3LBXA

Crystal structure of the erythrocyte spectrin tetramerization domain complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
140
structure length
140
Chain Sequence
ETAEEIQERRQEVLTRYQSFKERVAERGQKLEDSYHLQVFKRDADDLGKWIMEKVNILTDKSYEDPTNIQGKYQKHQSLEAEVQTKSRLMSELEKTREERFTMGHSAHEETKAHIEELRHLWDLLLELTLEKGDQLLRAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and functional interpretation of the erythrocyte spectrin tetramerization domain complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Spectrin alpha chain, erythrocyte
total genus 56
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2010-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00435 Spectrin Spectrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.60 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3lbxA00
3F31A 1U4QA 2ODUA 1CUNA 3PE0A 1WLXA 3LBXB 2SPCA 3EDVA 3UULA 3FB2A 1AJ3A 3LBXA 1HCIA 1S35A 2ODVA 3UUNA 1QUUA 1OWAA 3UUMA 1U5PA
chains in the Genus database with same CATH superfamily
4UELA 2X68A 3SRZA 3UU8A 2C5KT 2VVNA 2UUCT 4P1NA 4CXXA 2J47A 3OVUA 4K0UA 3UFEA 4EAHA 3QB5K 4LF7T 3IA3A 2HN2A 5LXTE 2UXBT 5LBQB 3RF1A 4YSXA 5CA0E 4LFCT 4NIQA 5JVDE 2CWOA 1MMAA 4GYSA 4DNDA 2MYSA 5AQJB 2LOSA 1N34T 4IT4A 4AIUA 1D1BA 3ESLA 4L9IA 3RIUA 5LHGB 4CXYA 2V7JA 2NR4A 2XJ7A 1T7SA 4Z8XA 4YTPA 5CFBA 2KZ7B 4DMVA 3RPUA 3RIUC 4JI0T 2UUBT 2CXFA 1J5ET 3PDYA 4BAYB 5AQKB 5AQSB 3PUAA 1YW0A 4BA9A 4AI6A 3ZN0B 1M62A 4H9RC 5M4YA 4HFDA 4O4IE 2WBLA 4LFAT 4L5GA 5JRCB 1HNXT 2GK9A 3CX6B 2YU2A 3LDQB 3WAKA 5JDHA 4YFSA 3FZFB 4GOUA 3FZLB 1VCTA 2VURA 5JH7E 3RC3A 3E22E 4H9SE 4CQIA 1WLXA 3LBXB 5AQUB 1BR4A 3EDVA 2V5DA 4O2BE 2M6IA 4JI5T 2WWVA 5FVKA 3TLUA 2XY8B 1S94A 2PTFA 3AEGA 5LOVE 4DR7T 2WM9A 5F5WA 1OEDC 1J5WA 5HXRA 2VK9A 1X9BA 4K0KT 4IIJE 3PTRB 5AQMB 1B7TA 2WZHA 2IAKA 2XTLA 4PK4A 3B13A 1OEDB 2PJQA 2E2AA 4EV6A 5BR8T 2ES0A 4EB6E 3PUQA 2V7KA 2BVMA 2C5IT 2QGSA 2WAUA 3KVAA 3LK42 2EHOC 4EZ4A 5L4EA 4GK5E 1G73A 3AA1B 4NUVA 2A2FX 4ILAA 2KT9A 5E0OA 2ZM2A 1WR6A 4X1YE 1FIOA 3O1IA 4UR9A 4A56A 2JIWA 5FY1A 5HAXA 5H6QB 4HKAA 5CB4E 2DLRA 3Q2MA 5L3CB 2YK0A 2BZBA 3VR8A 2V7LA 4PK6A 3VRBA 2FJEA 2LOPA 5HXHA 4TUYE 3X1DA 4UF0A 1IJ5A 5F3JA 3O9XA 2I59A 1UGOA 3ZT7A 4U33A 2I6HA 3RYFE 4IE0A 3UULA 2V6YB 1KNZA 1YQ4A 1KF6A 2V7IA 1HNZT 4X1IE 3JC6C 3L3PA 4ASKA 1NAFA 2J4GA 4OYKA 4Z91A 1E2AA 3AE7A 3IEEA 2NW7A 4I0UA 2G0UA 3F2EA 2K48A 1WYBA 4TWHA 2YKSA 4YLHA 1R8IA 2CLYB 1XNRT 2NP9A 4A5XA 2UXCT 2X0YA 3LK3B 3RH3A 4H9QC 3BQIA 3J9X1 4IL4A 3NRXA 1V9DA 4OHFA 4PW8A 1XZYA 2KWHA 2XQ4A 4X5TA 5FMNA 3RKGA 2RP4A 2IDOB 4YTNA 4UV8B 5CA1E 1MNDA 4JI4T 3NWIA 4QH1A 5ABHA 2HN1A 4I50E 4PNIA 5HCJA 4CN4A 2Y6XA 3ANWA 1XDOA 3JADA 2HPJA 2LEHA 2Q9QC 4XBFB 1XWMA 2X51A 3ANWB 2DHRA 3ETVA 4QXHB 4X66T 2JMHA 3T1HT 2YEVC 4U2YA 3R84B 3ZKRA 3B5MA 3VKGA 2L9QA 4C90A 4HFIA 3N9OA 1BR2A 3PJAA 3PUVF 2VVSA 5GONE 4KMCA 2XQYA 2UXXB 3K3OA 4TWDA 3V5UA 2RPAA 4QH4A 4CI2B 3QC9A 5LBMA 2LHRA 3UQ4A 3AEAA 4DO0A 3OTOT 2D5UA 2JMKA 4CN1A 3PUZF 4JI8T 4IE6A 2Q9QB 4GIWA 4AQFA 4EGWA 4FJOA 2Y8DA 2NW9A 4KUMB 4YJ2E 5LG3A 4H63H 2VQFT 1HS7A 5FKYA 3KBTA 2XPKA 1D0ZA 2IC9A 2LM2A 3C51A 2CHNA 1UCUA 2NOXA 3CWZB 4O4HE 4A98A 3JAEA 3JCFA 3AE3A 3I0QA 4DBRA 3AXJA 1HF8A 5TAOA 3C4WA 5CGMA 4DV3T 2L8KA 2Y48B 4ADZA 2ZLYA 2IUBA 1BR1A 2JRKA 4HWIB 4IE4A 2J1DG 4HFHA 2B1EA 2WZIA 2LE8A 4UF0B 2BKPA 2BVLA 3I0OA 3PUYF 3FZKB 4TWFA 4LF8T 3RX6A 3UUMA 4ZI3D 1N36T 4G63A 4TX5A 4JI3T 2VB6A 2J62A 3T1YT 1M7KA 3Q5XA 4WBOA 2JPFA 4MBQA 5J0ZA 3CPZA 4LMKA 4KP3C 2QVAA 4V1Av 3Q5WA 4PJNA 4QX8B 2IIUA 2KSRA 5A1LA 1W0BA 4O8SA 4LF9T 4HFBA 5AQIB 4IREA 3AE5A 5EK4A 4X62T 4JI1T 2WP9A 4AISA 2WQYA 4H63V 1ZEEA 4QKNA 1KK7A 2YOEA 4DUYT 3QB5A 2WB5A 3FZHB 3B57A 4GKJT 2BDEA 3L8RA 1AJ3A 4L0RA 4JBWF 3ZT6A 4YTMA 4JEHB 5EK3A 3LSVA 3HKDE 3UU4A 1XMOT 5JTGA 1SHZC 3CX7B 3HKBE 3N9MA 4OK0A 1VCSA 2BKNA 1MMGA 5HWXA 5AQGB 2CHOA 2LSIA 5JRCA 2YDSA 1IAPA 2E9XB 2HH7A 4QX7B 4UVCB 1U5PA 2D0TA 2VKJA 3AEDA 5JR9B 2XQ5A 2YU1A 1YXRA 2BG9A 3P4RA 5FY7A 2LHNA 4DR5T 4DMWA 4EOZB 1T98A 1US7B 4HEAA 3ABVA 5AQRB 5AQVB 3W15B 3K1SA 3NZPA 2LKHA 2IC6A 3LFMA 4PAGA 4ZS3A 3P7IA 1UK5A 5L4HA 4CXWA 1HNWT 5HEGA 4NXNT 5JQGE 2N9DA 5FXWA 3ZMZB 5ABEA 5AQQB 3RI5A 1IJ6A 3RQUA 3AECA 3RRCA 2DL1A 3KDSE 3AB3B 3ZYLA 1ZHCA 3RQWA 2OLTA 3RYIE 3ZEFB 1Z0PA 1OXZA 2FBWA 2F4VT 3UU5A 2RA1A 4DBQA 3RC8A 3SFDA 1T72A 3NBXX 4IDPA 2W0GA 4LFBT 4KI0F 5IHYA 1I6ZA 3AEFA 4YSYA 3ZT5A 4PJMA 5ABFB 2V1DB 5KXJA 1HG2A 1KFYA 1D1AA 1OWAA 3AVSA 3GN5A 4CZZB 2KXPB 5C8YE 3L09A 2KNDA 3EUHA 3H3MA 4YJ3E 5L3DB 5IYZE 2PBIA 2C0SA 2YN6A 1W09A 3SFEA 2BBHA 4U31A 3C4ZA 2XQ8A 3V5SA 2VKOA 5EK2A 5JDGA 3LJCA 3C50A 3F31A 2H88A 4ZI2C 3AE1A 4IHJE 2WS3A 4B3RT 1NEKA 4P0BA 3WAJA 4JYAT 5LGTB 1NENA 1MIYA 2KLQA 3N2GE 2ACZA 2BS3A 2D2SA 2YINA 2LLYA 4OYJA 4YSZA 1XMQT 2VKHA 4LMLA 2YDRA 4J2CA 3N9LA 3S4UA 3UT5E 1VRBA 4Q25A 2AXDS 2FJBA 3ZMTB 5IUXA 2CMRA 3IHRA 3NKZA 3P4PA 5FXZA 4COFA 1MIVA 3A8YC 3VKHA 2L3LA 2QYWA 3FHNA 3N9NA 4E7ZA 1VOMA 3QUJA 3FZMB 2AE9A 3MK7C 4XZCA 3KV6A 2LRKA 4H9NC 1MNEA 4UEMA 4EEDA 3HI2A 3AE6A 5L47A 5JREA 5IWAT 5AQLB 3ZMVB 2LSJA 3TLWA 2JQHA 1E1HB 4HTEA 4GK0E 2V6YA 4H9OC 4I43B 3JAFA 3VRAA 5J2UE 3PURA 2FJAA 2YDQA 1U4QA 2XAHB 1HFAA 2BG9C 2BG9E 3TLTA 2VL8A 4QWNB 5LMNT 2BS2A 4OFZA 3I9WA 1WFDA 2W00A 2X0HA 3NZQA 4X20E 3EDUA 2ZM8A 4AKLA 3UUXB 2W67A 2WWUA 1NWMX 4IE5A 3U3IA 1D0XA 3QNUA 3RRWA 4EYUA 2QRXA 2BKOA 3AA6B 3CKDA 1O3XA 3KV5A 2ZMAA 4M1PA 5LNKA 4TN7B 1HX8A 3A7MA 5KDMC 4DV5T 3VU7H 3ZMSB 1JNRA 1OEDE 3SS1A 4BJNA 5C2TA 5LG4A 2K24A 4B6XA 4CI1B 2PG8A 3EAMA 2X9YA 5HEJA 3J7Yq 4DV0T 1OEDA 2XQ9A 3ETUA 3O1JA 3KV9A 3OYXA 3EHZA 4TV8E 4F8HA 4PK5A 3HKCE 5FYMA 4DR1T 1IBMT 1SUMB 4P0AA 2X0LB 4EZHA 3Q5DA 1IBLT 3OKQA 4P09A 2XHEB 1WR0A 3UFGA 1W9RA 4JUYA 4EYYR 2WU2A 2D9DA 4Z90A 5AQOB 4ZXLA 2MTQA 4DR4T 4NUUA 2CBJA 3SOLA 2DNXA 2V7MA 4WZXA 2UXNB 1YKEB 2A9UA 2V5CA 3VHLA 1D0YA 3BK9A 2IW5B 4AKRB 2EHOD 4AKGA 1T8BA 4JI6T 5DQVA 1WYCA 5FY0A 3P4SA 3UTKA 1MMDA 4CI3B 1YKHB 1D1CA 1FEWA 2V6XA 4MFRA 4E7SA 4ZHQE 2K3WA 2V8SV 5HXEA 5HWYA 2VQET 4GKKT 3C4XA 4B3MT 3CQCB 3CMLA 3N2OA 4X1KE 5LCYA 5LJMA 2XSBA 4IDNA 2XM1A 1N33T 4EIWA 4DR2T 1QUUA 2MOZA 2XAFB 3AAEB 3GMIA 4HWDA 2MBGA 2M6BA 4B3TT 3NRYA 4WYVA 1MMNA 5BMVE 1FMWA 2WMOA 2W61A 5JDLA 4UXNB 1ZV4X 4WBNE 1CHUA 3AVRA 5C3JA 4TNVA 1UURA 4PJLA 4TNWA 5FNVE 4TZ4C 5LJNA 5HXSA 3EI0A 3JC6D 2CE7A 1MIWA 1KNRA 4KBMB 4QXCB 2WCAA 4UIGA 5DJQC 3ZLIA 1ZP0A 3FXDB 2CA5A 5L3GB 4DR3T 2XM2A 3RHWA 4PJJA 1KNPA 4KX6A 4AQGA 3IF8B 4I4TE 3DJBA 4G2AA 3I1AA 4GYRA 4QHOA 4U2ZA 2ZM6T 4IL9A 3CVRA 3UQ7A 4WW0A 4AKIA 2WDQA 3K3QC 3FB2A 1LVKA 3PV0F 5LB7B 3ZMUB 2Z6EA 3KVBA 4NPPA 4KHPT 4HN9A 2Q9QA 2FUPA 3MA9A 4B3ST 3ZC0A 3FBLA 2LSYA 4U7YA 3ONLC 3PU8A 2LSGA 3MJXA 3Q9DA 5DQWA 4BJMA 2BG9B 2HHHT 3M65A 4LF6T 3EABA 4NXMT 2K9AA 1SE7A 4I55E 2D0UA 5LP6E 2X9HA 2E5VA 1HTJF 2W63A 5HXCA 4H9PC 3A5XA 2XAJB 3ZSSA 5H6RB 4DV4T 3HA4A 2UXDT 5CJ5A 3PJAJ 3ZSTA 2DWKA 4DUZT 1QLBA 5KMGP 3F57A 2FJDA 1LRZA 2E9XA 3AAAB 5JR9A 3BQKA 3MXZA 3P4WA 4IDQA 4YXDA 2W62A 4JI7T 2WSSV 4FI5A 5ETWA 2IHR1 3AA0B 5AQPB 4U3CA 5FL1A 2OV9A 2E9XD 2W66A 2P9BA 4A97A 5KX5E 2W2UA 2H3RA 3E08A 4IE7A 2IMLA 4ZEYA 4YY3T 1S35A 4YHJA 1IZNB 5FVLA 4HWFA 4HGAA 2LT3A 3N2KE 3PU3A 4JEUB 2BS4A 1FMVA 4ZI7E 3H37A 3KV4A 4ERRA 3PUSA 3C98B 1JNZA 3P4QA 4ILUA 2VWAA 5AQNB 4JI2T 3SWHA 2Q9QD 5HEHA 3CX8B 3G06A 3TKLB 1SA0E 5FXXA 3IBPA 5HCMA 1GQEA 2PFVA 3FBZA 3DP7A 5L3BB 3GWHA 4EXTA 3RYCE 3P50A 1FJGT 4HE8A 3PE0A 3U78A 5F8PA 3UUBA 2KWIB 4UVBB 3PUGA 5HYAA 4KHZF 4JLEA 2QA7A 5HEOA 5LYJE 3WI3A 5AQFB 1YD8G 4HFVA 4MLKA 2CPTA 3MKDA 3ONJA 3TLVA 3H3AA 3L39A 3OPCA 3ZC1A 4PFOA 2EHOB 4DV1T 4O4LE 3AXJB 2NTYA 5ABGA 3RYHE 1W0AA 2VASA 4AQYT 4DR6T 2VKDA 3AE2A 3O1HA 3ZYKA 1WRDA 2A3DA 2CLYC 3ZCIA 1X79A 4HWCA 3UU6A 3AE4A 5J1GA 5ADXL 2KINB 4LF4T 3K8PC 2E8IA 4MHCA 5J2TE 2CXDA 4U74A 2LJLA 1LKXA 2X66A 3AAIA 3RGLA 5JDQA 4MALA 5LHHB 1L0VA 3HL6A 1I94T 4DIDB 2N2NA 1HX1B 2NTXA 4HFEA 3TLSA 1H7CA 2XAGB 4PFPA 1E7PA 3OJAA 3LK2B 1UX5A 4TV9E 2WU5A 3RKOA 3HKEE 4AQFC 2H7OA 4EEBA 3O4XE 4ZI3C 5LMUT 1YQ3A 2C5JA 2SPCA 2XQ7A 3C64A 2X9WA 2B76A 3AA7B 4HWHA 3RLFF 3ZN1B 5AQTB 1XNQT 2ZM0A 3N9QA 1HG5A 2XAQB 4WNKA 3ZJ2A 2CEAA 3OYZA 1BR0A 2WDVA 4UVAB 1Z8UA 2WDRA 4LMJA 2XQ3A 2XSAA 2R6GF 3QOFA 1DU2A 1Y64B 3AEEA 4ISTA 3ZYMA 2W4XA 1Y01A 3BQLA 2UUAT 3D0TA 3GN5B 2MAWA 3MZKB 4ZZCA 1LVFA 2I0MA 3CIRA 4QH5A 2OA5A 3R6NA 2EHOA 2CM0A 4IDZA 4AXPA 1WCRA 5ABFA 3KINB 2X67A 4ZZBA 2A72A 3K3NA 4O2AE 4ANJA 1HR0T 3VR9A 4U72A 2CWYA 1XDPA 2CRBA 3OBVE 1G8XA 5AFUL 5FL0A 2WY2A 3E0ZA 1KEYA 1EZ3A 4QXBB 2UU9T 2JQ9A 3RIFA 4C91A 5DABA 1QSDA 3T8OA 2XUEA 2K5BB 2JQQA 1N32T 5JDNA 5LGNB 2MPKA 2XZEA 4ZI2D 3Q5EA 2X9XA 3NVOA 4ILBA 2HPLA 4ZOLE 2ODVA 3UUNA 2XQ6A 4ISSA 3RIAA 4UV9B 5JDMA 4OX9T 1ZOYA 2V26A 2WMNA 3FXEB 5HEUA 2H89A 2LM9A 3CQXC 4XAXB 4JV5T 3CK6A 3PUWF 4X64T 3EVYA 3ZPOA 3GA8A 2DI4A 3PUXF 4O4JE 5L3EB 3AEBA 4ILCA 1UUSA 4CN6A 2KMFA 3ONXA 4DV2T 2E5LT 2ODUA 5AQHB 4U7IA 3HR0A 4DV6T 1CUNA 2NW8A 2XQAA 2DCFA 2ACXA 3KFWX 3N5LA 5LHIB 4IGUA 1ZKEA 4N78D 2NWBA 4F6RC 2CCQA 2CXLA 2XASB 3MACA 3I9YA 4X65T 5LGUB 3DTOA 5L2LA 4AKHA 4DVDA 1IBKT 4DV7T 2LSKA 3M3ZB 3LBXA 1HCIA 2LKGA 4HFCA 3ZCJA 2DWGA 4ZS2A 2H7VC 1UX4A 3N9PA 5FP3A 2VL0A 3LG7A 5EZYE 3KBUA 2BBJA 5LA6E 3AE9A 2LRLA 5FXVA 3CQGB 2CBIA 3P8CD 4YHHT 4IDOA 2M67A 3ZJ1A 2JJ9A 3QK6A 4YT0A 2JQKA 5L3FB 4LF5T 2E9XC 5JR9C 3AE8A 5JDFA 1J1JA 3UU3A 2N1GA
chains in the Genus database with same CATH topology
4UELA 2X68A 3SRZA 2C5KT 4CXXA 3UFEA 4K0UA 4EAHA 5LXTE 5LBQB 5CA0E 5JVDE 2CWOA 1MMAA 4GYSA 4DNDA 2MYSA 2LOSA 1D1BA 3ESLA 4L9IA 5LHGB 4CXYA 2V7JA 4Z8XA 2KZ7B 4DMVA 3RPUA 2CXFA 3PDYA 4BAYB 3PUAA 1YW0A 4BA9A 4AI6A 3ZN0B 4H9RC 5M4YA 4O4IE 2WBLA 4L5GA 2GK9A 3CX6B 2YU2A 3WAKA 5JDHA 4YFSA 4GOUA 5JH7E 3RC3A 3E22E 4H9SE 4CQIA 1WLXA 3LBXB 1BR4A 3EDVA 4O2BE 5LOVE 1S94A 2WM9A 5HXRA 2VK9A 4IIJE 3PTRB 1B7TA 2IAKA 2XTLA 4PK4A 3B13A 2PJQA 2ES0A 4EB6E 3PUQA 2V7KA 2BVMA 2C5IT 2QGSA 2WAUA 3KVAA 3LK42 2EHOC 4EZ4A 4GK5E 1G73A 3AA1B 4NUVA 2A2FX 5E0OA 2KT9A 2ZM2A 1WR6A 4X1YE 1FIOA 3O1IA 4A56A 5FY1A 5HAXA 5H6QB 4HKAA 5CB4E 2DLRA 3Q2MA 5L3CB 2YK0A 2BZBA 2V7LA 4PK6A 2LOPA 5HXHA 4TUYE 5F3JA 4UF0A 1IJ5A 3O9XA 2I59A 3RYFE 4IE0A 3UULA 1KNZA 2V7IA 4X1IE 3JC6C 3L3PA 4ASKA 1NAFA 4OYKA 3IEEA 2NW7A 2G0UA 3F2EA 2K48A 1WYBA 4YLHA 2CLYB 2NP9A 3LK3B 3RH3A 4H9QC 3BQIA 3J9X1 3NRXA 1V9DA 4OHFA 4PW8A 2KWHA 5FMNA 2RP4A 4UV8B 5CA1E 1MNDA 4I50E 4PNIA 2Y6XA 3ANWA 2HPJA 2LEHA 2Q9QC 4XBFB 2X51A 3ETVA 2DHRA 3ANWB 4QXHB 2JMHA 2YEVC 3R84B 3VKGA 2L9QA 4C90A 3N9OA 1BR2A 5GONE 4KMCA 2XQYA 2UXXB 3K3OA 3V5UA 4CI2B 3QC9A 5LBMA 2LHRA 4DO0A 2D5UA 2JMKA 4IE6A 2Q9QB 4GIWA 4AQFA 4FJOA 2Y8DA 2NW9A 4KUMB 4YJ2E 1HS7A 4H63H 3KBTA 3SS1A 1D0ZA 2IC9A 3C51A 3CWZB 1UCUA 2NOXA 4O4HE 4DBRA 3I0QA 1HF8A 5TAOA 3C4WA 2L8KA 2Y48B 4ADZA 2ZLYA 1BR1A 2JRKA 4IE4A 2J1DG 2B1EA 2LE8A 4UF0B 2BVLA 3I0OA 3UUMA 3RX6A 4ZI3D 4G63A 4TX5A 2VB6A 3Q5XA 4WBOA 2JPFA 4MBQA 3CPZA 4KP3C 4V1Av 3Q5WA 4PJNA 4QX8B 5A1LA 5JRCB 4O8SA 5EK4A 4QKNA 4H63V 1ZEEA 1KK7A 3B57A 2BDEA 1AJ3A 4L0RA 4JEHB 5EK3A 3HKDE 1SHZC 3CX7B 3HKBE 3N9MA 4OK0A 1MMGA 5HWXA 2LSIA 5JRCA 1IAPA 2E9XB 2HH7A 4QX7B 4UVCB 1U5PA 2D0TA 2VKJA 5JR9B 2YU1A 5FY7A 2LHNA 4DMWA 4EOZB 1T98A 1US7B 4HEAA 3W15B 5LG4A 3NZPA 4ZS3A 2IC6A 3LFMA 4PAGA 3P7IA 4CXWA 5JQGE 2N9DA 5FXWA 3ZMZB 1IJ6A 3RRCA 3KDSE 3AB3B 3ZYLA 1ZHCA 3RYIE 3ZEFB 1Z0PA 1OXZA 4DBQA 2RA1A 3RC8A 3NBXX 2W0GA 5IHYA 4PJMA 2V1DB 3AVSA 1HG2A 1OWAA 3GN5A 1D1AA 4CZZB 5C8YE 2KXPB 3L09A 2KNDA 3EUHA 4YJ3E 5L3DB 5IYZE 2PBIA 2C0SA 3C4ZA 3V5SA 2VKOA 5EK2A 5JDGA 3LJCA 3C50A 3F31A 4ZI2C 4IHJE 4P0BA 3WAJA 5LGTB 1MIYA 2KLQA 3N2GE 2D2SA 2YINA 4OYJA 2VKHA 4J2CA 3N9LA 3S4UA 3UT5E 1VRBA 3ZMTB 2CMRA 3IHRA 5FXZA 1MIVA 3VKHA 2L3LA 4E7ZA 3FHNA 3N9NA 1VOMA 3QUJA 3MK7C 4XZCA 3KV6A 4UEMA 4H9NC 1MNEA 5JREA 3HI2A 3ZMVB 2LSJA 1E1HB 4HTEA 4GK0E 4I43B 4H9OC 5J2UE 3PURA 1U4QA 2XAHB 1HFAA 2VL8A 4QWNB 4OFZA 3I9WA 3NZQA 2W00A 4X20E 4AKLA 3EDUA 2ZM8A 3UUXB 2WWUA 1NWMX 4IE5A 3U3IA 1D0XA 3RRWA 4EYUA 3AA6B 3CKDA 1O3XA 3KV5A 2ZMAA 4M1PA 5LNKA 4TN7B 1HX8A 5KDMC 3VU7H 3ZMSB 4BJNA 2K24A 4B6XA 4CI1B 2PG8A 2X9YA 3J7Yq 3O1JA 3ETUA 3KV9A 3OYXA 4TV8E 4PK5A 3HKCE 5FYMA 4P0AA 2X0LB 4EZHA 3OKQA 4P09A 2XHEB 5LGNB 4EYYR 4JUYA 2MTQA 4NUUA 3SOLA 2DNXA 2V7MA 2UXNB 1YKEB 3VHLA 4AKRB 4AKGA 1D0YA 3BK9A 2IW5B 2EHOD 5DQVA 1WYCA 5FY0A 3UTKA 1MMDA 4CI3B 1YKHB 1D1CA 1FEWA 4MFRA 4E7SA 4ZHQE 5HWYA 3C4XA 3CQCB 3CMLA 3N2OA 4X1KE 5LCYA 5LJMA 4EIWA 1QUUA 2MOZA 2XAFB 3AAEB 3GMIA 2MBGA 3NRYA 1MMNA 5BMVE 1FMWA 2WMOA 2W61A 5JDLA 4UXNB 1ZV4X 4WBNE 3AVRA 4PJLA 5FNVE 4TZ4C 5LJNA 5HXSA 3JC6D 2CE7A 1MIWA 4KBMB 4QXCB 4UIGA 5DJQC 3ZLIA 5L3GB 3FXDB 2CA5A 4PJJA 4AQGA 3IF8B 4I4TE 3DJBA 4G2AA 3I1AA 4GYRA 4QHOA 3CVRA 4AKIA 4WW0A 3K3QC 3FB2A 1LVKA 3ZMUB 2Z6EA 3KVBA 4HN9A 2Q9QA 3MA9A 3ZC0A 3FBLA 2LSYA 3PU8A 2LSGA 3MJXA 3Q9DA 5DQWA 4BJMA 3M65A 2K9AA 4I55E 2D0UA 5LP6E 2X9HA 1HTJF 2W63A 5HXCA 4H9PC 3A5XA 2XAJB 5H6RB 3HA4A 2DWKA 5KMGP 3F57A 1LRZA 2E9XA 3AAAB 5JR9A 3BQKA 3MXZA 2W62A 2WSSV 4FI5A 5ETWA 3AA0B 2E9XD 2P9BA 5KX5E 2H3RA 3E08A 4IE7A 1S35A 4YHJA 1IZNB 4HGAA 2LT3A 3N2KE 3PU3A 4JEUB 1FMVA 4ZI7E 3H37A 3KV4A 4ERRA 3PUSA 3C98B 4ILUA 2VWAA 3SWHA 2Q9QD 3CX8B 3TKLB 1SA0E 5FXXA 3IBPA 5L3BB 2PFVA 3FBZA 3DP7A 3GWHA 4EXTA 3RYCE 4HE8A 3PE0A 3U78A 5F8PA 2KWIB 4UVBB 3PUGA 5HYAA 5LYJE 4JLEA 2QA7A 3WI3A 1YD8G 4HFVA 4MLKA 3MKDA 3ZC1A 3H3AA 4PFOA 2EHOB 4O4LE 2NTYA 3RYHE 2VASA 2VKDA 3O1HA 3ZYKA 1WRDA 2A3DA 2CLYC 3ZCIA 1X79A 5J1GA 5ADXL 2KINB 3K8PC 2E8IA 4MHCA 5J2TE 2CXDA 4U74A 2LJLA 1LKXA 2X66A 3AAIA 5JDQA 4MALA 5LHHB 3HL6A 2N2NA 2NTXA 1H7CA 2XAGB 4PFPA 3OJAA 3LK2B 1UX5A 4TV9E 3RKOA 4AQFC 3HKEE 2H7OA 3O4XE 4ZI3C 3C64A 2C5JA 2SPCA 5HXEA 3ZN1B 2X9WA 3AA7B 2ZM0A 3N9QA 1HG5A 2XAQB 4WNKA 3ZJ2A 2CEAA 3OYZA 1BR0A 4UVAB 1Y64B 4ISTA 3ZYMA 3BQLA 3D0TA 3GN5B 3MZKB 1LVFA 2OA5A 3R6NA 2EHOA 2CM0A 4IDZA 4AXPA 3KINB 2X67A 2A72A 3K3NA 4O2AE 4ANJA 4U72A 2CWYA 3OBVE 1G8XA 5AFUL 3E0ZA 4QXBB 1EZ3A 4C91A 5DABA 1QSDA 3T8OA 2XUEA 2K5BB 2JQQA 5JDNA 4ZI2D 2X9XA 2HPLA 4ZOLE 2ODVA 3UUNA 4ISSA 5JDMA 4UV9B 2V26A 2WMNA 3FXEB 2LM9A 3CQXC 4XAXB 3EVYA 3ZPOA 3GA8A 2DI4A 4O4JE 5L3EB 2KMFA 3ONXA 2ODUA 3HR0A 1CUNA 2NW8A 5LHIB 2DCFA 2ACXA 3KFWX 3N5LA 4IGUA 1ZKEA 4N78D 2NWBA 4F6RC 2CCQA 2CXLA 2XASB 3MACA 3I9YA 5LGUB 3DTOA 5L2LA 4AKHA 4DVDA 2LSKA 3LBXA 1HCIA 3ZCJA 2DWGA 4ZS2A 2H7VC 1UX4A 3N9PA 5FP3A 3LG7A 5EZYE 3KBUA 5LA6E 5FXVA 3CQGB 3P8CD 2M67A 3ZJ1A 2JJ9A 3QK6A 5L3FB 2E9XC 5JR9C 5JDFA 2N1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F31 A;  1U4Q A;  2ODU A;  1CUN A;  3PE0 A;  1WLX A;  3LBX B;  2SPC A;  3EDV A;  3UUL A;  3FB2 A;  1AJ3 A;  3LBX A;  1HCI A;  1S35 A;  2ODV A;  3UUN A;  1QUU A;  1OWA A;  3UUM A;  1U5P A; 
#chains in the Genus database with same CATH topology
 4UEL A;  2X68 A;  3SRZ A;  3UU8 A;  2C5K T;  2VVN A;  2UUC T;  4P1N A;  4CXX A;  2J47 A;  3OVU A;  4K0U A;  3UFE A;  4EAH A;  3QB5 K;  4LF7 T;  3IA3 A;  2HN2 A;  5LXT E;  2UXB T;  5LBQ B;  3RF1 A;  4YSX A;  5CA0 E;  4LFC T;  4NIQ A;  5JVD E;  2CWO A;  1MMA A;  4GYS A;  4DND A;  2MYS A;  5AQJ B;  2LOS A;  1N34 T;  4IT4 A;  4AIU A;  1D1B A;  3ESL A;  4L9I A;  3RIU A;  5LHG B;  4CXY A;  2V7J A;  2NR4 A;  2XJ7 A;  1T7S A;  4Z8X A;  4YTP A;  5CFB A;  2KZ7 B;  4DMV A;  3RPU A;  3RIU C;  4JI0 T;  2UUB T;  2CXF A;  1J5E T;  3PDY A;  4BAY B;  5AQK B;  5AQS B;  3PUA A;  1YW0 A;  4BA9 A;  4AI6 A;  3ZN0 B;  1M62 A;  4H9R C;  5M4Y A;  4HFD A;  4O4I E;  2WBL A;  4LFA T;  4L5G A;  5JRC B;  1HNX T;  2GK9 A;  3CX6 B;  2YU2 A;  3LDQ B;  3WAK A;  5JDH A;  4YFS A;  3FZF B;  4GOU A;  3FZL B;  1VCT A;  2VUR A;  5JH7 E;  3RC3 A;  3E22 E;  4H9S E;  4CQI A;  1WLX A;  3LBX B;  5AQU B;  1BR4 A;  3EDV A;  2V5D A;  4O2B E;  2M6I A;  4JI5 T;  2WWV A;  5FVK A;  3TLU A;  2XY8 B;  1S94 A;  2PTF A;  3AEG A;  5LOV E;  4DR7 T;  2WM9 A;  5F5W A;  1OED C;  1J5W A;  5HXR A;  2VK9 A;  1X9B A;  4K0K T;  4IIJ E;  3PTR B;  5AQM B;  1B7T A;  2WZH A;  2IAK A;  2XTL A;  4PK4 A;  3B13 A;  1OED B;  2PJQ A;  2E2A A;  4EV6 A;  5BR8 T;  2ES0 A;  4EB6 E;  3PUQ A;  2V7K A;  2BVM A;  2C5I T;  2QGS A;  2WAU A;  3KVA A;  3LK4 2;  2EHO C;  4EZ4 A;  5L4E A;  4GK5 E;  1G73 A;  3AA1 B;  4NUV A;  2A2F X;  4ILA A;  2KT9 A;  5E0O A;  2ZM2 A;  1WR6 A;  4X1Y E;  1FIO A;  3O1I A;  4UR9 A;  4A56 A;  2JIW A;  5FY1 A;  5HAX A;  5H6Q B;  4HKA A;  5CB4 E;  2DLR A;  3Q2M A;  5L3C B;  2YK0 A;  2BZB A;  3VR8 A;  2V7L A;  4PK6 A;  3VRB A;  2FJE A;  2LOP A;  5HXH A;  4TUY E;  3X1D A;  4UF0 A;  1IJ5 A;  5F3J A;  3O9X A;  2I59 A;  1UGO A;  3ZT7 A;  4U33 A;  2I6H A;  3RYF E;  4IE0 A;  3UUL A;  2V6Y B;  1KNZ A;  1YQ4 A;  1KF6 A;  2V7I A;  1HNZ T;  4X1I E;  3JC6 C;  3L3P A;  4ASK A;  1NAF A;  2J4G A;  4OYK A;  4Z91 A;  1E2A A;  3AE7 A;  3IEE A;  2NW7 A;  4I0U A;  2G0U A;  3F2E A;  2K48 A;  1WYB A;  4TWH A;  2YKS A;  4YLH A;  1R8I A;  2CLY B;  1XNR T;  2NP9 A;  4A5X A;  2UXC T;  2X0Y A;  3LK3 B;  3RH3 A;  4H9Q C;  3BQI A;  3J9X 1;  4IL4 A;  3NRX A;  1V9D A;  4OHF A;  4PW8 A;  1XZY A;  2KWH A;  2XQ4 A;  4X5T A;  5FMN A;  3RKG A;  2RP4 A;  2IDO B;  4YTN A;  4UV8 B;  5CA1 E;  1MND A;  4JI4 T;  3NWI A;  4QH1 A;  5ABH A;  2HN1 A;  4I50 E;  4PNI A;  5HCJ A;  4CN4 A;  2Y6X A;  3ANW A;  1XDO A;  3JAD A;  2HPJ A;  2LEH A;  2Q9Q C;  4XBF B;  1XWM A;  2X51 A;  3ANW B;  2DHR A;  3ETV A;  4QXH B;  4X66 T;  2JMH A;  3T1H T;  2YEV C;  4U2Y A;  3R84 B;  3ZKR A;  3B5M A;  3VKG A;  2L9Q A;  4C90 A;  4HFI A;  3N9O A;  1BR2 A;  3PJA A;  3PUV F;  2VVS A;  5GON E;  4KMC A;  2XQY A;  2UXX B;  3K3O A;  4TWD A;  3V5U A;  2RPA A;  4QH4 A;  4CI2 B;  3QC9 A;  5LBM A;  2LHR A;  3UQ4 A;  3AEA A;  4DO0 A;  3OTO T;  2D5U A;  2JMK A;  4CN1 A;  3PUZ F;  4JI8 T;  4IE6 A;  2Q9Q B;  4GIW A;  4AQF A;  4EGW A;  4FJO A;  2Y8D A;  2NW9 A;  4KUM B;  4YJ2 E;  5LG3 A;  4H63 H;  2VQF T;  1HS7 A;  5FKY A;  3KBT A;  2XPK A;  1D0Z A;  2IC9 A;  2LM2 A;  3C51 A;  2CHN A;  1UCU A;  2NOX A;  3CWZ B;  4O4H E;  4A98 A;  3JAE A;  3JCF A;  3AE3 A;  3I0Q A;  4DBR A;  3AXJ A;  1HF8 A;  5TAO A;  3C4W A;  5CGM A;  4DV3 T;  2L8K A;  2Y48 B;  4ADZ A;  2ZLY A;  2IUB A;  1BR1 A;  2JRK A;  4HWI B;  4IE4 A;  2J1D G;  4HFH A;  2B1E A;  2WZI A;  2LE8 A;  4UF0 B;  2BKP A;  2BVL A;  3I0O A;  3PUY F;  3FZK B;  4TWF A;  4LF8 T;  3RX6 A;  3UUM A;  4ZI3 D;  1N36 T;  4G63 A;  4TX5 A;  4JI3 T;  2VB6 A;  2J62 A;  3T1Y T;  1M7K A;  3Q5X A;  4WBO A;  2JPF A;  4MBQ A;  5J0Z A;  3CPZ A;  4LMK A;  4KP3 C;  2QVA A;  4V1A v;  3Q5W A;  4PJN A;  4QX8 B;  2IIU A;  2KSR A;  5A1L A;  1W0B A;  4O8S A;  4LF9 T;  4HFB A;  5AQI B;  4IRE A;  3AE5 A;  5EK4 A;  4X62 T;  4JI1 T;  2WP9 A;  4AIS A;  2WQY A;  4H63 V;  1ZEE A;  4QKN A;  1KK7 A;  2YOE A;  4DUY T;  3QB5 A;  2WB5 A;  3FZH B;  3B57 A;  4GKJ T;  2BDE A;  3L8R A;  1AJ3 A;  4L0R A;  4JBW F;  3ZT6 A;  4YTM A;  4JEH B;  5EK3 A;  3LSV A;  3HKD E;  3UU4 A;  1XMO T;  5JTG A;  1SHZ C;  3CX7 B;  3HKB E;  3N9M A;  4OK0 A;  1VCS A;  2BKN A;  1MMG A;  5HWX A;  5AQG B;  2CHO A;  2LSI A;  5JRC A;  2YDS A;  1IAP A;  2E9X B;  2HH7 A;  4QX7 B;  4UVC B;  1U5P A;  2D0T A;  2VKJ A;  3AED A;  5JR9 B;  2XQ5 A;  2YU1 A;  1YXR A;  2BG9 A;  3P4R A;  5FY7 A;  2LHN A;  4DR5 T;  4DMW A;  4EOZ B;  1T98 A;  1US7 B;  4HEA A;  3ABV A;  5AQR B;  5AQV B;  3W15 B;  3K1S A;  3NZP A;  2LKH A;  2IC6 A;  3LFM A;  4PAG A;  4ZS3 A;  3P7I A;  1UK5 A;  5L4H A;  4CXW A;  1HNW T;  5HEG A;  4NXN T;  5JQG E;  2N9D A;  5FXW A;  3ZMZ B;  5ABE A;  5AQQ B;  3RI5 A;  1IJ6 A;  3RQU A;  3AEC A;  3RRC A;  2DL1 A;  3KDS E;  3AB3 B;  3ZYL A;  1ZHC A;  3RQW A;  2OLT A;  3RYI E;  3ZEF B;  1Z0P A;  1OXZ A;  2FBW A;  2F4V T;  3UU5 A;  2RA1 A;  4DBQ A;  3RC8 A;  3SFD A;  1T72 A;  3NBX X;  4IDP A;  2W0G A;  4LFB T;  4KI0 F;  5IHY A;  1I6Z A;  3AEF A;  4YSY A;  3ZT5 A;  4PJM A;  5ABF B;  2V1D B;  5KXJ A;  1HG2 A;  1KFY A;  1D1A A;  1OWA A;  3AVS A;  3GN5 A;  4CZZ B;  2KXP B;  5C8Y E;  3L09 A;  2KND A;  3EUH A;  3H3M A;  4YJ3 E;  5L3D B;  5IYZ E;  2PBI A;  2C0S A;  2YN6 A;  1W09 A;  3SFE A;  2BBH A;  4U31 A;  3C4Z A;  2XQ8 A;  3V5S A;  2VKO A;  5EK2 A;  5JDG A;  3LJC A;  3C50 A;  3F31 A;  2H88 A;  4ZI2 C;  3AE1 A;  4IHJ E;  2WS3 A;  4B3R T;  1NEK A;  4P0B A;  3WAJ A;  4JYA T;  5LGT B;  1NEN A;  1MIY A;  2KLQ A;  3N2G E;  2ACZ A;  2BS3 A;  2D2S A;  2YIN A;  2LLY A;  4OYJ A;  4YSZ A;  1XMQ T;  2VKH A;  4LML A;  2YDR A;  4J2C A;  3N9L A;  3S4U A;  3UT5 E;  1VRB A;  4Q25 A;  2AXD S;  2FJB A;  3ZMT B;  5IUX A;  2CMR A;  3IHR A;  3NKZ A;  3P4P A;  5FXZ A;  4COF A;  1MIV A;  3A8Y C;  3VKH A;  2L3L A;  2QYW A;  3FHN A;  3N9N A;  4E7Z A;  1VOM A;  3QUJ A;  3FZM B;  2AE9 A;  3MK7 C;  4XZC A;  3KV6 A;  2LRK A;  4H9N C;  1MNE A;  4UEM A;  4EED A;  3HI2 A;  3AE6 A;  5L47 A;  5JRE A;  5IWA T;  5AQL B;  3ZMV B;  2LSJ A;  3TLW A;  2JQH A;  1E1H B;  4HTE A;  4GK0 E;  2V6Y A;  4H9O C;  4I43 B;  3JAF A;  3VRA A;  5J2U E;  3PUR A;  2FJA A;  2YDQ A;  1U4Q A;  2XAH B;  1HFA A;  2BG9 C;  2BG9 E;  3TLT A;  2VL8 A;  4QWN B;  5LMN T;  2BS2 A;  4OFZ A;  3I9W A;  1WFD A;  2W00 A;  2X0H A;  3NZQ A;  4X20 E;  3EDU A;  2ZM8 A;  4AKL A;  3UUX B;  2W67 A;  2WWU A;  1NWM X;  4IE5 A;  3U3I A;  1D0X A;  3QNU A;  3RRW A;  4EYU A;  2QRX A;  2BKO A;  3AA6 B;  3CKD A;  1O3X A;  3KV5 A;  2ZMA A;  4M1P A;  5LNK A;  4TN7 B;  1HX8 A;  3A7M A;  5KDM C;  4DV5 T;  3VU7 H;  3ZMS B;  1JNR A;  1OED E;  3SS1 A;  4BJN A;  5C2T A;  5LG4 A;  2K24 A;  4B6X A;  4CI1 B;  2PG8 A;  3EAM A;  2X9Y A;  5HEJ A;  3J7Y q;  4DV0 T;  1OED A;  2XQ9 A;  3ETU A;  3O1J A;  3KV9 A;  3OYX A;  3EHZ A;  4TV8 E;  4F8H A;  4PK5 A;  3HKC E;  5FYM A;  4DR1 T;  1IBM T;  1SUM B;  4P0A A;  2X0L B;  4EZH A;  3Q5D A;  1IBL T;  3OKQ A;  4P09 A;  2XHE B;  1WR0 A;  3UFG A;  1W9R A;  4JUY A;  4EYY R;  2WU2 A;  2D9D A;  4Z90 A;  5AQO B;  4ZXL A;  2MTQ A;  4DR4 T;  4NUU A;  2CBJ A;  3SOL A;  2DNX A;  2V7M A;  4WZX A;  2UXN B;  1YKE B;  2A9U A;  2V5C A;  3VHL A;  1D0Y A;  3BK9 A;  2IW5 B;  4AKR B;  2EHO D;  4AKG A;  1T8B A;  4JI6 T;  5DQV A;  1WYC A;  5FY0 A;  3P4S A;  3UTK A;  1MMD A;  4CI3 B;  1YKH B;  1D1C A;  1FEW A;  2V6X A;  4MFR A;  4E7S A;  4ZHQ E;  2K3W A;  2V8S V;  5HXE A;  5HWY A;  2VQE T;  4GKK T;  3C4X A;  4B3M T;  3CQC B;  3CML A;  3N2O A;  4X1K E;  5LCY A;  5LJM A;  2XSB A;  4IDN A;  2XM1 A;  1N33 T;  4EIW A;  4DR2 T;  1QUU A;  2MOZ A;  2XAF B;  3AAE B;  3GMI A;  4HWD A;  2MBG A;  2M6B A;  4B3T T;  3NRY A;  4WYV A;  1MMN A;  5BMV E;  1FMW A;  2WMO A;  2W61 A;  5JDL A;  4UXN B;  1ZV4 X;  4WBN E;  1CHU A;  3AVR A;  5C3J A;  4TNV A;  1UUR A;  4PJL A;  4TNW A;  5FNV E;  4TZ4 C;  5LJN A;  5HXS A;  3EI0 A;  3JC6 D;  2CE7 A;  1MIW A;  1KNR A;  4KBM B;  4QXC B;  2WCA A;  4UIG A;  5DJQ C;  3ZLI A;  1ZP0 A;  3FXD B;  2CA5 A;  5L3G B;  4DR3 T;  2XM2 A;  3RHW A;  4PJJ A;  1KNP A;  4KX6 A;  4AQG A;  3IF8 B;  4I4T E;  3DJB A;  4G2A A;  3I1A A;  4GYR A;  4QHO A;  4U2Z A;  2ZM6 T;  4IL9 A;  3CVR A;  3UQ7 A;  4WW0 A;  4AKI A;  2WDQ A;  3K3Q C;  3FB2 A;  1LVK A;  3PV0 F;  5LB7 B;  3ZMU B;  2Z6E A;  3KVB A;  4NPP A;  4KHP T;  4HN9 A;  2Q9Q A;  2FUP A;  3MA9 A;  4B3S T;  3ZC0 A;  3FBL A;  2LSY A;  4U7Y A;  3ONL C;  3PU8 A;  2LSG A;  3MJX A;  3Q9D A;  5DQW A;  4BJM A;  2BG9 B;  2HHH T;  3M65 A;  4LF6 T;  3EAB A;  4NXM T;  2K9A A;  1SE7 A;  4I55 E;  2D0U A;  5LP6 E;  2X9H A;  2E5V A;  1HTJ F;  2W63 A;  5HXC A;  4H9P C;  3A5X A;  2XAJ B;  3ZSS A;  5H6R B;  4DV4 T;  3HA4 A;  2UXD T;  5CJ5 A;  3PJA J;  3ZST A;  2DWK A;  4DUZ T;  1QLB A;  5KMG P;  3F57 A;  2FJD A;  1LRZ A;  2E9X A;  3AAA B;  5JR9 A;  3BQK A;  3MXZ A;  3P4W A;  4IDQ A;  4YXD A;  2W62 A;  4JI7 T;  2WSS V;  4FI5 A;  5ETW A;  2IHR 1;  3AA0 B;  5AQP B;  4U3C A;  5FL1 A;  2OV9 A;  2E9X D;  2W66 A;  2P9B A;  4A97 A;  5KX5 E;  2W2U A;  2H3R A;  3E08 A;  4IE7 A;  2IML A;  4ZEY A;  4YY3 T;  1S35 A;  4YHJ A;  1IZN B;  5FVL A;  4HWF A;  4HGA A;  2LT3 A;  3N2K E;  3PU3 A;  4JEU B;  2BS4 A;  1FMV A;  4ZI7 E;  3H37 A;  3KV4 A;  4ERR A;  3PUS A;  3C98 B;  1JNZ A;  3P4Q A;  4ILU A;  2VWA A;  5AQN B;  4JI2 T;  3SWH A;  2Q9Q D;  5HEH A;  3CX8 B;  3G06 A;  3TKL B;  1SA0 E;  5FXX A;  3IBP A;  5HCM A;  1GQE A;  2PFV A;  3FBZ A;  3DP7 A;  5L3B B;  3GWH A;  4EXT A;  3RYC E;  3P50 A;  1FJG T;  4HE8 A;  3PE0 A;  3U78 A;  5F8P A;  3UUB A;  2KWI B;  4UVB B;  3PUG A;  5HYA A;  4KHZ F;  4JLE A;  2QA7 A;  5HEO A;  5LYJ E;  3WI3 A;  5AQF B;  1YD8 G;  4HFV A;  4MLK A;  2CPT A;  3MKD A;  3ONJ A;  3TLV A;  3H3A A;  3L39 A;  3OPC A;  3ZC1 A;  4PFO A;  2EHO B;  4DV1 T;  4O4L E;  3AXJ B;  2NTY A;  5ABG A;  3RYH E;  1W0A A;  2VAS A;  4AQY T;  4DR6 T;  2VKD A;  3AE2 A;  3O1H A;  3ZYK A;  1WRD A;  2A3D A;  2CLY C;  3ZCI A;  1X79 A;  4HWC A;  3UU6 A;  3AE4 A;  5J1G A;  5ADX L;  2KIN B;  4LF4 T;  3K8P C;  2E8I A;  4MHC A;  5J2T E;  2CXD A;  4U74 A;  2LJL A;  1LKX A;  2X66 A;  3AAI A;  3RGL A;  5JDQ A;  4MAL A;  5LHH B;  1L0V A;  3HL6 A;  1I94 T;  4DID B;  2N2N A;  1HX1 B;  2NTX A;  4HFE A;  3TLS A;  1H7C A;  2XAG B;  4PFP A;  1E7P A;  3OJA A;  3LK2 B;  1UX5 A;  4TV9 E;  2WU5 A;  3RKO A;  3HKE E;  4AQF C;  2H7O A;  4EEB A;  3O4X E;  4ZI3 C;  5LMU T;  1YQ3 A;  2C5J A;  2SPC A;  2XQ7 A;  3C64 A;  2X9W A;  2B76 A;  3AA7 B;  4HWH A;  3RLF F;  3ZN1 B;  5AQT B;  1XNQ T;  2ZM0 A;  3N9Q A;  1HG5 A;  2XAQ B;  4WNK A;  3ZJ2 A;  2CEA A;  3OYZ A;  1BR0 A;  2WDV A;  4UVA B;  1Z8U A;  2WDR A;  4LMJ A;  2XQ3 A;  2XSA A;  2R6G F;  3QOF A;  1DU2 A;  1Y64 B;  3AEE A;  4IST A;  3ZYM A;  2W4X A;  1Y01 A;  3BQL A;  2UUA T;  3D0T A;  3GN5 B;  2MAW A;  3MZK B;  4ZZC A;  1LVF A;  2I0M A;  3CIR A;  4QH5 A;  2OA5 A;  3R6N A;  2EHO A;  2CM0 A;  4IDZ A;  4AXP A;  1WCR A;  5ABF A;  3KIN B;  2X67 A;  4ZZB A;  2A72 A;  3K3N A;  4O2A E;  4ANJ A;  1HR0 T;  3VR9 A;  4U72 A;  2CWY A;  1XDP A;  2CRB A;  3OBV E;  1G8X A;  5AFU L;  5FL0 A;  2WY2 A;  3E0Z A;  1KEY A;  1EZ3 A;  4QXB B;  2UU9 T;  2JQ9 A;  3RIF A;  4C91 A;  5DAB A;  1QSD A;  3T8O A;  2XUE A;  2K5B B;  2JQQ A;  1N32 T;  5JDN A;  5LGN B;  2MPK A;  2XZE A;  4ZI2 D;  3Q5E A;  2X9X A;  3NVO A;  4ILB A;  2HPL A;  4ZOL E;  2ODV A;  3UUN A;  2XQ6 A;  4ISS A;  3RIA A;  4UV9 B;  5JDM A;  4OX9 T;  1ZOY A;  2V26 A;  2WMN A;  3FXE B;  5HEU A;  2H89 A;  2LM9 A;  3CQX C;  4XAX B;  4JV5 T;  3CK6 A;  3PUW F;  4X64 T;  3EVY A;  3ZPO A;  3GA8 A;  2DI4 A;  3PUX F;  4O4J E;  5L3E B;  3AEB A;  4ILC A;  1UUS A;  4CN6 A;  2KMF A;  3ONX A;  4DV2 T;  2E5L T;  2ODU A;  5AQH B;  4U7I A;  3HR0 A;  4DV6 T;  1CUN A;  2NW8 A;  2XQA A;  2DCF A;  2ACX A;  3KFW X;  3N5L A;  5LHI B;  4IGU A;  1ZKE A;  4N78 D;  2NWB A;  4F6R C;  2CCQ A;  2CXL A;  2XAS B;  3MAC A;  3I9Y A;  4X65 T;  5LGU B;  3DTO A;  5L2L A;  4AKH A;  4DVD A;  1IBK T;  4DV7 T;  2LSK A;  3M3Z B;  3LBX A;  1HCI A;  2LKG A;  4HFC A;  3ZCJ A;  2DWG A;  4ZS2 A;  2H7V C;  1UX4 A;  3N9P A;  5FP3 A;  2VL0 A;  3LG7 A;  5EZY E;  3KBU A;  2BBJ A;  5LA6 E;  3AE9 A;  2LRL A;  5FXV A;  3CQG B;  2CBI A;  3P8C D;  4YHH T;  4IDO A;  2M67 A;  3ZJ1 A;  2JJ9 A;  3QK6 A;  4YT0 A;  2JQK A;  5L3F B;  4LF5 T;  2E9X C;  5JR9 C;  3AE8 A;  5JDF A;  1J1J A;  3UU3 A;  2N1G A; 
#chains in the Genus database with same CATH homology
 4UEL A;  2X68 A;  3SRZ A;  2C5K T;  4CXX A;  3UFE A;  4K0U A;  4EAH A;  5LXT E;  5LBQ B;  5CA0 E;  5JVD E;  2CWO A;  1MMA A;  4GYS A;  4DND A;  2MYS A;  2LOS A;  1D1B A;  3ESL A;  4L9I A;  5LHG B;  4CXY A;  2V7J A;  4Z8X A;  2KZ7 B;  4DMV A;  3RPU A;  2CXF A;  3PDY A;  4BAY B;  3PUA A;  1YW0 A;  4BA9 A;  4AI6 A;  3ZN0 B;  4H9R C;  5M4Y A;  4O4I E;  2WBL A;  4L5G A;  2GK9 A;  3CX6 B;  2YU2 A;  3WAK A;  5JDH A;  4YFS A;  4GOU A;  5JH7 E;  3RC3 A;  3E22 E;  4H9S E;  4CQI A;  1WLX A;  3LBX B;  1BR4 A;  3EDV A;  4O2B E;  5LOV E;  1S94 A;  2WM9 A;  5HXR A;  2VK9 A;  4IIJ E;  3PTR B;  1B7T A;  2IAK A;  2XTL A;  4PK4 A;  3B13 A;  2PJQ A;  2ES0 A;  4EB6 E;  3PUQ A;  2V7K A;  2BVM A;  2C5I T;  2QGS A;  2WAU A;  3KVA A;  3LK4 2;  2EHO C;  4EZ4 A;  4GK5 E;  1G73 A;  3AA1 B;  4NUV A;  2A2F X;  5E0O A;  2KT9 A;  2ZM2 A;  1WR6 A;  4X1Y E;  1FIO A;  3O1I A;  4A56 A;  5FY1 A;  5HAX A;  5H6Q B;  4HKA A;  5CB4 E;  2DLR A;  3Q2M A;  5L3C B;  2YK0 A;  2BZB A;  2V7L A;  4PK6 A;  2LOP A;  5HXH A;  4TUY E;  5F3J A;  4UF0 A;  1IJ5 A;  3O9X A;  2I59 A;  3RYF E;  4IE0 A;  3UUL A;  1KNZ A;  2V7I A;  4X1I E;  3JC6 C;  3L3P A;  4ASK A;  1NAF A;  4OYK A;  3IEE A;  2NW7 A;  2G0U A;  3F2E A;  2K48 A;  1WYB A;  4YLH A;  2CLY B;  2NP9 A;  3LK3 B;  3RH3 A;  4H9Q C;  3BQI A;  3J9X 1;  3NRX A;  1V9D A;  4OHF A;  4PW8 A;  2KWH A;  5FMN A;  2RP4 A;  4UV8 B;  5CA1 E;  1MND A;  4I50 E;  4PNI A;  2Y6X A;  3ANW A;  2HPJ A;  2LEH A;  2Q9Q C;  4XBF B;  2X51 A;  3ETV A;  2DHR A;  3ANW B;  4QXH B;  2JMH A;  2YEV C;  3R84 B;  3VKG A;  2L9Q A;  4C90 A;  3N9O A;  1BR2 A;  5GON E;  4KMC A;  2XQY A;  2UXX B;  3K3O A;  3V5U A;  4CI2 B;  3QC9 A;  5LBM A;  2LHR A;  4DO0 A;  2D5U A;  2JMK A;  4IE6 A;  2Q9Q B;  4GIW A;  4AQF A;  4FJO A;  2Y8D A;  2NW9 A;  4KUM B;  4YJ2 E;  1HS7 A;  4H63 H;  3KBT A;  3SS1 A;  1D0Z A;  2IC9 A;  3C51 A;  3CWZ B;  1UCU A;  2NOX A;  4O4H E;  4DBR A;  3I0Q A;  1HF8 A;  5TAO A;  3C4W A;  2L8K A;  2Y48 B;  4ADZ A;  2ZLY A;  1BR1 A;  2JRK A;  4IE4 A;  2J1D G;  2B1E A;  2LE8 A;  4UF0 B;  2BVL A;  3I0O A;  3UUM A;  3RX6 A;  4ZI3 D;  4G63 A;  4TX5 A;  2VB6 A;  3Q5X A;  4WBO A;  2JPF A;  4MBQ A;  3CPZ A;  4KP3 C;  4V1A v;  3Q5W A;  4PJN A;  4QX8 B;  5A1L A;  5JRC B;  4O8S A;  5EK4 A;  4QKN A;  4H63 V;  1ZEE A;  1KK7 A;  3B57 A;  2BDE A;  1AJ3 A;  4L0R A;  4JEH B;  5EK3 A;  3HKD E;  1SHZ C;  3CX7 B;  3HKB E;  3N9M A;  4OK0 A;  1MMG A;  5HWX A;  2LSI A;  5JRC A;  1IAP A;  2E9X B;  2HH7 A;  4QX7 B;  4UVC B;  1U5P A;  2D0T A;  2VKJ A;  5JR9 B;  2YU1 A;  5FY7 A;  2LHN A;  4DMW A;  4EOZ B;  1T98 A;  1US7 B;  4HEA A;  3W15 B;  5LG4 A;  3NZP A;  4ZS3 A;  2IC6 A;  3LFM A;  4PAG A;  3P7I A;  4CXW A;  5JQG E;  2N9D A;  5FXW A;  3ZMZ B;  1IJ6 A;  3RRC A;  3KDS E;  3AB3 B;  3ZYL A;  1ZHC A;  3RYI E;  3ZEF B;  1Z0P A;  1OXZ A;  4DBQ A;  2RA1 A;  3RC8 A;  3NBX X;  2W0G A;  5IHY A;  4PJM A;  2V1D B;  3AVS A;  1HG2 A;  1OWA A;  3GN5 A;  1D1A A;  4CZZ B;  5C8Y E;  2KXP B;  3L09 A;  2KND A;  3EUH A;  4YJ3 E;  5L3D B;  5IYZ E;  2PBI A;  2C0S A;  3C4Z A;  3V5S A;  2VKO A;  5EK2 A;  5JDG A;  3LJC A;  3C50 A;  3F31 A;  4ZI2 C;  4IHJ E;  4P0B A;  3WAJ A;  5LGT B;  1MIY A;  2KLQ A;  3N2G E;  2D2S A;  2YIN A;  4OYJ A;  2VKH A;  4J2C A;  3N9L A;  3S4U A;  3UT5 E;  1VRB A;  3ZMT B;  2CMR A;  3IHR A;  5FXZ A;  1MIV A;  3VKH A;  2L3L A;  4E7Z A;  3FHN A;  3N9N A;  1VOM A;  3QUJ A;  3MK7 C;  4XZC A;  3KV6 A;  4UEM A;  4H9N C;  1MNE A;  5JRE A;  3HI2 A;  3ZMV B;  2LSJ A;  1E1H B;  4HTE A;  4GK0 E;  4I43 B;  4H9O C;  5J2U E;  3PUR A;  1U4Q A;  2XAH B;  1HFA A;  2VL8 A;  4QWN B;  4OFZ A;  3I9W A;  3NZQ A;  2W00 A;  4X20 E;  4AKL A;  3EDU A;  2ZM8 A;  3UUX B;  2WWU A;  1NWM X;  4IE5 A;  3U3I A;  1D0X A;  3RRW A;  4EYU A;  3AA6 B;  3CKD A;  1O3X A;  3KV5 A;  2ZMA A;  4M1P A;  5LNK A;  4TN7 B;  1HX8 A;  5KDM C;  3VU7 H;  3ZMS B;  4BJN A;  2K24 A;  4B6X A;  4CI1 B;  2PG8 A;  2X9Y A;  3J7Y q;  3O1J A;  3ETU A;  3KV9 A;  3OYX A;  4TV8 E;  4PK5 A;  3HKC E;  5FYM A;  4P0A A;  2X0L B;  4EZH A;  3OKQ A;  4P09 A;  2XHE B;  5LGN B;  4EYY R;  4JUY A;  2MTQ A;  4NUU A;  3SOL A;  2DNX A;  2V7M A;  2UXN B;  1YKE B;  3VHL A;  4AKR B;  4AKG A;  1D0Y A;  3BK9 A;  2IW5 B;  2EHO D;  5DQV A;  1WYC A;  5FY0 A;  3UTK A;  1MMD A;  4CI3 B;  1YKH B;  1D1C A;  1FEW A;  4MFR A;  4E7S A;  4ZHQ E;  5HWY A;  3C4X A;  3CQC B;  3CML A;  3N2O A;  4X1K E;  5LCY A;  5LJM A;  4EIW A;  1QUU A;  2MOZ A;  2XAF B;  3AAE B;  3GMI A;  2MBG A;  3NRY A;  1MMN A;  5BMV E;  1FMW A;  2WMO A;  2W61 A;  5JDL A;  4UXN B;  1ZV4 X;  4WBN E;  3AVR A;  4PJL A;  5FNV E;  4TZ4 C;  5LJN A;  5HXS A;  3JC6 D;  2CE7 A;  1MIW A;  4KBM B;  4QXC B;  4UIG A;  5DJQ C;  3ZLI A;  5L3G B;  3FXD B;  2CA5 A;  4PJJ A;  4AQG A;  3IF8 B;  4I4T E;  3DJB A;  4G2A A;  3I1A A;  4GYR A;  4QHO A;  3CVR A;  4AKI A;  4WW0 A;  3K3Q C;  3FB2 A;  1LVK A;  3ZMU B;  2Z6E A;  3KVB A;  4HN9 A;  2Q9Q A;  3MA9 A;  3ZC0 A;  3FBL A;  2LSY A;  3PU8 A;  2LSG A;  3MJX A;  3Q9D A;  5DQW A;  4BJM A;  3M65 A;  2K9A A;  4I55 E;  2D0U A;  5LP6 E;  2X9H A;  1HTJ F;  2W63 A;  5HXC A;  4H9P C;  3A5X A;  2XAJ B;  5H6R B;  3HA4 A;  2DWK A;  5KMG P;  3F57 A;  1LRZ A;  2E9X A;  3AAA B;  5JR9 A;  3BQK A;  3MXZ A;  2W62 A;  2WSS V;  4FI5 A;  5ETW A;  3AA0 B;  2E9X D;  2P9B A;  5KX5 E;  2H3R A;  3E08 A;  4IE7 A;  1S35 A;  4YHJ A;  1IZN B;  4HGA A;  2LT3 A;  3N2K E;  3PU3 A;  4JEU B;  1FMV A;  4ZI7 E;  3H37 A;  3KV4 A;  4ERR A;  3PUS A;  3C98 B;  4ILU A;  2VWA A;  3SWH A;  2Q9Q D;  3CX8 B;  3TKL B;  1SA0 E;  5FXX A;  3IBP A;  5L3B B;  2PFV A;  3FBZ A;  3DP7 A;  3GWH A;  4EXT A;  3RYC E;  4HE8 A;  3PE0 A;  3U78 A;  5F8P A;  2KWI B;  4UVB B;  3PUG A;  5HYA A;  5LYJ E;  4JLE A;  2QA7 A;  3WI3 A;  1YD8 G;  4HFV A;  4MLK A;  3MKD A;  3ZC1 A;  3H3A A;  4PFO A;  2EHO B;  4O4L E;  2NTY A;  3RYH E;  2VAS A;  2VKD A;  3O1H A;  3ZYK A;  1WRD A;  2A3D A;  2CLY C;  3ZCI A;  1X79 A;  5J1G A;  5ADX L;  2KIN B;  3K8P C;  2E8I A;  4MHC A;  5J2T E;  2CXD A;  4U74 A;  2LJL A;  1LKX A;  2X66 A;  3AAI A;  5JDQ A;  4MAL A;  5LHH B;  3HL6 A;  2N2N A;  2NTX A;  1H7C A;  2XAG B;  4PFP A;  3OJA A;  3LK2 B;  1UX5 A;  4TV9 E;  3RKO A;  4AQF C;  3HKE E;  2H7O A;  3O4X E;  4ZI3 C;  3C64 A;  2C5J A;  2SPC A;  5HXE A;  3ZN1 B;  2X9W A;  3AA7 B;  2ZM0 A;  3N9Q A;  1HG5 A;  2XAQ B;  4WNK A;  3ZJ2 A;  2CEA A;  3OYZ A;  1BR0 A;  4UVA B;  1Y64 B;  4IST A;  3ZYM A;  3BQL A;  3D0T A;  3GN5 B;  3MZK B;  1LVF A;  2OA5 A;  3R6N A;  2EHO A;  2CM0 A;  4IDZ A;  4AXP A;  3KIN B;  2X67 A;  2A72 A;  3K3N A;  4O2A E;  4ANJ A;  4U72 A;  2CWY A;  3OBV E;  1G8X A;  5AFU L;  3E0Z A;  4QXB B;  1EZ3 A;  4C91 A;  5DAB A;  1QSD A;  3T8O A;  2XUE A;  2K5B B;  2JQQ A;  5JDN A;  4ZI2 D;  2X9X A;  2HPL A;  4ZOL E;  2ODV A;  3UUN A;  4ISS A;  5JDM A;  4UV9 B;  2V26 A;  2WMN A;  3FXE B;  2LM9 A;  3CQX C;  4XAX B;  3EVY A;  3ZPO A;  3GA8 A;  2DI4 A;  4O4J E;  5L3E B;  2KMF A;  3ONX A;  2ODU A;  3HR0 A;  1CUN A;  2NW8 A;  5LHI B;  2DCF A;  2ACX A;  3KFW X;  3N5L A;  4IGU A;  1ZKE A;  4N78 D;  2NWB A;  4F6R C;  2CCQ A;  2CXL A;  2XAS B;  3MAC A;  3I9Y A;  5LGU B;  3DTO A;  5L2L A;  4AKH A;  4DVD A;  2LSK A;  3LBX A;  1HCI A;  3ZCJ A;  2DWG A;  4ZS2 A;  2H7V C;  1UX4 A;  3N9P A;  5FP3 A;  3LG7 A;  5EZY E;  3KBU A;  5LA6 E;  5FXV A;  3CQG B;  3P8C D;  2M67 A;  3ZJ1 A;  2JJ9 A;  3QK6 A;  5L3F B;  2E9X C;  5JR9 C;  5JDF A;  2N1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...