3LBXA

Crystal structure of the erythrocyte spectrin tetramerization domain complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
140
structure length
140
Chain Sequence
ETAEEIQERRQEVLTRYQSFKERVAERGQKLEDSYHLQVFKRDADDLGKWIMEKVNILTDKSYEDPTNIQGKYQKHQSLEAEVQTKSRLMSELEKTREERFTMGHSAHEETKAHIEELRHLWDLLLELTLEKGDQLLRAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Spectrin alpha chain, erythrocyte
publication title Crystal structure and functional interpretation of the erythrocyte spectrin tetramerization domain complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2010-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00435 Spectrin Spectrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.60 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3lbxA00
1CUNA 3F31A 3UUMA 1QUUA 3UULA 1OWAA 1AJ3A 2SPCA 1U4QA 2ODVA 3UUNA 3LBXA 3EDVA 2ODUA 3PE0A 1S35A 1HCIA 1WLXA 1U5PA 3LBXB 3FB2A
chains in the Genus database with same CATH superfamily
1KNZA 2H7OA 4DBQA 4U33A 2UXXB 3TKLB 3ZMSB 1U4QA 4ZI3C 3AEEA 3Q5EA 3ZT6A 3RQUA 4LF7T 4YSXA 5L4EA 1UK5A 3N2KE 2LSJA 4DR1T 2A9UA 5DABA 3ZKRA 5JDQA 1W09A 3HA4A 2Q9QD 2WMNA 3GMIA 4ANJA 2YEVC 3RYCE 3C4WA 2LJLA 2CXDA 4A97A 2XPKA 2W63A 4IIJE 1HFAA 2E9XA 4DV1T 1XZYA 4MALA 2CWOA 3SFDA 4DUYT 2Z6EA 1G8XA 4CN1A 2CHOA 4J2CA 3UFEA 3KFWX 4UV9B 1G73A 3VRAA 4DV0T 3AE4A 2I59A 4DV3T 2YDQA 4DV7T 4IE7A 3N2OA 3TLSA 4ASKA 3AEBA 1XMQT 3A5XA 3CKDA 1QUUA 2MTQA 5ABEA 4U2ZA 4Z8XA 1KFYA 2XHEB 1IJ6A 4DR4T 4JI1T 1ZHCA 4I43B 4IDPA 1I94T 2E8IA 2VB6A 2LHRA 2IDOB 4EXTA 4QKNA 3ZEFB 4WBOA 3ETVA 2NOXA 3QB5A 3AE2A 2WQYA 1YQ4A 3AA6B 3ZLIA 1OEDB 3KDSE 4NPPA 1S94A 5E0OA 5FXWA 2NP9A 2HH7A 4H9QC 4JI4T 5AQOB 2FBWA 3ZCIA 2W0GA 5LHHB 3KVBA 3AA1B 4IHJE 5LMNT 3F2EA 2L3LA 2WP9A 5AQMB 5AQRB 5FL1A 2V5CA 2AXDS 5L3BB 3AEGA 3JCFA 1HG5A 4LF5T 3O9XA 2ACZA 2X0LB 4PK4A 3LK2B 4DVDA 3MA9A 3FBLA 1J5WA 5ADXL 2X51A 4ISTA 5JTGA 5HEHA 3RPUA 4YSZA 4JYAT 3MKDA 5JREA 5ABHA 3RLFF 2XASB 3PUQA 4HEAA 3PTRB 3ZSSA 2UUAT 2A3DA 3L09A 4I50E 4AQYT 5JDFA 3AXJA 2UUBT 2UXBT 4NIQA 2ES0A 1D1AA 2XM2A 4WYVA 1W9RA 3UUMA 1NEKA 2V7IA 3EUHA 4YTMA 3O1JA 2E9XD 3IEEA 3C64A 5AQVB 2DWGA 2XSAA 2NWBA 4DR5T 2KWIB 4CXYA 2IUBA 3FHNA 2NW7A 2ACXA 2VASA 2JQKA 2OA5A 3BQKA 3ESLA 5AQJB 4LMKA 3UULA 1N34T 1FIOA 3ZMUB 5ABFA 3C51A 4O2BE 3KV5A 3GN5B 1NENA 3OYXA 3U78A 4HWDA 2UXNB 2W61A 2I6HA 1HTJF 2Y48B 3RIUC 5H6QB 2X0YA 2HPLA 4DR7T 4G2AA 4Z90A 4HWFA 2UXCT 3RRWA 3ZMVB 1XNQT 1WR6A 2LHNA 2V5DA 4JI2T 4EZ4A 2FJEA 1MMAA 5C3JA 5M4YA 2P9BA 4NUVA 3C4XA 3JADA 5FL0A 3Q9DA 2K24A 2L9QA 2BVMA 2WMOA 2LE8A 2KSRA 5F5WA 4B6XA 4TWHA 4OFZA 5CA1E 4ILCA 4CN6A 4U74A 4EYUA 5JDGA 4AQFC 3MJXA 2XY8B 4O4IE 4GYRA 2NTXA 1ZKEA 3IF8B 3OKQA 5DQVA 5EZYE 2WM9A 1KK7A 4IE6A 3AB3B 4MLKA 4TX5A 2LM2A 4QH4A 1AJ3A 4AKIA 3HR0A 2XAQB 5F8PA 1UGOA 3EDUA 3UUBA 2JJ9A 2H7VC 2EHOC 4ZI2C 2MAWA 3M3ZB 4PNIA 4BAYB 3LK3B 4HFBA 5LHGB 3VU7H 1WRDA 3AVSA 5JR9C 4O4HE 3CX7B 2PJQA 3N5LA 2VKJA 3CK6A 2XQ8A 4DR2T 4LMLA 2VL0A 2X66A 5AFUL 2LSKA 3RYIE 2WWVA 3HL6A 3PU8A 5J2UE 4B3RT 3ZSTA 1WYBA 3CWZB 4N78D 5H6RB 5HXEA 2LKGA 3RYFE 2KLQA 2UUCT 3RIFA 3I1AA 2PFVA 2YK0A 4ZEYA 1X9BA 2LSIA 2BS3A 5HEOA 2JPFA 5CA0E 3SRZA 1XMOT 2VKOA 5JH7E 3UQ4A 2YN6A 2V7LA 4EB6E 4DR6T 3AE1A 2VKHA 2X9WA 5EK4A 1U5PA 4JV5T 4LF8T 3Q5WA 4ZZBA 3B13A 1KEYA 4IE0A 1HR0T 2BBHA 3P4WA 4AKRB 4NXMT 2VURA 1NWMX 2YINA 5LJMA 3DJBA 4QHOA 3UUXB 3JC6C 3AE9A 4I55E 3FZMB 3TLUA 5L4HA 5LG4A 2LRLA 1N33T 4ZS2A 2JIWA 3I0QA 3QB5K 3ZN1B 3O1HA 3KVAA 3IBPA 4G63A 4QX7B 5TAOA 2RA1A 2XSBA 1LKXA 4DMVA 2QVAA 1LVFA 2JMKA 5LGUB 5HXCA 1UX5A 4YXDA 3H3AA 3ZMZB 4YT0A 4UF0B 2MPKA 2B1EA 4L0RA 2PTFA 3N9OA 2X9YA 2VQFT 5AQNB 3MXZA 3N9LA 2DNXA 3ONLC 2BG9C 4LF6T 1YKHB 2V6YB 2KZ7B 2WDQA 2VL8A 4NUUA 3BK9A 3VR9A 2C5KT 3MK7C 3O4XE 2W00A 4DIDB 1HNZT 3SWHA 1KNRA 4HWCA 1H7CA 4QX8B 4ILAA 4CXWA 4X20E 3T1YT 4OX9T 3BQLA 4TNWA 3ZYKA 4ERRA 3HI2A 3K8PC 2BS2A 3A8YC 3UTKA 2BG9E 5KMGP 1T8BA 2WU2A 4AKHA 3LK42 2X0HA 3N9PA 2XQ4A 2H3RA 1OEDA 2LSGA 4MFRA 3QUJA 4KMCA 4CXXA 5FXZA 3OBVE 3M65A 3AEAA 1KNPA 5FY0A 3PUXF 3F57A 3FBZA 3FB2A 2HPJA 3F31A 4ZXLA 3O1IA 4MHCA 5HXRA 4X1IE 1IZNB 2CCQA 4EIWA 5AQSB 3NVOA 2EHOB 3J9X1 2WAUA 3AE6A 3EHZA 2WZIA 5C8YE 2BKOA 5FY7A 1KF6A 4JUYA 4EEBA 5JR9B 2WBLA 5J0ZA 2CPTA 3UU8A 1SE7A 4UELA 1XWMA 4LFAT 2CE7A 4GYSA 5L2LA 4FI5A 4TNVA 3I0OA 2XQ7A 1BR4A 1HX1B 5F3JA 2D0UA 4OK0A 2QYWA 4O4JE 2XZEA 2W66A 4GK5E 3EAMA 5JDNA 5AQFB 1ZOYA 4YHHT 1BR0A 4YTNA 3WAJA 1MIYA 3C98B 1OXZA 2BKPA 4HFHA 2Q9QC 1N32T 3AVRA 2LEHA 3WI3A 3RKGA 3AEFA 3LJCA 3OJAA 2W67A 3NBXX 4UR9A 4EAHA 4AXPA 3EVYA 4K0KT 4YFSA 5FY1A 3RRCA 2MBGA 2VQET 2IC6A 5CGMA 2KT9A 4IDOA 4V1Av 4DO0A 3P4SA 2LM9A 4AIUA 3P8CD 1W0AA 3ZYMA 5L3DB 2Y6XA 4B3MT 1DU2A 4BJMA 2XM1A 3OYZA 3RF1A 3FZLB 2DCFA 4GIWA 4U3CA 3GN5A 3L3PA 4E7ZA 5CFBA 4IDNA 1Z8UA 1HX8A 4P0AA 4QXHB 3E08A 3CPZA 3LDQB 1IBMT 4KI0F 3PURA 3X1DA 5IHYA 2N9DA 3CVRA 2YDSA 1IAPA 2HN2A 4X66T 2X9HA 2K48A 3MZKB 4ILUA 5JVDE 2V6XA 4O8SA 3PV0F 2D2SA 4EOZB 4CI1B 2BG9B 1UX4A 4BA9A 4DNDA 2I0MA 3E22E 4UV8B 5CJ5A 4I4TE 1D0YA 4I0UA 4EZHA 3PUGA 1YD8G 2LOSA 2ZM8A 3IA3A 4ZI2D 1D0XA 3RX6A 3UU4A 5HCMA 1IBLT 5LHIB 2IMLA 2RP4A 3PUWF 3AAAB 3ZCJA 3R84B 4OHFA 2YKSA 2WB5A 3AXJB 4FJOA 1JNRA 2VVNA 2WCAA 4EGWA 2JQ9A 3WAKA 2H88A 4TV8E 4UVCB 3U3IA 4ILBA 2N1GA 4O2AE 4Q25A 3AAIA 1M7KA 3ZPOA 5HEJA 2V7MA 2FJBA 5A1LA 1HG2A 3FZKB 4LFBT 2DL1A 3PUYF 4CN4A 3I9WA 4IGUA 2CWYA 1D1BA 3CIRA 5HXSA 4QWNB 4IE5A 3AA0B 3H3MA 1MIVA 4JI3T 3AA7B 5L3FB 1T7SA 4PW8A 4XBFB 2YOEA 4YTPA 2CLYC 2E2AA 4JBWF 3R6NA 3L8RA 3PJAA 3QC9A 5LA6E 4K0UA 1W0BA 1HF8A 2E9XC 2ODVA 3B57A 5AQHB 1E2AA 2DI4A 3EDVA 3FZFB 1HNWT 2ODUA 2W4XA 1L0VA 3FXEB 4JI8T 2YDRA 3BQIA 5IUXA 3P50A 1T98A 2FUPA 3Q5DA 2X68A 4PFPA 4QH5A 2VWAA 4JI5T 3ZC1A 2BVLA 5DQWA 1V9DA 3ANWB 2V8SV 1WLXA 1XDPA 4C90A 4JLEA 3ZJ1A 1I6ZA 4IL9A 4B3ST 2Q9QB 1X79A 3J7Yq 2C0SA 3GWHA 5KX5E 1SUMB 1WFDA 4OYJA 3K3QC 1B7TA 1XNRT 4L5GA 4CQIA 4DBRA 3UT5E 4PK6A 4UVAB 4H63V 3LBXB 2V7KA 1VCSA 1YW0A 4CI2B 2VKDA 1OWAA 2NTYA 4TN7B 3N9QA 4PJJA 4HGAA 4ZI3D 3SFEA 5FXXA 5LYJE 4HTEA 1N36T 2JRKA 2MYSA 3AEDA 4DMWA 4ZI7E 5KDMC 3ZMTB 2WSSV 4ZHQE 3QNUA 3FXDB 4UIGA 1CUNA 1Z0PA 3UU3A 4ZS3A 4UF0A 2JQQA 2JMHA 3H37A 3CQXC 4JEHB 3AE8A 1HS7A 3JAEA 3P4QA 3ABVA 5JRCB 3CQGB 1BR1A 3RIUA 3OTOT 4IT4A 4HKAA 1J5ET 2KXPB 2DHRA 1JNZA 2V6YA 3P4PA 2V1DB 4JEUB 3I9YA 1J1JA 5L47A 2JQHA 2K5BB 2XAHB 2VK9A 4AISA 1HNXT 2J4GA 2Y8DA 3HKBE 2LT3A 2XQ3A 1WCRA 3TLVA 3ZT7A 4AKGA 3LSVA 3AECA 2C5IT 2N2NA 2CRBA 3RC8A 2UXDT 3ZC0A 2NW9A 2XQ6A 3KBTA 3S4UA 5L3CB 2PBIA 1R8IA 4H9RC 2K9AA 2DWKA 2WZHA 2F4VT 4AQFA 3PJAJ 4X65T 2XQYA 3CX8B 4H9OC 1EZ3A 2ZM6T 1MIWA 5LBMA 5LCYA 3N9NA 4HFCA 5FNVE 1YKEB 1QSDA 5J1GA 4X64T 1FEWA 2XTLA 2H89A 5AQTB 4F6RC 1XDOA 4XAXB 3V5SA 3K3NA 2XQAA 4WBNE 2QRXA 3RYHE 4HFDA 4BJNA 2EHOA 3P4RA 3EI0A 5FVLA 4A98A 2D9DA 5HCJA 4DR3T 5LG3A 2V7JA 1IJ5A 5JR9A 3ZJ2A 3RIAA 3NWIA 5AQQB 2XJ7A 3NZPA 5HWXA 2AE9A 2LLYA 4HE8A 5BR8T 4O4LE 5LB7B 2CLYB 3MACA 3RQWA 3ETUA 2J1DG 4GKJT 4GOUA 3DP7A 2E9XB 3T8OA 4DV4T 1O3XA 2WWUA 4PJLA 4UXNB 4F8HA 5FVKA 3QOFA 4M1PA 1VRBA 4PJMA 3NZQA 4XZCA 3JAFA 2PG8A 5DJQC 2R6GF 4H9PC 5LP6E 2UU9T 3QK6A 4MBQA 1FMWA 4WW0A 2LRKA 4Z91A 3C4ZA 2M67A 4LMJA 2X67A 1BR2A 3ZN0B 4A5XA 2CA5A 2A2FX 5EK2A 3PU3A 4DV5T 4GKKT 3K1SA 1NAFA 3ONJA 3ZT5A 2LKHA 3RI5A 1D1CA 5AQUB 2WU5A 1MMDA 2ZLYA 4JI7T 2FJDA 2X9XA 4KX6A 5CB4E 4TUYE 3LFMA 2IC9A 1LVKA 4QXCB 3PE0A 4UEMA 3RHWA 4IDQA 2XAFB 4CZZB 3UU5A 4KUMB 2D5UA 2XQ9A 5HYAA 5AQPB 2QGSA 4TWFA 2M6IA 4H9NC 4P0BA 4KBMB 3VRBA 2E5LT 1ZEEA 4X1YE 2KNDA 3L39A 2KMFA 2BG9A 4P09A 2IW5B 4IDZA 2GK9A 4KHPT 5BMVE 4OYKA 4QH1A 5GONE 3KV9A 2SPCA 4HFVA 5FMNA 3PUAA 2WY2A 4EYYR 2WS3A 3HKDE 5LBQB 4U7IA 4E7SA 3K3OA 4PFOA 1MNDA 3CQCB 4AKLA 5AQKB 4H63H 2IHR1 4P1NA 3SOLA 1Y01A 3KBUA 4DV2T 3PUSA 3V5UA 4YJ3E 2NW8A 3A7MA 1WR0A 2NR4A 5LXTE 1HCIA 3D0TA 5LMUT 4CI3B 4YJ2E 3VKHA 3N2GE 3NRYA 3VR8A 3VKGA 2WDVA 3E0ZA 3P7IA 4YHJA 5IWAT 4LFCT 3PUZF 3B5MA 2QA7A 5FP3A 2EHOD 3KINB 2CHNA 1ZV4X 5HWYA 4QXBB 2D0TA 1US7B 1WYCA 2M6BA 3PUVF 3DTOA 4DV6T 4PJNA 1FJGT 1LRZA 2HN1A 3NRXA 1SA0E 4A56A 4C91A 2XUEA 4YSYA 3CX6B 4PK5A 4AI6A 3GA8A 2XAJB 3UUNA 5JDLA 3AE7A 3FZHB 2J62A 3HKEE 3EABA 4IL4A 5IYZE 4U2YA 4TZ4C 5J2TE 2XQ5A 1GQEA 3PDYA 3ANWA 4JI6T 2E5VA 3KV6A 5ABFB 1MMGA 2Q9QA 5KXJA 1E1HB 3SS1A 3RH3A 5FYMA 2W62A 5FKYA 5JDMA 1UCUA 1UURA 2WDRA 3AAEB 1QLBA 3LBXA 2L8KA 3RGLA 3C50A 5LGTB 4WZXA 4U7YA 2CBIA 3JC6D 5LOVE 4EV6A 4YLHA 4UVBB 2YU2A 2CM0A 1T72A 5ABGA 4PAGA 2J47A 4IREA 3UQ7A 4GK0E 4KHZF 3KV4A 4HN9A 1YXRA 4B3TT 3AE3A 2HHHT 4TV9E 5JRCA 2XAGB 2G0UA 3ZYLA 2CXFA 1S35A 4IE4A 4JI0T 1OEDC 2A72A 3Q5XA 4U72A 5AQLB 3OVUA 2ZM0A 3AE5A 5L3GB 2IAKA 4HWHA 1VCTA 2ZMAA 2LOPA 3RKOA 3RC3A 3NKZA 5FXVA 2RPAA 5JDHA 2BZBA 4COFA 4TWDA 4HWIB 3Q2MA 1MMNA 2B76A 4NXNT 4WNKA 2MOZA 4LF9T 3G06A 1MNEA 2LSYA 1OEDE 5AQGB 4L9IA 5C2TA 4X5TA 1VOMA 3T1HT 2BDEA 5LNKA 5HAXA 5HXHA 3UU6A 1D0ZA 4X1KE 3TLTA 4ZZCA 5HEGA 3IHRA 4YY3T 4ISSA 5HEUA 2KWHA 5LJNA 2CEAA 4LF4T 2OV9A 2FJAA 2KINB 4HFIA 3TLWA 2YU1A 1SHZC 2ZM2A 2K3WA 1CHUA 4HFEA 4H9SE 2OLTA 3HKCE 2CXLA 4U31A 3CMLA 5EK3A 5JQGE 3ONXA 2V26A 2BKNA 1FMVA 3N9MA 3UFGA 2BBJA 5LGNB 3W15B 4ZOLE 4AQGA 2C5JA 2CMRA 1Y64B 2VVSA 4DUZT 1YQ3A 1E7PA 3VHLA 3OPCA 5L3EB 4X62T 5AQIB 4EEDA 1UUSA 4KP3C 5ETWA 2DLRA 3LG7A 1ZP0A 1IBKT 1M62A 4ADZA 2CBJA 2BS4A 2W2UA 2IIUA
chains in the Genus database with same CATH topology
2RP4A 1KNZA 3AAAB 3HL6A 2H7OA 2X9XA 3PU8A 4DBQA 5J2UE 3ZCJA 2UXXB 4OHFA 3R84B 3TKLB 5CB4E 1WYBA 4TUYE 3ZMSB 3CWZB 1U4QA 4N78D 3LFMA 5H6RB 2IC9A 5HXEA 4ZI3C 1LVKA 4QXCB 4FJOA 3RYFE 3PE0A 4UEMA 2KLQA 3N2KE 3WAKA 2LSJA 3I1AA 2XAFB 2PFVA 4TV8E 4CZZB 4KUMB 4UVCB 2D5UA 2YK0A 3U3IA 5DABA 5HYAA 5JDQA 2N1GA 2QGSA 4O2AE 2LSIA 3HA4A 2Q9QD 2WMNA 3GMIA 4H9NC 4P0BA 4ANJA 3AAIA 2YEVC 3ZPOA 2JPFA 4KBMB 5CA0E 2V7MA 3RYCE 3SRZA 1ZEEA 4X1YE 2KNDA 2LJLA 3C4WA 2CXDA 2KMFA 2VKOA 4P09A 1HG2A 2IW5B 5A1LA 5JH7E 2V7LA 2W63A 4EB6E 4IIJE 4IDZA 1HFAA 2VKHA 2X9WA 2GK9A 5EK4A 1U5PA 3Q5WA 3I9WA 4OYKA 5BMVE 4MALA 3B13A 4IGUA 2CWOA 2CWYA 4IE0A 2Z6EA 1G8XA 5GONE 1D1BA 5HXSA 4QWNB 4AKRB 4J2CA 4IE5A 3KV9A 1NWMX 2SPCA 3UFEA 4HFVA 3AA0B 3PUAA 3KFWX 5FMNA 4UV9B 1G73A 2YINA 4EYYR 3HKDE 5LBQB 4E7SA 5LJMA 1MIVA 3DJBA 4QHOA 3UUXB 3K3OA 4PFOA 2I59A 3AA7B 5L3FB 3JC6C 4I55E 4IE7A 4PW8A 4XBFB 3N2OA 1MNDA 3CQCB 4AKLA 2CLYC 4ASKA 4H63H 5LG4A 3A5XA 3CKDA 1QUUA 3R6NA 3SOLA 2MTQA 4ZS2A 3QC9A 3KBUA 5LA6E 4K0UA 3PUSA 3V5UA 4YJ3E 1HF8A 2E9XC 2ODVA 3I0QA 3B57A 2NW8A 4Z8XA 2XHEB 1IJ6A 2DI4A 3EDVA 2ODUA 5LXTE 3FXEB 3ZN1B 1ZHCA 3BQIA 1HCIA 3O1HA 3KVAA 3IBPA 1T98A 4G63A 4QX7B 4I43B 3D0TA 5TAOA 2RA1A 4CI3B 2E8IA 1LKXA 4YJ2E 3VKHA 2VB6A 2LHRA 4DMVA 1LVFA 2JMKA 3N2GE 3NRYA 4EXTA 5LGUB 4QKNA 5HXCA 3VKGA 3ZEFB 1UX5A 2X68A 4PFPA 4WBOA 3E0ZA 3H3AA 3ETVA 3P7IA 4YHJA 3ZMZB 2NOXA 2VWAA 4UF0B 2B1EA 3ZC1A 2BVLA 2QA7A 3AA6B 4L0RA 3ZLIA 5DQWA 2EHOD 1V9DA 5FP3A 3ANWB 3N9OA 2X9YA 3KINB 3KDSE 1WLXA 3MXZA 3N9LA 4C90A 1S94A 2DNXA 5E0OA 4JLEA 1ZV4X 2NP9A 2HH7A 5FXWA 3ZJ1A 5HWYA 2Q9QB 4H9QC 4QXBB 1YKHB 2D0TA 1US7B 1X79A 3J7Yq 2C0SA 1WYCA 2KZ7B 3GWHA 5KX5E 2VL8A 4NUUA 4OYJA 3K3QC 1B7TA 3BK9A 3ZCIA 3DTOA 2C5KT 3MK7C 3O4XE 2W0GA 2W00A 4PJNA 4L5GA 5LHHB 4CQIA 3SWHA 4DBRA 3UT5E 4PK6A 4UVAB 4H63V 1LRZA 3NRXA 3LBXB 1H7CA 1SA0E 3KVBA 4A56A 4C91A 4QX8B 2V7KA 2XUEA 3AA1B 4IHJE 3CX6B 3F2EA 4PK5A 1YW0A 4CI2B 4AI6A 2L3LA 3GA8A 4CXWA 4X20E 2VKDA 1OWAA 3BQLA 3ZYKA 2XAJB 2NTYA 4TN7B 3N9QA 4PJJA 4ERRA 4HGAA 3UUNA 3HI2A 3K8PC 5JDLA 4ZI3D 5L3BB 5FXXA 1HG5A 3UTKA 5LYJE 4HTEA 3O9XA 3HKEE 2JRKA 2MYSA 5KMGP 5IYZE 4DMWA 4ZI7E 2X0LB 5KDMC 4PK4A 3LK2B 3ZMTB 2WSSV 4ZHQE 3FXDB 4DVDA 4UIGA 1CUNA 4AKHA 1Z0PA 4TZ4C 3MA9A 3LK42 5J2TE 3FBLA 4ZS3A 4UF0A 2JQQA 3N9PA 5ADXL 2X51A 2JMHA 3H37A 3CQXC 3PDYA 2H3RA 3ANWA 2LSGA 4JEHB 4ISTA 1HS7A 3RPUA 3MKDA 4MFRA 5JREA 5JRCB 3CQGB 3QUJA 1BR1A 4KMCA 4CXXA 3KV6A 5FXZA 3OBVE 1MMGA 2Q9QA 3M65A 5FY0A 3F57A 4HKAA 2KXPB 3FBZA 2DHRA 2XASB 3PUQA 3FB2A 4HEAA 3PTRB 2A3DA 2HPJA 3F31A 1E1HB 3SS1A 3L09A 4I50E 2V1DB 4JEUB 3I9YA 3O1IA 3RH3A 5FYMA 2W62A 2K5BB 2XAHB 2VK9A 4MHCA 5JDFA 5HXRA 5JDMA 4X1IE 1IZNB 2CCQA 4EIWA 1UCUA 2Y8DA 2EHOB 3AAEB 3HKBE 3LBXA 2L8KA 2LT3A 3J9X1 3C50A 5LGTB 2WAUA 3JC6D 5C8YE 2ES0A 5LOVE 5FY7A 4YLHA 4UVBB 4JUYA 1D1AA 4AKGA 2YU2A 5JR9B 2C5IT 2WBLA 2CM0A 2N2NA 3UUMA 3RC8A 4UELA 2V7IA 3EUHA 3O1JA 3ZC0A 2NW9A 4PAGA 3KBTA 2CE7A 4GYSA 3S4UA 5L3CB 5L2LA 4FI5A 2E9XD 2PBIA 3I0OA 3IEEA 4GK0E 1BR4A 3C64A 2DWGA 2NWBA 4H9RC 2KWIB 4CXYA 2K9AA 3KV4A 5F3JA 2DWKA 2D0UA 3FHNA 4HN9A 4AQFA 2NW7A 2ACXA 2XQYA 4OK0A 4O4JE 3CX8B 2VASA 4H9OC 2OA5A 3BQKA 3ESLA 4GK5E 1EZ3A 1MIWA 4TV9E 5LBMA 5LCYA 5JDNA 3N9NA 3UULA 5JRCA 5FNVE 2XAGB 1YKEB 2G0UA 1FIOA 3ZMUB 1BR0A 1QSDA 3C51A 5J1GA 2CXFA 4O2BE 3ZYLA 3KV5A 1FEWA 2XTLA 3WAJA 1MIYA 3GN5B 4F6RC 3OYXA 1S35A 4IE4A 3U78A 2UXNB 2W61A 3C98B 2A72A 4XAXB 3Q5XA 3V5SA 1OXZA 1HTJF 2Y48B 3K3NA 4U72A 4WBNE 5H6QB 3RYHE 4BJNA 2EHOA 2Q9QC 2ZM0A 2HPLA 5L3GB 2IAKA 4G2AA 3AVRA 2LEHA 2ZMAA 3RRWA 3WI3A 3ZMVB 2LOPA 3RKOA 3LJCA 3RC3A 3OJAA 1WR6A 3NBXX 2V7JA 1IJ5A 5FXVA 2LHNA 4EAHA 5JR9A 5JDHA 2BZBA 4AXPA 3EVYA 3Q2MA 1MMNA 3ZJ2A 4EZ4A 4YFSA 3NZPA 1MMAA 4WNKA 5HWXA 2MOZA 5FY1A 3RRCA 1MNEA 5M4YA 2MBGA 2P9BA 2LSYA 2IC6A 2KT9A 4NUVA 3C4XA 4HE8A 4O4LE 4V1Av 4DO0A 3Q9DA 2K24A 2LM9A 4L9IA 2L9QA 2BVMA 3P8CD 1VOMA 2WMOA 3ZYMA 5L3DB 2BDEA 2LE8A 2CLYB 2Y6XA 3MACA 5LNKA 4B6XA 4BJMA 5HAXA 5HXHA 4OFZA 1D0ZA 2J1DG 3ETUA 3OYZA 5CA1E 2DCFA 4X1KE 4U74A 4GOUA 4GIWA 4EYUA 5JDGA 4AQFC 3DP7A 3GN5A 2E9XB 3T8OA 3L3PA 3IHRA 1O3XA 3MJXA 4E7ZA 4ISSA 4O4IE 2KWHA 5LJNA 4GYRA 2NTXA 2WWUA 4PJLA 1ZKEA 4UXNB 1HX8A 4P0AA 2CEAA 4M1PA 4QXHB 3E08A 3CPZA 1VRBA 3IF8B 3OKQA 4PJMA 5DQVA 3NZQA 4XZCA 2KINB 3PURA 5EZYE 5IHYA 2YU1A 2WM9A 1SHZC 2N9DA 1KK7A 3CVRA 2ZM2A 2PG8A 5DJQC 4IE6A 4H9SE 3AB3B 4H9PC 3HKCE 4MLKA 4TX5A 5LP6E 2CXLA 3CMLA 1IAPA 1FMWA 2X9HA 3QK6A 4MBQA 4WW0A 2K48A 3MZKB 5EK3A 1AJ3A 5JQGE 3ONXA 4AKIA 2V26A 4ILUA 3HR0A 2XAQB 5F8PA 3EDUA 1FMVA 3N9MA 5JVDE 2JJ9A 4O8SA 5LGNB 2H7VC 2EHOC 3C4ZA 3W15B 4ZI2C 4ZOLE 2D2SA 4AQGA 4EOZB 4CI1B 2M67A 2C5JA 2CMRA 4PNIA 4BAYB 1UX4A 4BA9A 1Y64B 3LK3B 4DNDA 3E22E 2X67A 5LHGB 1BR2A 3VU7H 4UV8B 1WRDA 3VHLA 5L3EB 3AVSA 3ZN0B 4I4TE 5JR9C 4O4HE 1D0YA 2CA5A 2A2FX 3CX7B 4KP3C 4EZHA 5ETWA 2DLRA 3PUGA 5EK2A 2PJQA 3N5LA 2VKJA 3PU3A 1YD8G 3LG7A 1NAFA 2LOSA 2X66A 4ADZA 2ZM8A 4ZI2D 1D0XA 5AFUL 1D1CA 3RX6A 2LSKA 3RYIE 1MMDA 2ZLYA 2E9XA 5LHIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CUN A;  3F31 A;  3UUM A;  1QUU A;  3UUL A;  1OWA A;  1AJ3 A;  2SPC A;  1U4Q A;  2ODV A;  3UUN A;  3LBX A;  3EDV A;  2ODU A;  3PE0 A;  1S35 A;  1HCI A;  1WLX A;  1U5P A;  3LBX B;  3FB2 A; 
#chains in the Genus database with same CATH topology
 1KNZ A;  2H7O A;  4DBQ A;  4U33 A;  2UXX B;  3TKL B;  3ZMS B;  1U4Q A;  4ZI3 C;  3AEE A;  3Q5E A;  3ZT6 A;  3RQU A;  4LF7 T;  4YSX A;  5L4E A;  1UK5 A;  3N2K E;  2LSJ A;  4DR1 T;  2A9U A;  5DAB A;  3ZKR A;  5JDQ A;  1W09 A;  3HA4 A;  2Q9Q D;  2WMN A;  3GMI A;  4ANJ A;  2YEV C;  3RYC E;  3C4W A;  2LJL A;  2CXD A;  4A97 A;  2XPK A;  2W63 A;  4IIJ E;  1HFA A;  2E9X A;  4DV1 T;  1XZY A;  4MAL A;  2CWO A;  3SFD A;  4DUY T;  2Z6E A;  1G8X A;  4CN1 A;  2CHO A;  4J2C A;  3UFE A;  3KFW X;  4UV9 B;  1G73 A;  3VRA A;  4DV0 T;  3AE4 A;  2I59 A;  4DV3 T;  2YDQ A;  4DV7 T;  4IE7 A;  3N2O A;  3TLS A;  4ASK A;  3AEB A;  1XMQ T;  3A5X A;  3CKD A;  1QUU A;  2MTQ A;  5ABE A;  4U2Z A;  4Z8X A;  1KFY A;  2XHE B;  1IJ6 A;  4DR4 T;  4JI1 T;  1ZHC A;  4I43 B;  4IDP A;  1I94 T;  2E8I A;  2VB6 A;  2LHR A;  2IDO B;  4EXT A;  4QKN A;  3ZEF B;  4WBO A;  3ETV A;  2NOX A;  3QB5 A;  3AE2 A;  2WQY A;  1YQ4 A;  3AA6 B;  3ZLI A;  1OED B;  3KDS E;  4NPP A;  1S94 A;  5E0O A;  5FXW A;  2NP9 A;  2HH7 A;  4H9Q C;  4JI4 T;  5AQO B;  2FBW A;  3ZCI A;  2W0G A;  5LHH B;  3KVB A;  3AA1 B;  4IHJ E;  5LMN T;  3F2E A;  2L3L A;  2WP9 A;  5AQM B;  5AQR B;  5FL1 A;  2V5C A;  2AXD S;  5L3B B;  3AEG A;  3JCF A;  1HG5 A;  4LF5 T;  3O9X A;  2ACZ A;  2X0L B;  4PK4 A;  3LK2 B;  4DVD A;  3MA9 A;  3FBL A;  1J5W A;  5ADX L;  2X51 A;  4IST A;  5JTG A;  5HEH A;  3RPU A;  4YSZ A;  4JYA T;  3MKD A;  5JRE A;  5ABH A;  3RLF F;  2XAS B;  3PUQ A;  4HEA A;  3PTR B;  3ZSS A;  2UUA T;  2A3D A;  3L09 A;  4I50 E;  4AQY T;  5JDF A;  3AXJ A;  2UUB T;  2UXB T;  4NIQ A;  2ES0 A;  1D1A A;  2XM2 A;  4WYV A;  1W9R A;  3UUM A;  1NEK A;  2V7I A;  3EUH A;  4YTM A;  3O1J A;  2E9X D;  3IEE A;  3C64 A;  5AQV B;  2DWG A;  2XSA A;  2NWB A;  4DR5 T;  2KWI B;  4CXY A;  2IUB A;  3FHN A;  2NW7 A;  2ACX A;  2VAS A;  2JQK A;  2OA5 A;  3BQK A;  3ESL A;  5AQJ B;  4LMK A;  3UUL A;  1N34 T;  1FIO A;  3ZMU B;  5ABF A;  3C51 A;  4O2B E;  3KV5 A;  3GN5 B;  1NEN A;  3OYX A;  3U78 A;  4HWD A;  2UXN B;  2W61 A;  2I6H A;  1HTJ F;  2Y48 B;  3RIU C;  5H6Q B;  2X0Y A;  2HPL A;  4DR7 T;  4G2A A;  4Z90 A;  4HWF A;  2UXC T;  3RRW A;  3ZMV B;  1XNQ T;  1WR6 A;  2LHN A;  2V5D A;  4JI2 T;  4EZ4 A;  2FJE A;  1MMA A;  5C3J A;  5M4Y A;  2P9B A;  4NUV A;  3C4X A;  3JAD A;  5FL0 A;  3Q9D A;  2K24 A;  2L9Q A;  2BVM A;  2WMO A;  2LE8 A;  2KSR A;  5F5W A;  4B6X A;  4TWH A;  4OFZ A;  5CA1 E;  4ILC A;  4CN6 A;  4U74 A;  4EYU A;  5JDG A;  4AQF C;  3MJX A;  2XY8 B;  4O4I E;  4GYR A;  2NTX A;  1ZKE A;  3IF8 B;  3OKQ A;  5DQV A;  5EZY E;  2WM9 A;  1KK7 A;  4IE6 A;  3AB3 B;  4MLK A;  4TX5 A;  2LM2 A;  4QH4 A;  1AJ3 A;  4AKI A;  3HR0 A;  2XAQ B;  5F8P A;  1UGO A;  3EDU A;  3UUB A;  2JJ9 A;  2H7V C;  2EHO C;  4ZI2 C;  2MAW A;  3M3Z B;  4PNI A;  4BAY B;  3LK3 B;  4HFB A;  5LHG B;  3VU7 H;  1WRD A;  3AVS A;  5JR9 C;  4O4H E;  3CX7 B;  2PJQ A;  3N5L A;  2VKJ A;  3CK6 A;  2XQ8 A;  4DR2 T;  4LML A;  2VL0 A;  2X66 A;  5AFU L;  2LSK A;  3RYI E;  2WWV A;  3HL6 A;  3PU8 A;  5J2U E;  4B3R T;  3ZST A;  1WYB A;  3CWZ B;  4N78 D;  5H6R B;  5HXE A;  2LKG A;  3RYF E;  2KLQ A;  2UUC T;  3RIF A;  3I1A A;  2PFV A;  2YK0 A;  4ZEY A;  1X9B A;  2LSI A;  2BS3 A;  5HEO A;  2JPF A;  5CA0 E;  3SRZ A;  1XMO T;  2VKO A;  5JH7 E;  3UQ4 A;  2YN6 A;  2V7L A;  4EB6 E;  4DR6 T;  3AE1 A;  2VKH A;  2X9W A;  5EK4 A;  1U5P A;  4JV5 T;  4LF8 T;  3Q5W A;  4ZZB A;  3B13 A;  1KEY A;  4IE0 A;  1HR0 T;  2BBH A;  3P4W A;  4AKR B;  4NXM T;  2VUR A;  1NWM X;  2YIN A;  5LJM A;  3DJB A;  4QHO A;  3UUX B;  3JC6 C;  3AE9 A;  4I55 E;  3FZM B;  3TLU A;  5L4H A;  5LG4 A;  2LRL A;  1N33 T;  4ZS2 A;  2JIW A;  3I0Q A;  3QB5 K;  3ZN1 B;  3O1H A;  3KVA A;  3IBP A;  4G63 A;  4QX7 B;  5TAO A;  2RA1 A;  2XSB A;  1LKX A;  4DMV A;  2QVA A;  1LVF A;  2JMK A;  5LGU B;  5HXC A;  1UX5 A;  4YXD A;  3H3A A;  3ZMZ B;  4YT0 A;  4UF0 B;  2MPK A;  2B1E A;  4L0R A;  2PTF A;  3N9O A;  2X9Y A;  2VQF T;  5AQN B;  3MXZ A;  3N9L A;  2DNX A;  3ONL C;  2BG9 C;  4LF6 T;  1YKH B;  2V6Y B;  2KZ7 B;  2WDQ A;  2VL8 A;  4NUU A;  3BK9 A;  3VR9 A;  2C5K T;  3MK7 C;  3O4X E;  2W00 A;  4DID B;  1HNZ T;  3SWH A;  1KNR A;  4HWC A;  1H7C A;  4QX8 B;  4ILA A;  4CXW A;  4X20 E;  3T1Y T;  4OX9 T;  3BQL A;  4TNW A;  3ZYK A;  4ERR A;  3HI2 A;  3K8P C;  2BS2 A;  3A8Y C;  3UTK A;  2BG9 E;  5KMG P;  1T8B A;  2WU2 A;  4AKH A;  3LK4 2;  2X0H A;  3N9P A;  2XQ4 A;  2H3R A;  1OED A;  2LSG A;  4MFR A;  3QUJ A;  4KMC A;  4CXX A;  5FXZ A;  3OBV E;  3M65 A;  3AEA A;  1KNP A;  5FY0 A;  3PUX F;  3F57 A;  3FBZ A;  3FB2 A;  2HPJ A;  3F31 A;  4ZXL A;  3O1I A;  4MHC A;  5HXR A;  4X1I E;  1IZN B;  2CCQ A;  4EIW A;  5AQS B;  3NVO A;  2EHO B;  3J9X 1;  2WAU A;  3AE6 A;  3EHZ A;  2WZI A;  5C8Y E;  2BKO A;  5FY7 A;  1KF6 A;  4JUY A;  4EEB A;  5JR9 B;  2WBL A;  5J0Z A;  2CPT A;  3UU8 A;  1SE7 A;  4UEL A;  1XWM A;  4LFA T;  2CE7 A;  4GYS A;  5L2L A;  4FI5 A;  4TNV A;  3I0O A;  2XQ7 A;  1BR4 A;  1HX1 B;  5F3J A;  2D0U A;  4OK0 A;  2QYW A;  4O4J E;  2XZE A;  2W66 A;  4GK5 E;  3EAM A;  5JDN A;  5AQF B;  1ZOY A;  4YHH T;  1BR0 A;  4YTN A;  3WAJ A;  1MIY A;  3C98 B;  1OXZ A;  2BKP A;  4HFH A;  2Q9Q C;  1N32 T;  3AVR A;  2LEH A;  3WI3 A;  3RKG A;  3AEF A;  3LJC A;  3OJA A;  2W67 A;  3NBX X;  4UR9 A;  4EAH A;  4AXP A;  3EVY A;  4K0K T;  4YFS A;  5FY1 A;  3RRC A;  2MBG A;  2VQE T;  2IC6 A;  5CGM A;  2KT9 A;  4IDO A;  4V1A v;  4DO0 A;  3P4S A;  2LM9 A;  4AIU A;  3P8C D;  1W0A A;  3ZYM A;  5L3D B;  2Y6X A;  4B3M T;  1DU2 A;  4BJM A;  2XM1 A;  3OYZ A;  3RF1 A;  3FZL B;  2DCF A;  4GIW A;  4U3C A;  3GN5 A;  3L3P A;  4E7Z A;  5CFB A;  4IDN A;  1Z8U A;  1HX8 A;  4P0A A;  4QXH B;  3E08 A;  3CPZ A;  3LDQ B;  1IBM T;  4KI0 F;  3PUR A;  3X1D A;  5IHY A;  2N9D A;  3CVR A;  2YDS A;  1IAP A;  2HN2 A;  4X66 T;  2X9H A;  2K48 A;  3MZK B;  4ILU A;  5JVD E;  2V6X A;  4O8S A;  3PV0 F;  2D2S A;  4EOZ B;  4CI1 B;  2BG9 B;  1UX4 A;  4BA9 A;  4DND A;  2I0M A;  3E22 E;  4UV8 B;  5CJ5 A;  4I4T E;  1D0Y A;  4I0U A;  4EZH A;  3PUG A;  1YD8 G;  2LOS A;  2ZM8 A;  3IA3 A;  4ZI2 D;  1D0X A;  3RX6 A;  3UU4 A;  5HCM A;  1IBL T;  5LHI B;  2IML A;  2RP4 A;  3PUW F;  3AAA B;  3ZCJ A;  3R84 B;  4OHF A;  2YKS A;  2WB5 A;  3AXJ B;  4FJO A;  1JNR A;  2VVN A;  2WCA A;  4EGW A;  2JQ9 A;  3WAK A;  2H88 A;  4TV8 E;  4UVC B;  3U3I A;  4ILB A;  2N1G A;  4O2A E;  4Q25 A;  3AAI A;  1M7K A;  3ZPO A;  5HEJ A;  2V7M A;  2FJB A;  5A1L A;  1HG2 A;  3FZK B;  4LFB T;  2DL1 A;  3PUY F;  4CN4 A;  3I9W A;  4IGU A;  2CWY A;  1D1B A;  3CIR A;  5HXS A;  4QWN B;  4IE5 A;  3AA0 B;  3H3M A;  1MIV A;  4JI3 T;  3AA7 B;  5L3F B;  1T7S A;  4PW8 A;  4XBF B;  2YOE A;  4YTP A;  2CLY C;  2E2A A;  4JBW F;  3R6N A;  3L8R A;  3PJA A;  3QC9 A;  5LA6 E;  4K0U A;  1W0B A;  1HF8 A;  2E9X C;  2ODV A;  3B57 A;  5AQH B;  1E2A A;  2DI4 A;  3EDV A;  3FZF B;  1HNW T;  2ODU A;  2W4X A;  1L0V A;  3FXE B;  4JI8 T;  2YDR A;  3BQI A;  5IUX A;  3P50 A;  1T98 A;  2FUP A;  3Q5D A;  2X68 A;  4PFP A;  4QH5 A;  2VWA A;  4JI5 T;  3ZC1 A;  2BVL A;  5DQW A;  1V9D A;  3ANW B;  2V8S V;  1WLX A;  1XDP A;  4C90 A;  4JLE A;  3ZJ1 A;  1I6Z A;  4IL9 A;  4B3S T;  2Q9Q B;  1X79 A;  3J7Y q;  2C0S A;  3GWH A;  5KX5 E;  1SUM B;  1WFD A;  4OYJ A;  3K3Q C;  1B7T A;  1XNR T;  4L5G A;  4CQI A;  4DBR A;  3UT5 E;  4PK6 A;  4UVA B;  4H63 V;  3LBX B;  2V7K A;  1VCS A;  1YW0 A;  4CI2 B;  2VKD A;  1OWA A;  2NTY A;  4TN7 B;  3N9Q A;  4PJJ A;  4HGA A;  4ZI3 D;  3SFE A;  5FXX A;  5LYJ E;  4HTE A;  1N36 T;  2JRK A;  2MYS A;  3AED A;  4DMW A;  4ZI7 E;  5KDM C;  3ZMT B;  2WSS V;  4ZHQ E;  3QNU A;  3FXD B;  4UIG A;  1CUN A;  1Z0P A;  3UU3 A;  4ZS3 A;  4UF0 A;  2JQQ A;  2JMH A;  3H37 A;  3CQX C;  4JEH B;  3AE8 A;  1HS7 A;  3JAE A;  3P4Q A;  3ABV A;  5JRC B;  3CQG B;  1BR1 A;  3RIU A;  3OTO T;  4IT4 A;  4HKA A;  1J5E T;  2KXP B;  2DHR A;  1JNZ A;  2V6Y A;  3P4P A;  2V1D B;  4JEU B;  3I9Y A;  1J1J A;  5L47 A;  2JQH A;  2K5B B;  2XAH B;  2VK9 A;  4AIS A;  1HNX T;  2J4G A;  2Y8D A;  3HKB E;  2LT3 A;  2XQ3 A;  1WCR A;  3TLV A;  3ZT7 A;  4AKG A;  3LSV A;  3AEC A;  2C5I T;  2N2N A;  2CRB A;  3RC8 A;  2UXD T;  3ZC0 A;  2NW9 A;  2XQ6 A;  3KBT A;  3S4U A;  5L3C B;  2PBI A;  1R8I A;  4H9R C;  2K9A A;  2DWK A;  2WZH A;  2F4V T;  4AQF A;  3PJA J;  4X65 T;  2XQY A;  3CX8 B;  4H9O C;  1EZ3 A;  2ZM6 T;  1MIW A;  5LBM A;  5LCY A;  3N9N A;  4HFC A;  5FNV E;  1YKE B;  1QSD A;  5J1G A;  4X64 T;  1FEW A;  2XTL A;  2H89 A;  5AQT B;  4F6R C;  1XDO A;  4XAX B;  3V5S A;  3K3N A;  2XQA A;  4WBN E;  2QRX A;  3RYH E;  4HFD A;  4BJN A;  2EHO A;  3P4R A;  3EI0 A;  5FVL A;  4A98 A;  2D9D A;  5HCJ A;  4DR3 T;  5LG3 A;  2V7J A;  1IJ5 A;  5JR9 A;  3ZJ2 A;  3RIA A;  3NWI A;  5AQQ B;  2XJ7 A;  3NZP A;  5HWX A;  2AE9 A;  2LLY A;  4HE8 A;  5BR8 T;  4O4L E;  5LB7 B;  2CLY B;  3MAC A;  3RQW A;  3ETU A;  2J1D G;  4GKJ T;  4GOU A;  3DP7 A;  2E9X B;  3T8O A;  4DV4 T;  1O3X A;  2WWU A;  4PJL A;  4UXN B;  4F8H A;  5FVK A;  3QOF A;  4M1P A;  1VRB A;  4PJM A;  3NZQ A;  4XZC A;  3JAF A;  2PG8 A;  5DJQ C;  2R6G F;  4H9P C;  5LP6 E;  2UU9 T;  3QK6 A;  4MBQ A;  1FMW A;  4WW0 A;  2LRK A;  4Z91 A;  3C4Z A;  2M67 A;  4LMJ A;  2X67 A;  1BR2 A;  3ZN0 B;  4A5X A;  2CA5 A;  2A2F X;  5EK2 A;  3PU3 A;  4DV5 T;  4GKK T;  3K1S A;  1NAF A;  3ONJ A;  3ZT5 A;  2LKH A;  3RI5 A;  1D1C A;  5AQU B;  2WU5 A;  1MMD A;  2ZLY A;  4JI7 T;  2FJD A;  2X9X A;  4KX6 A;  5CB4 E;  4TUY E;  3LFM A;  2IC9 A;  1LVK A;  4QXC B;  3PE0 A;  4UEM A;  3RHW A;  4IDQ A;  2XAF B;  4CZZ B;  3UU5 A;  4KUM B;  2D5U A;  2XQ9 A;  5HYA A;  5AQP B;  2QGS A;  4TWF A;  2M6I A;  4H9N C;  4P0B A;  4KBM B;  3VRB A;  2E5L T;  1ZEE A;  4X1Y E;  2KND A;  3L39 A;  2KMF A;  2BG9 A;  4P09 A;  2IW5 B;  4IDZ A;  2GK9 A;  4KHP T;  5BMV E;  4OYK A;  4QH1 A;  5GON E;  3KV9 A;  2SPC A;  4HFV A;  5FMN A;  3PUA A;  2WY2 A;  4EYY R;  2WS3 A;  3HKD E;  5LBQ B;  4U7I A;  4E7S A;  3K3O A;  4PFO A;  1MND A;  3CQC B;  4AKL A;  5AQK B;  4H63 H;  2IHR 1;  4P1N A;  3SOL A;  1Y01 A;  3KBU A;  4DV2 T;  3PUS A;  3V5U A;  4YJ3 E;  2NW8 A;  3A7M A;  1WR0 A;  2NR4 A;  5LXT E;  1HCI A;  3D0T A;  5LMU T;  4CI3 B;  4YJ2 E;  3VKH A;  3N2G E;  3NRY A;  3VR8 A;  3VKG A;  2WDV A;  3E0Z A;  3P7I A;  4YHJ A;  5IWA T;  4LFC T;  3PUZ F;  3B5M A;  2QA7 A;  5FP3 A;  2EHO D;  3KIN B;  2CHN A;  1ZV4 X;  5HWY A;  4QXB B;  2D0T A;  1US7 B;  1WYC A;  2M6B A;  3PUV F;  3DTO A;  4DV6 T;  4PJN A;  1FJG T;  1LRZ A;  2HN1 A;  3NRX A;  1SA0 E;  4A56 A;  4C91 A;  2XUE A;  4YSY A;  3CX6 B;  4PK5 A;  4AI6 A;  3GA8 A;  2XAJ B;  3UUN A;  5JDL A;  3AE7 A;  3FZH B;  2J62 A;  3HKE E;  3EAB A;  4IL4 A;  5IYZ E;  4U2Y A;  4TZ4 C;  5J2T E;  2XQ5 A;  1GQE A;  3PDY A;  3ANW A;  4JI6 T;  2E5V A;  3KV6 A;  5ABF B;  1MMG A;  2Q9Q A;  5KXJ A;  1E1H B;  3SS1 A;  3RH3 A;  5FYM A;  2W62 A;  5FKY A;  5JDM A;  1UCU A;  1UUR A;  2WDR A;  3AAE B;  1QLB A;  3LBX A;  2L8K A;  3RGL A;  3C50 A;  5LGT B;  4WZX A;  4U7Y A;  2CBI A;  3JC6 D;  5LOV E;  4EV6 A;  4YLH A;  4UVB B;  2YU2 A;  2CM0 A;  1T72 A;  5ABG A;  4PAG A;  2J47 A;  4IRE A;  3UQ7 A;  4GK0 E;  4KHZ F;  3KV4 A;  4HN9 A;  1YXR A;  4B3T T;  3AE3 A;  2HHH T;  4TV9 E;  5JRC A;  2XAG B;  2G0U A;  3ZYL A;  2CXF A;  1S35 A;  4IE4 A;  4JI0 T;  1OED C;  2A72 A;  3Q5X A;  4U72 A;  5AQL B;  3OVU A;  2ZM0 A;  3AE5 A;  5L3G B;  2IAK A;  4HWH A;  1VCT A;  2ZMA A;  2LOP A;  3RKO A;  3RC3 A;  3NKZ A;  5FXV A;  2RPA A;  5JDH A;  2BZB A;  4COF A;  4TWD A;  4HWI B;  3Q2M A;  1MMN A;  2B76 A;  4NXN T;  4WNK A;  2MOZ A;  4LF9 T;  3G06 A;  1MNE A;  2LSY A;  1OED E;  5AQG B;  4L9I A;  5C2T A;  4X5T A;  1VOM A;  3T1H T;  2BDE A;  5LNK A;  5HAX A;  5HXH A;  3UU6 A;  1D0Z A;  4X1K E;  3TLT A;  4ZZC A;  5HEG A;  3IHR A;  4YY3 T;  4ISS A;  5HEU A;  2KWH A;  5LJN A;  2CEA A;  4LF4 T;  2OV9 A;  2FJA A;  2KIN B;  4HFI A;  3TLW A;  2YU1 A;  1SHZ C;  2ZM2 A;  2K3W A;  1CHU A;  4HFE A;  4H9S E;  2OLT A;  3HKC E;  2CXL A;  4U31 A;  3CML A;  5EK3 A;  5JQG E;  3ONX A;  2V26 A;  2BKN A;  1FMV A;  3N9M A;  3UFG A;  2BBJ A;  5LGN B;  3W15 B;  4ZOL E;  4AQG A;  2C5J A;  2CMR A;  1Y64 B;  2VVS A;  4DUZ T;  1YQ3 A;  1E7P A;  3VHL A;  3OPC A;  5L3E B;  4X62 T;  5AQI B;  4EED A;  1UUS A;  4KP3 C;  5ETW A;  2DLR A;  3LG7 A;  1ZP0 A;  1IBK T;  1M62 A;  4ADZ A;  2CBJ A;  2BS4 A;  2W2U A;  2IIU A; 
#chains in the Genus database with same CATH homology
 2RP4 A;  1KNZ A;  3AAA B;  3HL6 A;  2H7O A;  2X9X A;  3PU8 A;  4DBQ A;  5J2U E;  3ZCJ A;  2UXX B;  4OHF A;  3R84 B;  3TKL B;  5CB4 E;  1WYB A;  4TUY E;  3ZMS B;  3CWZ B;  1U4Q A;  4N78 D;  3LFM A;  5H6R B;  2IC9 A;  5HXE A;  4ZI3 C;  1LVK A;  4QXC B;  4FJO A;  3RYF E;  3PE0 A;  4UEM A;  2KLQ A;  3N2K E;  3WAK A;  2LSJ A;  3I1A A;  2XAF B;  2PFV A;  4TV8 E;  4CZZ B;  4KUM B;  4UVC B;  2D5U A;  2YK0 A;  3U3I A;  5DAB A;  5HYA A;  5JDQ A;  2N1G A;  2QGS A;  4O2A E;  2LSI A;  3HA4 A;  2Q9Q D;  2WMN A;  3GMI A;  4H9N C;  4P0B A;  4ANJ A;  3AAI A;  2YEV C;  3ZPO A;  2JPF A;  4KBM B;  5CA0 E;  2V7M A;  3RYC E;  3SRZ A;  1ZEE A;  4X1Y E;  2KND A;  2LJL A;  3C4W A;  2CXD A;  2KMF A;  2VKO A;  4P09 A;  1HG2 A;  2IW5 B;  5A1L A;  5JH7 E;  2V7L A;  2W63 A;  4EB6 E;  4IIJ E;  4IDZ A;  1HFA A;  2VKH A;  2X9W A;  2GK9 A;  5EK4 A;  1U5P A;  3Q5W A;  3I9W A;  4OYK A;  5BMV E;  4MAL A;  3B13 A;  4IGU A;  2CWO A;  2CWY A;  4IE0 A;  2Z6E A;  1G8X A;  5GON E;  1D1B A;  5HXS A;  4QWN B;  4AKR B;  4J2C A;  4IE5 A;  3KV9 A;  1NWM X;  2SPC A;  3UFE A;  4HFV A;  3AA0 B;  3PUA A;  3KFW X;  5FMN A;  4UV9 B;  1G73 A;  2YIN A;  4EYY R;  3HKD E;  5LBQ B;  4E7S A;  5LJM A;  1MIV A;  3DJB A;  4QHO A;  3UUX B;  3K3O A;  4PFO A;  2I59 A;  3AA7 B;  5L3F B;  3JC6 C;  4I55 E;  4IE7 A;  4PW8 A;  4XBF B;  3N2O A;  1MND A;  3CQC B;  4AKL A;  2CLY C;  4ASK A;  4H63 H;  5LG4 A;  3A5X A;  3CKD A;  1QUU A;  3R6N A;  3SOL A;  2MTQ A;  4ZS2 A;  3QC9 A;  3KBU A;  5LA6 E;  4K0U A;  3PUS A;  3V5U A;  4YJ3 E;  1HF8 A;  2E9X C;  2ODV A;  3I0Q A;  3B57 A;  2NW8 A;  4Z8X A;  2XHE B;  1IJ6 A;  2DI4 A;  3EDV A;  2ODU A;  5LXT E;  3FXE B;  3ZN1 B;  1ZHC A;  3BQI A;  1HCI A;  3O1H A;  3KVA A;  3IBP A;  1T98 A;  4G63 A;  4QX7 B;  4I43 B;  3D0T A;  5TAO A;  2RA1 A;  4CI3 B;  2E8I A;  1LKX A;  4YJ2 E;  3VKH A;  2VB6 A;  2LHR A;  4DMV A;  1LVF A;  2JMK A;  3N2G E;  3NRY A;  4EXT A;  5LGU B;  4QKN A;  5HXC A;  3VKG A;  3ZEF B;  1UX5 A;  2X68 A;  4PFP A;  4WBO A;  3E0Z A;  3H3A A;  3ETV A;  3P7I A;  4YHJ A;  3ZMZ B;  2NOX A;  2VWA A;  4UF0 B;  2B1E A;  3ZC1 A;  2BVL A;  2QA7 A;  3AA6 B;  4L0R A;  3ZLI A;  5DQW A;  2EHO D;  1V9D A;  5FP3 A;  3ANW B;  3N9O A;  2X9Y A;  3KIN B;  3KDS E;  1WLX A;  3MXZ A;  3N9L A;  4C90 A;  1S94 A;  2DNX A;  5E0O A;  4JLE A;  1ZV4 X;  2NP9 A;  2HH7 A;  5FXW A;  3ZJ1 A;  5HWY A;  2Q9Q B;  4H9Q C;  4QXB B;  1YKH B;  2D0T A;  1US7 B;  1X79 A;  3J7Y q;  2C0S A;  1WYC A;  2KZ7 B;  3GWH A;  5KX5 E;  2VL8 A;  4NUU A;  4OYJ A;  3K3Q C;  1B7T A;  3BK9 A;  3ZCI A;  3DTO A;  2C5K T;  3MK7 C;  3O4X E;  2W0G A;  2W00 A;  4PJN A;  4L5G A;  5LHH B;  4CQI A;  3SWH A;  4DBR A;  3UT5 E;  4PK6 A;  4UVA B;  4H63 V;  1LRZ A;  3NRX A;  3LBX B;  1H7C A;  1SA0 E;  3KVB A;  4A56 A;  4C91 A;  4QX8 B;  2V7K A;  2XUE A;  3AA1 B;  4IHJ E;  3CX6 B;  3F2E A;  4PK5 A;  1YW0 A;  4CI2 B;  4AI6 A;  2L3L A;  3GA8 A;  4CXW A;  4X20 E;  2VKD A;  1OWA A;  3BQL A;  3ZYK A;  2XAJ B;  2NTY A;  4TN7 B;  3N9Q A;  4PJJ A;  4ERR A;  4HGA A;  3UUN A;  3HI2 A;  3K8P C;  5JDL A;  4ZI3 D;  5L3B B;  5FXX A;  1HG5 A;  3UTK A;  5LYJ E;  4HTE A;  3O9X A;  3HKE E;  2JRK A;  2MYS A;  5KMG P;  5IYZ E;  4DMW A;  4ZI7 E;  2X0L B;  5KDM C;  4PK4 A;  3LK2 B;  3ZMT B;  2WSS V;  4ZHQ E;  3FXD B;  4DVD A;  4UIG A;  1CUN A;  4AKH A;  1Z0P A;  4TZ4 C;  3MA9 A;  3LK4 2;  5J2T E;  3FBL A;  4ZS3 A;  4UF0 A;  2JQQ A;  3N9P A;  5ADX L;  2X51 A;  2JMH A;  3H37 A;  3CQX C;  3PDY A;  2H3R A;  3ANW A;  2LSG A;  4JEH B;  4IST A;  1HS7 A;  3RPU A;  3MKD A;  4MFR A;  5JRE A;  5JRC B;  3CQG B;  3QUJ A;  1BR1 A;  4KMC A;  4CXX A;  3KV6 A;  5FXZ A;  3OBV E;  1MMG A;  2Q9Q A;  3M65 A;  5FY0 A;  3F57 A;  4HKA A;  2KXP B;  3FBZ A;  2DHR A;  2XAS B;  3PUQ A;  3FB2 A;  4HEA A;  3PTR B;  2A3D A;  2HPJ A;  3F31 A;  1E1H B;  3SS1 A;  3L09 A;  4I50 E;  2V1D B;  4JEU B;  3I9Y A;  3O1I A;  3RH3 A;  5FYM A;  2W62 A;  2K5B B;  2XAH B;  2VK9 A;  4MHC A;  5JDF A;  5HXR A;  5JDM A;  4X1I E;  1IZN B;  2CCQ A;  4EIW A;  1UCU A;  2Y8D A;  2EHO B;  3AAE B;  3HKB E;  3LBX A;  2L8K A;  2LT3 A;  3J9X 1;  3C50 A;  5LGT B;  2WAU A;  3JC6 D;  5C8Y E;  2ES0 A;  5LOV E;  5FY7 A;  4YLH A;  4UVB B;  4JUY A;  1D1A A;  4AKG A;  2YU2 A;  5JR9 B;  2C5I T;  2WBL A;  2CM0 A;  2N2N A;  3UUM A;  3RC8 A;  4UEL A;  2V7I A;  3EUH A;  3O1J A;  3ZC0 A;  2NW9 A;  4PAG A;  3KBT A;  2CE7 A;  4GYS A;  3S4U A;  5L3C B;  5L2L A;  4FI5 A;  2E9X D;  2PBI A;  3I0O A;  3IEE A;  4GK0 E;  1BR4 A;  3C64 A;  2DWG A;  2NWB A;  4H9R C;  2KWI B;  4CXY A;  2K9A A;  3KV4 A;  5F3J A;  2DWK A;  2D0U A;  3FHN A;  4HN9 A;  4AQF A;  2NW7 A;  2ACX A;  2XQY A;  4OK0 A;  4O4J E;  3CX8 B;  2VAS A;  4H9O C;  2OA5 A;  3BQK A;  3ESL A;  4GK5 E;  1EZ3 A;  1MIW A;  4TV9 E;  5LBM A;  5LCY A;  5JDN A;  3N9N A;  3UUL A;  5JRC A;  5FNV E;  2XAG B;  1YKE B;  2G0U A;  1FIO A;  3ZMU B;  1BR0 A;  1QSD A;  3C51 A;  5J1G A;  2CXF A;  4O2B E;  3ZYL A;  3KV5 A;  1FEW A;  2XTL A;  3WAJ A;  1MIY A;  3GN5 B;  4F6R C;  3OYX A;  1S35 A;  4IE4 A;  3U78 A;  2UXN B;  2W61 A;  3C98 B;  2A72 A;  4XAX B;  3Q5X A;  3V5S A;  1OXZ A;  1HTJ F;  2Y48 B;  3K3N A;  4U72 A;  4WBN E;  5H6Q B;  3RYH E;  4BJN A;  2EHO A;  2Q9Q C;  2ZM0 A;  2HPL A;  5L3G B;  2IAK A;  4G2A A;  3AVR A;  2LEH A;  2ZMA A;  3RRW A;  3WI3 A;  3ZMV B;  2LOP A;  3RKO A;  3LJC A;  3RC3 A;  3OJA A;  1WR6 A;  3NBX X;  2V7J A;  1IJ5 A;  5FXV A;  2LHN A;  4EAH A;  5JR9 A;  5JDH A;  2BZB A;  4AXP A;  3EVY A;  3Q2M A;  1MMN A;  3ZJ2 A;  4EZ4 A;  4YFS A;  3NZP A;  1MMA A;  4WNK A;  5HWX A;  2MOZ A;  5FY1 A;  3RRC A;  1MNE A;  5M4Y A;  2MBG A;  2P9B A;  2LSY A;  2IC6 A;  2KT9 A;  4NUV A;  3C4X A;  4HE8 A;  4O4L E;  4V1A v;  4DO0 A;  3Q9D A;  2K24 A;  2LM9 A;  4L9I A;  2L9Q A;  2BVM A;  3P8C D;  1VOM A;  2WMO A;  3ZYM A;  5L3D B;  2BDE A;  2LE8 A;  2CLY B;  2Y6X A;  3MAC A;  5LNK A;  4B6X A;  4BJM A;  5HAX A;  5HXH A;  4OFZ A;  1D0Z A;  2J1D G;  3ETU A;  3OYZ A;  5CA1 E;  2DCF A;  4X1K E;  4U74 A;  4GOU A;  4GIW A;  4EYU A;  5JDG A;  4AQF C;  3DP7 A;  3GN5 A;  2E9X B;  3T8O A;  3L3P A;  3IHR A;  1O3X A;  3MJX A;  4E7Z A;  4ISS A;  4O4I E;  2KWH A;  5LJN A;  4GYR A;  2NTX A;  2WWU A;  4PJL A;  1ZKE A;  4UXN B;  1HX8 A;  4P0A A;  2CEA A;  4M1P A;  4QXH B;  3E08 A;  3CPZ A;  1VRB A;  3IF8 B;  3OKQ A;  4PJM A;  5DQV A;  3NZQ A;  4XZC A;  2KIN B;  3PUR A;  5EZY E;  5IHY A;  2YU1 A;  2WM9 A;  1SHZ C;  2N9D A;  1KK7 A;  3CVR A;  2ZM2 A;  2PG8 A;  5DJQ C;  4IE6 A;  4H9S E;  3AB3 B;  4H9P C;  3HKC E;  4MLK A;  4TX5 A;  5LP6 E;  2CXL A;  3CML A;  1IAP A;  1FMW A;  2X9H A;  3QK6 A;  4MBQ A;  4WW0 A;  2K48 A;  3MZK B;  5EK3 A;  1AJ3 A;  5JQG E;  3ONX A;  4AKI A;  2V26 A;  4ILU A;  3HR0 A;  2XAQ B;  5F8P A;  3EDU A;  1FMV A;  3N9M A;  5JVD E;  2JJ9 A;  4O8S A;  5LGN B;  2H7V C;  2EHO C;  3C4Z A;  3W15 B;  4ZI2 C;  4ZOL E;  2D2S A;  4AQG A;  4EOZ B;  4CI1 B;  2M67 A;  2C5J A;  2CMR A;  4PNI A;  4BAY B;  1UX4 A;  4BA9 A;  1Y64 B;  3LK3 B;  4DND A;  3E22 E;  2X67 A;  5LHG B;  1BR2 A;  3VU7 H;  4UV8 B;  1WRD A;  3VHL A;  5L3E B;  3AVS A;  3ZN0 B;  4I4T E;  5JR9 C;  4O4H E;  1D0Y A;  2CA5 A;  2A2F X;  3CX7 B;  4KP3 C;  4EZH A;  5ETW A;  2DLR A;  3PUG A;  5EK2 A;  2PJQ A;  3N5L A;  2VKJ A;  3PU3 A;  1YD8 G;  3LG7 A;  1NAF A;  2LOS A;  2X66 A;  4ADZ A;  2ZM8 A;  4ZI2 D;  1D0X A;  5AFU L;  1D1C A;  3RX6 A;  2LSK A;  3RYI E;  1MMD A;  2ZLY A;  2E9X A;  5LHI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...