3ZCIA

Crystal structure of helicobacter pylori t4ss protein cagl in a cubic crystal form with a distorted helical conformation of the rgd-motif
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
212
structure length
191
Chain Sequence
GAMEDITSGLKQLDSTYQETNQQVLKNLDEIFSEMGEEDALNIATAAIALRGDLALLKANFEANELFFISEDVIFKTYMSSPELLLTYMKINSDKVLVLYCEGKLKIEATAQNIRERLETSLKAYQSNIGGTASLITASQTLVESLKNKNFIKGIRKLMLAHNKVFLNYLEELDALERSLEQSKRQYLQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAG PATHOGENICITY ISLAND PROTEIN (CAG18)
publication title A Helical Rgd Motif Promoting Cell Adhesion: Crystal Structures of the Helicobacter Pylori Type Iv Secretion System Pilus Protein Cagl
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Protein binding
total genus 90
structure length 191
sequence length 212
ec nomenclature
pdb deposition date 2012-11-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1660 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3zciA00
3ZCJA 3ZCIA
chains in the Genus database with same CATH superfamily
2XAFB 4HFVA 4Z90A 5LB7B 3RX6A 4O4IE 4ZEYA 4H9NC 4MALA 3ETVA 1WR6A 5JRCB 3HI2A 1HG2A 2XSAA 5HCMA 3AXJB 1CHUA 2JMHA 4LFBT 4QX8B 2XQAA 1NWMX 3ZMZB 2V5DA 4H9OC 1D1AA 3RQWA 1QUUA 2NTYA 1VCTA 5AFUL 1G73A 3GA8A 2X9XA 2A9UA 5J0ZA 2UXNB 3E08A 2RA1A 1CUNA 1N36T 3EDVA 2CA5A 2XZEA 4GK0E 1XWMA 5LBQB 3AEAA 4GIWA 2XQ6A 3U3IA 3UQ4A 3UU4A 3U78A 3W15B 4U74A 5DQVA 2VKOA 4OYJA 1SE7A 4JV5T 2HH7A 4ZS3A 3ETUA 3ABVA 2HN1A 3FZLB 5FL1A 1S35A 1SA0E 3OBVE 2GK9A 3ONXA 3VR8A 2CXLA 2XJ7A 3SWHA 2NW7A 4DR7T 3P4PA 4DV4T 3NRYA 4LMJA 3RH3A 1YKHB 1NEKA 3AEGA 2JQQA 3CMLA 3GN5A 1Z0PA 3P4WA 2H3RA 2KSRA 3I1AA 3I9WA 2SPCA 1FMWA 3ESLA 3JAFA 1IAPA 2WWVA 3AAAB 1UK5A 1MIWA 3AVSA 1WYBA 3CK6A 2W66A 3EAMA 2ZLYA 2V6XA 3C64A 4AKHA 1UGOA 2ACZA 5F8PA 5H6RB 1ZV4X 2FJDA 2NW9A 2HPLA 2E9XB 3HKEE 2PG8A 3GMIA 4AISA 2UU9T 5HWXA 1WYCA 3IBPA 1KNPA 1FJGT 2XPKA 4DV0T 2N1GA 4I43B 2XUEA 3AE6A 3KVAA 4CXWA 3FXEB 3CQCB 2WU5A 1VCSA 4IE5A 2E2AA 4HFDA 2IUBA 2V8SV 2C5JA 2MYSA 2H7VC 4ILAA 4MHCA 3I9YA 2RPAA 2LHNA 2MPKA 4YXDA 5KMGP 3UUBA 4WNKA 2P9BA 4PFPA 4J2CA 3LDQB 2YDSA 1KK7A 3AE4A 2WMNA 3PUQA 3IF8B 5FVLA 4TWFA 5EK2A 3LG7A 3C4WA 4K0KT 3IA3A 4DNDA 3RPUA 5FY7A 1UX4A 4PK6A 4IDZA 4EAHA 5AQLB 1YD8G 4AI6A 1M7KA 2J47A 5JVDE 2V7KA 2VURA 4ANJA 2YKSA 4QH1A 1HFAA 2E9XC 4PW8A 5FVKA 2V6YB 4A5XA 2ACXA 4NXMT 2Q9QA 3UUMA 4E7SA 2VASA 4YHHT 2HPJA 3X1DA 3CX6B 4MFRA 3FZHB 2ZM0A 1UURA 1V9DA 2I6HA 2CWOA 3RHWA 2K48A 2XSBA 3TLVA 1R8IA 5FXZA 1D0YA 2D2SA 3MK7C 1YQ4A 3FHNA 3ONLC 3B5MA 2X0HA 3TLUA 4M1PA 4L5GA 5L4HA 1D1BA 5LHHB 2W4XA 4GOUA 5FYMA 4DVDA 4X62T 5L3CB 4O4HE 4O2BE 2KXPB 1IBMT 2QA7A 2ZM8A 2LE8A 5HEUA 1FEWA 2BKNA 1IJ5A 3HKBE 3TLWA 3M65A 4KUMB 2KINB 4NUVA 2HN2A 3MJXA 1LVFA 2UUBT 2X66A 1ZOYA 2JJ9A 3F2EA 4TWHA 3JCFA 2LT3A 3VKGA 4TNVA 2UXXB 1KNRA 1Z8UA 2ODUA 3ZC1A 4HFBA 4ISSA 3DTOA 4DV6T 2OV9A 5F3JA 3RF1A 1H7CA 3LSVA 4YT0A 1LKXA 3ZCIA 3RI5A 2CLYB 2CMRA 2WDQA 3UUXB 4FJOA 2CE7A 3AECA 5FNVE 1XMOT 4TZ4C 2KLQA 2FJBA 4L0RA 4IE6A 1B7TA 2CCQA 3VRAA 3LBXB 5TAOA 2W0GA 3V5SA 2YINA 2FUPA 3C50A 2LOPA 5AQVB 4AKGA 2FJEA 3RIUA 3SS1A 3GWHA 4IDPA 2CXFA 2BG9B 3VR9A 2H88A 4DUYT 3KV4A 5AQNB 2LLYA 3KBUA 3L39A 3ZMUB 4TN7B 3DJBA 1XZYA 4BJMA 3A7MA 4DV7T 5JDGA 3ZMSB 5CA1E 3LK3B 2YDQA 2YOEA 2XQYA 3HKCE 3AE7A 2PJQA 4B3TT 4XAXB 2C0SA 3J7Yq 2JPFA 4HFIA 3PUYF 4ASKA 3N9OA 5GONE 4ILBA 1M62A 2LRKA 2UXBT 2NR4A 2E5LT 5AQMB 1D0XA 2JMKA 3P50A 3JC6D 4TV9E 1N32T 3AAEB 2BS2A 1HNZT 4HEAA 5IUXA 4LF5T 5C8YE 2YU1A 2XAQB 2CLYC 3RYHE 4X1YE 5L3DB 1U4QA 2IAKA 3CKDA 4TNWA 3ANWA 3TLSA 4AKIA 4I50E 3CPZA 4TWDA 2VVNA 4QHOA 4YSXA 1N33T 2VK9A 4KP3C 4JI8T 1U5PA 5AQOB 2X9YA 4H63V 2LKHA 3D0TA 2LM2A 4N78D 2IIUA 2XQ9A 2NW8A 3HR0A 2BG9C 4OHFA 3KV5A 3GN5B 4CI1B 2ES0A 2DLRA 1W0AA 4IREA 3ONJA 3SRZA 3FZFB 3C4XA 4AXPA 1DU2A 3PUWF 2DCFA 4IE0A 4LMKA 5LA6E 5HXHA 3G06A 2CBIA 2DWGA 2DHRA 2LKGA 4YTNA 1XDOA 2D5UA 3KBTA 4H9RC 2LSYA 4QXHB 3ZCJA 5KXJA 1YKEB 3S4UA 4EZHA 4AIUA 2WS3A 5JDLA 5HXCA 3O4XE 4HTEA 4OYKA 5HCJA 4DV5T 3T8OA 1IBLT 3AEEA 3H3MA 4ILUA 3R84B 3OJAA 5L47A 5JDFA 2DWKA 2YDRA 4ZI3C 2XAJB 1MMAA 2E5VA 4LF7T 1Y01A 4BAYB 2XASB 4CXYA 4Z91A 4EYUA 4YTMA 2ZMAA 1J5ET 1SHZC 3AE5A 2CWYA 3RRCA 3V5UA 2YU2A 5AQJB 5LG4A 4HWIB 4EV6A 1SUMB 2X67A 2EHOA 4HWHA 4ZZBA 3UU8A 4DR6T 2BKPA 4O2AE 3WI3A 5J2UE 2ODVA 5L3BB 4UR9A 5LGNB 4IIJE 3AXJA 4LF4T 3Q9DA 4JLEA 1JNZA 3ZYKA 4G2AA 1BR2A 2I59A 1FIOA 3AA0B 1LVKA 4A56A 5CFBA 2YEVC 2LSIA 4EGWA 2M6IA 5JDHA 3PU3A 1ZEEA 3RYIE 2Q9QB 4DMVA 5LXTE 1WRDA 4IE7A 3CVRA 1BR1A 3ZJ2A 5BMVE 3RIAA 1UUSA 2PFVA 3ZN1B 3ZYMA 2JQKA 2K5BB 3MKDA 2JRKA 2VKHA 5A1LA 3PTRB 4JEHB 4P1NA 5AQKB 4U2YA 3UTKA 2MTQA 3ZMTB 4KI0F 3E0ZA 4NXNT 2KMFA 3MA9A 2RP4A 3RQUA 4Z8XA 1KFYA 5AQPB 4DO0A 3KDSE 4YTPA 2LEHA 3NBXX 5LNKA 5E0OA 2JQ9A 2E8IA 4WBOA 4PFOA 4JI1T 2CPTA 3N5LA 4U33A 3ZJ1A 2VL0A 1S94A 5HEJA 2NOXA 2KWIB 3J9X1 2BS4A 2KZ7B 2WBLA 4LF9T 3ZPOA 3AAIA 2VQFT 2WDVA 4QXBB 2YN6A 5DJQC 4BJNA 4DR4T 1MIYA 3HA4A 4UV9B 2Q9QC 1XNRT 2VB6A 3BQIA 4HKAA 2EHOD 4UV8B 3LFMA 4JI0T 2K24A 4PJLA 2WWUA 2WU2A 1W0BA 4QH4A 5HEGA 4ZI2C 4JYAT 4H9SE 3NKZA 3VU7H 2I0MA 2BVLA 4I0UA 4QXCB 5AQTB 2IHR1 3B57A 3P7IA 2WQYA 4F6RC 3ZSTA 2VKDA 3AE8A 1KEYA 2K3WA 5JDQA 2C5IT 2LJLA 3ZT5A 3O1JA 2NP9A 2XQ7A 3PE0A 4EXTA 1BR4A 4DR1T 4MBQA 3IEEA 2V7IA 4O4JE 4TUYE 1BR0A 2XQ8A 3EVYA 2X68A 2UUCT 4AQFA 5KX5E 3PUAA 3QB5A 5AQUB 5FXVA 4ZXLA 2OLTA 3KVBA 4X1IE 5EK3A 1OEDA 4UIGA 4JBWF 1IJ6A 4PK4A 4EB6E 2L8KA 3Q5XA 3L09A 5ETWA 4QWNB 1HTJF 5DQWA 3WAJA 3F57A 3Q5EA 5ABEA 5CGMA 4ISTA 2LSGA 3N2GE 1OWAA 2ZM2A 4AKLA 4ZS2A 2DNXA 4QX7B 2D0TA 4DV3T 3ANWB 2A2FX 1NENA 1HS7A 3MXZA 2XAGB 2XY8B 4WYVA 1IZNB 4DR5T 4JUYA 3NZQA 4IT4A 4IE4A 3CIRA 2W2UA 1WR0A 5JH7E 2Y48B 4U31A 5FXWA 3C98B 5CA0E 5ABFA 1HX1B 2LRLA 2E9XD 4UF0A 3OPCA 3RIUC 4YHJA 1O3XA 2X9WA 3O1IA 1J1JA 2WM9A 2MBGA 4AKRB 2X0YA 3K3NA 3PUZF 4X5TA 2WAUA 4KBMB 4JI5T 3SFDA 1L0VA 5LGUB 3HL6A 3C4ZA 3ZEFB 4DR3T 3L3PA 4H63H 4JI2T 2G0UA 3UU3A 5FY0A 4U2ZA 2VKJA 2W61A 3PJAJ 1UX5A 1VRBA 2CHNA 4DMWA 2DL1A 4NUUA 2IMLA 5JREA 1E2AA 3K8PC 4ILCA 2HHHT 2V7MA 2V26A 3UULA 4TV8E 4HWFA 4DIDB 1HF8A 4CZZB 4UEMA 5FL0A 4C90A 2A72A 3LBXA 5JR9A 3HKDE 5ADXL 2VQET 2J1DG 3UFGA 1XMQT 4QH5A 1W09A 3H37A 4U3CA 3RRWA 2VWAA 3PV0F 4OX9T 5J2TE 4C91A 4G63A 2CRBA 3EABA 2H7OA 4KMCA 1XDPA 2LOSA 5F5WA 3UUNA 1WLXA 4B3RT 4HGAA 4HWDA 3Q2MA 4UVBB 1N34T 3TKLB 3I0OA 2IC9A 1D1CA 4E7ZA 2Z6EA 2QYWA 2XM1A 3P4QA 4JI6T 5CB4E 4B3MT 2UXCT 5LYJE 2DI4A 2EHOB 1EZ3A 4CN4A 3AA7B 3RC3A 4LFCT 4CN6A 2MOZA 4EEDA 5HEOA 3K1SA 1ZHCA 2R6GF 4COFA 5ABGA 4DBQA 4KHPT 4X66T 3UFEA 1W9RA 4JEUB 4B6XA 3ZT7A 1MMDA 2Y6XA 3AE9A 4TX5A 5LBMA 3KV6A 1HNXT 4UVAB 5JTGA 3AEDA 4AQGA 4A98A 2M6BA 3SOLA 2WZIA 3PU8A 5FY1A 5M4YA 3NWIA 2ZM6T 3JAEA 1I6ZA 4K0UA 4XBFB 4PNIA 2WZHA 4F8HA 5AQGB 4CI3B 1US7B 3FB2A 3RKGA 4LMLA 4PJMA 3NZPA 1G8XA 3P8CD 3H3AA 4WW0A 4ZZCA 1KNZA 4HFHA 2QVAA 2W67A 2CBJA 3AE2A 5LJMA 3ZLIA 5JQGE 1I94T 5LGTB 1AJ3A 2J62A 1J5WA 5LHGB 4IL9A 4P09A 2PBIA 3QC9A 2UXDT 2W62A 2V5CA 5AQFB 3N9LA 5FP3A 3N2KE 2J4GA 3K3OA 3R6NA 5LCYA 1X79A 4X65T 1T72A 2FBWA 1KF6A 1HNWT 1E1HB 2Y8DA 4UELA 5JRCA 1MMGA 1ZP0A 3ZC0A 4DBRA 2CEAA 2M67A 2LHRA 2WB5A 2EHOC 4CXXA 5L3GB 2XTLA 4GYSA 1T98A 4IDQA 5KDMC 2W63A 3I0QA 3RLFF 4I55E 2VVSA 5AQRB 2XQ4A 3N9PA 2BDEA 2L9QA 3RIFA 4EYYR 4HFEA 4YSZA 2WMOA 5EZYE 1NAFA 3OKQA 4PJJA 4HE8A 2IDOB 4GKKT 1HG5A 4O8SA 2WSSV 4V1Av 2IW5B 4IHJE 3MZKB 4NIQA 3UU6A 2BBHA 3UU5A 2A3DA 2NWBA 2XAHB 2XQ3A 5LOVE 1OEDE 3N9MA 5BR8T 2H89A 3FZMB 4JI7T 3AEFA 3ZSSA 5IYZE 1YW0A 4A97A 2XHEB 4CQIA 4HN9A 4UVCB 4DR2T 4GKJT 4L9IA 3AEBA 3CQXC 1HCIA 1E7PA 3Q5WA 3OVUA 4H9PC 3AE1A 3CX7B 3FBLA 3O9XA 2CHOA 3QUJA 1Y64B 3RYFE 4LF6T 1MNEA 3LJCA 3T1HT 2B1EA 2E9XA 5LG3A 2V7JA 3SFEA 3FBZA 4ZI3D 2X51A 5FMNA 4JI4T 3BQKA 2PTFA 5AQQB 2KT9A 3Q5DA 4WZXA 3PDYA 2YK0A 3VHLA 1OEDB 3LK42 1VOMA 3NRXA 4GK5E 2LM9A 4LF8T 4KX6A 2CXDA 1T7SA 2CM0A 5DABA 5AQSB 2XQ5A 3QOFA 3ZMVB 4ZHQE 4NPPA 5C3JA 5LP6E 3BK9A 3PUXF 1T8BA 1OXZA 3AE3A 2JQHA 2BBJA 3EI0A 4KHZF 1IBKT 2WDRA 1HR0T 4HFCA 5C2TA 5FKYA 5HWYA 2W00A 3VKHA 5L3EB 2F4VT 4IDOA 4PK5A 5HXEA 2QGSA 3EHZA 3BQLA 3QB5K 2NTXA 3JC6C 3IHRA 1QLBA 5HEHA 5ABFB 4UF0B 3OYZA 2LSKA 4DUZT 3O1HA 3A5XA 4EIWA 2D0UA 3RYCE 4DV1T 4MLKA 4OK0A 3P4SA 5JDNA 1JNRA 3KFWX 2OA5A 4BA9A 4YJ3E 5IWAT 5LMNT 4PJNA 5HAXA 1WFDA 3ZYLA 4Q25A 4HWCA 2V6YA 2JIWA 3EDUA 4AQFC 2BG9E 1FMVA 3WAKA 2BZBA 3AB3B 3UT5E 2K9AA 5LMUT 2VL8A 4CI2B 1MMNA 3NVOA 3RGLA 3VRBA 1OEDC 3B13A 4U72A 4O4LE 5AQHB 4ZI7E 3QNUA 4EZ4A 4IL4A 5IHYA 3C51A 4EOZB 2V7LA 4DV2T 2D9DA 3RC8A 2B76A 3K3QC 2UUAT 3KV9A 4U7IA 1ZKEA 3FXDB 3TLTA 4QKNA 4X20E 5JR9B 2N9DA 3LK2B 3PUSA 4LFAT 3L8RA 2KNDA 2V1DB 5HXRA 3OYXA 5J1GA 3KINB 2BVMA 5L4EA 3ZN0B 3M3ZB 2BKOA 4AQYT 3PURA 3E22E 1UCUA 3P4RA 5JDMA 3A8YC 3OTOT 2WY2A 4YY3T 4I4TE 5HYAA 4P0BA 3F31A 4H9QC 2LSJA 4GYRA 3MACA 4ADZA 4YFSA 1D0ZA 3AA1B 2Q9QD 2WP9A 3UQ7A 3CWZB 1LRZA 3N2OA 4ERRA 4U7YA 4X64T 3N9NA 1YQ3A 4PAGA 4OFZA 3QK6A 4XZCA 2C5KT 2MAWA 2XM2A 5H6QB 4ZI2D 1MNDA 3CQGB 5AQIB 3AVRA 3AA6B 1HX8A 4UXNB 5L2LA 4B3ST 2N2NA 4EEBA 4JI3T 5L3FB 4IGUA 5HXSA 1MIVA 4P0AA 3EUHA 2FJAA 5LHIB 2WCAA 3JADA 1YXRA 3CX8B 3RKOA 2L3LA 4YSYA 1GQEA 1X9BA 3N9QA 4FI5A 1XNQT 2KWHA 3FZKB 1WCRA 2IC6A 3T1YT 3PUVF 1QSDA 5ABHA 2BS3A 2BG9A 5JR9C 2QRXA 3PUGA 3DP7A 4WBNE 2X9HA 4YJ2E 3ZT6A 4X1KE 2AXDS 4IDNA 4CN1A 2AE9A 5FXXA 3PJAA 2X0LB 5LJNA 5EK4A 4ZOLE 5CJ5A 3ZKRA 4YLHA
chains in the Genus database with same CATH topology
4I55E 2XAFB 4HFVA 2Q9QC 3KV4A 2VB6A 3BQIA 4HKAA 3RX6A 4O4IE 4H9NC 3N9PA 2EHOD 2BDEA 2L9QA 3ETVA 4MALA 1WR6A 4UV8B 5JRCB 3LFMA 2K24A 4PJLA 3HI2A 2WWUA 1HG2A 3KBUA 4EYYR 3ZMUB 4TN7B 3DJBA 2WMOA 5EZYE 1NAFA 2JMHA 4BJMA 4QX8B 5JDGA 3OKQA 4PJJA 4ZI2C 3ZMSB 1NWMX 4HE8A 3ZMZB 4H9OC 5CA1E 1D1AA 4H9SE 1HG5A 1QUUA 4O8SA 3VU7H 2WSSV 2BVLA 2NTYA 3LK3B 4QXCB 5AFUL 1G73A 2XQYA 4V1Av 3HKCE 3GA8A 2PJQA 2X9XA 2IW5B 2UXNB 2C0SA 4IHJE 3MZKB 4XAXB 3B57A 2RA1A 3E08A 3J7Yq 3P7IA 2JPFA 1CUNA 4F6RC 2VKDA 4ASKA 3EDVA 2CA5A 4GK0E 5LBQB 5JDQA 3N9OA 4GIWA 2A3DA 2C5IT 2LJLA 2NWBA 2XAHB 2NP9A 3O1JA 3U3IA 5GONE 5LOVE 3PE0A 4EXTA 1BR4A 4MBQA 3U78A 3N9MA 3IEEA 3W15B 2V7IA 1D0XA 2JMKA 4U74A 5DQVA 2VKOA 4OYJA 5IYZE 4O4JE 2HH7A 3JC6D 4TUYE 4TV9E 1BR0A 1YW0A 4ZS3A 3EVYA 2X68A 3AAEB 3ETUA 4HEAA 2XHEB 4CQIA 4AQFA 5KX5E 3PUAA 5FXVA 1S35A 4HN9A 4UVCB 5C8YE 1SA0E 2YU1A 3OBVE 2XAQB 2CLYC 4L9IA 3RYHE 4X1YE 2GK9A 3KVBA 3CQXC 2CXLA 1HCIA 3ONXA 4X1IE 3SWHA 5L3DB 1U4QA 2IAKA 3Q5WA 5EK3A 3CKDA 2NW7A 4H9PC 4UIGA 3ANWA 3NRYA 1IJ6A 4PK4A 3RH3A 4EB6E 2L8KA 1YKHB 3CX7B 3Q5XA 3FBLA 4AKIA 3L09A 5ETWA 4I50E 4QWNB 3O9XA 3QUJA 1Y64B 3CPZA 4QHOA 3RYFE 1HTJF 2VK9A 5DQWA 2JQQA 3WAJA 3F57A 3CMLA 3GN5A 1Z0PA 1MNEA 3LJCA 4ISTA 2B1EA 2E9XA 2H3RA 4KP3C 2LSGA 2V7JA 3I1AA 2SPCA 3I9WA 1U5PA 3FBZA 1FMWA 3N2GE 4ZI3D 2X51A 3ESLA 1OWAA 5FMNA 1IAPA 2ZM2A 3BQKA 3AAAB 2X9YA 1MIWA 2KT9A 4AKLA 4H63V 4ZS2A 3AVSA 2DNXA 1WYBA 3PDYA 3D0TA 4QX7B 2D0TA 2YK0A 3VHLA 3LK42 3ANWB 2A2FX 2ZLYA 1VOMA 3NRXA 4N78D 4GK5E 3MXZA 2XAGB 2LM9A 3C64A 1HS7A 4AKHA 2NW8A 2CXDA 1IZNB 3HR0A 4JUYA 2CM0A 5DABA 3NZQA 5F8PA 5H6RB 4OHFA 1ZV4X 3KV5A 3GN5B 2NW9A 4IE4A 2ES0A 4CI1B 2HPLA 2DLRA 2E9XB 3ZMVB 4ZHQE 3HKEE 5LP6E 3SRZA 2PG8A 5JH7E 3GMIA 2Y48B 3BK9A 3C4XA 5FXWA 1OXZA 3C98B 5HWXA 5CA0E 1WYCA 3IBPA 4AXPA 4UF0A 2E9XD 2DCFA 4IE0A 4YHJA 5LA6E 5HXHA 5HWYA 2W00A 1O3XA 2DWGA 2N1GA 4I43B 2X9WA 2DHRA 3O1IA 3VKHA 5L3EB 2WM9A 2MBGA 2XUEA 4AKRB 3K3NA 3KVAA 4CXWA 4PK5A 2D5UA 3FXEB 5HXEA 2QGSA 3CQCB 3KBTA 2WAUA 4KBMB 4H9RC 3BQLA 2LSYA 4QXHB 3ZCJA 2NTXA 4IE5A 3JC6C 3IHRA 5LGUB 2C5JA 3C4ZA 2MYSA 3HL6A 1YKEB 3S4UA 2H7VC 3ZEFB 4UF0B 4EZHA 3L3PA 4H63H 3OYZA 3I9YA 2G0UA 4MHCA 5FY0A 2LSKA 5JDLA 5HXCA 3O4XE 2LHNA 4HTEA 4OYKA 2VKJA 3O1HA 3A5XA 5KMGP 4EIWA 2D0UA 3RYCE 3T8OA 2W61A 4WNKA 1UX5A 2P9BA 4MLKA 4PFPA 1VRBA 4DMWA 4ILUA 4J2CA 4OK0A 3R84B 4NUUA 5JDNA 3KFWX 2OA5A 3OJAA 4BA9A 5JREA 5JDFA 1KK7A 2DWKA 3K8PC 4YJ3E 2XAJB 2WMNA 4ZI3C 2V7MA 1MMAA 3PUQA 2V26A 3IF8B 4PJNA 5HAXA 3UULA 4TV8E 1HF8A 4BAYB 2XASB 5EK2A 3ZYLA 3LG7A 3C4WA 3EDUA 4CZZB 4CXYA 4UEMA 4AQFC 4DNDA 1FMVA 4C90A 3RPUA 5FY7A 3WAKA 2A72A 2BZBA 3AB3B 3UT5E 2K9AA 1UX4A 3LBXA 4PK6A 5JR9A 4EYUA 3HKDE 2VL8A 4IDZA 4CI2B 2ZMAA 4EAHA 1MMNA 5ADXL 1SHZC 2J1DG 4U72A 3B13A 1YD8G 4O4LE 4ZI7E 4AI6A 2CWYA 3RRCA 3V5UA 2YU2A 5LG4A 3H37A 4EZ4A 3RRWA 2VWAA 5J2TE 5JVDE 5IHYA 4C91A 4G63A 2V7KA 2X67A 3C51A 4ANJA 2H7OA 2EHOA 4EOZB 2V7LA 4KMCA 2LOSA 3UUNA 1WLXA 1HFAA 2E9XC 4PW8A 3RC8A 3K3QC 4HGAA 3KV9A 1ZKEA 3Q2MA 4UVBB 3TKLB 3FXDB 2ACXA 3I0OA 2IC9A 1D1CA 4O2AE 3WI3A 4E7ZA 4QKNA 2Z6EA 4X20E 5JR9B 5J2UE 2Q9QA 2N9DA 3LK2B 3PUSA 3UUMA 2VASA 4E7SA 2HPJA 2ODVA 3CX6B 2KNDA 2V1DB 4MFRA 5HXRA 5L3BB 3OYXA 5LGNB 2ZM0A 5CB4E 4IIJE 3KINB 2BVMA 1V9DA 5J1GA 3ZN0B 2CWOA 3Q9DA 2K48A 4JLEA 5LYJE 2DI4A 3PURA 2EHOB 1UCUA 3E22E 1EZ3A 4G2AA 3ZYKA 3AA7B 1BR2A 3RC3A 5JDMA 2I59A 5FXZA 1D0YA 2D2SA 2MOZA 3MK7C 1FIOA 3AA0B 1LVKA 4A56A 3FHNA 1ZHCA 2YEVC 4M1PA 4L5GA 4DBQA 2LSIA 1D1BA 5LHHB 5JDHA 3PU3A 1ZEEA 3RYIE 4GOUA 3UFEA 4I4TE 5HYAA 2Q9QB 5FYMA 4P0BA 4JEUB 4DVDA 4DMVA 3F31A 4B6XA 5L3CB 4H9QC 5LXTE 4O4HE 2LSJA 1WRDA 4O2BE 4GYRA 1MMDA 2KXPB 3MACA 2Y6XA 4IE7A 4TX5A 4ADZA 5LBMA 2QA7A 3CVRA 1BR1A 2ZM8A 3KV6A 3ZJ2A 4YFSA 1D0ZA 5BMVE 3AA1B 2PFVA 2LE8A 2Q9QD 4UVAB 3ZN1B 3ZYMA 1FEWA 3CWZB 1LRZA 4AQGA 1IJ5A 3N2OA 3HKBE 3M65A 4KUMB 2K5BB 3MKDA 4ERRA 3SOLA 3PU8A 3N9NA 2JRKA 2KINB 5FY1A 4NUVA 5M4YA 2VKHA 4PAGA 4OFZA 3QK6A 4XZCA 5A1LA 4K0UA 2C5KT 3MJXA 3PTRB 4JEHB 1LVFA 4XBFB 2X66A 4PNIA 5H6QB 2JJ9A 3F2EA 4ZI2D 1MNDA 3CQGB 3UTKA 2MTQA 4CI3B 1US7B 3AA6B 2LT3A 3AVRA 3ZMTB 1HX8A 4UXNB 3FB2A 5L2LA 3VKGA 2N2NA 4PJMA 3NZPA 3E0ZA 2KMFA 1G8XA 2UXXB 3P8CD 3H3AA 3MA9A 4WW0A 5L3FB 4IGUA 5HXSA 2ODUA 1MIVA 3ZC1A 1KNZA 4ISSA 3DTOA 4P0AA 2RP4A 3EUHA 4Z8XA 5LHIB 5F3JA 4DO0A 5LJMA 3KDSE 3ZLIA 3CX8B 5JQGE 3RKOA 2LEHA 3NBXX 5LGTB 5LNKA 2L3LA 1H7CA 5E0OA 1AJ3A 3N9QA 4FI5A 2E8IA 1LKXA 2KWHA 4WBOA 3ZCIA 5LHGB 4P09A 2PBIA 2CLYB 3QC9A 2IC6A 2W62A 2CMRA 3UUXB 4PFOA 4FJOA 3N9LA 5FP3A 3N2KE 2CE7A 5FNVE 3N5LA 1QSDA 3K3OA 3ZJ1A 4TZ4C 1S94A 2NOXA 3R6NA 5LCYA 2KWIB 2KLQA 3J9X1 1X79A 5JR9C 2KZ7B 2WBLA 3PUGA 3DP7A 4L0RA 4IE6A 4WBNE 1B7TA 2CCQA 3ZPOA 1E1HB 2Y8DA 3LBXB 4UELA 5TAOA 3AAIA 2W0GA 2X9HA 3V5SA 5JRCA 4YJ2E 1MMGA 2YINA 4QXBB 3ZC0A 4DBRA 4X1KE 3C50A 2CEAA 2M67A 2LHRA 5DJQC 2LOPA 2EHOC 5FXXA 4CXXA 4BJNA 2X0LB 4AKGA 1MIYA 5L3GB 2XTLA 3HA4A 4GYSA 1T98A 5LJNA 5EK4A 3SS1A 3GWHA 4UV9B 4ZOLE 2CXFA 5KDMC 2W63A 3I0QA 4YLHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZCJ A;  3ZCI A; 
#chains in the Genus database with same CATH topology
 2XAF B;  4HFV A;  4Z90 A;  5LB7 B;  3RX6 A;  4O4I E;  4ZEY A;  4H9N C;  4MAL A;  3ETV A;  1WR6 A;  5JRC B;  3HI2 A;  1HG2 A;  2XSA A;  5HCM A;  3AXJ B;  1CHU A;  2JMH A;  4LFB T;  4QX8 B;  2XQA A;  1NWM X;  3ZMZ B;  2V5D A;  4H9O C;  1D1A A;  3RQW A;  1QUU A;  2NTY A;  1VCT A;  5AFU L;  1G73 A;  3GA8 A;  2X9X A;  2A9U A;  5J0Z A;  2UXN B;  3E08 A;  2RA1 A;  1CUN A;  1N36 T;  3EDV A;  2CA5 A;  2XZE A;  4GK0 E;  1XWM A;  5LBQ B;  3AEA A;  4GIW A;  2XQ6 A;  3U3I A;  3UQ4 A;  3UU4 A;  3U78 A;  3W15 B;  4U74 A;  5DQV A;  2VKO A;  4OYJ A;  1SE7 A;  4JV5 T;  2HH7 A;  4ZS3 A;  3ETU A;  3ABV A;  2HN1 A;  3FZL B;  5FL1 A;  1S35 A;  1SA0 E;  3OBV E;  2GK9 A;  3ONX A;  3VR8 A;  2CXL A;  2XJ7 A;  3SWH A;  2NW7 A;  4DR7 T;  3P4P A;  4DV4 T;  3NRY A;  4LMJ A;  3RH3 A;  1YKH B;  1NEK A;  3AEG A;  2JQQ A;  3CML A;  3GN5 A;  1Z0P A;  3P4W A;  2H3R A;  2KSR A;  3I1A A;  3I9W A;  2SPC A;  1FMW A;  3ESL A;  3JAF A;  1IAP A;  2WWV A;  3AAA B;  1UK5 A;  1MIW A;  3AVS A;  1WYB A;  3CK6 A;  2W66 A;  3EAM A;  2ZLY A;  2V6X A;  3C64 A;  4AKH A;  1UGO A;  2ACZ A;  5F8P A;  5H6R B;  1ZV4 X;  2FJD A;  2NW9 A;  2HPL A;  2E9X B;  3HKE E;  2PG8 A;  3GMI A;  4AIS A;  2UU9 T;  5HWX A;  1WYC A;  3IBP A;  1KNP A;  1FJG T;  2XPK A;  4DV0 T;  2N1G A;  4I43 B;  2XUE A;  3AE6 A;  3KVA A;  4CXW A;  3FXE B;  3CQC B;  2WU5 A;  1VCS A;  4IE5 A;  2E2A A;  4HFD A;  2IUB A;  2V8S V;  2C5J A;  2MYS A;  2H7V C;  4ILA A;  4MHC A;  3I9Y A;  2RPA A;  2LHN A;  2MPK A;  4YXD A;  5KMG P;  3UUB A;  4WNK A;  2P9B A;  4PFP A;  4J2C A;  3LDQ B;  2YDS A;  1KK7 A;  3AE4 A;  2WMN A;  3PUQ A;  3IF8 B;  5FVL A;  4TWF A;  5EK2 A;  3LG7 A;  3C4W A;  4K0K T;  3IA3 A;  4DND A;  3RPU A;  5FY7 A;  1UX4 A;  4PK6 A;  4IDZ A;  4EAH A;  5AQL B;  1YD8 G;  4AI6 A;  1M7K A;  2J47 A;  5JVD E;  2V7K A;  2VUR A;  4ANJ A;  2YKS A;  4QH1 A;  1HFA A;  2E9X C;  4PW8 A;  5FVK A;  2V6Y B;  4A5X A;  2ACX A;  4NXM T;  2Q9Q A;  3UUM A;  4E7S A;  2VAS A;  4YHH T;  2HPJ A;  3X1D A;  3CX6 B;  4MFR A;  3FZH B;  2ZM0 A;  1UUR A;  1V9D A;  2I6H A;  2CWO A;  3RHW A;  2K48 A;  2XSB A;  3TLV A;  1R8I A;  5FXZ A;  1D0Y A;  2D2S A;  3MK7 C;  1YQ4 A;  3FHN A;  3ONL C;  3B5M A;  2X0H A;  3TLU A;  4M1P A;  4L5G A;  5L4H A;  1D1B A;  5LHH B;  2W4X A;  4GOU A;  5FYM A;  4DVD A;  4X62 T;  5L3C B;  4O4H E;  4O2B E;  2KXP B;  1IBM T;  2QA7 A;  2ZM8 A;  2LE8 A;  5HEU A;  1FEW A;  2BKN A;  1IJ5 A;  3HKB E;  3TLW A;  3M65 A;  4KUM B;  2KIN B;  4NUV A;  2HN2 A;  3MJX A;  1LVF A;  2UUB T;  2X66 A;  1ZOY A;  2JJ9 A;  3F2E A;  4TWH A;  3JCF A;  2LT3 A;  3VKG A;  4TNV A;  2UXX B;  1KNR A;  1Z8U A;  2ODU A;  3ZC1 A;  4HFB A;  4ISS A;  3DTO A;  4DV6 T;  2OV9 A;  5F3J A;  3RF1 A;  1H7C A;  3LSV A;  4YT0 A;  1LKX A;  3ZCI A;  3RI5 A;  2CLY B;  2CMR A;  2WDQ A;  3UUX B;  4FJO A;  2CE7 A;  3AEC A;  5FNV E;  1XMO T;  4TZ4 C;  2KLQ A;  2FJB A;  4L0R A;  4IE6 A;  1B7T A;  2CCQ A;  3VRA A;  3LBX B;  5TAO A;  2W0G A;  3V5S A;  2YIN A;  2FUP A;  3C50 A;  2LOP A;  5AQV B;  4AKG A;  2FJE A;  3RIU A;  3SS1 A;  3GWH A;  4IDP A;  2CXF A;  2BG9 B;  3VR9 A;  2H88 A;  4DUY T;  3KV4 A;  5AQN B;  2LLY A;  3KBU A;  3L39 A;  3ZMU B;  4TN7 B;  3DJB A;  1XZY A;  4BJM A;  3A7M A;  4DV7 T;  5JDG A;  3ZMS B;  5CA1 E;  3LK3 B;  2YDQ A;  2YOE A;  2XQY A;  3HKC E;  3AE7 A;  2PJQ A;  4B3T T;  4XAX B;  2C0S A;  3J7Y q;  2JPF A;  4HFI A;  3PUY F;  4ASK A;  3N9O A;  5GON E;  4ILB A;  1M62 A;  2LRK A;  2UXB T;  2NR4 A;  2E5L T;  5AQM B;  1D0X A;  2JMK A;  3P50 A;  3JC6 D;  4TV9 E;  1N32 T;  3AAE B;  2BS2 A;  1HNZ T;  4HEA A;  5IUX A;  4LF5 T;  5C8Y E;  2YU1 A;  2XAQ B;  2CLY C;  3RYH E;  4X1Y E;  5L3D B;  1U4Q A;  2IAK A;  3CKD A;  4TNW A;  3ANW A;  3TLS A;  4AKI A;  4I50 E;  3CPZ A;  4TWD A;  2VVN A;  4QHO A;  4YSX A;  1N33 T;  2VK9 A;  4KP3 C;  4JI8 T;  1U5P A;  5AQO B;  2X9Y A;  4H63 V;  2LKH A;  3D0T A;  2LM2 A;  4N78 D;  2IIU A;  2XQ9 A;  2NW8 A;  3HR0 A;  2BG9 C;  4OHF A;  3KV5 A;  3GN5 B;  4CI1 B;  2ES0 A;  2DLR A;  1W0A A;  4IRE A;  3ONJ A;  3SRZ A;  3FZF B;  3C4X A;  4AXP A;  1DU2 A;  3PUW F;  2DCF A;  4IE0 A;  4LMK A;  5LA6 E;  5HXH A;  3G06 A;  2CBI A;  2DWG A;  2DHR A;  2LKG A;  4YTN A;  1XDO A;  2D5U A;  3KBT A;  4H9R C;  2LSY A;  4QXH B;  3ZCJ A;  5KXJ A;  1YKE B;  3S4U A;  4EZH A;  4AIU A;  2WS3 A;  5JDL A;  5HXC A;  3O4X E;  4HTE A;  4OYK A;  5HCJ A;  4DV5 T;  3T8O A;  1IBL T;  3AEE A;  3H3M A;  4ILU A;  3R84 B;  3OJA A;  5L47 A;  5JDF A;  2DWK A;  2YDR A;  4ZI3 C;  2XAJ B;  1MMA A;  2E5V A;  4LF7 T;  1Y01 A;  4BAY B;  2XAS B;  4CXY A;  4Z91 A;  4EYU A;  4YTM A;  2ZMA A;  1J5E T;  1SHZ C;  3AE5 A;  2CWY A;  3RRC A;  3V5U A;  2YU2 A;  5AQJ B;  5LG4 A;  4HWI B;  4EV6 A;  1SUM B;  2X67 A;  2EHO A;  4HWH A;  4ZZB A;  3UU8 A;  4DR6 T;  2BKP A;  4O2A E;  3WI3 A;  5J2U E;  2ODV A;  5L3B B;  4UR9 A;  5LGN B;  4IIJ E;  3AXJ A;  4LF4 T;  3Q9D A;  4JLE A;  1JNZ A;  3ZYK A;  4G2A A;  1BR2 A;  2I59 A;  1FIO A;  3AA0 B;  1LVK A;  4A56 A;  5CFB A;  2YEV C;  2LSI A;  4EGW A;  2M6I A;  5JDH A;  3PU3 A;  1ZEE A;  3RYI E;  2Q9Q B;  4DMV A;  5LXT E;  1WRD A;  4IE7 A;  3CVR A;  1BR1 A;  3ZJ2 A;  5BMV E;  3RIA A;  1UUS A;  2PFV A;  3ZN1 B;  3ZYM A;  2JQK A;  2K5B B;  3MKD A;  2JRK A;  2VKH A;  5A1L A;  3PTR B;  4JEH B;  4P1N A;  5AQK B;  4U2Y A;  3UTK A;  2MTQ A;  3ZMT B;  4KI0 F;  3E0Z A;  4NXN T;  2KMF A;  3MA9 A;  2RP4 A;  3RQU A;  4Z8X A;  1KFY A;  5AQP B;  4DO0 A;  3KDS E;  4YTP A;  2LEH A;  3NBX X;  5LNK A;  5E0O A;  2JQ9 A;  2E8I A;  4WBO A;  4PFO A;  4JI1 T;  2CPT A;  3N5L A;  4U33 A;  3ZJ1 A;  2VL0 A;  1S94 A;  5HEJ A;  2NOX A;  2KWI B;  3J9X 1;  2BS4 A;  2KZ7 B;  2WBL A;  4LF9 T;  3ZPO A;  3AAI A;  2VQF T;  2WDV A;  4QXB B;  2YN6 A;  5DJQ C;  4BJN A;  4DR4 T;  1MIY A;  3HA4 A;  4UV9 B;  2Q9Q C;  1XNR T;  2VB6 A;  3BQI A;  4HKA A;  2EHO D;  4UV8 B;  3LFM A;  4JI0 T;  2K24 A;  4PJL A;  2WWU A;  2WU2 A;  1W0B A;  4QH4 A;  5HEG A;  4ZI2 C;  4JYA T;  4H9S E;  3NKZ A;  3VU7 H;  2I0M A;  2BVL A;  4I0U A;  4QXC B;  5AQT B;  2IHR 1;  3B57 A;  3P7I A;  2WQY A;  4F6R C;  3ZST A;  2VKD A;  3AE8 A;  1KEY A;  2K3W A;  5JDQ A;  2C5I T;  2LJL A;  3ZT5 A;  3O1J A;  2NP9 A;  2XQ7 A;  3PE0 A;  4EXT A;  1BR4 A;  4DR1 T;  4MBQ A;  3IEE A;  2V7I A;  4O4J E;  4TUY E;  1BR0 A;  2XQ8 A;  3EVY A;  2X68 A;  2UUC T;  4AQF A;  5KX5 E;  3PUA A;  3QB5 A;  5AQU B;  5FXV A;  4ZXL A;  2OLT A;  3KVB A;  4X1I E;  5EK3 A;  1OED A;  4UIG A;  4JBW F;  1IJ6 A;  4PK4 A;  4EB6 E;  2L8K A;  3Q5X A;  3L09 A;  5ETW A;  4QWN B;  1HTJ F;  5DQW A;  3WAJ A;  3F57 A;  3Q5E A;  5ABE A;  5CGM A;  4IST A;  2LSG A;  3N2G E;  1OWA A;  2ZM2 A;  4AKL A;  4ZS2 A;  2DNX A;  4QX7 B;  2D0T A;  4DV3 T;  3ANW B;  2A2F X;  1NEN A;  1HS7 A;  3MXZ A;  2XAG B;  2XY8 B;  4WYV A;  1IZN B;  4DR5 T;  4JUY A;  3NZQ A;  4IT4 A;  4IE4 A;  3CIR A;  2W2U A;  1WR0 A;  5JH7 E;  2Y48 B;  4U31 A;  5FXW A;  3C98 B;  5CA0 E;  5ABF A;  1HX1 B;  2LRL A;  2E9X D;  4UF0 A;  3OPC A;  3RIU C;  4YHJ A;  1O3X A;  2X9W A;  3O1I A;  1J1J A;  2WM9 A;  2MBG A;  4AKR B;  2X0Y A;  3K3N A;  3PUZ F;  4X5T A;  2WAU A;  4KBM B;  4JI5 T;  3SFD A;  1L0V A;  5LGU B;  3HL6 A;  3C4Z A;  3ZEF B;  4DR3 T;  3L3P A;  4H63 H;  4JI2 T;  2G0U A;  3UU3 A;  5FY0 A;  4U2Z A;  2VKJ A;  2W61 A;  3PJA J;  1UX5 A;  1VRB A;  2CHN A;  4DMW A;  2DL1 A;  4NUU A;  2IML A;  5JRE A;  1E2A A;  3K8P C;  4ILC A;  2HHH T;  2V7M A;  2V26 A;  3UUL A;  4TV8 E;  4HWF A;  4DID B;  1HF8 A;  4CZZ B;  4UEM A;  5FL0 A;  4C90 A;  2A72 A;  3LBX A;  5JR9 A;  3HKD E;  5ADX L;  2VQE T;  2J1D G;  3UFG A;  1XMQ T;  4QH5 A;  1W09 A;  3H37 A;  4U3C A;  3RRW A;  2VWA A;  3PV0 F;  4OX9 T;  5J2T E;  4C91 A;  4G63 A;  2CRB A;  3EAB A;  2H7O A;  4KMC A;  1XDP A;  2LOS A;  5F5W A;  3UUN A;  1WLX A;  4B3R T;  4HGA A;  4HWD A;  3Q2M A;  4UVB B;  1N34 T;  3TKL B;  3I0O A;  2IC9 A;  1D1C A;  4E7Z A;  2Z6E A;  2QYW A;  2XM1 A;  3P4Q A;  4JI6 T;  5CB4 E;  4B3M T;  2UXC T;  5LYJ E;  2DI4 A;  2EHO B;  1EZ3 A;  4CN4 A;  3AA7 B;  3RC3 A;  4LFC T;  4CN6 A;  2MOZ A;  4EED A;  5HEO A;  3K1S A;  1ZHC A;  2R6G F;  4COF A;  5ABG A;  4DBQ A;  4KHP T;  4X66 T;  3UFE A;  1W9R A;  4JEU B;  4B6X A;  3ZT7 A;  1MMD A;  2Y6X A;  3AE9 A;  4TX5 A;  5LBM A;  3KV6 A;  1HNX T;  4UVA B;  5JTG A;  3AED A;  4AQG A;  4A98 A;  2M6B A;  3SOL A;  2WZI A;  3PU8 A;  5FY1 A;  5M4Y A;  3NWI A;  2ZM6 T;  3JAE A;  1I6Z A;  4K0U A;  4XBF B;  4PNI A;  2WZH A;  4F8H A;  5AQG B;  4CI3 B;  1US7 B;  3FB2 A;  3RKG A;  4LML A;  4PJM A;  3NZP A;  1G8X A;  3P8C D;  3H3A A;  4WW0 A;  4ZZC A;  1KNZ A;  4HFH A;  2QVA A;  2W67 A;  2CBJ A;  3AE2 A;  5LJM A;  3ZLI A;  5JQG E;  1I94 T;  5LGT B;  1AJ3 A;  2J62 A;  1J5W A;  5LHG B;  4IL9 A;  4P09 A;  2PBI A;  3QC9 A;  2UXD T;  2W62 A;  2V5C A;  5AQF B;  3N9L A;  5FP3 A;  3N2K E;  2J4G A;  3K3O A;  3R6N A;  5LCY A;  1X79 A;  4X65 T;  1T72 A;  2FBW A;  1KF6 A;  1HNW T;  1E1H B;  2Y8D A;  4UEL A;  5JRC A;  1MMG A;  1ZP0 A;  3ZC0 A;  4DBR A;  2CEA A;  2M67 A;  2LHR A;  2WB5 A;  2EHO C;  4CXX A;  5L3G B;  2XTL A;  4GYS A;  1T98 A;  4IDQ A;  5KDM C;  2W63 A;  3I0Q A;  3RLF F;  4I55 E;  2VVS A;  5AQR B;  2XQ4 A;  3N9P A;  2BDE A;  2L9Q A;  3RIF A;  4EYY R;  4HFE A;  4YSZ A;  2WMO A;  5EZY E;  1NAF A;  3OKQ A;  4PJJ A;  4HE8 A;  2IDO B;  4GKK T;  1HG5 A;  4O8S A;  2WSS V;  4V1A v;  2IW5 B;  4IHJ E;  3MZK B;  4NIQ A;  3UU6 A;  2BBH A;  3UU5 A;  2A3D A;  2NWB A;  2XAH B;  2XQ3 A;  5LOV E;  1OED E;  3N9M A;  5BR8 T;  2H89 A;  3FZM B;  4JI7 T;  3AEF A;  3ZSS A;  5IYZ E;  1YW0 A;  4A97 A;  2XHE B;  4CQI A;  4HN9 A;  4UVC B;  4DR2 T;  4GKJ T;  4L9I A;  3AEB A;  3CQX C;  1HCI A;  1E7P A;  3Q5W A;  3OVU A;  4H9P C;  3AE1 A;  3CX7 B;  3FBL A;  3O9X A;  2CHO A;  3QUJ A;  1Y64 B;  3RYF E;  4LF6 T;  1MNE A;  3LJC A;  3T1H T;  2B1E A;  2E9X A;  5LG3 A;  2V7J A;  3SFE A;  3FBZ A;  4ZI3 D;  2X51 A;  5FMN A;  4JI4 T;  3BQK A;  2PTF A;  5AQQ B;  2KT9 A;  3Q5D A;  4WZX A;  3PDY A;  2YK0 A;  3VHL A;  1OED B;  3LK4 2;  1VOM A;  3NRX A;  4GK5 E;  2LM9 A;  4LF8 T;  4KX6 A;  2CXD A;  1T7S A;  2CM0 A;  5DAB A;  5AQS B;  2XQ5 A;  3QOF A;  3ZMV B;  4ZHQ E;  4NPP A;  5C3J A;  5LP6 E;  3BK9 A;  3PUX F;  1T8B A;  1OXZ A;  3AE3 A;  2JQH A;  2BBJ A;  3EI0 A;  4KHZ F;  1IBK T;  2WDR A;  1HR0 T;  4HFC A;  5C2T A;  5FKY A;  5HWY A;  2W00 A;  3VKH A;  5L3E B;  2F4V T;  4IDO A;  4PK5 A;  5HXE A;  2QGS A;  3EHZ A;  3BQL A;  3QB5 K;  2NTX A;  3JC6 C;  3IHR A;  1QLB A;  5HEH A;  5ABF B;  4UF0 B;  3OYZ A;  2LSK A;  4DUZ T;  3O1H A;  3A5X A;  4EIW A;  2D0U A;  3RYC E;  4DV1 T;  4MLK A;  4OK0 A;  3P4S A;  5JDN A;  1JNR A;  3KFW X;  2OA5 A;  4BA9 A;  4YJ3 E;  5IWA T;  5LMN T;  4PJN A;  5HAX A;  1WFD A;  3ZYL A;  4Q25 A;  4HWC A;  2V6Y A;  2JIW A;  3EDU A;  4AQF C;  2BG9 E;  1FMV A;  3WAK A;  2BZB A;  3AB3 B;  3UT5 E;  2K9A A;  5LMU T;  2VL8 A;  4CI2 B;  1MMN A;  3NVO A;  3RGL A;  3VRB A;  1OED C;  3B13 A;  4U72 A;  4O4L E;  5AQH B;  4ZI7 E;  3QNU A;  4EZ4 A;  4IL4 A;  5IHY A;  3C51 A;  4EOZ B;  2V7L A;  4DV2 T;  2D9D A;  3RC8 A;  2B76 A;  3K3Q C;  2UUA T;  3KV9 A;  4U7I A;  1ZKE A;  3FXD B;  3TLT A;  4QKN A;  4X20 E;  5JR9 B;  2N9D A;  3LK2 B;  3PUS A;  4LFA T;  3L8R A;  2KND A;  2V1D B;  5HXR A;  3OYX A;  5J1G A;  3KIN B;  2BVM A;  5L4E A;  3ZN0 B;  3M3Z B;  2BKO A;  4AQY T;  3PUR A;  3E22 E;  1UCU A;  3P4R A;  5JDM A;  3A8Y C;  3OTO T;  2WY2 A;  4YY3 T;  4I4T E;  5HYA A;  4P0B A;  3F31 A;  4H9Q C;  2LSJ A;  4GYR A;  3MAC A;  4ADZ A;  4YFS A;  1D0Z A;  3AA1 B;  2Q9Q D;  2WP9 A;  3UQ7 A;  3CWZ B;  1LRZ A;  3N2O A;  4ERR A;  4U7Y A;  4X64 T;  3N9N A;  1YQ3 A;  4PAG A;  4OFZ A;  3QK6 A;  4XZC A;  2C5K T;  2MAW A;  2XM2 A;  5H6Q B;  4ZI2 D;  1MND A;  3CQG B;  5AQI B;  3AVR A;  3AA6 B;  1HX8 A;  4UXN B;  5L2L A;  4B3S T;  2N2N A;  4EEB A;  4JI3 T;  5L3F B;  4IGU A;  5HXS A;  1MIV A;  4P0A A;  3EUH A;  2FJA A;  5LHI B;  2WCA A;  3JAD A;  1YXR A;  3CX8 B;  3RKO A;  2L3L A;  4YSY A;  1GQE A;  1X9B A;  3N9Q A;  4FI5 A;  1XNQ T;  2KWH A;  3FZK B;  1WCR A;  2IC6 A;  3T1Y T;  3PUV F;  1QSD A;  5ABH A;  2BS3 A;  2BG9 A;  5JR9 C;  2QRX A;  3PUG A;  3DP7 A;  4WBN E;  2X9H A;  4YJ2 E;  3ZT6 A;  4X1K E;  2AXD S;  4IDN A;  4CN1 A;  2AE9 A;  5FXX A;  3PJA A;  2X0L B;  5LJN A;  5EK4 A;  4ZOL E;  5CJ5 A;  3ZKR A;  4YLH A; 
#chains in the Genus database with same CATH homology
 4I55 E;  2XAF B;  4HFV A;  2Q9Q C;  3KV4 A;  2VB6 A;  3BQI A;  4HKA A;  3RX6 A;  4O4I E;  4H9N C;  3N9P A;  2EHO D;  2BDE A;  2L9Q A;  3ETV A;  4MAL A;  1WR6 A;  4UV8 B;  5JRC B;  3LFM A;  2K24 A;  4PJL A;  3HI2 A;  2WWU A;  1HG2 A;  3KBU A;  4EYY R;  3ZMU B;  4TN7 B;  3DJB A;  2WMO A;  5EZY E;  1NAF A;  2JMH A;  4BJM A;  4QX8 B;  5JDG A;  3OKQ A;  4PJJ A;  4ZI2 C;  3ZMS B;  1NWM X;  4HE8 A;  3ZMZ B;  4H9O C;  5CA1 E;  1D1A A;  4H9S E;  1HG5 A;  1QUU A;  4O8S A;  3VU7 H;  2WSS V;  2BVL A;  2NTY A;  3LK3 B;  4QXC B;  5AFU L;  1G73 A;  2XQY A;  4V1A v;  3HKC E;  3GA8 A;  2PJQ A;  2X9X A;  2IW5 B;  2UXN B;  2C0S A;  4IHJ E;  3MZK B;  4XAX B;  3B57 A;  2RA1 A;  3E08 A;  3J7Y q;  3P7I A;  2JPF A;  1CUN A;  4F6R C;  2VKD A;  4ASK A;  3EDV A;  2CA5 A;  4GK0 E;  5LBQ B;  5JDQ A;  3N9O A;  4GIW A;  2A3D A;  2C5I T;  2LJL A;  2NWB A;  2XAH B;  2NP9 A;  3O1J A;  3U3I A;  5GON E;  5LOV E;  3PE0 A;  4EXT A;  1BR4 A;  4MBQ A;  3U78 A;  3N9M A;  3IEE A;  3W15 B;  2V7I A;  1D0X A;  2JMK A;  4U74 A;  5DQV A;  2VKO A;  4OYJ A;  5IYZ E;  4O4J E;  2HH7 A;  3JC6 D;  4TUY E;  4TV9 E;  1BR0 A;  1YW0 A;  4ZS3 A;  3EVY A;  2X68 A;  3AAE B;  3ETU A;  4HEA A;  2XHE B;  4CQI A;  4AQF A;  5KX5 E;  3PUA A;  5FXV A;  1S35 A;  4HN9 A;  4UVC B;  5C8Y E;  1SA0 E;  2YU1 A;  3OBV E;  2XAQ B;  2CLY C;  4L9I A;  3RYH E;  4X1Y E;  2GK9 A;  3KVB A;  3CQX C;  2CXL A;  1HCI A;  3ONX A;  4X1I E;  3SWH A;  5L3D B;  1U4Q A;  2IAK A;  3Q5W A;  5EK3 A;  3CKD A;  2NW7 A;  4H9P C;  4UIG A;  3ANW A;  3NRY A;  1IJ6 A;  4PK4 A;  3RH3 A;  4EB6 E;  2L8K A;  1YKH B;  3CX7 B;  3Q5X A;  3FBL A;  4AKI A;  3L09 A;  5ETW A;  4I50 E;  4QWN B;  3O9X A;  3QUJ A;  1Y64 B;  3CPZ A;  4QHO A;  3RYF E;  1HTJ F;  2VK9 A;  5DQW A;  2JQQ A;  3WAJ A;  3F57 A;  3CML A;  3GN5 A;  1Z0P A;  1MNE A;  3LJC A;  4IST A;  2B1E A;  2E9X A;  2H3R A;  4KP3 C;  2LSG A;  2V7J A;  3I1A A;  2SPC A;  3I9W A;  1U5P A;  3FBZ A;  1FMW A;  3N2G E;  4ZI3 D;  2X51 A;  3ESL A;  1OWA A;  5FMN A;  1IAP A;  2ZM2 A;  3BQK A;  3AAA B;  2X9Y A;  1MIW A;  2KT9 A;  4AKL A;  4H63 V;  4ZS2 A;  3AVS A;  2DNX A;  1WYB A;  3PDY A;  3D0T A;  4QX7 B;  2D0T A;  2YK0 A;  3VHL A;  3LK4 2;  3ANW B;  2A2F X;  2ZLY A;  1VOM A;  3NRX A;  4N78 D;  4GK5 E;  3MXZ A;  2XAG B;  2LM9 A;  3C64 A;  1HS7 A;  4AKH A;  2NW8 A;  2CXD A;  1IZN B;  3HR0 A;  4JUY A;  2CM0 A;  5DAB A;  3NZQ A;  5F8P A;  5H6R B;  4OHF A;  1ZV4 X;  3KV5 A;  3GN5 B;  2NW9 A;  4IE4 A;  2ES0 A;  4CI1 B;  2HPL A;  2DLR A;  2E9X B;  3ZMV B;  4ZHQ E;  3HKE E;  5LP6 E;  3SRZ A;  2PG8 A;  5JH7 E;  3GMI A;  2Y48 B;  3BK9 A;  3C4X A;  5FXW A;  1OXZ A;  3C98 B;  5HWX A;  5CA0 E;  1WYC A;  3IBP A;  4AXP A;  4UF0 A;  2E9X D;  2DCF A;  4IE0 A;  4YHJ A;  5LA6 E;  5HXH A;  5HWY A;  2W00 A;  1O3X A;  2DWG A;  2N1G A;  4I43 B;  2X9W A;  2DHR A;  3O1I A;  3VKH A;  5L3E B;  2WM9 A;  2MBG A;  2XUE A;  4AKR B;  3K3N A;  3KVA A;  4CXW A;  4PK5 A;  2D5U A;  3FXE B;  5HXE A;  2QGS A;  3CQC B;  3KBT A;  2WAU A;  4KBM B;  4H9R C;  3BQL A;  2LSY A;  4QXH B;  3ZCJ A;  2NTX A;  4IE5 A;  3JC6 C;  3IHR A;  5LGU B;  2C5J A;  3C4Z A;  2MYS A;  3HL6 A;  1YKE B;  3S4U A;  2H7V C;  3ZEF B;  4UF0 B;  4EZH A;  3L3P A;  4H63 H;  3OYZ A;  3I9Y A;  2G0U A;  4MHC A;  5FY0 A;  2LSK A;  5JDL A;  5HXC A;  3O4X E;  2LHN A;  4HTE A;  4OYK A;  2VKJ A;  3O1H A;  3A5X A;  5KMG P;  4EIW A;  2D0U A;  3RYC E;  3T8O A;  2W61 A;  4WNK A;  1UX5 A;  2P9B A;  4MLK A;  4PFP A;  1VRB A;  4DMW A;  4ILU A;  4J2C A;  4OK0 A;  3R84 B;  4NUU A;  5JDN A;  3KFW X;  2OA5 A;  3OJA A;  4BA9 A;  5JRE A;  5JDF A;  1KK7 A;  2DWK A;  3K8P C;  4YJ3 E;  2XAJ B;  2WMN A;  4ZI3 C;  2V7M A;  1MMA A;  3PUQ A;  2V26 A;  3IF8 B;  4PJN A;  5HAX A;  3UUL A;  4TV8 E;  1HF8 A;  4BAY B;  2XAS B;  5EK2 A;  3ZYL A;  3LG7 A;  3C4W A;  3EDU A;  4CZZ B;  4CXY A;  4UEM A;  4AQF C;  4DND A;  1FMV A;  4C90 A;  3RPU A;  5FY7 A;  3WAK A;  2A72 A;  2BZB A;  3AB3 B;  3UT5 E;  2K9A A;  1UX4 A;  3LBX A;  4PK6 A;  5JR9 A;  4EYU A;  3HKD E;  2VL8 A;  4IDZ A;  4CI2 B;  2ZMA A;  4EAH A;  1MMN A;  5ADX L;  1SHZ C;  2J1D G;  4U72 A;  3B13 A;  1YD8 G;  4O4L E;  4ZI7 E;  4AI6 A;  2CWY A;  3RRC A;  3V5U A;  2YU2 A;  5LG4 A;  3H37 A;  4EZ4 A;  3RRW A;  2VWA A;  5J2T E;  5JVD E;  5IHY A;  4C91 A;  4G63 A;  2V7K A;  2X67 A;  3C51 A;  4ANJ A;  2H7O A;  2EHO A;  4EOZ B;  2V7L A;  4KMC A;  2LOS A;  3UUN A;  1WLX A;  1HFA A;  2E9X C;  4PW8 A;  3RC8 A;  3K3Q C;  4HGA A;  3KV9 A;  1ZKE A;  3Q2M A;  4UVB B;  3TKL B;  3FXD B;  2ACX A;  3I0O A;  2IC9 A;  1D1C A;  4O2A E;  3WI3 A;  4E7Z A;  4QKN A;  2Z6E A;  4X20 E;  5JR9 B;  5J2U E;  2Q9Q A;  2N9D A;  3LK2 B;  3PUS A;  3UUM A;  2VAS A;  4E7S A;  2HPJ A;  2ODV A;  3CX6 B;  2KND A;  2V1D B;  4MFR A;  5HXR A;  5L3B B;  3OYX A;  5LGN B;  2ZM0 A;  5CB4 E;  4IIJ E;  3KIN B;  2BVM A;  1V9D A;  5J1G A;  3ZN0 B;  2CWO A;  3Q9D A;  2K48 A;  4JLE A;  5LYJ E;  2DI4 A;  3PUR A;  2EHO B;  1UCU A;  3E22 E;  1EZ3 A;  4G2A A;  3ZYK A;  3AA7 B;  1BR2 A;  3RC3 A;  5JDM A;  2I59 A;  5FXZ A;  1D0Y A;  2D2S A;  2MOZ A;  3MK7 C;  1FIO A;  3AA0 B;  1LVK A;  4A56 A;  3FHN A;  1ZHC A;  2YEV C;  4M1P A;  4L5G A;  4DBQ A;  2LSI A;  1D1B A;  5LHH B;  5JDH A;  3PU3 A;  1ZEE A;  3RYI E;  4GOU A;  3UFE A;  4I4T E;  5HYA A;  2Q9Q B;  5FYM A;  4P0B A;  4JEU B;  4DVD A;  4DMV A;  3F31 A;  4B6X A;  5L3C B;  4H9Q C;  5LXT E;  4O4H E;  2LSJ A;  1WRD A;  4O2B E;  4GYR A;  1MMD A;  2KXP B;  3MAC A;  2Y6X A;  4IE7 A;  4TX5 A;  4ADZ A;  5LBM A;  2QA7 A;  3CVR A;  1BR1 A;  2ZM8 A;  3KV6 A;  3ZJ2 A;  4YFS A;  1D0Z A;  5BMV E;  3AA1 B;  2PFV A;  2LE8 A;  2Q9Q D;  4UVA B;  3ZN1 B;  3ZYM A;  1FEW A;  3CWZ B;  1LRZ A;  4AQG A;  1IJ5 A;  3N2O A;  3HKB E;  3M65 A;  4KUM B;  2K5B B;  3MKD A;  4ERR A;  3SOL A;  3PU8 A;  3N9N A;  2JRK A;  2KIN B;  5FY1 A;  4NUV A;  5M4Y A;  2VKH A;  4PAG A;  4OFZ A;  3QK6 A;  4XZC A;  5A1L A;  4K0U A;  2C5K T;  3MJX A;  3PTR B;  4JEH B;  1LVF A;  4XBF B;  2X66 A;  4PNI A;  5H6Q B;  2JJ9 A;  3F2E A;  4ZI2 D;  1MND A;  3CQG B;  3UTK A;  2MTQ A;  4CI3 B;  1US7 B;  3AA6 B;  2LT3 A;  3AVR A;  3ZMT B;  1HX8 A;  4UXN B;  3FB2 A;  5L2L A;  3VKG A;  2N2N A;  4PJM A;  3NZP A;  3E0Z A;  2KMF A;  1G8X A;  2UXX B;  3P8C D;  3H3A A;  3MA9 A;  4WW0 A;  5L3F B;  4IGU A;  5HXS A;  2ODU A;  1MIV A;  3ZC1 A;  1KNZ A;  4ISS A;  3DTO A;  4P0A A;  2RP4 A;  3EUH A;  4Z8X A;  5LHI B;  5F3J A;  4DO0 A;  5LJM A;  3KDS E;  3ZLI A;  3CX8 B;  5JQG E;  3RKO A;  2LEH A;  3NBX X;  5LGT B;  5LNK A;  2L3L A;  1H7C A;  5E0O A;  1AJ3 A;  3N9Q A;  4FI5 A;  2E8I A;  1LKX A;  2KWH A;  4WBO A;  3ZCI A;  5LHG B;  4P09 A;  2PBI A;  2CLY B;  3QC9 A;  2IC6 A;  2W62 A;  2CMR A;  3UUX B;  4PFO A;  4FJO A;  3N9L A;  5FP3 A;  3N2K E;  2CE7 A;  5FNV E;  3N5L A;  1QSD A;  3K3O A;  3ZJ1 A;  4TZ4 C;  1S94 A;  2NOX A;  3R6N A;  5LCY A;  2KWI B;  2KLQ A;  3J9X 1;  1X79 A;  5JR9 C;  2KZ7 B;  2WBL A;  3PUG A;  3DP7 A;  4L0R A;  4IE6 A;  4WBN E;  1B7T A;  2CCQ A;  3ZPO A;  1E1H B;  2Y8D A;  3LBX B;  4UEL A;  5TAO A;  3AAI A;  2W0G A;  2X9H A;  3V5S A;  5JRC A;  4YJ2 E;  1MMG A;  2YIN A;  4QXB B;  3ZC0 A;  4DBR A;  4X1K E;  3C50 A;  2CEA A;  2M67 A;  2LHR A;  5DJQ C;  2LOP A;  2EHO C;  5FXX A;  4CXX A;  4BJN A;  2X0L B;  4AKG A;  1MIY A;  5L3G B;  2XTL A;  3HA4 A;  4GYS A;  1T98 A;  5LJN A;  5EK4 A;  3SS1 A;  3GWH A;  4UV9 B;  4ZOL E;  2CXF A;  5KDM C;  2W63 A;  3I0Q A;  4YLH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...