4KHPT

Structure of the thermus thermophilus 30s ribosomal subunit in complex with de-6-msa-pactamycin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Bioactive Pactamycin Analog Bound to the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S Ribosomal RNA
total genus 33
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4khpT00
4LF5T 3T1YT 2VQFT 4B3TT 4LFCT 1IBLT 1N33T 1XMQT 4NXNT 4GKKT 1N36T 4LF9T 4GKJT 4DV7T 4DUZT 4DV3T 4KHPT 4B3ST 4JI3T 4YY3T 4DV2T 2UU9T 4NXMT 2E5LT 1FJGT 4LF7T 4DR4T 4DR6T 4DV0T 2UXCT 4LF8T 1XNQT 1J5ET 4LF4T 5BR8T 4JV5T 2VQET 2HHHT 1HNZT 2UUBT 1HNXT 4B3RT 1HNWT 4DV6T 4DR7T 4DUYT 1IBMT 4JYAT 4JI2T 4LFAT 2UUCT 2UUAT 4DR1T 4JI7T 4X66T 2UXDT 4AQYT 1XNRT 4DR5T 1IBKT 5LMNT 4DR2T 1N34T 4YHHT 4B3MT 1HR0T 2ZM6T 4JI0T 4JI4T 4DV4T 3OTOT 4DV1T 5IWAT 4JI6T 4DV5T 2UXBT 4OX9T 4LF6T 4JI5T 4LFBT 1I94T 3T1HT 4K0KT 1N32T 5LMUT 1XMOT 4JI1T 4X65T 4DR3T 4X64T 4JI8T 4X62T 2F4VT
chains in the Genus database with same CATH superfamily
3ESLA 2JIWA 2X68A 4LF5T 2BDEA 3CVRA 3KDSE 1H7CA 4H9NC 2YOEA 1OWAA 4WBOA 4A98A 3T1YT 4YHJA 5LP6E 2WY2A 1MIVA 1VCTA 2M67A 2PFVA 3N9MA 5CA1E 1XMQT 4NXNT 1IJ6A 1UURA 2WBLA 3BQIA 2H7VC 3LFMA 2DLRA 2DHRA 2E8IA 3FZHB 4U31A 4EV6A 2LSKA 5ETWA 3L3PA 1N36T 3R6NA 3AE5A 4LF9T 3EVYA 2WQYA 2BZBA 2W4XA 3KFWX 5ABEA 3FZFB 3FZMB 2A2FX 2Z6EA 1JNRA 3HKDE 2LRKA 3LG7A 3PUAA 3Q5DA 4IE5A 5AQJB 5LXTE 4DV7T 4GKJT 3RIAA 4J2CA 5AQPB 2XQYA 1T7SA 3TLVA 1G73A 2MOZA 4KI0F 4OK0A 2UU9T 3RKOA 3ZMSB 4IE4A 4GOUA 4IE0A 1FIOA 4QH4A 4CI2B 4DMWA 3FHNA 3ONXA 4O4JE 4WYVA 2JJ9A 4BA9A 2LOPA 4LF7T 2FJBA 2DNXA 2CA5A 3RC8A 4HFEA 1LKXA 1UUSA 3BQKA 5AQNB 4DR6T 2D0UA 2UXCT 5LCYA 4LF8T 2N9DA 3N9QA 1WFDA 5J1GA 1J5ET 4KP3C 5BR8T 3GN5A 4AXPA 4BAYB 3AAIA 1HNXT 3EUHA 1WYBA 4B3RT 2A3DA 3ETUA 4IL9A 3PURA 5LJMA 1R8IA 2LKGA 3CMLA 3H37A 4DV6T 4QH5A 1FMVA 4FI5A 5L3DB 2WWUA 4P09A 1UK5A 2A72A 2CHNA 3PJAA 1ZHCA 2HPLA 1S35A 2D0TA 4AQFA 2WU2A 1VRBA 2I59A 3CPZA 2UUAT 2WZHA 2UUCT 3RYIE 2KZ7B 3Q9DA 4IDPA 4O4IE 2WMNA 2YU1A 3AE8A 5L3BB 1XDOA 1Z0PA 3AEGA 1IAPA 2XQ5A 3MJXA 3Q5XA 2FJAA 4PJMA 2Q9QC 3I9WA 3I0OA 5LBQB 3RYCE 4AISA 5JREA 4C90A 1WR0A 3TLUA 4HTEA 3SWHA 5HEJA 4QXCB 3A5XA 4O2BE 1X79A 3N9PA 5LMNT 2DCFA 4DR2T 3ZJ1A 2W0GA 4ILCA 3TLTA 3RQUA 5EK3A 4HWFA 4B3MT 3PUZF 2WB5A 4A5XA 2ZM6T 3MKDA 2X9XA 2YDQA 3EAMA 3P7IA 2WZIA 5IUXA 5CJ5A 2V6XA 3AEDA 3PTRB 4YFSA 4H9RC 5LHGB 3AEAA 2Q9QD 5HEUA 3N9NA 2EHOC 4KX6A 3IA3A 4IL4A 3KVBA 2WAUA 5AQKB 2VKJA 1ZKEA 5HAXA 2WSSV 3UUNA 3RIFA 1L0VA 4EXTA 5JR9C 2X0YA 1HCIA 2X0HA 3VHLA 2QA7A 4TX5A 3AA0B 2JMKA 3Q5WA 4UVBB 2WP9A 3LDQB 5E0OA 4JI6T 2NOXA 3KV9A 3SFEA 1W09A 4HWDA 1OEDB 4XZCA 1I6ZA 3AA6B 3AEBA 3UFGA 5EK4A 2CXFA 1KK7A 4EYUA 4F6RC 4WBNE 5AQSB 3GN5B 5L4HA 1S94A 4KBMB 4X1IE 2CXDA 3HKEE 2V5CA 4U7IA 2XASB 4TNVA 3EDUA 4JEHB 2GK9A 3HR0A 5LMUT 4JBWF 3AE7A 1E2AA 2MYSA 5AQLB 2XAQB 3HL6A 3O9XA 2X9WA 4H63V 3QOFA 4F8HA 5HXSA 1YD8G 1E1HB 2CM0A 2XQ8A 3NWIA 3ZYKA 4EZHA 4QWNB 4X65T 5L47A 4HFBA 5HYAA 2JPFA 2JQ9A 2V7LA 5FL1A 1D1CA 2KWIB 3RRWA 4OHFA 4ZI2C 1WR6A 2DI4A 2XAGB 4JI8T 2IW5B 3F57A 4X62T 1YKHB 2E9XB 2N1GA 2B76A 4X5TA 5JDGA 5FXWA 5FL0A 2KINB 1T98A 4EIWA 5LHHB 1HG5A 2C0SA 2VKDA 4MLKA 4PJNA 4LFCT 2V7MA 5L3CB 4QXHB 1IBLT 2CRBA 3NZPA 3PUYF 4EB6E 4EOZB 3NVOA 2PG8A 4GKKT 4Z90A 3VKGA 1YW0A 1QSDA 4KMCA 4TV8E 4DBRA 4XBFB 2D9DA 3N2OA 3QNUA 4IGUA 2MAWA 3SRZA 2EHOD 4ZI2D 4EEBA 5TAOA 3QC9A 2WDVA 4LMKA 4TWFA 4PJLA 3RQWA 4L0RA 2JMHA 3CX8B 3P8CD 1LVFA 1D0YA 2Y8DA 4HWIB 4KHPT 2WCAA 2ACXA 4TWHA 2VK9A 1MMDA 5H6RB 1LRZA 3AE4A 3FB2A 3JC6C 4JUYA 1MMNA 5LNKA 1MMAA 1X9BA 4YTPA 4NXMT 5LHIB 2V6YB 4PJJA 2J47A 2SPCA 2YEVC 1US7B 1XZYA 2YINA 3ANWA 5FP3A 3ZN0B 2E5LT 2ZM2A 2DL1A 2KNDA 2LOSA 4CZZB 2ES0A 4MFRA 3AEEA 1XNQT 4PK6A 3A8YC 5L3FB 1FMWA 1NENA 2FUPA 2W2UA 3Q5EA 3AE3A 3LBXA 4UEMA 2K9AA 2YKSA 3ZYLA 3UQ7A 5L2LA 2UUBT 2VWAA 5JRCA 3FZLB 1YQ3A 3CK6A 4O8SA 5LB7B 3L8RA 3N5LA 3ZMZB 4YSZA 5LGTB 4U74A 5ABGA 3CQXC 5AFUL 2RA1A 3AXJA 5L3EB 4QXBB 1B7TA 4I43B 1NAFA 1Y01A 2KMFA 4WW0A 4DUYT 1NEKA 5AQRB 1IBMT 2XUEA 5HWYA 3FBZA 4JI2T 2CCQA 2LJLA 4LFAT 4HFHA 1J5WA 4UVCB 2YK0A 1O3XA 4WNKA 1DU2A 3RX6A 1KNPA 4DR1T 4JI7T 4YSXA 4HE8A 1HX8A 3ZMUB 3ZJ2A 3VR8A 1U4QA 4X66T 1M7KA 3RPUA 3ZT6A 1HF8A 3UUXB 1W0BA 5LGUB 4ZOLE 5CB4E 4ZS3A 3PE0A 4QX8B 4BJNA 3DP7A 3IBPA 4EZ4A 3WI3A 2VKHA 2VVNA 2OA5A 3L39A 1JNZA 3C51A 4WZXA 4HFVA 5HEOA 5C8YE 5HXHA 2IC6A 3CQGB 4G63A 2HPJA 3T8OA 3AAAB 1BR0A 1WYCA 3EI0A 2LM2A 2Y6XA 2WU5A 4GK0E 1VOMA 4AKHA 2EHOA 4AKLA 5LYJE 2H7OA 2ODUA 2V5DA 2KT9A 3FBLA 3I1AA 4QHOA 3UTKA 2R6GF 5A1LA 4YTMA 4IDNA 3VRAA 3JC6D 3RI5A 4L5GA 4I4TE 2JRKA 3RIUC 4HKAA 2BS2A 3RHWA 5ADXL 2N2NA 3O1HA 3ZYMA 4X20E 2CE7A 2VB6A 5DABA 2XAHB 3O4XE 2DWGA 4X1YE 3QUJA 5IHYA 2MBGA 3ZMTB 5ABFB 1OEDA 5HCJA 2G0UA 3AE6A 4COFA 4OX9T 2X0LB 1U5PA 2I6HA 2W63A 3DTOA 4JI5T 2LEHA 5FMNA 2YN6A 4CXWA 2NW8A 3MZKB 4UF0B 3RIUA 4LFBT 4YJ3E 5FXVA 4U2YA 2LHRA 3QB5A 2FBWA 2PTFA 1QLBA 2XAJB 4H63H 3HKBE 4TNWA 4TZ4C 2BBJA 5DQWA 5AQQB 2M6IA 3CIRA 5JH7E 4AKIA 5AQGB 1W9RA 3AAEB 3A7MA 3E0ZA 4ILAA 3TLSA 4B6XA 4YY3T 5HWXA 2FJDA 3C50A 2NW7A 5J2UE 4JI1T 5AQTB 4Z91A 4OYKA 2CPTA 4GYRA 2E5VA 4HWCA 2C5JA 3CX6B 3B5MA 3QB5K 4ZI3D 5LJNA 2NTXA 3AEFA 5AQMB 2BKPA 2W62A 2JQQA 4DO0A 4U33A 3QK6A 4JV5T 5JDQA 3C64A 2F4VT 3TKLB 4ISTA 5JDLA 1NWMX 2UXNB 3N9LA 3ZT5A 1G8XA 3JADA 3OYXA 4DMVA 2VKOA 4DBQA 2C5IT 4QH1A 4ERRA 3UU4A 3O1IA 4HN9A 3X1DA 4LMJA 3ZKRA 3RKGA 1QUUA 3ZC0A 1J1JA 2H89A 3KV4A 3SFDA 4MHCA 2PJQA 3K1SA 4QX7B 2XZEA 3E08A 3ABVA 1KEYA 3ZSTA 1ZOYA 3N2KE 3C4XA 3K3OA 3MA9A 4ASKA 5ABHA 3RRCA 3M3ZB 1KFYA 1YKEB 4P1NA 3E22E 4HGAA 5AQOB 3PUXF 5HXRA 4HFCA 5AQIB 3RGLA 4DUZT 1HG2A 3EABA 4YXDA 4CN6A 2IMLA 2AE9A 4ZEYA 4DV3T 4B3ST 3GA8A 4CN4A 3PDYA 4O4LE 1WCRA 2L9QA 5JR9A 3ZCJA 4G2AA 3B57A 3VR9A 4YJ2E 3UU3A 4CXYA 1W0AA 3ANWB 3DJBA 2BBHA 2E9XA 3L09A 1OEDE 5H6QB 5KDMC 3M65A 1GQEA 2LRLA 3LK3B 3NKZA 4QKNA 3UU6A 4EGWA 1LVKA 3LK42 4P0BA 1T8BA 1XDPA 4DV0T 2JQKA 3D0TA 3PUSA 4GYSA 4IE7A 1ZEEA 1HFAA 2QYWA 3O1JA 3RC3A 3ZCIA 4AQFC 2VQET 3PJAJ 5FXXA 4PK4A 2BKNA 1IJ5A 2K5BB 2ODVA 3LJCA 1XWMA 3PU3A 4H9SE 1SA0E 4PAGA 4TV9E 2NW9A 3P4RA 4IDOA 4ZS2A 2EHOB 1OEDC 5AQHB 3SS1A 1EZ3A 1MNEA 3PUGA 4NUUA 4DR7T 5CA0E 1WLXA 2XY8B 3P4SA 3OYZA 4IE6A 3W15B 3MACA 4ZI7E 2BKOA 4U7YA 4ZI3C 1YXRA 3KV5A 2XJ7A 3WAKA 2MTQA 3P4PA 4OFZA 4A97A 3P4QA 4H9OC 5FVLA 3AB3B 3CX7B 3OJAA 1IZNB 4TN7B 3J7Yq 1HTJF 3ZN1B 1KNZA 2PBIA 1AJ3A 2Q9QB 2IIUA 5JDHA 1XNRT 5JRCB 3ZEFB 2V7JA 4X1KE 4DNDA 4DR5T 1IBKT 4HFIA 2P9BA 4UR9A 3UU8A 2XQ4A 2XSAA 1Y64B 3K3QC 4YHHT 3ZMVB 1HR0T 2K48A 4ZZCA 4PFOA 4E7ZA 4ILUA 4DV4T 3KVAA 2B1EA 2VVSA 3CQCB 5JQGE 3OTOT 3C4ZA 3C4WA 1SUMB 2ZM0A 3ONJA 5AQUB 4UV9B 4ZXLA 1SHZC 3LSVA 2NP9A 2XSBA 2IAKA 3ETVA 4Q25A 5HXCA 4EAHA 4UIGA 4P0AA 4HFDA 1HNZT 2BS4A 2QVAA 3VKHA 4BJMA 2XHEB 1MNDA 3ONLC 2KLQA 2X66A 1MIYA 2CMRA 3HI2A 4CI1B 3U3IA 2HH7A 3UUBA 5HXEA 2WM9A 2YU2A 5IWAT 2CEAA 3F2EA 3AVSA 3V5SA 1UCUA 3AA1B 2UXBT 3HKCE 3RYHE 3CWZB 2IHR1 2ZLYA 3IF8B 5BMVE 4U2ZA 2CBIA 4UF0A 2K24A 2W67A 2W66A 4DIDB 3JAEA 2X51A 3PUQA 2ZM8A 3LBXB 2NTYA 4FJOA 4YSYA 2XAFB 3AXJB 3RLFF 3UQ4A 1M62A 3T1HT 1N32T 2QRXA 3NRYA 5F3JA 2UXXB 4CN1A 2E2AA 4ILBA 2CWYA 3FZKB 3KBTA 3GMIA 2HN1A 5HEHA 5LOVE 2A9UA 5J0ZA 2YDRA 1KNRA 2OV9A 3CKDA 1E7PA 3ZT7A 2AXDS 4IT4A 5DQVA 2YDSA 3Q2MA 4U3CA 3U78A 2XM2A 2D5UA 4HWHA 5JR9B 1T72A 2VL8A 5JVDE 2BG9A 3OKQA 4NPPA 4X64T 5AQVB 1ZV4X 2J4GA 5EZYE 4XAXB 3UU5A 5EK2A 5IYZE 1BR2A 3NRXA 3N2GE 5CFBA 2V6YA 4E7SA 2Q9QA 2L3LA 4H9PC 4UELA 3P4WA 5JDFA 2VQFT 2WWVA 3V5UA 4B3TT 4CQIA 2XQ3A 3IEEA 4ZZBA 2WDRA 3HA4A 5C2TA 2X67A 3FXDB 3EHZA 4LF4T 2IC9A 1MIWA 2J62A 2LSJA 4EEDA 5LG4A 2CLYC 2LLYA 1CUNA 4L9IA 5L4EA 1N33T 4PK5A 2QGSA 2BVLA 2X9YA 5KMGP 2V7KA 4UV8B 4AIUA 5AQFB 3BQLA 1KF6A 1HX1B 3N9OA 2XQAA 5GONE 3GWHA 2BG9B 2V7IA 3KBUA 4O2AE 5F5WA 4JI3T 1Z8UA 5FXZA 3I0QA 3P50A 4PFPA 2XQ7A 5FY7A 4DV2T 3LK2B 2XPKA 3AE2A 3ZC1A 3I9YA 2LKHA 1FJGT 5ABFA 3UUMA 5FKYA 3J9X1 4DR4T 2CLYB 2L8KA 4HEAA 2VASA 3AE1A 2E9XC 3ZPOA 4ADZA 2WMOA 3PUWF 3AE9A 3OPCA 1YQ4A 3OVUA 4GIWA 4YTNA 2LSGA 4IIJE 2XM1A 2D2SA 5FVKA 5HEGA 5LBMA 2NR4A 3WAJA 2HHHT 4YT0A 3H3MA 4I55E 3AECA 3B13A 4NIQA 4K0UA 2ZMAA 3TLWA 2KWHA 1SE7A 2LSIA 3K3NA 4H9QC 4PNIA 4EYYR 1HNWT 5FNVE 1BR1A 4IDZA 4A56A 2RPAA 3NZQA 1D1AA 2V8SV 3PU8A 4PW8A 5FY0A 4UXNB 4JYAT 4U72A 2NWBA 2RP4A 3MK7C 5F8PA 5FY1A 2FJEA 3UT5E 2DWKA 2UXDT 2I0MA 4KHZF 4AQYT 4OYJA 2J1DG 2K3WA 5LA6E 1CHUA 2Y48B 2M6BA 5M4YA 1N34T 3C98B 1I94T 2V26A 4GK5E 5C3JA 2OLTA 2WS3A 2CBJA 2IDOB 5HCMA 3JAFA 5J2TE 2LSYA 4JI4T 4JI0T 2LHNA 3AVRA 3BK9A 3MXZA 4LMLA 4MBQA 3UFEA 3PUVF 2KSRA 2MPKA 3S4UA 3H3AA 3IHRA 2W61A 2X9HA 4AQGA 2WDQA 4ANJA 1D0XA 4KUMB 3ZSSA 2IUBA 2V1DB 2H3RA 3OBVE 2LT3A 5KXJA 4UVAB 3SOLA 4I0UA 3NBXX 4YLHA 4N78D 3UULA 4DV1T 4C91A 2JQHA 2E9XD 4IREA 2HN2A 2CHOA 3KV6A 4JEUB 3RF1A 4DV5T 4CI3B 4IDQA 5LGNB 1VCSA 5JDMA 1HS7A 2XQ6A 4ISSA 5FYMA 1D0ZA 2CWOA 4LF6T 3ZLIA 3JCFA 1UX4A 2XTLA 4MALA 4NUVA 4ZHQE 5LG3A 3VRBA 4DVDA 3KINB 4AI6A 1D1BA 3PV0F 1MMGA 2LE8A 2C5KT 2XQ9A 5DJQC 3VU7H 5CGMA 5JDNA 4AKGA 2BG9E 2VURA 3RYFE 2H88A 3FXEB 4K0KT 1UGOA 1XMOT 4AKRB 2ACZA 4IHJE 1OXZA 4JLEA 2W00A 4O4HE 4I50E 3F31A 4V1Av 2VL0A 4TWDA 1WRDA 2BG9C 1ZP0A 5JTGA 4DR3T 5KX5E 3G06A 5L3GB 2BVMA 1V9DA 2KXPB 4M1PA 2LM9A 3R84B 3EDVA 3AA7B 4CXXA 1FEWA 2CXLA 1UX5A 4Z8XA 1BR4A 3K8PC 2BS3A 4TUYE 3RH3A
chains in the Genus database with same CATH topology
4LF5T 3T1YT 2VQFT 4B3TT 4LFCT 1IBLT 1N33T 1XMQT 4NXNT 4GKKT 1N36T 4LF9T 4GKJT 4DV7T 4DUZT 4DV3T 4KHPT 4B3ST 4JI3T 4YY3T 4DV2T 2UU9T 4NXMT 2E5LT 1FJGT 4LF7T 4DR4T 4DR6T 4DV0T 2UXCT 4LF8T 1XNQT 1J5ET 4LF4T 5BR8T 4JV5T 2VQET 2HHHT 1HNZT 2UUBT 1HNXT 4B3RT 1HNWT 4DV6T 4DR7T 4DUYT 1IBMT 4JYAT 4JI2T 4LFAT 2UUCT 2UUAT 4DR1T 4JI7T 4X66T 2UXDT 4AQYT 1XNRT 4DR5T 1IBKT 5LMNT 4DR2T 1N34T 4YHHT 4B3MT 1HR0T 2ZM6T 4JI0T 4JI4T 4DV4T 3OTOT 4DV1T 5IWAT 4JI6T 4DV5T 2UXBT 4OX9T 4LF6T 4JI5T 4LFBT 1I94T 3T1HT 4K0KT 1N32T 5LMUT 1XMOT 4JI1T 4X65T 4DR3T 4X64T 4JI8T 4X62T 2F4VT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF5 T;  3T1Y T;  2VQF T;  4B3T T;  4LFC T;  1IBL T;  1N33 T;  1XMQ T;  4NXN T;  4GKK T;  1N36 T;  4LF9 T;  4GKJ T;  4DV7 T;  4DUZ T;  4DV3 T;  4KHP T;  4B3S T;  4JI3 T;  4YY3 T;  4DV2 T;  2UU9 T;  4NXM T;  2E5L T;  1FJG T;  4LF7 T;  4DR4 T;  4DR6 T;  4DV0 T;  2UXC T;  4LF8 T;  1XNQ T;  1J5E T;  4LF4 T;  5BR8 T;  4JV5 T;  2VQE T;  2HHH T;  1HNZ T;  2UUB T;  1HNX T;  4B3R T;  1HNW T;  4DV6 T;  4DR7 T;  4DUY T;  1IBM T;  4JYA T;  4JI2 T;  4LFA T;  2UUC T;  2UUA T;  4DR1 T;  4JI7 T;  4X66 T;  2UXD T;  4AQY T;  1XNR T;  4DR5 T;  1IBK T;  5LMN T;  4DR2 T;  1N34 T;  4YHH T;  4B3M T;  1HR0 T;  2ZM6 T;  4JI0 T;  4JI4 T;  4DV4 T;  3OTO T;  4DV1 T;  5IWA T;  4JI6 T;  4DV5 T;  2UXB T;  4OX9 T;  4LF6 T;  4JI5 T;  4LFB T;  1I94 T;  3T1H T;  4K0K T;  1N32 T;  5LMU T;  1XMO T;  4JI1 T;  4X65 T;  4DR3 T;  4X64 T;  4JI8 T;  4X62 T;  2F4V T; 
#chains in the Genus database with same CATH topology
 3ESL A;  2JIW A;  2X68 A;  4LF5 T;  2BDE A;  3CVR A;  3KDS E;  1H7C A;  4H9N C;  2YOE A;  1OWA A;  4WBO A;  4A98 A;  3T1Y T;  4YHJ A;  5LP6 E;  2WY2 A;  1MIV A;  1VCT A;  2M67 A;  2PFV A;  3N9M A;  5CA1 E;  1XMQ T;  4NXN T;  1IJ6 A;  1UUR A;  2WBL A;  3BQI A;  2H7V C;  3LFM A;  2DLR A;  2DHR A;  2E8I A;  3FZH B;  4U31 A;  4EV6 A;  2LSK A;  5ETW A;  3L3P A;  1N36 T;  3R6N A;  3AE5 A;  4LF9 T;  3EVY A;  2WQY A;  2BZB A;  2W4X A;  3KFW X;  5ABE A;  3FZF B;  3FZM B;  2A2F X;  2Z6E A;  1JNR A;  3HKD E;  2LRK A;  3LG7 A;  3PUA A;  3Q5D A;  4IE5 A;  5AQJ B;  5LXT E;  4DV7 T;  4GKJ T;  3RIA A;  4J2C A;  5AQP B;  2XQY A;  1T7S A;  3TLV A;  1G73 A;  2MOZ A;  4KI0 F;  4OK0 A;  2UU9 T;  3RKO A;  3ZMS B;  4IE4 A;  4GOU A;  4IE0 A;  1FIO A;  4QH4 A;  4CI2 B;  4DMW A;  3FHN A;  3ONX A;  4O4J E;  4WYV A;  2JJ9 A;  4BA9 A;  2LOP A;  4LF7 T;  2FJB A;  2DNX A;  2CA5 A;  3RC8 A;  4HFE A;  1LKX A;  1UUS A;  3BQK A;  5AQN B;  4DR6 T;  2D0U A;  2UXC T;  5LCY A;  4LF8 T;  2N9D A;  3N9Q A;  1WFD A;  5J1G A;  1J5E T;  4KP3 C;  5BR8 T;  3GN5 A;  4AXP A;  4BAY B;  3AAI A;  1HNX T;  3EUH A;  1WYB A;  4B3R T;  2A3D A;  3ETU A;  4IL9 A;  3PUR A;  5LJM A;  1R8I A;  2LKG A;  3CML A;  3H37 A;  4DV6 T;  4QH5 A;  1FMV A;  4FI5 A;  5L3D B;  2WWU A;  4P09 A;  1UK5 A;  2A72 A;  2CHN A;  3PJA A;  1ZHC A;  2HPL A;  1S35 A;  2D0T A;  4AQF A;  2WU2 A;  1VRB A;  2I59 A;  3CPZ A;  2UUA T;  2WZH A;  2UUC T;  3RYI E;  2KZ7 B;  3Q9D A;  4IDP A;  4O4I E;  2WMN A;  2YU1 A;  3AE8 A;  5L3B B;  1XDO A;  1Z0P A;  3AEG A;  1IAP A;  2XQ5 A;  3MJX A;  3Q5X A;  2FJA A;  4PJM A;  2Q9Q C;  3I9W A;  3I0O A;  5LBQ B;  3RYC E;  4AIS A;  5JRE A;  4C90 A;  1WR0 A;  3TLU A;  4HTE A;  3SWH A;  5HEJ A;  4QXC B;  3A5X A;  4O2B E;  1X79 A;  3N9P A;  5LMN T;  2DCF A;  4DR2 T;  3ZJ1 A;  2W0G A;  4ILC A;  3TLT A;  3RQU A;  5EK3 A;  4HWF A;  4B3M T;  3PUZ F;  2WB5 A;  4A5X A;  2ZM6 T;  3MKD A;  2X9X A;  2YDQ A;  3EAM A;  3P7I A;  2WZI A;  5IUX A;  5CJ5 A;  2V6X A;  3AED A;  3PTR B;  4YFS A;  4H9R C;  5LHG B;  3AEA A;  2Q9Q D;  5HEU A;  3N9N A;  2EHO C;  4KX6 A;  3IA3 A;  4IL4 A;  3KVB A;  2WAU A;  5AQK B;  2VKJ A;  1ZKE A;  5HAX A;  2WSS V;  3UUN A;  3RIF A;  1L0V A;  4EXT A;  5JR9 C;  2X0Y A;  1HCI A;  2X0H A;  3VHL A;  2QA7 A;  4TX5 A;  3AA0 B;  2JMK A;  3Q5W A;  4UVB B;  2WP9 A;  3LDQ B;  5E0O A;  4JI6 T;  2NOX A;  3KV9 A;  3SFE A;  1W09 A;  4HWD A;  1OED B;  4XZC A;  1I6Z A;  3AA6 B;  3AEB A;  3UFG A;  5EK4 A;  2CXF A;  1KK7 A;  4EYU A;  4F6R C;  4WBN E;  5AQS B;  3GN5 B;  5L4H A;  1S94 A;  4KBM B;  4X1I E;  2CXD A;  3HKE E;  2V5C A;  4U7I A;  2XAS B;  4TNV A;  3EDU A;  4JEH B;  2GK9 A;  3HR0 A;  5LMU T;  4JBW F;  3AE7 A;  1E2A A;  2MYS A;  5AQL B;  2XAQ B;  3HL6 A;  3O9X A;  2X9W A;  4H63 V;  3QOF A;  4F8H A;  5HXS A;  1YD8 G;  1E1H B;  2CM0 A;  2XQ8 A;  3NWI A;  3ZYK A;  4EZH A;  4QWN B;  4X65 T;  5L47 A;  4HFB A;  5HYA A;  2JPF A;  2JQ9 A;  2V7L A;  5FL1 A;  1D1C A;  2KWI B;  3RRW A;  4OHF A;  4ZI2 C;  1WR6 A;  2DI4 A;  2XAG B;  4JI8 T;  2IW5 B;  3F57 A;  4X62 T;  1YKH B;  2E9X B;  2N1G A;  2B76 A;  4X5T A;  5JDG A;  5FXW A;  5FL0 A;  2KIN B;  1T98 A;  4EIW A;  5LHH B;  1HG5 A;  2C0S A;  2VKD A;  4MLK A;  4PJN A;  4LFC T;  2V7M A;  5L3C B;  4QXH B;  1IBL T;  2CRB A;  3NZP A;  3PUY F;  4EB6 E;  4EOZ B;  3NVO A;  2PG8 A;  4GKK T;  4Z90 A;  3VKG A;  1YW0 A;  1QSD A;  4KMC A;  4TV8 E;  4DBR A;  4XBF B;  2D9D A;  3N2O A;  3QNU A;  4IGU A;  2MAW A;  3SRZ A;  2EHO D;  4ZI2 D;  4EEB A;  5TAO A;  3QC9 A;  2WDV A;  4LMK A;  4TWF A;  4PJL A;  3RQW A;  4L0R A;  2JMH A;  3CX8 B;  3P8C D;  1LVF A;  1D0Y A;  2Y8D A;  4HWI B;  4KHP T;  2WCA A;  2ACX A;  4TWH A;  2VK9 A;  1MMD A;  5H6R B;  1LRZ A;  3AE4 A;  3FB2 A;  3JC6 C;  4JUY A;  1MMN A;  5LNK A;  1MMA A;  1X9B A;  4YTP A;  4NXM T;  5LHI B;  2V6Y B;  4PJJ A;  2J47 A;  2SPC A;  2YEV C;  1US7 B;  1XZY A;  2YIN A;  3ANW A;  5FP3 A;  3ZN0 B;  2E5L T;  2ZM2 A;  2DL1 A;  2KND A;  2LOS A;  4CZZ B;  2ES0 A;  4MFR A;  3AEE A;  1XNQ T;  4PK6 A;  3A8Y C;  5L3F B;  1FMW A;  1NEN A;  2FUP A;  2W2U A;  3Q5E A;  3AE3 A;  3LBX A;  4UEM A;  2K9A A;  2YKS A;  3ZYL A;  3UQ7 A;  5L2L A;  2UUB T;  2VWA A;  5JRC A;  3FZL B;  1YQ3 A;  3CK6 A;  4O8S A;  5LB7 B;  3L8R A;  3N5L A;  3ZMZ B;  4YSZ A;  5LGT B;  4U74 A;  5ABG A;  3CQX C;  5AFU L;  2RA1 A;  3AXJ A;  5L3E B;  4QXB B;  1B7T A;  4I43 B;  1NAF A;  1Y01 A;  2KMF A;  4WW0 A;  4DUY T;  1NEK A;  5AQR B;  1IBM T;  2XUE A;  5HWY A;  3FBZ A;  4JI2 T;  2CCQ A;  2LJL A;  4LFA T;  4HFH A;  1J5W A;  4UVC B;  2YK0 A;  1O3X A;  4WNK A;  1DU2 A;  3RX6 A;  1KNP A;  4DR1 T;  4JI7 T;  4YSX A;  4HE8 A;  1HX8 A;  3ZMU B;  3ZJ2 A;  3VR8 A;  1U4Q A;  4X66 T;  1M7K A;  3RPU A;  3ZT6 A;  1HF8 A;  3UUX B;  1W0B A;  5LGU B;  4ZOL E;  5CB4 E;  4ZS3 A;  3PE0 A;  4QX8 B;  4BJN A;  3DP7 A;  3IBP A;  4EZ4 A;  3WI3 A;  2VKH A;  2VVN A;  2OA5 A;  3L39 A;  1JNZ A;  3C51 A;  4WZX A;  4HFV A;  5HEO A;  5C8Y E;  5HXH A;  2IC6 A;  3CQG B;  4G63 A;  2HPJ A;  3T8O A;  3AAA B;  1BR0 A;  1WYC A;  3EI0 A;  2LM2 A;  2Y6X A;  2WU5 A;  4GK0 E;  1VOM A;  4AKH A;  2EHO A;  4AKL A;  5LYJ E;  2H7O A;  2ODU A;  2V5D A;  2KT9 A;  3FBL A;  3I1A A;  4QHO A;  3UTK A;  2R6G F;  5A1L A;  4YTM A;  4IDN A;  3VRA A;  3JC6 D;  3RI5 A;  4L5G A;  4I4T E;  2JRK A;  3RIU C;  4HKA A;  2BS2 A;  3RHW A;  5ADX L;  2N2N A;  3O1H A;  3ZYM A;  4X20 E;  2CE7 A;  2VB6 A;  5DAB A;  2XAH B;  3O4X E;  2DWG A;  4X1Y E;  3QUJ A;  5IHY A;  2MBG A;  3ZMT B;  5ABF B;  1OED A;  5HCJ A;  2G0U A;  3AE6 A;  4COF A;  4OX9 T;  2X0L B;  1U5P A;  2I6H A;  2W63 A;  3DTO A;  4JI5 T;  2LEH A;  5FMN A;  2YN6 A;  4CXW A;  2NW8 A;  3MZK B;  4UF0 B;  3RIU A;  4LFB T;  4YJ3 E;  5FXV A;  4U2Y A;  2LHR A;  3QB5 A;  2FBW A;  2PTF A;  1QLB A;  2XAJ B;  4H63 H;  3HKB E;  4TNW A;  4TZ4 C;  2BBJ A;  5DQW A;  5AQQ B;  2M6I A;  3CIR A;  5JH7 E;  4AKI A;  5AQG B;  1W9R A;  3AAE B;  3A7M A;  3E0Z A;  4ILA A;  3TLS A;  4B6X A;  4YY3 T;  5HWX A;  2FJD A;  3C50 A;  2NW7 A;  5J2U E;  4JI1 T;  5AQT B;  4Z91 A;  4OYK A;  2CPT A;  4GYR A;  2E5V A;  4HWC A;  2C5J A;  3CX6 B;  3B5M A;  3QB5 K;  4ZI3 D;  5LJN A;  2NTX A;  3AEF A;  5AQM B;  2BKP A;  2W62 A;  2JQQ A;  4DO0 A;  4U33 A;  3QK6 A;  4JV5 T;  5JDQ A;  3C64 A;  2F4V T;  3TKL B;  4IST A;  5JDL A;  1NWM X;  2UXN B;  3N9L A;  3ZT5 A;  1G8X A;  3JAD A;  3OYX A;  4DMV A;  2VKO A;  4DBQ A;  2C5I T;  4QH1 A;  4ERR A;  3UU4 A;  3O1I A;  4HN9 A;  3X1D A;  4LMJ A;  3ZKR A;  3RKG A;  1QUU A;  3ZC0 A;  1J1J A;  2H89 A;  3KV4 A;  3SFD A;  4MHC A;  2PJQ A;  3K1S A;  4QX7 B;  2XZE A;  3E08 A;  3ABV A;  1KEY A;  3ZST A;  1ZOY A;  3N2K E;  3C4X A;  3K3O A;  3MA9 A;  4ASK A;  5ABH A;  3RRC A;  3M3Z B;  1KFY A;  1YKE B;  4P1N A;  3E22 E;  4HGA A;  5AQO B;  3PUX F;  5HXR A;  4HFC A;  5AQI B;  3RGL A;  4DUZ T;  1HG2 A;  3EAB A;  4YXD A;  4CN6 A;  2IML A;  2AE9 A;  4ZEY A;  4DV3 T;  4B3S T;  3GA8 A;  4CN4 A;  3PDY A;  4O4L E;  1WCR A;  2L9Q A;  5JR9 A;  3ZCJ A;  4G2A A;  3B57 A;  3VR9 A;  4YJ2 E;  3UU3 A;  4CXY A;  1W0A A;  3ANW B;  3DJB A;  2BBH A;  2E9X A;  3L09 A;  1OED E;  5H6Q B;  5KDM C;  3M65 A;  1GQE A;  2LRL A;  3LK3 B;  3NKZ A;  4QKN A;  3UU6 A;  4EGW A;  1LVK A;  3LK4 2;  4P0B A;  1T8B A;  1XDP A;  4DV0 T;  2JQK A;  3D0T A;  3PUS A;  4GYS A;  4IE7 A;  1ZEE A;  1HFA A;  2QYW A;  3O1J A;  3RC3 A;  3ZCI A;  4AQF C;  2VQE T;  3PJA J;  5FXX A;  4PK4 A;  2BKN A;  1IJ5 A;  2K5B B;  2ODV A;  3LJC A;  1XWM A;  3PU3 A;  4H9S E;  1SA0 E;  4PAG A;  4TV9 E;  2NW9 A;  3P4R A;  4IDO A;  4ZS2 A;  2EHO B;  1OED C;  5AQH B;  3SS1 A;  1EZ3 A;  1MNE A;  3PUG A;  4NUU A;  4DR7 T;  5CA0 E;  1WLX A;  2XY8 B;  3P4S A;  3OYZ A;  4IE6 A;  3W15 B;  3MAC A;  4ZI7 E;  2BKO A;  4U7Y A;  4ZI3 C;  1YXR A;  3KV5 A;  2XJ7 A;  3WAK A;  2MTQ A;  3P4P A;  4OFZ A;  4A97 A;  3P4Q A;  4H9O C;  5FVL A;  3AB3 B;  3CX7 B;  3OJA A;  1IZN B;  4TN7 B;  3J7Y q;  1HTJ F;  3ZN1 B;  1KNZ A;  2PBI A;  1AJ3 A;  2Q9Q B;  2IIU A;  5JDH A;  1XNR T;  5JRC B;  3ZEF B;  2V7J A;  4X1K E;  4DND A;  4DR5 T;  1IBK T;  4HFI A;  2P9B A;  4UR9 A;  3UU8 A;  2XQ4 A;  2XSA A;  1Y64 B;  3K3Q C;  4YHH T;  3ZMV B;  1HR0 T;  2K48 A;  4ZZC A;  4PFO A;  4E7Z A;  4ILU A;  4DV4 T;  3KVA A;  2B1E A;  2VVS A;  3CQC B;  5JQG E;  3OTO T;  3C4Z A;  3C4W A;  1SUM B;  2ZM0 A;  3ONJ A;  5AQU B;  4UV9 B;  4ZXL A;  1SHZ C;  3LSV A;  2NP9 A;  2XSB A;  2IAK A;  3ETV A;  4Q25 A;  5HXC A;  4EAH A;  4UIG A;  4P0A A;  4HFD A;  1HNZ T;  2BS4 A;  2QVA A;  3VKH A;  4BJM A;  2XHE B;  1MND A;  3ONL C;  2KLQ A;  2X66 A;  1MIY A;  2CMR A;  3HI2 A;  4CI1 B;  3U3I A;  2HH7 A;  3UUB A;  5HXE A;  2WM9 A;  2YU2 A;  5IWA T;  2CEA A;  3F2E A;  3AVS A;  3V5S A;  1UCU A;  3AA1 B;  2UXB T;  3HKC E;  3RYH E;  3CWZ B;  2IHR 1;  2ZLY A;  3IF8 B;  5BMV E;  4U2Z A;  2CBI A;  4UF0 A;  2K24 A;  2W67 A;  2W66 A;  4DID B;  3JAE A;  2X51 A;  3PUQ A;  2ZM8 A;  3LBX B;  2NTY A;  4FJO A;  4YSY A;  2XAF B;  3AXJ B;  3RLF F;  3UQ4 A;  1M62 A;  3T1H T;  1N32 T;  2QRX A;  3NRY A;  5F3J A;  2UXX B;  4CN1 A;  2E2A A;  4ILB A;  2CWY A;  3FZK B;  3KBT A;  3GMI A;  2HN1 A;  5HEH A;  5LOV E;  2A9U A;  5J0Z A;  2YDR A;  1KNR A;  2OV9 A;  3CKD A;  1E7P A;  3ZT7 A;  2AXD S;  4IT4 A;  5DQV A;  2YDS A;  3Q2M A;  4U3C A;  3U78 A;  2XM2 A;  2D5U A;  4HWH A;  5JR9 B;  1T72 A;  2VL8 A;  5JVD E;  2BG9 A;  3OKQ A;  4NPP A;  4X64 T;  5AQV B;  1ZV4 X;  2J4G A;  5EZY E;  4XAX B;  3UU5 A;  5EK2 A;  5IYZ E;  1BR2 A;  3NRX A;  3N2G E;  5CFB A;  2V6Y A;  4E7S A;  2Q9Q A;  2L3L A;  4H9P C;  4UEL A;  3P4W A;  5JDF A;  2VQF T;  2WWV A;  3V5U A;  4B3T T;  4CQI A;  2XQ3 A;  3IEE A;  4ZZB A;  2WDR A;  3HA4 A;  5C2T A;  2X67 A;  3FXD B;  3EHZ A;  4LF4 T;  2IC9 A;  1MIW A;  2J62 A;  2LSJ A;  4EED A;  5LG4 A;  2CLY C;  2LLY A;  1CUN A;  4L9I A;  5L4E A;  1N33 T;  4PK5 A;  2QGS A;  2BVL A;  2X9Y A;  5KMG P;  2V7K A;  4UV8 B;  4AIU A;  5AQF B;  3BQL A;  1KF6 A;  1HX1 B;  3N9O A;  2XQA A;  5GON E;  3GWH A;  2BG9 B;  2V7I A;  3KBU A;  4O2A E;  5F5W A;  4JI3 T;  1Z8U A;  5FXZ A;  3I0Q A;  3P50 A;  4PFP A;  2XQ7 A;  5FY7 A;  4DV2 T;  3LK2 B;  2XPK A;  3AE2 A;  3ZC1 A;  3I9Y A;  2LKH A;  1FJG T;  5ABF A;  3UUM A;  5FKY A;  3J9X 1;  4DR4 T;  2CLY B;  2L8K A;  4HEA A;  2VAS A;  3AE1 A;  2E9X C;  3ZPO A;  4ADZ A;  2WMO A;  3PUW F;  3AE9 A;  3OPC A;  1YQ4 A;  3OVU A;  4GIW A;  4YTN A;  2LSG A;  4IIJ E;  2XM1 A;  2D2S A;  5FVK A;  5HEG A;  5LBM A;  2NR4 A;  3WAJ A;  2HHH T;  4YT0 A;  3H3M A;  4I55 E;  3AEC A;  3B13 A;  4NIQ A;  4K0U A;  2ZMA A;  3TLW A;  2KWH A;  1SE7 A;  2LSI A;  3K3N A;  4H9Q C;  4PNI A;  4EYY R;  1HNW T;  5FNV E;  1BR1 A;  4IDZ A;  4A56 A;  2RPA A;  3NZQ A;  1D1A A;  2V8S V;  3PU8 A;  4PW8 A;  5FY0 A;  4UXN B;  4JYA T;  4U72 A;  2NWB A;  2RP4 A;  3MK7 C;  5F8P A;  5FY1 A;  2FJE A;  3UT5 E;  2DWK A;  2UXD T;  2I0M A;  4KHZ F;  4AQY T;  4OYJ A;  2J1D G;  2K3W A;  5LA6 E;  1CHU A;  2Y48 B;  2M6B A;  5M4Y A;  1N34 T;  3C98 B;  1I94 T;  2V26 A;  4GK5 E;  5C3J A;  2OLT A;  2WS3 A;  2CBJ A;  2IDO B;  5HCM A;  3JAF A;  5J2T E;  2LSY A;  4JI4 T;  4JI0 T;  2LHN A;  3AVR A;  3BK9 A;  3MXZ A;  4LML A;  4MBQ A;  3UFE A;  3PUV F;  2KSR A;  2MPK A;  3S4U A;  3H3A A;  3IHR A;  2W61 A;  2X9H A;  4AQG A;  2WDQ A;  4ANJ A;  1D0X A;  4KUM B;  3ZSS A;  2IUB A;  2V1D B;  2H3R A;  3OBV E;  2LT3 A;  5KXJ A;  4UVA B;  3SOL A;  4I0U A;  3NBX X;  4YLH A;  4N78 D;  3UUL A;  4DV1 T;  4C91 A;  2JQH A;  2E9X D;  4IRE A;  2HN2 A;  2CHO A;  3KV6 A;  4JEU B;  3RF1 A;  4DV5 T;  4CI3 B;  4IDQ A;  5LGN B;  1VCS A;  5JDM A;  1HS7 A;  2XQ6 A;  4ISS A;  5FYM A;  1D0Z A;  2CWO A;  4LF6 T;  3ZLI A;  3JCF A;  1UX4 A;  2XTL A;  4MAL A;  4NUV A;  4ZHQ E;  5LG3 A;  3VRB A;  4DVD A;  3KIN B;  4AI6 A;  1D1B A;  3PV0 F;  1MMG A;  2LE8 A;  2C5K T;  2XQ9 A;  5DJQ C;  3VU7 H;  5CGM A;  5JDN A;  4AKG A;  2BG9 E;  2VUR A;  3RYF E;  2H88 A;  3FXE B;  4K0K T;  1UGO A;  1XMO T;  4AKR B;  2ACZ A;  4IHJ E;  1OXZ A;  4JLE A;  2W00 A;  4O4H E;  4I50 E;  3F31 A;  4V1A v;  2VL0 A;  4TWD A;  1WRD A;  2BG9 C;  1ZP0 A;  5JTG A;  4DR3 T;  5KX5 E;  3G06 A;  5L3G B;  2BVM A;  1V9D A;  2KXP B;  4M1P A;  2LM9 A;  3R84 B;  3EDV A;  3AA7 B;  4CXX A;  1FEW A;  2CXL A;  1UX5 A;  4Z8X A;  1BR4 A;  3K8P C;  2BS3 A;  4TUY E;  3RH3 A; 
#chains in the Genus database with same CATH homology
 4LF5 T;  3T1Y T;  2VQF T;  4B3T T;  4LFC T;  1IBL T;  1N33 T;  1XMQ T;  4NXN T;  4GKK T;  1N36 T;  4LF9 T;  4GKJ T;  4DV7 T;  4DUZ T;  4DV3 T;  4KHP T;  4B3S T;  4JI3 T;  4YY3 T;  4DV2 T;  2UU9 T;  4NXM T;  2E5L T;  1FJG T;  4LF7 T;  4DR4 T;  4DR6 T;  4DV0 T;  2UXC T;  4LF8 T;  1XNQ T;  1J5E T;  4LF4 T;  5BR8 T;  4JV5 T;  2VQE T;  2HHH T;  1HNZ T;  2UUB T;  1HNX T;  4B3R T;  1HNW T;  4DV6 T;  4DR7 T;  4DUY T;  1IBM T;  4JYA T;  4JI2 T;  4LFA T;  2UUC T;  2UUA T;  4DR1 T;  4JI7 T;  4X66 T;  2UXD T;  4AQY T;  1XNR T;  4DR5 T;  1IBK T;  5LMN T;  4DR2 T;  1N34 T;  4YHH T;  4B3M T;  1HR0 T;  2ZM6 T;  4JI0 T;  4JI4 T;  4DV4 T;  3OTO T;  4DV1 T;  5IWA T;  4JI6 T;  4DV5 T;  2UXB T;  4OX9 T;  4LF6 T;  4JI5 T;  4LFB T;  1I94 T;  3T1H T;  4K0K T;  1N32 T;  5LMU T;  1XMO T;  4JI1 T;  4X65 T;  4DR3 T;  4X64 T;  4JI8 T;  4X62 T;  2F4V T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...