A;  3C51 A;  2CHO A;  2HH7 A;  1HNZ T;  2PG8 A;  5FY7 A;  4HWF A;  2W00 A;  5KDM C;  2BVL A;  2KWH A;  2NTY A;  2X67 A;  3A8Y C;  4HFH A;  4O4H E;  1D1C A;  2A9U A;  1MMG A;  2LLY A;  2XAS B;  2YEV C;  4DV3 T;  4HWI B;  2D2S A;  3UQ7 A;  2XAJ B;  4H9R C;  4PK4 A;  4A56 A;  1J5E T;  2Y8D A;  3PTR B;  2SPC A;  3LK3 B;  4KP3 C;  1IBM T;  2DWG A;  2XZE A;  1KK7 A;  3AE6 A;  3NKZ A;  2XQ5 A;  4UIG A;  2BG9 C;  4ERR A;  4YHH T;  1WYC A;  2WDV A;  2BZB A;  4IE0 A;  4L0R A;  3UUB A;  2KT9 A;  4QH4 A;  1US7 B;  2JJ9 A;  2ODU A;  1G8X A;  2BS3 A;  3F31 A;  2LKG A;  3PUS A;  5LOV E;  4YSY A;  4GKJ T;  3OJA A;  2CBJ A;  2PTF A;  4AKG A;  3ZST A;  3QB5 A;  2NTX A;  5J2U E;  3J9X 1;  4GK0 E;  2Q9Q B;  4IE5 A;  4GK5 E;  1R8I A;  3ZC0 A;  4PJM A;  4WNK A;  3PU3 A;  1ZV4 X;  2H88 A;  3PUY F;  5JQG E;  5L3G B;  3O9X A;  1IBK T;  4B3R T;  3Q5W A;  3RH3 A;  4YFS A;  4B6X A;  3T1Y T;  2WDQ A;  2VKH A;  2BDE A;  2ODV A;  2ZM8 A;  3L09 A;  4HE8 A;  3R84 B;  3PU8 A;  2QA7 A;  5L4E A;  3TLU A;  3PUA A;  3VR8 A;  3QUJ A;  1M62 A;  2LJL A;  2A2F X;  2JPF A;  5AQO B;  2X51 A;  4IE6 A;  4DV4 T;  2UUC T;  1HX8 A;  5FXV A;  1LRZ A;  4C90 A;  2YKS A;  5HWX A;  1VCS A;  3ZKR A;  2C5I T;  2EHO D;  5TAO A;  2VWA A;  2VAS A;  2XTL A;  4X62 T;  1ZP0 A;  5LBQ B;  1N33 T;  1W0A A;  4J2C A;  5GON E;  4IL4 A;  3UU8 A;  4UV9 B;  3RC8 A;  1D1B A;  4E7Z A;  1SA0 E;  2WWU A;  2WY2 A;  5JRC A;  2RP4 A;  4U72 A;  3JAD A;  3P4R A;  4CXX A;  3UQ4 A;  5ABH A;  3SRZ A;  4Z8X A;  1G73 A;  4A98 A;  1HR0 T;  2W66 A;  2OLT A;  4TWD A;  3FXE B;  3L3P A;  4IHJ E;  3N2O A;  3O1I A;  3IBP A;  4YLH A;  3RF1 A;  1T98 A;  3P4W A;  3N2K E;  5FVK A;  1OED E;  2L9Q A;  2MYS A;  4LF4 T;  4X1I E;  3P8C D;  4AQG A;  3M3Z B;  5LBM A;  2WP9 A;  2E9X C;  5DQV A;  2KND A;  3U78 A;  4TNW A;  4HWD A;  4U2Y A;  4ZI2 D;  4JUY A;  2YN6 A;  1XWM A;  3UUL A;  1HG5 A;  3ZJ1 A;  3LSV A;  4F6R C;  4E7S A;  1IBL T;  1ZOY A;  4AKI A;  4KMC A;  4EIW A;  3VKG A;  4UVB B;  5IYZ E;  2PJQ A;  5HXH A;  4B3S T;  2XSB A;  1LVK A;  3JCF A;  2NW9 A;  3UUM A;  4OYJ A;  4EEB A;  2VK9 A;  3EUH A;  4DR3 T;  3AB3 B;  3IEE A;  4WW0 A;  3EI0 A;  1IJ6 A;  4HFB A;  4H9P C;  2XQY A;  2NOX A;  3AEA A;  4ZOL E;  4UVA B;  2BG9 A;  3S4U A;  4YXD A;  5LYJ E;  5CGM A;  5L3F B;  5LMN T;  2V6X A;  2E9X D;  3OTO T;  4YT0 A;  2LRK A;  2BBH A;  4QX8 B;  4K0K T;  1YKH B;  1J1J A;  4YHJ A;  1AJ3 A;  1X9B A;  3R6N A;  2I0M A;  5JDF A;  2WSS V;  1D0X A;  5AQS B;  3ZMS B;  4ZZC A;  5BR8 T;  2MAW A;  3N2G E;  5ADX L;  3BQK A;  5JDM A;  2VKJ A;  4OFZ A;  5BMV E;  3P4Q A;  5L47 A;  2KLQ A;  2Y6X A;  2X0Y A;  3RGL A;  1N34 T;  3P4S A;  3K3O A;  2V5C A;  4Z90 A;  1NAF A;  3KV9 A;  1MMA A;  2CWY A;  2BS4 A;  3UFG A;  4CZZ B;  3C50 A;  3Q5E A;  3RI5 A;  3KBT A;  3LDQ B;  5AQT B;  2X66 A;  3PUZ F;  1IAP A;  5H6Q B;  5L4H A;  4B3T T;  5JDN A;  5HXR A;  2JQH A;  2CM0 A;  3CX6 B;  1UUS A;  3AE8 A;  3MJX A;  4U33 A;  3AVR A;  4DO0 A;  2MOZ A;  3KFW X;  4JI2 T;  1HF8 A;  1HNW T;  5JRC B;  2EHO C;  3UU3 A;  1LKX A;  4HKA A;  4QHO A;  2ZM2 A;  3AEG A;  5CB4 E;  4GKK T;  2JQQ A;  3LBX A;  4LML A;  2KSR A;  2LSJ A;  3QNU A;  4JBW F;  4L5G A;  4TN7 B;  2MTQ A;  4YSZ A;  5HWY A;  4PJL A;  4A5X A;  2CEA A;  4C91 A;  5LNK A;  2W62 A;  2CLY B;  1W0B A;  2XSA A;  3UUX B;  3B13 A;  4KHZ F;  2UUA T;  1DU2 A;  2LM2 A;  2XQ4 A;  4BJM A;  4O8S A;  1HTJ F;  4DID B;  2LEH A;  2VVN A;  4ISS A;  5ABG A;  2YDS A;  3NBX X;  5JDQ A;  2CWO A;  2XQA A;  3ZYK A;  3N5L A;  1T8B A;  2DWK A;  3E22 E;  5LJN A;  3PE0 A;  2ZLY A;  4DMV A;  4YTP A;  5CJ5 A;  3WAJ A;  4JI3 T;  4JI8 T;  3KV4 A;  3N9N A;  1N36 T;  3I0Q A;  3PV0 F;  3B5M A;  4O4L E;  4DV1 T;  2XPK A;  4TV8 E;  2RA1 A;  4XAX B;  3A7M A;  4LF6 T;  1W9R A;  1ZEE A;  2H89 A;  2WM9 A;  3HR0 A;  4EZH A;  2B76 A;  2VL0 A;  4GYS A;  4H63 H;  4DBQ A;  2M6I A;  4JI0 T;  5AQU B;  3NRY A;  3T1H T;  1IZN B;  4TWH A;  4DV7 T;  3HI2 A;  3OYZ A;  2E9X A;  4EOZ B;  2V8S V;  5F3J A;  1YXR A;  1WYB A;  1D0Z A;  2K5B B;  4AIU A;  1FMV A;  1BR1 A;  2KXP B;  2BKO A;  2XM2 A;  4FJO A;  1ZKE A;  3ZCI A;  4MHC A;  5JR9 C;  2L3L A;  3HA4 A;  2WU5 A;  5KMG P;  5AQN B;  4ZS2 A;  1QSD A;  2LOP A;  4UF0 B;  4UVC B;  3UTK A;  4NXN T;  3PUG A;  3AE2 A;  3TKL B;  4AKL A;  2W67 A;  2CXF A;  4NXM T;  2RPA A;  3FHN A;  3ZC1 A;  4LF5 T;  4U3C A;  2CXL A;  3DTO A;  3EDV A;  2X9W A;  3ONX A;  4LFB T;  4ZZB A;  4LFC T;  2R6G F;  2IDO B;  2E5L T;  2UU9 T;  2XQ3 A;  2LM9 A;  3HL6 A;  1LVF A;  2LSK A;  5DAB A;  5IHY A;  1HG2 A;  3CML A;  4G2A A;  4QH5 A;  4DR5 T;  3RKO A;  1CUN A;  3TLS A;  2D5U A;  4UXN B;  5AQM B;  2ZM6 T;  2V6Y B;  4WZX A;  3TLW A;  4HFI A;  5ABE A;  1N32 T;  3MK7 C;  3L8R A;  3JAE A;  2VVS A;  2IAK A;  3WAK A;  4UV8 B;  1OED B;  2H7O A;  3PUQ A;  3MAC A;  2CRB A;  3LJC A;  2CPT A;  1HFA A;  1T72 A;  3HKD E;  3KBU A;  3KV5 A;  4COF A;  3AED A;  3FZM B;  4X1K E;  2HPL A;  2NW8 A;  3AA6 B;  1EZ3 A;  1Z0P A;  3RC3 A;  5L3E B;  4DV2 T;  2EHO A;  1KNR A;  3GN5 A;  4HEA A;  4NUU A;  4ANJ A;  4CXW A;  4GYR A;  1Y64 B;  5H6R B;  1UX4 A;  3UU6 A;  4ADZ A;  4N78 D;  3HKC E;  4XBF B;  5AQP B;  3SOL A;  3PUX F;  3KV6 A;  3AE3 A;  1WCR A;  2E9X B;  2NR4 A;  3UU4 A;  4O2B E;  2W2U A;  2K48 A;  3AAI A;  2J62 A;  3DJB A;  3NRX A;  4MAL A;  3RKG A;  3RYI E;  3KIN B;  3F57 A;  4NUV A;  1E2A A;  4MBQ A;  5AQL B;  3MA9 A;  3O4X E;  3IHR A;  5ABF B;  4EXT A;  1XMO T;  3LK2 B;  1E1H B;  4BAY B;  4JI4 T;  4H9O C;  2N9D A;  2LSG A;  3P7I A;  1MIW A;  4U74 A;  4WBN E; 
#chains in the Genus database with same CATH homology
 5LMN T;  1FJG T;  4DR7 T;  3OTO T;  4K0K T;  1XMQ T;  4B3M T;  5BR8 T;  4X64 T;  1N34 T;  4JI5 T;  4B3T T;  1HNW T;  4JI2 T;  4DR2 T;  4JI7 T;  2UXD T;  4GKK T;  1HNZ T;  2UUA T;  4DV3 T;  4LFA T;  4JI3 T;  1N36 T;  1J5E T;  4DV1 T;  1I94 T;  1IBM T;  4LF7 T;  4DUY T;  4JI8 T;  4X65 T;  4LF6 T;  4YHH T;  4JI0 T;  1HNX T;  3T1H T;  4JYA T;  4DV7 T;  4GKJ T;  2UUB T;  4DUZ T;  4KHP T;  2HHH T;  4JI1 T;  4NXN T;  1IBK T;  4B3R T;  3T1Y T;  4LF5 T;  4LFB T;  4LFC T;  2E5L T;  4YY3 T;  4X66 T;  2UU9 T;  4DV4 T;  2UUC T;  2UXC T;  2ZM6 T;  4LF8 T;  2VQE T;  1N32 T;  4X62 T;  4AQY T;  1XNQ T;  1N33 T;  1XNR T;  2F4V T;  4DR4 T;  2VQF T;  1HR0 T;  4JV5 T;  4DR6 T;  4NXM T;  2UXB T;  4DV2 T;  5IWA T;  4JI6 T;  4LF4 T;  4DV6 T;  5LMU T;  4DR1 T;  4OX9 T;  1IBL T;  4B3S T;  1XMO T;  4JI4 T;  4DR3 T;  4DV0 T;  4DV5 T;  4DR5 T;  4LF9 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...