3ZCIA

Crystal structure of helicobacter pylori t4ss protein cagl in a cubic crystal form with a distorted helical conformation of the rgd-motif
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
212
structure length
191
Chain Sequence
GAMEDITSGLKQLDSTYQETNQQVLKNLDEIFSEMGEEDALNIATAAIALRGDLALLKANFEANELFFISEDVIFKTYMSSPELLLTYMKINSDKVLVLYCEGKLKIEATAQNIRERLETSLKAYQSNIGGTASLITASQTLVESLKNKNFIKGIRKLMLAHNKVFLNYLEELDALERSLEQSKRQYLQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords CAG PATHOGENICITY ISLAND PROTEIN (CAG18)
publication title A Helical Rgd Motif Promoting Cell Adhesion: Crystal Structures of the Helicobacter Pylori Type Iv Secretion System Pilus Protein Cagl
pubmed doi rcsb
source organism Helicobacter pylori
total genus 90
structure length 191
sequence length 212
ec nomenclature
pdb deposition date 2012-11-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1660 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3zciA00
3ZCJA 3ZCIA
chains in the Genus database with same CATH superfamily
3RRWA 3PURA 5JDNA 5LJMA 2L3LA 3CX8B 4A5XA 3UUNA 4NPPA 3IHRA 4GK0E 3J7Yq 2BS2A 1SHZC 3PUYF 4DV2T 3RH3A 3EI0A 4ZZCA 1J1JA 1T72A 5FXVA 4TUYE 3M65A 3RIUA 1HF8A 2LSJA 1WYBA 2C5IT 3Q5DA 2PFVA 2IMLA 3LG7A 4YTPA 1WCRA 4DV5T 5LGNB 4U33A 5DQVA 5CFBA 3UUMA 3EUHA 2WMOA 3ZYLA 4CXXA 1YD8G 2PBIA 1HNZT 4P0BA 4DVDA 4ZS3A 3OYXA 4KHZF 4CI3B 1HNXT 4YLHA 3AA6B 2BDEA 3H3MA 2CHOA 5KXJA 3AEEA 4F6RC 4PK4A 5JDGA 2XZEA 4J2CA 1YXRA 5DABA 3T8OA 1BR0A 4HTEA 3NKZA 1HNWT 4MFRA 3PUAA 2YU2A 3AA1B 4DV6T 2JQHA 3CIRA 4JI8T 3ZSSA 2RP4A 4I50E 3KBTA 2BBHA 2X0YA 1R8IA 4CI1B 1D0ZA 4GKJT 2EHOB 2YOEA 2ZM0A 4PNIA 2MYSA 5FVKA 4EEDA 3CKDA 4O2BE 3AAAB 2CXDA 1O3XA 2CHNA 2DCFA 2MPKA 2W63A 5L3BB 4ZEYA 3HKDE 4HFIA 3GN5A 1Y64B 4ISTA 2WWUA 1W09A 2DLRA 4IDPA 4DV0T 3FZKB 3O1IA 3VKGA 3RYFE 4UIGA 3SWHA 1MMAA 5LG4A 2WAUA 3QK6A 1AJ3A 3ONXA 4HN9A 1N36T 1MMNA 4NIQA 3LDQB 3R6NA 4OK0A 3PJAA 2BKNA 4YJ2E 4IE5A 4LFAT 2KT9A 3RYCE 5AQLB 3AE1A 3P50A 4X62T 4NUVA 3KDSE 2W4XA 2IAKA 4A56A 5LB7B 2QYWA 4CXYA 4QX7B 2H89A 1XNRT 1D1BA 5ETWA 4LFBT 5LMNT 2UXBT 2XAQB 3HKCE 4AQYT 5JQGE 2BZBA 3P8CD 3PUQA 3OPCA 3KVAA 4QKNA 4B6XA 5ABFB 4HGAA 4DR7T 5KDMC 2K24A 3LSVA 4EZ4A 5FP3A 4ERRA 3SOLA 4AQGA 4EB6E 5KX5E 2Q9QC 2KMFA 3AE2A 3H37A 1VOMA 4CI2B 2ES0A 3ANWB 3WAKA 2VVSA 1KFYA 4HFVA 4JI1T 4JI6T 4ILCA 1WRDA 2Z6EA 2JJ9A 1UK5A 3C4ZA 2M6IA 2WDRA 4H63V 5IUXA 2MBGA 3AVSA 3UFGA 3BQKA 3PV0F 2VVNA 3FB2A 2J4GA 3N9LA 2CE7A 2V5CA 5JH7E 1LRZA 1HR0T 2XASB 4PJJA 4HWFA 2WMNA 1IAPA 2X9XA 2MOZA 4NUUA 4JI3T 2YDRA 2V7MA 3CMLA 5HXHA 2CWOA 3UU6A 4TWFA 4ILUA 1XZYA 5HEUA 2L9QA 2MAWA 2NW8A 2C0SA 4JI5T 2E9XB 5LA6E 3CQXC 4IE6A 1OEDE 3JC6C 1M7KA 4AQFC 4HWIB 2JRKA 4PK5A 3AAEB 2DNXA 3L39A 1E1HB 3LBXA 2YDQA 2H7VC 3I0OA 1CHUA 4OFZA 2CBJA 3ZJ1A 3A7MA 1FMVA 4YXDA 3PUSA 1UURA 4U7YA 4IL9A 5H6RB 5L2LA 3RIFA 4CN1A 2BVMA 3N9OA 1Z8UA 1IJ6A 2WS3A 1HCIA 2WU2A 3FZMB 3ZMSB 5JDLA 3RF1A 2WDQA 5J0ZA 2SPCA 4TNVA 2LM9A 2KLQA 2V7KA 4H9OC 1KNZA 1QSDA 3AE8A 5ABEA 3P7IA 3M3ZB 5AQNB 5H6QB 3FZHB 4DBRA 2A72A 3UUBA 4DV4T 3D0TA 2V6YB 2BG9B 5IWAT 4DR2T 2UU9T 2LOSA 4G2AA 2XM2A 2H7OA 2CXLA 2K3WA 2KWHA 3SFDA 2X67A 4YSYA 3J9X1 5C8YE 2XQYA 4PJMA 4DUZT 2VWAA 4PW8A 3RC3A 4JI2T 5FY7A 2QRXA 3RIAA 4O4LE 4PAGA 2BVLA 4IE0A 2D0TA 1OEDC 1LVKA 4HFHA 2CEAA 3QB5A 3I1AA 4TN7B 5BMVE 3HA4A 3KV4A 5JR9C 5LBMA 2NOXA 2Q9QA 4AXPA 2JMKA 2WQYA 2JIWA 3JAFA 3UULA 3RKOA 5L3CB 5LHIB 3PDYA 3AEAA 4YFSA 2Y6XA 4CXWA 2WZHA 2WB5A 4ILAA 3AE9A 3TLTA 3IEEA 2W00A 1MIVA 4HWDA 1FJGT 3JC6D 4QHOA 4LF9T 5HEHA 4TWHA 2BKOA 4U74A 2NW7A 3ETVA 5AQVB 2NP9A 2NTXA 3B57A 2CA5A 3HR0A 2NWBA 1UX4A 2X0LB 1FEWA 1NAFA 2C5KT 4HEAA 4ILBA 3UQ7A 1X79A 2FUPA 3AE5A 4JEUB 3CPZA 2MTQA 3K3QC 5FKYA 4DR6T 4DR1T 3IF8B 2W0GA 2YKSA 4DMVA 3TLWA 3LJCA 4U2ZA 5AQOB 1HS7A 3C4WA 2PTFA 2CLYB 2V1DB 4AQFA 3AECA 4AISA 2ACZA 2CM0A 3MJXA 1KK7A 3AE4A 3ZSTA 2FJDA 5ADXL 3AXJA 4NXNT 2QA7A 4LMKA 1IBKT 2X9WA 3RRCA 3GN5B 4KHPT 3E08A 2LHNA 1G8XA 4O4HE 3PUXF 3ZMVB 4OYKA 4X64T 4KX6A 2OLTA 1IZNB 4KP3C 5FXXA 2FJEA 2BBJA 3O4XE 1BR1A 4MBQA 3O9XA 3E0ZA 5CB4E 4BJMA 2I59A 4HFBA 5L3DB 4LMJA 2YEVC 3EDVA 5FY1A 2K48A 2XUEA 3OBVE 2YU1A 3JADA 4ZI3C 3IA3A 2UXCT 3W15B 2X51A 2XQ6A 1W9RA 1OWAA 3ZPOA 5LG3A 2A2FX 2M67A 2ZM6T 4YHJA 3N9PA 4YJ3E 4GYRA 3ZYMA 4I55E 3RKGA 1OEDA 4UVCB 4L0RA 5AQTB 3TLVA 5J1GA 1YW0A 1QLBA 4DR3T 4DIDB 4M1PA 3C51A 4UVBB 2E5VA 1ZP0A 1BR4A 3KINB 3P4WA 5TAOA 3SRZA 1HX1B 4WYVA 3PJAJ 4AIUA 5JDFA 5HAXA 4DUYT 2XAJB 4E7SA 1N33T 3ONJA 3K8PC 2HH7A 2WP9A 3RPUA 3KV5A 1X9BA 2UXXB 5DQWA 5L4EA 2UXDT 2C5JA 1EZ3A 4X1YE 3FHNA 4PK6A 4EGWA 5L47A 2LSIA 2LSGA 2V5DA 4JEHB 3K1SA 3A5XA 2D5UA 3RLFF 1W0AA 2JQKA 3MACA 5EK3A 3PUWF 4MLKA 2EHOD 2XHEB 1UGOA 4X5TA 2JQQA 2ZMAA 2CRBA 3LBXB 5JRCA 3Q5WA 4LF5T 1UX5A 3CVRA 4YTNA 2XSBA 3AE6A 5FXZA 1H7CA 2N2NA 3N2KE 4HE8A 4KBMB 3I0QA 3UU5A 3BQLA 4A97A 2LKHA 2X66A 4U3CA 2DWGA 4ZI3D 2E9XC 2XSAA 1YKHB 5LJNA 4C90A 5LP6E 4AKRB 3IBPA 1KF6A 4UV9B 4YSZA 3AEFA 4H9QC 4PJNA 4GKKT 5AQPB 2X68A 4EYUA 3ZEFB 2WY2A 3MA9A 4LFCT 4QXBB 2KSRA 4ZI2D 1E2AA 3ZCIA 2HHHT 5C2TA 4X1IE 2CXFA 5BR8T 3AB3B 1BR2A 5F5WA 1NEKA 4HFCA 3C98B 4MALA 3HL6A 3FBLA 4B3MT 1CUNA 4WNKA 3P4QA 3RGLA 2R6GF 5LBQB 4X20E 4IT4A 2UUCT 4TV9E 3UFEA 4AKIA 2VQFT 3HKEE 4ZS2A 4H9SE 2X9YA 2RA1A 3ZCJA 1I6ZA 2LKGA 3NRYA 1XMQT 4U7IA 1Y01A 2NR4A 4EOZB 3ZN0B 2Q9QB 5AQKB 1JNRA 3CQCB 3MZKB 4U31A 3ZC1A 3EHZA 2B1EA 4YSXA 3VHLA 4O4JE 2LEHA 2VKDA 5AQJB 2LJLA 4OYJA 4UF0A 2E2AA 1QUUA 4KUMB 5HXCA 2E8IA 2ZM8A 4UXNB 3GMIA 3PU8A 3ZJ2A 2Y48B 2JPFA 5HYAA 2W67A 1VCSA 4ASKA 1MNDA 1T7SA 1M62A 2NTYA 3WI3A 1E7PA 3AA7B 2WBLA 3CX7B 5ABGA 4YTMA 4IREA 2XQAA 3RIUC 2UUBT 4DR4T 2YK0A 3ZT7A 4DNDA 2W61A 4K0KT 4TX5A 3N5LA 1B7TA 4BJNA 1D0YA 1U4QA 3S4UA 1L0VA 3L3PA 2KZ7B 2E9XD 3R84B 2CWYA 4L5GA 1HG5A 3K3OA 4QH4A 4V1Av 4DR5T 2RPAA 4DO0A 4IDNA 4ANJA 2H3RA 5J2TE 3VRAA 4DV1T 2DWKA 1ZHCA 2DL1A 3OYZA 3CWZB 5AQFB 2ZLYA 1I94T 3RHWA 3N9QA 2IW5B 3AXJB 4P09A 4H9PC 4COFA 4I0UA 2XY8B 2KXPB 3UU3A 4CN4A 5A1LA 3VRBA 3NWIA 2CMRA 5GONE 5AQRB 2IC6A 2F4VT 5AQSB 2WWVA 4FJOA 5LMUT 2ZM2A 4JI0T 2UXNB 2CLYC 4AKHA 3AA0B 4IDOA 1WFDA 2XPKA 3ZN1B 4YHHT 2VURA 1GQEA 4Q25A 3BK9A 1XMOT 5LCYA 2A3DA 3ONLC 1XNQT 5IYZE 2LSYA 4UELA 2IDOB 4QH1A 4H9RC 1D1CA 2XQ3A 5AQUB 4WBNE 3PUVF 2VKHA 3B13A 3C4XA 3P4PA 4PJLA 5HCJA 4GYSA 2V6XA 4H9NC 2KWIB 3AEGA 2IC9A 5FNVE 2HN2A 4UV8B 4QXCB 3AAIA 4EEBA 4ZOLE 3I9WA 4JI4T 2VB6A 2K5BB 5HEJA 5HXEA 3ZMUB 3SFEA 5EZYE 5AFUL 4KI0F 4UR9A 2X0HA 1SUMB 2JQ9A 3ZYKA 5EK4A 1KNPA 3NZPA 1W0BA 1DU2A 5HWXA 1N34T 4KMCA 2XAFB 1S35A 1MMDA 3DP7A 3MK7C 3K3NA 2W62A 4WBOA 3NZQA 1G73A 2P9BA 3VKHA 4C91A 2L8KA 4G63A 1SE7A 2IHR1 4JBWF 4OX9T 1IJ5A 3PUZF 4OHFA 5ABHA 1D1AA 4HWHA 4O2AE 2EHOC 3JCFA 3ZMZB 4XAXB 4DV3T 3UQ4A 1N32T 3PTRB 5LOVE 3EVYA 4LMLA 4IE7A 4X1KE 4X65T 5L4HA 3EDUA 4PFPA 4CZZB 3QC9A 4AKGA 4F8HA 3LK42 2AE9A 2VK9A 5LNKA 2W66A 3UTKA 5JTGA 3EABA 2OV9A 2I6HA 4WW0A 2DHRA 2XJ7A 3QOFA 3V5UA 1NENA 4E7ZA 2WU5A 4A98A 2LE8A 4P0AA 3LFMA 5AQIB 2WM9A 3FXEB 3FZFB 5L3EB 2LLYA 2CBIA 2UUAT 5JRCB 4GK5E 4ZI2C 2VKJA 3LK2B 5AQGB 2V7JA 1WR6A 1VRBA 3I9YA 1D0XA 4IHJE 5FXWA 1YQ3A 3V5SA 3KFWX 5CA0E 5JR9A 4EAHA 2Y8DA 1MMGA 4TV8E 4IGUA 2W2UA 2I0MA 5FMNA 3ZC0A 3O1JA 1XDOA 3PUGA 3QUJA 4JYAT 2N1GA 2PJQA 3ZKRA 2LSKA 1FIOA 5F3JA 3ZT6A 4XBFB 2CPTA 3HKBE 3UUXB 4ZHQE 2B76A 4JV5T 2XTLA 3Q9DA 2WCAA 5IHYA 2IIUA 3NRXA 4I4TE 3C50A 3OTOT 2HPLA 4O4IE 3RX6A 4IE4A 5F8PA 4B3RT 1J5ET 3QNUA 4BA9A 2LOPA 3T1HT 4LF4T 4ADZA 2PG8A 4QXHB 4UVAB 1Z0PA 3NBXX 3B5MA 2IUBA 4TNWA 1US7B 5CGMA 5FVLA 5AQQB 3VR8A 5J2UE 5HWYA 2BG9E 4DV7T 4QX8B 5FYMA 3KV6A 3AE3A 5M4YA 4H63H 5JDHA 2D2SA 2KINB 3AEDA 3Q2MA 3ZT5A 5JVDE 1UCUA 4YY3T 5AQHB 2AXDS 5HXRA 4EV6A 1T8BA 1UUSA 3L09A 4JUYA 2BS3A 2LHRA 4UF0B 2YDSA 2V8SV 4TWDA 4O8SA 3TLUA 3JAEA 3Q5XA 5HCMA 2V7LA 4DBQA 5LHHB 3T1YT 3PU3A 4Z90A 4YT0A 4B3TT 3RYIE 2GK9A 2EHOA 1WR0A 2J62A 4HFEA 1YQ4A 4Z91A 3FZLB 5C3JA 2DI4A 3Q5EA 2J47A 2LRLA 1ZEEA 2BS4A 4NXMT 3LK3B 4IL4A 2N9DA 3GWHA 2VKOA 4EYYR 5HEGA 1S94A 4XZCA 4ZI7E 3MKDA 5AQMB 3N2OA 2K9AA 2XQ5A 2LRKA 3CX6B 4WZXA 3N2GE 2V26A 3RQWA 2QVAA 2XAHB 5LXTE 2HN1A 5JDMA 4GOUA 2XM1A 3O1HA 4LF6T 3DJBA 4BAYB 2BG9C 3NVOA 4IDZA 4I43B 5LHGB 3L8RA 3C64A 2D9DA 1OXZA 2HPJA 4EIWA 2FBWA 1LKXA 4P1NA 2VL0A 1V9DA 3KV9A 2OA5A 3TKLB 4JLEA 2ODVA 3A8YC 4DMWA 2YINA 5LYJE 4QH5A 3DTOA 2BKPA 2XQ7A 4ZZBA 3ABVA 1HTJF 2FJBA 5ABFA 1XDPA 2YN6A 4EXTA 1WYCA 3F31A 4B3ST 2WZIA 3GA8A 5LGTB 3KVBA 4IDQA 3N9MA 3U78A 3P4RA 4JI7T 2V7IA 4X66T 2E5LT 4IIJE 4LF8T 5L3GB 3ANWA 4PFOA 3QB5K 3RI5A 1T98A 1KNRA 4EZHA 5FY0A 3CK6A 4L9IA 4GIWA 1VCTA 3EAMA 1WLXA 3OKQA 2J1DG 3FXDB 2VASA 3RQUA 5LGUB 3AEBA 5EK2A 3H3AA 1J5WA 1U5PA 2Q9QD 2QGSA 2WDVA 1HFAA 5KMGP 2WSSV 3OVUA 3ZMTB 1ZV4X 2VL8A 5HXSA 3U3IA 3ESLA 4AKLA 4HWCA 3RYHE 3ZLIA 2D0UA 4U72A 1XWMA 5E0OA 3UT5E 2VQET 3OJAA 3UU4A 1ZKEA 5CA1E 1HX8A 2A9UA 2LT3A 1NWMX 4AI6A 2E9XA 3AE7A 3SS1A 4K0UA 5FL1A 1HG2A 5FL0A 1MIWA 3FBZA 5HEOA 4HFDA 2XQ4A 4CQIA 2FJAA 5JREA 2M6BA 1IBMT 3G06A 2X9HA 3CQGB 1ZOYA 4TZ4C 2XQ8A 3PE0A 3HI2A 4LF7T 3P4SA 4CN6A 5JDQA 1YKEB 3TLSA 3VR9A 2NW9A 3KBUA 3X1DA 4MHCA 1IBLT 3AVRA 3F2EA 2LM2A 3F57A 4Z8XA 4ISSA 4U2YA 3VU7H 3RC8A 2XAGB 3UU8A 1SA0E 2CCQA 4HKAA 2XQ9A 1LVFA 4QWNB 1FMWA 5DJQC 2V6YA 3BQIA 2BG9A 3MXZA 2ODUA 1OEDB 1MIYA 5L3FB 2H88A 4FI5A 4UEMA 1MNEA 1KEYA 5JR9B 2JMHA 3ETUA 3N9NA 4ZXLA 3E22E 2KNDA 4N78D 2G0UA 1JNZA 3WAJA 2ACXA 5CJ5A
chains in the Genus database with same CATH topology
3RRWA 2VWAA 3NRXA 3PURA 5JDNA 4I4TE 4PW8A 5LJMA 2L3LA 3C50A 3CX8B 2HPLA 4O4IE 3UUNA 4MALA 3RX6A 3RC3A 3HL6A 3IHRA 4GK0E 3J7Yq 4IE4A 5F8PA 3FBLA 5FY7A 1SHZC 4O4LE 4PAGA 1CUNA 4WNKA 4BA9A 2BVLA 4IE0A 2LOPA 2D0TA 3RH3A 1LVKA 2CEAA 5LBQB 4ADZA 4TN7B 3I1AA 2PG8A 4X20E 4TV9E 3UFEA 4AKIA 5BMVE 3HA4A 3HKEE 4QXHB 4UVAB 3KV4A 1Z0PA 3NBXX 4H9SE 4ZS2A 5LBMA 2X9YA 5JR9C 2NOXA 2Q9QA 2RA1A 4TUYE 5FXVA 3M65A 1US7B 3ZCJA 4AXPA 1HF8A 3NRYA 2JMKA 2LSJA 5J2UE 1WYBA 4EOZB 2C5IT 2PFVA 5HWYA 3ZN0B 3UULA 3LG7A 3RKOA 2Q9QB 5L3CB 5LHIB 3PDYA 4YFSA 2Y6XA 4CXWA 4QX8B 3CQCB 5LGNB 5FYMA 3MZKB 3KV6A 3ZC1A 5DQVA 2B1EA 3UUMA 3EUHA 3VHLA 2WMOA 3IEEA 3ZYLA 4CXXA 2W00A 4H63H 5JDHA 4O4JE 1YD8G 2D2SA 5M4YA 2LEHA 2VKDA 2PBIA 1MIVA 4P0BA 2LJLA 4DVDA 4ZS3A 2KINB 3OYXA 3Q2MA 3JC6D 4OYJA 4QHOA 5JVDE 1UCUA 4UF0A 1QUUA 4KUMB 5HXCA 2E8IA 2ZM8A 4UXNB 4CI3B 3GMIA 3PU8A 4U74A 4YLHA 3AA6B 2NW7A 5HXRA 2BDEA 3ETVA 3ZJ2A 2NP9A 2Y48B 3L09A 2NTXA 3B57A 4JUYA 2JPFA 5HYAA 2LHRA 4UF0B 4ASKA 4F6RC 1MNDA 4PK4A 2CA5A 2NTYA 5JDGA 3HR0A 4O8SA 4J2CA 3WI3A 2NWBA 1UX4A 2X0LB 3Q5XA 5DABA 2V7LA 3AA7B 3T8OA 1BR0A 4DBQA 2WBLA 1FEWA 3CX7B 4HTEA 5LHHB 1NAFA 2C5KT 3PU3A 4HEAA 4MFRA 1X79A 3RYIE 3PUAA 2YU2A 3AA1B 2GK9A 2EHOA 2YK0A 4JEUB 4DNDA 3CPZA 2W61A 2MTQA 2RP4A 3K3QC 4I50E 3KBTA 4TX5A 3IF8B 3N5LA 2W0GA 1B7TA 4BJNA 4DMVA 1D0YA 2DI4A 4CI1B 1D0ZA 1U4QA 3S4UA 2EHOB 3L3PA 2KZ7B 1ZEEA 3LJCA 2E9XD 2ZM0A 1HS7A 4PNIA 3R84B 2CWYA 3LK3B 3C4WA 4L5GA 2MYSA 1HG5A 2N9DA 3GWHA 2CLYB 2V1DB 3K3OA 3CKDA 4V1Av 2VKOA 3AAAB 4O2BE 4AQFA 4EYYR 2CM0A 4DO0A 2CXDA 1O3XA 2DCFA 4ANJA 3MJXA 2W63A 2H3RA 5L3BB 5J2TE 1KK7A 3HKDE 3GN5A 1Y64B 5ADXL 4ISTA 2DWKA 1S94A 2WWUA 1ZHCA 4XZCA 4ZI7E 3OYZA 3MKDA 3CWZB 3N2OA 2DLRA 2K9AA 2QA7A 2ZLYA 3N9QA 3CX6B 2IW5B 2X9WA 3RRCA 3GN5B 3O1IA 3VKGA 3N2GE 2V26A 3E08A 2LHNA 4P09A 3RYFE 4H9PC 1G8XA 4UIGA 2XAHB 5LXTE 3SWHA 2KXPB 1MMAA 4O4HE 5A1LA 5JDMA 4GOUA 3ZMVB 3O1HA 2CMRA 2WAUA 3QK6A 3DJBA 4OYKA 5LG4A 4BAYB 1AJ3A 5GONE 2IC6A 3ONXA 4HN9A 4IDZA 1MMNA 4I43B 5LHGB 1IZNB 3R6NA 3C64A 1OXZA 4FJOA 4KP3C 2ZM2A 5FXXA 2UXNB 2HPJA 4OK0A 4EIWA 4YJ2E 4IE5A 2CLYC 1LKXA 3O4XE 2KT9A 1BR1A 3RYCE 4AKHA 1V9DA 4MBQA 3O9XA 3KV9A 2OA5A 3TKLB 3AA0B 3E0ZA 4JLEA 2ODVA 4NUVA 3KDSE 3ZN1B 5CB4E 4BJMA 4DMWA 2IAKA 4A56A 2I59A 2YINA 5IHYA 5LYJE 3BK9A 5LCYA 5L3DB 2A3DA 2YEVC 4CXYA 4QX7B 3EDVA 3DTOA 1D1BA 5ETWA 5FY1A 2K48A 2XAQB 2XUEA 5IYZE 1HTJF 3HKCE 5JQGE 2LSYA 2BZBA 3P8CD 3OBVE 4UELA 3PUQA 3KVAA 2YU1A 4EXTA 1WYCA 3F31A 4ZI3C 4QKNA 4H9RC 3GA8A 1D1CA 5LGTB 3W15B 4B6XA 2X51A 3KVBA 4HGAA 3N9MA 4PJLA 2VKHA 3B13A 3C4XA 3U78A 4WBNE 1OWAA 3ZPOA 4GYSA 5KDMC 2A2FX 2V7IA 4H9NC 2K24A 2KWIB 4EZ4A 4IIJE 2M67A 5FNVE 2IC9A 5FP3A 4YHJA 3N9PA 4YJ3E 5L3GB 4ERRA 4UV8B 3ANWA 4GYRA 4QXCB 3SOLA 3ZYMA 3AAIA 4AQGA 4EB6E 5KX5E 4I55E 4PFOA 2Q9QC 2KMFA 3H37A 4ZOLE 1VOMA 4CI2B 3I9WA 1T98A 2ES0A 4UVCB 2VB6A 4L0RA 2K5BB 3ANWB 3WAKA 5HXEA 4EZHA 4HFVA 5FY0A 3ZMUB 5EZYE 5J1GA 4L9IA 5AFUL 1YW0A 4GIWA 1WLXA 3OKQA 2J1DG 3FXDB 3C51A 4M1PA 1WRDA 2VASA 5LGUB 2Z6EA 3ZYKA 5EK2A 4UVBB 2JJ9A 5EK4A 3NZPA 3H3AA 1BR4A 3C4ZA 3KINB 5HWXA 5TAOA 1U5PA 2Q9QD 2QGSA 1HFAA 3SRZA 4KMCA 2XAFB 4H63V 5KMGP 1S35A 2WSSV 2MBGA 3AVSA 1MMDA 3ZMTB 3DP7A 1ZV4X 3MK7C 2VL8A 5HXSA 3BQKA 3U3IA 3K3NA 3ESLA 5JDFA 4AKLA 5HAXA 3RYHE 2W62A 4WBOA 3NZQA 3ZLIA 2XAJB 2D0UA 3FB2A 1G73A 4U72A 2P9BA 5E0OA 4E7SA 3VKHA 3UT5E 3N9LA 2CE7A 3OJAA 4C91A 3K8PC 5JH7E 2HH7A 3RPUA 3KV5A 1LRZA 2XASB 2L8KA 4G63A 1ZKEA 5CA1E 4PJJA 1HX8A 2WMNA 1IJ5A 1IAPA 2X9XA 2MOZA 2UXXB 5DQWA 2C5JA 2LT3A 4OHFA 1D1AA 4NUUA 1NWMX 1EZ3A 2EHOC 4O2AE 3ZMZB 4X1YE 4AI6A 4XAXB 2V7MA 2E9XA 3FHNA 4PK6A 3CMLA 2LSIA 3SS1A 2LSGA 4K0UA 5HXHA 2CWOA 3PTRB 4JEHB 1HG2A 4ILUA 5LOVE 3A5XA 2D5UA 3EVYA 2L9QA 4IE7A 4X1KE 1MIWA 3FBZA 2NW8A 2C0SA 4CZZB 3EDUA 4PFPA 2E9XB 5LA6E 3QC9A 4AKGA 4CQIA 3CQXC 3LK42 4IE6A 3JC6C 5JREA 2VK9A 4AQFC 5LNKA 2JRKA 4PK5A 3UTKA 3AAEB 3MACA 2X9HA 2DNXA 5EK3A 1E1HB 3LBXA 2DHRA 3CQGB 4WW0A 2H7VC 3I0OA 4OFZA 4MLKA 3ZJ1A 2EHOD 4TZ4C 1FMVA 3PUSA 2XHEB 3PE0A 3V5UA 3HI2A 2JQQA 2ZMAA 4E7ZA 5JDQA 5H6RB 3LBXB 1YKEB 5JRCA 2LE8A 4P0AA 3Q5WA 3LFMA 5L2LA 2BVMA 2WM9A 3N9OA 3FXEB 2NW9A 1UX5A 1IJ6A 3CVRA 3KBUA 5L3EB 1HCIA 4MHCA 5FXZA 1H7CA 3AVRA 2N2NA 3N2KE 3F2EA 3F57A 4Z8XA 5JRCB 4GK5E 4ISSA 3ZMSB 3VU7H 4HE8A 5JDLA 3RC8A 4KBMB 2XAGB 3I0QA 4ZI2C 1SA0E 3BQLA 2CCQA 2VKJA 3LK2B 2X66A 2V7JA 2DWGA 2SPCA 1WR6A 4ZI3D 2LM9A 2E9XC 1VRBA 2KLQA 3I9YA 1YKHB 2V7KA 4HKAA 5LJNA 1LVFA 4H9OC 1D0XA 4C90A 4QWNB 1KNZA 4IHJE 5FXWA 1FMWA 1QSDA 3BQIA 5DJQC 5LP6E 3V5SA 3P7IA 4AKRB 3KFWX 5CA0E 3MXZA 5JR9A 3IBPA 4EAHA 2Y8DA 2ODUA 1MMGA 5H6QB 4UV9B 4H9QC 1MIYA 4TV8E 2A72A 4PJNA 4DBRA 4IGUA 5L3FB 2X68A 4FI5A 4EYUA 3D0TA 3ZEFB 4UEMA 5FMNA 3ZC0A 3O1JA 3MA9A 1MNEA 4QXBB 4ZI2D 5JR9B 2JMHA 3PUGA 2LOSA 4G2AA 3QUJA 3ZCIA 3ETUA 2N1GA 2PJQA 2H7OA 3N9NA 2LSKA 1FIOA 2CXLA 5F3JA 3E22E 2KWHA 4X1IE 2KNDA 4XBFB 4N78D 3HKBE 2CXFA 3UUXB 4ZHQE 3AB3B 2G0UA 1BR2A 2X67A 2XTLA 3Q9DA 3J9X1 5C8YE 3WAJA 2ACXA 3C98B 2XQYA 4PJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZCJ A;  3ZCI A; 
#chains in the Genus database with same CATH topology
 3RRW A;  3PUR A;  5JDN A;  5LJM A;  2L3L A;  3CX8 B;  4A5X A;  3UUN A;  4NPP A;  3IHR A;  4GK0 E;  3J7Y q;  2BS2 A;  1SHZ C;  3PUY F;  4DV2 T;  3RH3 A;  3EI0 A;  4ZZC A;  1J1J A;  1T72 A;  5FXV A;  4TUY E;  3M65 A;  3RIU A;  1HF8 A;  2LSJ A;  1WYB A;  2C5I T;  3Q5D A;  2PFV A;  2IML A;  3LG7 A;  4YTP A;  1WCR A;  4DV5 T;  5LGN B;  4U33 A;  5DQV A;  5CFB A;  3UUM A;  3EUH A;  2WMO A;  3ZYL A;  4CXX A;  1YD8 G;  2PBI A;  1HNZ T;  4P0B A;  4DVD A;  4ZS3 A;  3OYX A;  4KHZ F;  4CI3 B;  1HNX T;  4YLH A;  3AA6 B;  2BDE A;  3H3M A;  2CHO A;  5KXJ A;  3AEE A;  4F6R C;  4PK4 A;  5JDG A;  2XZE A;  4J2C A;  1YXR A;  5DAB A;  3T8O A;  1BR0 A;  4HTE A;  3NKZ A;  1HNW T;  4MFR A;  3PUA A;  2YU2 A;  3AA1 B;  4DV6 T;  2JQH A;  3CIR A;  4JI8 T;  3ZSS A;  2RP4 A;  4I50 E;  3KBT A;  2BBH A;  2X0Y A;  1R8I A;  4CI1 B;  1D0Z A;  4GKJ T;  2EHO B;  2YOE A;  2ZM0 A;  4PNI A;  2MYS A;  5FVK A;  4EED A;  3CKD A;  4O2B E;  3AAA B;  2CXD A;  1O3X A;  2CHN A;  2DCF A;  2MPK A;  2W63 A;  5L3B B;  4ZEY A;  3HKD E;  4HFI A;  3GN5 A;  1Y64 B;  4IST A;  2WWU A;  1W09 A;  2DLR A;  4IDP A;  4DV0 T;  3FZK B;  3O1I A;  3VKG A;  3RYF E;  4UIG A;  3SWH A;  1MMA A;  5LG4 A;  2WAU A;  3QK6 A;  1AJ3 A;  3ONX A;  4HN9 A;  1N36 T;  1MMN A;  4NIQ A;  3LDQ B;  3R6N A;  4OK0 A;  3PJA A;  2BKN A;  4YJ2 E;  4IE5 A;  4LFA T;  2KT9 A;  3RYC E;  5AQL B;  3AE1 A;  3P50 A;  4X62 T;  4NUV A;  3KDS E;  2W4X A;  2IAK A;  4A56 A;  5LB7 B;  2QYW A;  4CXY A;  4QX7 B;  2H89 A;  1XNR T;  1D1B A;  5ETW A;  4LFB T;  5LMN T;  2UXB T;  2XAQ B;  3HKC E;  4AQY T;  5JQG E;  2BZB A;  3P8C D;  3PUQ A;  3OPC A;  3KVA A;  4QKN A;  4B6X A;  5ABF B;  4HGA A;  4DR7 T;  5KDM C;  2K24 A;  3LSV A;  4EZ4 A;  5FP3 A;  4ERR A;  3SOL A;  4AQG A;  4EB6 E;  5KX5 E;  2Q9Q C;  2KMF A;  3AE2 A;  3H37 A;  1VOM A;  4CI2 B;  2ES0 A;  3ANW B;  3WAK A;  2VVS A;  1KFY A;  4HFV A;  4JI1 T;  4JI6 T;  4ILC A;  1WRD A;  2Z6E A;  2JJ9 A;  1UK5 A;  3C4Z A;  2M6I A;  2WDR A;  4H63 V;  5IUX A;  2MBG A;  3AVS A;  3UFG A;  3BQK A;  3PV0 F;  2VVN A;  3FB2 A;  2J4G A;  3N9L A;  2CE7 A;  2V5C A;  5JH7 E;  1LRZ A;  1HR0 T;  2XAS B;  4PJJ A;  4HWF A;  2WMN A;  1IAP A;  2X9X A;  2MOZ A;  4NUU A;  4JI3 T;  2YDR A;  2V7M A;  3CML A;  5HXH A;  2CWO A;  3UU6 A;  4TWF A;  4ILU A;  1XZY A;  5HEU A;  2L9Q A;  2MAW A;  2NW8 A;  2C0S A;  4JI5 T;  2E9X B;  5LA6 E;  3CQX C;  4IE6 A;  1OED E;  3JC6 C;  1M7K A;  4AQF C;  4HWI B;  2JRK A;  4PK5 A;  3AAE B;  2DNX A;  3L39 A;  1E1H B;  3LBX A;  2YDQ A;  2H7V C;  3I0O A;  1CHU A;  4OFZ A;  2CBJ A;  3ZJ1 A;  3A7M A;  1FMV A;  4YXD A;  3PUS A;  1UUR A;  4U7Y A;  4IL9 A;  5H6R B;  5L2L A;  3RIF A;  4CN1 A;  2BVM A;  3N9O A;  1Z8U A;  1IJ6 A;  2WS3 A;  1HCI A;  2WU2 A;  3FZM B;  3ZMS B;  5JDL A;  3RF1 A;  2WDQ A;  5J0Z A;  2SPC A;  4TNV A;  2LM9 A;  2KLQ A;  2V7K A;  4H9O C;  1KNZ A;  1QSD A;  3AE8 A;  5ABE A;  3P7I A;  3M3Z B;  5AQN B;  5H6Q B;  3FZH B;  4DBR A;  2A72 A;  3UUB A;  4DV4 T;  3D0T A;  2V6Y B;  2BG9 B;  5IWA T;  4DR2 T;  2UU9 T;  2LOS A;  4G2A A;  2XM2 A;  2H7O A;  2CXL A;  2K3W A;  2KWH A;  3SFD A;  2X67 A;  4YSY A;  3J9X 1;  5C8Y E;  2XQY A;  4PJM A;  4DUZ T;  2VWA A;  4PW8 A;  3RC3 A;  4JI2 T;  5FY7 A;  2QRX A;  3RIA A;  4O4L E;  4PAG A;  2BVL A;  4IE0 A;  2D0T A;  1OED C;  1LVK A;  4HFH A;  2CEA A;  3QB5 A;  3I1A A;  4TN7 B;  5BMV E;  3HA4 A;  3KV4 A;  5JR9 C;  5LBM A;  2NOX A;  2Q9Q A;  4AXP A;  2JMK A;  2WQY A;  2JIW A;  3JAF A;  3UUL A;  3RKO A;  5L3C B;  5LHI B;  3PDY A;  3AEA A;  4YFS A;  2Y6X A;  4CXW A;  2WZH A;  2WB5 A;  4ILA A;  3AE9 A;  3TLT A;  3IEE A;  2W00 A;  1MIV A;  4HWD A;  1FJG T;  3JC6 D;  4QHO A;  4LF9 T;  5HEH A;  4TWH A;  2BKO A;  4U74 A;  2NW7 A;  3ETV A;  5AQV B;  2NP9 A;  2NTX A;  3B57 A;  2CA5 A;  3HR0 A;  2NWB A;  1UX4 A;  2X0L B;  1FEW A;  1NAF A;  2C5K T;  4HEA A;  4ILB A;  3UQ7 A;  1X79 A;  2FUP A;  3AE5 A;  4JEU B;  3CPZ A;  2MTQ A;  3K3Q C;  5FKY A;  4DR6 T;  4DR1 T;  3IF8 B;  2W0G A;  2YKS A;  4DMV A;  3TLW A;  3LJC A;  4U2Z A;  5AQO B;  1HS7 A;  3C4W A;  2PTF A;  2CLY B;  2V1D B;  4AQF A;  3AEC A;  4AIS A;  2ACZ A;  2CM0 A;  3MJX A;  1KK7 A;  3AE4 A;  3ZST A;  2FJD A;  5ADX L;  3AXJ A;  4NXN T;  2QA7 A;  4LMK A;  1IBK T;  2X9W A;  3RRC A;  3GN5 B;  4KHP T;  3E08 A;  2LHN A;  1G8X A;  4O4H E;  3PUX F;  3ZMV B;  4OYK A;  4X64 T;  4KX6 A;  2OLT A;  1IZN B;  4KP3 C;  5FXX A;  2FJE A;  2BBJ A;  3O4X E;  1BR1 A;  4MBQ A;  3O9X A;  3E0Z A;  5CB4 E;  4BJM A;  2I59 A;  4HFB A;  5L3D B;  4LMJ A;  2YEV C;  3EDV A;  5FY1 A;  2K48 A;  2XUE A;  3OBV E;  2YU1 A;  3JAD A;  4ZI3 C;  3IA3 A;  2UXC T;  3W15 B;  2X51 A;  2XQ6 A;  1W9R A;  1OWA A;  3ZPO A;  5LG3 A;  2A2F X;  2M67 A;  2ZM6 T;  4YHJ A;  3N9P A;  4YJ3 E;  4GYR A;  3ZYM A;  4I55 E;  3RKG A;  1OED A;  4UVC B;  4L0R A;  5AQT B;  3TLV A;  5J1G A;  1YW0 A;  1QLB A;  4DR3 T;  4DID B;  4M1P A;  3C51 A;  4UVB B;  2E5V A;  1ZP0 A;  1BR4 A;  3KIN B;  3P4W A;  5TAO A;  3SRZ A;  1HX1 B;  4WYV A;  3PJA J;  4AIU A;  5JDF A;  5HAX A;  4DUY T;  2XAJ B;  4E7S A;  1N33 T;  3ONJ A;  3K8P C;  2HH7 A;  2WP9 A;  3RPU A;  3KV5 A;  1X9B A;  2UXX B;  5DQW A;  5L4E A;  2UXD T;  2C5J A;  1EZ3 A;  4X1Y E;  3FHN A;  4PK6 A;  4EGW A;  5L47 A;  2LSI A;  2LSG A;  2V5D A;  4JEH B;  3K1S A;  3A5X A;  2D5U A;  3RLF F;  1W0A A;  2JQK A;  3MAC A;  5EK3 A;  3PUW F;  4MLK A;  2EHO D;  2XHE B;  1UGO A;  4X5T A;  2JQQ A;  2ZMA A;  2CRB A;  3LBX B;  5JRC A;  3Q5W A;  4LF5 T;  1UX5 A;  3CVR A;  4YTN A;  2XSB A;  3AE6 A;  5FXZ A;  1H7C A;  2N2N A;  3N2K E;  4HE8 A;  4KBM B;  3I0Q A;  3UU5 A;  3BQL A;  4A97 A;  2LKH A;  2X66 A;  4U3C A;  2DWG A;  4ZI3 D;  2E9X C;  2XSA A;  1YKH B;  5LJN A;  4C90 A;  5LP6 E;  4AKR B;  3IBP A;  1KF6 A;  4UV9 B;  4YSZ A;  3AEF A;  4H9Q C;  4PJN A;  4GKK T;  5AQP B;  2X68 A;  4EYU A;  3ZEF B;  2WY2 A;  3MA9 A;  4LFC T;  4QXB B;  2KSR A;  4ZI2 D;  1E2A A;  3ZCI A;  2HHH T;  5C2T A;  4X1I E;  2CXF A;  5BR8 T;  3AB3 B;  1BR2 A;  5F5W A;  1NEK A;  4HFC A;  3C98 B;  4MAL A;  3HL6 A;  3FBL A;  4B3M T;  1CUN A;  4WNK A;  3P4Q A;  3RGL A;  2R6G F;  5LBQ B;  4X20 E;  4IT4 A;  2UUC T;  4TV9 E;  3UFE A;  4AKI A;  2VQF T;  3HKE E;  4ZS2 A;  4H9S E;  2X9Y A;  2RA1 A;  3ZCJ A;  1I6Z A;  2LKG A;  3NRY A;  1XMQ T;  4U7I A;  1Y01 A;  2NR4 A;  4EOZ B;  3ZN0 B;  2Q9Q B;  5AQK B;  1JNR A;  3CQC B;  3MZK B;  4U31 A;  3ZC1 A;  3EHZ A;  2B1E A;  4YSX A;  3VHL A;  4O4J E;  2LEH A;  2VKD A;  5AQJ B;  2LJL A;  4OYJ A;  4UF0 A;  2E2A A;  1QUU A;  4KUM B;  5HXC A;  2E8I A;  2ZM8 A;  4UXN B;  3GMI A;  3PU8 A;  3ZJ2 A;  2Y48 B;  2JPF A;  5HYA A;  2W67 A;  1VCS A;  4ASK A;  1MND A;  1T7S A;  1M62 A;  2NTY A;  3WI3 A;  1E7P A;  3AA7 B;  2WBL A;  3CX7 B;  5ABG A;  4YTM A;  4IRE A;  2XQA A;  3RIU C;  2UUB T;  4DR4 T;  2YK0 A;  3ZT7 A;  4DND A;  2W61 A;  4K0K T;  4TX5 A;  3N5L A;  1B7T A;  4BJN A;  1D0Y A;  1U4Q A;  3S4U A;  1L0V A;  3L3P A;  2KZ7 B;  2E9X D;  3R84 B;  2CWY A;  4L5G A;  1HG5 A;  3K3O A;  4QH4 A;  4V1A v;  4DR5 T;  2RPA A;  4DO0 A;  4IDN A;  4ANJ A;  2H3R A;  5J2T E;  3VRA A;  4DV1 T;  2DWK A;  1ZHC A;  2DL1 A;  3OYZ A;  3CWZ B;  5AQF B;  2ZLY A;  1I94 T;  3RHW A;  3N9Q A;  2IW5 B;  3AXJ B;  4P09 A;  4H9P C;  4COF A;  4I0U A;  2XY8 B;  2KXP B;  3UU3 A;  4CN4 A;  5A1L A;  3VRB A;  3NWI A;  2CMR A;  5GON E;  5AQR B;  2IC6 A;  2F4V T;  5AQS B;  2WWV A;  4FJO A;  5LMU T;  2ZM2 A;  4JI0 T;  2UXN B;  2CLY C;  4AKH A;  3AA0 B;  4IDO A;  1WFD A;  2XPK A;  3ZN1 B;  4YHH T;  2VUR A;  1GQE A;  4Q25 A;  3BK9 A;  1XMO T;  5LCY A;  2A3D A;  3ONL C;  1XNQ T;  5IYZ E;  2LSY A;  4UEL A;  2IDO B;  4QH1 A;  4H9R C;  1D1C A;  2XQ3 A;  5AQU B;  4WBN E;  3PUV F;  2VKH A;  3B13 A;  3C4X A;  3P4P A;  4PJL A;  5HCJ A;  4GYS A;  2V6X A;  4H9N C;  2KWI B;  3AEG A;  2IC9 A;  5FNV E;  2HN2 A;  4UV8 B;  4QXC B;  3AAI A;  4EEB A;  4ZOL E;  3I9W A;  4JI4 T;  2VB6 A;  2K5B B;  5HEJ A;  5HXE A;  3ZMU B;  3SFE A;  5EZY E;  5AFU L;  4KI0 F;  4UR9 A;  2X0H A;  1SUM B;  2JQ9 A;  3ZYK A;  5EK4 A;  1KNP A;  3NZP A;  1W0B A;  1DU2 A;  5HWX A;  1N34 T;  4KMC A;  2XAF B;  1S35 A;  1MMD A;  3DP7 A;  3MK7 C;  3K3N A;  2W62 A;  4WBO A;  3NZQ A;  1G73 A;  2P9B A;  3VKH A;  4C91 A;  2L8K A;  4G63 A;  1SE7 A;  2IHR 1;  4JBW F;  4OX9 T;  1IJ5 A;  3PUZ F;  4OHF A;  5ABH A;  1D1A A;  4HWH A;  4O2A E;  2EHO C;  3JCF A;  3ZMZ B;  4XAX B;  4DV3 T;  3UQ4 A;  1N32 T;  3PTR B;  5LOV E;  3EVY A;  4LML A;  4IE7 A;  4X1K E;  4X65 T;  5L4H A;  3EDU A;  4PFP A;  4CZZ B;  3QC9 A;  4AKG A;  4F8H A;  3LK4 2;  2AE9 A;  2VK9 A;  5LNK A;  2W66 A;  3UTK A;  5JTG A;  3EAB A;  2OV9 A;  2I6H A;  4WW0 A;  2DHR A;  2XJ7 A;  3QOF A;  3V5U A;  1NEN A;  4E7Z A;  2WU5 A;  4A98 A;  2LE8 A;  4P0A A;  3LFM A;  5AQI B;  2WM9 A;  3FXE B;  3FZF B;  5L3E B;  2LLY A;  2CBI A;  2UUA T;  5JRC B;  4GK5 E;  4ZI2 C;  2VKJ A;  3LK2 B;  5AQG B;  2V7J A;  1WR6 A;  1VRB A;  3I9Y A;  1D0X A;  4IHJ E;  5FXW A;  1YQ3 A;  3V5S A;  3KFW X;  5CA0 E;  5JR9 A;  4EAH A;  2Y8D A;  1MMG A;  4TV8 E;  4IGU A;  2W2U A;  2I0M A;  5FMN A;  3ZC0 A;  3O1J A;  1XDO A;  3PUG A;  3QUJ A;  4JYA T;  2N1G A;  2PJQ A;  3ZKR A;  2LSK A;  1FIO A;  5F3J A;  3ZT6 A;  4XBF B;  2CPT A;  3HKB E;  3UUX B;  4ZHQ E;  2B76 A;  4JV5 T;  2XTL A;  3Q9D A;  2WCA A;  5IHY A;  2IIU A;  3NRX A;  4I4T E;  3C50 A;  3OTO T;  2HPL A;  4O4I E;  3RX6 A;  4IE4 A;  5F8P A;  4B3R T;  1J5E T;  3QNU A;  4BA9 A;  2LOP A;  3T1H T;  4LF4 T;  4ADZ A;  2PG8 A;  4QXH B;  4UVA B;  1Z0P A;  3NBX X;  3B5M A;  2IUB A;  4TNW A;  1US7 B;  5CGM A;  5FVL A;  5AQQ B;  3VR8 A;  5J2U E;  5HWY A;  2BG9 E;  4DV7 T;  4QX8 B;  5FYM A;  3KV6 A;  3AE3 A;  5M4Y A;  4H63 H;  5JDH A;  2D2S A;  2KIN B;  3AED A;  3Q2M A;  3ZT5 A;  5JVD E;  1UCU A;  4YY3 T;  5AQH B;  2AXD S;  5HXR A;  4EV6 A;  1T8B A;  1UUS A;  3L09 A;  4JUY A;  2BS3 A;  2LHR A;  4UF0 B;  2YDS A;  2V8S V;  4TWD A;  4O8S A;  3TLU A;  3JAE A;  3Q5X A;  5HCM A;  2V7L A;  4DBQ A;  5LHH B;  3T1Y T;  3PU3 A;  4Z90 A;  4YT0 A;  4B3T T;  3RYI E;  2GK9 A;  2EHO A;  1WR0 A;  2J62 A;  4HFE A;  1YQ4 A;  4Z91 A;  3FZL B;  5C3J A;  2DI4 A;  3Q5E A;  2J47 A;  2LRL A;  1ZEE A;  2BS4 A;  4NXM T;  3LK3 B;  4IL4 A;  2N9D A;  3GWH A;  2VKO A;  4EYY R;  5HEG A;  1S94 A;  4XZC A;  4ZI7 E;  3MKD A;  5AQM B;  3N2O A;  2K9A A;  2XQ5 A;  2LRK A;  3CX6 B;  4WZX A;  3N2G E;  2V26 A;  3RQW A;  2QVA A;  2XAH B;  5LXT E;  2HN1 A;  5JDM A;  4GOU A;  2XM1 A;  3O1H A;  4LF6 T;  3DJB A;  4BAY B;  2BG9 C;  3NVO A;  4IDZ A;  4I43 B;  5LHG B;  3L8R A;  3C64 A;  2D9D A;  1OXZ A;  2HPJ A;  4EIW A;  2FBW A;  1LKX A;  4P1N A;  2VL0 A;  1V9D A;  3KV9 A;  2OA5 A;  3TKL B;  4JLE A;  2ODV A;  3A8Y C;  4DMW A;  2YIN A;  5LYJ E;  4QH5 A;  3DTO A;  2BKP A;  2XQ7 A;  4ZZB A;  3ABV A;  1HTJ F;  2FJB A;  5ABF A;  1XDP A;  2YN6 A;  4EXT A;  1WYC A;  3F31 A;  4B3S T;  2WZI A;  3GA8 A;  5LGT B;  3KVB A;  4IDQ A;  3N9M A;  3U78 A;  3P4R A;  4JI7 T;  2V7I A;  4X66 T;  2E5L T;  4IIJ E;  4LF8 T;  5L3G B;  3ANW A;  4PFO A;  3QB5 K;  3RI5 A;  1T98 A;  1KNR A;  4EZH A;  5FY0 A;  3CK6 A;  4L9I A;  4GIW A;  1VCT A;  3EAM A;  1WLX A;  3OKQ A;  2J1D G;  3FXD B;  2VAS A;  3RQU A;  5LGU B;  3AEB A;  5EK2 A;  3H3A A;  1J5W A;  1U5P A;  2Q9Q D;  2QGS A;  2WDV A;  1HFA A;  5KMG P;  2WSS V;  3OVU A;  3ZMT B;  1ZV4 X;  2VL8 A;  5HXS A;  3U3I A;  3ESL A;  4AKL A;  4HWC A;  3RYH E;  3ZLI A;  2D0U A;  4U72 A;  1XWM A;  5E0O A;  3UT5 E;  2VQE T;  3OJA A;  3UU4 A;  1ZKE A;  5CA1 E;  1HX8 A;  2A9U A;  2LT3 A;  1NWM X;  4AI6 A;  2E9X A;  3AE7 A;  3SS1 A;  4K0U A;  5FL1 A;  1HG2 A;  5FL0 A;  1MIW A;  3FBZ A;  5HEO A;  4HFD A;  2XQ4 A;  4CQI A;  2FJA A;  5JRE A;  2M6B A;  1IBM T;  3G06 A;  2X9H A;  3CQG B;  1ZOY A;  4TZ4 C;  2XQ8 A;  3PE0 A;  3HI2 A;  4LF7 T;  3P4S A;  4CN6 A;  5JDQ A;  1YKE B;  3TLS A;  3VR9 A;  2NW9 A;  3KBU A;  3X1D A;  4MHC A;  1IBL T;  3AVR A;  3F2E A;  2LM2 A;  3F57 A;  4Z8X A;  4ISS A;  4U2Y A;  3VU7 H;  3RC8 A;  2XAG B;  3UU8 A;  1SA0 E;  2CCQ A;  4HKA A;  2XQ9 A;  1LVF A;  4QWN B;  1FMW A;  5DJQ C;  2V6Y A;  3BQI A;  2BG9 A;  3MXZ A;  2ODU A;  1OED B;  1MIY A;  5L3F B;  2H88 A;  4FI5 A;  4UEM A;  1MNE A;  1KEY A;  5JR9 B;  2JMH A;  3ETU A;  3N9N A;  4ZXL A;  3E22 E;  2KND A;  4N78 D;  2G0U A;  1JNZ A;  3WAJ A;  2ACX A;  5CJ5 A; 
#chains in the Genus database with same CATH homology
 3RRW A;  2VWA A;  3NRX A;  3PUR A;  5JDN A;  4I4T E;  4PW8 A;  5LJM A;  2L3L A;  3C50 A;  3CX8 B;  2HPL A;  4O4I E;  3UUN A;  4MAL A;  3RX6 A;  3RC3 A;  3HL6 A;  3IHR A;  4GK0 E;  3J7Y q;  4IE4 A;  5F8P A;  3FBL A;  5FY7 A;  1SHZ C;  4O4L E;  4PAG A;  1CUN A;  4WNK A;  4BA9 A;  2BVL A;  4IE0 A;  2LOP A;  2D0T A;  3RH3 A;  1LVK A;  2CEA A;  5LBQ B;  4ADZ A;  4TN7 B;  3I1A A;  2PG8 A;  4X20 E;  4TV9 E;  3UFE A;  4AKI A;  5BMV E;  3HA4 A;  3HKE E;  4QXH B;  4UVA B;  3KV4 A;  1Z0P A;  3NBX X;  4H9S E;  4ZS2 A;  5LBM A;  2X9Y A;  5JR9 C;  2NOX A;  2Q9Q A;  2RA1 A;  4TUY E;  5FXV A;  3M65 A;  1US7 B;  3ZCJ A;  4AXP A;  1HF8 A;  3NRY A;  2JMK A;  2LSJ A;  5J2U E;  1WYB A;  4EOZ B;  2C5I T;  2PFV A;  5HWY A;  3ZN0 B;  3UUL A;  3LG7 A;  3RKO A;  2Q9Q B;  5L3C B;  5LHI B;  3PDY A;  4YFS A;  2Y6X A;  4CXW A;  4QX8 B;  3CQC B;  5LGN B;  5FYM A;  3MZK B;  3KV6 A;  3ZC1 A;  5DQV A;  2B1E A;  3UUM A;  3EUH A;  3VHL A;  2WMO A;  3IEE A;  3ZYL A;  4CXX A;  2W00 A;  4H63 H;  5JDH A;  4O4J E;  1YD8 G;  2D2S A;  5M4Y A;  2LEH A;  2VKD A;  2PBI A;  1MIV A;  4P0B A;  2LJL A;  4DVD A;  4ZS3 A;  2KIN B;  3OYX A;  3Q2M A;  3JC6 D;  4OYJ A;  4QHO A;  5JVD E;  1UCU A;  4UF0 A;  1QUU A;  4KUM B;  5HXC A;  2E8I A;  2ZM8 A;  4UXN B;  4CI3 B;  3GMI A;  3PU8 A;  4U74 A;  4YLH A;  3AA6 B;  2NW7 A;  5HXR A;  2BDE A;  3ETV A;  3ZJ2 A;  2NP9 A;  2Y48 B;  3L09 A;  2NTX A;  3B57 A;  4JUY A;  2JPF A;  5HYA A;  2LHR A;  4UF0 B;  4ASK A;  4F6R C;  1MND A;  4PK4 A;  2CA5 A;  2NTY A;  5JDG A;  3HR0 A;  4O8S A;  4J2C A;  3WI3 A;  2NWB A;  1UX4 A;  2X0L B;  3Q5X A;  5DAB A;  2V7L A;  3AA7 B;  3T8O A;  1BR0 A;  4DBQ A;  2WBL A;  1FEW A;  3CX7 B;  4HTE A;  5LHH B;  1NAF A;  2C5K T;  3PU3 A;  4HEA A;  4MFR A;  1X79 A;  3RYI E;  3PUA A;  2YU2 A;  3AA1 B;  2GK9 A;  2EHO A;  2YK0 A;  4JEU B;  4DND A;  3CPZ A;  2W61 A;  2MTQ A;  2RP4 A;  3K3Q C;  4I50 E;  3KBT A;  4TX5 A;  3IF8 B;  3N5L A;  2W0G A;  1B7T A;  4BJN A;  4DMV A;  1D0Y A;  2DI4 A;  4CI1 B;  1D0Z A;  1U4Q A;  3S4U A;  2EHO B;  3L3P A;  2KZ7 B;  1ZEE A;  3LJC A;  2E9X D;  2ZM0 A;  1HS7 A;  4PNI A;  3R84 B;  2CWY A;  3LK3 B;  3C4W A;  4L5G A;  2MYS A;  1HG5 A;  2N9D A;  3GWH A;  2CLY B;  2V1D B;  3K3O A;  3CKD A;  4V1A v;  2VKO A;  3AAA B;  4O2B E;  4AQF A;  4EYY R;  2CM0 A;  4DO0 A;  2CXD A;  1O3X A;  2DCF A;  4ANJ A;  3MJX A;  2W63 A;  2H3R A;  5L3B B;  5J2T E;  1KK7 A;  3HKD E;  3GN5 A;  1Y64 B;  5ADX L;  4IST A;  2DWK A;  1S94 A;  2WWU A;  1ZHC A;  4XZC A;  4ZI7 E;  3OYZ A;  3MKD A;  3CWZ B;  3N2O A;  2DLR A;  2K9A A;  2QA7 A;  2ZLY A;  3N9Q A;  3CX6 B;  2IW5 B;  2X9W A;  3RRC A;  3GN5 B;  3O1I A;  3VKG A;  3N2G E;  2V26 A;  3E08 A;  2LHN A;  4P09 A;  3RYF E;  4H9P C;  1G8X A;  4UIG A;  2XAH B;  5LXT E;  3SWH A;  2KXP B;  1MMA A;  4O4H E;  5A1L A;  5JDM A;  4GOU A;  3ZMV B;  3O1H A;  2CMR A;  2WAU A;  3QK6 A;  3DJB A;  4OYK A;  5LG4 A;  4BAY B;  1AJ3 A;  5GON E;  2IC6 A;  3ONX A;  4HN9 A;  4IDZ A;  1MMN A;  4I43 B;  5LHG B;  1IZN B;  3R6N A;  3C64 A;  1OXZ A;  4FJO A;  4KP3 C;  2ZM2 A;  5FXX A;  2UXN B;  2HPJ A;  4OK0 A;  4EIW A;  4YJ2 E;  4IE5 A;  2CLY C;  1LKX A;  3O4X E;  2KT9 A;  1BR1 A;  3RYC E;  4AKH A;  1V9D A;  4MBQ A;  3O9X A;  3KV9 A;  2OA5 A;  3TKL B;  3AA0 B;  3E0Z A;  4JLE A;  2ODV A;  4NUV A;  3KDS E;  3ZN1 B;  5CB4 E;  4BJM A;  4DMW A;  2IAK A;  4A56 A;  2I59 A;  2YIN A;  5IHY A;  5LYJ E;  3BK9 A;  5LCY A;  5L3D B;  2A3D A;  2YEV C;  4CXY A;  4QX7 B;  3EDV A;  3DTO A;  1D1B A;  5ETW A;  5FY1 A;  2K48 A;  2XAQ B;  2XUE A;  5IYZ E;  1HTJ F;  3HKC E;  5JQG E;  2LSY A;  2BZB A;  3P8C D;  3OBV E;  4UEL A;  3PUQ A;  3KVA A;  2YU1 A;  4EXT A;  1WYC A;  3F31 A;  4ZI3 C;  4QKN A;  4H9R C;  3GA8 A;  1D1C A;  5LGT B;  3W15 B;  4B6X A;  2X51 A;  3KVB A;  4HGA A;  3N9M A;  4PJL A;  2VKH A;  3B13 A;  3C4X A;  3U78 A;  4WBN E;  1OWA A;  3ZPO A;  4GYS A;  5KDM C;  2A2F X;  2V7I A;  4H9N C;  2K24 A;  2KWI B;  4EZ4 A;  4IIJ E;  2M67 A;  5FNV E;  2IC9 A;  5FP3 A;  4YHJ A;  3N9P A;  4YJ3 E;  5L3G B;  4ERR A;  4UV8 B;  3ANW A;  4GYR A;  4QXC B;  3SOL A;  3ZYM A;  3AAI A;  4AQG A;  4EB6 E;  5KX5 E;  4I55 E;  4PFO A;  2Q9Q C;  2KMF A;  3H37 A;  4ZOL E;  1VOM A;  4CI2 B;  3I9W A;  1T98 A;  2ES0 A;  4UVC B;  2VB6 A;  4L0R A;  2K5B B;  3ANW B;  3WAK A;  5HXE A;  4EZH A;  4HFV A;  5FY0 A;  3ZMU B;  5EZY E;  5J1G A;  4L9I A;  5AFU L;  1YW0 A;  4GIW A;  1WLX A;  3OKQ A;  2J1D G;  3FXD B;  3C51 A;  4M1P A;  1WRD A;  2VAS A;  5LGU B;  2Z6E A;  3ZYK A;  5EK2 A;  4UVB B;  2JJ9 A;  5EK4 A;  3NZP A;  3H3A A;  1BR4 A;  3C4Z A;  3KIN B;  5HWX A;  5TAO A;  1U5P A;  2Q9Q D;  2QGS A;  1HFA A;  3SRZ A;  4KMC A;  2XAF B;  4H63 V;  5KMG P;  1S35 A;  2WSS V;  2MBG A;  3AVS A;  1MMD A;  3ZMT B;  3DP7 A;  1ZV4 X;  3MK7 C;  2VL8 A;  5HXS A;  3BQK A;  3U3I A;  3K3N A;  3ESL A;  5JDF A;  4AKL A;  5HAX A;  3RYH E;  2W62 A;  4WBO A;  3NZQ A;  3ZLI A;  2XAJ B;  2D0U A;  3FB2 A;  1G73 A;  4U72 A;  2P9B A;  5E0O A;  4E7S A;  3VKH A;  3UT5 E;  3N9L A;  2CE7 A;  3OJA A;  4C91 A;  3K8P C;  5JH7 E;  2HH7 A;  3RPU A;  3KV5 A;  1LRZ A;  2XAS B;  2L8K A;  4G63 A;  1ZKE A;  5CA1 E;  4PJJ A;  1HX8 A;  2WMN A;  1IJ5 A;  1IAP A;  2X9X A;  2MOZ A;  2UXX B;  5DQW A;  2C5J A;  2LT3 A;  4OHF A;  1D1A A;  4NUU A;  1NWM X;  1EZ3 A;  2EHO C;  4O2A E;  3ZMZ B;  4X1Y E;  4AI6 A;  4XAX B;  2V7M A;  2E9X A;  3FHN A;  4PK6 A;  3CML A;  2LSI A;  3SS1 A;  2LSG A;  4K0U A;  5HXH A;  2CWO A;  3PTR B;  4JEH B;  1HG2 A;  4ILU A;  5LOV E;  3A5X A;  2D5U A;  3EVY A;  2L9Q A;  4IE7 A;  4X1K E;  1MIW A;  3FBZ A;  2NW8 A;  2C0S A;  4CZZ B;  3EDU A;  4PFP A;  2E9X B;  5LA6 E;  3QC9 A;  4AKG A;  4CQI A;  3CQX C;  3LK4 2;  4IE6 A;  3JC6 C;  5JRE A;  2VK9 A;  4AQF C;  5LNK A;  2JRK A;  4PK5 A;  3UTK A;  3AAE B;  3MAC A;  2X9H A;  2DNX A;  5EK3 A;  1E1H B;  3LBX A;  2DHR A;  3CQG B;  4WW0 A;  2H7V C;  3I0O A;  4OFZ A;  4MLK A;  3ZJ1 A;  2EHO D;  4TZ4 C;  1FMV A;  3PUS A;  2XHE B;  3PE0 A;  3V5U A;  3HI2 A;  2JQQ A;  2ZMA A;  4E7Z A;  5JDQ A;  5H6R B;  3LBX B;  1YKE B;  5JRC A;  2LE8 A;  4P0A A;  3Q5W A;  3LFM A;  5L2L A;  2BVM A;  2WM9 A;  3N9O A;  3FXE B;  2NW9 A;  1UX5 A;  1IJ6 A;  3CVR A;  3KBU A;  5L3E B;  1HCI A;  4MHC A;  5FXZ A;  1H7C A;  3AVR A;  2N2N A;  3N2K E;  3F2E A;  3F57 A;  4Z8X A;  5JRC B;  4GK5 E;  4ISS A;  3ZMS B;  3VU7 H;  4HE8 A;  5JDL A;  3RC8 A;  4KBM B;  2XAG B;  3I0Q A;  4ZI2 C;  1SA0 E;  3BQL A;  2CCQ A;  2VKJ A;  3LK2 B;  2X66 A;  2V7J A;  2DWG A;  2SPC A;  1WR6 A;  4ZI3 D;  2LM9 A;  2E9X C;  1VRB A;  2KLQ A;  3I9Y A;  1YKH B;  2V7K A;  4HKA A;  5LJN A;  1LVF A;  4H9O C;  1D0X A;  4C90 A;  4QWN B;  1KNZ A;  4IHJ E;  5FXW A;  1FMW A;  1QSD A;  3BQI A;  5DJQ C;  5LP6 E;  3V5S A;  3P7I A;  4AKR B;  3KFW X;  5CA0 E;  3MXZ A;  5JR9 A;  3IBP A;  4EAH A;  2Y8D A;  2ODU A;  1MMG A;  5H6Q B;  4UV9 B;  4H9Q C;  1MIY A;  4TV8 E;  2A72 A;  4PJN A;  4DBR A;  4IGU A;  5L3F B;  2X68 A;  4FI5 A;  4EYU A;  3D0T A;  3ZEF B;  4UEM A;  5FMN A;  3ZC0 A;  3O1J A;  3MA9 A;  1MNE A;  4QXB B;  4ZI2 D;  5JR9 B;  2JMH A;  3PUG A;  2LOS A;  4G2A A;  3QUJ A;  3ZCI A;  3ETU A;  2N1G A;  2PJQ A;  2H7O A;  3N9N A;  2LSK A;  1FIO A;  2CXL A;  5F3J A;  3E22 E;  2KWH A;  4X1I E;  2KND A;  4XBF B;  4N78 D;  3HKB E;  2CXF A;  3UUX B;  4ZHQ E;  3AB3 B;  2G0U A;  1BR2 A;  2X67 A;  2XTL A;  3Q9D A;  3J9X 1;  5C8Y E;  3WAJ A;  2ACX A;  3C98 B;  2XQY A;  4PJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...