3ZCIA

Crystal structure of helicobacter pylori t4ss protein cagl in a cubic crystal form with a distorted helical conformation of the rgd-motif
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
212
structure length
191
Chain Sequence
GAMEDITSGLKQLDSTYQETNQQVLKNLDEIFSEMGEEDALNIATAAIALRGDLALLKANFEANELFFISEDVIFKTYMSSPELLLTYMKINSDKVLVLYCEGKLKIEATAQNIRERLETSLKAYQSNIGGTASLITASQTLVESLKNKNFIKGIRKLMLAHNKVFLNYLEELDALERSLEQSKRQYLQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Helical Rgd Motif Promoting Cell Adhesion: Crystal Structures of the Helicobacter Pylori Type Iv Secretion System Pilus Protein Cagl
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Protein binding
molecule keywords CAG PATHOGENICITY ISLAND PROTEIN (CAG18)
total genus 90
structure length 191
sequence length 212
ec nomenclature
pdb deposition date 2012-11-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1660 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3zciA00
3ZCIA 3ZCJA
chains in the Genus database with same CATH superfamily
4G2AA 1MMGA 3C4ZA 3UU6A 5AQVB 2D2SA 4DV6T 4JI7T 4O2BE 4ANJA 3ZSSA 2HN2A 4TWHA 3B57A 3N9PA 5EK4A 1UUSA 1WRDA 2K9AA 2Q9QA 2NR4A 3HKEE 2CBIA 4NUUA 1KFYA 4A56A 4EZ4A 2BS2A 4ZZBA 1KF6A 2YU1A 4IE0A 3MXZA 4ZS2A 1HNWT 2WZIA 3LFMA 2RPAA 3UU3A 4G63A 4CI3B 2D5UA 2V7LA 4YTPA 1CUNA 2CMRA 2D0TA 3DJBA 4IL9A 5BMVE 5CGMA 1MNDA 5DJQC 2FJEA 2Y48B 3BQLA 1ZEEA 4FJOA 5KDMC 1D0ZA 2KMFA 2UUAT 4ILBA 3AB3B 3JCFA 3NZQA 5LMUT 2E5LT 4B3TT 1ZHCA 2LLYA 3NVOA 5AQHB 5L3BB 1IBLT 2LHNA 3M3ZB 3C4XA 3SOLA 2OV9A 2CLYB 2FJAA 1J5WA 1WR0A 3RC3A 2JQ9A 2VQET 3HL6A 3RI5A 4EB6E 5JDGA 3I0OA 4U7YA 3PUXF 4O4HE 4X62T 4DR5T 2CLYC 3N9OA 3ZCJA 3AXJB 3W15B 1E2AA 3PUQA 2HPLA 2V7MA 4LMKA 4X5TA 2Q9QD 2KZ7B 4OFZA 4TV8E 4WBNE 3KBUA 5HXHA 2V7KA 2UXDT 1ZKEA 2CPTA 5FL0A 3U78A 2WDRA 4LFBT 2KLQA 4UEMA 2E9XA 4IE5A 2XQ8A 4YT0A 4HN9A 2ZLYA 2V6YB 1HG5A 3MACA 4H9RC 1MMAA 4IT4A 1D1BA 5AQUB 4ZI3C 3ZKRA 3ZJ1A 2W67A 3PU3A 2WDQA 3EI0A 3VKGA 2K3WA 3FZHB 5HCMA 3FBLA 2YK0A 2E8IA 2YDRA 3PDYA 4YSZA 3B5MA 1EZ3A 1MIYA 2XQ9A 5LYJE 2V6YA 4DUYT 1HCIA 3RRWA 3I9WA 1BR1A 1D0YA 3QK6A 4OK0A 5HXCA 3T1HT 3RGLA 3CX8B 4JI1T 1H7CA 2ODUA 3CQGB 5AQTB 3NBXX 3X1DA 5FL1A 3LSVA 4BJNA 1I94T 2A2FX 5FKYA 2X9WA 2DLRA 2EHOD 2QGSA 2WMOA 3L39A 2KWHA 2M67A 2VWAA 2FJBA 2J1DG 4P0BA 4X1KE 2M6IA 1UCUA 3UUMA 2ZMAA 3ZC1A 4DIDB 2XUEA 3U3IA 4AKHA 4DVDA 2IDOB 4ILAA 3TLTA 3ONLC 5LHHB 3LG7A 3HR0A 3TKLB 4TNVA 2BKNA 2NOXA 5EK3A 5FNVE 5ABGA 5ADXL 4JEHB 4QX7B 3J9X1 4AQYT 2VASA 3DTOA 3KV6A 3AAAB 1IAPA 4KX6A 2LHRA 5FMNA 4OHFA 3RPUA 4TZ4C 1BR4A 4IE7A 4NIQA 1T7SA 2W0GA 2K24A 2H88A 1E7PA 5CA0E 3CVRA 1X9BA 2WU2A 4AIUA 3AEEA 3IEEA 5HEGA 3Q5XA 3RQUA 2Q9QC 4H63V 1FJGT 3HKCE 3P7IA 1S35A 5HXEA 1QUUA 3AEBA 2Q9QB 4A98A 2VL8A 4FI5A 1JNZA 1XZYA 2PBIA 2RA1A 3AE7A 3LDQB 4ZI3D 5DABA 3C64A 5E0OA 1KNZA 1IBMT 4I55E 4JI4T 2ACXA 3NKZA 3O1JA 5HEUA 3RKOA 2EHOA 2J4GA 3E0ZA 5C3JA 4DR1T 2YOEA 2C0SA 1X79A 3AE6A 4I4TE 4M1PA 3RIUC 5CJ5A 4JBWF 2ODVA 4TN7B 4TNWA 5JVDE 4AKRB 3PUYF 1J5ET 3VRAA 3VKHA 5HEJA 2XY8B 2VVNA 2W66A 2IIUA 2NTYA 1YW0A 3FZMB 1SE7A 2NW7A 3AXJA 2MAWA 4MALA 2NW9A 2LKHA 3Q5WA 2JMHA 4QXCB 2CXLA 3TLWA 2AE9A 3KVAA 3PUSA 2V5DA 3F2EA 3EABA 3K3QC 3N9NA 3RKGA 2BBHA 1IJ5A 3LK42 3ZYMA 2XM1A 3KDSE 4AKGA 4IREA 1UGOA 3MA9A 4DR7T 4XAXB 2I59A 4O2AE 3OVUA 3LK2B 4IDPA 5J1GA 3AA6B 4COFA 3F31A 4DBRA 3NWIA 2OA5A 4WW0A 2X9YA 4C90A 3K3NA 2R6GF 4LF6T 4EYUA 2IC9A 2VURA 4NXMT 3AA1B 3SWHA 3WAJA 4UF0A 4H9QC 4HGAA 5JDQA 4JI5T 2XM2A 1KEYA 3LJCA 1HTJF 2FBWA 1YKEB 3P4PA 4IDNA 4J2CA 4KBMB 5IWAT 4DV2T 1VOMA 3PE0A 3I9YA 2FUPA 5EK2A 4GK5E 5LHGB 1ZP0A 2V5CA 2HN1A 2WP9A 4QKNA 4E7SA 4IE4A 3EVYA 5L4EA 2D9DA 3RHWA 2E9XB 1UX5A 2XQ6A 3FXDB 1QSDA 3P50A 3LBXB 4CN6A 3RYFE 4DMWA 3C98B 2BVMA 2QYWA 2XQ5A 4YTNA 2YKSA 5FXVA 5LA6E 2AXDS 2RP4A 3N9LA 4ZI2C 3UU4A 2LJLA 4UXNB 1FMWA 4QH4A 3PU8A 2BVLA 2H3RA 2BG9E 5LOVE 5C2TA 4AQFA 1VCTA 2IC6A 4HTEA 3A5XA 5AQOB 4CQIA 2NTXA 4JI8T 5LJNA 4IGUA 4X66T 2MPKA 4QXBB 3ZN0B 5LNKA 1BR0A 4LF8T 4H63H 2Z6EA 4EEBA 3HI2A 1DU2A 3TLUA 3A7MA 3O4XE 4K0UA 2XSBA 3FHNA 3K3OA 2LOSA 5KXJA 4AXPA 4U3CA 1KNPA 3P4WA 4U33A 3ZN1B 1YKHB 1HG2A 2BDEA 3K8PC 2LRKA 2VKJA 3JADA 3UULA 4L9IA 1XDPA 4JLEA 4EIWA 4QH5A 4JI0T 4DMVA 5IUXA 5JH7E 2CE7A 3OYXA 3P8CD 3QB5K 2IMLA 2XQAA 3FZFB 2BBJA 1OEDA 3RF1A 4YY3T 4MHCA 5CA1E 5TAOA 5AQQB 4KI0F 4DNDA 3ZJ2A 5JRCB 1WR6A 2IAKA 2CWYA 3UT5E 4LF7T 2VQFT 2C5JA 2NP9A 3NRXA 5F8PA 2YEVC 3QB5A 4MFRA 5L2LA 4AKLA 1YXRA 5LB7B 5JQGE 3OPCA 4LFAT 4UELA 3UUNA 2A3DA 2H7VC 3EAMA 4P1NA 4DUZT 1US7B 4P0AA 2MYSA 3ZEFB 2DNXA 3EDVA 5FP3A 2XZEA 1G8XA 2WCAA 1YQ3A 2XQ4A 3Q5DA 3A8YC 2VKOA 3Q5EA 4P09A 3R6NA 3SFEA 1T98A 3L3PA 4AKIA 1FEWA 4ZI2D 4LFCT 1OEDB 1G73A 4MLKA 4HWFA 3AEFA 4CI1B 4JI3T 4JUYA 5ABFB 1LVKA 3PTRB 2EHOC 5HYAA 1N36T 3PUGA 2H7OA 2JQHA 2VKHA 2YDQA 3BQKA 4YLHA 3QNUA 2V7JA 3OTOT 4WYVA 1HX1B 2BS3A 2V8SV 1AJ3A 1NWMX 3VHLA 3JAFA 3UUBA 3ZPOA 2DWKA 3JAEA 4B3MT 3N5LA 2CRBA 2M6BA 2V26A 2X51A 2XQYA 1NENA 2V7IA 1T72A 2X68A 3GA8A 3MK7C 1BR2A 4U74A 4X64T 4HFHA 4E7ZA 2XPKA 3MJXA 4UR9A 1HFAA 4O4JE 3ZMVB 5ABFA 4GYRA 2WBLA 3AVSA 3CK6A 5LGUB 2WZHA 5LBQB 4JI2T 3RYHE 3AE9A 3EHZA 5AQSB 2LRLA 5GONE 5LMNT 4ASKA 4CZZB 5HEOA 4LMLA 4GKJT 5FXZA 2K48A 3T8OA 3AE8A 3PUVF 3RC8A 4DR4T 1VCSA 1T8BA 1IZNB 1D1CA 1O3XA 2WDVA 4UV9B 5ABEA 3CX7B 2W63A 4H9NC 4UVCB 2BKOA 3ETUA 5L4HA 3HKBE 4QHOA 3LBXA 2UUCT 3H3MA 4EV6A 3AAEB 4DV3T 5FY1A 2N1GA 4IDQA 3C50A 3PJAA 2XAJB 4ILUA 4OYJA 5FY0A 4A5XA 5F3JA 3OBVE 2CXDA 2KXPB 3P4QA 4IDZA 4EOZB 3RLFF 4ISSA 5FY7A 5LG3A 2DHRA 2Y8DA 5JDHA 2LSYA 2PJQA 2E5VA 2LEHA 4I0UA 3AE3A 3N9MA 3UFGA 4GYSA 2C5KT 4B3ST 4QXHB 4O4LE 3AE2A 2KWIB 2ZM8A 4TWFA 1N33T 1M7KA 2CEAA 1WFDA 4QH1A 4PJMA 4ZXLA 4TUYE 4PK5A 5AQGB 1B7TA 4HWDA 4OX9T 4KHPT 5L3GB 4K0KT 2NW8A 1Z0PA 2BG9C 2ES0A 2PG8A 2PFVA 5LP6E 4X65T 1Z8UA 4PJNA 2KINB 4B3RT 5JREA 3E22E 3ZSTA 4X1IE 2LSGA 2JQKA 3E08A 2F4VT 1Y01A 4O8SA 4DV1T 5M4YA 5L47A 3RRCA 1V9DA 1HX8A 2V6XA 3L09A 2WAUA 4CN4A 4EYYR 2FJDA 1FIOA 3AE5A 3AEGA 1CHUA 4PJLA 2CXFA 2JRKA 3ANWA 5HCJA 3RQWA 1SUMB 2BS4A 5ETWA 4PFOA 5AFUL 5JDLA 5HXRA 4UVAB 3ETVA 3UQ4A 4EGWA 3ZYKA 2LKGA 2LM2A 4DV5T 2B76A 1NEKA 3GMIA 1R8IA 1WYBA 1NAFA 1N32T 2CHNA 2XASB 5JDFA 4KHZF 4U31A 4HFIA 3RH3A 4NPPA 2UXXB 1MMNA 2LSKA 3AE4A 5JRCA 1VRBA 3I1AA 2DWGA 2BZBA 2C5IT 2B1EA 2KNDA 2OLTA 2X66A 3CPZA 1SHZC 4O4IE 4ERRA 3CQXC 5LJMA 4GKKT 1D1AA 2E9XC 3WI3A 5L3CB 3O9XA 4I43B 2IHR1 2MTQA 3FB2A 3ABVA 3O1IA 1MMDA 2CWOA 2IUBA 2WY2A 4GIWA 1D0XA 4AQFC 5A1LA 3PUZF 1J1JA 4HFBA 1W0AA 5AQMB 5DQVA 2YU2A 4YSXA 2A72A 3FBZA 4HWHA 2CHOA 4JYAT 1U5PA 3QOFA 4YTMA 3IBPA 5EZYE 5FXWA 1S94A 4L0RA 4F8HA 4DV4T 4ADZA 3SS1A 4DR6T 2WWUA 4WNKA 2QVAA 4HFEA 2XQ3A 4ZZCA 5AQJB 3AA7B 4IDOA 3VRBA 3ZT7A 1UURA 3FZLB 4I50E 1W0BA 4U7IA 4Z91A 3CIRA 5JDMA 5JTGA 2MOZA 1M62A 3UU5A 5JR9B 4CXWA 2UU9T 5AQPB 5LGNB 3IF8B 3K1SA 2QA7A 5ABHA 1IBKT 1I6ZA 4QWNB 2XAFB 5CFBA 5KMGP 3IA3A 1XWMA 2LM9A 4TWDA 2JMKA 2XHEB 3RYIE 3ONXA 3EUHA 3H37A 4GK0E 2K5BB 1FMVA 2E9XD 4H9OC 4YXDA 2JPFA 3P4RA 3ZMUB 2UXCT 5HAXA 2I0MA 3QUJA 3TLSA 2J47A 1N34T 5LXTE 4KUMB 1XNRT 5AQIB 1UK5A 3KINB 2QRXA 2XSAA 3G06A 3PURA 4Q25A 4CN1A 2X0YA 5HWXA 2HPJA 2W2UA 3C4WA 4PFPA 2DL1A 2YDSA 2UXNB 4WZXA 4PAGA 4IE6A 3TLVA 2BG9A 3ZYLA 4HKAA 5FVLA 4DV0T 4DV7T 4LF9T 4GOUA 3VU7H 1E1HB 3PUWF 2W61A 4IL4A 4X20E 1ZOYA 4IHJE 1MIWA 2XJ7A 3R84B 3VR8A 2WS3A 3ESLA 2IW5B 1HR0T 1W09A 4EAHA 2PTFA 2BG9B 2XAHB 2JIWA 2N9DA 3OJAA 4CI2B 2P9BA 3ONJA 5LG4A 5H6QB 4B6XA 2VK9A 1YD8G 3KVBA 1HNZT 2WM9A 4JEUB 4U72A 2WWVA 3CX6B 4YHJA 4LF4T 4KMCA 3UUXB 4C91A 2L3LA 2XAQB 3AECA 3P4SA 5H6RB 3ZMTB 3ZT5A 2CCQA 5DQWA 4ZS3A 2I6HA 4YSYA 3JC6C 4ISTA 2WMNA 4BA9A 1Y64B 2BKPA 2YINA 4BJMA 2SPCA 4DR2T 2DI4A 1OEDE 4ZI7E 4U2YA 4DBQA 4AQGA 5L3DB 1JNRA 3KV9A 1U4QA 3O1HA 4XBFB 1L0VA 4H9PC 4X1YE 1GQEA 3H3AA 3T1YT 4TX5A 3ZLIA 4LMJA 2ZM2A 4EEDA 4UVBB 1KK7A 3AEAA 2HH7A 3HA4A 5JR9A 2LSJA 3I0QA 3UQ7A 3D0TA 2G0UA 5F5WA 4EXTA 2CM0A 3IHRA 3KFWX 2DCFA 4A97A 2JQQA 3C51A 5AQFB 2JJ9A 3KV5A 1YQ4A 3NRYA 4DR3T 4ZEYA 1LVFA 3PJAJ 4N78D 2H89A 2GK9A 5LBMA 4ILCA 3UU8A 1W9RA 4XZCA 3RIUA 3UTKA 4JI6T 5BR8T 1MIVA 2XQ7A 4PK4A 2W62A 1XNQT 3DP7A 1WCRA 4MBQA 3J7Yq 3WAKA 4PK6A 3JC6D 5J0ZA 4PW8A 2WSSV 2VKDA 2VB6A 1QLBA 2WQYA 2ZM0A 3V5UA 5L3FB 4AISA 4OYKA 1LKXA 2CBJA 4ZHQE 3UFEA 3CQCB 3FXEB 3SRZA 2X9HA 2HHHT 2E2AA 1LRZA 5L3EB 2NWBA 4WBOA 4Z8XA 4DO0A 3M65A 3NZPA 4NXNT 4UV8B 2LT3A 1OXZA 2YN6A 3GN5A 3KV4A 3S4UA 5HWYA 5LCYA 3V5SA 3VR9A 2XAGB 3PV0F 4HFCA 3BQIA 4IIJE 1OEDC 4TV9E 5FXXA 3RX6A 4YHHT 3L8RA 4HE8A 4LF5T 2X67A 4KP3C 2UXBT 5CB4E 1WLXA 3EDUA 4HFDA 2V1DB 3RYCE 2LE8A 5HEHA 2WU5A 2W00A 3CWZB 4HWIB 3ANWB 4PNIA 2UUBT 4AI6A 4QX8B 3MKDA 4ZOLE 4Z90A 4F6RC 1WYCA 4YFSA 2D0UA 5FVKA 3Q2MA 1HS7A 3N2GE 3N2OA 1XDOA 3OYZA 4BAYB 5AQKB 2A9UA 3AVRA 3N2KE 3KBTA 2W4XA 3BK9A 4V1Av 3LK3B 2J62A 4EZHA 3AA0B 4UF0B 2XTLA 1UX4A 3OKQA 4H9SE 5LHIB 1XMQT 2CA5A 5IHYA 2L9QA 2VL0A 3PUAA 1MNEA 1KNRA 2X9XA 4HFVA 3GN5B 4YJ3E 4HEAA 5IYZE 3CKDA 5C8YE 5JR9C 2L8KA 2N2NA 3HKDE 2LOPA 5J2TE 5AQLB 3RIFA 3SFDA 5HXSA 2ZM6T 2KT9A 3QC9A 2Y6XA 3ZT6A 1HF8A 5FYMA 4YJ2E 2X0HA 4HWCA 3GWHA 5LGTB 3B13A 4CXYA 3Q9DA 5KX5E 1SA0E 4L5GA 2LSIA 4U2ZA 3ZMSB 1ZV4X 5JDNA 4UIGA 2X0LB 4NUVA 3FZKB 1IJ6A 4PJJA 2MBGA 2VVSA 3ZMZB 4JV5T 3ZCIA 1XMOT 3F57A 3N9QA 5AQNB 4CXXA 3CMLA 3MZKB 3RIAA 2WB5A 3ZC0A 5AQRB 3AAIA 5J2UE 1HNXT 3AE1A 3AEDA 1OWAA 2EHOB 2KSRA 2ACZA
chains in the Genus database with same CATH topology
4G2AA 1MMGA 3C4ZA 2D2SA 4O2BE 4ANJA 3B57A 3N9PA 5EK4A 1WRDA 2K9AA 2Q9QA 3HKEE 4NUUA 4A56A 5LJMA 4EZ4A 4IE0A 2YU1A 4ZS2A 3MXZA 3LFMA 4G63A 4CI3B 2D5UA 2V7LA 1CUNA 2CMRA 2D0TA 3DJBA 5BMVE 1MNDA 5DJQC 2Y48B 3BQLA 1ZEEA 4FJOA 5KDMC 1D0ZA 2KMFA 3AB3B 3NZQA 1ZHCA 5L3BB 2LHNA 3C4XA 3SOLA 2CLYB 3RC3A 3HL6A 4EB6E 5JDGA 3I0OA 4O4HE 2CLYC 3N9OA 3ZCJA 3W15B 3PUQA 2HPLA 2V7MA 2Q9QD 2KZ7B 4OFZA 4TV8E 4WBNE 3KBUA 5HXHA 2V7KA 1ZKEA 3U78A 2KLQA 4UEMA 2E9XA 4IE5A 4HN9A 2ZLYA 4ZI3C 1HG5A 3MACA 4H9RC 1MMAA 5JDHA 1D1BA 3ZJ1A 3PU3A 3VKGA 3FBLA 2YK0A 2E8IA 3PDYA 5LYJE 1EZ3A 1MIYA 1HCIA 3RRWA 3I9WA 1BR1A 1D0YA 3QK6A 4OK0A 5HXCA 3CX8B 1H7CA 2ODUA 3CQGB 3NBXX 4BJNA 2A2FX 2X9WA 2DLRA 2EHOD 2QGSA 2WMOA 4TX5A 2KWHA 2M67A 2VWAA 2J1DG 4X1KE 4P0BA 3UUMA 3ZC1A 1UCUA 4AKHA 2ZMAA 2XUEA 3U3IA 4DVDA 5LHHB 3LG7A 3HR0A 3TKLB 2NOXA 5EK3A 5FNVE 5ADXL 4JEHB 4QX7B 3J9X1 2VASA 3DTOA 3KV6A 3AAAB 1IAPA 2LHRA 5FMNA 4OHFA 3RPUA 4TZ4C 1BR4A 4IE7A 2W0GA 2K24A 5CA0E 3CVRA 3IEEA 3Q5XA 2Q9QC 4H63V 3HKCE 3P7IA 1S35A 5HXEA 1QUUA 2Q9QB 2VL8A 4FI5A 2PBIA 4ZI3D 2RA1A 1KNZA 5DABA 3C64A 5E0OA 4I55E 2ACXA 3O1JA 1HS7A 3RKOA 2EHOA 3E0ZA 2C0SA 1X79A 4I4TE 4M1PA 2ODVA 4TN7B 5JVDE 4AKRB 3VKHA 2NTYA 1YW0A 2NW7A 2NW9A 3Q5WA 2JMHA 4QXCB 2CXLA 3KVAA 3PUSA 3F2EA 3K3QC 3N9NA 3ZYMA 4AKGA 1IJ5A 3LK42 3KDSE 3MA9A 4XAXB 2I59A 4O2AE 3LK2B 5J1GA 3AA6B 4DBRA 3F31A 2OA5A 4WW0A 2X9YA 4C90A 3K3NA 4EYUA 2IC9A 3AA1B 3SWHA 3WAJA 4UF0A 4H9QC 4HGAA 5JDQA 3LJCA 1HTJF 4J2CA 1YKEB 4KBMB 1VOMA 3PE0A 3I9YA 5EK2A 4GK5E 5LHGB 4QKNA 4E7SA 4IE4A 3EVYA 5J2TE 2E9XB 1UX5A 3FXDB 1QSDA 3LBXB 4DMWA 3RYFE 3C98B 2BVMA 5FXVA 5LA6E 2RP4A 3N9LA 4ZI2C 2LJLA 4UXNB 1FMWA 3PU8A 2BVLA 2H3RA 5LOVE 4AQFA 2IC6A 4HTEA 3A5XA 4CQIA 2NTXA 5LJNA 4IGUA 4QXBB 3ZN0B 5LNKA 1BR0A 4H63H 2Z6EA 3HI2A 3O4XE 4K0UA 3FHNA 3K3OA 2LOSA 4AXPA 3ZN1B 1YKHB 1HG2A 2BDEA 3K8PC 2VKJA 3UULA 4L9IA 4EIWA 4JLEA 4DMVA 5JH7E 2CE7A 3OYXA 3P8CD 4MHCA 5CA1E 5TAOA 4DNDA 3ZJ2A 5JRCB 1WR6A 2IAKA 2CWYA 3UT5E 2C5JA 2NP9A 3NRXA 5F8PA 2YEVC 4MFRA 5L2LA 4AKLA 5JQGE 4UELA 3UUNA 2A3DA 2H7VC 1US7B 4P0AA 2MYSA 3ZEFB 2DNXA 3EDVA 5FP3A 1G8XA 3J7Yq 2VKOA 4P09A 3R6NA 1T98A 3L3PA 4AKIA 1FEWA 4ZI2D 1G73A 4MLKA 4CI1B 4JUYA 1LVKA 3PTRB 2EHOC 5HYAA 3PUGA 2H7OA 2VKHA 3BQKA 4YLHA 2V7JA 1AJ3A 1NWMX 3VHLA 3ZPOA 2DWKA 3N5LA 2V26A 2X51A 2XQYA 2V7IA 3MK7C 2X68A 3GA8A 1BR2A 4U74A 4E7ZA 3ZMVB 3MJXA 1HFAA 4O4JE 4GYRA 2WBLA 3AVSA 5LGUB 5LBQB 3RYHE 5GONE 4ASKA 4CZZB 5FXZA 2K48A 3T8OA 3RC8A 1IZNB 1D1CA 1O3XA 4UV9B 3CX7B 2W63A 4H9NC 4UVCB 3ETUA 3HKBE 4QHOA 3LBXA 3AAEB 5FY1A 2N1GA 5F3JA 3C50A 2XAJB 4ILUA 4OYJA 5FY0A 3OBVE 2CXDA 2KXPB 4EOZB 4ISSA 5FY7A 2DHRA 2Y8DA 2LSYA 2PJQA 2LEHA 3N9MA 4GYSA 2C5KT 4QXHB 4O4LE 2KWIB 2ZM8A 2CEAA 4PJMA 4TUYE 4PK5A 1B7TA 5L3GB 2NW8A 1Z0PA 2ES0A 2PG8A 2PFVA 5LP6E 4PJNA 2KINB 5JREA 3E22E 4X1IE 2LSGA 3E08A 4O8SA 5M4YA 3RRCA 1V9DA 1HX8A 3L09A 4EYYR 2WAUA 1FIOA 2CXFA 2JRKA 3ANWA 5ETWA 4PFOA 5AFUL 5JDLA 5HXRA 4UVAB 3ETVA 3ZYKA 3GMIA 1WYBA 1NAFA 2XASB 5JDFA 3RH3A 2UXXB 1MMNA 2LSKA 5JRCA 1VRBA 3I1AA 2DWGA 2BZBA 2C5IT 2B1EA 2KNDA 2X66A 3CPZA 4MALA 1SHZC 4O4IE 4ERRA 3CQXC 1D1AA 2E9XC 3WI3A 5L3CB 3O9XA 4I43B 2MTQA 3FB2A 3O1IA 1MMDA 2CWOA 4GIWA 5A1LA 1D0XA 4AQFC 5DQVA 2YU2A 3FBZA 2A72A 1U5PA 5EZYE 5FXWA 3IBPA 1S94A 4L0RA 4ADZA 3SS1A 2WWUA 4WNKA 3AA7B 4I50E 5JDMA 2MOZA 5JR9B 4CXWA 5LGNB 3IF8B 2QA7A 4QWNB 2XAFB 5KMGP 2LM9A 2JMKA 2XHEB 3RYIE 3ONXA 3EUHA 3H37A 4GK0E 2K5BB 1FMVA 2E9XD 4H9OC 2JPFA 3ZMUB 5HAXA 3QUJA 5LXTE 4KUMB 3KINB 3PURA 5HWXA 2HPJA 3C4WA 4PFPA 2UXNB 4PAGA 4IE6A 3ZYLA 4HKAA 4GOUA 3VU7H 1E1HB 2W61A 4X20E 4IHJE 1MIWA 3R84B 3ESLA 2IW5B 4EAHA 2XAHB 3OJAA 2N9DA 4CI2B 2P9BA 5H6QB 4B6XA 2VK9A 1YD8G 3KVBA 2WM9A 4JEUB 4U72A 3CX6B 4YHJA 4KMCA 3UUXB 4C91A 2L3LA 2XAQB 3ZMTB 5H6RB 4DBQA 2CCQA 5DQWA 4ZS3A 3JC6C 4ISTA 2WMNA 4BA9A 1Y64B 2YINA 4BJMA 2SPCA 2DI4A 4ZI7E 4AQGA 5L3DB 3O1HA 3KV9A 1U4QA 4XBFB 4H9PC 4X1YE 3H3AA 3ZLIA 2ZM2A 4UVBB 1KK7A 2HH7A 3HA4A 5JR9A 2LSJA 3I0QA 3D0TA 2G0UA 4EXTA 2CM0A 3IHRA 3KFWX 2DCFA 2JQQA 3C51A 2JJ9A 3KV5A 3NRYA 1LVFA 4N78D 2GK9A 5LBMA 4XZCA 3UTKA 1MIVA 4PK4A 2W62A 3DP7A 4MBQA 3WAKA 4PK6A 3JC6D 4PW8A 2WSSV 2VKDA 2VB6A 2ZM0A 3V5UA 5L3FB 4OYKA 1LKXA 4ZHQE 3UFEA 3CQCB 3FXEB 3SRZA 2X9HA 1LRZA 5L3EB 2NWBA 4WBOA 4Z8XA 4DO0A 3M65A 3NZPA 4UV8B 2LT3A 1OXZA 3GN5A 3KV4A 3V5SA 3S4UA 5HWYA 5LCYA 5LG4A 2XAGB 4TV9E 5FXXA 3BQIA 4IIJE 3RX6A 4HE8A 2X67A 4KP3C 5CB4E 1WLXA 3EDUA 2V1DB 3RYCE 2LE8A 2W00A 3CWZB 3ANWB 4PNIA 4AI6A 4QX8B 3MKDA 4ZOLE 4F6RC 1WYCA 4YFSA 2D0UA 3Q2MA 3N2GE 3N2OA 3OYZA 4BAYB 3AVRA 3N2KE 3KBTA 4V1Av 3BK9A 3LK3B 4EZHA 3AA0B 4UF0B 2XTLA 1UX4A 3OKQA 4H9SE 5LHIB 2CA5A 5IHYA 2L9QA 3PUAA 1MNEA 2X9XA 4YJ3E 4HFVA 3GN5B 5IYZE 4HEAA 5JR9C 3CKDA 5C8YE 2L8KA 2N2NA 3HKDE 2LOPA 5HXSA 2KT9A 3QC9A 2Y6XA 1HF8A 5FYMA 4YJ2E 3GWHA 5LGTB 3B13A 4CXYA 3Q9DA 5KX5E 1SA0E 4L5GA 2LSIA 3ZMSB 1ZV4X 5JDNA 4UIGA 2X0LB 4NUVA 1IJ6A 4PJJA 2MBGA 3ZMZB 3ZCIA 3F57A 3N9QA 4CXXA 3CMLA 3MZKB 3ZC0A 3AAIA 5J2UE 1OWAA 2EHOB 4PJLA 4IDZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZCI A;  3ZCJ A; 
#chains in the Genus database with same CATH topology
 4G2A A;  1MMG A;  3C4Z A;  3UU6 A;  5AQV B;  2D2S A;  4DV6 T;  4JI7 T;  4O2B E;  4ANJ A;  3ZSS A;  2HN2 A;  4TWH A;  3B57 A;  3N9P A;  5EK4 A;  1UUS A;  1WRD A;  2K9A A;  2Q9Q A;  2NR4 A;  3HKE E;  2CBI A;  4NUU A;  1KFY A;  4A56 A;  4EZ4 A;  2BS2 A;  4ZZB A;  1KF6 A;  2YU1 A;  4IE0 A;  3MXZ A;  4ZS2 A;  1HNW T;  2WZI A;  3LFM A;  2RPA A;  3UU3 A;  4G63 A;  4CI3 B;  2D5U A;  2V7L A;  4YTP A;  1CUN A;  2CMR A;  2D0T A;  3DJB A;  4IL9 A;  5BMV E;  5CGM A;  1MND A;  5DJQ C;  2FJE A;  2Y48 B;  3BQL A;  1ZEE A;  4FJO A;  5KDM C;  1D0Z A;  2KMF A;  2UUA T;  4ILB A;  3AB3 B;  3JCF A;  3NZQ A;  5LMU T;  2E5L T;  4B3T T;  1ZHC A;  2LLY A;  3NVO A;  5AQH B;  5L3B B;  1IBL T;  2LHN A;  3M3Z B;  3C4X A;  3SOL A;  2OV9 A;  2CLY B;  2FJA A;  1J5W A;  1WR0 A;  3RC3 A;  2JQ9 A;  2VQE T;  3HL6 A;  3RI5 A;  4EB6 E;  5JDG A;  3I0O A;  4U7Y A;  3PUX F;  4O4H E;  4X62 T;  4DR5 T;  2CLY C;  3N9O A;  3ZCJ A;  3AXJ B;  3W15 B;  1E2A A;  3PUQ A;  2HPL A;  2V7M A;  4LMK A;  4X5T A;  2Q9Q D;  2KZ7 B;  4OFZ A;  4TV8 E;  4WBN E;  3KBU A;  5HXH A;  2V7K A;  2UXD T;  1ZKE A;  2CPT A;  5FL0 A;  3U78 A;  2WDR A;  4LFB T;  2KLQ A;  4UEM A;  2E9X A;  4IE5 A;  2XQ8 A;  4YT0 A;  4HN9 A;  2ZLY A;  2V6Y B;  1HG5 A;  3MAC A;  4H9R C;  1MMA A;  4IT4 A;  1D1B A;  5AQU B;  4ZI3 C;  3ZKR A;  3ZJ1 A;  2W67 A;  3PU3 A;  2WDQ A;  3EI0 A;  3VKG A;  2K3W A;  3FZH B;  5HCM A;  3FBL A;  2YK0 A;  2E8I A;  2YDR A;  3PDY A;  4YSZ A;  3B5M A;  1EZ3 A;  1MIY A;  2XQ9 A;  5LYJ E;  2V6Y A;  4DUY T;  1HCI A;  3RRW A;  3I9W A;  1BR1 A;  1D0Y A;  3QK6 A;  4OK0 A;  5HXC A;  3T1H T;  3RGL A;  3CX8 B;  4JI1 T;  1H7C A;  2ODU A;  3CQG B;  5AQT B;  3NBX X;  3X1D A;  5FL1 A;  3LSV A;  4BJN A;  1I94 T;  2A2F X;  5FKY A;  2X9W A;  2DLR A;  2EHO D;  2QGS A;  2WMO A;  3L39 A;  2KWH A;  2M67 A;  2VWA A;  2FJB A;  2J1D G;  4P0B A;  4X1K E;  2M6I A;  1UCU A;  3UUM A;  2ZMA A;  3ZC1 A;  4DID B;  2XUE A;  3U3I A;  4AKH A;  4DVD A;  2IDO B;  4ILA A;  3TLT A;  3ONL C;  5LHH B;  3LG7 A;  3HR0 A;  3TKL B;  4TNV A;  2BKN A;  2NOX A;  5EK3 A;  5FNV E;  5ABG A;  5ADX L;  4JEH B;  4QX7 B;  3J9X 1;  4AQY T;  2VAS A;  3DTO A;  3KV6 A;  3AAA B;  1IAP A;  4KX6 A;  2LHR A;  5FMN A;  4OHF A;  3RPU A;  4TZ4 C;  1BR4 A;  4IE7 A;  4NIQ A;  1T7S A;  2W0G A;  2K24 A;  2H88 A;  1E7P A;  5CA0 E;  3CVR A;  1X9B A;  2WU2 A;  4AIU A;  3AEE A;  3IEE A;  5HEG A;  3Q5X A;  3RQU A;  2Q9Q C;  4H63 V;  1FJG T;  3HKC E;  3P7I A;  1S35 A;  5HXE A;  1QUU A;  3AEB A;  2Q9Q B;  4A98 A;  2VL8 A;  4FI5 A;  1JNZ A;  1XZY A;  2PBI A;  2RA1 A;  3AE7 A;  3LDQ B;  4ZI3 D;  5DAB A;  3C64 A;  5E0O A;  1KNZ A;  1IBM T;  4I55 E;  4JI4 T;  2ACX A;  3NKZ A;  3O1J A;  5HEU A;  3RKO A;  2EHO A;  2J4G A;  3E0Z A;  5C3J A;  4DR1 T;  2YOE A;  2C0S A;  1X79 A;  3AE6 A;  4I4T E;  4M1P A;  3RIU C;  5CJ5 A;  4JBW F;  2ODV A;  4TN7 B;  4TNW A;  5JVD E;  4AKR B;  3PUY F;  1J5E T;  3VRA A;  3VKH A;  5HEJ A;  2XY8 B;  2VVN A;  2W66 A;  2IIU A;  2NTY A;  1YW0 A;  3FZM B;  1SE7 A;  2NW7 A;  3AXJ A;  2MAW A;  4MAL A;  2NW9 A;  2LKH A;  3Q5W A;  2JMH A;  4QXC B;  2CXL A;  3TLW A;  2AE9 A;  3KVA A;  3PUS A;  2V5D A;  3F2E A;  3EAB A;  3K3Q C;  3N9N A;  3RKG A;  2BBH A;  1IJ5 A;  3LK4 2;  3ZYM A;  2XM1 A;  3KDS E;  4AKG A;  4IRE A;  1UGO A;  3MA9 A;  4DR7 T;  4XAX B;  2I59 A;  4O2A E;  3OVU A;  3LK2 B;  4IDP A;  5J1G A;  3AA6 B;  4COF A;  3F31 A;  4DBR A;  3NWI A;  2OA5 A;  4WW0 A;  2X9Y A;  4C90 A;  3K3N A;  2R6G F;  4LF6 T;  4EYU A;  2IC9 A;  2VUR A;  4NXM T;  3AA1 B;  3SWH A;  3WAJ A;  4UF0 A;  4H9Q C;  4HGA A;  5JDQ A;  4JI5 T;  2XM2 A;  1KEY A;  3LJC A;  1HTJ F;  2FBW A;  1YKE B;  3P4P A;  4IDN A;  4J2C A;  4KBM B;  5IWA T;  4DV2 T;  1VOM A;  3PE0 A;  3I9Y A;  2FUP A;  5EK2 A;  4GK5 E;  5LHG B;  1ZP0 A;  2V5C A;  2HN1 A;  2WP9 A;  4QKN A;  4E7S A;  4IE4 A;  3EVY A;  5L4E A;  2D9D A;  3RHW A;  2E9X B;  1UX5 A;  2XQ6 A;  3FXD B;  1QSD A;  3P50 A;  3LBX B;  4CN6 A;  3RYF E;  4DMW A;  3C98 B;  2BVM A;  2QYW A;  2XQ5 A;  4YTN A;  2YKS A;  5FXV A;  5LA6 E;  2AXD S;  2RP4 A;  3N9L A;  4ZI2 C;  3UU4 A;  2LJL A;  4UXN B;  1FMW A;  4QH4 A;  3PU8 A;  2BVL A;  2H3R A;  2BG9 E;  5LOV E;  5C2T A;  4AQF A;  1VCT A;  2IC6 A;  4HTE A;  3A5X A;  5AQO B;  4CQI A;  2NTX A;  4JI8 T;  5LJN A;  4IGU A;  4X66 T;  2MPK A;  4QXB B;  3ZN0 B;  5LNK A;  1BR0 A;  4LF8 T;  4H63 H;  2Z6E A;  4EEB A;  3HI2 A;  1DU2 A;  3TLU A;  3A7M A;  3O4X E;  4K0U A;  2XSB A;  3FHN A;  3K3O A;  2LOS A;  5KXJ A;  4AXP A;  4U3C A;  1KNP A;  3P4W A;  4U33 A;  3ZN1 B;  1YKH B;  1HG2 A;  2BDE A;  3K8P C;  2LRK A;  2VKJ A;  3JAD A;  3UUL A;  4L9I A;  1XDP A;  4JLE A;  4EIW A;  4QH5 A;  4JI0 T;  4DMV A;  5IUX A;  5JH7 E;  2CE7 A;  3OYX A;  3P8C D;  3QB5 K;  2IML A;  2XQA A;  3FZF B;  2BBJ A;  1OED A;  3RF1 A;  4YY3 T;  4MHC A;  5CA1 E;  5TAO A;  5AQQ B;  4KI0 F;  4DND A;  3ZJ2 A;  5JRC B;  1WR6 A;  2IAK A;  2CWY A;  3UT5 E;  4LF7 T;  2VQF T;  2C5J A;  2NP9 A;  3NRX A;  5F8P A;  2YEV C;  3QB5 A;  4MFR A;  5L2L A;  4AKL A;  1YXR A;  5LB7 B;  5JQG E;  3OPC A;  4LFA T;  4UEL A;  3UUN A;  2A3D A;  2H7V C;  3EAM A;  4P1N A;  4DUZ T;  1US7 B;  4P0A A;  2MYS A;  3ZEF B;  2DNX A;  3EDV A;  5FP3 A;  2XZE A;  1G8X A;  2WCA A;  1YQ3 A;  2XQ4 A;  3Q5D A;  3A8Y C;  2VKO A;  3Q5E A;  4P09 A;  3R6N A;  3SFE A;  1T98 A;  3L3P A;  4AKI A;  1FEW A;  4ZI2 D;  4LFC T;  1OED B;  1G73 A;  4MLK A;  4HWF A;  3AEF A;  4CI1 B;  4JI3 T;  4JUY A;  5ABF B;  1LVK A;  3PTR B;  2EHO C;  5HYA A;  1N36 T;  3PUG A;  2H7O A;  2JQH A;  2VKH A;  2YDQ A;  3BQK A;  4YLH A;  3QNU A;  2V7J A;  3OTO T;  4WYV A;  1HX1 B;  2BS3 A;  2V8S V;  1AJ3 A;  1NWM X;  3VHL A;  3JAF A;  3UUB A;  3ZPO A;  2DWK A;  3JAE A;  4B3M T;  3N5L A;  2CRB A;  2M6B A;  2V26 A;  2X51 A;  2XQY A;  1NEN A;  2V7I A;  1T72 A;  2X68 A;  3GA8 A;  3MK7 C;  1BR2 A;  4U74 A;  4X64 T;  4HFH A;  4E7Z A;  2XPK A;  3MJX A;  4UR9 A;  1HFA A;  4O4J E;  3ZMV B;  5ABF A;  4GYR A;  2WBL A;  3AVS A;  3CK6 A;  5LGU B;  2WZH A;  5LBQ B;  4JI2 T;  3RYH E;  3AE9 A;  3EHZ A;  5AQS B;  2LRL A;  5GON E;  5LMN T;  4ASK A;  4CZZ B;  5HEO A;  4LML A;  4GKJ T;  5FXZ A;  2K48 A;  3T8O A;  3AE8 A;  3PUV F;  3RC8 A;  4DR4 T;  1VCS A;  1T8B A;  1IZN B;  1D1C A;  1O3X A;  2WDV A;  4UV9 B;  5ABE A;  3CX7 B;  2W63 A;  4H9N C;  4UVC B;  2BKO A;  3ETU A;  5L4H A;  3HKB E;  4QHO A;  3LBX A;  2UUC T;  3H3M A;  4EV6 A;  3AAE B;  4DV3 T;  5FY1 A;  2N1G A;  4IDQ A;  3C50 A;  3PJA A;  2XAJ B;  4ILU A;  4OYJ A;  5FY0 A;  4A5X A;  5F3J A;  3OBV E;  2CXD A;  2KXP B;  3P4Q A;  4IDZ A;  4EOZ B;  3RLF F;  4ISS A;  5FY7 A;  5LG3 A;  2DHR A;  2Y8D A;  5JDH A;  2LSY A;  2PJQ A;  2E5V A;  2LEH A;  4I0U A;  3AE3 A;  3N9M A;  3UFG A;  4GYS A;  2C5K T;  4B3S T;  4QXH B;  4O4L E;  3AE2 A;  2KWI B;  2ZM8 A;  4TWF A;  1N33 T;  1M7K A;  2CEA A;  1WFD A;  4QH1 A;  4PJM A;  4ZXL A;  4TUY E;  4PK5 A;  5AQG B;  1B7T A;  4HWD A;  4OX9 T;  4KHP T;  5L3G B;  4K0K T;  2NW8 A;  1Z0P A;  2BG9 C;  2ES0 A;  2PG8 A;  2PFV A;  5LP6 E;  4X65 T;  1Z8U A;  4PJN A;  2KIN B;  4B3R T;  5JRE A;  3E22 E;  3ZST A;  4X1I E;  2LSG A;  2JQK A;  3E08 A;  2F4V T;  1Y01 A;  4O8S A;  4DV1 T;  5M4Y A;  5L47 A;  3RRC A;  1V9D A;  1HX8 A;  2V6X A;  3L09 A;  2WAU A;  4CN4 A;  4EYY R;  2FJD A;  1FIO A;  3AE5 A;  3AEG A;  1CHU A;  4PJL A;  2CXF A;  2JRK A;  3ANW A;  5HCJ A;  3RQW A;  1SUM B;  2BS4 A;  5ETW A;  4PFO A;  5AFU L;  5JDL A;  5HXR A;  4UVA B;  3ETV A;  3UQ4 A;  4EGW A;  3ZYK A;  2LKG A;  2LM2 A;  4DV5 T;  2B76 A;  1NEK A;  3GMI A;  1R8I A;  1WYB A;  1NAF A;  1N32 T;  2CHN A;  2XAS B;  5JDF A;  4KHZ F;  4U31 A;  4HFI A;  3RH3 A;  4NPP A;  2UXX B;  1MMN A;  2LSK A;  3AE4 A;  5JRC A;  1VRB A;  3I1A A;  2DWG A;  2BZB A;  2C5I T;  2B1E A;  2KND A;  2OLT A;  2X66 A;  3CPZ A;  1SHZ C;  4O4I E;  4ERR A;  3CQX C;  5LJM A;  4GKK T;  1D1A A;  2E9X C;  3WI3 A;  5L3C B;  3O9X A;  4I43 B;  2IHR 1;  2MTQ A;  3FB2 A;  3ABV A;  3O1I A;  1MMD A;  2CWO A;  2IUB A;  2WY2 A;  4GIW A;  1D0X A;  4AQF C;  5A1L A;  3PUZ F;  1J1J A;  4HFB A;  1W0A A;  5AQM B;  5DQV A;  2YU2 A;  4YSX A;  2A72 A;  3FBZ A;  4HWH A;  2CHO A;  4JYA T;  1U5P A;  3QOF A;  4YTM A;  3IBP A;  5EZY E;  5FXW A;  1S94 A;  4L0R A;  4F8H A;  4DV4 T;  4ADZ A;  3SS1 A;  4DR6 T;  2WWU A;  4WNK A;  2QVA A;  4HFE A;  2XQ3 A;  4ZZC A;  5AQJ B;  3AA7 B;  4IDO A;  3VRB A;  3ZT7 A;  1UUR A;  3FZL B;  4I50 E;  1W0B A;  4U7I A;  4Z91 A;  3CIR A;  5JDM A;  5JTG A;  2MOZ A;  1M62 A;  3UU5 A;  5JR9 B;  4CXW A;  2UU9 T;  5AQP B;  5LGN B;  3IF8 B;  3K1S A;  2QA7 A;  5ABH A;  1IBK T;  1I6Z A;  4QWN B;  2XAF B;  5CFB A;  5KMG P;  3IA3 A;  1XWM A;  2LM9 A;  4TWD A;  2JMK A;  2XHE B;  3RYI E;  3ONX A;  3EUH A;  3H37 A;  4GK0 E;  2K5B B;  1FMV A;  2E9X D;  4H9O C;  4YXD A;  2JPF A;  3P4R A;  3ZMU B;  2UXC T;  5HAX A;  2I0M A;  3QUJ A;  3TLS A;  2J47 A;  1N34 T;  5LXT E;  4KUM B;  1XNR T;  5AQI B;  1UK5 A;  3KIN B;  2QRX A;  2XSA A;  3G06 A;  3PUR A;  4Q25 A;  4CN1 A;  2X0Y A;  5HWX A;  2HPJ A;  2W2U A;  3C4W A;  4PFP A;  2DL1 A;  2YDS A;  2UXN B;  4WZX A;  4PAG A;  4IE6 A;  3TLV A;  2BG9 A;  3ZYL A;  4HKA A;  5FVL A;  4DV0 T;  4DV7 T;  4LF9 T;  4GOU A;  3VU7 H;  1E1H B;  3PUW F;  2W61 A;  4IL4 A;  4X20 E;  1ZOY A;  4IHJ E;  1MIW A;  2XJ7 A;  3R84 B;  3VR8 A;  2WS3 A;  3ESL A;  2IW5 B;  1HR0 T;  1W09 A;  4EAH A;  2PTF A;  2BG9 B;  2XAH B;  2JIW A;  2N9D A;  3OJA A;  4CI2 B;  2P9B A;  3ONJ A;  5LG4 A;  5H6Q B;  4B6X A;  2VK9 A;  1YD8 G;  3KVB A;  1HNZ T;  2WM9 A;  4JEU B;  4U72 A;  2WWV A;  3CX6 B;  4YHJ A;  4LF4 T;  4KMC A;  3UUX B;  4C91 A;  2L3L A;  2XAQ B;  3AEC A;  3P4S A;  5H6R B;  3ZMT B;  3ZT5 A;  2CCQ A;  5DQW A;  4ZS3 A;  2I6H A;  4YSY A;  3JC6 C;  4IST A;  2WMN A;  4BA9 A;  1Y64 B;  2BKP A;  2YIN A;  4BJM A;  2SPC A;  4DR2 T;  2DI4 A;  1OED E;  4ZI7 E;  4U2Y A;  4DBQ A;  4AQG A;  5L3D B;  1JNR A;  3KV9 A;  1U4Q A;  3O1H A;  4XBF B;  1L0V A;  4H9P C;  4X1Y E;  1GQE A;  3H3A A;  3T1Y T;  4TX5 A;  3ZLI A;  4LMJ A;  2ZM2 A;  4EED A;  4UVB B;  1KK7 A;  3AEA A;  2HH7 A;  3HA4 A;  5JR9 A;  2LSJ A;  3I0Q A;  3UQ7 A;  3D0T A;  2G0U A;  5F5W A;  4EXT A;  2CM0 A;  3IHR A;  3KFW X;  2DCF A;  4A97 A;  2JQQ A;  3C51 A;  5AQF B;  2JJ9 A;  3KV5 A;  1YQ4 A;  3NRY A;  4DR3 T;  4ZEY A;  1LVF A;  3PJA J;  4N78 D;  2H89 A;  2GK9 A;  5LBM A;  4ILC A;  3UU8 A;  1W9R A;  4XZC A;  3RIU A;  3UTK A;  4JI6 T;  5BR8 T;  1MIV A;  2XQ7 A;  4PK4 A;  2W62 A;  1XNQ T;  3DP7 A;  1WCR A;  4MBQ A;  3J7Y q;  3WAK A;  4PK6 A;  3JC6 D;  5J0Z A;  4PW8 A;  2WSS V;  2VKD A;  2VB6 A;  1QLB A;  2WQY A;  2ZM0 A;  3V5U A;  5L3F B;  4AIS A;  4OYK A;  1LKX A;  2CBJ A;  4ZHQ E;  3UFE A;  3CQC B;  3FXE B;  3SRZ A;  2X9H A;  2HHH T;  2E2A A;  1LRZ A;  5L3E B;  2NWB A;  4WBO A;  4Z8X A;  4DO0 A;  3M65 A;  3NZP A;  4NXN T;  4UV8 B;  2LT3 A;  1OXZ A;  2YN6 A;  3GN5 A;  3KV4 A;  3S4U A;  5HWY A;  5LCY A;  3V5S A;  3VR9 A;  2XAG B;  3PV0 F;  4HFC A;  3BQI A;  4IIJ E;  1OED C;  4TV9 E;  5FXX A;  3RX6 A;  4YHH T;  3L8R A;  4HE8 A;  4LF5 T;  2X67 A;  4KP3 C;  2UXB T;  5CB4 E;  1WLX A;  3EDU A;  4HFD A;  2V1D B;  3RYC E;  2LE8 A;  5HEH A;  2WU5 A;  2W00 A;  3CWZ B;  4HWI B;  3ANW B;  4PNI A;  2UUB T;  4AI6 A;  4QX8 B;  3MKD A;  4ZOL E;  4Z90 A;  4F6R C;  1WYC A;  4YFS A;  2D0U A;  5FVK A;  3Q2M A;  1HS7 A;  3N2G E;  3N2O A;  1XDO A;  3OYZ A;  4BAY B;  5AQK B;  2A9U A;  3AVR A;  3N2K E;  3KBT A;  2W4X A;  3BK9 A;  4V1A v;  3LK3 B;  2J62 A;  4EZH A;  3AA0 B;  4UF0 B;  2XTL A;  1UX4 A;  3OKQ A;  4H9S E;  5LHI B;  1XMQ T;  2CA5 A;  5IHY A;  2L9Q A;  2VL0 A;  3PUA A;  1MNE A;  1KNR A;  2X9X A;  4HFV A;  3GN5 B;  4YJ3 E;  4HEA A;  5IYZ E;  3CKD A;  5C8Y E;  5JR9 C;  2L8K A;  2N2N A;  3HKD E;  2LOP A;  5J2T E;  5AQL B;  3RIF A;  3SFD A;  5HXS A;  2ZM6 T;  2KT9 A;  3QC9 A;  2Y6X A;  3ZT6 A;  1HF8 A;  5FYM A;  4YJ2 E;  2X0H A;  4HWC A;  3GWH A;  5LGT B;  3B13 A;  4CXY A;  3Q9D A;  5KX5 E;  1SA0 E;  4L5G A;  2LSI A;  4U2Z A;  3ZMS B;  1ZV4 X;  5JDN A;  4UIG A;  2X0L B;  4NUV A;  3FZK B;  1IJ6 A;  4PJJ A;  2MBG A;  2VVS A;  3ZMZ B;  4JV5 T;  3ZCI A;  1XMO T;  3F57 A;  3N9Q A;  5AQN B;  4CXX A;  3CML A;  3MZK B;  3RIA A;  2WB5 A;  3ZC0 A;  5AQR B;  3AAI A;  5J2U E;  1HNX T;  3AE1 A;  3AED A;  1OWA A;  2EHO B;  2KSR A;  2ACZ A; 
#chains in the Genus database with same CATH homology
 4G2A A;  1MMG A;  3C4Z A;  2D2S A;  4O2B E;  4ANJ A;  3B57 A;  3N9P A;  5EK4 A;  1WRD A;  2K9A A;  2Q9Q A;  3HKE E;  4NUU A;  4A56 A;  5LJM A;  4EZ4 A;  4IE0 A;  2YU1 A;  4ZS2 A;  3MXZ A;  3LFM A;  4G63 A;  4CI3 B;  2D5U A;  2V7L A;  1CUN A;  2CMR A;  2D0T A;  3DJB A;  5BMV E;  1MND A;  5DJQ C;  2Y48 B;  3BQL A;  1ZEE A;  4FJO A;  5KDM C;  1D0Z A;  2KMF A;  3AB3 B;  3NZQ A;  1ZHC A;  5L3B B;  2LHN A;  3C4X A;  3SOL A;  2CLY B;  3RC3 A;  3HL6 A;  4EB6 E;  5JDG A;  3I0O A;  4O4H E;  2CLY C;  3N9O A;  3ZCJ A;  3W15 B;  3PUQ A;  2HPL A;  2V7M A;  2Q9Q D;  2KZ7 B;  4OFZ A;  4TV8 E;  4WBN E;  3KBU A;  5HXH A;  2V7K A;  1ZKE A;  3U78 A;  2KLQ A;  4UEM A;  2E9X A;  4IE5 A;  4HN9 A;  2ZLY A;  4ZI3 C;  1HG5 A;  3MAC A;  4H9R C;  1MMA A;  5JDH A;  1D1B A;  3ZJ1 A;  3PU3 A;  3VKG A;  3FBL A;  2YK0 A;  2E8I A;  3PDY A;  5LYJ E;  1EZ3 A;  1MIY A;  1HCI A;  3RRW A;  3I9W A;  1BR1 A;  1D0Y A;  3QK6 A;  4OK0 A;  5HXC A;  3CX8 B;  1H7C A;  2ODU A;  3CQG B;  3NBX X;  4BJN A;  2A2F X;  2X9W A;  2DLR A;  2EHO D;  2QGS A;  2WMO A;  4TX5 A;  2KWH A;  2M67 A;  2VWA A;  2J1D G;  4X1K E;  4P0B A;  3UUM A;  3ZC1 A;  1UCU A;  4AKH A;  2ZMA A;  2XUE A;  3U3I A;  4DVD A;  5LHH B;  3LG7 A;  3HR0 A;  3TKL B;  2NOX A;  5EK3 A;  5FNV E;  5ADX L;  4JEH B;  4QX7 B;  3J9X 1;  2VAS A;  3DTO A;  3KV6 A;  3AAA B;  1IAP A;  2LHR A;  5FMN A;  4OHF A;  3RPU A;  4TZ4 C;  1BR4 A;  4IE7 A;  2W0G A;  2K24 A;  5CA0 E;  3CVR A;  3IEE A;  3Q5X A;  2Q9Q C;  4H63 V;  3HKC E;  3P7I A;  1S35 A;  5HXE A;  1QUU A;  2Q9Q B;  2VL8 A;  4FI5 A;  2PBI A;  4ZI3 D;  2RA1 A;  1KNZ A;  5DAB A;  3C64 A;  5E0O A;  4I55 E;  2ACX A;  3O1J A;  1HS7 A;  3RKO A;  2EHO A;  3E0Z A;  2C0S A;  1X79 A;  4I4T E;  4M1P A;  2ODV A;  4TN7 B;  5JVD E;  4AKR B;  3VKH A;  2NTY A;  1YW0 A;  2NW7 A;  2NW9 A;  3Q5W A;  2JMH A;  4QXC B;  2CXL A;  3KVA A;  3PUS A;  3F2E A;  3K3Q C;  3N9N A;  3ZYM A;  4AKG A;  1IJ5 A;  3LK4 2;  3KDS E;  3MA9 A;  4XAX B;  2I59 A;  4O2A E;  3LK2 B;  5J1G A;  3AA6 B;  4DBR A;  3F31 A;  2OA5 A;  4WW0 A;  2X9Y A;  4C90 A;  3K3N A;  4EYU A;  2IC9 A;  3AA1 B;  3SWH A;  3WAJ A;  4UF0 A;  4H9Q C;  4HGA A;  5JDQ A;  3LJC A;  1HTJ F;  4J2C A;  1YKE B;  4KBM B;  1VOM A;  3PE0 A;  3I9Y A;  5EK2 A;  4GK5 E;  5LHG B;  4QKN A;  4E7S A;  4IE4 A;  3EVY A;  5J2T E;  2E9X B;  1UX5 A;  3FXD B;  1QSD A;  3LBX B;  4DMW A;  3RYF E;  3C98 B;  2BVM A;  5FXV A;  5LA6 E;  2RP4 A;  3N9L A;  4ZI2 C;  2LJL A;  4UXN B;  1FMW A;  3PU8 A;  2BVL A;  2H3R A;  5LOV E;  4AQF A;  2IC6 A;  4HTE A;  3A5X A;  4CQI A;  2NTX A;  5LJN A;  4IGU A;  4QXB B;  3ZN0 B;  5LNK A;  1BR0 A;  4H63 H;  2Z6E A;  3HI2 A;  3O4X E;  4K0U A;  3FHN A;  3K3O A;  2LOS A;  4AXP A;  3ZN1 B;  1YKH B;  1HG2 A;  2BDE A;  3K8P C;  2VKJ A;  3UUL A;  4L9I A;  4EIW A;  4JLE A;  4DMV A;  5JH7 E;  2CE7 A;  3OYX A;  3P8C D;  4MHC A;  5CA1 E;  5TAO A;  4DND A;  3ZJ2 A;  5JRC B;  1WR6 A;  2IAK A;  2CWY A;  3UT5 E;  2C5J A;  2NP9 A;  3NRX A;  5F8P A;  2YEV C;  4MFR A;  5L2L A;  4AKL A;  5JQG E;  4UEL A;  3UUN A;  2A3D A;  2H7V C;  1US7 B;  4P0A A;  2MYS A;  3ZEF B;  2DNX A;  3EDV A;  5FP3 A;  1G8X A;  3J7Y q;  2VKO A;  4P09 A;  3R6N A;  1T98 A;  3L3P A;  4AKI A;  1FEW A;  4ZI2 D;  1G73 A;  4MLK A;  4CI1 B;  4JUY A;  1LVK A;  3PTR B;  2EHO C;  5HYA A;  3PUG A;  2H7O A;  2VKH A;  3BQK A;  4YLH A;  2V7J A;  1AJ3 A;  1NWM X;  3VHL A;  3ZPO A;  2DWK A;  3N5L A;  2V26 A;  2X51 A;  2XQY A;  2V7I A;  3MK7 C;  2X68 A;  3GA8 A;  1BR2 A;  4U74 A;  4E7Z A;  3ZMV B;  3MJX A;  1HFA A;  4O4J E;  4GYR A;  2WBL A;  3AVS A;  5LGU B;  5LBQ B;  3RYH E;  5GON E;  4ASK A;  4CZZ B;  5FXZ A;  2K48 A;  3T8O A;  3RC8 A;  1IZN B;  1D1C A;  1O3X A;  4UV9 B;  3CX7 B;  2W63 A;  4H9N C;  4UVC B;  3ETU A;  3HKB E;  4QHO A;  3LBX A;  3AAE B;  5FY1 A;  2N1G A;  5F3J A;  3C50 A;  2XAJ B;  4ILU A;  4OYJ A;  5FY0 A;  3OBV E;  2CXD A;  2KXP B;  4EOZ B;  4ISS A;  5FY7 A;  2DHR A;  2Y8D A;  2LSY A;  2PJQ A;  2LEH A;  3N9M A;  4GYS A;  2C5K T;  4QXH B;  4O4L E;  2KWI B;  2ZM8 A;  2CEA A;  4PJM A;  4TUY E;  4PK5 A;  1B7T A;  5L3G B;  2NW8 A;  1Z0P A;  2ES0 A;  2PG8 A;  2PFV A;  5LP6 E;  4PJN A;  2KIN B;  5JRE A;  3E22 E;  4X1I E;  2LSG A;  3E08 A;  4O8S A;  5M4Y A;  3RRC A;  1V9D A;  1HX8 A;  3L09 A;  4EYY R;  2WAU A;  1FIO A;  2CXF A;  2JRK A;  3ANW A;  5ETW A;  4PFO A;  5AFU L;  5JDL A;  5HXR A;  4UVA B;  3ETV A;  3ZYK A;  3GMI A;  1WYB A;  1NAF A;  2XAS B;  5JDF A;  3RH3 A;  2UXX B;  1MMN A;  2LSK A;  5JRC A;  1VRB A;  3I1A A;  2DWG A;  2BZB A;  2C5I T;  2B1E A;  2KND A;  2X66 A;  3CPZ A;  4MAL A;  1SHZ C;  4O4I E;  4ERR A;  3CQX C;  1D1A A;  2E9X C;  3WI3 A;  5L3C B;  3O9X A;  4I43 B;  2MTQ A;  3FB2 A;  3O1I A;  1MMD A;  2CWO A;  4GIW A;  5A1L A;  1D0X A;  4AQF C;  5DQV A;  2YU2 A;  3FBZ A;  2A72 A;  1U5P A;  5EZY E;  5FXW A;  3IBP A;  1S94 A;  4L0R A;  4ADZ A;  3SS1 A;  2WWU A;  4WNK A;  3AA7 B;  4I50 E;  5JDM A;  2MOZ A;  5JR9 B;  4CXW A;  5LGN B;  3IF8 B;  2QA7 A;  4QWN B;  2XAF B;  5KMG P;  2LM9 A;  2JMK A;  2XHE B;  3RYI E;  3ONX A;  3EUH A;  3H37 A;  4GK0 E;  2K5B B;  1FMV A;  2E9X D;  4H9O C;  2JPF A;  3ZMU B;  5HAX A;  3QUJ A;  5LXT E;  4KUM B;  3KIN B;  3PUR A;  5HWX A;  2HPJ A;  3C4W A;  4PFP A;  2UXN B;  4PAG A;  4IE6 A;  3ZYL A;  4HKA A;  4GOU A;  3VU7 H;  1E1H B;  2W61 A;  4X20 E;  4IHJ E;  1MIW A;  3R84 B;  3ESL A;  2IW5 B;  4EAH A;  2XAH B;  3OJA A;  2N9D A;  4CI2 B;  2P9B A;  5H6Q B;  4B6X A;  2VK9 A;  1YD8 G;  3KVB A;  2WM9 A;  4JEU B;  4U72 A;  3CX6 B;  4YHJ A;  4KMC A;  3UUX B;  4C91 A;  2L3L A;  2XAQ B;  3ZMT B;  5H6R B;  4DBQ A;  2CCQ A;  5DQW A;  4ZS3 A;  3JC6 C;  4IST A;  2WMN A;  4BA9 A;  1Y64 B;  2YIN A;  4BJM A;  2SPC A;  2DI4 A;  4ZI7 E;  4AQG A;  5L3D B;  3O1H A;  3KV9 A;  1U4Q A;  4XBF B;  4H9P C;  4X1Y E;  3H3A A;  3ZLI A;  2ZM2 A;  4UVB B;  1KK7 A;  2HH7 A;  3HA4 A;  5JR9 A;  2LSJ A;  3I0Q A;  3D0T A;  2G0U A;  4EXT A;  2CM0 A;  3IHR A;  3KFW X;  2DCF A;  2JQQ A;  3C51 A;  2JJ9 A;  3KV5 A;  3NRY A;  1LVF A;  4N78 D;  2GK9 A;  5LBM A;  4XZC A;  3UTK A;  1MIV A;  4PK4 A;  2W62 A;  3DP7 A;  4MBQ A;  3WAK A;  4PK6 A;  3JC6 D;  4PW8 A;  2WSS V;  2VKD A;  2VB6 A;  2ZM0 A;  3V5U A;  5L3F B;  4OYK A;  1LKX A;  4ZHQ E;  3UFE A;  3CQC B;  3FXE B;  3SRZ A;  2X9H A;  1LRZ A;  5L3E B;  2NWB A;  4WBO A;  4Z8X A;  4DO0 A;  3M65 A;  3NZP A;  4UV8 B;  2LT3 A;  1OXZ A;  3GN5 A;  3KV4 A;  3V5S A;  3S4U A;  5HWY A;  5LCY A;  5LG4 A;  2XAG B;  4TV9 E;  5FXX A;  3BQI A;  4IIJ E;  3RX6 A;  4HE8 A;  2X67 A;  4KP3 C;  5CB4 E;  1WLX A;  3EDU A;  2V1D B;  3RYC E;  2LE8 A;  2W00 A;  3CWZ B;  3ANW B;  4PNI A;  4AI6 A;  4QX8 B;  3MKD A;  4ZOL E;  4F6R C;  1WYC A;  4YFS A;  2D0U A;  3Q2M A;  3N2G E;  3N2O A;  3OYZ A;  4BAY B;  3AVR A;  3N2K E;  3KBT A;  4V1A v;  3BK9 A;  3LK3 B;  4EZH A;  3AA0 B;  4UF0 B;  2XTL A;  1UX4 A;  3OKQ A;  4H9S E;  5LHI B;  2CA5 A;  5IHY A;  2L9Q A;  3PUA A;  1MNE A;  2X9X A;  4YJ3 E;  4HFV A;  3GN5 B;  5IYZ E;  4HEA A;  5JR9 C;  3CKD A;  5C8Y E;  2L8K A;  2N2N A;  3HKD E;  2LOP A;  5HXS A;  2KT9 A;  3QC9 A;  2Y6X A;  1HF8 A;  5FYM A;  4YJ2 E;  3GWH A;  5LGT B;  3B13 A;  4CXY A;  3Q9D A;  5KX5 E;  1SA0 E;  4L5G A;  2LSI A;  3ZMS B;  1ZV4 X;  5JDN A;  4UIG A;  2X0L B;  4NUV A;  1IJ6 A;  4PJJ A;  2MBG A;  3ZMZ B;  3ZCI A;  3F57 A;  3N9Q A;  4CXX A;  3CML A;  3MZK B;  3ZC0 A;  3AAI A;  5J2U E;  1OWA A;  2EHO B;  4PJL A;  4IDZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...