3LBXA

Crystal structure of the erythrocyte spectrin tetramerization domain complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
140
structure length
140
Chain Sequence
b'ETAEEIQERRQEVLTRYQSFKERVAERGQKLEDSYHLQVFKRDADDLGKWIMEKVNILTDKSYEDPTNIQGKYQKHQSLEAEVQTKSRLMSELEKTREERFTMGHSAHEETKAHIEELRHLWDLLLELTLEKGDQLLRAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spectrin alpha chain, erythrocyte
publication title Crystal structure and functional interpretation of the erythrocyte spectrin tetramerization domain complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 56
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2010-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00435 Spectrin Spectrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.60 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3lbxA00
1S35A 1U4QA 1WLXA 2SPCA 3LBXA 3UUNA 3F31A 1AJ3A 3UUMA 1U5PA 1CUNA 1OWAA 1QUUA 3LBXB 3PE0A 3FB2A 1HCIA 3EDVA 2ODUA 3UULA 2ODVA
chains in the Genus database with same CATH superfamily
3LK2B 4YSXA 3UU8A 1FMWA 2WZHA 2JJ9A 4PJJA 4CN4A 2LM9A 1ZKEA 5LYJE 2X9XA 2XJ7A 2D5UA 3PV0F 4PFOA 3PTRB 3N9LA 2LJLA 4DR7T 4AQYT 4N78D 3EDUA 4AKGA 2WDRA 4QKNA 5AQQB 3UQ7A 2V6YB 2V5DA 4DV6T 4GK0E 2QYWA 3Q5WA 2L3LA 4CI3B 2FJEA 3SWHA 4YHHT 1N34T 1VOMA 1OEDA 3ZMSB 4ANJA 4UELA 2XQ7A 4JI5T 3RF1A 5CA1E 1HNZT 3AVSA 1QLBA 1UUSA 5LG4A 5L2LA 3G06A 1HX8A 1N33T 4ZOLE 3N9PA 2VKJA 5JRCA 2JQKA 3JC6C 4UR9A 2D2SA 1YQ4A 2A9UA 4PJLA 3C98B 3UQ4A 3GMIA 3HKCE 3LK3B 3ONJA 2W0GA 1SE7A 3PUZF 2ZM8A 1JNRA 4LF5T 4DV5T 2YOEA 5LNKA 3RIUA 2NTYA 3PUAA 3P4PA 5L4HA 1UX5A 1YXRA 2EHOA 3CQGB 4KBMB 2YDQA 2E5VA 3LBXB 2NW7A 2VL8A 2AXDS 2X9YA 2CBJA 3CX8B 1WCRA 3U3IA 4AQGA 2K48A 2YU2A 3IBPA 5JH7E 5CJ5A 4B3ST 1KFYA 3HKDE 4PK6A 4LF8T 3E0ZA 4JI4T 2BS4A 3RC3A 4EOZB 4MFRA 5KMGP 4YJ2E 2Y8DA 3WI3A 4HFIA 3I9WA 4IE4A 5LA6E 2Q9QA 4LF4T 3CX6B 4IL9A 3KV6A 2MYSA 1W9RA 2ACZA 3P8CD 4IE7A 2WDVA 3HI2A 3RRCA 4U7IA 3N2GE 3ZYMA 4A97A 2VURA 4MBQA 2KZ7B 1W0BA 3EVYA 2C0SA 3P4WA 5JDFA 2MPKA 2LHNA 2LT3A 4XBFB 4HFEA 4O2AE 4A98A 4QH5A 1IZNB 2CWOA 4H9QC 3P4SA 2RPAA 4LFCT 2XQYA 4IL4A 2ES0A 4I55E 3HKEE 5JR9A 2DWGA 1MMDA 3TLWA 5JDGA 3AE5A 1XNQT 1UX4A 1L0VA 4QH1A 3S4UA 4YTMA 4IIJE 4TNVA 3V5SA 1HCIA 3ONLC 1WYBA 3B57A 2PG8A 4O4JE 4UVCB 4QX7B 2XQ3A 2CEAA 2XASB 2CLYB 1M62A 3SFDA 2UU9T 4DV1T 3JC6D 1SA0E 2UXDT 3ZT5A 5LG3A 1WR6A 4JI7T 5AQLB 2HPLA 2CLYC 3QB5K 2YU1A 4ZZBA 5HXHA 3D0TA 5JDNA 3P4RA 1S35A 4YSZA 5AQHB 3B5MA 1KNPA 2FJAA 3Q5XA 3E22E 5FY0A 4P09A 4YFSA 4DUYT 2J47A 2YINA 2LSIA 3T8OA 3AE3A 2YK0A 4ILAA 5IWAT 5H6QB 1WFDA 2V6YA 3J9X1 4NIQA 1KNZA 2DWKA 2CPTA 2MOZA 5C2TA 4LMJA 4ZI2C 4HWDA 2IAKA 5HXEA 2JMKA 3N5LA 3WAKA 4GYRA 4B3MT 5LB7B 2UUAT 1NEKA 1I6ZA 2LKGA 4IGUA 2WMOA 4QHOA 3RQWA 4EB6E 3PUQA 4WBOA 5TAOA 4XAXB 2BG9B 2LOPA 2B76A 2XAJB 4LMKA 4DO0A 4J2CA 3AECA 1EZ3A 3LDQB 1MIVA 2BBHA 2DI4A 3ZT6A 3VKHA 4DBRA 2M6BA 3CQCB 1HS7A 4U2ZA 3RIAA 3L39A 4WBNE 3UU6A 2BG9C 4PJNA 3PJAJ 2XQ4A 2C5KT 4IDQA 4EEDA 5ABEA 2WWVA 4YLHA 5HEGA 5EK3A 5A1LA 1U5PA 1D0ZA 1Z8UA 1IJ6A 3A5XA 2WS3A 1IAPA 3FB2A 1XZYA 2RA1A 3PUVF 4IE0A 3E08A 3FZFB 4QXBB 4GKJT 2VB6A 4CXWA 3RKGA 2XQ9A 3LBXA 3O1HA 2HN1A 5FMNA 3K1SA 3P7IA 2WWUA 2E5LT 3AE1A 2D0TA 1NAFA 4ZHQE 5HYAA 4KHPT 2LM2A 2WAUA 5HXCA 1AJ3A 4B3RT 5LGUB 3V5UA 3K3NA 5L3EB 4YTNA 2YEVC 3H3MA 4CQIA 2H3RA 3AVRA 2C5JA 2SPCA 3LG7A 5LGTB 4HGAA 2DCFA 2V7JA 4DV3T 2CXFA 1UURA 2CM0A 4OYKA 5LJMA 2L8KA 2ODUA 5J2TE 4JI6T 5EK2A 2WM9A 2NP9A 4KI0F 3FZKB 1G8XA 3RHWA 3RIFA 2BKPA 2X0LB 3Q5EA 1O3XA 3RYCE 4Z90A 2JIWA 2KWIB 5ABFB 2XAHB 2J1DG 3ZMUB 4HWHA 4P0AA 2XAGB 3TLVA 4JEUB 5DABA 3X1DA 3BQKA 3MXZA 3KV5A 4U31A 4ZI3D 4PAGA 3PE0A 4QX8B 4MHCA 3OYXA 3EAMA 2J62A 4H9SE 3SFEA 3ZN1B 4A56A 5KXJA 5E0OA 3FZHB 2JMHA 4DV4T 2M67A 2KNDA 2I6HA 3QB5A 4X1IE 3NWIA 3FZLB 2XSAA 3P50A 3PDYA 1E1HB 3UULA 3PU3A 1YQ3A 4UEMA 1CHUA 2P9BA 1ZHCA 3PUYF 2CA5A 4PNIA 4UIGA 2RP4A 5FYMA 4PK5A 3VR9A 2LKHA 5KDMC 3PU8A 3PUGA 2UXNB 4XZCA 2MTQA 3K8PC 5LMUT 3KVBA 5C8YE 1E2AA 3ZN0B 4AKLA 2XAQB 1D1BA 3Q5DA 4MALA 3C4WA 3N9QA 2CBIA 3AAAB 2EHOD 3DP7A 3SS1A 1ZEEA 5LHIB 2F4VT 4U3CA 4HFBA 5LHHB 3O1IA 2K9AA 2BBJA 3LFMA 4LF9T 1IBKT 2NW8A 1HFAA 1KNRA 3A8YC 2QGSA 1LRZA 4ILBA 3NKZA 2BG9A 2Q9QD 2W4XA 5HWYA 3OYZA 3RYIE 4DUZT 2UUCT 1HG5A 3NRXA 2XQ8A 2D9DA 2MBGA 2PFVA 3PUSA 5L47A 3ZT7A 4GK5E 2YDRA 4F8HA 4X20E 2VQFT 4HEAA 1BR1A 3AE8A 5FXXA 5L4EA 4IE6A 1MIYA 4QXHB 1ZOYA 4I0UA 4HFCA 1J5ET 2BZBA 2QRXA 4K0UA 3Q2MA 2C5IT 1LVKA 5IUXA 4EZHA 4A5XA 2XQAA 3ANWB 4G2AA 4IT4A 1FJGT 3KVAA 2WQYA 2M6IA 1XDPA 5HCJA 2NWBA 1V9DA 3AA7B 4HKAA 1BR4A 2K5BB 1MNEA 4EZ4A 4X64T 1DU2A 3CX7B 5F3JA 3U78A 4UVBB 4HWIB 1IBLT 3FXEB 2JPFA 5LHGB 4HWCA 1J5WA 5IYZE 4CXXA 5J1GA 3J7Yq 3HL6A 1N36T 4HFDA 4TWDA 1ZV4X 4ILUA 2V1DB 5HEUA 2V7LA 5AQUB 3PUWF 3ZCIA 5ABFA 5LOVE 5ABGA 2E9XB 2ZM6T 1I94T 2DNXA 1X9BA 2UXBT 2CXDA 2ACXA 4IDOA 5LJNA 3ZC0A 4O2BE 3GWHA 3MKDA 2E9XC 3N9OA 4DR4T 5BR8T 3MA9A 4YSYA 3TKLB 4DR6T 3OTOT 1D0YA 2PBIA 4H63H 3O1JA 5AQOB 4L5GA 3UU4A 4UXNB 2VKDA 2XM2A 2XSBA 3P4QA 5FKYA 2JQ9A 2V8SV 5CGMA 3BQIA 2IIUA 4B3TT 4DR2T 3H37A 5HAXA 5AQNB 4AKIA 2X67A 3AXJB 4PW8A 4U72A 5LBMA 3F2EA 2LSJA 4CI2B 4ISTA 3OBVE 3WAJA 4BAYB 2LE8A 3CIRA 4E7ZA 3O9XA 3AEFA 4H63V 1Y64B 4HN9A 1NWMX 5AQFB 5H6RB 1T8BA 1BR0A 4U74A 1Y01A 2KT9A 1UCUA 4IDPA 3RGLA 3GN5B 4UV9B 4DR3T 2VK9A 3CK6A 1YD8G 2BKOA 3AEEA 1N32T 4JI8T 1D1AA 3CPZA 3C64A 4JEHB 4FJOA 3N9MA 3NZQA 4EGWA 3KINB 2W2UA 4HWFA 3Q9DA 1WRDA 4YHJA 4BJMA 1VRBA 4UVAB 1BR2A 2QVAA 2D0UA 2OV9A 1Z0PA 5J2UE 4NXNT 4LFBT 5AQIB 3AA1B 5HEOA 2CCQA 3NZPA 1KEYA 3RX6A 3ZKRA 5LXTE 1XMQT 1T7SA 3RQUA 1FIOA 5AQRB 2LEHA 1HG2A 2V7IA 3KDSE 3PUXF 3VU7H 3ZYLA 3OKQA 3C4ZA 4Z91A 2KLQA 4YY3T 4QH4A 1M7KA 2E8IA 3AAIA 5DQWA 3L09A 4QWNB 3AE6A 2IUBA 4AXPA 4WNKA 3CVRA 4GKKT 2YDSA 5AQMB 3ANWA 4TWHA 4EAHA 1D1CA 2W67A 4O4LE 5HXSA 4KMCA 4C90A 3BQLA 4F6RC 4CI1B 2A2FX 2FBWA 4PFPA 2WU5A 3KV4A 2W66A 4KX6A 5CFBA 4AIUA 4G63A 5JDLA 3VHLA 2LSKA 3ETVA 2HHHT 4I4TE 3IF8B 5LCYA 2XQ6A 2XY8B 4ASKA 4ILCA 4BA9A 1UGOA 2HPJA 4YTPA 4DV0T 3UUNA 5AQPB 3UUMA 4H9PC 3TLUA 3KBUA 1D0XA 4Z8XA 1LKXA 1OEDE 2H88A 3ZJ2A 4JBWF 3ABVA 3OJAA 4LF7T 3JADA 2PJQA 4GIWA 3AB3B 3N2OA 2E9XA 3ESLA 3W15B 5ADXL 4ZI2D 3AEGA 4KUMB 4ERRA 2VQET 2H7VC 2H7OA 3VRAA 3ONXA 3C51A 2XUEA 2DL1A 3UFGA 5FVLA 4CZZB 5FVKA 1WLXA 4L0RA 4DMVA 4C91A 5HEJA 2OA5A 2WMNA 1OWAA 3RYFE 5AQVB 4LF6T 2Z6EA 5FL0A 2W61A 2MAWA 5J0ZA 3ZPOA 4JI0T 3RLFF 2GK9A 3QC9A 3ETUA 2LRKA 4M1PA 3I1AA 4ZZCA 1KF6A 1T72A 3EI0A 3NVOA 2CE7A 3AXJA 2XZEA 4LMLA 1OXZA 3NRYA 5JQGE 2NW9A 2WDQA 5L3DB 5KX5E 3QUJA 3UU3A 2XTLA 5FP3A 1W09A 2BVMA 1HX1B 2K3WA 3MZKB 3ZJ1A 2CWYA 2W63A 4AISA 2HN2A 5JDHA 3GN5A 3UTKA 4TV9E 2BS3A 2X9HA 2NTXA 3ZLIA 3CKDA 3AA6B 3QK6A 4E7SA 1CUNA 1XDOA 2HH7A 3K3OA 4TX5A 1MMNA 4OK0A 3HKBE 5AFUL 1E7PA 4TWFA 4IDNA 1T98A 2WB5A 2KMFA 3N2KE 3CWZB 3AE7A 1IBMT 2ZM2A 3KBTA 2WU2A 3AE2A 2XPKA 4NXMT 4OX9T 4UV8B 3JCFA 1MIWA 3LK42 4PJMA 3T1HT 4MLKA 3AEBA 2ZMAA 2FJDA 4Q25A 2BDEA 4ZS2A 1VCTA 2XM1A 2A3DA 3L8RA 1U4QA 3OVUA 2IDOB 2CRBA 3UT5E 4JUYA 5AQTB 3O4XE 3BK9A 2X0HA 4TNWA 4KP3C 1IJ5A 2WZIA 4AI6A 2DHRA 4X1YE 3DJBA 2KXPB 1MNDA 2WP9A 3ZSSA 5AQJB 2UXCT 5F8PA 5LP6E 4B6XA 1NENA 4DR5T 4NPPA 3ZMVB 2K24A 1YKEB 1SUMB 1XWMA 5GONE 3JAEA 1HTJF 4LFAT 2KWHA 1G73A 3HA4A 3RPUA 3ZC1A 4ISSA 2LHRA 4TZ4C 2E2AA 2W00A 2UUBT 4NUVA 4H9OC 4PK4A 5FY1A 4WYVA 5FL1A 3MK7C 2VKHA 4BJNA 2VVNA 4YJ3E 4CXYA 2V6XA 3AEDA 1JNZA 3KFWX 1B7TA 1WR0A 3AA0B 4P0BA 2YN6A 3VKGA 5IHYA 5AQSB 1SHZC 1US7B 1R8IA 3ZMZB 3A7MA 1QSDA 4X5TA 4AQFC 4X66T 2X51A 4EV6A 2VL0A 4P1NA 4TUYE 3B13A 4QXCB 1VCSA 4AKHA 2VWAA 2FJBA 2XHEB 4HE8A 2H89A 3C50A 4X65T 4UF0B 3MJXA 2OLTA 3FBZA 4ZI7E 5DJQC 1YKHB 3ZCJA 1YW0A 2UXXB 2NOXA 2JQQA 5EZYE 3AEAA 2ZLYA 2Y48B 5L3BB 3QNUA 3FZMB 2I0MA 2KSRA 5FXZA 3FXDB 3UUBA 5FXVA 2VKOA 2KINB 4U2YA 1XNRT 4DBQA 4DIDB 1MMGA 3RC8A 2XQ5A 3ZYKA 3M3ZB 4DNDA 4H9NC 5JVDE 1S94A 2Y6XA 5M4YA 2IMLA 4OYJA 4EIWA 2LLYA 3UUXB 2LSGA 2G0UA 4JYAT 5F5WA 4L9IA 3MACA 1QUUA 1HNXT 1GQEA 3EABA 3RH3A 2X68A 4ZS3A 3I9YA 1FEWA 1J1JA 4O4HE 3N9NA 2R6GF 4DMWA 4KHZF 2V26A 5JTGA 3AE4A 2IC9A 4O4IE 4IHJE 3VR8A 3CQXC 3IEEA 2FUPA 3UU5A 5HEHA 2CXLA 1OEDB 2N2NA 2DLRA 4ZI3C 2V5CA 4JLEA 3EUHA 5AQGB 4X62T 2LOSA 3RYHE 4HFHA 3FBLA 5FNVE 2IHR1 1OEDC 3OPCA 3RRWA 1ZP0A 2WSSV 4JI1T 4EYYR 5LMNT 5HWXA 3ZMTB 4FI5A 2L9QA 3ZSTA 4O8SA 4EXTA 2LRLA 5JRCB 2ZM0A 4HTEA 3FHNA 4OHFA 4H9RC 3T1YT 5LBQB 1H7CA 2N9DA 5HXRA 2E9XD 3M65A 5ABHA 4HFVA 2JRKA 1WYCA 2CHOA 2CHNA 3PJAA 2X66A 4NUUA 2IW5B 3SOLA 1KK7A 3EHZA 4CN6A 5EK4A 2N1GA 2XAFB 4COFA 2LSYA 5FY7A 2EHOB 5LGNB 4DR1T 3GA8A 3H3AA 1FMVA 4IREA 3RIUC 2WCAA 2V7MA 5CB4E 4JI3T 3NBXX 5ETWA 4DVDA 5AQKB 3IA3A 4GOUA 5HCMA 5JDQA 2X9WA 2EHOC 2CMRA 4OFZA 3KV9A 2X0YA 5JDMA 3L3PA 2PTFA 4GYSA 3SRZA 2QA7A 2J4GA 5L3CB 2B1EA 2YKSA 2I59A 3I0QA 3PURA 3CMLA 2Q9QB 3UFEA 1LVFA 5CA0E 4AQFA 3JAFA 3RKOA 5L3FB 1UK5A 1X79A 3AAEB 3DTOA 2W62A 2Q9QC 3F31A 3I0OA 4WW0A 3TLSA 1XMOT 5BMVE 2NR4A 5C3JA 4V1Av 5DQVA 5JREA 4WZXA 4X1KE 4I43B 3RI5A 4K0KT 4TN7B 2V7KA 3AE9A 4YT0A 3EDVA 3R84B 4DV7T 5FXWA 2ODVA 2JQHA 2IC6A 1MMAA 2BG9E 4CN1A 4AKRB 3F57A 4ADZA 1HR0T 5JR9B 3TLTA 3LSVA 3ZEFB 4ZEYA 2VASA 4IDZA 3K3QC 4TV8E 4JI2T 4U7YA 4UF0A 3C4XA 4IE5A 4U33A 2WY2A 4ZXLA 2AE9A 3R6NA 5JR9C 3QOFA 2BKNA 3VRBA 3IHRA 2BS2A 1W0AA 3HR0A 2WBLA 4DV2T 1HNWT 2BVLA 3LJCA 4I50E 4JV5T 4EYUA 2A72A 1HF8A 5L3GB 4YXDA 2VVSA 4EEBA
chains in the Genus database with same CATH topology
3LK2B 4QXBB 5GONE 1HTJF 2VB6A 4CXWA 2LSJA 4CI2B 4ISTA 3OBVE 2KWHA 3LBXA 3O1HA 3WAJA 5FMNA 1G73A 4BAYB 1FMWA 2LE8A 3P7IA 4E7ZA 3O9XA 2WWUA 2JJ9A 3HA4A 4PJJA 2LM9A 1ZKEA 4H63V 5LYJE 3RPUA 2X9XA 3ZC1A 2D0TA 4ISSA 2LHRA 4TZ4C 1Y64B 4HN9A 1NWMX 2D5UA 1NAFA 4ZHQE 2W00A 5HYAA 2WAUA 4NUVA 4PFOA 5H6RB 5HXCA 4H9OC 1BR0A 4U74A 4PK4A 1AJ3A 3PTRB 5LGUB 3N9LA 3V5UA 2LJLA 3K3NA 5L3EB 5FY1A 2KT9A 2YEVC 1UCUA 4CQIA 2H3RA 3AVRA 4N78D 2C5JA 2SPCA 3GN5B 3MK7C 3LG7A 3EDUA 5LGTB 2VKHA 4HGAA 2DCFA 4AKGA 4QKNA 4BJNA 2V7JA 2CXFA 4UV9B 4YJ3E 2VK9A 4CXYA 2CM0A 4OYKA 5LJMA 1YD8G 3KFWX 2L8KA 2ODUA 1B7TA 4GK0E 5J2TE 3AA0B 4P0BA 5EK2A 2WM9A 3Q5WA 2NP9A 2L3LA 4CI3B 1D1AA 3VKGA 3SWHA 1VOMA 1G8XA 3CPZA 3C64A 3ZMSB 4JEHB 4ANJA 4FJOA 3N9MA 3NZQA 4UELA 3KINB 2X0LB 1O3XA 3RYCE 5IHYA 2KWIB 3Q9DA 1WRDA 4YHJA 4BJMA 2XAHB 2J1DG 1VRBA 3ZMUB 5CA1E 4UVAB 1BR2A 1SHZC 1US7B 4P0AA 3AVSA 3ZMZB 1QSDA 4AQFC 2D0UA 2X51A 5LG4A 2XAGB 4JEUB 1Z0PA 5DABA 5J2UE 3BQKA 3MXZA 4TUYE 5L2LA 3B13A 3KV5A 4QXCB 4ZI3D 1HX8A 4AKHA 2VWAA 4PAGA 4ZOLE 3N9PA 3PE0A 3AA1B 4QX8B 2CCQA 4MHCA 2XHEB 4HE8A 3OYXA 2VKJA 3NZPA 5JRCA 4H9SE 3JC6C 3ZN1B 4A56A 3C50A 5E0OA 2D2SA 3RX6A 4PJLA 5LXTE 2JMHA 2M67A 2KNDA 3MJXA 4UF0B 3FBZA 4X1IE 3C98B 3GMIA 1FIOA 4ZI7E 3HKCE 1YKHB 5DJQC 3ZCJA 2LEHA 1HG2A 2V7IA 1YW0A 2UXXB 2NOXA 3KDSE 3LK3B 2W0GA 3VU7H 2JQQA 3ZYLA 2ZM8A 3C4ZA 3OKQA 5EZYE 5LNKA 3PDYA 2KLQA 2ZLYA 2Y48B 1E1HB 5L3BB 2NTYA 3UULA 3PU3A 3PUAA 4UEMA 2P9BA 5FXZA 1ZHCA 3FXDB 5FXVA 2VKOA 1UX5A 2KINB 2E8IA 3AAIA 5DQWA 2CA5A 3L09A 4PNIA 4QWNB 2EHOA 4UIGA 4WNKA 4AXPA 4DBQA 3CQGB 1MMGA 2RP4A 3RC8A 4KBMB 5FYMA 4PK5A 3CVRA 3ZYKA 4DNDA 3ANWA 4H9NC 3LBXB 5KDMC 2NW7A 2VL8A 2X9YA 5JVDE 1D1CA 1S94A 2Y6XA 4EAHA 3PU8A 3PUGA 3CX8B 5M4YA 3U3IA 4AQGA 2K48A 4O4LE 2UXNB 5HXSA 4OYJA 4KMCA 4XZCA 2MTQA 4C90A 3K8PC 4EIWA 2YU2A 3BQLA 3KVBA 4F6RC 3IBPA 5JH7E 4CI1B 2A2FX 3UUXB 5C8YE 3ZN0B 4PFPA 2LSGA 3KV4A 2G0UA 4AKLA 3HKDE 4L9IA 3MACA 4PK6A 2XAQB 1QUUA 1D1BA 3E0ZA 3RC3A 4EOZB 4MFRA 3RH3A 4YJ2E 2Y8DA 5KMGP 3WI3A 4G63A 5JDLA 2X68A 4ZS3A 3I9YA 1FEWA 4MALA 3VHLA 3C4WA 2LSKA 3ETVA 3N9QA 4I4TE 3I9WA 3IF8B 3AAAB 4O4HE 3N9NA 2EHOD 5LCYA 4IE4A 3DP7A 5LA6E 4ASKA 3SS1A 4DMWA 1ZEEA 4BA9A 2Q9QA 2HPJA 2V26A 5LHIB 3UUNA 2IC9A 3CX6B 4O4IE 3UUMA 3KV6A 2MYSA 4IHJE 3CQXC 4H9PC 3KBUA 5LHHB 3IEEA 1D0XA 4Z8XA 3O1IA 1LKXA 3P8CD 4IE7A 2K9AA 3ZJ2A 3HI2A 3LFMA 3RRCA 3OJAA 3N2GE 2CXLA 2NW8A 2N2NA 3ZYMA 2PJQA 1HFAA 2KZ7B 4MBQA 4ZI3C 4JLEA 4GIWA 3AB3B 3EVYA 3EUHA 3N2OA 2C0SA 2E9XA 3ESLA 3W15B 5ADXL 5JDFA 2LOSA 4ZI2D 3RYHE 4KUMB 4ERRA 2LHNA 2LT3A 3FBLA 5FNVE 2H7VC 2H7OA 2QGSA 4XBFB 1LRZA 4O2AE 3RRWA 1IZNB 2CWOA 4H9QC 3ONXA 2WSSV 2XQYA 4EYYR 2ES0A 4I55E 3C51A 5HWXA 3ZMTB 2Q9QD 2XUEA 3HKEE 5HWYA 5JR9A 3OYZA 3RYIE 4CZZB 4FI5A 2DWGA 2L9QA 1MMDA 4O8SA 4EXTA 1HG5A 3NRXA 1WLXA 5JRCB 4L0RA 2ZM0A 5JDGA 4DMVA 4C91A 1UX4A 2MBGA 2PFVA 4HTEA 2OA5A 3PUSA 3S4UA 3FHNA 2WMNA 1OWAA 3RYFE 4OHFA 4H9RC 4GK5E 2Z6EA 5LBQB 4IIJE 1H7CA 2N9DA 5HXRA 2E9XD 2W61A 3V5SA 1HCIA 3M65A 1WYBA 4X20E 3B57A 2PG8A 4HFVA 2JRKA 4O4JE 4UVCB 3ZPOA 1WYCA 2GK9A 4QX7B 4HEAA 3QC9A 1BR1A 2CEAA 2XASB 3ETUA 2CLYB 2X66A 4NUUA 4M1PA 3I1AA 2IW5B 3SOLA 1KK7A 5FXXA 3JC6D 2CE7A 4IE6A 5EK4A 1SA0E 2N1GA 2XAFB 1OXZA 3NRYA 1MIYA 1WR6A 4QXHB 5JQGE 2LSYA 5FY7A 2NW9A 2HPLA 2EHOB 2BZBA 4K0UA 5LGNB 2CLYC 3GA8A 1FMVA 3H3AA 3Q2MA 5L3DB 2C5IT 2YU1A 5KX5E 5HXHA 3D0TA 2V7MA 3QUJA 1LVKA 5CB4E 5JDNA 4EZHA 3NBXX 1S35A 3ANWB 5ETWA 4DVDA 4G2AA 3KVAA 3Q5XA 3E22E 4GOUA 5FY0A 2XTLA 5FP3A 2NWBA 2BVMA 4P09A 4YFSA 5JDQA 2X9WA 2YINA 1V9DA 3AA7B 2LSIA 2EHOC 3T8OA 2YK0A 4HKAA 1BR4A 2K5BB 3MZKB 1MNEA 3ZJ1A 2CWYA 2W63A 4EZ4A 2CMRA 4OFZA 3CX7B 5H6QB 3KV9A 5F3JA 5JDMA 3L3PA 3U78A 4UVBB 5JDHA 4GYSA 3GN5A 3UTKA 4TV9E 2X9HA 3FXEB 3SRZA 2QA7A 2NTXA 5L3CB 2JPFA 5LHGB 3ZLIA 3CKDA 2B1EA 3J9X1 3AA6B 3QK6A 4E7SA 1KNZA 2DWKA 5IYZE 1CUNA 4CXXA 2MOZA 2HH7A 2I59A 3I0QA 3K3OA 3CMLA 3PURA 4TX5A 1MMNA 2Q9QB 5J1GA 1LVFA 4OK0A 3UFEA 3HKBE 4ZI2C 3J7Yq 2IAKA 5AFUL 5CA0E 5HXEA 1T98A 3HL6A 3N2KE 2KMFA 2JMKA 4AQFA 3CWZB 3N5LA 3WAKA 4GYRA 3RKOA 1ZV4X 4ILUA 2V1DB 2V7LA 2ZM2A 3KBTA 5L3FB 1X79A 3AAEB 3DTOA 3ZCIA 2W62A 2Q9QC 3F31A 5LOVE 3I0OA 4WW0A 5BMVE 4UV8B 4V1Av 2E9XB 5DQVA 5JREA 1MIWA 2DNXA 3LK42 4PJMA 4X1KE 4I43B 4IGUA 2WMOA 4MLKA 4QHOA 4EB6E 3PUQA 2ZMAA 4TN7B 4WBOA 2V7KA 2BDEA 5TAOA 3EDVA 2CXDA 3R84B 4ZS2A 2ACXA 5LJNA 5FXWA 3ZC0A 2ODVA 4XAXB 2IC6A 1MMAA 2A3DA 4O2BE 1U4QA 3GWHA 3MKDA 2E9XC 3N9OA 4AKRB 2LOPA 3F57A 3UT5E 4ADZA 2XAJB 5JR9B 4JUYA 4J2CA 4DO0A 1EZ3A 3O4XE 1MIVA 2DI4A 3MA9A 3ZEFB 2VASA 3VKHA 3BK9A 3TKLB 4DBRA 3CQCB 4IDZA 3K3QC 4TV8E 1HS7A 4UF0A 3C4XA 1D0YA 4IE5A 2PBIA 4KP3C 1IJ5A 4H63H 4AI6A 3O1JA 2DHRA 4WBNE 4X1YE 4L5GA 3DJBA 4PJNA 4UXNB 2VKDA 3R6NA 5JR9C 2KXPB 2C5KT 1MNDA 4YLHA 3IHRA 5EK3A 5F8PA 5A1LA 5LP6E 4B6XA 1U5PA 3HR0A 1D0ZA 2WBLA 3BQIA 1IJ6A 3A5XA 2BVLA 3H37A 5HAXA 3LJCA 3ZMVB 1IAPA 2K24A 1YKEB 4I50E 3FB2A 2RA1A 4EYUA 4AKIA 2X67A 4PW8A 4U72A 5LBMA 2A72A 1HF8A 4IE0A 5L3GB 3F2EA 3E08A 2DLRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S35 A;  1U4Q A;  1WLX A;  2SPC A;  3LBX A;  3UUN A;  3F31 A;  1AJ3 A;  3UUM A;  1U5P A;  1CUN A;  1OWA A;  1QUU A;  3LBX B;  3PE0 A;  3FB2 A;  1HCI A;  3EDV A;  2ODU A;  3UUL A;  2ODV A; 
#chains in the Genus database with same CATH topology
 3LK2 B;  4YSX A;  3UU8 A;  1FMW A;  2WZH A;  2JJ9 A;  4PJJ A;  4CN4 A;  2LM9 A;  1ZKE A;  5LYJ E;  2X9X A;  2XJ7 A;  2D5U A;  3PV0 F;  4PFO A;  3PTR B;  3N9L A;  2LJL A;  4DR7 T;  4AQY T;  4N78 D;  3EDU A;  4AKG A;  2WDR A;  4QKN A;  5AQQ B;  3UQ7 A;  2V6Y B;  2V5D A;  4DV6 T;  4GK0 E;  2QYW A;  3Q5W A;  2L3L A;  4CI3 B;  2FJE A;  3SWH A;  4YHH T;  1N34 T;  1VOM A;  1OED A;  3ZMS B;  4ANJ A;  4UEL A;  2XQ7 A;  4JI5 T;  3RF1 A;  5CA1 E;  1HNZ T;  3AVS A;  1QLB A;  1UUS A;  5LG4 A;  5L2L A;  3G06 A;  1HX8 A;  1N33 T;  4ZOL E;  3N9P A;  2VKJ A;  5JRC A;  2JQK A;  3JC6 C;  4UR9 A;  2D2S A;  1YQ4 A;  2A9U A;  4PJL A;  3C98 B;  3UQ4 A;  3GMI A;  3HKC E;  3LK3 B;  3ONJ A;  2W0G A;  1SE7 A;  3PUZ F;  2ZM8 A;  1JNR A;  4LF5 T;  4DV5 T;  2YOE A;  5LNK A;  3RIU A;  2NTY A;  3PUA A;  3P4P A;  5L4H A;  1UX5 A;  1YXR A;  2EHO A;  3CQG B;  4KBM B;  2YDQ A;  2E5V A;  3LBX B;  2NW7 A;  2VL8 A;  2AXD S;  2X9Y A;  2CBJ A;  3CX8 B;  1WCR A;  3U3I A;  4AQG A;  2K48 A;  2YU2 A;  3IBP A;  5JH7 E;  5CJ5 A;  4B3S T;  1KFY A;  3HKD E;  4PK6 A;  4LF8 T;  3E0Z A;  4JI4 T;  2BS4 A;  3RC3 A;  4EOZ B;  4MFR A;  5KMG P;  4YJ2 E;  2Y8D A;  3WI3 A;  4HFI A;  3I9W A;  4IE4 A;  5LA6 E;  2Q9Q A;  4LF4 T;  3CX6 B;  4IL9 A;  3KV6 A;  2MYS A;  1W9R A;  2ACZ A;  3P8C D;  4IE7 A;  2WDV A;  3HI2 A;  3RRC A;  4U7I A;  3N2G E;  3ZYM A;  4A97 A;  2VUR A;  4MBQ A;  2KZ7 B;  1W0B A;  3EVY A;  2C0S A;  3P4W A;  5JDF A;  2MPK A;  2LHN A;  2LT3 A;  4XBF B;  4HFE A;  4O2A E;  4A98 A;  4QH5 A;  1IZN B;  2CWO A;  4H9Q C;  3P4S A;  2RPA A;  4LFC T;  2XQY A;  4IL4 A;  2ES0 A;  4I55 E;  3HKE E;  5JR9 A;  2DWG A;  1MMD A;  3TLW A;  5JDG A;  3AE5 A;  1XNQ T;  1UX4 A;  1L0V A;  4QH1 A;  3S4U A;  4YTM A;  4IIJ E;  4TNV A;  3V5S A;  1HCI A;  3ONL C;  1WYB A;  3B57 A;  2PG8 A;  4O4J E;  4UVC B;  4QX7 B;  2XQ3 A;  2CEA A;  2XAS B;  2CLY B;  1M62 A;  3SFD A;  2UU9 T;  4DV1 T;  3JC6 D;  1SA0 E;  2UXD T;  3ZT5 A;  5LG3 A;  1WR6 A;  4JI7 T;  5AQL B;  2HPL A;  2CLY C;  3QB5 K;  2YU1 A;  4ZZB A;  5HXH A;  3D0T A;  5JDN A;  3P4R A;  1S35 A;  4YSZ A;  5AQH B;  3B5M A;  1KNP A;  2FJA A;  3Q5X A;  3E22 E;  5FY0 A;  4P09 A;  4YFS A;  4DUY T;  2J47 A;  2YIN A;  2LSI A;  3T8O A;  3AE3 A;  2YK0 A;  4ILA A;  5IWA T;  5H6Q B;  1WFD A;  2V6Y A;  3J9X 1;  4NIQ A;  1KNZ A;  2DWK A;  2CPT A;  2MOZ A;  5C2T A;  4LMJ A;  4ZI2 C;  4HWD A;  2IAK A;  5HXE A;  2JMK A;  3N5L A;  3WAK A;  4GYR A;  4B3M T;  5LB7 B;  2UUA T;  1NEK A;  1I6Z A;  2LKG A;  4IGU A;  2WMO A;  4QHO A;  3RQW A;  4EB6 E;  3PUQ A;  4WBO A;  5TAO A;  4XAX B;  2BG9 B;  2LOP A;  2B76 A;  2XAJ B;  4LMK A;  4DO0 A;  4J2C A;  3AEC A;  1EZ3 A;  3LDQ B;  1MIV A;  2BBH A;  2DI4 A;  3ZT6 A;  3VKH A;  4DBR A;  2M6B A;  3CQC B;  1HS7 A;  4U2Z A;  3RIA A;  3L39 A;  4WBN E;  3UU6 A;  2BG9 C;  4PJN A;  3PJA J;  2XQ4 A;  2C5K T;  4IDQ A;  4EED A;  5ABE A;  2WWV A;  4YLH A;  5HEG A;  5EK3 A;  5A1L A;  1U5P A;  1D0Z A;  1Z8U A;  1IJ6 A;  3A5X A;  2WS3 A;  1IAP A;  3FB2 A;  1XZY A;  2RA1 A;  3PUV F;  4IE0 A;  3E08 A;  3FZF B;  4QXB B;  4GKJ T;  2VB6 A;  4CXW A;  3RKG A;  2XQ9 A;  3LBX A;  3O1H A;  2HN1 A;  5FMN A;  3K1S A;  3P7I A;  2WWU A;  2E5L T;  3AE1 A;  2D0T A;  1NAF A;  4ZHQ E;  5HYA A;  4KHP T;  2LM2 A;  2WAU A;  5HXC A;  1AJ3 A;  4B3R T;  5LGU B;  3V5U A;  3K3N A;  5L3E B;  4YTN A;  2YEV C;  3H3M A;  4CQI A;  2H3R A;  3AVR A;  2C5J A;  2SPC A;  3LG7 A;  5LGT B;  4HGA A;  2DCF A;  2V7J A;  4DV3 T;  2CXF A;  1UUR A;  2CM0 A;  4OYK A;  5LJM A;  2L8K A;  2ODU A;  5J2T E;  4JI6 T;  5EK2 A;  2WM9 A;  2NP9 A;  4KI0 F;  3FZK B;  1G8X A;  3RHW A;  3RIF A;  2BKP A;  2X0L B;  3Q5E A;  1O3X A;  3RYC E;  4Z90 A;  2JIW A;  2KWI B;  5ABF B;  2XAH B;  2J1D G;  3ZMU B;  4HWH A;  4P0A A;  2XAG B;  3TLV A;  4JEU B;  5DAB A;  3X1D A;  3BQK A;  3MXZ A;  3KV5 A;  4U31 A;  4ZI3 D;  4PAG A;  3PE0 A;  4QX8 B;  4MHC A;  3OYX A;  3EAM A;  2J62 A;  4H9S E;  3SFE A;  3ZN1 B;  4A56 A;  5KXJ A;  5E0O A;  3FZH B;  2JMH A;  4DV4 T;  2M67 A;  2KND A;  2I6H A;  3QB5 A;  4X1I E;  3NWI A;  3FZL B;  2XSA A;  3P50 A;  3PDY A;  1E1H B;  3UUL A;  3PU3 A;  1YQ3 A;  4UEM A;  1CHU A;  2P9B A;  1ZHC A;  3PUY F;  2CA5 A;  4PNI A;  4UIG A;  2RP4 A;  5FYM A;  4PK5 A;  3VR9 A;  2LKH A;  5KDM C;  3PU8 A;  3PUG A;  2UXN B;  4XZC A;  2MTQ A;  3K8P C;  5LMU T;  3KVB A;  5C8Y E;  1E2A A;  3ZN0 B;  4AKL A;  2XAQ B;  1D1B A;  3Q5D A;  4MAL A;  3C4W A;  3N9Q A;  2CBI A;  3AAA B;  2EHO D;  3DP7 A;  3SS1 A;  1ZEE A;  5LHI B;  2F4V T;  4U3C A;  4HFB A;  5LHH B;  3O1I A;  2K9A A;  2BBJ A;  3LFM A;  4LF9 T;  1IBK T;  2NW8 A;  1HFA A;  1KNR A;  3A8Y C;  2QGS A;  1LRZ A;  4ILB A;  3NKZ A;  2BG9 A;  2Q9Q D;  2W4X A;  5HWY A;  3OYZ A;  3RYI E;  4DUZ T;  2UUC T;  1HG5 A;  3NRX A;  2XQ8 A;  2D9D A;  2MBG A;  2PFV A;  3PUS A;  5L47 A;  3ZT7 A;  4GK5 E;  2YDR A;  4F8H A;  4X20 E;  2VQF T;  4HEA A;  1BR1 A;  3AE8 A;  5FXX A;  5L4E A;  4IE6 A;  1MIY A;  4QXH B;  1ZOY A;  4I0U A;  4HFC A;  1J5E T;  2BZB A;  2QRX A;  4K0U A;  3Q2M A;  2C5I T;  1LVK A;  5IUX A;  4EZH A;  4A5X A;  2XQA A;  3ANW B;  4G2A A;  4IT4 A;  1FJG T;  3KVA A;  2WQY A;  2M6I A;  1XDP A;  5HCJ A;  2NWB A;  1V9D A;  3AA7 B;  4HKA A;  1BR4 A;  2K5B B;  1MNE A;  4EZ4 A;  4X64 T;  1DU2 A;  3CX7 B;  5F3J A;  3U78 A;  4UVB B;  4HWI B;  1IBL T;  3FXE B;  2JPF A;  5LHG B;  4HWC A;  1J5W A;  5IYZ E;  4CXX A;  5J1G A;  3J7Y q;  3HL6 A;  1N36 T;  4HFD A;  4TWD A;  1ZV4 X;  4ILU A;  2V1D B;  5HEU A;  2V7L A;  5AQU B;  3PUW F;  3ZCI A;  5ABF A;  5LOV E;  5ABG A;  2E9X B;  2ZM6 T;  1I94 T;  2DNX A;  1X9B A;  2UXB T;  2CXD A;  2ACX A;  4IDO A;  5LJN A;  3ZC0 A;  4O2B E;  3GWH A;  3MKD A;  2E9X C;  3N9O A;  4DR4 T;  5BR8 T;  3MA9 A;  4YSY A;  3TKL B;  4DR6 T;  3OTO T;  1D0Y A;  2PBI A;  4H63 H;  3O1J A;  5AQO B;  4L5G A;  3UU4 A;  4UXN B;  2VKD A;  2XM2 A;  2XSB A;  3P4Q A;  5FKY A;  2JQ9 A;  2V8S V;  5CGM A;  3BQI A;  2IIU A;  4B3T T;  4DR2 T;  3H37 A;  5HAX A;  5AQN B;  4AKI A;  2X67 A;  3AXJ B;  4PW8 A;  4U72 A;  5LBM A;  3F2E A;  2LSJ A;  4CI2 B;  4IST A;  3OBV E;  3WAJ A;  4BAY B;  2LE8 A;  3CIR A;  4E7Z A;  3O9X A;  3AEF A;  4H63 V;  1Y64 B;  4HN9 A;  1NWM X;  5AQF B;  5H6R B;  1T8B A;  1BR0 A;  4U74 A;  1Y01 A;  2KT9 A;  1UCU A;  4IDP A;  3RGL A;  3GN5 B;  4UV9 B;  4DR3 T;  2VK9 A;  3CK6 A;  1YD8 G;  2BKO A;  3AEE A;  1N32 T;  4JI8 T;  1D1A A;  3CPZ A;  3C64 A;  4JEH B;  4FJO A;  3N9M A;  3NZQ A;  4EGW A;  3KIN B;  2W2U A;  4HWF A;  3Q9D A;  1WRD A;  4YHJ A;  4BJM A;  1VRB A;  4UVA B;  1BR2 A;  2QVA A;  2D0U A;  2OV9 A;  1Z0P A;  5J2U E;  4NXN T;  4LFB T;  5AQI B;  3AA1 B;  5HEO A;  2CCQ A;  3NZP A;  1KEY A;  3RX6 A;  3ZKR A;  5LXT E;  1XMQ T;  1T7S A;  3RQU A;  1FIO A;  5AQR B;  2LEH A;  1HG2 A;  2V7I A;  3KDS E;  3PUX F;  3VU7 H;  3ZYL A;  3OKQ A;  3C4Z A;  4Z91 A;  2KLQ A;  4YY3 T;  4QH4 A;  1M7K A;  2E8I A;  3AAI A;  5DQW A;  3L09 A;  4QWN B;  3AE6 A;  2IUB A;  4AXP A;  4WNK A;  3CVR A;  4GKK T;  2YDS A;  5AQM B;  3ANW A;  4TWH A;  4EAH A;  1D1C A;  2W67 A;  4O4L E;  5HXS A;  4KMC A;  4C90 A;  3BQL A;  4F6R C;  4CI1 B;  2A2F X;  2FBW A;  4PFP A;  2WU5 A;  3KV4 A;  2W66 A;  4KX6 A;  5CFB A;  4AIU A;  4G63 A;  5JDL A;  3VHL A;  2LSK A;  3ETV A;  2HHH T;  4I4T E;  3IF8 B;  5LCY A;  2XQ6 A;  2XY8 B;  4ASK A;  4ILC A;  4BA9 A;  1UGO A;  2HPJ A;  4YTP A;  4DV0 T;  3UUN A;  5AQP B;  3UUM A;  4H9P C;  3TLU A;  3KBU A;  1D0X A;  4Z8X A;  1LKX A;  1OED E;  2H88 A;  3ZJ2 A;  4JBW F;  3ABV A;  3OJA A;  4LF7 T;  3JAD A;  2PJQ A;  4GIW A;  3AB3 B;  3N2O A;  2E9X A;  3ESL A;  3W15 B;  5ADX L;  4ZI2 D;  3AEG A;  4KUM B;  4ERR A;  2VQE T;  2H7V C;  2H7O A;  3VRA A;  3ONX A;  3C51 A;  2XUE A;  2DL1 A;  3UFG A;  5FVL A;  4CZZ B;  5FVK A;  1WLX A;  4L0R A;  4DMV A;  4C91 A;  5HEJ A;  2OA5 A;  2WMN A;  1OWA A;  3RYF E;  5AQV B;  4LF6 T;  2Z6E A;  5FL0 A;  2W61 A;  2MAW A;  5J0Z A;  3ZPO A;  4JI0 T;  3RLF F;  2GK9 A;  3QC9 A;  3ETU A;  2LRK A;  4M1P A;  3I1A A;  4ZZC A;  1KF6 A;  1T72 A;  3EI0 A;  3NVO A;  2CE7 A;  3AXJ A;  2XZE A;  4LML A;  1OXZ A;  3NRY A;  5JQG E;  2NW9 A;  2WDQ A;  5L3D B;  5KX5 E;  3QUJ A;  3UU3 A;  2XTL A;  5FP3 A;  1W09 A;  2BVM A;  1HX1 B;  2K3W A;  3MZK B;  3ZJ1 A;  2CWY A;  2W63 A;  4AIS A;  2HN2 A;  5JDH A;  3GN5 A;  3UTK A;  4TV9 E;  2BS3 A;  2X9H A;  2NTX A;  3ZLI A;  3CKD A;  3AA6 B;  3QK6 A;  4E7S A;  1CUN A;  1XDO A;  2HH7 A;  3K3O A;  4TX5 A;  1MMN A;  4OK0 A;  3HKB E;  5AFU L;  1E7P A;  4TWF A;  4IDN A;  1T98 A;  2WB5 A;  2KMF A;  3N2K E;  3CWZ B;  3AE7 A;  1IBM T;  2ZM2 A;  3KBT A;  2WU2 A;  3AE2 A;  2XPK A;  4NXM T;  4OX9 T;  4UV8 B;  3JCF A;  1MIW A;  3LK4 2;  4PJM A;  3T1H T;  4MLK A;  3AEB A;  2ZMA A;  2FJD A;  4Q25 A;  2BDE A;  4ZS2 A;  1VCT A;  2XM1 A;  2A3D A;  3L8R A;  1U4Q A;  3OVU A;  2IDO B;  2CRB A;  3UT5 E;  4JUY A;  5AQT B;  3O4X E;  3BK9 A;  2X0H A;  4TNW A;  4KP3 C;  1IJ5 A;  2WZI A;  4AI6 A;  2DHR A;  4X1Y E;  3DJB A;  2KXP B;  1MND A;  2WP9 A;  3ZSS A;  5AQJ B;  2UXC T;  5F8P A;  5LP6 E;  4B6X A;  1NEN A;  4DR5 T;  4NPP A;  3ZMV B;  2K24 A;  1YKE B;  1SUM B;  1XWM A;  5GON E;  3JAE A;  1HTJ F;  4LFA T;  2KWH A;  1G73 A;  3HA4 A;  3RPU A;  3ZC1 A;  4ISS A;  2LHR A;  4TZ4 C;  2E2A A;  2W00 A;  2UUB T;  4NUV A;  4H9O C;  4PK4 A;  5FY1 A;  4WYV A;  5FL1 A;  3MK7 C;  2VKH A;  4BJN A;  2VVN A;  4YJ3 E;  4CXY A;  2V6X A;  3AED A;  1JNZ A;  3KFW X;  1B7T A;  1WR0 A;  3AA0 B;  4P0B A;  2YN6 A;  3VKG A;  5IHY A;  5AQS B;  1SHZ C;  1US7 B;  1R8I A;  3ZMZ B;  3A7M A;  1QSD A;  4X5T A;  4AQF C;  4X66 T;  2X51 A;  4EV6 A;  2VL0 A;  4P1N A;  4TUY E;  3B13 A;  4QXC B;  1VCS A;  4AKH A;  2VWA A;  2FJB A;  2XHE B;  4HE8 A;  2H89 A;  3C50 A;  4X65 T;  4UF0 B;  3MJX A;  2OLT A;  3FBZ A;  4ZI7 E;  5DJQ C;  1YKH B;  3ZCJ A;  1YW0 A;  2UXX B;  2NOX A;  2JQQ A;  5EZY E;  3AEA A;  2ZLY A;  2Y48 B;  5L3B B;  3QNU A;  3FZM B;  2I0M A;  2KSR A;  5FXZ A;  3FXD B;  3UUB A;  5FXV A;  2VKO A;  2KIN B;  4U2Y A;  1XNR T;  4DBQ A;  4DID B;  1MMG A;  3RC8 A;  2XQ5 A;  3ZYK A;  3M3Z B;  4DND A;  4H9N C;  5JVD E;  1S94 A;  2Y6X A;  5M4Y A;  2IML A;  4OYJ A;  4EIW A;  2LLY A;  3UUX B;  2LSG A;  2G0U A;  4JYA T;  5F5W A;  4L9I A;  3MAC A;  1QUU A;  1HNX T;  1GQE A;  3EAB A;  3RH3 A;  2X68 A;  4ZS3 A;  3I9Y A;  1FEW A;  1J1J A;  4O4H E;  3N9N A;  2R6G F;  4DMW A;  4KHZ F;  2V26 A;  5JTG A;  3AE4 A;  2IC9 A;  4O4I E;  4IHJ E;  3VR8 A;  3CQX C;  3IEE A;  2FUP A;  3UU5 A;  5HEH A;  2CXL A;  1OED B;  2N2N A;  2DLR A;  4ZI3 C;  2V5C A;  4JLE A;  3EUH A;  5AQG B;  4X62 T;  2LOS A;  3RYH E;  4HFH A;  3FBL A;  5FNV E;  2IHR 1;  1OED C;  3OPC A;  3RRW A;  1ZP0 A;  2WSS V;  4JI1 T;  4EYY R;  5LMN T;  5HWX A;  3ZMT B;  4FI5 A;  2L9Q A;  3ZST A;  4O8S A;  4EXT A;  2LRL A;  5JRC B;  2ZM0 A;  4HTE A;  3FHN A;  4OHF A;  4H9R C;  3T1Y T;  5LBQ B;  1H7C A;  2N9D A;  5HXR A;  2E9X D;  3M65 A;  5ABH A;  4HFV A;  2JRK A;  1WYC A;  2CHO A;  2CHN A;  3PJA A;  2X66 A;  4NUU A;  2IW5 B;  3SOL A;  1KK7 A;  3EHZ A;  4CN6 A;  5EK4 A;  2N1G A;  2XAF B;  4COF A;  2LSY A;  5FY7 A;  2EHO B;  5LGN B;  4DR1 T;  3GA8 A;  3H3A A;  1FMV A;  4IRE A;  3RIU C;  2WCA A;  2V7M A;  5CB4 E;  4JI3 T;  3NBX X;  5ETW A;  4DVD A;  5AQK B;  3IA3 A;  4GOU A;  5HCM A;  5JDQ A;  2X9W A;  2EHO C;  2CMR A;  4OFZ A;  3KV9 A;  2X0Y A;  5JDM A;  3L3P A;  2PTF A;  4GYS A;  3SRZ A;  2QA7 A;  2J4G A;  5L3C B;  2B1E A;  2YKS A;  2I59 A;  3I0Q A;  3PUR A;  3CML A;  2Q9Q B;  3UFE A;  1LVF A;  5CA0 E;  4AQF A;  3JAF A;  3RKO A;  5L3F B;  1UK5 A;  1X79 A;  3AAE B;  3DTO A;  2W62 A;  2Q9Q C;  3F31 A;  3I0O A;  4WW0 A;  3TLS A;  1XMO T;  5BMV E;  2NR4 A;  5C3J A;  4V1A v;  5DQV A;  5JRE A;  4WZX A;  4X1K E;  4I43 B;  3RI5 A;  4K0K T;  4TN7 B;  2V7K A;  3AE9 A;  4YT0 A;  3EDV A;  3R84 B;  4DV7 T;  5FXW A;  2ODV A;  2JQH A;  2IC6 A;  1MMA A;  2BG9 E;  4CN1 A;  4AKR B;  3F57 A;  4ADZ A;  1HR0 T;  5JR9 B;  3TLT A;  3LSV A;  3ZEF B;  4ZEY A;  2VAS A;  4IDZ A;  3K3Q C;  4TV8 E;  4JI2 T;  4U7Y A;  4UF0 A;  3C4X A;  4IE5 A;  4U33 A;  2WY2 A;  4ZXL A;  2AE9 A;  3R6N A;  5JR9 C;  3QOF A;  2BKN A;  3VRB A;  3IHR A;  2BS2 A;  1W0A A;  3HR0 A;  2WBL A;  4DV2 T;  1HNW T;  2BVL A;  3LJC A;  4I50 E;  4JV5 T;  4EYU A;  2A72 A;  1HF8 A;  5L3G B;  4YXD A;  2VVS A;  4EEB A; 
#chains in the Genus database with same CATH homology
 3LK2 B;  4QXB B;  5GON E;  1HTJ F;  2VB6 A;  4CXW A;  2LSJ A;  4CI2 B;  4IST A;  3OBV E;  2KWH A;  3LBX A;  3O1H A;  3WAJ A;  5FMN A;  1G73 A;  4BAY B;  1FMW A;  2LE8 A;  3P7I A;  4E7Z A;  3O9X A;  2WWU A;  2JJ9 A;  3HA4 A;  4PJJ A;  2LM9 A;  1ZKE A;  4H63 V;  5LYJ E;  3RPU A;  2X9X A;  3ZC1 A;  2D0T A;  4ISS A;  2LHR A;  4TZ4 C;  1Y64 B;  4HN9 A;  1NWM X;  2D5U A;  1NAF A;  4ZHQ E;  2W00 A;  5HYA A;  2WAU A;  4NUV A;  4PFO A;  5H6R B;  5HXC A;  4H9O C;  1BR0 A;  4U74 A;  4PK4 A;  1AJ3 A;  3PTR B;  5LGU B;  3N9L A;  3V5U A;  2LJL A;  3K3N A;  5L3E B;  5FY1 A;  2KT9 A;  2YEV C;  1UCU A;  4CQI A;  2H3R A;  3AVR A;  4N78 D;  2C5J A;  2SPC A;  3GN5 B;  3MK7 C;  3LG7 A;  3EDU A;  5LGT B;  2VKH A;  4HGA A;  2DCF A;  4AKG A;  4QKN A;  4BJN A;  2V7J A;  2CXF A;  4UV9 B;  4YJ3 E;  2VK9 A;  4CXY A;  2CM0 A;  4OYK A;  5LJM A;  1YD8 G;  3KFW X;  2L8K A;  2ODU A;  1B7T A;  4GK0 E;  5J2T E;  3AA0 B;  4P0B A;  5EK2 A;  2WM9 A;  3Q5W A;  2NP9 A;  2L3L A;  4CI3 B;  1D1A A;  3VKG A;  3SWH A;  1VOM A;  1G8X A;  3CPZ A;  3C64 A;  3ZMS B;  4JEH B;  4ANJ A;  4FJO A;  3N9M A;  3NZQ A;  4UEL A;  3KIN B;  2X0L B;  1O3X A;  3RYC E;  5IHY A;  2KWI B;  3Q9D A;  1WRD A;  4YHJ A;  4BJM A;  2XAH B;  2J1D G;  1VRB A;  3ZMU B;  5CA1 E;  4UVA B;  1BR2 A;  1SHZ C;  1US7 B;  4P0A A;  3AVS A;  3ZMZ B;  1QSD A;  4AQF C;  2D0U A;  2X51 A;  5LG4 A;  2XAG B;  4JEU B;  1Z0P A;  5DAB A;  5J2U E;  3BQK A;  3MXZ A;  4TUY E;  5L2L A;  3B13 A;  3KV5 A;  4QXC B;  4ZI3 D;  1HX8 A;  4AKH A;  2VWA A;  4PAG A;  4ZOL E;  3N9P A;  3PE0 A;  3AA1 B;  4QX8 B;  2CCQ A;  4MHC A;  2XHE B;  4HE8 A;  3OYX A;  2VKJ A;  3NZP A;  5JRC A;  4H9S E;  3JC6 C;  3ZN1 B;  4A56 A;  3C50 A;  5E0O A;  2D2S A;  3RX6 A;  4PJL A;  5LXT E;  2JMH A;  2M67 A;  2KND A;  3MJX A;  4UF0 B;  3FBZ A;  4X1I E;  3C98 B;  3GMI A;  1FIO A;  4ZI7 E;  3HKC E;  1YKH B;  5DJQ C;  3ZCJ A;  2LEH A;  1HG2 A;  2V7I A;  1YW0 A;  2UXX B;  2NOX A;  3KDS E;  3LK3 B;  2W0G A;  3VU7 H;  2JQQ A;  3ZYL A;  2ZM8 A;  3C4Z A;  3OKQ A;  5EZY E;  5LNK A;  3PDY A;  2KLQ A;  2ZLY A;  2Y48 B;  1E1H B;  5L3B B;  2NTY A;  3UUL A;  3PU3 A;  3PUA A;  4UEM A;  2P9B A;  5FXZ A;  1ZHC A;  3FXD B;  5FXV A;  2VKO A;  1UX5 A;  2KIN B;  2E8I A;  3AAI A;  5DQW A;  2CA5 A;  3L09 A;  4PNI A;  4QWN B;  2EHO A;  4UIG A;  4WNK A;  4AXP A;  4DBQ A;  3CQG B;  1MMG A;  2RP4 A;  3RC8 A;  4KBM B;  5FYM A;  4PK5 A;  3CVR A;  3ZYK A;  4DND A;  3ANW A;  4H9N C;  3LBX B;  5KDM C;  2NW7 A;  2VL8 A;  2X9Y A;  5JVD E;  1D1C A;  1S94 A;  2Y6X A;  4EAH A;  3PU8 A;  3PUG A;  3CX8 B;  5M4Y A;  3U3I A;  4AQG A;  2K48 A;  4O4L E;  2UXN B;  5HXS A;  4OYJ A;  4KMC A;  4XZC A;  2MTQ A;  4C90 A;  3K8P C;  4EIW A;  2YU2 A;  3BQL A;  3KVB A;  4F6R C;  3IBP A;  5JH7 E;  4CI1 B;  2A2F X;  3UUX B;  5C8Y E;  3ZN0 B;  4PFP A;  2LSG A;  3KV4 A;  2G0U A;  4AKL A;  3HKD E;  4L9I A;  3MAC A;  4PK6 A;  2XAQ B;  1QUU A;  1D1B A;  3E0Z A;  3RC3 A;  4EOZ B;  4MFR A;  3RH3 A;  4YJ2 E;  2Y8D A;  5KMG P;  3WI3 A;  4G63 A;  5JDL A;  2X68 A;  4ZS3 A;  3I9Y A;  1FEW A;  4MAL A;  3VHL A;  3C4W A;  2LSK A;  3ETV A;  3N9Q A;  4I4T E;  3I9W A;  3IF8 B;  3AAA B;  4O4H E;  3N9N A;  2EHO D;  5LCY A;  4IE4 A;  3DP7 A;  5LA6 E;  4ASK A;  3SS1 A;  4DMW A;  1ZEE A;  4BA9 A;  2Q9Q A;  2HPJ A;  2V26 A;  5LHI B;  3UUN A;  2IC9 A;  3CX6 B;  4O4I E;  3UUM A;  3KV6 A;  2MYS A;  4IHJ E;  3CQX C;  4H9P C;  3KBU A;  5LHH B;  3IEE A;  1D0X A;  4Z8X A;  3O1I A;  1LKX A;  3P8C D;  4IE7 A;  2K9A A;  3ZJ2 A;  3HI2 A;  3LFM A;  3RRC A;  3OJA A;  3N2G E;  2CXL A;  2NW8 A;  2N2N A;  3ZYM A;  2PJQ A;  1HFA A;  2KZ7 B;  4MBQ A;  4ZI3 C;  4JLE A;  4GIW A;  3AB3 B;  3EVY A;  3EUH A;  3N2O A;  2C0S A;  2E9X A;  3ESL A;  3W15 B;  5ADX L;  5JDF A;  2LOS A;  4ZI2 D;  3RYH E;  4KUM B;  4ERR A;  2LHN A;  2LT3 A;  3FBL A;  5FNV E;  2H7V C;  2H7O A;  2QGS A;  4XBF B;  1LRZ A;  4O2A E;  3RRW A;  1IZN B;  2CWO A;  4H9Q C;  3ONX A;  2WSS V;  2XQY A;  4EYY R;  2ES0 A;  4I55 E;  3C51 A;  5HWX A;  3ZMT B;  2Q9Q D;  2XUE A;  3HKE E;  5HWY A;  5JR9 A;  3OYZ A;  3RYI E;  4CZZ B;  4FI5 A;  2DWG A;  2L9Q A;  1MMD A;  4O8S A;  4EXT A;  1HG5 A;  3NRX A;  1WLX A;  5JRC B;  4L0R A;  2ZM0 A;  5JDG A;  4DMV A;  4C91 A;  1UX4 A;  2MBG A;  2PFV A;  4HTE A;  2OA5 A;  3PUS A;  3S4U A;  3FHN A;  2WMN A;  1OWA A;  3RYF E;  4OHF A;  4H9R C;  4GK5 E;  2Z6E A;  5LBQ B;  4IIJ E;  1H7C A;  2N9D A;  5HXR A;  2E9X D;  2W61 A;  3V5S A;  1HCI A;  3M65 A;  1WYB A;  4X20 E;  3B57 A;  2PG8 A;  4HFV A;  2JRK A;  4O4J E;  4UVC B;  3ZPO A;  1WYC A;  2GK9 A;  4QX7 B;  4HEA A;  3QC9 A;  1BR1 A;  2CEA A;  2XAS B;  3ETU A;  2CLY B;  2X66 A;  4NUU A;  4M1P A;  3I1A A;  2IW5 B;  3SOL A;  1KK7 A;  5FXX A;  3JC6 D;  2CE7 A;  4IE6 A;  5EK4 A;  1SA0 E;  2N1G A;  2XAF B;  1OXZ A;  3NRY A;  1MIY A;  1WR6 A;  4QXH B;  5JQG E;  2LSY A;  5FY7 A;  2NW9 A;  2HPL A;  2EHO B;  2BZB A;  4K0U A;  5LGN B;  2CLY C;  3GA8 A;  1FMV A;  3H3A A;  3Q2M A;  5L3D B;  2C5I T;  2YU1 A;  5KX5 E;  5HXH A;  3D0T A;  2V7M A;  3QUJ A;  1LVK A;  5CB4 E;  5JDN A;  4EZH A;  3NBX X;  1S35 A;  3ANW B;  5ETW A;  4DVD A;  4G2A A;  3KVA A;  3Q5X A;  3E22 E;  4GOU A;  5FY0 A;  2XTL A;  5FP3 A;  2NWB A;  2BVM A;  4P09 A;  4YFS A;  5JDQ A;  2X9W A;  2YIN A;  1V9D A;  3AA7 B;  2LSI A;  2EHO C;  3T8O A;  2YK0 A;  4HKA A;  1BR4 A;  2K5B B;  3MZK B;  1MNE A;  3ZJ1 A;  2CWY A;  2W63 A;  4EZ4 A;  2CMR A;  4OFZ A;  3CX7 B;  5H6Q B;  3KV9 A;  5F3J A;  5JDM A;  3L3P A;  3U78 A;  4UVB B;  5JDH A;  4GYS A;  3GN5 A;  3UTK A;  4TV9 E;  2X9H A;  3FXE B;  3SRZ A;  2QA7 A;  2NTX A;  5L3C B;  2JPF A;  5LHG B;  3ZLI A;  3CKD A;  2B1E A;  3J9X 1;  3AA6 B;  3QK6 A;  4E7S A;  1KNZ A;  2DWK A;  5IYZ E;  1CUN A;  4CXX A;  2MOZ A;  2HH7 A;  2I59 A;  3I0Q A;  3K3O A;  3CML A;  3PUR A;  4TX5 A;  1MMN A;  2Q9Q B;  5J1G A;  1LVF A;  4OK0 A;  3UFE A;  3HKB E;  4ZI2 C;  3J7Y q;  2IAK A;  5AFU L;  5CA0 E;  5HXE A;  1T98 A;  3HL6 A;  3N2K E;  2KMF A;  2JMK A;  4AQF A;  3CWZ B;  3N5L A;  3WAK A;  4GYR A;  3RKO A;  1ZV4 X;  4ILU A;  2V1D B;  2V7L A;  2ZM2 A;  3KBT A;  5L3F B;  1X79 A;  3AAE B;  3DTO A;  3ZCI A;  2W62 A;  2Q9Q C;  3F31 A;  5LOV E;  3I0O A;  4WW0 A;  5BMV E;  4UV8 B;  4V1A v;  2E9X B;  5DQV A;  5JRE A;  1MIW A;  2DNX A;  3LK4 2;  4PJM A;  4X1K E;  4I43 B;  4IGU A;  2WMO A;  4MLK A;  4QHO A;  4EB6 E;  3PUQ A;  2ZMA A;  4TN7 B;  4WBO A;  2V7K A;  2BDE A;  5TAO A;  3EDV A;  2CXD A;  3R84 B;  4ZS2 A;  2ACX A;  5LJN A;  5FXW A;  3ZC0 A;  2ODV A;  4XAX B;  2IC6 A;  1MMA A;  2A3D A;  4O2B E;  1U4Q A;  3GWH A;  3MKD A;  2E9X C;  3N9O A;  4AKR B;  2LOP A;  3F57 A;  3UT5 E;  4ADZ A;  2XAJ B;  5JR9 B;  4JUY A;  4J2C A;  4DO0 A;  1EZ3 A;  3O4X E;  1MIV A;  2DI4 A;  3MA9 A;  3ZEF B;  2VAS A;  3VKH A;  3BK9 A;  3TKL B;  4DBR A;  3CQC B;  4IDZ A;  3K3Q C;  4TV8 E;  1HS7 A;  4UF0 A;  3C4X A;  1D0Y A;  4IE5 A;  2PBI A;  4KP3 C;  1IJ5 A;  4H63 H;  4AI6 A;  3O1J A;  2DHR A;  4WBN E;  4X1Y E;  4L5G A;  3DJB A;  4PJN A;  4UXN B;  2VKD A;  3R6N A;  5JR9 C;  2KXP B;  2C5K T;  1MND A;  4YLH A;  3IHR A;  5EK3 A;  5F8P A;  5A1L A;  5LP6 E;  4B6X A;  1U5P A;  3HR0 A;  1D0Z A;  2WBL A;  3BQI A;  1IJ6 A;  3A5X A;  2BVL A;  3H37 A;  5HAX A;  3LJC A;  3ZMV B;  1IAP A;  2K24 A;  1YKE B;  4I50 E;  3FB2 A;  2RA1 A;  4EYU A;  4AKI A;  2X67 A;  4PW8 A;  4U72 A;  5LBM A;  2A72 A;  1HF8 A;  4IE0 A;  5L3G B;  3F2E A;  3E08 A;  2DLR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...