3ZCIA

Crystal structure of helicobacter pylori t4ss protein cagl in a cubic crystal form with a distorted helical conformation of the rgd-motif
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
212
structure length
191
Chain Sequence
b'GAMEDITSGLKQLDSTYQETNQQVLKNLDEIFSEMGEEDALNIATAAIALRGDLALLKANFEANELFFISEDVIFKTYMSSPELLLTYMKINSDKVLVLYCEGKLKIEATAQNIRERLETSLKAYQSNIGGTASLITASQTLVESLKNKNFIKGIRKLMLAHNKVFLNYLEELDALERSLEQSKRQYLQER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAG PATHOGENICITY ISLAND PROTEIN (CAG18)
publication title A Helical Rgd Motif Promoting Cell Adhesion: Crystal Structures of the Helicobacter Pylori Type Iv Secretion System Pilus Protein Cagl
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Protein binding
total genus 90
structure length 191
sequence length 212
ec nomenclature
pdb deposition date 2012-11-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1660 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3zciA00
3ZCIA 3ZCJA
chains in the Genus database with same CATH superfamily
4DMWA 2FJDA 1J1JA 2WCAA 2DLRA 2LKHA 2WP9A 5FP3A 2QA7A 3ZN1B 4PFPA 3RRWA 2MTQA 2PG8A 5L4HA 2M6IA 3ONLC 3C51A 2H89A 4UXNB 4NUUA 5FYMA 2MYSA 2E5VA 5AQIB 4A97A 4OFZA 3EUHA 4KI0F 5JQGE 3Q9DA 2KMFA 1HTJF 4WW0A 2OLTA 3PUAA 4DV3T 2KINB 2MAWA 2ACXA 3I0QA 5HCMA 1E1HB 1YQ4A 2NW8A 2W00A 1UUSA 1S35A 2M67A 2EHOD 4YTPA 2CEAA 4DR7T 1HX1B 2XASB 2I0MA 4HKAA 3ZC0A 3AVSA 3JAFA 4O4HE 3QNUA 5HWXA 3LJCA 4XBFB 3VKGA 5JDGA 4LFAT 2UXBT 5L2LA 3P4QA 4WYVA 2FJBA 2UXDT 2GK9A 2FJAA 2H7OA 4PW8A 2Q9QB 2WQYA 2Q9QA 4E7ZA 2KXPB 5AQUB 2WZHA 1HF8A 5EK3A 4QH4A 4YT0A 1SUMB 3O4XE 2WSSV 2V8SV 3L3PA 5HEHA 4ZEYA 2PJQA 2WY2A 5LP6E 2Y6XA 2CM0A 4OYJA 4KP3C 1WLXA 1ZKEA 3NRXA 3I9YA 3HKDE 3KVBA 4HTEA 4H9RC 5JDQA 3GA8A 2CWOA 3I0OA 5HEGA 4TWHA 4I43B 1KNRA 2QGSA 2Y8DA 5C3JA 3N2GE 4ISTA 3MA9A 4LF7T 4QKNA 3ZPOA 2WS3A 5LGTB 2ZLYA 4PK4A 2J62A 4ZZCA 3E0ZA 4HFVA 2VKDA 2VKOA 2W2UA 3EI0A 4H9NC 2HH7A 2CBIA 1HG5A 4PK5A 1G8XA 2C5KT 5AQQB 1QUUA 3KFWX 5LG4A 5KDMC 5BR8T 3ZJ2A 4YSXA 5LBMA 3CWZB 2V26A 3OYXA 5H6RB 3OYZA 4QXBB 4AKIA 4IDOA 3UULA 2VASA 3AB3B 4CN4A 4DV0T 4PJMA 5HXRA 2X9YA 2H88A 3X1DA 1QLBA 2YK0A 5AQFB 3SRZA 1T7SA 1CUNA 4X1YE 1S94A 4P0AA 4EIWA 5FY0A 3MZKB 4Q25A 4IE0A 4UEMA 4ZI2D 4IDQA 5CGMA 4U7YA 2WMOA 2VK9A 4IGUA 3AVRA 3OJAA 1LVFA 4HFIA 1T98A 2W66A 2XQ5A 4DR5T 4I55E 2ZM8A 2HPLA 4UVAB 3EABA 2SPCA 2V7JA 3TLUA 1BR0A 2XSAA 2YDRA 3AAIA 4UV9B 3NBXX 3AEFA 5CFBA 1HNZT 3UQ4A 1E2AA 2NTYA 4JI6T 4QWNB 3MXZA 1UURA 2BVMA 1MIYA 1X79A 2XY8B 5LHHB 4HFHA 3RYCE 4QXCB 5AQOB 1IJ5A 4O4IE 3ZYMA 3PUZF 2HN1A 1WRDA 4YLHA 2HN2A 3BQLA 2XQAA 2WMNA 4AISA 4OK0A 1Y01A 2IAKA 3IF8B 2LOPA 2Q9QD 2IC9A 3CX8B 3DTOA 2YU2A 1U5PA 4WZXA 3UU5A 3MKDA 5FKYA 4I0UA 5LGUB 1W9RA 3J9X1 3CQGB 3RYFE 5BMVE 3UQ7A 1N34T 3JC6D 3Q5WA 2WWVA 2IIUA 1YKHB 4UVCB 4YHJA 3G06A 3O1JA 2A9UA 4EEDA 4DR3T 2NWBA 3LG7A 1D1BA 4X1KE 1E7PA 2L9QA 4CZZB 3T1HT 4JV5T 3MK7C 5DQWA 2WDQA 4LFBT 3OBVE 3AEDA 2ODVA 5FXZA 2K48A 2J4GA 4AQFC 3A8YC 3PUVF 3QB5K 1OWAA 2WU5A 2YDQA 4TWFA 3PUXF 2A2FX 3TLTA 2LKGA 2W61A 2UXCT 5HWYA 3ZJ1A 5JDLA 3VRAA 3TLWA 2R6GF 5AQTB 5AQGB 1XMQT 3AAAB 1V9DA 3ONXA 3LK42 3NVOA 2NOXA 2W62A 2PFVA 4YTMA 3ZN0B 4PAGA 5EK2A 2XHEB 3GMIA 3KV4A 2V1DB 2YINA 3PJAJ 4DV6T 5L3EB 3WI3A 4HWIB 4ILUA 3KBTA 2D0TA 4U2YA 3ZYLA 4TX5A 2VL0A 5LA6E 2X9XA 3ZLIA 2I59A 3UU6A 4WBOA 5LGNB 1UX5A 4IE7A 3RC3A 1W09A 2RPAA 5KXJA 4O8SA 4KX6A 4I4TE 3C4WA 1SHZC 4X5TA 4TUYE 3LBXB 3RC8A 2YDSA 1KNZA 3LBXA 3PU8A 3JADA 3UU8A 3AE3A 2ES0A 2V7LA 4IE5A 3R84B 2DI4A 3AEGA 4DV7T 3NZQA 3CX6B 2QVAA 2Y48B 4JI8T 1VCSA 4C91A 1H7CA 3AAEB 1UK5A 3ONJA 1YW0A 4M1PA 2CBJA 3LFMA 3KINB 2K3WA 4X20E 4TNWA 4H9PC 3IBPA 4IHJE 4TV9E 4KHPT 5ABGA 5JR9C 2VVNA 3AA1B 2LM2A 4ANJA 5ETWA 1D0ZA 2F4VT 3E08A 2ZM6T 2ODUA 4JBWF 4MBQA 3SS1A 2XQYA 2VKHA 2UXXB 2B76A 4DIDB 5AQHB 1LVKA 4JI4T 2VL8A 4U7IA 5DABA 4EOZB 3VKHA 1ZV4X 2VURA 4DR2T 2LSJA 3ABVA 2UUBT 4L5GA 1XWMA 3KBUA 2XQ4A 2IMLA 4NXMT 4HFEA 4EZHA 3M65A 4OHFA 3EDUA 5FY7A 3MJXA 5CJ5A 4UVBB 2JQHA 2JIWA 3NRYA 3PUGA 4ISSA 1YD8G 3KV9A 2KT9A 3SWHA 2XSBA 3FZHB 3PUSA 5LXTE 4EYYR 3A5XA 4AQGA 3CQCB 2LEHA 3P50A 1NEKA 3AE2A 4IE6A 2KLQA 5JDHA 2CE7A 3CVRA 4JI5T 3ZYKA 4L9IA 2VB6A 5LNKA 1HS7A 5J2UE 5AQPB 2UUCT 4DR4T 2E5LT 4TNVA 3SOLA 2LSKA 4YJ2E 5FL1A 4QXHB 3HI2A 3HKBE 2LM9A 4TV8E 2XAQB 3H3MA 3PU3A 2XQ6A 3AA6B 3P4SA 2DHRA 4ZHQE 5IWAT 1M62A 4PK6A 1U4QA 4UF0B 5J0ZA 4A56A 2D0UA 4UF0A 4EAHA 4HE8A 4J2CA 4UR9A 2KSRA 3K3QC 3V5UA 2L8KA 4LF4T 3ZT5A 2LSIA 4DR6T 3EVYA 1MMGA 2V7IA 2N2NA 3RH3A 5LJMA 3O1IA 4P09A 5FL0A 3CX7B 5C8YE 1CHUA 3GWHA 1Y64B 2N1GA 4ZS3A 5AQKB 5LJNA 1YXRA 5TAOA 3ANWB 4U3CA 4EYUA 3ETUA 3ANWA 1JNZA 1UCUA 4F6RC 2WB5A 4DV2T 3UFGA 1ZP0A 2BG9E 3LDQB 2KNDA 4GK5E 1KEYA 5JRCB 3I1AA 5L3FB 2MPKA 3RLFF 5JRCA 4PJJA 3UUBA 5J2TE 4AKLA 4IDNA 4GYSA 4F8HA 5LHIB 4AQFA 2JRKA 2VVSA 1N33T 5IYZE 3NZPA 2V6XA 3AE8A 3CIRA 4ILAA 4FI5A 1FIOA 2K9AA 4U74A 1M7KA 4E7SA 4HWFA 5L3DB 3PDYA 1N32T 4ZZBA 3QK6A 2H7VC 4JEHB 2XUEA 4HFBA 4MLKA 1QSDA 3AEEA 5F5WA 2JMHA 3PUYF 1HNWT 4H63V 5M4YA 3DP7A 4HFDA 4L0RA 3RIFA 2X66A 5AQRB 2CMRA 2WDVA 3RQUA 5CA0E 3ZT6A 1W0BA 3VHLA 3C4XA 4DNDA 2CXLA 5HXCA 3N2KE 4LMJA 2BG9C 4JLEA 3BQKA 2AXDS 2IW5B 2X0LB 4ZXLA 3L09A 3V5SA 2J47A 3K1SA 4AIUA 3P7IA 1KF6A 3AE7A 4GK0E 3QUJA 3AE9A 3FXDB 3Q5XA 1EZ3A 2XQ7A 5HYAA 2JQQA 2JQKA 4QH1A 3QC9A 3FBZA 4EGWA 4H9SE 3CQXC 1MIVA 2FBWA 4ASKA 1IZNB 3KVAA 3H3AA 1FMVA 4NPPA 1KFYA 2VWAA 3ZSTA 2LSYA 4N78D 2CHOA 4ILBA 5LCYA 5JR9B 1D1CA 3RX6A 3RF1A 3J7Yq 4MHCA 5JR9A 5AFUL 2C5JA 3ZKRA 2DWKA 2XAGB 3PUWF 1ZHCA 1VOMA 3BQIA 1BR2A 3ZEFB 3HA4A 4YY3T 5HEJA 3T8OA 4BJMA 5ABHA 4CI3B 5KX5E 3EHZA 2YN6A 2M6BA 1D0YA 4ILCA 1ZOYA 4LF9T 1B7TA 2Z6EA 5JDFA 3P4PA 5E0OA 5FXVA 5ABFB 3ZMZB 5FMNA 5ABFA 2YEVC 2OA5A 3PE0A 1IAPA 1XNRT 2IDOB 1LRZA 3E22E 4PFOA 4JI2T 5JREA 2X0YA 2UU9T 4ZOLE 4IDPA 2XPKA 5AQJB 4U72A 2WAUA 2UUAT 5LMNT 3U3IA 2JMKA 4UIGA 1WYCA 2CXFA 4BAYB 4PJNA 4GKKT 5AQLB 3RKGA 3HL6A 3BK9A 2W67A 5ADXL 1J5WA 1HFAA 5L47A 3FB2A 3UTKA 2WM9A 3D0TA 1LKXA 3RPUA 2XZEA 3FBLA 4DR1T 5GONE 1IBKT 4ZI3C 1IJ6A 3N9PA 2V7KA 3NWIA 1T8BA 4HN9A 1I6ZA 2DCFA 2BVLA 3UFEA 5LG3A 4B3ST 3LK3B 1O3XA 2X0HA 1MMAA 3HKCE 4V1Av 5LHGB 4ZI3D 5FVKA 4O4LE 4IL9A 4GIWA 1AJ3A 4UELA 4XZCA 2YOEA 4AXPA 3AE6A 4B3TT 3H37A 3N2OA 4YJ3E 3MACA 3AA0B 4EZ4A 3AE1A 4TZ4C 5FY1A 1J5ET 5AQNB 2HPJA 5J1GA 4BA9A 4IE4A 2RP4A 1OXZA 4UV8B 2LE8A 3B13A 4AI6A 1IBLT 5HCJA 5F3JA 3OKQA 4GKJT 2E9XC 5L3GB 3K3NA 5LOVE 4B6XA 5AQVB 3N9OA 2E9XD 4QX8B 4CXWA 3R6NA 4X64T 5JDNA 4ZI7E 3ESLA 4NIQA 2LT3A 5FNVE 3CKDA 3FZLB 5L4EA 2LHNA 4P0BA 4O4JE 1Z8UA 5HAXA 3PV0F 1KNPA 4B3MT 4MALA 2ZM2A 1KK7A 2LSGA 2I6HA 4TN7B 2E8IA 4C90A 1OEDE 3ZMVB 2E2AA 4AKHA 2A72A 4DUYT 3N9QA 2V5DA 3PTRB 5JDMA 1IBMT 5L3BB 1MMDA 4PNIA 2BG9B 3W15B 5JVDE 3K8PC 1FMWA 2BG9A 3CMLA 4HWCA 2EHOC 5HXHA 2VQET 2LRLA 2X9HA 3CPZA 4EB6E 4DUZT 3KDSE 2WU2A 3IA3A 2X67A 1XMOT 1SE7A 5ABEA 3AECA 2V6YB 1VRBA 5L3CB 2V6YA 1YKEB 4Z90A 3PUQA 3HKEE 4DBRA 2J1DG 3N9MA 3ZCJA 2XM2A 3F31A 4DVDA 3EAMA 3TLVA 2ACZA 3I9WA 4JYAT 2CXDA 4HFCA 2D5UA 3AXJB 1HR0T 5AQMB 5JTGA 1W0AA 3AXJA 2LOSA 1R8IA 1D0XA 2BS3A 3VR8A 1HG2A 3AEAA 1UX4A 1OEDC 4COFA 1X9BA 4X1IE 3IHRA 5AQSB 4JI3T 2V5CA 2XQ3A 3CK6A 5HEOA 1ZEEA 2CLYC 4HWHA 3AE5A 2YKSA 4O2BE 2MOZA 5FXXA 1WYBA 5IHYA 3A7MA 5H6QB 4AQYT 3RIUC 1XDPA 2JPFA 3FZFB 2H3RA 3RYHE 4YXDA 1DU2A 2WWUA 1NENA 3TLSA 3K3OA 4QX7B 3Q2MA 2XAHB 1FEWA 2QRXA 3QB5A 3PURA 3UUNA 5LYJE 2KWIB 2NW7A 2V7MA 1SA0E 4AKGA 4WNKA 3M3ZB 2JQ9A 3RKOA 2W0GA 4K0UA 4U2ZA 1MNDA 3FXEB 5FXWA 2HHHT 4CI1B 4X65T 4K0KT 3P8CD 3UUXB 5C2TA 2BS2A 2XJ7A 4CXXA 1XZYA 4YFSA 5LMUT 4LF5T 1Z0PA 5EZYE 1XDOA 2CCQA 4G2AA 4U33A 2XQ9A 3B5MA 3C50A 2BS4A 3RI5A 4DV4T 3RRCA 3AA7B 3ZMSB 3OPCA 3SFEA 1GQEA 3F57A 2NW9A 5F8PA 3SFDA 4BJNA 3ZMTB 5A1LA 3HR0A 4G63A 2LHRA 4JI7T 3C4ZA 3FHNA 4QHOA 4ZI2C 2BKPA 1T72A 4KUMB 2B1EA 5KMGP 3RHWA 5CB4E 4WBNE 4JI1T 1BR1A 3T1YT 2LJLA 4DBQA 1FJGT 4DO0A 4GOUA 4X62T 5DQVA 2BKOA 2K5BB 4EEBA 3JAEA 1HCIA 4ADZA 4GYRA 4TWDA 2BKNA 3S4UA 4A98A 2PBIA 1L0VA 2BZBA 2XAJB 3WAKA 1NWMX 2E9XB 4IL4A 5EK4A 4KMCA 2VKJA 4JEUB 3LSVA 3Q5DA 2E9XA 1MIWA 3RGLA 3ZSSA 3FZMB 3L39A 4FJOA 4EV6A 2CA5A 2FUPA 3C64A 3RQWA 3Q5EA 1XNQT 2X51A 1G73A 2CHNA 4YHHT 4H9QC 3RIAA 3TKLB 2BDEA 2IHR1 1I94T 1VCTA 4U31A 4H63H 1WR6A 3ZCIA 3WAJA 2Q9QC 4LMKA 4A5XA 1UGOA 3C98B 2A3DA 3P4WA 2D2SA 2X9WA 2RA1A 1MNEA 5IUXA 4CN1A 2WDRA 4NUVA 2WBLA 1YQ3A 3ZMUB 2DWGA 1US7B 2WZIA 4HGAA 3IEEA 3OTOT 3JC6C 4IIJE 1NAFA 5LB7B 4YSZA 4ERRA 2C5IT 4DMVA 4XAXB 3UU3A 2PTFA 3N9LA 2XTLA 1N36T 4MFRA 3VRBA 3LK2B 2EHOB 3PJAA 4LF6T 2ZM0A 3KV6A 2EHOA 4JI0T 4QH5A 3AEBA 1JNRA 3VR9A 1WCRA 3DJBA 5FVLA 2BBHA 2NP9A 4X66T 2UXNB 1MMNA 2AE9A 2JJ9A 4IREA 2KZ7B 1HX8A 5JH7E 3ZC1A 2XAFB 3OVUA 2P9BA 2CPTA 2QYWA 2L3LA 4PJLA 4DV5T 2DNXA 2G0UA 2LLYA 2XQ8A 3KV5A 4OYKA 4HWDA 2VQFT 2XM1A 4CI2B 4O2AE 4AKRB 3EDVA 4IT4A 4ZS2A 1D1AA 1OEDB 5DJQC 4B3RT 4LF8T 4OX9T 3N5LA 2KWHA 3F2EA 1OEDA 2YU1A 2X68A 4YTNA 4JUYA 2IUBA 3O1HA 2ZMAA 3VU7H 2BBJA 1HNXT 1WR0A 2CLYB 3UUMA 4LFCT 3RYIE 2N9DA 5HEUA 4CN6A 5LBQB 4CQIA 2CRBA 1WFDA 3ETVA 3RIUA 5HXSA 2K24A 3B57A 4P1NA 2NR4A 2C0SA 2MBGA 1BR4A 2NTXA 2W4XA 2OV9A 2IC6A 3O9XA 4KHZF 2CWYA 4YSYA 3UT5E 3UU4A 3GN5B 3FZKB 4Z91A 3GN5A 3QOFA 4CXYA 2D9DA 3P4RA 5CA1E 3L8RA 3AE4A 4I50E 2LRKA 4DV1T 3U78A 2W63A 4IDZA 4LMLA 4HEAA 3N9NA 5HXEA 4Z8XA 3JCFA 4KBMB 4EXTA 4NXNT 3ZT7A 2FJEA 4H9OC 3NKZA 2DL1A
chains in the Genus database with same CATH topology
4DMWA 2CXLA 5HXCA 3N2KE 2ODVA 5FXZA 2K48A 2DLRA 4JLEA 3BQKA 2IW5B 2X0LB 4AQFC 3L09A 5FP3A 3V5SA 2QA7A 3P7IA 3ZN1B 4PFPA 1ZEEA 2CLYC 3RRWA 4GK0E 1OWAA 2MTQA 3QUJA 3FXDB 2PG8A 3Q5XA 4O2BE 1EZ3A 2MOZA 5FXXA 1WYBA 2A2FX 5HYAA 5IHYA 2JQQA 2W61A 5H6QB 3QC9A 3C51A 5HWYA 3ZJ1A 3FBZA 5JDLA 4UXNB 4H9SE 4NUUA 2JPFA 2MYSA 3CQXC 3AAAB 5FYMA 1V9DA 1MIVA 3ONXA 3LK42 4OFZA 4ASKA 2NOXA 3EUHA 1IZNB 2H3RA 3KVAA 2W62A 3RYHE 2WWUA 3H3AA 5JQGE 1FMVA 2PFVA 3Q9DA 3ZN0B 3K3OA 4PAGA 4QX7B 3Q2MA 2XAHB 2KMFA 5EK2A 1FEWA 2XHEB 3GMIA 1HTJF 3KV4A 2VWAA 4WW0A 3PUAA 2V1DB 2YINA 3PURA 2LSYA 3UUNA 4N78D 5LYJE 2KWIB 5LCYA 2NW7A 5L3EB 2V7MA 5JR9B 1D1CA 3WI3A 1SA0E 3RX6A 4ILUA 3J7Yq 4AKGA 4WNKA 4MHCA 5JR9A 3KBTA 5AFUL 2C5JA 2D0TA 2KINB 2DWKA 2XAGB 3RKOA 2ACXA 3I0QA 1ZHCA 1VOMA 3BQIA 1E1HB 1BR2A 3ZEFB 3ZYLA 3HA4A 2W0GA 4K0UA 4TX5A 3T8OA 1MNDA 3FXEB 5FXWA 4BJMA 4CI3B 5KX5E 4CI1B 2NW8A 5LA6E 2W00A 2X9XA 3ZLIA 2I59A 4WBOA 3P8CD 3UUXB 1D0YA 1S35A 2EHOD 2M67A 1UX5A 5LGNB 1B7TA 2CEAA 4IE7A 2Z6EA 3RC3A 2XASB 5JDFA 5E0OA 5FXVA 4CXXA 3ZMZB 4O8SA 4HKAA 5FMNA 4YFSA 4I4TE 2YEVC 3C4WA 3ZC0A 2OA5A 3PE0A 1Z0PA 3AVSA 5EZYE 4O4HE 2CCQA 1IAPA 1SHZC 4G2AA 5HWXA 3LJCA 4XBFB 3VKGA 1LRZA 5JDGA 3C50A 5L2LA 4TUYE 3LBXB 3RC8A 1KNZA 3RRCA 3AA7B 3E22E 3LBXA 3PU8A 3ZMSB 4PFOA 2GK9A 3F57A 2H7OA 4PW8A 2ES0A 5F8PA 2NW9A 4BJNA 3ZMTB 5JREA 2Q9QB 2V7LA 4IE5A 5A1LA 2Q9QA 4ZOLE 3R84B 2DI4A 3HR0A 4G63A 2LHRA 4E7ZA 2KXPB 3C4ZA 3NZQA 3FHNA 4QHOA 4U72A 4ZI2C 3CX6B 2WAUA 1HF8A 2Y48B 5EK3A 3U3IA 4C91A 2JMKA 4KUMB 1H7CA 2B1EA 3AAEB 4UIGA 1YW0A 1WYCA 2CXFA 3O4XE 4M1PA 5KMGP 2WSSV 3WAKA 3LFMA 5CB4E 4PJNA 4BAYB 1BR1A 4WBNE 3L3PA 2LJLA 4DBQA 4DO0A 3KINB 4GOUA 5DQVA 2K5BB 2PJQA 1HCIA 4X20E 4ADZA 5LP6E 4GYRA 2Y6XA 3HL6A 3S4UA 3BK9A 4H9PC 5ADXL 2CM0A 3IBPA 4OYJA 1HFAA 2PBIA 4IHJE 4KP3C 4TV9E 1WLXA 5JR9C 3AA1B 3FB2A 3UTKA 2BZBA 4ANJA 1ZKEA 5ETWA 2WM9A 1D0ZA 2XAJB 3E08A 1NWMX 2E9XB 2ODUA 1LKXA 3D0TA 4KMCA 5EK4A 2VKJA 3RPUA 4JEUB 3NRXA 3FBLA 2E9XA 5GONE 4ZI3C 1MIWA 1IJ6A 3N9PA 2V7KA 3HKDE 3I9YA 4MBQA 3KVBA 4HTEA 4HN9A 2DCFA 2BVLA 2XQYA 3SS1A 3UFEA 3LK3B 1O3XA 2VKHA 4H9RC 5JDQA 3GA8A 2UXXB 1MMAA 2CWOA 3I0OA 3HKCE 4FJOA 4V1Av 5LHGB 4I43B 2CA5A 4ZI3D 1LVKA 2VL8A 2QGSA 4O4LE 5DABA 2Y8DA 4EOZB 3C64A 3VKHA 2X51A 1G73A 1ZV4X 3N2GE 4GIWA 4ISTA 4H9QC 3MA9A 4QKNA 3ZPOA 5LGTB 1AJ3A 4UELA 3TKLB 2LSJA 2ZLYA 4PK4A 4XZCA 2BDEA 4L5GA 4AXPA 3KBUA 3E0ZA 4HFVA 4X1IE 4H63H 2VKDA 1WR6A 2VKOA 3ZCIA 4EZHA 3WAJA 3H37A 3M65A 4OHFA 2Q9QC 3EDUA 3N2OA 4H9NC 4YJ3E 5FY7A 3MACA 3MJXA 3C98B 3AA0B 2HH7A 2A3DA 4UVBB 4EZ4A 2D2SA 2X9WA 2RA1A 1HG5A 4PK5A 4TZ4C 1G8XA 2C5KT 5FY1A 3NRYA 1MNEA 3PUGA 4ISSA 1YD8G 1QUUA 3KFWX 3KV9A 5LG4A 5KDMC 2KT9A 3SWHA 3ZJ2A 3PUSA 5LBMA 5LXTE 4EYYR 3A5XA 2HPJA 4AQGA 4NUVA 3CQCB 2LEHA 2WBLA 5J1GA 3CWZB 2V26A 3ZMUB 2DWGA 4BA9A 3OYXA 5H6RB 4IE4A 1US7B 3OYZA 2RP4A 2KLQA 4HGAA 1OXZA 4IE6A 4QXBB 2CE7A 3IEEA 5JDHA 3JC6C 4AKIA 4UV8B 4IIJE 3CVRA 2VASA 3UULA 2LE8A 1NAFA 3AB3B 3B13A 3ZYKA 4L9IA 2VB6A 5LNKA 4ERRA 4AI6A 2C5IT 1HS7A 4PJMA 5HXRA 2X9YA 4DMVA 4XAXB 5J2UE 5F3JA 3OKQA 2E9XC 5L3GB 3N9LA 3SOLA 3K3NA 2LSKA 2XTLA 4YJ2E 2YK0A 5LOVE 3SRZA 4MFRA 4QXHB 3HI2A 3HKBE 2LM9A 3LK2B 4TV8E 4B6XA 3N9OA 1CUNA 4X1YE 1S94A 2EHOB 4P0AA 4EIWA 2E9XD 2XAQB 2ZM0A 4QX8B 3KV6A 2EHOA 5FY0A 4CXWA 3R6NA 3MZKB 3PU3A 4IE0A 4UEMA 3AA6B 4ZI2D 5JDNA 2DHRA 4ZHQE 4PK6A 4ZI7E 3ESLA 1U4QA 4UF0B 2WMOA 4A56A 2D0UA 4UF0A 4EAHA 3DJBA 2LT3A 5FNVE 2VK9A 4HE8A 2NP9A 4IGUA 4J2CA 3AVRA 3CKDA 3OJAA 2UXNB 1LVFA 1T98A 1MMNA 3K3QC 3V5UA 2LHNA 2L8KA 4I55E 4P0BA 2ZM8A 4O4JE 2HPLA 2LSIA 3EVYA 4UVAB 1MMGA 5HAXA 2JJ9A 2SPCA 2V7IA 2V7JA 2N2NA 2KZ7B 3RH3A 5LJMA 1HX8A 3O1IA 4P09A 5JH7E 3CX7B 3ZC1A 1BR0A 2XAFB 3AAIA 4UV9B 5C8YE 3NBXX 4MALA 2P9BA 2ZM2A 2L3LA 3GWHA 1Y64B 4PJLA 1KK7A 2N1GA 2LSGA 2DNXA 2NTYA 4ZS3A 2G0UA 3MXZA 4QWNB 2BVMA 5LJNA 4TN7B 3KV5A 2E8IA 4OYKA 1MIYA 1X79A 5TAOA 4CI2B 3ANWB 4C90A 5LHHB 4EYUA 3RYCE 3ETUA 3ZMVB 3ANWA 4O2AE 4QXCB 4AKRB 1UCUA 3EDVA 4AKHA 2A72A 4F6RC 4ZS2A 1IJ5A 4O4IE 2KNDA 1D1AA 4GK5E 3N9QA 3ZYMA 5JRCB 5DJQC 3N5LA 3I1AA 5L3FB 2KWHA 1WRDA 3F2EA 3PTRB 5JDMA 5JRCA 2YU1A 2X68A 4PJJA 4YLHA 5L3BB 5J2TE 3BQLA 4AKLA 1MMDA 4GYSA 4JUYA 4PNIA 2WMNA 3W15B 5JVDE 4OK0A 3K8PC 3O1HA 5LHIB 2ZMAA 1FMWA 3VU7H 2IAKA 3IF8B 4AQFA 2JRKA 2LOPA 3CMLA 2Q9QD 2IC9A 5IYZE 2CLYB 3CX8B 3UUMA 2EHOC 3DTOA 3NZPA 2YU2A 5HXHA 1U5PA 4FI5A 3RYIE 2X9HA 3CPZA 4EB6E 1FIOA 2N9DA 3KDSE 3MKDA 5LBQB 2K9AA 4CQIA 2X67A 4U74A 4E7SA 3ETVA 5L3DB 5HXSA 2K24A 3B57A 5LGUB 3PDYA 2C0SA 2MBGA 3J9X1 3CQGB 3RYFE 1BR4A 1VRBA 2NTXA 5BMVE 5L3CB 3QK6A 2H7VC 1YKEB 2IC6A 3O9XA 3PUQA 4JEHB 2XUEA 3HKEE 4DBRA 2CWYA 2J1DG 3N9MA 3JC6D 3Q5WA 3UT5E 4MLKA 3ZCJA 1QSDA 3F31A 4DVDA 1YKHB 3GN5B 4UVCB 4YHJA 3O1JA 2JMHA 3GN5A 4CXYA 2NWBA 3I9WA 3LG7A 4H63V 5M4YA 3DP7A 5CA1E 1D1BA 2CXDA 4I50E 4L0RA 2D5UA 2X66A 4X1KE 2L9QA 2CMRA 3U78A 2W63A 4IDZA 4HEAA 2LOSA 3N9NA 5CA0E 5HXEA 4Z8XA 1D0XA 3VHLA 4KBMB 4CZZB 3C4XA 4EXTA 1HG2A 3MK7C 5DQWA 4H9OC 1UX4A 4DNDA 3OBVE 3IHRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZCI A;  3ZCJ A; 
#chains in the Genus database with same CATH topology
 4DMW A;  2FJD A;  1J1J A;  2WCA A;  2DLR A;  2LKH A;  2WP9 A;  5FP3 A;  2QA7 A;  3ZN1 B;  4PFP A;  3RRW A;  2MTQ A;  2PG8 A;  5L4H A;  2M6I A;  3ONL C;  3C51 A;  2H89 A;  4UXN B;  4NUU A;  5FYM A;  2MYS A;  2E5V A;  5AQI B;  4A97 A;  4OFZ A;  3EUH A;  4KI0 F;  5JQG E;  3Q9D A;  2KMF A;  1HTJ F;  4WW0 A;  2OLT A;  3PUA A;  4DV3 T;  2KIN B;  2MAW A;  2ACX A;  3I0Q A;  5HCM A;  1E1H B;  1YQ4 A;  2NW8 A;  2W00 A;  1UUS A;  1S35 A;  2M67 A;  2EHO D;  4YTP A;  2CEA A;  4DR7 T;  1HX1 B;  2XAS B;  2I0M A;  4HKA A;  3ZC0 A;  3AVS A;  3JAF A;  4O4H E;  3QNU A;  5HWX A;  3LJC A;  4XBF B;  3VKG A;  5JDG A;  4LFA T;  2UXB T;  5L2L A;  3P4Q A;  4WYV A;  2FJB A;  2UXD T;  2GK9 A;  2FJA A;  2H7O A;  4PW8 A;  2Q9Q B;  2WQY A;  2Q9Q A;  4E7Z A;  2KXP B;  5AQU B;  2WZH A;  1HF8 A;  5EK3 A;  4QH4 A;  4YT0 A;  1SUM B;  3O4X E;  2WSS V;  2V8S V;  3L3P A;  5HEH A;  4ZEY A;  2PJQ A;  2WY2 A;  5LP6 E;  2Y6X A;  2CM0 A;  4OYJ A;  4KP3 C;  1WLX A;  1ZKE A;  3NRX A;  3I9Y A;  3HKD E;  3KVB A;  4HTE A;  4H9R C;  5JDQ A;  3GA8 A;  2CWO A;  3I0O A;  5HEG A;  4TWH A;  4I43 B;  1KNR A;  2QGS A;  2Y8D A;  5C3J A;  3N2G E;  4IST A;  3MA9 A;  4LF7 T;  4QKN A;  3ZPO A;  2WS3 A;  5LGT B;  2ZLY A;  4PK4 A;  2J62 A;  4ZZC A;  3E0Z A;  4HFV A;  2VKD A;  2VKO A;  2W2U A;  3EI0 A;  4H9N C;  2HH7 A;  2CBI A;  1HG5 A;  4PK5 A;  1G8X A;  2C5K T;  5AQQ B;  1QUU A;  3KFW X;  5LG4 A;  5KDM C;  5BR8 T;  3ZJ2 A;  4YSX A;  5LBM A;  3CWZ B;  2V26 A;  3OYX A;  5H6R B;  3OYZ A;  4QXB B;  4AKI A;  4IDO A;  3UUL A;  2VAS A;  3AB3 B;  4CN4 A;  4DV0 T;  4PJM A;  5HXR A;  2X9Y A;  2H88 A;  3X1D A;  1QLB A;  2YK0 A;  5AQF B;  3SRZ A;  1T7S A;  1CUN A;  4X1Y E;  1S94 A;  4P0A A;  4EIW A;  5FY0 A;  3MZK B;  4Q25 A;  4IE0 A;  4UEM A;  4ZI2 D;  4IDQ A;  5CGM A;  4U7Y A;  2WMO A;  2VK9 A;  4IGU A;  3AVR A;  3OJA A;  1LVF A;  4HFI A;  1T98 A;  2W66 A;  2XQ5 A;  4DR5 T;  4I55 E;  2ZM8 A;  2HPL A;  4UVA B;  3EAB A;  2SPC A;  2V7J A;  3TLU A;  1BR0 A;  2XSA A;  2YDR A;  3AAI A;  4UV9 B;  3NBX X;  3AEF A;  5CFB A;  1HNZ T;  3UQ4 A;  1E2A A;  2NTY A;  4JI6 T;  4QWN B;  3MXZ A;  1UUR A;  2BVM A;  1MIY A;  1X79 A;  2XY8 B;  5LHH B;  4HFH A;  3RYC E;  4QXC B;  5AQO B;  1IJ5 A;  4O4I E;  3ZYM A;  3PUZ F;  2HN1 A;  1WRD A;  4YLH A;  2HN2 A;  3BQL A;  2XQA A;  2WMN A;  4AIS A;  4OK0 A;  1Y01 A;  2IAK A;  3IF8 B;  2LOP A;  2Q9Q D;  2IC9 A;  3CX8 B;  3DTO A;  2YU2 A;  1U5P A;  4WZX A;  3UU5 A;  3MKD A;  5FKY A;  4I0U A;  5LGU B;  1W9R A;  3J9X 1;  3CQG B;  3RYF E;  5BMV E;  3UQ7 A;  1N34 T;  3JC6 D;  3Q5W A;  2WWV A;  2IIU A;  1YKH B;  4UVC B;  4YHJ A;  3G06 A;  3O1J A;  2A9U A;  4EED A;  4DR3 T;  2NWB A;  3LG7 A;  1D1B A;  4X1K E;  1E7P A;  2L9Q A;  4CZZ B;  3T1H T;  4JV5 T;  3MK7 C;  5DQW A;  2WDQ A;  4LFB T;  3OBV E;  3AED A;  2ODV A;  5FXZ A;  2K48 A;  2J4G A;  4AQF C;  3A8Y C;  3PUV F;  3QB5 K;  1OWA A;  2WU5 A;  2YDQ A;  4TWF A;  3PUX F;  2A2F X;  3TLT A;  2LKG A;  2W61 A;  2UXC T;  5HWY A;  3ZJ1 A;  5JDL A;  3VRA A;  3TLW A;  2R6G F;  5AQT B;  5AQG B;  1XMQ T;  3AAA B;  1V9D A;  3ONX A;  3LK4 2;  3NVO A;  2NOX A;  2W62 A;  2PFV A;  4YTM A;  3ZN0 B;  4PAG A;  5EK2 A;  2XHE B;  3GMI A;  3KV4 A;  2V1D B;  2YIN A;  3PJA J;  4DV6 T;  5L3E B;  3WI3 A;  4HWI B;  4ILU A;  3KBT A;  2D0T A;  4U2Y A;  3ZYL A;  4TX5 A;  2VL0 A;  5LA6 E;  2X9X A;  3ZLI A;  2I59 A;  3UU6 A;  4WBO A;  5LGN B;  1UX5 A;  4IE7 A;  3RC3 A;  1W09 A;  2RPA A;  5KXJ A;  4O8S A;  4KX6 A;  4I4T E;  3C4W A;  1SHZ C;  4X5T A;  4TUY E;  3LBX B;  3RC8 A;  2YDS A;  1KNZ A;  3LBX A;  3PU8 A;  3JAD A;  3UU8 A;  3AE3 A;  2ES0 A;  2V7L A;  4IE5 A;  3R84 B;  2DI4 A;  3AEG A;  4DV7 T;  3NZQ A;  3CX6 B;  2QVA A;  2Y48 B;  4JI8 T;  1VCS A;  4C91 A;  1H7C A;  3AAE B;  1UK5 A;  3ONJ A;  1YW0 A;  4M1P A;  2CBJ A;  3LFM A;  3KIN B;  2K3W A;  4X20 E;  4TNW A;  4H9P C;  3IBP A;  4IHJ E;  4TV9 E;  4KHP T;  5ABG A;  5JR9 C;  2VVN A;  3AA1 B;  2LM2 A;  4ANJ A;  5ETW A;  1D0Z A;  2F4V T;  3E08 A;  2ZM6 T;  2ODU A;  4JBW F;  4MBQ A;  3SS1 A;  2XQY A;  2VKH A;  2UXX B;  2B76 A;  4DID B;  5AQH B;  1LVK A;  4JI4 T;  2VL8 A;  4U7I A;  5DAB A;  4EOZ B;  3VKH A;  1ZV4 X;  2VUR A;  4DR2 T;  2LSJ A;  3ABV A;  2UUB T;  4L5G A;  1XWM A;  3KBU A;  2XQ4 A;  2IML A;  4NXM T;  4HFE A;  4EZH A;  3M65 A;  4OHF A;  3EDU A;  5FY7 A;  3MJX A;  5CJ5 A;  4UVB B;  2JQH A;  2JIW A;  3NRY A;  3PUG A;  4ISS A;  1YD8 G;  3KV9 A;  2KT9 A;  3SWH A;  2XSB A;  3FZH B;  3PUS A;  5LXT E;  4EYY R;  3A5X A;  4AQG A;  3CQC B;  2LEH A;  3P50 A;  1NEK A;  3AE2 A;  4IE6 A;  2KLQ A;  5JDH A;  2CE7 A;  3CVR A;  4JI5 T;  3ZYK A;  4L9I A;  2VB6 A;  5LNK A;  1HS7 A;  5J2U E;  5AQP B;  2UUC T;  4DR4 T;  2E5L T;  4TNV A;  3SOL A;  2LSK A;  4YJ2 E;  5FL1 A;  4QXH B;  3HI2 A;  3HKB E;  2LM9 A;  4TV8 E;  2XAQ B;  3H3M A;  3PU3 A;  2XQ6 A;  3AA6 B;  3P4S A;  2DHR A;  4ZHQ E;  5IWA T;  1M62 A;  4PK6 A;  1U4Q A;  4UF0 B;  5J0Z A;  4A56 A;  2D0U A;  4UF0 A;  4EAH A;  4HE8 A;  4J2C A;  4UR9 A;  2KSR A;  3K3Q C;  3V5U A;  2L8K A;  4LF4 T;  3ZT5 A;  2LSI A;  4DR6 T;  3EVY A;  1MMG A;  2V7I A;  2N2N A;  3RH3 A;  5LJM A;  3O1I A;  4P09 A;  5FL0 A;  3CX7 B;  5C8Y E;  1CHU A;  3GWH A;  1Y64 B;  2N1G A;  4ZS3 A;  5AQK B;  5LJN A;  1YXR A;  5TAO A;  3ANW B;  4U3C A;  4EYU A;  3ETU A;  3ANW A;  1JNZ A;  1UCU A;  4F6R C;  2WB5 A;  4DV2 T;  3UFG A;  1ZP0 A;  2BG9 E;  3LDQ B;  2KND A;  4GK5 E;  1KEY A;  5JRC B;  3I1A A;  5L3F B;  2MPK A;  3RLF F;  5JRC A;  4PJJ A;  3UUB A;  5J2T E;  4AKL A;  4IDN A;  4GYS A;  4F8H A;  5LHI B;  4AQF A;  2JRK A;  2VVS A;  1N33 T;  5IYZ E;  3NZP A;  2V6X A;  3AE8 A;  3CIR A;  4ILA A;  4FI5 A;  1FIO A;  2K9A A;  4U74 A;  1M7K A;  4E7S A;  4HWF A;  5L3D B;  3PDY A;  1N32 T;  4ZZB A;  3QK6 A;  2H7V C;  4JEH B;  2XUE A;  4HFB A;  4MLK A;  1QSD A;  3AEE A;  5F5W A;  2JMH A;  3PUY F;  1HNW T;  4H63 V;  5M4Y A;  3DP7 A;  4HFD A;  4L0R A;  3RIF A;  2X66 A;  5AQR B;  2CMR A;  2WDV A;  3RQU A;  5CA0 E;  3ZT6 A;  1W0B A;  3VHL A;  3C4X A;  4DND A;  2CXL A;  5HXC A;  3N2K E;  4LMJ A;  2BG9 C;  4JLE A;  3BQK A;  2AXD S;  2IW5 B;  2X0L B;  4ZXL A;  3L09 A;  3V5S A;  2J47 A;  3K1S A;  4AIU A;  3P7I A;  1KF6 A;  3AE7 A;  4GK0 E;  3QUJ A;  3AE9 A;  3FXD B;  3Q5X A;  1EZ3 A;  2XQ7 A;  5HYA A;  2JQQ A;  2JQK A;  4QH1 A;  3QC9 A;  3FBZ A;  4EGW A;  4H9S E;  3CQX C;  1MIV A;  2FBW A;  4ASK A;  1IZN B;  3KVA A;  3H3A A;  1FMV A;  4NPP A;  1KFY A;  2VWA A;  3ZST A;  2LSY A;  4N78 D;  2CHO A;  4ILB A;  5LCY A;  5JR9 B;  1D1C A;  3RX6 A;  3RF1 A;  3J7Y q;  4MHC A;  5JR9 A;  5AFU L;  2C5J A;  3ZKR A;  2DWK A;  2XAG B;  3PUW F;  1ZHC A;  1VOM A;  3BQI A;  1BR2 A;  3ZEF B;  3HA4 A;  4YY3 T;  5HEJ A;  3T8O A;  4BJM A;  5ABH A;  4CI3 B;  5KX5 E;  3EHZ A;  2YN6 A;  2M6B A;  1D0Y A;  4ILC A;  1ZOY A;  4LF9 T;  1B7T A;  2Z6E A;  5JDF A;  3P4P A;  5E0O A;  5FXV A;  5ABF B;  3ZMZ B;  5FMN A;  5ABF A;  2YEV C;  2OA5 A;  3PE0 A;  1IAP A;  1XNR T;  2IDO B;  1LRZ A;  3E22 E;  4PFO A;  4JI2 T;  5JRE A;  2X0Y A;  2UU9 T;  4ZOL E;  4IDP A;  2XPK A;  5AQJ B;  4U72 A;  2WAU A;  2UUA T;  5LMN T;  3U3I A;  2JMK A;  4UIG A;  1WYC A;  2CXF A;  4BAY B;  4PJN A;  4GKK T;  5AQL B;  3RKG A;  3HL6 A;  3BK9 A;  2W67 A;  5ADX L;  1J5W A;  1HFA A;  5L47 A;  3FB2 A;  3UTK A;  2WM9 A;  3D0T A;  1LKX A;  3RPU A;  2XZE A;  3FBL A;  4DR1 T;  5GON E;  1IBK T;  4ZI3 C;  1IJ6 A;  3N9P A;  2V7K A;  3NWI A;  1T8B A;  4HN9 A;  1I6Z A;  2DCF A;  2BVL A;  3UFE A;  5LG3 A;  4B3S T;  3LK3 B;  1O3X A;  2X0H A;  1MMA A;  3HKC E;  4V1A v;  5LHG B;  4ZI3 D;  5FVK A;  4O4L E;  4IL9 A;  4GIW A;  1AJ3 A;  4UEL A;  4XZC A;  2YOE A;  4AXP A;  3AE6 A;  4B3T T;  3H37 A;  3N2O A;  4YJ3 E;  3MAC A;  3AA0 B;  4EZ4 A;  3AE1 A;  4TZ4 C;  5FY1 A;  1J5E T;  5AQN B;  2HPJ A;  5J1G A;  4BA9 A;  4IE4 A;  2RP4 A;  1OXZ A;  4UV8 B;  2LE8 A;  3B13 A;  4AI6 A;  1IBL T;  5HCJ A;  5F3J A;  3OKQ A;  4GKJ T;  2E9X C;  5L3G B;  3K3N A;  5LOV E;  4B6X A;  5AQV B;  3N9O A;  2E9X D;  4QX8 B;  4CXW A;  3R6N A;  4X64 T;  5JDN A;  4ZI7 E;  3ESL A;  4NIQ A;  2LT3 A;  5FNV E;  3CKD A;  3FZL B;  5L4E A;  2LHN A;  4P0B A;  4O4J E;  1Z8U A;  5HAX A;  3PV0 F;  1KNP A;  4B3M T;  4MAL A;  2ZM2 A;  1KK7 A;  2LSG A;  2I6H A;  4TN7 B;  2E8I A;  4C90 A;  1OED E;  3ZMV B;  2E2A A;  4AKH A;  2A72 A;  4DUY T;  3N9Q A;  2V5D A;  3PTR B;  5JDM A;  1IBM T;  5L3B B;  1MMD A;  4PNI A;  2BG9 B;  3W15 B;  5JVD E;  3K8P C;  1FMW A;  2BG9 A;  3CML A;  4HWC A;  2EHO C;  5HXH A;  2VQE T;  2LRL A;  2X9H A;  3CPZ A;  4EB6 E;  4DUZ T;  3KDS E;  2WU2 A;  3IA3 A;  2X67 A;  1XMO T;  1SE7 A;  5ABE A;  3AEC A;  2V6Y B;  1VRB A;  5L3C B;  2V6Y A;  1YKE B;  4Z90 A;  3PUQ A;  3HKE E;  4DBR A;  2J1D G;  3N9M A;  3ZCJ A;  2XM2 A;  3F31 A;  4DVD A;  3EAM A;  3TLV A;  2ACZ A;  3I9W A;  4JYA T;  2CXD A;  4HFC A;  2D5U A;  3AXJ B;  1HR0 T;  5AQM B;  5JTG A;  1W0A A;  3AXJ A;  2LOS A;  1R8I A;  1D0X A;  2BS3 A;  3VR8 A;  1HG2 A;  3AEA A;  1UX4 A;  1OED C;  4COF A;  1X9B A;  4X1I E;  3IHR A;  5AQS B;  4JI3 T;  2V5C A;  2XQ3 A;  3CK6 A;  5HEO A;  1ZEE A;  2CLY C;  4HWH A;  3AE5 A;  2YKS A;  4O2B E;  2MOZ A;  5FXX A;  1WYB A;  5IHY A;  3A7M A;  5H6Q B;  4AQY T;  3RIU C;  1XDP A;  2JPF A;  3FZF B;  2H3R A;  3RYH E;  4YXD A;  1DU2 A;  2WWU A;  1NEN A;  3TLS A;  3K3O A;  4QX7 B;  3Q2M A;  2XAH B;  1FEW A;  2QRX A;  3QB5 A;  3PUR A;  3UUN A;  5LYJ E;  2KWI B;  2NW7 A;  2V7M A;  1SA0 E;  4AKG A;  4WNK A;  3M3Z B;  2JQ9 A;  3RKO A;  2W0G A;  4K0U A;  4U2Z A;  1MND A;  3FXE B;  5FXW A;  2HHH T;  4CI1 B;  4X65 T;  4K0K T;  3P8C D;  3UUX B;  5C2T A;  2BS2 A;  2XJ7 A;  4CXX A;  1XZY A;  4YFS A;  5LMU T;  4LF5 T;  1Z0P A;  5EZY E;  1XDO A;  2CCQ A;  4G2A A;  4U33 A;  2XQ9 A;  3B5M A;  3C50 A;  2BS4 A;  3RI5 A;  4DV4 T;  3RRC A;  3AA7 B;  3ZMS B;  3OPC A;  3SFE A;  1GQE A;  3F57 A;  2NW9 A;  5F8P A;  3SFD A;  4BJN A;  3ZMT B;  5A1L A;  3HR0 A;  4G63 A;  2LHR A;  4JI7 T;  3C4Z A;  3FHN A;  4QHO A;  4ZI2 C;  2BKP A;  1T72 A;  4KUM B;  2B1E A;  5KMG P;  3RHW A;  5CB4 E;  4WBN E;  4JI1 T;  1BR1 A;  3T1Y T;  2LJL A;  4DBQ A;  1FJG T;  4DO0 A;  4GOU A;  4X62 T;  5DQV A;  2BKO A;  2K5B B;  4EEB A;  3JAE A;  1HCI A;  4ADZ A;  4GYR A;  4TWD A;  2BKN A;  3S4U A;  4A98 A;  2PBI A;  1L0V A;  2BZB A;  2XAJ B;  3WAK A;  1NWM X;  2E9X B;  4IL4 A;  5EK4 A;  4KMC A;  2VKJ A;  4JEU B;  3LSV A;  3Q5D A;  2E9X A;  1MIW A;  3RGL A;  3ZSS A;  3FZM B;  3L39 A;  4FJO A;  4EV6 A;  2CA5 A;  2FUP A;  3C64 A;  3RQW A;  3Q5E A;  1XNQ T;  2X51 A;  1G73 A;  2CHN A;  4YHH T;  4H9Q C;  3RIA A;  3TKL B;  2BDE A;  2IHR 1;  1I94 T;  1VCT A;  4U31 A;  4H63 H;  1WR6 A;  3ZCI A;  3WAJ A;  2Q9Q C;  4LMK A;  4A5X A;  1UGO A;  3C98 B;  2A3D A;  3P4W A;  2D2S A;  2X9W A;  2RA1 A;  1MNE A;  5IUX A;  4CN1 A;  2WDR A;  4NUV A;  2WBL A;  1YQ3 A;  3ZMU B;  2DWG A;  1US7 B;  2WZI A;  4HGA A;  3IEE A;  3OTO T;  3JC6 C;  4IIJ E;  1NAF A;  5LB7 B;  4YSZ A;  4ERR A;  2C5I T;  4DMV A;  4XAX B;  3UU3 A;  2PTF A;  3N9L A;  2XTL A;  1N36 T;  4MFR A;  3VRB A;  3LK2 B;  2EHO B;  3PJA A;  4LF6 T;  2ZM0 A;  3KV6 A;  2EHO A;  4JI0 T;  4QH5 A;  3AEB A;  1JNR A;  3VR9 A;  1WCR A;  3DJB A;  5FVL A;  2BBH A;  2NP9 A;  4X66 T;  2UXN B;  1MMN A;  2AE9 A;  2JJ9 A;  4IRE A;  2KZ7 B;  1HX8 A;  5JH7 E;  3ZC1 A;  2XAF B;  3OVU A;  2P9B A;  2CPT A;  2QYW A;  2L3L A;  4PJL A;  4DV5 T;  2DNX A;  2G0U A;  2LLY A;  2XQ8 A;  3KV5 A;  4OYK A;  4HWD A;  2VQF T;  2XM1 A;  4CI2 B;  4O2A E;  4AKR B;  3EDV A;  4IT4 A;  4ZS2 A;  1D1A A;  1OED B;  5DJQ C;  4B3R T;  4LF8 T;  4OX9 T;  3N5L A;  2KWH A;  3F2E A;  1OED A;  2YU1 A;  2X68 A;  4YTN A;  4JUY A;  2IUB A;  3O1H A;  2ZMA A;  3VU7 H;  2BBJ A;  1HNX T;  1WR0 A;  2CLY B;  3UUM A;  4LFC T;  3RYI E;  2N9D A;  5HEU A;  4CN6 A;  5LBQ B;  4CQI A;  2CRB A;  1WFD A;  3ETV A;  3RIU A;  5HXS A;  2K24 A;  3B57 A;  4P1N A;  2NR4 A;  2C0S A;  2MBG A;  1BR4 A;  2NTX A;  2W4X A;  2OV9 A;  2IC6 A;  3O9X A;  4KHZ F;  2CWY A;  4YSY A;  3UT5 E;  3UU4 A;  3GN5 B;  3FZK B;  4Z91 A;  3GN5 A;  3QOF A;  4CXY A;  2D9D A;  3P4R A;  5CA1 E;  3L8R A;  3AE4 A;  4I50 E;  2LRK A;  4DV1 T;  3U78 A;  2W63 A;  4IDZ A;  4LML A;  4HEA A;  3N9N A;  5HXE A;  4Z8X A;  3JCF A;  4KBM B;  4EXT A;  4NXN T;  3ZT7 A;  2FJE A;  4H9O C;  3NKZ A;  2DL1 A; 
#chains in the Genus database with same CATH homology
 4DMW A;  2CXL A;  5HXC A;  3N2K E;  2ODV A;  5FXZ A;  2K48 A;  2DLR A;  4JLE A;  3BQK A;  2IW5 B;  2X0L B;  4AQF C;  3L09 A;  5FP3 A;  3V5S A;  2QA7 A;  3P7I A;  3ZN1 B;  4PFP A;  1ZEE A;  2CLY C;  3RRW A;  4GK0 E;  1OWA A;  2MTQ A;  3QUJ A;  3FXD B;  2PG8 A;  3Q5X A;  4O2B E;  1EZ3 A;  2MOZ A;  5FXX A;  1WYB A;  2A2F X;  5HYA A;  5IHY A;  2JQQ A;  2W61 A;  5H6Q B;  3QC9 A;  3C51 A;  5HWY A;  3ZJ1 A;  3FBZ A;  5JDL A;  4UXN B;  4H9S E;  4NUU A;  2JPF A;  2MYS A;  3CQX C;  3AAA B;  5FYM A;  1V9D A;  1MIV A;  3ONX A;  3LK4 2;  4OFZ A;  4ASK A;  2NOX A;  3EUH A;  1IZN B;  2H3R A;  3KVA A;  2W62 A;  3RYH E;  2WWU A;  3H3A A;  5JQG E;  1FMV A;  2PFV A;  3Q9D A;  3ZN0 B;  3K3O A;  4PAG A;  4QX7 B;  3Q2M A;  2XAH B;  2KMF A;  5EK2 A;  1FEW A;  2XHE B;  3GMI A;  1HTJ F;  3KV4 A;  2VWA A;  4WW0 A;  3PUA A;  2V1D B;  2YIN A;  3PUR A;  2LSY A;  3UUN A;  4N78 D;  5LYJ E;  2KWI B;  5LCY A;  2NW7 A;  5L3E B;  2V7M A;  5JR9 B;  1D1C A;  3WI3 A;  1SA0 E;  3RX6 A;  4ILU A;  3J7Y q;  4AKG A;  4WNK A;  4MHC A;  5JR9 A;  3KBT A;  5AFU L;  2C5J A;  2D0T A;  2KIN B;  2DWK A;  2XAG B;  3RKO A;  2ACX A;  3I0Q A;  1ZHC A;  1VOM A;  3BQI A;  1E1H B;  1BR2 A;  3ZEF B;  3ZYL A;  3HA4 A;  2W0G A;  4K0U A;  4TX5 A;  3T8O A;  1MND A;  3FXE B;  5FXW A;  4BJM A;  4CI3 B;  5KX5 E;  4CI1 B;  2NW8 A;  5LA6 E;  2W00 A;  2X9X A;  3ZLI A;  2I59 A;  4WBO A;  3P8C D;  3UUX B;  1D0Y A;  1S35 A;  2EHO D;  2M67 A;  1UX5 A;  5LGN B;  1B7T A;  2CEA A;  4IE7 A;  2Z6E A;  3RC3 A;  2XAS B;  5JDF A;  5E0O A;  5FXV A;  4CXX A;  3ZMZ B;  4O8S A;  4HKA A;  5FMN A;  4YFS A;  4I4T E;  2YEV C;  3C4W A;  3ZC0 A;  2OA5 A;  3PE0 A;  1Z0P A;  3AVS A;  5EZY E;  4O4H E;  2CCQ A;  1IAP A;  1SHZ C;  4G2A A;  5HWX A;  3LJC A;  4XBF B;  3VKG A;  1LRZ A;  5JDG A;  3C50 A;  5L2L A;  4TUY E;  3LBX B;  3RC8 A;  1KNZ A;  3RRC A;  3AA7 B;  3E22 E;  3LBX A;  3PU8 A;  3ZMS B;  4PFO A;  2GK9 A;  3F57 A;  2H7O A;  4PW8 A;  2ES0 A;  5F8P A;  2NW9 A;  4BJN A;  3ZMT B;  5JRE A;  2Q9Q B;  2V7L A;  4IE5 A;  5A1L A;  2Q9Q A;  4ZOL E;  3R84 B;  2DI4 A;  3HR0 A;  4G63 A;  2LHR A;  4E7Z A;  2KXP B;  3C4Z A;  3NZQ A;  3FHN A;  4QHO A;  4U72 A;  4ZI2 C;  3CX6 B;  2WAU A;  1HF8 A;  2Y48 B;  5EK3 A;  3U3I A;  4C91 A;  2JMK A;  4KUM B;  1H7C A;  2B1E A;  3AAE B;  4UIG A;  1YW0 A;  1WYC A;  2CXF A;  3O4X E;  4M1P A;  5KMG P;  2WSS V;  3WAK A;  3LFM A;  5CB4 E;  4PJN A;  4BAY B;  1BR1 A;  4WBN E;  3L3P A;  2LJL A;  4DBQ A;  4DO0 A;  3KIN B;  4GOU A;  5DQV A;  2K5B B;  2PJQ A;  1HCI A;  4X20 E;  4ADZ A;  5LP6 E;  4GYR A;  2Y6X A;  3HL6 A;  3S4U A;  3BK9 A;  4H9P C;  5ADX L;  2CM0 A;  3IBP A;  4OYJ A;  1HFA A;  2PBI A;  4IHJ E;  4KP3 C;  4TV9 E;  1WLX A;  5JR9 C;  3AA1 B;  3FB2 A;  3UTK A;  2BZB A;  4ANJ A;  1ZKE A;  5ETW A;  2WM9 A;  1D0Z A;  2XAJ B;  3E08 A;  1NWM X;  2E9X B;  2ODU A;  1LKX A;  3D0T A;  4KMC A;  5EK4 A;  2VKJ A;  3RPU A;  4JEU B;  3NRX A;  3FBL A;  2E9X A;  5GON E;  4ZI3 C;  1MIW A;  1IJ6 A;  3N9P A;  2V7K A;  3HKD E;  3I9Y A;  4MBQ A;  3KVB A;  4HTE A;  4HN9 A;  2DCF A;  2BVL A;  2XQY A;  3SS1 A;  3UFE A;  3LK3 B;  1O3X A;  2VKH A;  4H9R C;  5JDQ A;  3GA8 A;  2UXX B;  1MMA A;  2CWO A;  3I0O A;  3HKC E;  4FJO A;  4V1A v;  5LHG B;  4I43 B;  2CA5 A;  4ZI3 D;  1LVK A;  2VL8 A;  2QGS A;  4O4L E;  5DAB A;  2Y8D A;  4EOZ B;  3C64 A;  3VKH A;  2X51 A;  1G73 A;  1ZV4 X;  3N2G E;  4GIW A;  4IST A;  4H9Q C;  3MA9 A;  4QKN A;  3ZPO A;  5LGT B;  1AJ3 A;  4UEL A;  3TKL B;  2LSJ A;  2ZLY A;  4PK4 A;  4XZC A;  2BDE A;  4L5G A;  4AXP A;  3KBU A;  3E0Z A;  4HFV A;  4X1I E;  4H63 H;  2VKD A;  1WR6 A;  2VKO A;  3ZCI A;  4EZH A;  3WAJ A;  3H37 A;  3M65 A;  4OHF A;  2Q9Q C;  3EDU A;  3N2O A;  4H9N C;  4YJ3 E;  5FY7 A;  3MAC A;  3MJX A;  3C98 B;  3AA0 B;  2HH7 A;  2A3D A;  4UVB B;  4EZ4 A;  2D2S A;  2X9W A;  2RA1 A;  1HG5 A;  4PK5 A;  4TZ4 C;  1G8X A;  2C5K T;  5FY1 A;  3NRY A;  1MNE A;  3PUG A;  4ISS A;  1YD8 G;  1QUU A;  3KFW X;  3KV9 A;  5LG4 A;  5KDM C;  2KT9 A;  3SWH A;  3ZJ2 A;  3PUS A;  5LBM A;  5LXT E;  4EYY R;  3A5X A;  2HPJ A;  4AQG A;  4NUV A;  3CQC B;  2LEH A;  2WBL A;  5J1G A;  3CWZ B;  2V26 A;  3ZMU B;  2DWG A;  4BA9 A;  3OYX A;  5H6R B;  4IE4 A;  1US7 B;  3OYZ A;  2RP4 A;  2KLQ A;  4HGA A;  1OXZ A;  4IE6 A;  4QXB B;  2CE7 A;  3IEE A;  5JDH A;  3JC6 C;  4AKI A;  4UV8 B;  4IIJ E;  3CVR A;  2VAS A;  3UUL A;  2LE8 A;  1NAF A;  3AB3 B;  3B13 A;  3ZYK A;  4L9I A;  2VB6 A;  5LNK A;  4ERR A;  4AI6 A;  2C5I T;  1HS7 A;  4PJM A;  5HXR A;  2X9Y A;  4DMV A;  4XAX B;  5J2U E;  5F3J A;  3OKQ A;  2E9X C;  5L3G B;  3N9L A;  3SOL A;  3K3N A;  2LSK A;  2XTL A;  4YJ2 E;  2YK0 A;  5LOV E;  3SRZ A;  4MFR A;  4QXH B;  3HI2 A;  3HKB E;  2LM9 A;  3LK2 B;  4TV8 E;  4B6X A;  3N9O A;  1CUN A;  4X1Y E;  1S94 A;  2EHO B;  4P0A A;  4EIW A;  2E9X D;  2XAQ B;  2ZM0 A;  4QX8 B;  3KV6 A;  2EHO A;  5FY0 A;  4CXW A;  3R6N A;  3MZK B;  3PU3 A;  4IE0 A;  4UEM A;  3AA6 B;  4ZI2 D;  5JDN A;  2DHR A;  4ZHQ E;  4PK6 A;  4ZI7 E;  3ESL A;  1U4Q A;  4UF0 B;  2WMO A;  4A56 A;  2D0U A;  4UF0 A;  4EAH A;  3DJB A;  2LT3 A;  5FNV E;  2VK9 A;  4HE8 A;  2NP9 A;  4IGU A;  4J2C A;  3AVR A;  3CKD A;  3OJA A;  2UXN B;  1LVF A;  1T98 A;  1MMN A;  3K3Q C;  3V5U A;  2LHN A;  2L8K A;  4I55 E;  4P0B A;  2ZM8 A;  4O4J E;  2HPL A;  2LSI A;  3EVY A;  4UVA B;  1MMG A;  5HAX A;  2JJ9 A;  2SPC A;  2V7I A;  2V7J A;  2N2N A;  2KZ7 B;  3RH3 A;  5LJM A;  1HX8 A;  3O1I A;  4P09 A;  5JH7 E;  3CX7 B;  3ZC1 A;  1BR0 A;  2XAF B;  3AAI A;  4UV9 B;  5C8Y E;  3NBX X;  4MAL A;  2P9B A;  2ZM2 A;  2L3L A;  3GWH A;  1Y64 B;  4PJL A;  1KK7 A;  2N1G A;  2LSG A;  2DNX A;  2NTY A;  4ZS3 A;  2G0U A;  3MXZ A;  4QWN B;  2BVM A;  5LJN A;  4TN7 B;  3KV5 A;  2E8I A;  4OYK A;  1MIY A;  1X79 A;  5TAO A;  4CI2 B;  3ANW B;  4C90 A;  5LHH B;  4EYU A;  3RYC E;  3ETU A;  3ZMV B;  3ANW A;  4O2A E;  4QXC B;  4AKR B;  1UCU A;  3EDV A;  4AKH A;  2A72 A;  4F6R C;  4ZS2 A;  1IJ5 A;  4O4I E;  2KND A;  1D1A A;  4GK5 E;  3N9Q A;  3ZYM A;  5JRC B;  5DJQ C;  3N5L A;  3I1A A;  5L3F B;  2KWH A;  1WRD A;  3F2E A;  3PTR B;  5JDM A;  5JRC A;  2YU1 A;  2X68 A;  4PJJ A;  4YLH A;  5L3B B;  5J2T E;  3BQL A;  4AKL A;  1MMD A;  4GYS A;  4JUY A;  4PNI A;  2WMN A;  3W15 B;  5JVD E;  4OK0 A;  3K8P C;  3O1H A;  5LHI B;  2ZMA A;  1FMW A;  3VU7 H;  2IAK A;  3IF8 B;  4AQF A;  2JRK A;  2LOP A;  3CML A;  2Q9Q D;  2IC9 A;  5IYZ E;  2CLY B;  3CX8 B;  3UUM A;  2EHO C;  3DTO A;  3NZP A;  2YU2 A;  5HXH A;  1U5P A;  4FI5 A;  3RYI E;  2X9H A;  3CPZ A;  4EB6 E;  1FIO A;  2N9D A;  3KDS E;  3MKD A;  5LBQ B;  2K9A A;  4CQI A;  2X67 A;  4U74 A;  4E7S A;  3ETV A;  5L3D B;  5HXS A;  2K24 A;  3B57 A;  5LGU B;  3PDY A;  2C0S A;  2MBG A;  3J9X 1;  3CQG B;  3RYF E;  1BR4 A;  1VRB A;  2NTX A;  5BMV E;  5L3C B;  3QK6 A;  2H7V C;  1YKE B;  2IC6 A;  3O9X A;  3PUQ A;  4JEH B;  2XUE A;  3HKE E;  4DBR A;  2CWY A;  2J1D G;  3N9M A;  3JC6 D;  3Q5W A;  3UT5 E;  4MLK A;  3ZCJ A;  1QSD A;  3F31 A;  4DVD A;  1YKH B;  3GN5 B;  4UVC B;  4YHJ A;  3O1J A;  2JMH A;  3GN5 A;  4CXY A;  2NWB A;  3I9W A;  3LG7 A;  4H63 V;  5M4Y A;  3DP7 A;  5CA1 E;  1D1B A;  2CXD A;  4I50 E;  4L0R A;  2D5U A;  2X66 A;  4X1K E;  2L9Q A;  2CMR A;  3U78 A;  2W63 A;  4IDZ A;  4HEA A;  2LOS A;  3N9N A;  5CA0 E;  5HXE A;  4Z8X A;  1D0X A;  3VHL A;  4KBM B;  4CZZ B;  3C4X A;  4EXT A;  1HG2 A;  3MK7 C;  5DQW A;  4H9O C;  1UX4 A;  4DND A;  3OBV E;  3IHR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...