4KHPT

Structure of the thermus thermophilus 30s ribosomal subunit in complex with de-6-msa-pactamycin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S Ribosomal RNA
publication title Crystal Structure of a Bioactive Pactamycin Analog Bound to the 30S Ribosomal Subunit.
pubmed doi rcsb
total genus 33
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4khpT00
2UUCT 4JI2T 1N36T 2HHHT 4LF7T 4DUYT 4LF6T 2UXCT 1HNWT 4DV5T 4JI3T 4JI8T 4X66T 4LF5T 4X64T 4NXMT 4GKKT 2VQFT 4DUZT 4YY3T 4DR2T 4DV3T 4LFCT 5LMUT 4NXNT 1FJGT 4LF8T 4GKJT 5BR8T 4DV0T 2UUBT 4DV6T 4JI0T 4DV4T 1N34T 4DV2T 4JYAT 4JI7T 4B3MT 1N32T 3OTOT 4B3ST 1XNQT 4JV5T 2UXBT 2ZM6T 1XNRT 4JI6T 2VQET 4LFBT 3T1HT 4LF9T 4DV1T 4AQYT 4DR3T 1XMQT 2UU9T 4OX9T 4B3TT 4LFAT 1I94T 2E5LT 3T1YT 4DR4T 4X62T 4K0KT 1XMOT 4DR1T 4KHPT 1HR0T 1J5ET 4DV7T 1IBLT 4YHHT 4JI1T 4X65T 1N33T 1HNZT 4JI5T 5IWAT 4JI4T 1IBMT 4LF4T 4DR5T 2F4VT 4B3RT 2UXDT 4DR7T 2UUAT 4DR6T 5LMNT 1IBKT 1HNXT
chains in the Genus database with same CATH superfamily
4LMKA 3ONLC 2ES0A 5IHYA 5F8PA 1KNRA 3DTOA 1WYBA 4DV5T 1OWAA 3PE0A 5FVLA 4H63V 3KBUA 2LSIA 3K3OA 4NPPA 4KUMB 4TUYE 2FJBA 2Q9QC 3UU4A 5JDFA 3AA1B 4DV0T 4WZXA 3EDUA 3KINB 5EK3A 2BG9C 5KMGP 4C91A 4EOZB 1VRBA 2IIUA 4P1NA 1MNDA 2R6GF 2D2SA 3ZC1A 4NUVA 1N32T 4O4JE 2VASA 2BBJA 4LMLA 5C2TA 3VKHA 2Z6EA 5ABGA 1D0ZA 3ZCIA 5JR9B 4AI6A 1L0VA 2XAJB 4UELA 3AVRA 1G73A 3VR8A 2XQ9A 3I0QA 2X0YA 3PDYA 1ZHCA 3ZJ2A 4TX5A 4IL9A 3ANWA 3RX6A 1E1HB 4ILAA 3ZMSB 2Y8DA 4EGWA 1B7TA 3QK6A 4ZEYA 3WI3A 2EHOB 4B3RT 3LFMA 2ACZA 4UXNB 2ZMAA 2UUAT 2M67A 2XY8B 3UU5A 4HFEA 2XAQB 3PUZF 5A1LA 1WFDA 3ZN1B 5JTGA 2UUCT 5HXHA 3RIAA 4E7SA 3Q5DA 2BVMA 2HHHT 1D0YA 2KWIB 2JMHA 5HEHA 2MOZA 2MYSA 4JI8T 1U5PA 1WR0A 2PBIA 3ZN0B 5AQNB 5J2TE 3N9MA 3TLWA 2CWYA 3N9OA 1KK7A 3NZQA 2BS3A 5BR8T 4LMJA 2CXLA 5DQWA 2ZLYA 5E0OA 1M7KA 3I0OA 3RIUA 4BJMA 2HN1A 3AAEB 4A97A 3SFDA 1MIWA 3VRBA 2K24A 3LBXB 1HF8A 4JV5T 1YKHB 1UUSA 4LFBT 3T1HT 4WNKA 5HEJA 3JAFA 1ZOYA 2LSGA 2M6BA 3F2EA 4OX9T 3AA6B 4X62T 2CE7A 4IDQA 4O4IE 2BS2A 3A5XA 2CM0A 4ILCA 2LEHA 2WS3A 2YK0A 5JDNA 3RQWA 2CBIA 4U31A 4UEMA 1UCUA 2XQ5A 2BZBA 4PJMA 3T8OA 4IT4A 4DO0A 3BQLA 3QC9A 5AQGB 4IDPA 3R6NA 4JEHB 3C4WA 4YJ2E 4UVCB 2MAWA 5JDGA 1OEDE 2X66A 3JAEA 4GOUA 4ISSA 2XSAA 2XAFB 5FNVE 5HCJA 5J2UE 3RGLA 2KXPB 5L3DB 3P7IA 5LYJE 4DUYT 1MMNA 4HWDA 4QXCB 1T8BA 2J62A 4IIJE 4P0BA 3ZEFB 2OLTA 3N2OA 3CQGB 1UK5A 4O2BE 3ETVA 1FJGT 3OKQA 1Y01A 1OXZA 3HL6A 3CWZB 2UUBT 2W63A 1UX4A 3HI2A 3MK7C 5F5WA 2W62A 4JLEA 5FL0A 4PNIA 2BKPA 1J5WA 4DIDB 1U4QA 4HWCA 3SFEA 1T98A 3UU8A 2WQYA 3S4UA 1JNZA 2QRXA 3CQXC 3F31A 2D0TA 4X20E 3NRXA 2IAKA 2V7KA 4EIWA 4EV6A 2XQ6A 2QA7A 4UR9A 4AQYT 1XMQT 3MA9A 4LFAT 3N9QA 4YSXA 2WWUA 1I94T 4NUUA 3L3PA 2NOXA 4COFA 1HR0T 4WBOA 2L3LA 4OYJA 5LJMA 3UUXB 3CKDA 4YHHT 4IL4A 2DLRA 5HXCA 1HNZT 4OHFA 2X9WA 2V6YB 5L3GB 3ZYLA 3FBLA 4YXDA 1WLXA 3BQIA 3ZMVB 1N36T 4LF7T 3NRYA 1SHZC 3L09A 2XZEA 2XPKA 5JR9C 2XQYA 4LF5T 3OPCA 2VL0A 3QOFA 5KXJA 1S35A 3ONJA 4P0AA 1KF6A 4H9SE 3A7MA 3U3IA 2Y6XA 4AKGA 4JI0T 4X1YE 4AKRB 5HXEA 1FMWA 2X67A 5AQUB 3VHLA 3FXDB 2I6HA 4IDZA 2CRBA 2XTLA 4GYSA 3RKOA 5L3BB 2JPFA 3ZC0A 3PUWF 2IHR1 3JC6D 3C4XA 5FL1A 2UU9T 4EEBA 2E5LT 1WYCA 4K0KT 3DJBA 1XMOT 3GA8A 3GMIA 2C5KT 4QH5A 4DV7T 4L5GA 2YU1A 2Y48B 2LKHA 3KVAA 5L3EB 4TWFA 4WBNE 3H3AA 4HE8A 2E2AA 3AEDA 4ZI7E 2BS4A 5LMNT 4AQFC 3PU8A 2B1EA 2YEVC 1IBKT 2N1GA 4U2ZA 4DMWA 3UTKA 2XM1A 2JMKA 2IC6A 4YSYA 2VKDA 3PTRB 4X64T 1FMVA 2V8SV 3RYIE 1HCIA 1BR2A 2CWOA 3TLSA 3P50A 5L4HA 4I0UA 4DV4T 1N34T 4EB6E 1WR6A 4DV2T 1BR4A 3AEEA 2ZM6T 4MBQA 2NWBA 3I9WA 2XJ7A 5JDHA 4YJ3E 3FZLB 3UQ4A 3AA7B 4CN4A 5LJNA 3SRZA 1YW0A 3P4SA 1OEDA 2LT3A 3RF1A 3QNUA 4H9OC 1UGOA 5FY1A 2ZM2A 3UUBA 1DU2A 2MTQA 5LG3A 3ZMZB 4ZI2D 4KX6A 2NW9A 1SUMB 2X68A 3N9NA 3PURA 3N2KE 1T72A 2OA5A 3PU3A 3O1IA 2CMRA 5LGTB 3L39A 5FXXA 1HNXT 2DI4A 3CQCB 2YDRA 3PUYF 3AE5A 2V1DB 3A8YC 1CHUA 3N9PA 4PJNA 3UUNA 2LLYA 4HFVA 1YKEB 4LFCT 3G06A 4UF0B 2WMOA 4IE6A 2NTYA 3KV5A 4ILBA 2W2UA 5LNKA 3GN5A 5AQIB 5JREA 3J7Yq 1W9RA 2EHOA 2LSJA 2V7LA 3HKDE 4HFIA 4I4TE 5FXZA 2PJQA 4GIWA 2ACXA 5ABHA 3JCFA 3UULA 4P09A 4DVDA 5ABFB 3ZSTA 5AQVB 4U72A 3M65A 3AA0B 2JQQA 3JC6C 2W4XA 1V9DA 3PV0F 3P4QA 4F8HA 2WM9A 3K8PC 1IJ6A 1KNPA 4JI1T 4KI0F 4EYYR 4A56A 1HX8A 3CPZA 2LRKA 5JH7E 5KDMC 1XDPA 4H9RC 2WU5A 2ODUA 3B5MA 4ZOLE 4ZHQE 3EUHA 1O3XA 3HKBE 4JI2T 1EZ3A 5L3FB 1US7B 2C5IT 3AXJA 4WW0A 4IGUA 2WWVA 1LRZA 2E9XB 2HPLA 4BAYB 4DMVA 2CXFA 5FP3A 4HFDA 5LBQB 5IYZE 3WAJA 2OV9A 3F57A 5DABA 3RC3A 5IUXA 2YOEA 2W66A 5HWYA 1ZKEA 2K5BB 3LK3B 4AXPA 3RH3A 1KNZA 2LRLA 1XNRT 5LA6E 4FI5A 2E9XD 4A98A 5LHGB 4MFRA 4I43B 4DR4T 2YU2A 4PJLA 4G2AA 5EK2A 3SOLA 1J5ET 1M62A 4H9NC 1D0XA 4ZZCA 3AEGA 4X65T 5HEOA 4ASKA 2QYWA 2NTXA 1MMDA 3SWHA 1FEWA 5LBMA 1IAPA 4EXTA 4ZI2C 5HAXA 1MMAA 5M4YA 4I50E 1HTJF 3B13A 1HG5A 3OBVE 3ANWB 4QXBB 2UXCT 3EI0A 4DV3T 5J1GA 4GYRA 2V5CA 3LDQB 5AQKB 4M1PA 5HCMA 3MJXA 2V6YA 4DV6T 4X5TA 4ZZBA 4YHJA 5BMVE 2Q9QA 1YD8G 2ODVA 2KWHA 3ZT6A 1ZV4X 3QB5K 5LHIB 4TNVA 2LHNA 4B3MT 2BG9A 2A9UA 2JRKA 4HFCA 4OK0A 3LJCA 3E22E 2BKNA 2FJAA 5LOVE 4DV1T 5FMNA 1QSDA 4UVAB 3T1YT 4IDNA 2MBGA 2XAHB 4CXWA 4PJJA 5HXSA 4IHJE 4IE4A 2LSKA 2WDQA 2W00A 2CXDA 4HFHA 3HA4A 2VURA 3TLVA 3ZJ1A 2HPJA 2F4VT 4HWIB 4TNWA 2YINA 2H7OA 5L3CB 3CIRA 1QLBA 3FB2A 4AKLA 2L8KA 4B6XA 2NP9A 2LSYA 4TZ4C 3UFGA 4J2CA 4YTNA 4AIUA 3E08A 3Q5EA 1MNEA 4C90A 3TKLB 2LHRA 3AAAB 2VKOA 4I55E 3IF8B 4DBRA 4EEDA 2LE8A 5JRCA 4CN6A 4PK6A 4EZHA 3FBZA 5CA1E 4TWDA 2PFVA 3C4ZA 4Z8XA 1VOMA 3FZFB 5FY0A 4QH4A 2SPCA 2FJEA 3RIFA 3R84B 2E9XC 2DWKA 5FY7A 5H6QB 1WCRA 4YT0A 4XZCA 1IBLT 3O1JA 2CLYB 2NR4A 3RYFE 2WAUA 4XAXB 3IBPA 1LVKA 3RHWA 4EYUA 5FKYA 4TV8E 4DR7T 3Q9DA 4DR6T 3RQUA 4CXYA 4HTEA 2D5UA 3EHZA 1NENA 2H7VC 2J4GA 5ADXL 3ABVA 3K3QC 4AISA 4UV9B 3AECA 5LG4A 2XQ3A 3AEFA 4O4HE 5AQTB 2QGSA 2KINB 4Q25A 5HXRA 5FVKA 2WSSV 4GKJT 2KMFA 4O2AE 4QX8B 4U2YA 2WBLA 4U7YA 5FXVA 1HS7A 2A72A 4MALA 1D1CA 3Q5WA 1NAFA 2NW8A 4PAGA 1Z8UA 3O9XA 3CX8B 3OTOT 2UXBT 2V7JA 2KSRA 3ZYKA 2JQ9A 3ZPOA 3BQKA 5EK4A 4DR3T 4ADZA 3CK6A 5LHHB 1YQ3A 1R8IA 2X51A 3OYZA 2M6IA 2VKJA 1LVFA 3ESLA 1NWMX 2CEAA 2HH7A 3GWHA 4CXXA 4JI4T 1JNRA 2H88A 3RKGA 2XQ7A 5ETWA 5CFBA 2PTFA 3CMLA 2J1DG 4HFBA 3ZT5A 3PUAA 4NXMT 4AKIA 5JDQA 3KV6A 3RIUC 4K0UA 1S94A 4L0RA 4ANJA 5LMUT 2CPTA 3RLFF 2BKOA 3PUQA 2E5VA 5JR9A 3PUXF 3ZKRA 4ZXLA 4IE0A 5CB4E 4ZS2A 2PG8A 2HN2A 3AE4A 4O4LE 5DJQC 3ONXA 2IW5B 4MLKA 4U33A 4Z91A 2KT9A 4XBFB 4N78D 1XZYA 3KFWX 4ZS3A 1HFAA 3E0ZA 5CGMA 2WY2A 3SS1A 3NVOA 3AE8A 3V5UA 2YN6A 3AE1A 4DR1T 1KFYA 1BR1A 3HR0A 5H6RB 3J9X1 3D0TA 2P9BA 3RRCA 5DQVA 2WB5A 3EAMA 5ABEA 5FYMA 3RC8A 4YTPA 3MXZA 4TV9E 3RYCE 4JI5T 2LJLA 3AEAA 4LF4T 4BA9A 5L4EA 5AQRB 2CA5A 2JIWA 3JADA 1Z0PA 3PJAA 2XHEB 4PW8A 1OEDB 1W0AA 4FJOA 1CUNA 3VR9A 3VRAA 3RRWA 4U7IA 3OVUA 3OYXA 3AE6A 3ZT7A 4AQFA 1VCSA 2MPKA 3ZYMA 5AQMB 3L8RA 2JQHA 3LBXA 4DUZT 4TWHA 3TLTA 4PFOA 4HEAA 2K9AA 2XQ4A 2N2NA 2H3RA 2K48A 3KV9A 2CLYC 5LB7B 1VCTA 4PK4A 3UQ7A 4JBWF 1SA0E 3LSVA 2I0MA 4YTMA 3UFEA 5FXWA 4X1IE 2CCQA 4MHCA 3AEBA 3HKEE 4JI7T 2KLQA 3WAKA 4U3CA 5HYAA 2X9YA 4QX7B 4UVBB 3N5LA 2DHRA 3NWIA 4KP3C 3GN5B 2WP9A 1UURA 4CN1A 2IDOB 2AE9A 1X9BA 2BBHA 5HEGA 1ZEEA 1MMGA 4GK5E 1HX1B 2JJ9A 3C51A 3H37A 2X9XA 3O1HA 3C50A 2W67A 4OYKA 4H9QC 2VVSA 5IWAT 3BK9A 3LK42 5L47A 1GQEA 2IMLA 2WDRA 2XUEA 5LXTE 3C64A 2ZM0A 2BVLA 4OFZA 3RPUA 5LGUB 2EHOD 3AB3B 2X9HA 4JI3T 4CI3B 5JDMA 3N2GE 2V7MA 4GKKT 3H3MA 5LP6E 4PK5A 4ZI3D 4DBQA 2G0UA 2H89A 1QUUA 1MIYA 4DNDA 2XAGB 5AQLB 2A2FX 2X0LB 3FXEB 2DWGA 3AXJB 1E2AA 3LK2B 3P4RA 3OJAA 4JYAT 4EAHA 4KBMB 4X1KE 2WZHA 2B76A 3P4PA 4QWNB 3KBTA 3KDSE 5AQHB 5GONE 2AXDS 3UT5E 4EZ4A 3ZCJA 2LOSA 1XWMA 2WU2A 1H7CA 2CHNA 1YQ4A 2YDQA 2LOPA 3FZHB 2K3WA 2V26A 4QH1A 4YFSA 3PUGA 5J0ZA 2N9DA 2FJDA 4BJNA 3IHRA 5LGNB 2YDSA 4HN9A 3EDVA 2UXNB 5KX5E 2J47A 3ZLIA 2E8IA 2LM9A 2WZIA 2UXXB 1HNWT 1X79A 4YY3T 4NXNT 3P8CD 4A5XA 4Z90A 3FZKB 4QXHB 5L2LA 2WMNA 4U74A 3MZKB 2CBJA 1D1AA 4G63A 3C98B 5JQGE 3DP7A 1NEKA 3Q2MA 1T7SA 1D1BA 5AQQB 1W09A 2VB6A 4JI6T 3AE2A 3FHNA 4LF9T 1OEDC 2I59A 2LM2A 3KV4A 5C3JA 3MKDA 3AE7A 4CI1B 3K1SA 2RA1A 1SE7A 2Q9QB 3LG7A 4KMCA 1BR0A 5AQOB 2XQAA 3AVSA 2IC9A 2BG9B 4HWHA 1KEYA 3PUVF 3RYHE 1AJ3A 3UUMA 3Q5XA 4DR5T 4IE7A 3U78A 3I1AA 2UXDT 3PJAJ 3W15B 3UU3A 2FUPA 5HEUA 2D9DA 3AE3A 5JDLA 2Q9QD 4CI2B 1W0BA 3V5SA 4X66T 4UV8B 3ETUA 3QUJA 1XDOA 2XASB 2ZM8A 2DCFA 2VQFT 2EHOC 4DR2T 3FZMB 4HWFA 2RPAA 1YXRA 3O4XE 2VL8A 5TAOA 4YSZA 2XM2A 4UIGA 2DNXA 4NIQA 2A3DA 3B57A 1J1JA 2W61A 4ERRA 4ZI3C 3TLUA 3ZMTB 5AQFB 2VWAA 3CVRA 4O8SA 2JQKA 2NW7A 3EABA 3PUSA 1E7PA 3KVBA 1WRDA 2L9QA 3ZMUB 4CZZB 3NKZA 2VQET 4IDOA 4H9PC 4JUYA 4ISTA 5JVDE 4B3TT 5C8YE 3QB5A 4TN7B 5JRCB 4E7ZA 1MIVA 4KHPT 2RP4A 2LKGA 3UU6A 5F3JA 3CX6B 4IE5A 2XSBA 3IA3A 5AQJB 4YLHA 1IBMT 4UF0A 4ILUA 4AKHA 2WDVA 3I9YA 4F6RC 1ZP0A 4AQGA 1Y64B 3VU7H 2QVAA 4V1Av 2C0SA 1UX5A 3MACA 1IJ5A 4LF6T 2C5JA 4KHZF 3N9LA 1I6ZA 2W0GA 2V6XA 1LKXA 4LF8T 5ABFA 3AAIA 3AE9A 4WYVA 2VVNA 3VKGA 2KNDA 3HKCE 3RI5A 2IUBA 2V7IA 3K3NA 4HKAA 2BG9E 5AQSB 1G8XA 4IREA 4JEUB 3P4WA 4QKNA 4B3ST 1XNQT 4L9IA 5CA0E 4CQIA 3EVYA 2WCAA 5AQPB 5EZYE 3NBXX 3X1DA 3ZSSA 2VKHA 4H63H 4QHOA 1FIOA 2XQ8A 2KZ7B 3CX7B 5AFUL 5HWXA 4PFPA 1IZNB 1N33T 3M3ZB 3NZPA 2V5DA 2DL1A 2E9XA 2D0UA 2CHOA 4HGAA 2YKSA 2X0HA 5LCYA 2BDEA 2GK9A 2FBWA 3IEEA 4GK0E 1HG2A 2VK9A 5CJ5A
chains in the Genus database with same CATH topology
2UUCT 4JI2T 1N36T 2HHHT 4LF7T 4DUYT 4LF6T 2UXCT 1HNWT 4DV5T 4JI3T 4JI8T 4X66T 4LF5T 4X64T 4NXMT 4GKKT 2VQFT 4DUZT 4YY3T 4DR2T 4DV3T 4LFCT 5LMUT 4NXNT 1FJGT 4LF8T 4GKJT 5BR8T 4DV0T 2UUBT 4DV6T 4JI0T 4DV4T 1N34T 4DV2T 4JYAT 4JI7T 4B3MT 1N32T 3OTOT 4B3ST 1XNQT 4JV5T 2UXBT 2ZM6T 1XNRT 4JI6T 2VQET 4LFBT 3T1HT 4LF9T 4DV1T 4AQYT 4DR3T 1XMQT 2UU9T 4OX9T 4B3TT 4LFAT 1I94T 2E5LT 3T1YT 4DR4T 4X62T 4K0KT 1XMOT 4DR1T 4KHPT 1HR0T 1J5ET 4DV7T 1IBLT 4YHHT 4JI1T 4X65T 1N33T 1HNZT 4JI5T 5IWAT 4JI4T 1IBMT 4LF4T 4DR5T 2F4VT 4B3RT 2UXDT 4DR7T 2UUAT 4DR6T 5LMNT 1IBKT 1HNXT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUC T;  4JI2 T;  1N36 T;  2HHH T;  4LF7 T;  4DUY T;  4LF6 T;  2UXC T;  1HNW T;  4DV5 T;  4JI3 T;  4JI8 T;  4X66 T;  4LF5 T;  4X64 T;  4NXM T;  4GKK T;  2VQF T;  4DUZ T;  4YY3 T;  4DR2 T;  4DV3 T;  4LFC T;  5LMU T;  4NXN T;  1FJG T;  4LF8 T;  4GKJ T;  5BR8 T;  4DV0 T;  2UUB T;  4DV6 T;  4JI0 T;  4DV4 T;  1N34 T;  4DV2 T;  4JYA T;  4JI7 T;  4B3M T;  1N32 T;  3OTO T;  4B3S T;  1XNQ T;  4JV5 T;  2UXB T;  2ZM6 T;  1XNR T;  4JI6 T;  2VQE T;  4LFB T;  3T1H T;  4LF9 T;  4DV1 T;  4AQY T;  4DR3 T;  1XMQ T;  2UU9 T;  4OX9 T;  4B3T T;  4LFA T;  1I94 T;  2E5L T;  3T1Y T;  4DR4 T;  4X62 T;  4K0K T;  1XMO T;  4DR1 T;  4KHP T;  1HR0 T;  1J5E T;  4DV7 T;  1IBL T;  4YHH T;  4JI1 T;  4X65 T;  1N33 T;  1HNZ T;  4JI5 T;  5IWA T;  4JI4 T;  1IBM T;  4LF4 T;  4DR5 T;  2F4V T;  4B3R T;  2UXD T;  4DR7 T;  2UUA T;  4DR6 T;  5LMN T;  1IBK T;  1HNX T; 
#chains in the Genus database with same CATH topology
 4LMK A;  3ONL C;  2ES0 A;  5IHY A;  5F8P A;  1KNR A;  3DTO A;  1WYB A;  4DV5 T;  1OWA A;  3PE0 A;  5FVL A;  4H63 V;  3KBU A;  2LSI A;  3K3O A;  4NPP A;  4KUM B;  4TUY E;  2FJB A;  2Q9Q C;  3UU4 A;  5JDF A;  3AA1 B;  4DV0 T;  4WZX A;  3EDU A;  3KIN B;  5EK3 A;  2BG9 C;  5KMG P;  4C91 A;  4EOZ B;  1VRB A;  2IIU A;  4P1N A;  1MND A;  2R6G F;  2D2S A;  3ZC1 A;  4NUV A;  1N32 T;  4O4J E;  2VAS A;  2BBJ A;  4LML A;  5C2T A;  3VKH A;  2Z6E A;  5ABG A;  1D0Z A;  3ZCI A;  5JR9 B;  4AI6 A;  1L0V A;  2XAJ B;  4UEL A;  3AVR A;  1G73 A;  3VR8 A;  2XQ9 A;  3I0Q A;  2X0Y A;  3PDY A;  1ZHC A;  3ZJ2 A;  4TX5 A;  4IL9 A;  3ANW A;  3RX6 A;  1E1H B;  4ILA A;  3ZMS B;  2Y8D A;  4EGW A;  1B7T A;  3QK6 A;  4ZEY A;  3WI3 A;  2EHO B;  4B3R T;  3LFM A;  2ACZ A;  4UXN B;  2ZMA A;  2UUA T;  2M67 A;  2XY8 B;  3UU5 A;  4HFE A;  2XAQ B;  3PUZ F;  5A1L A;  1WFD A;  3ZN1 B;  5JTG A;  2UUC T;  5HXH A;  3RIA A;  4E7S A;  3Q5D A;  2BVM A;  2HHH T;  1D0Y A;  2KWI B;  2JMH A;  5HEH A;  2MOZ A;  2MYS A;  4JI8 T;  1U5P A;  1WR0 A;  2PBI A;  3ZN0 B;  5AQN B;  5J2T E;  3N9M A;  3TLW A;  2CWY A;  3N9O A;  1KK7 A;  3NZQ A;  2BS3 A;  5BR8 T;  4LMJ A;  2CXL A;  5DQW A;  2ZLY A;  5E0O A;  1M7K A;  3I0O A;  3RIU A;  4BJM A;  2HN1 A;  3AAE B;  4A97 A;  3SFD A;  1MIW A;  3VRB A;  2K24 A;  3LBX B;  1HF8 A;  4JV5 T;  1YKH B;  1UUS A;  4LFB T;  3T1H T;  4WNK A;  5HEJ A;  3JAF A;  1ZOY A;  2LSG A;  2M6B A;  3F2E A;  4OX9 T;  3AA6 B;  4X62 T;  2CE7 A;  4IDQ A;  4O4I E;  2BS2 A;  3A5X A;  2CM0 A;  4ILC A;  2LEH A;  2WS3 A;  2YK0 A;  5JDN A;  3RQW A;  2CBI A;  4U31 A;  4UEM A;  1UCU A;  2XQ5 A;  2BZB A;  4PJM A;  3T8O A;  4IT4 A;  4DO0 A;  3BQL A;  3QC9 A;  5AQG B;  4IDP A;  3R6N A;  4JEH B;  3C4W A;  4YJ2 E;  4UVC B;  2MAW A;  5JDG A;  1OED E;  2X66 A;  3JAE A;  4GOU A;  4ISS A;  2XSA A;  2XAF B;  5FNV E;  5HCJ A;  5J2U E;  3RGL A;  2KXP B;  5L3D B;  3P7I A;  5LYJ E;  4DUY T;  1MMN A;  4HWD A;  4QXC B;  1T8B A;  2J62 A;  4IIJ E;  4P0B A;  3ZEF B;  2OLT A;  3N2O A;  3CQG B;  1UK5 A;  4O2B E;  3ETV A;  1FJG T;  3OKQ A;  1Y01 A;  1OXZ A;  3HL6 A;  3CWZ B;  2UUB T;  2W63 A;  1UX4 A;  3HI2 A;  3MK7 C;  5F5W A;  2W62 A;  4JLE A;  5FL0 A;  4PNI A;  2BKP A;  1J5W A;  4DID B;  1U4Q A;  4HWC A;  3SFE A;  1T98 A;  3UU8 A;  2WQY A;  3S4U A;  1JNZ A;  2QRX A;  3CQX C;  3F31 A;  2D0T A;  4X20 E;  3NRX A;  2IAK A;  2V7K A;  4EIW A;  4EV6 A;  2XQ6 A;  2QA7 A;  4UR9 A;  4AQY T;  1XMQ T;  3MA9 A;  4LFA T;  3N9Q A;  4YSX A;  2WWU A;  1I94 T;  4NUU A;  3L3P A;  2NOX A;  4COF A;  1HR0 T;  4WBO A;  2L3L A;  4OYJ A;  5LJM A;  3UUX B;  3CKD A;  4YHH T;  4IL4 A;  2DLR A;  5HXC A;  1HNZ T;  4OHF A;  2X9W A;  2V6Y B;  5L3G B;  3ZYL A;  3FBL A;  4YXD A;  1WLX A;  3BQI A;  3ZMV B;  1N36 T;  4LF7 T;  3NRY A;  1SHZ C;  3L09 A;  2XZE A;  2XPK A;  5JR9 C;  2XQY A;  4LF5 T;  3OPC A;  2VL0 A;  3QOF A;  5KXJ A;  1S35 A;  3ONJ A;  4P0A A;  1KF6 A;  4H9S E;  3A7M A;  3U3I A;  2Y6X A;  4AKG A;  4JI0 T;  4X1Y E;  4AKR B;  5HXE A;  1FMW A;  2X67 A;  5AQU B;  3VHL A;  3FXD B;  2I6H A;  4IDZ A;  2CRB A;  2XTL A;  4GYS A;  3RKO A;  5L3B B;  2JPF A;  3ZC0 A;  3PUW F;  2IHR 1;  3JC6 D;  3C4X A;  5FL1 A;  2UU9 T;  4EEB A;  2E5L T;  1WYC A;  4K0K T;  3DJB A;  1XMO T;  3GA8 A;  3GMI A;  2C5K T;  4QH5 A;  4DV7 T;  4L5G A;  2YU1 A;  2Y48 B;  2LKH A;  3KVA A;  5L3E B;  4TWF A;  4WBN E;  3H3A A;  4HE8 A;  2E2A A;  3AED A;  4ZI7 E;  2BS4 A;  5LMN T;  4AQF C;  3PU8 A;  2B1E A;  2YEV C;  1IBK T;  2N1G A;  4U2Z A;  4DMW A;  3UTK A;  2XM1 A;  2JMK A;  2IC6 A;  4YSY A;  2VKD A;  3PTR B;  4X64 T;  1FMV A;  2V8S V;  3RYI E;  1HCI A;  1BR2 A;  2CWO A;  3TLS A;  3P50 A;  5L4H A;  4I0U A;  4DV4 T;  1N34 T;  4EB6 E;  1WR6 A;  4DV2 T;  1BR4 A;  3AEE A;  2ZM6 T;  4MBQ A;  2NWB A;  3I9W A;  2XJ7 A;  5JDH A;  4YJ3 E;  3FZL B;  3UQ4 A;  3AA7 B;  4CN4 A;  5LJN A;  3SRZ A;  1YW0 A;  3P4S A;  1OED A;  2LT3 A;  3RF1 A;  3QNU A;  4H9O C;  1UGO A;  5FY1 A;  2ZM2 A;  3UUB A;  1DU2 A;  2MTQ A;  5LG3 A;  3ZMZ B;  4ZI2 D;  4KX6 A;  2NW9 A;  1SUM B;  2X68 A;  3N9N A;  3PUR A;  3N2K E;  1T72 A;  2OA5 A;  3PU3 A;  3O1I A;  2CMR A;  5LGT B;  3L39 A;  5FXX A;  1HNX T;  2DI4 A;  3CQC B;  2YDR A;  3PUY F;  3AE5 A;  2V1D B;  3A8Y C;  1CHU A;  3N9P A;  4PJN A;  3UUN A;  2LLY A;  4HFV A;  1YKE B;  4LFC T;  3G06 A;  4UF0 B;  2WMO A;  4IE6 A;  2NTY A;  3KV5 A;  4ILB A;  2W2U A;  5LNK A;  3GN5 A;  5AQI B;  5JRE A;  3J7Y q;  1W9R A;  2EHO A;  2LSJ A;  2V7L A;  3HKD E;  4HFI A;  4I4T E;  5FXZ A;  2PJQ A;  4GIW A;  2ACX A;  5ABH A;  3JCF A;  3UUL A;  4P09 A;  4DVD A;  5ABF B;  3ZST A;  5AQV B;  4U72 A;  3M65 A;  3AA0 B;  2JQQ A;  3JC6 C;  2W4X A;  1V9D A;  3PV0 F;  3P4Q A;  4F8H A;  2WM9 A;  3K8P C;  1IJ6 A;  1KNP A;  4JI1 T;  4KI0 F;  4EYY R;  4A56 A;  1HX8 A;  3CPZ A;  2LRK A;  5JH7 E;  5KDM C;  1XDP A;  4H9R C;  2WU5 A;  2ODU A;  3B5M A;  4ZOL E;  4ZHQ E;  3EUH A;  1O3X A;  3HKB E;  4JI2 T;  1EZ3 A;  5L3F B;  1US7 B;  2C5I T;  3AXJ A;  4WW0 A;  4IGU A;  2WWV A;  1LRZ A;  2E9X B;  2HPL A;  4BAY B;  4DMV A;  2CXF A;  5FP3 A;  4HFD A;  5LBQ B;  5IYZ E;  3WAJ A;  2OV9 A;  3F57 A;  5DAB A;  3RC3 A;  5IUX A;  2YOE A;  2W66 A;  5HWY A;  1ZKE A;  2K5B B;  3LK3 B;  4AXP A;  3RH3 A;  1KNZ A;  2LRL A;  1XNR T;  5LA6 E;  4FI5 A;  2E9X D;  4A98 A;  5LHG B;  4MFR A;  4I43 B;  4DR4 T;  2YU2 A;  4PJL A;  4G2A A;  5EK2 A;  3SOL A;  1J5E T;  1M62 A;  4H9N C;  1D0X A;  4ZZC A;  3AEG A;  4X65 T;  5HEO A;  4ASK A;  2QYW A;  2NTX A;  1MMD A;  3SWH A;  1FEW A;  5LBM A;  1IAP A;  4EXT A;  4ZI2 C;  5HAX A;  1MMA A;  5M4Y A;  4I50 E;  1HTJ F;  3B13 A;  1HG5 A;  3OBV E;  3ANW B;  4QXB B;  2UXC T;  3EI0 A;  4DV3 T;  5J1G A;  4GYR A;  2V5C A;  3LDQ B;  5AQK B;  4M1P A;  5HCM A;  3MJX A;  2V6Y A;  4DV6 T;  4X5T A;  4ZZB A;  4YHJ A;  5BMV E;  2Q9Q A;  1YD8 G;  2ODV A;  2KWH A;  3ZT6 A;  1ZV4 X;  3QB5 K;  5LHI B;  4TNV A;  2LHN A;  4B3M T;  2BG9 A;  2A9U A;  2JRK A;  4HFC A;  4OK0 A;  3LJC A;  3E22 E;  2BKN A;  2FJA A;  5LOV E;  4DV1 T;  5FMN A;  1QSD A;  4UVA B;  3T1Y T;  4IDN A;  2MBG A;  2XAH B;  4CXW A;  4PJJ A;  5HXS A;  4IHJ E;  4IE4 A;  2LSK A;  2WDQ A;  2W00 A;  2CXD A;  4HFH A;  3HA4 A;  2VUR A;  3TLV A;  3ZJ1 A;  2HPJ A;  2F4V T;  4HWI B;  4TNW A;  2YIN A;  2H7O A;  5L3C B;  3CIR A;  1QLB A;  3FB2 A;  4AKL A;  2L8K A;  4B6X A;  2NP9 A;  2LSY A;  4TZ4 C;  3UFG A;  4J2C A;  4YTN A;  4AIU A;  3E08 A;  3Q5E A;  1MNE A;  4C90 A;  3TKL B;  2LHR A;  3AAA B;  2VKO A;  4I55 E;  3IF8 B;  4DBR A;  4EED A;  2LE8 A;  5JRC A;  4CN6 A;  4PK6 A;  4EZH A;  3FBZ A;  5CA1 E;  4TWD A;  2PFV A;  3C4Z A;  4Z8X A;  1VOM A;  3FZF B;  5FY0 A;  4QH4 A;  2SPC A;  2FJE A;  3RIF A;  3R84 B;  2E9X C;  2DWK A;  5FY7 A;  5H6Q B;  1WCR A;  4YT0 A;  4XZC A;  1IBL T;  3O1J A;  2CLY B;  2NR4 A;  3RYF E;  2WAU A;  4XAX B;  3IBP A;  1LVK A;  3RHW A;  4EYU A;  5FKY A;  4TV8 E;  4DR7 T;  3Q9D A;  4DR6 T;  3RQU A;  4CXY A;  4HTE A;  2D5U A;  3EHZ A;  1NEN A;  2H7V C;  2J4G A;  5ADX L;  3ABV A;  3K3Q C;  4AIS A;  4UV9 B;  3AEC A;  5LG4 A;  2XQ3 A;  3AEF A;  4O4H E;  5AQT B;  2QGS A;  2KIN B;  4Q25 A;  5HXR A;  5FVK A;  2WSS V;  4GKJ T;  2KMF A;  4O2A E;  4QX8 B;  4U2Y A;  2WBL A;  4U7Y A;  5FXV A;  1HS7 A;  2A72 A;  4MAL A;  1D1C A;  3Q5W A;  1NAF A;  2NW8 A;  4PAG A;  1Z8U A;  3O9X A;  3CX8 B;  3OTO T;  2UXB T;  2V7J A;  2KSR A;  3ZYK A;  2JQ9 A;  3ZPO A;  3BQK A;  5EK4 A;  4DR3 T;  4ADZ A;  3CK6 A;  5LHH B;  1YQ3 A;  1R8I A;  2X51 A;  3OYZ A;  2M6I A;  2VKJ A;  1LVF A;  3ESL A;  1NWM X;  2CEA A;  2HH7 A;  3GWH A;  4CXX A;  4JI4 T;  1JNR A;  2H88 A;  3RKG A;  2XQ7 A;  5ETW A;  5CFB A;  2PTF A;  3CML A;  2J1D G;  4HFB A;  3ZT5 A;  3PUA A;  4NXM T;  4AKI A;  5JDQ A;  3KV6 A;  3RIU C;  4K0U A;  1S94 A;  4L0R A;  4ANJ A;  5LMU T;  2CPT A;  3RLF F;  2BKO A;  3PUQ A;  2E5V A;  5JR9 A;  3PUX F;  3ZKR A;  4ZXL A;  4IE0 A;  5CB4 E;  4ZS2 A;  2PG8 A;  2HN2 A;  3AE4 A;  4O4L E;  5DJQ C;  3ONX A;  2IW5 B;  4MLK A;  4U33 A;  4Z91 A;  2KT9 A;  4XBF B;  4N78 D;  1XZY A;  3KFW X;  4ZS3 A;  1HFA A;  3E0Z A;  5CGM A;  2WY2 A;  3SS1 A;  3NVO A;  3AE8 A;  3V5U A;  2YN6 A;  3AE1 A;  4DR1 T;  1KFY A;  1BR1 A;  3HR0 A;  5H6R B;  3J9X 1;  3D0T A;  2P9B A;  3RRC A;  5DQV A;  2WB5 A;  3EAM A;  5ABE A;  5FYM A;  3RC8 A;  4YTP A;  3MXZ A;  4TV9 E;  3RYC E;  4JI5 T;  2LJL A;  3AEA A;  4LF4 T;  4BA9 A;  5L4E A;  5AQR B;  2CA5 A;  2JIW A;  3JAD A;  1Z0P A;  3PJA A;  2XHE B;  4PW8 A;  1OED B;  1W0A A;  4FJO A;  1CUN A;  3VR9 A;  3VRA A;  3RRW A;  4U7I A;  3OVU A;  3OYX A;  3AE6 A;  3ZT7 A;  4AQF A;  1VCS A;  2MPK A;  3ZYM A;  5AQM B;  3L8R A;  2JQH A;  3LBX A;  4DUZ T;  4TWH A;  3TLT A;  4PFO A;  4HEA A;  2K9A A;  2XQ4 A;  2N2N A;  2H3R A;  2K48 A;  3KV9 A;  2CLY C;  5LB7 B;  1VCT A;  4PK4 A;  3UQ7 A;  4JBW F;  1SA0 E;  3LSV A;  2I0M A;  4YTM A;  3UFE A;  5FXW A;  4X1I E;  2CCQ A;  4MHC A;  3AEB A;  3HKE E;  4JI7 T;  2KLQ A;  3WAK A;  4U3C A;  5HYA A;  2X9Y A;  4QX7 B;  4UVB B;  3N5L A;  2DHR A;  3NWI A;  4KP3 C;  3GN5 B;  2WP9 A;  1UUR A;  4CN1 A;  2IDO B;  2AE9 A;  1X9B A;  2BBH A;  5HEG A;  1ZEE A;  1MMG A;  4GK5 E;  1HX1 B;  2JJ9 A;  3C51 A;  3H37 A;  2X9X A;  3O1H A;  3C50 A;  2W67 A;  4OYK A;  4H9Q C;  2VVS A;  5IWA T;  3BK9 A;  3LK4 2;  5L47 A;  1GQE A;  2IML A;  2WDR A;  2XUE A;  5LXT E;  3C64 A;  2ZM0 A;  2BVL A;  4OFZ A;  3RPU A;  5LGU B;  2EHO D;  3AB3 B;  2X9H A;  4JI3 T;  4CI3 B;  5JDM A;  3N2G E;  2V7M A;  4GKK T;  3H3M A;  5LP6 E;  4PK5 A;  4ZI3 D;  4DBQ A;  2G0U A;  2H89 A;  1QUU A;  1MIY A;  4DND A;  2XAG B;  5AQL B;  2A2F X;  2X0L B;  3FXE B;  2DWG A;  3AXJ B;  1E2A A;  3LK2 B;  3P4R A;  3OJA A;  4JYA T;  4EAH A;  4KBM B;  4X1K E;  2WZH A;  2B76 A;  3P4P A;  4QWN B;  3KBT A;  3KDS E;  5AQH B;  5GON E;  2AXD S;  3UT5 E;  4EZ4 A;  3ZCJ A;  2LOS A;  1XWM A;  2WU2 A;  1H7C A;  2CHN A;  1YQ4 A;  2YDQ A;  2LOP A;  3FZH B;  2K3W A;  2V26 A;  4QH1 A;  4YFS A;  3PUG A;  5J0Z A;  2N9D A;  2FJD A;  4BJN A;  3IHR A;  5LGN B;  2YDS A;  4HN9 A;  3EDV A;  2UXN B;  5KX5 E;  2J47 A;  3ZLI A;  2E8I A;  2LM9 A;  2WZI A;  2UXX B;  1HNW T;  1X79 A;  4YY3 T;  4NXN T;  3P8C D;  4A5X A;  4Z90 A;  3FZK B;  4QXH B;  5L2L A;  2WMN A;  4U74 A;  3MZK B;  2CBJ A;  1D1A A;  4G63 A;  3C98 B;  5JQG E;  3DP7 A;  1NEK A;  3Q2M A;  1T7S A;  1D1B A;  5AQQ B;  1W09 A;  2VB6 A;  4JI6 T;  3AE2 A;  3FHN A;  4LF9 T;  1OED C;  2I59 A;  2LM2 A;  3KV4 A;  5C3J A;  3MKD A;  3AE7 A;  4CI1 B;  3K1S A;  2RA1 A;  1SE7 A;  2Q9Q B;  3LG7 A;  4KMC A;  1BR0 A;  5AQO B;  2XQA A;  3AVS A;  2IC9 A;  2BG9 B;  4HWH A;  1KEY A;  3PUV F;  3RYH E;  1AJ3 A;  3UUM A;  3Q5X A;  4DR5 T;  4IE7 A;  3U78 A;  3I1A A;  2UXD T;  3PJA J;  3W15 B;  3UU3 A;  2FUP A;  5HEU A;  2D9D A;  3AE3 A;  5JDL A;  2Q9Q D;  4CI2 B;  1W0B A;  3V5S A;  4X66 T;  4UV8 B;  3ETU A;  3QUJ A;  1XDO A;  2XAS B;  2ZM8 A;  2DCF A;  2VQF T;  2EHO C;  4DR2 T;  3FZM B;  4HWF A;  2RPA A;  1YXR A;  3O4X E;  2VL8 A;  5TAO A;  4YSZ A;  2XM2 A;  4UIG A;  2DNX A;  4NIQ A;  2A3D A;  3B57 A;  1J1J A;  2W61 A;  4ERR A;  4ZI3 C;  3TLU A;  3ZMT B;  5AQF B;  2VWA A;  3CVR A;  4O8S A;  2JQK A;  2NW7 A;  3EAB A;  3PUS A;  1E7P A;  3KVB A;  1WRD A;  2L9Q A;  3ZMU B;  4CZZ B;  3NKZ A;  2VQE T;  4IDO A;  4H9P C;  4JUY A;  4IST A;  5JVD E;  4B3T T;  5C8Y E;  3QB5 A;  4TN7 B;  5JRC B;  4E7Z A;  1MIV A;  4KHP T;  2RP4 A;  2LKG A;  3UU6 A;  5F3J A;  3CX6 B;  4IE5 A;  2XSB A;  3IA3 A;  5AQJ B;  4YLH A;  1IBM T;  4UF0 A;  4ILU A;  4AKH A;  2WDV A;  3I9Y A;  4F6R C;  1ZP0 A;  4AQG A;  1Y64 B;  3VU7 H;  2QVA A;  4V1A v;  2C0S A;  1UX5 A;  3MAC A;  1IJ5 A;  4LF6 T;  2C5J A;  4KHZ F;  3N9L A;  1I6Z A;  2W0G A;  2V6X A;  1LKX A;  4LF8 T;  5ABF A;  3AAI A;  3AE9 A;  4WYV A;  2VVN A;  3VKG A;  2KND A;  3HKC E;  3RI5 A;  2IUB A;  2V7I A;  3K3N A;  4HKA A;  2BG9 E;  5AQS B;  1G8X A;  4IRE A;  4JEU B;  3P4W A;  4QKN A;  4B3S T;  1XNQ T;  4L9I A;  5CA0 E;  4CQI A;  3EVY A;  2WCA A;  5AQP B;  5EZY E;  3NBX X;  3X1D A;  3ZSS A;  2VKH A;  4H63 H;  4QHO A;  1FIO A;  2XQ8 A;  2KZ7 B;  3CX7 B;  5AFU L;  5HWX A;  4PFP A;  1IZN B;  1N33 T;  3M3Z B;  3NZP A;  2V5D A;  2DL1 A;  2E9X A;  2D0U A;  2CHO A;  4HGA A;  2YKS A;  2X0H A;  5LCY A;  2BDE A;  2GK9 A;  2FBW A;  3IEE A;  4GK0 E;  1HG2 A;  2VK9 A;  5CJ5 A; 
#chains in the Genus database with same CATH homology
 2UUC T;  4JI2 T;  1N36 T;  2HHH T;  4LF7 T;  4DUY T;  4LF6 T;  2UXC T;  1HNW T;  4DV5 T;  4JI3 T;  4JI8 T;  4X66 T;  4LF5 T;  4X64 T;  4NXM T;  4GKK T;  2VQF T;  4DUZ T;  4YY3 T;  4DR2 T;  4DV3 T;  4LFC T;  5LMU T;  4NXN T;  1FJG T;  4LF8 T;  4GKJ T;  5BR8 T;  4DV0 T;  2UUB T;  4DV6 T;  4JI0 T;  4DV4 T;  1N34 T;  4DV2 T;  4JYA T;  4JI7 T;  4B3M T;  1N32 T;  3OTO T;  4B3S T;  1XNQ T;  4JV5 T;  2UXB T;  2ZM6 T;  1XNR T;  4JI6 T;  2VQE T;  4LFB T;  3T1H T;  4LF9 T;  4DV1 T;  4AQY T;  4DR3 T;  1XMQ T;  2UU9 T;  4OX9 T;  4B3T T;  4LFA T;  1I94 T;  2E5L T;  3T1Y T;  4DR4 T;  4X62 T;  4K0K T;  1XMO T;  4DR1 T;  4KHP T;  1HR0 T;  1J5E T;  4DV7 T;  1IBL T;  4YHH T;  4JI1 T;  4X65 T;  1N33 T;  1HNZ T;  4JI5 T;  5IWA T;  4JI4 T;  1IBM T;  4LF4 T;  4DR5 T;  2F4V T;  4B3R T;  2UXD T;  4DR7 T;  2UUA T;  4DR6 T;  5LMN T;  1IBK T;  1HNX T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...