3LBXA

Crystal structure of the erythrocyte spectrin tetramerization domain complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
140
structure length
140
Chain Sequence
ETAEEIQERRQEVLTRYQSFKERVAERGQKLEDSYHLQVFKRDADDLGKWIMEKVNILTDKSYEDPTNIQGKYQKHQSLEAEVQTKSRLMSELEKTREERFTMGHSAHEETKAHIEELRHLWDLLLELTLEKGDQLLRAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and functional interpretation of the erythrocyte spectrin tetramerization domain complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Spectrin alpha chain, erythrocyte
total genus 56
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2010-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00435 Spectrin Spectrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.60 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3lbxA00
3UULA 1U5PA 3EDVA 1S35A 2ODVA 3LBXA 3UUNA 1QUUA 3LBXB 3FB2A 1WLXA 1HCIA 1CUNA 3F31A 3UUMA 1AJ3A 1OWAA 3PE0A 2SPCA 1U4QA 2ODUA
chains in the Genus database with same CATH superfamily
2H3RA 4F6RC 3IA3A 2DWKA 3AEAA 3P8CD 2ZM0A 4XZCA 3TLWA 5IWAT 2ZMAA 3MJXA 1JNZA 3BQKA 3Q9DA 3HI2A 3AE6A 3H37A 3AEGA 1IJ5A 3JC6C 4IL9A 3AE5A 3CKDA 4X62T 3TLTA 5JQGE 2LLYA 4HKAA 4V1Av 4CN4A 4B3TT 2JIWA 2CM0A 3R6NA 4AQGA 1EZ3A 3LBXB 1MIWA 3C64A 3A8YC 1N36T 1WLXA 4HN9A 1YD8G 1L0VA 1D0ZA 1G73A 5AQOB 2VB6A 3PJAJ 3RIUC 2VVSA 2CLYC 2KNDA 3T8OA 3JADA 4IDNA 5AQGB 2E9XA 2X0YA 3FZFB 1UUSA 1HG2A 4CI3B 3ZC0A 3B13A 1JNRA 2ACXA 3QOFA 4H9NC 3QB5A 3RRWA 3KVAA 2FJBA 1OEDA 3RI5A 4B6XA 1XMOT 3AE1A 3HA4A 3SRZA 4I0UA 4JI1T 4U7IA 4YY3T 2X0HA 2LT3A 2MOZA 5HAXA 5LCYA 3WAKA 4LF8T 5LHGB 2UU9T 4O8SA 2NOXA 2KWIB 3I9YA 3QUJA 4X5TA 1ZV4X 4X1IE 4JUYA 3ETVA 5LBQB 3AA7B 2N2NA 1ZOYA 3PUSA 4HFEA 4HWIB 4WYVA 1YQ3A 2RPAA 4QWNB 1UK5A 4P0BA 3RKOA 4OX9T 4PK6A 4JEUB 4N78D 4PJLA 5LMNT 2VWAA 1MMNA 4AKHA 4YHHT 2D9DA 3LK42 3NRXA 2CBIA 1NAFA 4QH5A 4LF4T 3AAAB 2LKHA 4CXYA 3BQIA 3ANWB 5JRCA 5E0OA 2X9WA 2A2FX 3CQGB 2CCQA 2IAKA 5FVLA 3ESLA 4YHJA 2Y6XA 4JEHB 3HR0A 3SOLA 4DO0A 5L3FB 4H9QC 3WAJA 2LE8A 2J47A 5HXRA 3RRCA 2LHRA 3PUGA 2DHRA 2LSJA 4TX5A 3E0ZA 5EK3A 1SA0E 4HFCA 5FMNA 2PJQA 2V7JA 3FXDB 2A72A 5LG4A 2BKOA 2NWBA 3WI3A 2ZLYA 3UUNA 4YT0A 4JV5T 2BZBA 1YKHB 2D0UA 2LM2A 2BKNA 2YDQA 2EHOC 2G0UA 1MMAA 1YKEB 3ZYKA 4U2ZA 3RGLA 4ZI7E 3C51A 3DJBA 2HPJA 3K8PC 1ZP0A 2NW7A 4LMKA 2EHOA 4MFRA 4P1NA 4UVCB 4QXCB 5HXCA 4PJJA 5IHYA 4AIUA 2BS3A 1N34T 3CQXC 2Q9QB 2HHHT 1DU2A 5AQKB 4IHJE 4NUVA 5L3EB 4EGWA 3AE2A 5DJQC 4IE5A 4ERRA 1HX8A 4DMVA 2XM1A 4U31A 1BR4A 1MNEA 3N9OA 2CXDA 3PE0A 4ILAA 2W63A 3N9QA 3X1DA 4JI7T 3UUBA 1KNZA 2BVMA 3NBXX 1W09A 3N9NA 2C5KT 2CMRA 4NUUA 3FBLA 2LSKA 5AQHB 4CXXA 2VKJA 3RYCE 3RYHE 5BMVE 5LG3A 4DV2T 5AQSB 2WY2A 5L3DB 2I0MA 3NKZA 3RIUA 5HXSA 2W61A 2Y48B 3NWIA 4YSXA 1W0BA 3E22E 2LEHA 4JI6T 1N33T 3MKDA 4K0KT 2A3DA 1IAPA 5HWXA 3P4QA 5LA6E 3AEEA 1O3XA 5HCJA 1NWMX 1FJGT 2FJEA 3JC6D 2C0SA 3OYXA 1VOMA 3UFGA 4TV9E 2N1GA 2ZM6T 3RC8A 2BDEA 3Q5EA 2X9XA 4EYUA 4LF6T 3VKGA 1XZYA 4CZZB 2CHOA 1Y64B 3S4UA 1HFAA 3VHLA 2C5IT 2XQ8A 2P9BA 2WDRA 3FZMB 3P7IA 3ZLIA 1FIOA 1NEKA 2W0GA 2XSBA 2PG8A 2KINB 1MMDA 3HKEE 5AQLB 2DLRA 5AQMB 5CA1E 3F2EA 2F4VT 3CMLA 1UX4A 2V7KA 2W62A 3JCFA 5JDGA 4LF5T 5A1LA 5HEJA 1U5PA 4I50E 5FXZA 1X79A 2J1DG 4F8HA 1H7CA 2QYWA 4OYKA 2VVNA 5LB7B 4JBWF 5IYZE 2L3LA 1IZNB 2WQYA 3MA9A 2X9YA 1WFDA 5FP3A 4HFIA 3PU8A 1WR0A 4UF0A 5HEGA 1KNPA 3ABVA 3UFEA 3ZT6A 4YJ2E 4GKJT 1UGOA 3AECA 1IJ6A 2XPKA 3HKCE 4X1YE 4J2CA 4HGAA 4AKLA 1KK7A 2JQ9A 3GMIA 1KNRA 2N9DA 2ZM8A 5HEUA 1LVKA 3UUXB 5KXJA 4ILCA 1J1JA 3SFEA 4DV1T 4EOZB 4I4TE 3HL6A 4B3MT 3VR9A 4YTNA 1HX1B 2CRBA 5HEHA 3CX8B 2Y8DA 4GOUA 5AFUL 1D0XA 1HG5A 4DMWA 3P4PA 2D0TA 5JR9A 3UTKA 5DQVA 2WZIA 1YXRA 3AE4A 2V5CA 3FZLB 3I0QA 3Q5WA 2CPTA 3LBXA 2V7LA 3AVSA 3FZHB 4Z90A 4CQIA 2KLQA 5JREA 4DR5T 2E5LT 3G06A 4U3CA 3RYFE 4HWCA 5HXEA 2IMLA 3RIFA 2BS2A 1HCIA 3EHZA 3AB3B 3FB2A 3OBVE 3ZCJA 4ASKA 3ZJ2A 4BA9A 3N2OA 4EYYR 3N9LA 5HXHA 4A97A 4LFCT 2CXLA 2PBIA 3ZEFB 4HFBA 2Z6EA 2XM2A 3ONLC 4IE7A 4O4JE 5H6RB 4ZOLE 3OVUA 3RHWA 3AA0B 4EAHA 4EV6A 2DL1A 2UUCT 3QNUA 2Q9QA 3PUWF 4O4IE 4QXBB 2WU5A 3ZYLA 4QH4A 4DBRA 1XDOA 2SPCA 3EAMA 3FZKB 3I9WA 2BG9E 4IIJE 5L3CB 2JRKA 2V26A 5IUXA 2KWHA 4EEDA 5M4YA 2IUBA 2XQAA 4O2AE 1I94T 3UU8A 4O2BE 4H9OC 4UVBB 4ZZBA 2D5UA 1HNWT 3QK6A 2XASB 3AA1B 2V7MA 2NTXA 5AQNB 5HWYA 3MXZA 1SHZC 3I0OA 2JMKA 4IDZA 4Z91A 2NW9A 4U2YA 5LGTB 3RQUA 2PTFA 2AE9A 5J1GA 2WWUA 3OKQA 2R6GF 4DR4T 1Z8UA 3N9PA 3LFMA 4LMLA 4UR9A 1MNDA 4DR3T 4UVAB 4YJ3E 4ZHQE 3ZPOA 3JAEA 3J7Yq 4DV0T 4TZ4C 2V8SV 3KDSE 5L4HA 3DTOA 1N32T 1OWAA 2JQHA 1B7TA 2VQET 2Q9QC 3AA6B 5JDFA 4DVDA 3U3IA 3ETUA 4ADZA 2UUAT 2RA1A 4H63H 2OLTA 3C4XA 3LG7A 5TAOA 3SS1A 1OXZA 5ABFB 3KV6A 3PUQA 2XQ9A 2X66A 4IL4A 4QXHB 3BK9A 4XBFB 3KBUA 1M7KA 3PURA 4QX8B 5LHIB 2UUBT 4HWFA 5JDMA 5EZYE 5FL0A 4DNDA 3RH3A 3VRBA 3AXJB 4ISSA 4G2AA 2XAFB 1BR2A 4H9RC 2XUEA 2WBLA 5ETWA 4E7ZA 3ZMZB 4DR2T 2QRXA 2NP9A 3MZKB 4NXMT 2XY8B 4UF0B 4E7SA 1IBMT 4EZHA 5J0ZA 2IC6A 4U72A 5C2TA 2V6YA 1D1AA 2YINA 3ZYMA 5LBMA 2WZHA 1KF6A 3LDQB 4ZEYA 2V6XA 3F31A 3QB5K 4WBNE 1YQ4A 5ADXL 3VU7H 2UXCT 1UX5A 2CWOA 2XQ6A 5DQWA 5FXXA 4A98A 1T8BA 2XTLA 3N5LA 3R84B 4ZI2D 2ODUA 1S94A 4M1PA 1MIVA 2DCFA 2ZM2A 3C4WA 2XJ7A 3CX6B 4UIGA 4Z8XA 3ZMTB 1HNXT 3H3AA 3UU6A 4DUYT 2V1DB 2LJLA 3AEDA 4CN1A 3N2KE 4JI4T 1GQEA 1S35A 2W2UA 2NW8A 4AQYT 4FJOA 4IE6A 2AXDS 3VR8A 4EB6E 4LF7T 1WYCA 3K3OA 1SUMB 2VL8A 3ONJA 5FY1A 1XNRT 4TWFA 4X64T 2KZ7B 2DWGA 5AQVB 4MLKA 2DNXA 2LSGA 4BJMA 2WSSV 4X20E 4HFHA 2JQQA 1LVFA 3EI0A 4QKNA 2JQKA 4KI0F 4NIQA 5JR9C 2KMFA 5ABHA 4G63A 4ZXLA 3EDUA 3CPZA 3D0TA 2VURA 2E9XD 1NENA 2YDSA 3UUMA 2PFVA 4LF9T 2QGSA 4IT4A 4CI2B 4DR6T 5ABFA 2WAUA 4IDQA 4HEAA 2ES0A 1U4QA 2CXFA 3LSVA 2K9AA 3GWHA 2WDQA 3KV9A 1KEYA 2CA5A 4JLEA 4YXDA 4DV5T 3CX7B 5LOVE 3RPUA 3TLVA 4K0UA 1W0AA 2YKSA 3TLSA 5JDLA 1Z0PA 5JH7E 5LMUT 3IEEA 5DABA 4XAXB 5AQPB 1QUUA 2BVLA 2EHOB 4O4LE 3GN5B 3M3ZB 5CFBA 1XNQT 2CBJA 2XAHB 2IHR1 2XQ3A 4PK5A 4X65T 3T1YT 1MIYA 2LSYA 3I1AA 1T72A 2NR4A 2VK9A 4EXTA 2YU1A 2DI4A 2XAQB 5C8YE 3OYZA 5ABEA 3TLUA 5AQIB 4EEBA 3IBPA 3KV4A 4ZZCA 3OJAA 1FMVA 4H9PC 4AQFA 3V5UA 3P4WA 3N2GE 2H7VC 3EABA 4DV4T 5H6QB 5EK4A 4X66T 4KHZF 5JVDE 5FYMA 1OEDB 2WMOA 4TWDA 3ZSSA 2VASA 3KFWX 1D1CA 2BS4A 2MYSA 3AAEB 3AE7A 3AE8A 2WP9A 3IHRA 3PTRB 4ZI3D 4ANJA 3O9XA 4NXNT 2VL0A 2CLYB 3PUVF 4U7YA 2BG9B 3KV5A 4L9IA 3RQWA 4AKIA 4U33A 4X1KE 1G8XA 4IGUA 5JDHA 2IIUA 2VKOA 3AE9A 4WW0A 4BAYB 5FY0A 1CUNA 3K3QC 5C3JA 5AQUB 3L09A 3EVYA 4EZ4A 5LYJE 2LOSA 4IE0A 1XWMA 2WS3A 2UXDT 1UURA 4TV8E 1IBKT 2MBGA 4ISTA 4I43B 5LHHB 2V6YB 2YEVC 3L8RA 4KHPT 2BBHA 2LKGA 2JMHA 2MTQA 2J4GA 2L9QA 2BKPA 4ILBA 3VKHA 1QLBA 3PUAA 3RLFF 3KVBA 3QC9A 4QHOA 3RYIE 4GK5E 3ZN0B 3GA8A 3L39A 3T1HT 4PK4A 4KX6A 4P0AA 5F5WA 4OHFA 3UQ4A 5LJMA 3LJCA 2X9HA 2XSAA 1WYBA 2HN1A 3EDVA 3GN5A 2L8KA 3FBZA 3PUYF 3HKDE 3J9X1 3NZPA 1HF8A 2MAWA 4DR1T 4JI5T 1WCRA 3L3PA 3PDYA 4HWDA 2M6IA 2I59A 4A5XA 4C90A 3CIRA 4YSYA 5HYAA 4C91A 1ZHCA 4IE4A 2X51A 3N9MA 1UCUA 4UV8B 5FL1A 2C5JA 1Y01A 4HE8A 3A7MA 2BG9C 2WDVA 2YDRA 4YLHA 4YTMA 4AKGA 3NVOA 4LFAT 2HPLA 3JAFA 3O1JA 3B57A 4PNIA 5CB4E 4KP3C 1XMQT 2BG9A 5FXWA 1VRBA 1XDPA 4AI6A 1FMWA 4GKKT 4DV7T 5FNVE 3FHNA 2OV9A 1HTJF 3SWHA 3ZJ1A 4DV3T 3NRYA 3OPCA 2FUPA 2WU2A 2KXPB 3AEFA 5L47A 4GIWA 5GONE 2LRKA 5JR9B 3PV0F 2LSIA 2B76A 2YN6A 3C4ZA 5L3BB 2XAGB 2JJ9A 1W9RA 3E08A 4GK0E 4IDPA 4P09A 3ZC1A 1WRDA 2W67A 2WCAA 3C50A 3F57A 2YK0A 4QH1A 4UXNB 3ZCIA 4AISA 4OFZA 1VCSA 5F8PA 2CEAA 3A5XA 4MALA 4TNVA 2X68A 4WNKA 3RC3A 3KINB 2E5VA 3KBTA 3P4SA 2M67A 5AQJB 1US7B 3B5MA 2UXNB 5FXVA 3PU3A 2BBJA 4PFOA 4COFA 4WBOA 4HTEA 4YSZA 1D0YA 4L0RA 3RKGA 4PJNA 3U78A 4JI8T 4OK0A 5FKYA 3RX6A 5CA0E 2WWVA 5KX5E 2CHNA 2EHOD 3Q2MA 1MMGA 2B1EA 4LFBT 4DIDB 3HKBE 4B3ST 1LRZA 1VCTA 2D2SA 2OA5A 1WR6A 5LNKA 2K48A 5L3GB 1E2AA 3Q5DA 4TNWA 1AJ3A 3ZT5A 3ANWA 3RF1A 1J5ET 5JTGA 1YW0A 5JRCB 2RP4A 1OEDE 2CWYA 1V9DA 2K5BB 3P4RA 4HFVA 4LMJA 5HEOA 5AQFB 3UULA 4ZI3C 2UXBT 4UEMA 3OTOT 4QX7B 3BQLA 2HN2A 1HS7A 5JDNA 3LK2B 1ZEEA 2YOEA 3UT5E 2IW5B 3AVRA 4UELA 4PAGA 2NTYA 4MBQA 2XQ7A 1QSDA 4PFPA 5LGNB 3UQ7A 4OYJA 1I6ZA 4O4HE 4CN6A 3W15B 5FY7A 2CE7A 4CI1B 4NPPA 2E9XB 5L4EA 4JYAT 1HNZT 2KSRA 4DBQA 3AXJA 3CK6A 5F3JA 2HH7A 4IDOA 1KFYA 1T7SA 4KUMB 1FEWA 3ZT7A 3ZMVB 4H63V 3UU3A 2W4XA 2WB5A 1LKXA 2ACZA 4ZS2A 2VKHA 4TN7B 3UU5A 4CXWA 4DR7T 3K3NA 4WZXA 3RIAA 5KMGP 4IREA 1E1HB 2WM9A 2FJAA 1X9BA 5L2LA 2Q9QD 3MK7C 3Q5XA 4U74A 4JI0T 2XZEA 2W66A 1J5WA 2QA7A 2XAJB 3MACA 3CQCB 4PW8A 3TKLB 4JI2T 4DUZT 1SE7A 2YU2A 5KDMC 1D1BA 2E2AA 3ZMUB 4YFSA 2KT9A 5CJ5A 4JI3T 2V7IA 2V5DA 1E7PA 3CVRA 1M62A 3H3MA 5AQQB 3ZMSB 4HFDA 4TWHA 3PUZF 4ZI2C 5LP6E 3EUHA 3SFDA 3V5SA 5FVKA 1BR0A 3PUXF 3NZQA 4L5GA 3ZKRA 5JDQA 2XQYA 4EIWA 5LGUB 4AXPA 1IBLT 5ABGA 2IDOB 1CHUA 2UXXB 2X0LB 1BR1A 5LXTE 2FJDA 2J62A 5LJNA 2VKDA 3O1IA 3P50A 5AQRB 5EK2A 1R8IA 3AE3A 3M65A 4HWHA 4H9SE 3VRAA 2WMNA 4A56A 3AEBA 2JPFA 3LK3B 4KMCA 2LM9A 2FBWA 4KBMB 3ZSTA 3DP7A 3K1SA 1HR0T 4ILUA 1ZKEA 2ODVA 3IF8B 2LOPA 4TUYE 5BR8T 3ZN1B 4AKRB 5J2UE 3O4XE 2I6HA 4DV6T 4Q25A 2E9XC 2W00A 4BJNA 2K3WA 4I55E 2IC9A 3UU4A 4UV9B 2E8IA 2XQ4A 3ONXA 5HCMA 4YTPA 2GK9A 1OEDC 2H7OA 2H89A 3O1HA 4FI5A 2VQFT 4MHCA 2XQ5A 5CGMA 1T98A 2K24A 2MPKA 3PJAA 2XHEB 4ZS3A 3C98B 2A9UA 4PJMA 4GYRA 2QVAA 2H88A 2M6BA 3CWZB 3FXEB 4GYSA 2X67A 2LHNA 4AQFC 5J2TE 4B3RT 5AQTB 3AAIA 2LRLA
chains in the Genus database with same CATH topology
2H3RA 4F6RC 2DWKA 3P8CD 4XZCA 2ZM0A 2ZMAA 3MJXA 3BQKA 3Q9DA 3HI2A 3H37A 3JC6C 1IJ5A 3CKDA 5JQGE 4HKAA 4V1Av 2CM0A 3R6NA 4AQGA 1EZ3A 3LBXB 1MIWA 3C64A 1WLXA 4HN9A 1YD8G 1D0ZA 1G73A 2VB6A 3T8OA 2CLYC 2KNDA 2E9XA 1HG2A 4CI3B 3ZC0A 3B13A 2ACXA 4H9NC 3RRWA 3KVAA 4B6XA 3SRZA 3HA4A 2LT3A 2MOZA 5HAXA 5LCYA 3WAKA 5LHGB 4O8SA 2NOXA 2KWIB 3I9YA 3QUJA 1ZV4X 4X1IE 4JUYA 3ETVA 5LBQB 3AA7B 2N2NA 3PUSA 4QWNB 4P0BA 3RKOA 4PK6A 4JEUB 4N78D 4PJLA 2VWAA 1MMNA 4AKHA 3LK42 3NRXA 1NAFA 3AAAB 4CXYA 3BQIA 3ANWB 5JRCA 5E0OA 2X9WA 2A2FX 3CQGB 2CCQA 2IAKA 3ESLA 4YHJA 2Y6XA 4JEHB 3HR0A 3SOLA 4DO0A 5L3FB 4H9QC 3WAJA 2LE8A 5HXRA 3RRCA 2LHRA 3PUGA 2DHRA 2LSJA 4TX5A 3E0ZA 5EK3A 1SA0E 2PJQA 2V7JA 3FXDB 2A72A 5LG4A 2NWBA 3WI3A 2ZLYA 3UUNA 2BZBA 1YKHB 2D0UA 2EHOC 2G0UA 1MMAA 1YKEB 3ZYKA 4ZI7E 3C51A 3DJBA 2HPJA 3K8PC 2NW7A 4UVCB 2EHOA 4MFRA 5IHYA 5HXCA 4QXCB 4PJJA 3CQXC 2Q9QB 4IHJE 4NUVA 5L3EB 4ERRA 5DJQC 4IE5A 1HX8A 4DMVA 1BR4A 1MNEA 3N9OA 2CXDA 3PE0A 1KNZA 2W63A 3N9QA 2BVMA 3NBXX 3N9NA 2C5KT 2CMRA 4NUUA 3FBLA 2LSKA 4CXXA 2VKJA 3RYCE 3RYHE 5BMVE 5L3DB 5HXSA 2W61A 2Y48B 3E22E 2LEHA 3MKDA 2A3DA 1IAPA 5HWXA 5LA6E 1O3XA 1NWMX 3JC6D 2C0SA 3OYXA 1VOMA 4TV9E 2N1GA 3RC8A 2BDEA 4EYUA 2X9XA 3VKGA 4CZZB 1Y64B 3S4UA 1HFAA 3VHLA 2C5IT 2P9BA 3ZLIA 3P7IA 1FIOA 3HKEE 2W0GA 5FMNA 2PG8A 2KINB 1MMDA 2DLRA 5CA1E 3F2EA 3CMLA 1UX4A 2V7KA 2W62A 5JDGA 5A1LA 1U5PA 4I50E 5FXZA 1X79A 2J1DG 1H7CA 4OYKA 5IYZE 2L3LA 1IZNB 3MA9A 5FP3A 2X9YA 3PU8A 4UF0A 3UFEA 4YJ2E 1IJ6A 3HKCE 4X1YE 4J2CA 4HGAA 4AKLA 1KK7A 3GMIA 2N9DA 2ZM8A 1LVKA 3UUXB 4EOZB 4I4TE 3HL6A 3CX8B 2Y8DA 4GOUA 5AFUL 1D0XA 1HG5A 4DMWA 3UTKA 2D0TA 5JR9A 5DQVA 3I0QA 3Q5WA 4CQIA 3LBXA 2V7LA 3AVSA 5JREA 2KLQA 3RYFE 5HXEA 3OBVE 1HCIA 3FB2A 3AB3B 4ASKA 3ZCJA 4BA9A 4EYYR 3ZJ2A 4CI1B 3N2OA 5HXHA 3N9LA 2CXLA 2PBIA 3ZEFB 2Z6EA 4IE7A 4O4JE 5H6RB 4ZOLE 3AA0B 4EAHA 2Q9QA 4O4IE 4QXBB 3ZYLA 4DBRA 2SPCA 3I9WA 5L3CB 4IIJE 2JRKA 2V26A 2KWHA 5M4YA 4O2AE 4O2BE 4H9OC 4UVBB 2D5UA 3QK6A 2XASB 3AA1B 2V7MA 2NTXA 5HWYA 3MXZA 1SHZC 3I0OA 2JMKA 4IDZA 2NW9A 5LGTB 5J1GA 2WWUA 3OKQA 3N9PA 3LFMA 1MNDA 4UVAB 4YJ3E 4ZHQE 3ZPOA 3J7Yq 4TZ4C 3KDSE 3DTOA 1OWAA 1B7TA 2Q9QC 3AA6B 5JDFA 4DVDA 3U3IA 3ETUA 4ADZA 2RA1A 4H63H 3C4XA 5TAOA 3LG7A 3SS1A 1OXZA 3KV6A 3PUQA 4XBFB 2X66A 4QXHB 3BK9A 3KBUA 3PURA 4QX8B 5LHIB 5JDMA 5EZYE 4DNDA 3RH3A 4ISSA 5ETWA 4G2AA 2XAFB 1BR2A 4H9RC 2XUEA 2WBLA 4E7ZA 3ZMZB 2NP9A 3MZKB 4UF0B 4E7SA 4EZHA 2IC6A 4U72A 1D1AA 2YINA 3ZYMA 5LBMA 3F31A 4WBNE 5ADXL 3VU7H 1UX5A 2CWOA 5DQWA 5FXXA 2XTLA 3N5LA 3R84B 4ZI2D 2ODUA 1S94A 4M1PA 1MIVA 2DCFA 2ZM2A 3C4WA 4UIGA 3CX6B 4Z8XA 3ZMTB 3H3AA 2V1DB 2LJLA 3N2KE 1S35A 2NW8A 4FJOA 4IE6A 4EB6E 1WYCA 3K3OA 2VL8A 5FY1A 2KZ7B 2DWGA 4MLKA 2DNXA 2LSGA 4BJMA 2WSSV 4X20E 2JQQA 1LVFA 4QKNA 5JR9C 2KMFA 4G63A 3EDUA 3CPZA 3D0TA 2E9XD 3UUMA 2PFVA 2QGSA 4CI2B 2WAUA 4HEAA 2ES0A 1U4QA 2CXFA 2K9AA 3GWHA 3KV9A 2CA5A 4JLEA 3CX7B 5LOVE 3RPUA 5JDLA 4K0UA 1Z0PA 5JH7E 3IEEA 5DABA 4XAXB 1QUUA 2BVLA 2EHOB 4O4LE 3GN5B 2XAHB 4PK5A 1MIYA 2LSYA 3I1AA 2VK9A 4EXTA 2YU1A 2DI4A 2XAQB 5C8YE 3OYZA 3IBPA 3KV4A 3OJAA 1FMVA 4H9PC 4AQFA 3V5UA 3N2GE 2H7VC 5H6QB 5EK4A 5JVDE 5FYMA 2WMOA 2VASA 3KFWX 1D1CA 2MYSA 3AAEB 3O9XA 3IHRA 3PTRB 4ZI3D 4ANJA 2CLYB 4L9IA 3KV5A 4AKIA 5JDHA 4X1KE 1G8XA 4IGUA 2VKOA 4WW0A 4BAYB 5FY0A 1CUNA 3K3QC 3L09A 3EVYA 4EZ4A 5LYJE 2LOSA 4IE0A 4TV8E 2MBGA 4ISTA 4I43B 5LHHB 2YEVC 2JMHA 2MTQA 3VKHA 2L9QA 3PUAA 3KVBA 3QC9A 4QHOA 3RYIE 4GK5E 3ZN0B 3GA8A 4PK4A 4P0AA 5LJMA 4OHFA 3LJCA 2X9HA 1WYBA 3EDVA 3GN5A 2L8KA 3FBZA 3J9X1 3HKDE 3NZPA 1HF8A 3L3PA 5HYAA 3PDYA 2I59A 4C90A 4C91A 1ZHCA 4IE4A 2X51A 3N9MA 1UCUA 4UV8B 2C5JA 4HE8A 4YLHA 4AKGA 2HPLA 3O1JA 3B57A 4PNIA 5CB4E 4KP3C 5FXWA 1VRBA 4AI6A 1FMWA 5FNVE 3FHNA 1HTJF 3SWHA 3ZJ1A 3NRYA 2KXPB 4GIWA 5GONE 5JR9B 2LSIA 3C4ZA 5L3BB 2XAGB 2JJ9A 3E08A 4GK0E 4P09A 3ZC1A 1WRDA 3F57A 3C50A 3ZCIA 2YK0A 4UXNB 4OFZA 5F8PA 2CEAA 3A5XA 4MALA 4WNKA 2X68A 3RC3A 3KINB 3KBTA 2M67A 1US7B 5FXVA 2UXNB 3PU3A 4PFOA 4WBOA 4HTEA 1D0YA 4L0RA 3U78A 4PJNA 4OK0A 3RX6A 5CA0E 5KX5E 2EHOD 3Q2MA 1MMGA 2B1EA 3HKBE 1LRZA 2D2SA 2OA5A 1WR6A 5LNKA 2K48A 5L3GB 1AJ3A 3ANWA 5JRCB 1YW0A 2RP4A 2CWYA 2K5BB 1V9DA 4HFVA 3UULA 4ZI3C 4UEMA 4QX7B 3BQLA 1HS7A 5JDNA 3LK2B 1ZEEA 3UT5E 2IW5B 3AVRA 4UELA 4PAGA 2NTYA 4MBQA 1QSDA 4PFPA 5LGNB 4OYJA 4O4HE 3W15B 5FY7A 2CE7A 2E9XB 4DBQA 5F3JA 2HH7A 4KUMB 1FEWA 3ZMVB 4H63V 1LKXA 4ZS2A 4CXWA 2VKHA 4TN7B 3K3NA 5KMGP 1E1HB 2WM9A 5L2LA 2Q9QD 3MK7C 3Q5XA 4U74A 2QA7A 2XAJB 3MACA 3CQCB 4PW8A 3TKLB 2YU2A 5KDMC 1D1BA 3ZMUB 4YFSA 2KT9A 2V7IA 3CVRA 3ZMSB 4ZI2C 5LP6E 3EUHA 3V5SA 1BR0A 3NZQA 4L5GA 5JDQA 5LGUB 2XQYA 4EIWA 4AXPA 2UXXB 2X0LB 1BR1A 5LXTE 5LJNA 2VKDA 3O1IA 5EK2A 3M65A 4H9SE 2WMNA 4A56A 2JPFA 3LK3B 4KMCA 2LM9A 4KBMB 3DP7A 4ILUA 1ZKEA 2ODVA 3IF8B 2LOPA 4TUYE 3ZN1B 4AKRB 5J2UE 3O4XE 4BJNA 2E9XC 2W00A 4I55E 2IC9A 4UV9B 2E8IA 3ONXA 2GK9A 2H7OA 3O1HA 4FI5A 4MHCA 1T98A 2K24A 2XHEB 4ZS3A 3C98B 4PJMA 4GYRA 3FXEB 3CWZB 4GYSA 4AQFC 2X67A 2LHNA 5J2TE 3AAIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UUL A;  1U5P A;  3EDV A;  1S35 A;  2ODV A;  3LBX A;  3UUN A;  1QUU A;  3LBX B;  3FB2 A;  1WLX A;  1HCI A;  1CUN A;  3F31 A;  3UUM A;  1AJ3 A;  1OWA A;  3PE0 A;  2SPC A;  1U4Q A;  2ODU A; 
#chains in the Genus database with same CATH topology
 2H3R A;  4F6R C;  3IA3 A;  2DWK A;  3AEA A;  3P8C D;  2ZM0 A;  4XZC A;  3TLW A;  5IWA T;  2ZMA A;  3MJX A;  1JNZ A;  3BQK A;  3Q9D A;  3HI2 A;  3AE6 A;  3H37 A;  3AEG A;  1IJ5 A;  3JC6 C;  4IL9 A;  3AE5 A;  3CKD A;  4X62 T;  3TLT A;  5JQG E;  2LLY A;  4HKA A;  4V1A v;  4CN4 A;  4B3T T;  2JIW A;  2CM0 A;  3R6N A;  4AQG A;  1EZ3 A;  3LBX B;  1MIW A;  3C64 A;  3A8Y C;  1N36 T;  1WLX A;  4HN9 A;  1YD8 G;  1L0V A;  1D0Z A;  1G73 A;  5AQO B;  2VB6 A;  3PJA J;  3RIU C;  2VVS A;  2CLY C;  2KND A;  3T8O A;  3JAD A;  4IDN A;  5AQG B;  2E9X A;  2X0Y A;  3FZF B;  1UUS A;  1HG2 A;  4CI3 B;  3ZC0 A;  3B13 A;  1JNR A;  2ACX A;  3QOF A;  4H9N C;  3QB5 A;  3RRW A;  3KVA A;  2FJB A;  1OED A;  3RI5 A;  4B6X A;  1XMO T;  3AE1 A;  3HA4 A;  3SRZ A;  4I0U A;  4JI1 T;  4U7I A;  4YY3 T;  2X0H A;  2LT3 A;  2MOZ A;  5HAX A;  5LCY A;  3WAK A;  4LF8 T;  5LHG B;  2UU9 T;  4O8S A;  2NOX A;  2KWI B;  3I9Y A;  3QUJ A;  4X5T A;  1ZV4 X;  4X1I E;  4JUY A;  3ETV A;  5LBQ B;  3AA7 B;  2N2N A;  1ZOY A;  3PUS A;  4HFE A;  4HWI B;  4WYV A;  1YQ3 A;  2RPA A;  4QWN B;  1UK5 A;  4P0B A;  3RKO A;  4OX9 T;  4PK6 A;  4JEU B;  4N78 D;  4PJL A;  5LMN T;  2VWA A;  1MMN A;  4AKH A;  4YHH T;  2D9D A;  3LK4 2;  3NRX A;  2CBI A;  1NAF A;  4QH5 A;  4LF4 T;  3AAA B;  2LKH A;  4CXY A;  3BQI A;  3ANW B;  5JRC A;  5E0O A;  2X9W A;  2A2F X;  3CQG B;  2CCQ A;  2IAK A;  5FVL A;  3ESL A;  4YHJ A;  2Y6X A;  4JEH B;  3HR0 A;  3SOL A;  4DO0 A;  5L3F B;  4H9Q C;  3WAJ A;  2LE8 A;  2J47 A;  5HXR A;  3RRC A;  2LHR A;  3PUG A;  2DHR A;  2LSJ A;  4TX5 A;  3E0Z A;  5EK3 A;  1SA0 E;  4HFC A;  5FMN A;  2PJQ A;  2V7J A;  3FXD B;  2A72 A;  5LG4 A;  2BKO A;  2NWB A;  3WI3 A;  2ZLY A;  3UUN A;  4YT0 A;  4JV5 T;  2BZB A;  1YKH B;  2D0U A;  2LM2 A;  2BKN A;  2YDQ A;  2EHO C;  2G0U A;  1MMA A;  1YKE B;  3ZYK A;  4U2Z A;  3RGL A;  4ZI7 E;  3C51 A;  3DJB A;  2HPJ A;  3K8P C;  1ZP0 A;  2NW7 A;  4LMK A;  2EHO A;  4MFR A;  4P1N A;  4UVC B;  4QXC B;  5HXC A;  4PJJ A;  5IHY A;  4AIU A;  2BS3 A;  1N34 T;  3CQX C;  2Q9Q B;  2HHH T;  1DU2 A;  5AQK B;  4IHJ E;  4NUV A;  5L3E B;  4EGW A;  3AE2 A;  5DJQ C;  4IE5 A;  4ERR A;  1HX8 A;  4DMV A;  2XM1 A;  4U31 A;  1BR4 A;  1MNE A;  3N9O A;  2CXD A;  3PE0 A;  4ILA A;  2W63 A;  3N9Q A;  3X1D A;  4JI7 T;  3UUB A;  1KNZ A;  2BVM A;  3NBX X;  1W09 A;  3N9N A;  2C5K T;  2CMR A;  4NUU A;  3FBL A;  2LSK A;  5AQH B;  4CXX A;  2VKJ A;  3RYC E;  3RYH E;  5BMV E;  5LG3 A;  4DV2 T;  5AQS B;  2WY2 A;  5L3D B;  2I0M A;  3NKZ A;  3RIU A;  5HXS A;  2W61 A;  2Y48 B;  3NWI A;  4YSX A;  1W0B A;  3E22 E;  2LEH A;  4JI6 T;  1N33 T;  3MKD A;  4K0K T;  2A3D A;  1IAP A;  5HWX A;  3P4Q A;  5LA6 E;  3AEE A;  1O3X A;  5HCJ A;  1NWM X;  1FJG T;  2FJE A;  3JC6 D;  2C0S A;  3OYX A;  1VOM A;  3UFG A;  4TV9 E;  2N1G A;  2ZM6 T;  3RC8 A;  2BDE A;  3Q5E A;  2X9X A;  4EYU A;  4LF6 T;  3VKG A;  1XZY A;  4CZZ B;  2CHO A;  1Y64 B;  3S4U A;  1HFA A;  3VHL A;  2C5I T;  2XQ8 A;  2P9B A;  2WDR A;  3FZM B;  3P7I A;  3ZLI A;  1FIO A;  1NEK A;  2W0G A;  2XSB A;  2PG8 A;  2KIN B;  1MMD A;  3HKE E;  5AQL B;  2DLR A;  5AQM B;  5CA1 E;  3F2E A;  2F4V T;  3CML A;  1UX4 A;  2V7K A;  2W62 A;  3JCF A;  5JDG A;  4LF5 T;  5A1L A;  5HEJ A;  1U5P A;  4I50 E;  5FXZ A;  1X79 A;  2J1D G;  4F8H A;  1H7C A;  2QYW A;  4OYK A;  2VVN A;  5LB7 B;  4JBW F;  5IYZ E;  2L3L A;  1IZN B;  2WQY A;  3MA9 A;  2X9Y A;  1WFD A;  5FP3 A;  4HFI A;  3PU8 A;  1WR0 A;  4UF0 A;  5HEG A;  1KNP A;  3ABV A;  3UFE A;  3ZT6 A;  4YJ2 E;  4GKJ T;  1UGO A;  3AEC A;  1IJ6 A;  2XPK A;  3HKC E;  4X1Y E;  4J2C A;  4HGA A;  4AKL A;  1KK7 A;  2JQ9 A;  3GMI A;  1KNR A;  2N9D A;  2ZM8 A;  5HEU A;  1LVK A;  3UUX B;  5KXJ A;  4ILC A;  1J1J A;  3SFE A;  4DV1 T;  4EOZ B;  4I4T E;  3HL6 A;  4B3M T;  3VR9 A;  4YTN A;  1HX1 B;  2CRB A;  5HEH A;  3CX8 B;  2Y8D A;  4GOU A;  5AFU L;  1D0X A;  1HG5 A;  4DMW A;  3P4P A;  2D0T A;  5JR9 A;  3UTK A;  5DQV A;  2WZI A;  1YXR A;  3AE4 A;  2V5C A;  3FZL B;  3I0Q A;  3Q5W A;  2CPT A;  3LBX A;  2V7L A;  3AVS A;  3FZH B;  4Z90 A;  4CQI A;  2KLQ A;  5JRE A;  4DR5 T;  2E5L T;  3G06 A;  4U3C A;  3RYF E;  4HWC A;  5HXE A;  2IML A;  3RIF A;  2BS2 A;  1HCI A;  3EHZ A;  3AB3 B;  3FB2 A;  3OBV E;  3ZCJ A;  4ASK A;  3ZJ2 A;  4BA9 A;  3N2O A;  4EYY R;  3N9L A;  5HXH A;  4A97 A;  4LFC T;  2CXL A;  2PBI A;  3ZEF B;  4HFB A;  2Z6E A;  2XM2 A;  3ONL C;  4IE7 A;  4O4J E;  5H6R B;  4ZOL E;  3OVU A;  3RHW A;  3AA0 B;  4EAH A;  4EV6 A;  2DL1 A;  2UUC T;  3QNU A;  2Q9Q A;  3PUW F;  4O4I E;  4QXB B;  2WU5 A;  3ZYL A;  4QH4 A;  4DBR A;  1XDO A;  2SPC A;  3EAM A;  3FZK B;  3I9W A;  2BG9 E;  4IIJ E;  5L3C B;  2JRK A;  2V26 A;  5IUX A;  2KWH A;  4EED A;  5M4Y A;  2IUB A;  2XQA A;  4O2A E;  1I94 T;  3UU8 A;  4O2B E;  4H9O C;  4UVB B;  4ZZB A;  2D5U A;  1HNW T;  3QK6 A;  2XAS B;  3AA1 B;  2V7M A;  2NTX A;  5AQN B;  5HWY A;  3MXZ A;  1SHZ C;  3I0O A;  2JMK A;  4IDZ A;  4Z91 A;  2NW9 A;  4U2Y A;  5LGT B;  3RQU A;  2PTF A;  2AE9 A;  5J1G A;  2WWU A;  3OKQ A;  2R6G F;  4DR4 T;  1Z8U A;  3N9P A;  3LFM A;  4LML A;  4UR9 A;  1MND A;  4DR3 T;  4UVA B;  4YJ3 E;  4ZHQ E;  3ZPO A;  3JAE A;  3J7Y q;  4DV0 T;  4TZ4 C;  2V8S V;  3KDS E;  5L4H A;  3DTO A;  1N32 T;  1OWA A;  2JQH A;  1B7T A;  2VQE T;  2Q9Q C;  3AA6 B;  5JDF A;  4DVD A;  3U3I A;  3ETU A;  4ADZ A;  2UUA T;  2RA1 A;  4H63 H;  2OLT A;  3C4X A;  3LG7 A;  5TAO A;  3SS1 A;  1OXZ A;  5ABF B;  3KV6 A;  3PUQ A;  2XQ9 A;  2X66 A;  4IL4 A;  4QXH B;  3BK9 A;  4XBF B;  3KBU A;  1M7K A;  3PUR A;  4QX8 B;  5LHI B;  2UUB T;  4HWF A;  5JDM A;  5EZY E;  5FL0 A;  4DND A;  3RH3 A;  3VRB A;  3AXJ B;  4ISS A;  4G2A A;  2XAF B;  1BR2 A;  4H9R C;  2XUE A;  2WBL A;  5ETW A;  4E7Z A;  3ZMZ B;  4DR2 T;  2QRX A;  2NP9 A;  3MZK B;  4NXM T;  2XY8 B;  4UF0 B;  4E7S A;  1IBM T;  4EZH A;  5J0Z A;  2IC6 A;  4U72 A;  5C2T A;  2V6Y A;  1D1A A;  2YIN A;  3ZYM A;  5LBM A;  2WZH A;  1KF6 A;  3LDQ B;  4ZEY A;  2V6X A;  3F31 A;  3QB5 K;  4WBN E;  1YQ4 A;  5ADX L;  3VU7 H;  2UXC T;  1UX5 A;  2CWO A;  2XQ6 A;  5DQW A;  5FXX A;  4A98 A;  1T8B A;  2XTL A;  3N5L A;  3R84 B;  4ZI2 D;  2ODU A;  1S94 A;  4M1P A;  1MIV A;  2DCF A;  2ZM2 A;  3C4W A;  2XJ7 A;  3CX6 B;  4UIG A;  4Z8X A;  3ZMT B;  1HNX T;  3H3A A;  3UU6 A;  4DUY T;  2V1D B;  2LJL A;  3AED A;  4CN1 A;  3N2K E;  4JI4 T;  1GQE A;  1S35 A;  2W2U A;  2NW8 A;  4AQY T;  4FJO A;  4IE6 A;  2AXD S;  3VR8 A;  4EB6 E;  4LF7 T;  1WYC A;  3K3O A;  1SUM B;  2VL8 A;  3ONJ A;  5FY1 A;  1XNR T;  4TWF A;  4X64 T;  2KZ7 B;  2DWG A;  5AQV B;  4MLK A;  2DNX A;  2LSG A;  4BJM A;  2WSS V;  4X20 E;  4HFH A;  2JQQ A;  1LVF A;  3EI0 A;  4QKN A;  2JQK A;  4KI0 F;  4NIQ A;  5JR9 C;  2KMF A;  5ABH A;  4G63 A;  4ZXL A;  3EDU A;  3CPZ A;  3D0T A;  2VUR A;  2E9X D;  1NEN A;  2YDS A;  3UUM A;  2PFV A;  4LF9 T;  2QGS A;  4IT4 A;  4CI2 B;  4DR6 T;  5ABF A;  2WAU A;  4IDQ A;  4HEA A;  2ES0 A;  1U4Q A;  2CXF A;  3LSV A;  2K9A A;  3GWH A;  2WDQ A;  3KV9 A;  1KEY A;  2CA5 A;  4JLE A;  4YXD A;  4DV5 T;  3CX7 B;  5LOV E;  3RPU A;  3TLV A;  4K0U A;  1W0A A;  2YKS A;  3TLS A;  5JDL A;  1Z0P A;  5JH7 E;  5LMU T;  3IEE A;  5DAB A;  4XAX B;  5AQP B;  1QUU A;  2BVL A;  2EHO B;  4O4L E;  3GN5 B;  3M3Z B;  5CFB A;  1XNQ T;  2CBJ A;  2XAH B;  2IHR 1;  2XQ3 A;  4PK5 A;  4X65 T;  3T1Y T;  1MIY A;  2LSY A;  3I1A A;  1T72 A;  2NR4 A;  2VK9 A;  4EXT A;  2YU1 A;  2DI4 A;  2XAQ B;  5C8Y E;  3OYZ A;  5ABE A;  3TLU A;  5AQI B;  4EEB A;  3IBP A;  3KV4 A;  4ZZC A;  3OJA A;  1FMV A;  4H9P C;  4AQF A;  3V5U A;  3P4W A;  3N2G E;  2H7V C;  3EAB A;  4DV4 T;  5H6Q B;  5EK4 A;  4X66 T;  4KHZ F;  5JVD E;  5FYM A;  1OED B;  2WMO A;  4TWD A;  3ZSS A;  2VAS A;  3KFW X;  1D1C A;  2BS4 A;  2MYS A;  3AAE B;  3AE7 A;  3AE8 A;  2WP9 A;  3IHR A;  3PTR B;  4ZI3 D;  4ANJ A;  3O9X A;  4NXN T;  2VL0 A;  2CLY B;  3PUV F;  4U7Y A;  2BG9 B;  3KV5 A;  4L9I A;  3RQW A;  4AKI A;  4U33 A;  4X1K E;  1G8X A;  4IGU A;  5JDH A;  2IIU A;  2VKO A;  3AE9 A;  4WW0 A;  4BAY B;  5FY0 A;  1CUN A;  3K3Q C;  5C3J A;  5AQU B;  3L09 A;  3EVY A;  4EZ4 A;  5LYJ E;  2LOS A;  4IE0 A;  1XWM A;  2WS3 A;  2UXD T;  1UUR A;  4TV8 E;  1IBK T;  2MBG A;  4IST A;  4I43 B;  5LHH B;  2V6Y B;  2YEV C;  3L8R A;  4KHP T;  2BBH A;  2LKG A;  2JMH A;  2MTQ A;  2J4G A;  2L9Q A;  2BKP A;  4ILB A;  3VKH A;  1QLB A;  3PUA A;  3RLF F;  3KVB A;  3QC9 A;  4QHO A;  3RYI E;  4GK5 E;  3ZN0 B;  3GA8 A;  3L39 A;  3T1H T;  4PK4 A;  4KX6 A;  4P0A A;  5F5W A;  4OHF A;  3UQ4 A;  5LJM A;  3LJC A;  2X9H A;  2XSA A;  1WYB A;  2HN1 A;  3EDV A;  3GN5 A;  2L8K A;  3FBZ A;  3PUY F;  3HKD E;  3J9X 1;  3NZP A;  1HF8 A;  2MAW A;  4DR1 T;  4JI5 T;  1WCR A;  3L3P A;  3PDY A;  4HWD A;  2M6I A;  2I59 A;  4A5X A;  4C90 A;  3CIR A;  4YSY A;  5HYA A;  4C91 A;  1ZHC A;  4IE4 A;  2X51 A;  3N9M A;  1UCU A;  4UV8 B;  5FL1 A;  2C5J A;  1Y01 A;  4HE8 A;  3A7M A;  2BG9 C;  2WDV A;  2YDR A;  4YLH A;  4YTM A;  4AKG A;  3NVO A;  4LFA T;  2HPL A;  3JAF A;  3O1J A;  3B57 A;  4PNI A;  5CB4 E;  4KP3 C;  1XMQ T;  2BG9 A;  5FXW A;  1VRB A;  1XDP A;  4AI6 A;  1FMW A;  4GKK T;  4DV7 T;  5FNV E;  3FHN A;  2OV9 A;  1HTJ F;  3SWH A;  3ZJ1 A;  4DV3 T;  3NRY A;  3OPC A;  2FUP A;  2WU2 A;  2KXP B;  3AEF A;  5L47 A;  4GIW A;  5GON E;  2LRK A;  5JR9 B;  3PV0 F;  2LSI A;  2B76 A;  2YN6 A;  3C4Z A;  5L3B B;  2XAG B;  2JJ9 A;  1W9R A;  3E08 A;  4GK0 E;  4IDP A;  4P09 A;  3ZC1 A;  1WRD A;  2W67 A;  2WCA A;  3C50 A;  3F57 A;  2YK0 A;  4QH1 A;  4UXN B;  3ZCI A;  4AIS A;  4OFZ A;  1VCS A;  5F8P A;  2CEA A;  3A5X A;  4MAL A;  4TNV A;  2X68 A;  4WNK A;  3RC3 A;  3KIN B;  2E5V A;  3KBT A;  3P4S A;  2M67 A;  5AQJ B;  1US7 B;  3B5M A;  2UXN B;  5FXV A;  3PU3 A;  2BBJ A;  4PFO A;  4COF A;  4WBO A;  4HTE A;  4YSZ A;  1D0Y A;  4L0R A;  3RKG A;  4PJN A;  3U78 A;  4JI8 T;  4OK0 A;  5FKY A;  3RX6 A;  5CA0 E;  2WWV A;  5KX5 E;  2CHN A;  2EHO D;  3Q2M A;  1MMG A;  2B1E A;  4LFB T;  4DID B;  3HKB E;  4B3S T;  1LRZ A;  1VCT A;  2D2S A;  2OA5 A;  1WR6 A;  5LNK A;  2K48 A;  5L3G B;  1E2A A;  3Q5D A;  4TNW A;  1AJ3 A;  3ZT5 A;  3ANW A;  3RF1 A;  1J5E T;  5JTG A;  1YW0 A;  5JRC B;  2RP4 A;  1OED E;  2CWY A;  1V9D A;  2K5B B;  3P4R A;  4HFV A;  4LMJ A;  5HEO A;  5AQF B;  3UUL A;  4ZI3 C;  2UXB T;  4UEM A;  3OTO T;  4QX7 B;  3BQL A;  2HN2 A;  1HS7 A;  5JDN A;  3LK2 B;  1ZEE A;  2YOE A;  3UT5 E;  2IW5 B;  3AVR A;  4UEL A;  4PAG A;  2NTY A;  4MBQ A;  2XQ7 A;  1QSD A;  4PFP A;  5LGN B;  3UQ7 A;  4OYJ A;  1I6Z A;  4O4H E;  4CN6 A;  3W15 B;  5FY7 A;  2CE7 A;  4CI1 B;  4NPP A;  2E9X B;  5L4E A;  4JYA T;  1HNZ T;  2KSR A;  4DBQ A;  3AXJ A;  3CK6 A;  5F3J A;  2HH7 A;  4IDO A;  1KFY A;  1T7S A;  4KUM B;  1FEW A;  3ZT7 A;  3ZMV B;  4H63 V;  3UU3 A;  2W4X A;  2WB5 A;  1LKX A;  2ACZ A;  4ZS2 A;  2VKH A;  4TN7 B;  3UU5 A;  4CXW A;  4DR7 T;  3K3N A;  4WZX A;  3RIA A;  5KMG P;  4IRE A;  1E1H B;  2WM9 A;  2FJA A;  1X9B A;  5L2L A;  2Q9Q D;  3MK7 C;  3Q5X A;  4U74 A;  4JI0 T;  2XZE A;  2W66 A;  1J5W A;  2QA7 A;  2XAJ B;  3MAC A;  3CQC B;  4PW8 A;  3TKL B;  4JI2 T;  4DUZ T;  1SE7 A;  2YU2 A;  5KDM C;  1D1B A;  2E2A A;  3ZMU B;  4YFS A;  2KT9 A;  5CJ5 A;  4JI3 T;  2V7I A;  2V5D A;  1E7P A;  3CVR A;  1M62 A;  3H3M A;  5AQQ B;  3ZMS B;  4HFD A;  4TWH A;  3PUZ F;  4ZI2 C;  5LP6 E;  3EUH A;  3SFD A;  3V5S A;  5FVK A;  1BR0 A;  3PUX F;  3NZQ A;  4L5G A;  3ZKR A;  5JDQ A;  2XQY A;  4EIW A;  5LGU B;  4AXP A;  1IBL T;  5ABG A;  2IDO B;  1CHU A;  2UXX B;  2X0L B;  1BR1 A;  5LXT E;  2FJD A;  2J62 A;  5LJN A;  2VKD A;  3O1I A;  3P50 A;  5AQR B;  5EK2 A;  1R8I A;  3AE3 A;  3M65 A;  4HWH A;  4H9S E;  3VRA A;  2WMN A;  4A56 A;  3AEB A;  2JPF A;  3LK3 B;  4KMC A;  2LM9 A;  2FBW A;  4KBM B;  3ZST A;  3DP7 A;  3K1S A;  1HR0 T;  4ILU A;  1ZKE A;  2ODV A;  3IF8 B;  2LOP A;  4TUY E;  5BR8 T;  3ZN1 B;  4AKR B;  5J2U E;  3O4X E;  2I6H A;  4DV6 T;  4Q25 A;  2E9X C;  2W00 A;  4BJN A;  2K3W A;  4I55 E;  2IC9 A;  3UU4 A;  4UV9 B;  2E8I A;  2XQ4 A;  3ONX A;  5HCM A;  4YTP A;  2GK9 A;  1OED C;  2H7O A;  2H89 A;  3O1H A;  4FI5 A;  2VQF T;  4MHC A;  2XQ5 A;  5CGM A;  1T98 A;  2K24 A;  2MPK A;  3PJA A;  2XHE B;  4ZS3 A;  3C98 B;  2A9U A;  4PJM A;  4GYR A;  2QVA A;  2H88 A;  2M6B A;  3CWZ B;  3FXE B;  4GYS A;  2X67 A;  2LHN A;  4AQF C;  5J2T E;  4B3R T;  5AQT B;  3AAI A;  2LRL A; 
#chains in the Genus database with same CATH homology
 2H3R A;  4F6R C;  2DWK A;  3P8C D;  4XZC A;  2ZM0 A;  2ZMA A;  3MJX A;  3BQK A;  3Q9D A;  3HI2 A;  3H37 A;  3JC6 C;  1IJ5 A;  3CKD A;  5JQG E;  4HKA A;  4V1A v;  2CM0 A;  3R6N A;  4AQG A;  1EZ3 A;  3LBX B;  1MIW A;  3C64 A;  1WLX A;  4HN9 A;  1YD8 G;  1D0Z A;  1G73 A;  2VB6 A;  3T8O A;  2CLY C;  2KND A;  2E9X A;  1HG2 A;  4CI3 B;  3ZC0 A;  3B13 A;  2ACX A;  4H9N C;  3RRW A;  3KVA A;  4B6X A;  3SRZ A;  3HA4 A;  2LT3 A;  2MOZ A;  5HAX A;  5LCY A;  3WAK A;  5LHG B;  4O8S A;  2NOX A;  2KWI B;  3I9Y A;  3QUJ A;  1ZV4 X;  4X1I E;  4JUY A;  3ETV A;  5LBQ B;  3AA7 B;  2N2N A;  3PUS A;  4QWN B;  4P0B A;  3RKO A;  4PK6 A;  4JEU B;  4N78 D;  4PJL A;  2VWA A;  1MMN A;  4AKH A;  3LK4 2;  3NRX A;  1NAF A;  3AAA B;  4CXY A;  3BQI A;  3ANW B;  5JRC A;  5E0O A;  2X9W A;  2A2F X;  3CQG B;  2CCQ A;  2IAK A;  3ESL A;  4YHJ A;  2Y6X A;  4JEH B;  3HR0 A;  3SOL A;  4DO0 A;  5L3F B;  4H9Q C;  3WAJ A;  2LE8 A;  5HXR A;  3RRC A;  2LHR A;  3PUG A;  2DHR A;  2LSJ A;  4TX5 A;  3E0Z A;  5EK3 A;  1SA0 E;  2PJQ A;  2V7J A;  3FXD B;  2A72 A;  5LG4 A;  2NWB A;  3WI3 A;  2ZLY A;  3UUN A;  2BZB A;  1YKH B;  2D0U A;  2EHO C;  2G0U A;  1MMA A;  1YKE B;  3ZYK A;  4ZI7 E;  3C51 A;  3DJB A;  2HPJ A;  3K8P C;  2NW7 A;  4UVC B;  2EHO A;  4MFR A;  5IHY A;  5HXC A;  4QXC B;  4PJJ A;  3CQX C;  2Q9Q B;  4IHJ E;  4NUV A;  5L3E B;  4ERR A;  5DJQ C;  4IE5 A;  1HX8 A;  4DMV A;  1BR4 A;  1MNE A;  3N9O A;  2CXD A;  3PE0 A;  1KNZ A;  2W63 A;  3N9Q A;  2BVM A;  3NBX X;  3N9N A;  2C5K T;  2CMR A;  4NUU A;  3FBL A;  2LSK A;  4CXX A;  2VKJ A;  3RYC E;  3RYH E;  5BMV E;  5L3D B;  5HXS A;  2W61 A;  2Y48 B;  3E22 E;  2LEH A;  3MKD A;  2A3D A;  1IAP A;  5HWX A;  5LA6 E;  1O3X A;  1NWM X;  3JC6 D;  2C0S A;  3OYX A;  1VOM A;  4TV9 E;  2N1G A;  3RC8 A;  2BDE A;  4EYU A;  2X9X A;  3VKG A;  4CZZ B;  1Y64 B;  3S4U A;  1HFA A;  3VHL A;  2C5I T;  2P9B A;  3ZLI A;  3P7I A;  1FIO A;  3HKE E;  2W0G A;  5FMN A;  2PG8 A;  2KIN B;  1MMD A;  2DLR A;  5CA1 E;  3F2E A;  3CML A;  1UX4 A;  2V7K A;  2W62 A;  5JDG A;  5A1L A;  1U5P A;  4I50 E;  5FXZ A;  1X79 A;  2J1D G;  1H7C A;  4OYK A;  5IYZ E;  2L3L A;  1IZN B;  3MA9 A;  5FP3 A;  2X9Y A;  3PU8 A;  4UF0 A;  3UFE A;  4YJ2 E;  1IJ6 A;  3HKC E;  4X1Y E;  4J2C A;  4HGA A;  4AKL A;  1KK7 A;  3GMI A;  2N9D A;  2ZM8 A;  1LVK A;  3UUX B;  4EOZ B;  4I4T E;  3HL6 A;  3CX8 B;  2Y8D A;  4GOU A;  5AFU L;  1D0X A;  1HG5 A;  4DMW A;  3UTK A;  2D0T A;  5JR9 A;  5DQV A;  3I0Q A;  3Q5W A;  4CQI A;  3LBX A;  2V7L A;  3AVS A;  5JRE A;  2KLQ A;  3RYF E;  5HXE A;  3OBV E;  1HCI A;  3FB2 A;  3AB3 B;  4ASK A;  3ZCJ A;  4BA9 A;  4EYY R;  3ZJ2 A;  4CI1 B;  3N2O A;  5HXH A;  3N9L A;  2CXL A;  2PBI A;  3ZEF B;  2Z6E A;  4IE7 A;  4O4J E;  5H6R B;  4ZOL E;  3AA0 B;  4EAH A;  2Q9Q A;  4O4I E;  4QXB B;  3ZYL A;  4DBR A;  2SPC A;  3I9W A;  5L3C B;  4IIJ E;  2JRK A;  2V26 A;  2KWH A;  5M4Y A;  4O2A E;  4O2B E;  4H9O C;  4UVB B;  2D5U A;  3QK6 A;  2XAS B;  3AA1 B;  2V7M A;  2NTX A;  5HWY A;  3MXZ A;  1SHZ C;  3I0O A;  2JMK A;  4IDZ A;  2NW9 A;  5LGT B;  5J1G A;  2WWU A;  3OKQ A;  3N9P A;  3LFM A;  1MND A;  4UVA B;  4YJ3 E;  4ZHQ E;  3ZPO A;  3J7Y q;  4TZ4 C;  3KDS E;  3DTO A;  1OWA A;  1B7T A;  2Q9Q C;  3AA6 B;  5JDF A;  4DVD A;  3U3I A;  3ETU A;  4ADZ A;  2RA1 A;  4H63 H;  3C4X A;  5TAO A;  3LG7 A;  3SS1 A;  1OXZ A;  3KV6 A;  3PUQ A;  4XBF B;  2X66 A;  4QXH B;  3BK9 A;  3KBU A;  3PUR A;  4QX8 B;  5LHI B;  5JDM A;  5EZY E;  4DND A;  3RH3 A;  4ISS A;  5ETW A;  4G2A A;  2XAF B;  1BR2 A;  4H9R C;  2XUE A;  2WBL A;  4E7Z A;  3ZMZ B;  2NP9 A;  3MZK B;  4UF0 B;  4E7S A;  4EZH A;  2IC6 A;  4U72 A;  1D1A A;  2YIN A;  3ZYM A;  5LBM A;  3F31 A;  4WBN E;  5ADX L;  3VU7 H;  1UX5 A;  2CWO A;  5DQW A;  5FXX A;  2XTL A;  3N5L A;  3R84 B;  4ZI2 D;  2ODU A;  1S94 A;  4M1P A;  1MIV A;  2DCF A;  2ZM2 A;  3C4W A;  4UIG A;  3CX6 B;  4Z8X A;  3ZMT B;  3H3A A;  2V1D B;  2LJL A;  3N2K E;  1S35 A;  2NW8 A;  4FJO A;  4IE6 A;  4EB6 E;  1WYC A;  3K3O A;  2VL8 A;  5FY1 A;  2KZ7 B;  2DWG A;  4MLK A;  2DNX A;  2LSG A;  4BJM A;  2WSS V;  4X20 E;  2JQQ A;  1LVF A;  4QKN A;  5JR9 C;  2KMF A;  4G63 A;  3EDU A;  3CPZ A;  3D0T A;  2E9X D;  3UUM A;  2PFV A;  2QGS A;  4CI2 B;  2WAU A;  4HEA A;  2ES0 A;  1U4Q A;  2CXF A;  2K9A A;  3GWH A;  3KV9 A;  2CA5 A;  4JLE A;  3CX7 B;  5LOV E;  3RPU A;  5JDL A;  4K0U A;  1Z0P A;  5JH7 E;  3IEE A;  5DAB A;  4XAX B;  1QUU A;  2BVL A;  2EHO B;  4O4L E;  3GN5 B;  2XAH B;  4PK5 A;  1MIY A;  2LSY A;  3I1A A;  2VK9 A;  4EXT A;  2YU1 A;  2DI4 A;  2XAQ B;  5C8Y E;  3OYZ A;  3IBP A;  3KV4 A;  3OJA A;  1FMV A;  4H9P C;  4AQF A;  3V5U A;  3N2G E;  2H7V C;  5H6Q B;  5EK4 A;  5JVD E;  5FYM A;  2WMO A;  2VAS A;  3KFW X;  1D1C A;  2MYS A;  3AAE B;  3O9X A;  3IHR A;  3PTR B;  4ZI3 D;  4ANJ A;  2CLY B;  4L9I A;  3KV5 A;  4AKI A;  5JDH A;  4X1K E;  1G8X A;  4IGU A;  2VKO A;  4WW0 A;  4BAY B;  5FY0 A;  1CUN A;  3K3Q C;  3L09 A;  3EVY A;  4EZ4 A;  5LYJ E;  2LOS A;  4IE0 A;  4TV8 E;  2MBG A;  4IST A;  4I43 B;  5LHH B;  2YEV C;  2JMH A;  2MTQ A;  3VKH A;  2L9Q A;  3PUA A;  3KVB A;  3QC9 A;  4QHO A;  3RYI E;  4GK5 E;  3ZN0 B;  3GA8 A;  4PK4 A;  4P0A A;  5LJM A;  4OHF A;  3LJC A;  2X9H A;  1WYB A;  3EDV A;  3GN5 A;  2L8K A;  3FBZ A;  3J9X 1;  3HKD E;  3NZP A;  1HF8 A;  3L3P A;  5HYA A;  3PDY A;  2I59 A;  4C90 A;  4C91 A;  1ZHC A;  4IE4 A;  2X51 A;  3N9M A;  1UCU A;  4UV8 B;  2C5J A;  4HE8 A;  4YLH A;  4AKG A;  2HPL A;  3O1J A;  3B57 A;  4PNI A;  5CB4 E;  4KP3 C;  5FXW A;  1VRB A;  4AI6 A;  1FMW A;  5FNV E;  3FHN A;  1HTJ F;  3SWH A;  3ZJ1 A;  3NRY A;  2KXP B;  4GIW A;  5GON E;  5JR9 B;  2LSI A;  3C4Z A;  5L3B B;  2XAG B;  2JJ9 A;  3E08 A;  4GK0 E;  4P09 A;  3ZC1 A;  1WRD A;  3F57 A;  3C50 A;  3ZCI A;  2YK0 A;  4UXN B;  4OFZ A;  5F8P A;  2CEA A;  3A5X A;  4MAL A;  4WNK A;  2X68 A;  3RC3 A;  3KIN B;  3KBT A;  2M67 A;  1US7 B;  5FXV A;  2UXN B;  3PU3 A;  4PFO A;  4WBO A;  4HTE A;  1D0Y A;  4L0R A;  3U78 A;  4PJN A;  4OK0 A;  3RX6 A;  5CA0 E;  5KX5 E;  2EHO D;  3Q2M A;  1MMG A;  2B1E A;  3HKB E;  1LRZ A;  2D2S A;  2OA5 A;  1WR6 A;  5LNK A;  2K48 A;  5L3G B;  1AJ3 A;  3ANW A;  5JRC B;  1YW0 A;  2RP4 A;  2CWY A;  2K5B B;  1V9D A;  4HFV A;  3UUL A;  4ZI3 C;  4UEM A;  4QX7 B;  3BQL A;  1HS7 A;  5JDN A;  3LK2 B;  1ZEE A;  3UT5 E;  2IW5 B;  3AVR A;  4UEL A;  4PAG A;  2NTY A;  4MBQ A;  1QSD A;  4PFP A;  5LGN B;  4OYJ A;  4O4H E;  3W15 B;  5FY7 A;  2CE7 A;  2E9X B;  4DBQ A;  5F3J A;  2HH7 A;  4KUM B;  1FEW A;  3ZMV B;  4H63 V;  1LKX A;  4ZS2 A;  4CXW A;  2VKH A;  4TN7 B;  3K3N A;  5KMG P;  1E1H B;  2WM9 A;  5L2L A;  2Q9Q D;  3MK7 C;  3Q5X A;  4U74 A;  2QA7 A;  2XAJ B;  3MAC A;  3CQC B;  4PW8 A;  3TKL B;  2YU2 A;  5KDM C;  1D1B A;  3ZMU B;  4YFS A;  2KT9 A;  2V7I A;  3CVR A;  3ZMS B;  4ZI2 C;  5LP6 E;  3EUH A;  3V5S A;  1BR0 A;  3NZQ A;  4L5G A;  5JDQ A;  5LGU B;  2XQY A;  4EIW A;  4AXP A;  2UXX B;  2X0L B;  1BR1 A;  5LXT E;  5LJN A;  2VKD A;  3O1I A;  5EK2 A;  3M65 A;  4H9S E;  2WMN A;  4A56 A;  2JPF A;  3LK3 B;  4KMC A;  2LM9 A;  4KBM B;  3DP7 A;  4ILU A;  1ZKE A;  2ODV A;  3IF8 B;  2LOP A;  4TUY E;  3ZN1 B;  4AKR B;  5J2U E;  3O4X E;  4BJN A;  2E9X C;  2W00 A;  4I55 E;  2IC9 A;  4UV9 B;  2E8I A;  3ONX A;  2GK9 A;  2H7O A;  3O1H A;  4FI5 A;  4MHC A;  1T98 A;  2K24 A;  2XHE B;  4ZS3 A;  3C98 B;  4PJM A;  4GYR A;  3FXE B;  3CWZ B;  4GYS A;  4AQF C;  2X67 A;  2LHN A;  5J2T E;  3AAI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...