1NAFA

Crystal structure of the human gga1 gat domain
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
129
structure length
124
Chain Sequence
DEEKSKMLARLLKSSHPEDLRAANKLIKEMVQEDQKRMEKISKRVNAIEEVNNNVKLLTEMVMSHSQGSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEILQANDNLTQVINLYKQLVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein, membrane protein
molecule keywords ADP-ribosylation factor binding protein GGA1
publication title The Structure of the GGA1-GAT Domain Reveals the Molecular Basis for ARF Binding and Membrane Association of GGAs
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 124
sequence length 129
ec nomenclature
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03127 GAT GAT domain
A PF18308 GGA_N-GAT GGA N-GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1nafA01
1.20.58.160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1nafA02
5AW8B 3V5BA 1A02F 2E43A 4KHXA 2N9BA 1T2KD 2P67A 3HTKA 3O8ZA 3VMYA 4I6MC 3M06A 2XV5A 1OWAA 4GT1A 1GZLA 4HYTB 2W27A 5AVYB 2C9LY 2VRSA 5AVZB 5APQA 2R3CA 4AUWA 2N9DA 4GKGA 1GTWA 1G2CB 3IR9A 1OXZA 1H89A 1H8AA 2P2UA 3LIEA 3P7KA 5APWA 5AVVB 5AW7B 1IO4A 3VYIA 3A7OA 5AVRB 3A3YB 3A5TA 3NFQA 2E42A 1WRDA 5AW0B 1H88A 3HE5B 2QM8A 4C46A 3L35A 3NTNA 5APVA 1GK6A 1YYCA 2Z5HA 1WR6A 3NMDA 3L37A 1MUUA 2ZFCA 1NAFA 2KP8A 3M9BA 3MD0A 1HUCA 1GU4A 1O3XA 2R5BA 3B8EB 3M0AA 5APXA 1FOSE 3HE5A 3T97A 3M91A 3P8MC 5AW2B 5AW3B 2WPRA 5APYA 2N2NA 1S9KD 4DZOA 5APSA 3VTPC 1KQLA 1S9KE 4JYCA 4LC1A 1HJBA 1CI6A 2BASA 1T2KC 1CZQA 2QM7A 3UIAA 4EOTA 1GD2E 1HBWA 2R32A 2WPSA 5CMZA 3MGNA 5AVXB 2WTYA 2YO3A 3OAKA 2P7JA 2C9NY 5APTA 2Q5UA 1J2JB 4AYCA 1JNMA 1FOSF 3TYYA 2YNYA 4AQRD 1CI6B 3KDPB 2Z5IA 1YD8G 3HE4B 5AVQB 5AW5B 1CSBA 4XE5B 5AW1B 2WPQA 4M3LA 4RESB 2WT7A 3L36A 1SLQA 1X8YA 3LIDA 2IPPA 2R5DA 1FAVA 3M0DA 1SP4A 2YO2A 3V4QA 3KQGA 3VMZA 5AVTB 3HE4A 4C7NB 1GK4A 1GU5A 3SWFA 5AW9B 5AVWB 4JYBA 5AW6B 2Q7CA 1JUNA 3TK1A 1A02J 5AW4B 2WT7B 5AVSB 3NXSA 1X79A 3TNUB 3VMXA 1MV8A 2XZRA 3VN0A 2JJLA 2WWWA 4I2LC 4C7NA 1MFZA 2XU6A 3V4WA 2ZXEB 3A2AA 1HWTC 1DH3A 2H7HA 3I5CA 3M9HA 1NWQA 5AVUB 2Q3IA 1NWMX 3P32A 2W6AA 4B86A 3TNUA 5APUA
chains in the Genus database with same CATH superfamily
2D2CB 4HFBA 5L3GB 2YINA 2ODVA 1AVYA 2IX7C 3HTKA 3B5NC 4XZCA 1U4QA 2LXBA 2YKPA 4PV1B 3TGUG 3A5XA 3P8CE 1QUUA 5HEGA 1GL2B 3Q3DA 5LA6E 3CWBG 3EQ2A 1XNRT 4ZNCA 2Z6EA 3ETUA 4AUWA 2FJEA 3ONXA 3QUJA 1D0YA 3RK3B 5APWA 4WZXA 4DNDA 3OYZA 3H1HE 3A3YB 2V1DB 2R44A 5L2LA 5HXSA 4DMWA 4PD4D 4XBFB 1N8RQ 4QH4A 2GK9A 1KILD 4EIJA 5CFBA 2B89A 1HUCA 1UIIA 2X9YA 3ZYLA 4WBNE 3RI5A 4YTPA 2IIUA 4HJGH 3GWHA 1VF5B 3CCVP 4PK4A 3H1HG 4HN9A 3BK9A 1MZ9A 1J5WA 1S2EA 3UU5A 1FDMA 2O1KA 2WZ7A 4GDOA 1HNXT 5AQVB 3UIAA 4A7PA 5HEJA 4DR7T 1GD2E 3PLNA 2XSAA 3AEEC 4JF7A 1YQ3A 3ZC1A 4XAXB 1ZXGA 4A97A 4YTNA 3LJCA 1JNMA 1FOSF 5HXCA 4DMVA 5DJUB 1NU1E 1RF1A 3O9XA 2H88C 2XNXA 2BG9A 3HKEE 5LJNA 3R6NA 3V5UA 1J1EB 2YIUC 1BE3G 3CD6P 1BGYD 1M1JC 2E5TA 2NR4A 2ZYAA 2OYHA 3WUTA 1BCCE 1NEKA 1RE4A 1PP9E 1SQPK 4C7NB 2VASA 3S4UA 1J5ET 1NTKK 2C0SA 5AW6B 2L9QA 5L3DB 3TK1A 3CCRP 1KV4A 2A2FX 1X79A 3PURA 2Y9YA 3KXDA 3H1JG 4UF0A 4TLFA 3CPWO 1FC2C 5ABFB 2NW8A 3L75G 2BBJA 2YDQA 5TISH 1LJ2A 5CJ0A 2H7HA 1EZ3A 4KHZF 2WSEH 5B66E 3RQUA 5H6QB 1T2KD 4H13B 2X66A 1J1DC 2LHNA 3O8ZA 3HD7C 3RK2B 3VMYA 2ACXA 4LMLA 2V7JA 4K0KT 1M62A 2O01N 5KJ7C 3AE8C 2HODA 1VQ6P 1OWAA 4EXTA 2N1TC 3E7KA 2J47A 3TGUD 3N5LA 1SQQG 5APQA 2R3CA 1HF9A 3CWBD 4ISTA 3L70G 3CCUP 1SFCC 4UV9B 4AQFA 3I55P 2FFDB 1TU3F 2OYIA 5AVRB 1KZUB 1D1BA 4JI5T 1KNZA 3Q1MA 3BCCE 1ZN5A 1IAPA 2JIWA 2VK9A 2WMNA 3WAJA 1KORA 1FZEA 5TISE 2POHA 4D6TG 2MOZA 4NPFX 2XZEA 2M6BA 2ZFCA 1JY2P 2CK3H 1YQ4C 3N4XA 5APXA 2VVSA 3T97A 3P8MC 4QH1A 1FU1A 3RQWA 3ZC0A 5ABEA 4PJJA 1BR1A 2BBHA 1L4AD 3JC6D 4GIWA 3VTPC 1KQLA 3C4XA 2X9XA 4ASVA 2RH0A 4IDOA 3EDVA 3H1HD 1CI6A 2JP3A 2H43A 1JMMA 1MNDA 4B3TT 3C4ZA 1SQBE 4C7RA 1ZP0A 2LJLA 3LBXA 3AA0B 3CQXC 1Q2NA 5KKZC 1JCDA 2BZBA 4JPZB 4DV1T 2BCCJ 4NPEA 3E1IA 2OARA 3ZJ1A 2WSSH 4ZI2C 5LG4A 2I6HA 1LTJC 1HTLC 1L0LE 1BE3D 5KMGP 5ADXL 4P0BA 1OW7A 3B13A 2Q7CA 3ITKA 1V9DA 1URQA 1SQVG 3JCFA 3CX5I 4DJGA 4WY4A 3FXEB 2E74B 3IAOA 4I2LC 3P7IA 1KILB 4L76A 4JUYA 3CMLA 3H1IG 2K5BB 2KYVA 1EQ7A 1HJ0A 3H1JD 2D9DA 1QL2A 3CMAP 2RA1A 2E76D 3L72G 3L75D 1FZCB 1EXJA 2WZIA 3PUZF 3QNUA 4YSYA 3K3OA 5JR9B 4U7JA 4WW0A 5FP3A 3AEFA 4JEHB 1AQTA 3LSVA 2UUCT 4CXWA 5F3JA 4O4IE 5J1GA 5LXTE 2YMYA 2LEHA 2XM1A 3UFEA 1OXZA 2A45G 2JEEA 2NPSA 3JSVC 1Y64B 4H9SE 4UVAB 4N6JA 1GL2A 1SQQD 3KVAA 4BWNA 3L70D 1BDDA 2ACZA 4LF5T 1OW8A 4I1LA 4C46A 1L0NE 5AQHB 3VP8A 2V5CA 3N9OA 5CBNA 3CXHI 4DCKA 2C0XA 2WU2A 3CCEP 3MUDA 1YI2P 2HN1A 2UXXB 2XASB 3M9BA 4WYVA 3EUHA 4D6TD 5EZYE 3F57A 1P84H 1K73Q 5AW2B 3R4YA 5AW3B 2Z4EA 2CXLA 3FBZA 4NXNT 1BR4A 4H44D 1RF0A 1USDA 4H0LC 3ZN0B 4ZKUA 3RYCE 5HWXA 1UUSA 4DR3T 5H6RB 1AQ5A 3PJSK 3AA7B 2VL0A 1SQXG 1MMNA 5CCHD 1MMAA 3Q5DA 4DV4T 3CVRA 3WUUA 1NAYA 2LRLA 4YTMA 1IFNA 4I0UA 4HFDA 3L73J 5LHGB 2K1AA 4ZI3D 4CXXA 5AQGB 3GHGB 4X66T 3RK3E 2JQQA 3ZSTA 2WDRA 2LKMA 2E9XC 3HE4B 1NVOA 1VQMP 5AQPB 5FY7A 1ZW0A 4QXHB 5AW5B 1CSBA 2WT7A 2NW7A 2AXCA 3LIDA 3Q2MA 2R5DA 1N34T 2XM2A 2HR3A 3RKGA 3G4SP 5HEHA 3CCLP 3HUSC 4BXLA 3ZCJA 1P84E 4HWDA 4ASKA 5L3BB 1QEXA 3L74G 1G73A 3B71A 1US7B 2JJLA 2KLUA 5JQGE 1SQVD 4AQYT 4C7NA 3OJAA 1JM0A 1KYOH 2KMFA 4CN6A 1I94T 1PPJE 3KV6A 5AVUB 3H1LE 3RYHE 2AEJA 3P32A 4ZZCA 4IE4A 3H1ID 3K3QC 5AW8B 4LF9T 2EHOC 3CIRA 3T1YT 4JEUB 1L4AB 5ABFA 4P1NA 3L72D 3CCQP 3O1IA 2P10A 3AEAC 4V1Av 3AE4C 3GW6A 4I6MC 4A5XA 4PW8A 1N73C 4UB6E 2E5YA 3GF3A 3G6EP 1ZHCA 1N33T 3KVBA 3FZLB 1SA0E 2VRSA 3HTKB 5IUXA 5LOVE 3SFEC 3AXJB 4PFPA 3C64A 2G0UA 2FBWC 4EB6E 1EZVI 3LG7A 4DV6T 5KLVJ 3HE5B 1DEEG 5FL1A 3EVYA 1XTCC 2JQHA 2XQ9A 5FVLA 1KYOE 2IZ1A 1NTZG 4Y99B 2ZT9C 2VKHA 2KWIB 4EEDA 2UXCT 3B8EB 1LRZA 2JPFA 1PV3A 3PUYF 4DZOA 3CCMP 4KX6A 2IBZE 2E2AA 2LT3A 3EWKA 4MLKA 2E76B 2WPSA 1JO5A 4DR6T 5CBOA 1SQXD 1XTGB 2IMLA 4ILUA 1VDFA 2O1JA 3RPUA 1NTMJ 4PFOA 2IBZG 3OTOT 5LGTB 3QB5K 2G3AA 4YT0A 2XAQB 1SHZC 2VKJA 2NPSD 4P0AA 3O4XE 4NPPA 4UELA 3H1KG 2WBLA 3L71G 2BG9B 3GA8A 3AEDC 1KQFB 4ZEYA 4JBWF 2GA1A 2XQ8A 1MV8A 4PD4H 2C5KT 2OYHB 3N2KE 3L8RA 3L74D 3AE9A 1XDPA 3AE7A 4C90A 4PJ0H 5GTHE 3AE2A 3M9HA 1RH5B 5JRCB 1UURA 5JDLA 3M3ZB 3UQ4A 3E08A 4UF0B 4H44B 1KILA 5B5EH 1IFIA 2P67A 1JY3P 4KMCA 3AECA 1M7KA 4DV3T 5FY0A 3QWOC 1LT9C 2BVMA 1FZCA 2FYUK 2JWAA 3UQ7A 1GZLA 3AVRA 2XQ6A 2N9DA 1JOCA 1N7SC 3AEGA 5JR9A 2PRRA 2YMKA 2Y0EA 3P7KA 3II6A 2ZM2A 2B9BA 5TAOA 2QJKB 2QJYB 2HODB 2YEVC 3TDKA 4FI5A 3VHLA 2LSIA 3AB3B 3H1HJ 1LGHB 2QA4P 2BS4A 3RIFA 4PD4E 3NWIA 2VWAA 3AE5A 2RMZA 2J5UA 2JDIH 5JDNA 1KILE 3U3IA 3SWYA 1NAFA 4XA4A 2OYIB 3Q5XA 2LHRA 4TNVA 1NTZD 4B3MT 3Q5WA 2X0YA 1NKZB 2MAWA 2WQYA 3T1HT 5APSA 3P4SA 5KLIC 2FYUG 1JB0J 3ABVA 1GW4A 1W09A 3K5BA 5KLVK 1JY2N 3T97B 1Q81Q 4HWCA 4LF4T 4PJNA 1LWUB 5APTA 3G06A 4AYCA 1URQC 4AKHA 3BRTB 1CI6B 5LJMA 2CXDA 2IAKA 5LHIB 3S9OA 1LTSC 3F2EA 4QH5A 5DQVA 5HXRA 1NU1J 3LBXB 5AW1B 4H63H 4DBQA 3H3AA 1SLQA 1NHLA 2IBZD 3C50A 1BGYE 2D2SA 3KBTA 1LVFA 3M0DA 3EABA 3AAEB 3I56P 2I0MA 2RPAA 3AE1A 3HE4A 3NBXX 4H9RC 5CJ4A 1BCCJ 4U3FG 3CK6A 1PP9J 1YXRA 2WSCH 3C98B 1HNWT 3H1KD 3N9LA 4EYYR 3ZYKA 1VQ5P 1DD4A 2Y0DA 3L71D 3TNUB 1OEDC 4I50E 1NTMK 5E79H 4HKZH 2D2CC 1IBMT 3RX6A 1YTZT 1W9RA 4H9NC 3RIUA 5IHYA 1RY3A 2IZ0A 4PV1C 1HS7A 1CW5A 3GMIA 3GMAA 4I55E 4EIWA 3CKDA 1FEWA 3Q5PA 3W68A 3L09A 2E75D 1JTHB 2K9AA 3RK3C 4GT1A 2AEMA 3A0BH 5AVYB 3AEBA 2W27A 1WMKA 4KBMB 1HX8A 5CA1E 1NH4A 2LXCB 1EDLA 4GKGA 2B1EA 3ZKRA 2KNDA 3PTRB 2WWVA 1H89A 2J4GA 1H8AA 1E1HB 4M1PA 3AA1B 4YY3T 5JDFA 2IW5B 5BMVE 4DV5T 3A8YC 2PFVA 1RHZB 1AJYA 1HTJF 5E79E 1X0TA 1YYCA 3AE6C 1IBLT 3BCCJ 1VF5C 2NPSB 4DR5T 4KJMA 2VKDA 3AXJA 4DBRA 2JMKA 2N1TD 3ANWA 1H0TB 1S3JA 3HE5A 1Y8AA 2NP9A 4WNKA 2WSEJ 2P9BA 4YXDC 3X1DA 4A98A 5APYA 5BU5A 3GN5B 1KFNA 1S9KD 2XQ4A 3UU4A 2V4HA 3A0BE 4HTEA 1N86A 2MTQA 4ISSA 5JDHA 4CI2B 4K35A 4G2AA 5AVXB 2LSYA 3EFGA 1SQBJ 3PH0A 2C9NY 4K0UA 2WDVA 4AKRB 4E7SA 1J1EC 3P4WA 1JNZA 3M9QA 1H7CA 2XQYA 3HKDE 2XNDH 5EK4A 2WPQA 5H2FH 1WLXA 1EZVG 4TT3H 2IPPA 3KHUA 1IFMA 2W90A 4BAYB 2MJZA 1BE3E 3BATA 1PZQA 4HWIB 4NPDA 4JI0T 1JUNA 1L0LJ 4H9QC 4CI1B 4W7YA 2WT7B 5B66H 3NXSA 4HFIA 2J59M 4U3FD 1AFOA 1RE3C 3RYFE 3A2AA 1HWTC 1NU1K 4JQ0D 1VL2A 4E7ZA 3H1JE 5J2TE 3RK2C 1YITP 2ZMAA 4X65T 2Q1KA 3S4RA 1QVGO 3L75E 2KZIA 2XQ3A 2CLYC 2R3SA 3OJAB 1KB9E 3M06A 2JMHA 5JRCA 2CRBA 1YTZI 5C3JA 1BDCA 5H2FE 4EI2A 2FFDC 1ZLLA 2O01H 1XNQT 2KINB 5EFWB 5LMNT 1G2CB 4EYYQ 2JKVA 3LIEA 2AEFA 1M8OB 5AVVB 3UT5E 5CCHA 1BSHA 1S72P 1CUNA 1SQQE 1JNRA 4WBAA 2BG9E 1NTKE 3L70E 3RRWA 3RL0D 3NFQA 3FZKB 4JI3T 2CPSA 1X9VA 1RQUA 3OW2O 4TV9E 4ZS2A 2Z5HA 3WU2E 5JDMA 3N9NA 4KP3C 1L0NJ 3SSUA 1AA0A 5M4YA 4D6TE 4CXYA 1NO4A 1KK7A 1SQPG 4X20E 4I7ZB 4G63A 1NTKG 1AV1A 2YU1A 3KZIH 2CEAA 2WM9A 4Q25A 1VQPP 2CHOA 3LFMA 2IYPA 3WUVA 2AXDS 2ZM6T 1FS0E 3CCJP 3NVOA 4HFEA 4DV2T 2BVLA 1W5CE 4UIGA 4ERRA 3IHRA 4EOTA 2OTLP 3FZFB 2NW9A 2K48A 5JH7E 4WB4A 4ILBA 4LLHA 2YXQB 2K37A 4K3AA 3T8OA 2YKQA 1IFDA 4ILAA 1CHUA 5A1LA 2E75B 3CI9A 4OGQC 2WZHA 1LWUA 4H0LD 4QX7B 3TLTA 1LNQA 1X8YA 2WDQA 2LM9A 4HKAA 3TLWA 5FYMA 2ZAEB 2H89A 2X0LB 4OK0A 3SWFA 2E74C 2ODUA 4YSXA 3ETVA 4GYRA 3A0HE 2Q3EA 4ASWA 5J2UE 4J2CA 3KZIE 1K9MQ 1UGOA 5LBMA 1LTIC 2CBIA 3VN0A 1DEBA 5F8PA 1SQVE 5AQMB 2XU6A 2E9XD 1YIJP 4EEBA 2A06E 4F8HA 1FZFA 2V6YA 2PBIA 2K9JB 3TNUA 1FDOA 1UX4A 2L91A 3H1IE 5AFUL 4A56A 1BSNA 3H1LJ 3L72E 2V26A 2LKHA 2XY8B 2OQQA 1L0LK 2LKGA 4LMKA 4U7YA 5JVDE 1B7TA 2FYNB 1I6ZA 2A06G 5AQQB 3WAKA 4XFJA 1WT6A 2C5JA 2Q9QA 3PDYA 2NRGA 2KSJA 1JY3N 1JTHA 1LTBC 3B57A 5KAFE 3FHNA 2I59A 1WRDA 5DQWA 3ESLA 4IDZA 5DABA 2V6XA 5APVA 3ZPOA 4YHHT 1KB9D 1KTMA 3Q5SA 2KB7P 2M5AA 2KLVA 3AE3C 1M56D 1LTGC 3PUGA 1ZOYA 5CHXA 3FGAD 2W63A 1GU4A 4DOJA 1O3XA 3PUVF 2I1KA 3ZT7A 3VR8A 2ZM8A 2WPRA 2N2NA 3D0TA 1SQPD 2FXMA 1PGJA 3RIAA 1NTKD 1T2KC 1H0TA 2LSKA 5AQRB 4IE5A 2Y8DA 3GHGC 3PUWF 2W61A 4DR4T 1D7MA 4YXWH 1EDKA 3GN5A 1LTJB 2E5VA 1SQXE 3ZCIA 1L0NK 2YKSA 3JADA 3J9X1 2KK7A 5IYZE 5KAIE 2XAJB 2MKVA 1YD8G 4YHJA 2WMMA 4QKNA 4M3LA 3NKZA 1EC5A 2I1JA 1KNPA 2X68A 2WSSV 5FNVE 5FXWA 5LB7B 2HPLA 2IDOB 2N9YB 4R4LA 3RL0B 4P09A 3QH9A 5M1BA 5AVSB 2H3RA 4DR1T 4NIQA 4IE7A 1UX5A 1DU2A 1ZMEC 3VRAA 1T6AA 3L74E 1L4AC 4UB6H 3KFWX 4Y28J 3ZMTB 3ZMVB 3B4SA 2CE7A 5LGNB 3MACA 2GM4A 3B5NA 2E43A 2M3EA 4H9PC 4EZ4A 5FMNA 1FJKA 2PFXA 2ZYDA 2FYZA 1QX8A 2AE9A 4YJ2E 4WVZA 2W67A 3HR0A 3GG2A 3PUAA 5EK2A 3HRNA 4U74A 3TLVA 2OLTA 1SE7A 3R84B 1GTWA 1VCTA 1LP1B 1T8ZA 3RYIE 3DP7A 2A06D 2CMRA 3PTZA 3CX6B 3MZWB 4LF7T 4Y99C 2KUBA 2YXRB 2M6IA 1KMIZ 5AW0B 1VQNP 4H0LB 1SS1A 5AQFB 1G2CA 5BVZA 1NOHA 2SPCA 2JQ9A 4IT4A 4HWHA 4GOUA 2DHRA 3V2QA 1OVUA 4N78D 2N1GA 3E0ZA 3MHVA 3UU3A 3P4PA 1NTZE 4CZZB 2BS3A 4IE0A 4YLHA 2FY8A 4YTPC 3CX8B 3VMAA 1MFTA 2ZVNB 1HJBA 4QXCB 2V8SV 3BRVB 4IDQA 3AEEA 3ANWB 3I9WA 1GMJA 4B3ST 3C9IA 3RGUA 2G8YA 4JI2T 3MGNA 4JLEA 2BCCG 1HVVA 3OAKA 1YKEB 1R8IA 1YQ3C 2PGDA 2V7QH 1MNEA 3HUSB 1WFDA 4PJMA 3ZYMA 3O1HA 2BKOA 2Z5IA 5AVQB 2CWOA 1M1JA 2I8DA 4YFSA 1RF1C 4Z90A 1OVVA 4UVBB 2BG9C 2XAGB 3I1AA 2KWHA 2CM0A 4PK5A 2Q9QD 4OH8B 3RF1A 3D70A 3VRBA 5AQIB 1BGYJ 1GK4A 3C51A 4EOZB 2VQET 2OYHC 3U1CA 5GTHH 1RE4C 1IJ5A 3DTOA 4U7IA 4KI0F 3QB5A 3M65A 3H1KE 4EZHA 3HA4A 1S5LE 3L71E 1MMGA 2XQ5A 5FKYA 3GF7A 5ABHA 1MFZA 4X1YE 1Q82Q 3H37A 3RRCA 4H44C 3MTUE 3NZQA 5HEOA 4GKJT 2HPCA 1YKHB 1FZGA 3BQIA 2IC6A 3CWZB 5FXZA 2OTJP 3JCUH 2BS2A 1HGZA 1Q90D 3HD7A 5L3FB 3V5BA 2AXTH 2B87A 4GOFA 5LMUT 5KJ7A 2UUAT 3AE8A 2H7VC 1N7LA 4GYSA 2N1TA 2WAUA 1FDIA 1HR0T 2PTFA 2K9JA 1VCSA 2QJKC 2QJYC 2PG8A 1SFCA 4DIDB 4W7ZA 1UCUA 3AA6B 1LT1A 1NKNA 1HCIA 3TGUJ 2L8KA 4PNIA 2IDBA 2JR8A 1R8EA 3CWBJ 5HCMA 2XTLA 1HFAA 1FMWA 1MMDA 1T72A 2V5DA 1PGQA 4AQFC 2V7IA 4BA9A 2WSCJ 2OYIC 2IFMA 4BJNA 4PK6A 2XPKA 2WP9A 2X67A 1YQ4A 1AVOA 4AIUA 4RKUJ 4AXPA 3GLMA 3ONLC 3CX5E 2KP8A 4MN4C 3UUNA 3JCUE 4JI1T 5CCGD 3PJAA 3KYQA 3W15B 2AXTE 3IN6A 2CPTA 1VPCA 3PUSA 1S9KE 4MHCA 1DIPA 4U33A 3L73G 1VQ4P 1Z8UA 3VKHA 3RL0g 1KQSO 3I9YA 3FWNA 3E22E 4DVDA 3VKGA 3N7NA 5F5WA 2FYUE 2W6JH 2H89C 4IL4A 3B5ND 3SFDA 1ZP0C 4AQRD 1OZHA 4OYKA 3MP7B 3L3PA 1QGKB 5LGUB 3DJBA 2VKOA 5HXHA 1LTJA 2CHNA 4UEMA 3L36A 3ZSSA 3A7MA 1D0ZA 1FAVA 1S5LX 4OVNF 1IFPA 3JAEA 1USEA 1E2AA 4IGUA 3KQGA 3N9PA 4JI8T 5DJTB 5LBQB 1T3JA 2XAFB 5LYJE 2QA7A 2VURA 3LK42 3PRJA 1BE3J 4IOIH 1T98A 4EDFA 3CXHE 4BRYA 4CQIA 4U3FE 5JDGA 2IC9A 3OKQA 1LT9B 2W62A 3HKBE 1M90Q 4WY4C 1Y9BA 4IIJE 4AI6A 1U57A 1Z0PA 1J1JA 2R6GF 3UUMA 5L8RJ 4IL6E 1JY2O 5KLVE 2Q3IA 4B3RT 3PUQA 4RJTA 3VMZA 3H1JJ 5HAXA 2DNXA 1KD1Q 3L75J 4Z8XA 3UFGA 1UK5A 2C5IT 1KQGB 3EAMA 3FZMB 1XWMA 3C4WA 3LDQB 2V6YB 5TJHA 3AEFC 5CJ5A 1LTTC 3H32A 4ZKPA 2XSBA 3IA3A 2GUSA 3FWLA 2KS1B 5KLVG 2OTKE 3IR9A 5CA0E 5C2TA 2K24A 3KV9A 5L47A 2P2UA 2XUEA 3VYIA 3A7OA 2NPSC 2IYOA 2ZM0A 3LK2B 5AQOB 1GL2C 3K1SA 1SQQJ 1XMOT 1T3UA 1H88A 2FUPA 1NTKJ 3FB2A 3RH3A 3L70J 3NTNA 2ZLYA 1LP1A 2PJQA 3ZLIA 1GK6A 5L4EA 2Q9QB 2W0GA 3G3ZA 4UXNB 1K8AQ 3M0AA 3MUDC 3Q5RA 3M91A 1VRBA 2J1DG 2WMOA 3IBPA 1OMIA 4D6TJ 3TSIA 1IJDB 2XJ7A 4HEAA 2M5AB 4GK5E 3PP5A 2LM2A 2W00A 4ANJA 2VL8A 1RF0C 3BQLA 3E1RA 2QJPB 3CPZA 1NTMG 4EAHA 3L73D 2R32A 1L2PA 4L73A 5CMZA 3HD7D 2JO1A 5GTIE 1MIVA 4TN7B 2Q5UA 1J2JB 5KJ7D 1LVKA 2O01J 2D5UA 3F31A 2E9XA 4U2ZA 4ZOLE 3CMEP 2RP4A 3CX5D 4DV0T 3MK7C 3LW5J 3KDSE 2D0TA 4WWIA 3S1KA 2QRXA 3IF4A 1OEDB 1SFCD 3SWHA 4LF8T 1FJPA 3HUSA 3SWKA 4O2AE 1YBKA 5BR8T 4H63V 4TUYE 3C1LA 1EZVE 2KZ7B 2FYUD 2UU9T 1SUMB 2KNCA 1A02J 2WY2A 1VOMA 4IL6X 4TZ4C 1FIOA 1G8XA 3FXDB 2FKWB 2MYSA 5FVKA 2JJ9A 5AQKB 1IK9A 1KB9H 4LF6T 3CX7B 1XZYA 4H9OC 5LG3A 1SQVJ 4HFHA 4OGQD 2YU2A 2EHOA 5CB4E 4F6RC 2O3JA 2W6AA 5APUA 3AEAA 1A02F 3AE4A 4AKGA 1BR0A 1N73A 2MPKA 3CC4P 3H1IJ 2HHHT 2E74D 3L72J 4JI4T 1E79H 4UR9A 3CXHD 2UXNB 3MKDA 4HYTB 1Y01A 4U3CA 1NYHA 3IF8B 1N32T 3B5NB 3FBLA 3WU2H 3SFEA 3ZDMA 4H13C 2X9HA 2FBWA 3KINB 1IJ6A 5KLVD 3PU3A 1QL1A 4X62T 4ZI2D 3RC3A 2DLRA 2E42A 1X9BA 1ZRTD 2QM8A 1P84I 1WR6A 2OA5A 1QVFO 4TWDA 3UUBA 2J58A 4I7ZC 3OPCA 4O4HE 2DL1A 2XDJA 1E7PA 2K3WA 4JI6T 4NUUA 3D71A 3ZMUB 2R5BA 4OWFA 2A3DA 5HWYA 3CLQA 1KN7A 4KUMB 3P4QA 3WMM0 4KT0J 3I0QA 4JYCA 3LW5H 1DD3A 1SQPE 2RN0A 4EGWA 3EI0A 5IWAT 2QM7A 1SQQK 3V2PA 4CI3B 2FJDA 4IFFA 5KTBA 3TLSA 4YSZA 3RLFF 2WTYA 4I43B 2E75C 1NU1G 1NTMD 2E8IA 4X5TA 2IHR1 2KIKA 1SQXJ 1M7LA 2YNYA 2X0HA 3CCSP 2B76A 3RKOA 2YDRA 4Z1MH 3H25A 2JRKA 3A0HH 1BCCG 5HEUA 1PP9G 4UV8B 2ES0A 3RC8A 2V7LA 3OA7A 3AEDA 4W80A 4BJMA 4UVCB 1KYOI 1S4XA 4FJOA 3SRZA 1M57D 2YIUB 1VQ9P 4L5GA 2L3LA 1M1JB 2CLYB 1XMQT 2UWJE 3QK6A 3TLUA 1RQVA 4CN4A 3L39A 2HG5D 2W2UA 1FZAA 4TNWA 3NRXA 2NWBA 3QC9A 2IBZI 2KOGA 1NWQA 3AE9C 3L74J 1NWMX 3AE7C 3AE2C 3VR9A 2ZYGA 2XKMA 3QOFA 1LT9A 2FYNC 2N9BA 1YJ9P 2M8RA 1EZVD 1S94A 2BKPA 4OFZA 3P8CD 1YHQP 1KILC 2W6BA 2HPCB 1SQBK 3AECC 5KAFH 4GIFA 2A45H 1N7SA 3PUXF 3C8VA 4R4MA 2C0WA 3ZMZB 4AQGA 1J1DB 2NZ2A 3HD7B 1FZCC 2B87B 3UU8A 4GK0E 2Y0CA 3VOPA 1SQVK 2N1TB 3AEGC 3BCCG 5JR9C 3ZN1B 3ZT6A 4L74A 3N9QA 1G1IA 2KSRA 4L75A 5CGMA 3D6ZA 4LMJA 3ZT5A 2KS1A 2XHEB 4DUZT 1SFCB 1OIPA 2CPBA 1Q86Q 2LSJA 4LFBT 4IE6A 3NMDA 1FMVA 3AVSA 2LE8A 3AE5C 2L5GB 3SFDC 2QGSA 3I0OA 2DCFA 2W8ZA 3OYXA 4N78E 3U78A 1HGVA 1FOSE 1JEKA 1YJWP 1X22A 3MZKB 1NTZJ 4HH2A 3KPEA 3CC7P 4AISA 2SPZA 1HH0A 1SQBG 1IBKT 5KAIH 5EK3A 4OYJA 2WQYC 2BASA 1OVRA 4DR2T 4OGQB 2EHOD 2LOPA 1PGOA 3ABVC 2KT9A 3NRYA 3FZHB 3IFMA 2QEXP 1VQLP 1LKXA 3K3NA 2WWUA 3V5SA 3RHWA 5HYAA 1NU1D 1MKMA 1JY3O 5K5GB 2DI4A 1LTAC 1W2EA 1SVFA 1QLBA 5JREA 1L0LG 1DX7A 5KKZB 2YDSA 3O6QB 3RL0C 2PP6A 1YJNP 1BCCD 1SP4A 1PP9D 2YO2A 4PD4I 2J62A 3HI2A 2FJAA 3TKLB 3M0DC 5AW9B 3CQGB 5AQLB 3AE1C 1OEDA 3RBZA 3MA9A 3O1JA 1PIXA 4Z91A 1ZV8A 2ZT9D 1SQXK 2Q6QA 3UULA 2MBGA 2OYOA 1MIWA 3BASA 5LCYA 3H1KJ 1M1KQ 3V4WA 3WI3A 3L71J 3JC22 4EV6A 3U59A 1HG2A 3V2NA 4YPCA 5L3EB 1K05A 3FXDA 4BRYB 3RIUC 4KHXA 2K88A 4IHJE 4QWNB 3W67A 4ZMDA 2V7QJ 4AKIA 5CCGA 1YW0A 2HPJA 4ADZA 2KI7B 1KNRA 4OX9T 2C9LY 3D6YA 1OEDE 5DJQC 2BEQD 5FL0A 4DUYT 1FBMA 3AEBC 4MFRA 1EDJA 2Q9IA 2CA5A 3JC6C 5AW7B 2Y9ZA 4NXMT 2UUBT 2UXBT 1L0NG 4X64T 2JWDA 2P58A 3H32B 5GONE 1NGMB 3AE6A 3BCCD 2M3BA 2A72A 1N36T 2VB6A 3FX0A 2W83C 2H8PD 3R2PA 1IZNB 4NUVA 5ABGA 4LFCT 4TWHA 3ZMSB 3RGLA 1MUUA 2WU5A 2CWYA 4YXDA 2XAHB 3ONJA 4PAGA 1EXIA 2WCAA 2V7KA 1KEYA 4JV5T 2X9WA 2ZXXA 1D1AA 2BKNA 4HE8A 1XDOA 1N2DC 1U7JA 5AQTB 4LGDE 1ZKEA 3Q2YA 2V7MA 3EHZA 5HXEA 2YOEA 1SQBD 4PJLA 3JAFA 4U72A 1BR2A 5C39A 2P7JA 2Y6XA 2FYUJ 1E5WA 1ZEEA 4HFVA 4JI7T 2LRKA 2BCCE 4DO0A 2CCQA 1R5LA 2A9UA 5KX5E 5L4HA 1N7SD 2FXOA 1NTZK 5HCJA 3USSA 1NJIQ 2E76C 4JBZA 1S5LH 3UUXB 2XQAA 1W0AA 2E9XB 2RKLA 3PJAJ 1L0LD 1PGPA 2UXDT 3SS1A 4CN1A 5AVWB 4JYBA 4ZS3A 2D0UA 1RE3A 2IFNA 2WPVB 3HKCE 2NTYA 2H88A 2QIWA 1PPJG 1QLED 1VQOP 3H1LG 4IDNA 3G9RA 4U3FJ 4UB8H 4KHPT 4U31A 4GKKT 2XQ7A 2KNCB 2BEZF 1QSDA 1JMBA 4U2YA 5JTGA 3KV4A 3J7Yq 1L0VA 5KDMC 2CBJA 1ZR2A 3Q9DA 3B5MA 1GW3A 2FJBA 3V6IA 2DWGA 2FFDA 1GDTA 1T8BA 3H6PA 2EHOB 3IEEA 5L3CB 1URQD 5FY1A 5AVZB 1EDIA 3MJXA 1N73B 4WY4D 2Y48B 2LR2A 2QVAA 3VP9A 4ZXLA 4COFA 4EYUA 1HF8A 4O4JE 3CX5H 5CCHC 3N2OA 4ZZBA 4N3YB 1L0ND 1GQEA 2M0BA 3L35A 4LFAT 2W66A 3EFFK 3VU7H 2HYNA 1HX1B 4UB8E 2KSEA 4IDPA 3F5HA 3TF5A 3PV0F 4ZI3C 2KZJA 4OHFA 3SOLA 4GODA 1Z56A 3BVHA 2LOSA 2D2CD 4GOEA 5ETWA 1WR0A 1HG5A 4IREA 2ZT9B 1KFMA 4L0RA 3AAAB 1ZV4X 4PV1D 1FZBA 1OX3A 1GL2D 2QSIA 1KB9I 4IFMA 1RF1B 2QYWA 1U7MA 3L73E 3BQKA 2YO3A 3AAIA 2W4XA 2M67A 3RK3D 3MXZA 3PE0A 2ITAA 1PL5A 2X51A 1S1CX 2HH7A 1ZR4A 4YJ3E 3CXHH 4DV7T 4RESB 2WB5A 1X79B 3FXEA 5AQJB 3EDUA 1LWUC 1PFIA 4HB1A 2P1JA 1GU5A 2LLYA 2NTXA 1P84D 2WSFJ 4IL6H 4HGAA 3NZPA 2JQKA 2QE7H 2YK0A 1FJGT 1VF5D 3O6QA 4ZHQE 1VQ8P 3MIWA 2XZRA 3L4FA 5AQUB 2BCCD 2HLOA 2FXPA 4X1IE 1DH3A 5AQNB 2DWKA 1PPJD 3I5CA 3UU6A 4AKLA 3RBXA 3H1LD 2K3RA 1IK7A 2GUVA 4MBQA 4HFCA 4ZI7E 5JDQA 2LSGA 4TV8E 1VQKP 1WCRA 3Q5EA 2CXFA 3ZEFB 3F89A 3N9MA 2XV5A 2ZJSE 4PJ0E 3V2RA 1OFCX 4DT0A 1NENA 2YKOA 5FXXA 2KLQA 1WYCA 4HWFA 1JCCA 4IFDK 5AQSB 5B5EE 3CC2P 3P50A 2E5LT 1IO4A 5LNKA 1W2BO 2Q9QC 4ILCA 1WRGA 5LHHB 1N7SB 3A5TA 1W0BA 3PHLA 1T7SA 3PU8A 4IL9A 3AE3A 1ZRTE 4B6XA 5FXVA 1KYOD 2PAJA 3L37A 1HNZT 2DW3A 3MD0A 2YN6A 3CQCB 5LP6E 1UIXA 4O8SA 3N2GE 1ZOYC 2ZVOB 2QJPC 1VQ7P 2H7OA 5GTIH 4QHOA 4WBOA 2B88A 4H13D 4QXBB 3KBUA 3LK3B 1S35A 1D1CA 3P4RA 4X1KE 3RK2D 3ZJ2A 3GHGA 4LC1A 1MIYA 1CZQA 4C91A 1R5SA 1OW6A 3K8PC 1SQPJ 1HBWA 2VVNA 5KXJA 2OV9A 5KLIB 1U5PA 1KF6A 3HL6A 2QG4A 3OBVE 4I4TE 1NTME 2HFED 2IUBA 4O4LE 3TYYA 2WSFH 1Q7YQ 2WS3A 3KDPB 1FE6A 1BGYG 2NOXA 1KC8Q 1IFJA 4XE5B 1URQB 3KV5A 2F4VT 1KFYA 1Y47A 4RO0A 2A45I 1AJ3A 4JYAT 4WY4B 5BU8B 3V4QA 3G71P 1IC2A 2WVRA 4CPGA 5AVTB 4L9IA 5J0ZA 2VQFT 1G1JA 2KXPB 1WYBA 5AW4B 4O9BA 1K04A 2BDEA 4TWFA 3VMXA 3UTKA 5CCGC 3CL3D 3TGUE 1L4AA 3H3MA 2WITA 2WWWA 5E0OA 4QX8B 2K9YA 3OVUA 2ZXEB 3CWBE 1D0XA 2OGUA 3U1AA 4O2BE 5C8YE 4QMAA 2HN2A 4TX5A 4B86A 4MALA
chains in the Genus database with same CATH topology
5L3GB 2YINA 2ODVA 2IX7C 3HTKA 3B5NC 4XZCA 1U4QA 2YKPA 3A5XA 3P8CE 1QUUA 1GL2B 5LA6E 3EQ2A 2Z6EA 3ETUA 4AUWA 3ONXA 3QUJA 1D0YA 3RK3B 5APWA 4DNDA 3OYZA 3A3YB 2V1DB 5L2LA 5HXSA 4DMWA 4XBFB 2GK9A 1KILD 4EIJA 1HUCA 2X9YA 3ZYLA 4WBNE 3GWHA 4PK4A 4HN9A 3BK9A 1MZ9A 1FDMA 2O1KA 2WZ7A 3UIAA 1GD2E 4JF7A 3ZC1A 4XAXB 3LJCA 1JNMA 1FOSF 5HXCA 4DMVA 1RF1A 3O9XA 2XNXA 3HKEE 5LJNA 3R6NA 3V5UA 1J1EB 1M1JC 2OYHA 1RE4A 1SQPK 4C7NB 2VASA 3S4UA 1NTKK 2C0SA 5AW6B 2L9QA 5L3DB 3TK1A 2A2FX 1X79A 3PURA 4UF0A 2NW8A 5CJ0A 2H7HA 1EZ3A 2WSEH 5H6QB 1T2KD 2X66A 1J1DC 2LHNA 3O8ZA 3HD7C 3RK2B 3VMYA 2ACXA 2V7JA 5KJ7C 2HODA 1OWAA 4EXTA 2N1TC 3N5LA 5APQA 2R3CA 4ISTA 1SFCC 4UV9B 4AQFA 2FFDB 2OYIA 5AVRB 1KZUB 1D1BA 1KNZA 1ZN5A 1IAPA 2VK9A 2WMNA 3WAJA 1FZEA 2POHA 2MOZA 2ZFCA 1JY2P 3N4XA 5APXA 3T97A 3P8MC 1FU1A 3ZC0A 4PJJA 1BR1A 4GIWA 3JC6D 1L4AD 3VTPC 1KQLA 3C4XA 2X9XA 3EDVA 1CI6A 2H43A 1JMMA 1MNDA 3C4ZA 4C7RA 3LBXA 2LJLA 3AA0B 3CQXC 1JCDA 2BZBA 3E1IA 2OARA 3ZJ1A 4ZI2C 5LG4A 1LTJC 1HTLC 5KMGP 5ADXL 4P0BA 3B13A 2Q7CA 1V9DA 1URQA 4WY4A 3FXEB 4I2LC 3P7IA 1KILB 4JUYA 3CMLA 2K5BB 2KYVA 1EQ7A 1QL2A 2RA1A 1FZCB 3K3OA 5JR9B 4WW0A 5FP3A 4JEHB 4CXWA 5F3JA 4O4IE 5J1GA 5LXTE 2YMYA 2LEHA 3UFEA 1OXZA 2A45G 2JEEA 2NPSA 1Y64B 4H9SE 4UVAB 4N6JA 1GL2A 3KVAA 4I1LA 4C46A 3VP8A 3N9OA 2C0XA 3MUDA 2UXXB 2XASB 3M9BA 3EUHA 5EZYE 3F57A 5AW2B 5AW3B 2Z4EA 2CXLA 3FBZA 1BR4A 1RF0A 3ZN0B 4ZKUA 3RYCE 5HWXA 5H6RB 1AQ5A 3AA7B 1MMNA 5CCHD 1MMAA 3CVRA 1IFNA 5LHGB 4ZI3D 4CXXA 3GHGB 2JQQA 2LKMA 2E9XC 3HE4B 5FY7A 4QXHB 5AW5B 1CSBA 2WT7A 2NW7A 3LIDA 3Q2MA 2R5DA 3HUSC 3ZCJA 4ASKA 5L3BB 1G73A 1US7B 2JJLA 5JQGE 4C7NA 3OJAA 2KMFA 3KV6A 5AVUB 3RYHE 3P32A 4IE4A 3K3QC 5AW8B 2EHOC 4JEUB 1L4AB 3O1IA 4V1Av 4I6MC 4PW8A 1N73C 1ZHCA 3KVBA 1SA0E 2VRSA 3HTKB 5LOVE 4PFPA 3C64A 2G0UA 4EB6E 3LG7A 3HE5B 3EVYA 1XTCC 4Y99B 2VKHA 2KWIB 3B8EB 1LRZA 2JPFA 4DZOA 2LT3A 4MLKA 2WPSA 1JO5A 1XTGB 4ILUA 1VDFA 2O1JA 3RPUA 4PFOA 5LGTB 2XAQB 1SHZC 2VKJA 2NPSD 4P0AA 3O4XE 4UELA 2WBLA 3GA8A 1MV8A 2C5KT 2OYHB 3N2KE 4C90A 3M9HA 5JRCB 5JDLA 3E08A 4UF0B 1KILA 1IFIA 2P67A 1JY3P 4KMCA 5FY0A 1LT9C 2BVMA 1FZCA 2FYUK 1GZLA 3AVRA 2N9DA 1JOCA 1N7SC 5JR9A 3P7KA 3II6A 2ZM2A 5TAOA 2HODB 2YEVC 4FI5A 3VHLA 2LSIA 3AB3B 1LGHB 2VWAA 5JDNA 3U3IA 3SWYA 1NAFA 4XA4A 2OYIB 3Q5XA 2LHRA 3Q5WA 1NKZB 5APSA 1GW4A 5KLVK 1JY2N 4PJNA 1LWUB 5APTA 4AYCA 1URQC 4AKHA 3BRTB 1CI6B 5LJMA 2CXDA 2IAKA 5LHIB 1LTSC 3F2EA 5DQVA 5HXRA 3LBXB 5AW1B 4H63H 4DBQA 3H3AA 1SLQA 1NHLA 3C50A 2D2SA 3KBTA 1LVFA 3M0DA 3AAEB 3HE4A 3NBXX 4H9RC 5CJ4A 2WSCH 3C98B 3N9LA 4EYYR 3ZYKA 3TNUB 4I50E 1NTMK 3RX6A 1YTZT 4H9NC 5IHYA 1RY3A 1HS7A 1CW5A 3GMIA 4I55E 4EIWA 3CKDA 1FEWA 3L09A 2K9AA 1JTHB 3RK3C 4GT1A 5AVYB 2W27A 4KBMB 1HX8A 5CA1E 1NH4A 4GKGA 2B1EA 2KNDA 3PTRB 1H89A 1H8AA 1E1HB 4M1PA 3AA1B 5JDFA 2IW5B 5BMVE 2PFVA 1HTJF 1YYCA 2NPSB 2VKDA 4DBRA 2JMKA 2N1TD 3ANWA 3HE5A 2NP9A 4WNKA 2P9BA 5APYA 5BU5A 3GN5B 1KFNA 1S9KD 4HTEA 1N86A 2MTQA 4ISSA 5JDHA 4CI2B 4G2AA 5AVXB 2LSYA 3EFGA 2C9NY 4K0UA 4AKRB 4E7SA 1J1EC 3M9QA 1H7CA 2XQYA 3HKDE 5EK4A 2WPQA 1WLXA 2IPPA 1IFMA 4BAYB 2MJZA 3BATA 1JUNA 4H9QC 4CI1B 4W7YA 2WT7B 3NXSA 2J59M 1AFOA 1RE3C 3RYFE 3A2AA 1HWTC 1NU1K 4E7ZA 5J2TE 3RK2C 2ZMAA 2CLYC 3OJAB 3M06A 2JMHA 5JRCA 1YTZI 2FFDC 1ZLLA 2O01H 2KINB 1G2CB 3LIEA 5AVVB 3UT5E 5CCHA 1CUNA 4WBAA 3RRWA 3RL0D 3NFQA 2CPSA 1X9VA 4TV9E 4ZS2A 2Z5HA 5JDMA 3N9NA 4KP3C 5M4YA 4CXYA 1NO4A 1KK7A 4X20E 4G63A 2YU1A 2CEAA 2WM9A 3LFMA 2BVLA 4UIGA 4ERRA 3IHRA 4EOTA 2NW9A 2K48A 5JH7E 4WB4A 4LLHA 3T8OA 2YKQA 1IFDA 5A1LA 3CI9A 1LWUA 4QX7B 1X8YA 2LM9A 4HKAA 5FYMA 2X0LB 4OK0A 3SWFA 2ODUA 3ETVA 4GYRA 5J2UE 4J2CA 5LBMA 1LTIC 3VN0A 1DEBA 5F8PA 2XU6A 2E9XD 1FZFA 2PBIA 3TNUA 1UX4A 5AFUL 4A56A 2V26A 1L0LK 5JVDE 1B7TA 3WAKA 1WT6A 2C5JA 2Q9QA 3PDYA 2KSJA 1JY3N 1JTHA 1LTBC 3B57A 3FHNA 2I59A 1WRDA 5DQWA 3ESLA 4IDZA 5DABA 3ZPOA 5APVA 2KB7P 2KLVA 1LTGC 3PUGA 5CHXA 2W63A 1GU4A 4DOJA 1O3XA 2I1KA 2ZM8A 2WPRA 2N2NA 3D0TA 2FXMA 1T2KC 2LSKA 4IE5A 2Y8DA 3GHGC 2W61A 3GN5A 1LTJB 3ZCIA 1L0NK 3J9X1 5IYZE 2XAJB 1YD8G 4YHJA 4QKNA 4M3LA 2I1JA 2X68A 2WSSV 5FNVE 5FXWA 2HPLA 4P09A 3RL0B 5AVSB 2H3RA 4IE7A 1UX5A 3ZMTB 1L4AC 3KFWX 3ZMVB 2CE7A 5LGNB 3MACA 2GM4A 3B5NA 2E43A 4H9PC 4EZ4A 5FMNA 1FJKA 2FYZA 4YJ2E 3HR0A 3PUAA 5EK2A 3HRNA 4U74A 3R84B 1GTWA 1T8ZA 3RYIE 3DP7A 2CMRA 3CX6B 4Y99C 5AW0B 1G2CA 5BVZA 1NOHA 2SPCA 4GOUA 2DHRA 3V2QA 4N78D 2N1GA 3E0ZA 4CZZB 4IE0A 4YLHA 3CX8B 1HJBA 4QXCB 3BRVB 3I9WA 3ANWB 3C9IA 3MGNA 4JLEA 1HVVA 3OAKA 1YKEB 1MNEA 4PJMA 3HUSB 3ZYMA 3O1HA 2Z5IA 5AVQB 2CWOA 1M1JA 4YFSA 1RF1C 4UVBB 2XAGB 3I1AA 2KWHA 2CM0A 4PK5A 2Q9QD 4OH8B 1GK4A 3C51A 4EOZB 2OYHC 3U1CA 1RE4C 1IJ5A 3DTOA 3M65A 4EZHA 3HA4A 1MMGA 1MFZA 4X1YE 3H37A 3RRCA 3MTUE 3NZQA 2HPCA 1YKHB 1FZGA 3BQIA 2IC6A 3CWZB 5FXZA 1HGZA 3HD7A 5L3FB 3V5BA 5KJ7A 2H7VC 1N7LA 4GYSA 2N1TA 2WAUA 2PG8A 1SFCA 4W7ZA 1UCUA 3AA6B 1NKNA 1HCIA 2L8KA 4PNIA 2XTLA 1HFAA 1FMWA 1MMDA 4AQFC 2V7IA 4BA9A 4BJNA 2OYIC 2IFMA 4PK6A 2X67A 4AXPA 2KP8A 3UUNA 5CCGD 3KYQA 3W15B 1VPCA 3PUSA 1S9KE 4MHCA 3VKHA 3I9YA 3E22E 4DVDA 3VKGA 3N7NA 3B5ND 4AQRD 4OYKA 3L3PA 5LGUB 3DJBA 2VKOA 5HXHA 1LTJA 4UEMA 3L36A 1D0ZA 1FAVA 4IGUA 3KQGA 3N9PA 5LBQB 1T3JA 2XAFB 5LYJE 2QA7A 3LK42 1T98A 4CQIA 5JDGA 2IC9A 3OKQA 1LT9B 2W62A 3HKBE 4WY4C 4IIJE 4AI6A 1Z0PA 3UUMA 1JY2O 2Q3IA 3PUQA 3VMZA 5HAXA 2DNXA 4Z8XA 2C5IT 3C4WA 1LTTC 3H32A 4ZKPA 2GUSA 3IR9A 5CA0E 2K24A 3KV9A 2P2UA 2XUEA 3VYIA 3A7OA 2NPSC 2ZM0A 3LK2B 1GL2C 1T3UA 1H88A 3FB2A 3RH3A 3NTNA 2ZLYA 2PJQA 3ZLIA 1GK6A 2Q9QB 2W0GA 3G3ZA 4UXNB 3M0AA 3M91A 1VRBA 2J1DG 2WMOA 3IBPA 3TSIA 1IJDB 4HEAA 4GK5E 3PP5A 2W00A 4ANJA 2VL8A 1RF0C 3BQLA 3CPZA 4EAHA 2R32A 5CMZA 3HD7D 1MIVA 4TN7B 2Q5UA 1J2JB 5KJ7D 1LVKA 2D5UA 3F31A 4ZOLE 2E9XA 2RP4A 3MK7C 3KDSE 2D0TA 1SFCD 3SWHA 1FJPA 3HUSA 4O2AE 4H63V 4TUYE 2KZ7B 1A02J 4TZ4C 1VOMA 1FIOA 1G8XA 3FXDB 2FKWB 2MYSA 2JJ9A 1IK9A 3CX7B 4H9OC 2YU2A 2EHOA 5CB4E 4F6RC 2W6AA 5APUA 1A02F 4AKGA 1BR0A 1N73A 2UXNB 3MKDA 4HYTB 3IF8B 3B5NB 3FBLA 2X9HA 3KINB 1IJ6A 3PU3A 1QL1A 4ZI2D 3RC3A 2DLRA 2E42A 2QM8A 1WR6A 2OA5A 2J58A 4O4HE 2XDJA 3ZMUB 4NUUA 2R5BA 2A3DA 5HWYA 3CLQA 4KUMB 3WMM0 3I0QA 4JYCA 3LW5H 2QM7A 1SQQK 3V2PA 4CI3B 4IFFA 5KTBA 2WTYA 4I43B 2E8IA 1M7LA 2YNYA 3RKOA 2JRKA 4UV8B 2ES0A 3RC8A 2V7LA 3OA7A 4W80A 4BJMA 4UVCB 4FJOA 3SRZA 4L5GA 2L3LA 1M1JB 2CLYB 3QK6A 2HG5D 1FZAA 3NRXA 2NWBA 3QC9A 2KOGA 1NWQA 1NWMX 2XKMA 1LT9A 2N9BA 2M8RA 1S94A 4OFZA 3P8CD 1KILC 2W6BA 2HPCB 1SQBK 4GIFA 2A45H 1N7SA 2C0WA 3ZMZB 4AQGA 1J1DB 3HD7B 1FZCC 4GK0E 3VOPA 1SQVK 2N1TB 5JR9C 3ZN1B 3N9QA 1G1IA 2XHEB 1SFCB 2CPBA 2LSJA 4IE6A 3NMDA 1FMVA 3AVSA 2LE8A 2L5GB 2QGSA 3I0OA 2DCFA 3OYXA 4N78E 3U78A 1HGVA 1FOSE 3MZKB 4HH2A 3KPEA 1HH0A 5EK3A 4OYJA 2BASA 2EHOD 2LOPA 2KT9A 3NRYA 3IFMA 1LKXA 3K3NA 2WWUA 3V5SA 5HYAA 1JY3O 2DI4A 1LTAC 1W2EA 1SVFA 5JREA 1DX7A 3RL0C 2PP6A 1SP4A 2YO2A 3HI2A 3TKLB 3M0DC 5AW9B 3CQGB 3MA9A 3O1JA 1ZV8A 1SQXK 3UULA 2MBGA 1MIWA 3BASA 5LCYA 3V4WA 3WI3A 3U59A 1HG2A 3V2NA 5L3EB 4KHXA 4IHJE 4QWNB 4AKIA 5CCGA 1YW0A 2HPJA 4ADZA 2C9LY 5DJQC 1FBMA 4MFRA 2Q9IA 2CA5A 3JC6C 5AW7B 3H32B 5GONE 2M3BA 2A72A 2VB6A 2H8PD 3R2PA 1IZNB 4NUVA 3ZMSB 1MUUA 2CWYA 2XAHB 4PAGA 2V7KA 2X9WA 1D1AA 4HE8A 1N2DC 4LGDE 1ZKEA 2V7MA 5HXEA 4PJLA 4U72A 1BR2A 2P7JA 2Y6XA 1E5WA 1ZEEA 4HFVA 4DO0A 2CCQA 5KX5E 1N7SD 1NTZK 3UUXB 2E9XB 3SS1A 5AVWB 4JYBA 4ZS3A 2D0UA 1RE3A 2IFNA 3HKCE 2NTYA 1QSDA 3KV4A 3J7Yq 5KDMC 1ZR2A 3Q9DA 1GW3A 2DWGA 2FFDA 1GDTA 3H6PA 2EHOB 3IEEA 5L3CB 1URQD 5FY1A 5AVZB 3MJXA 1N73B 4WY4D 2Y48B 3VP9A 4EYUA 1HF8A 4O4JE 5CCHC 3N2OA 4N3YB 3L35A 3VU7H 2HYNA 4ZI3C 4OHFA 3SOLA 1Z56A 3BVHA 2LOSA 5ETWA 1HG5A 1KFMA 4L0RA 3AAAB 1ZV4X 1FZBA 1GL2D 4IFMA 1RF1B 3BQKA 2YO3A 3AAIA 2M67A 3RK3D 3MXZA 3PE0A 2X51A 2HH7A 1ZR4A 4YJ3E 4RESB 1X79B 3EDUA 1LWUC 1PFIA 2P1JA 1GU5A 2NTXA 4HGAA 3NZPA 2YK0A 4ZHQE 3MIWA 2XZRA 3L4FA 2HLOA 4X1IE 1DH3A 2DWKA 3I5CA 4AKLA 2GUVA 4MBQA 4ZI7E 5JDQA 2LSGA 4TV8E 3ZEFB 2CXFA 3N9MA 2XV5A 3V2RA 2YKOA 5FXXA 2KLQA 1WYCA 1JCCA 4IFDK 1IO4A 5LNKA 2Q9QC 1WRGA 5LHHB 1N7SB 3A5TA 3PU8A 4B6XA 5FXVA 2PAJA 3L37A 3MD0A 3CQCB 5LP6E 4O8SA 3N2GE 2H7OA 4QHOA 4WBOA 4QXBB 3KBUA 3LK3B 1S35A 4X1KE 3ZJ2A 1D1CA 3RK2D 3GHGA 4LC1A 1MIYA 1CZQA 4C91A 3K8PC 1HBWA 1U5PA 3HL6A 3OBVE 4I4TE 2HFED 4O4LE 3TYYA 2WSFH 3KDPB 2NOXA 1IFJA 4XE5B 1URQB 3KV5A 2A45I 1AJ3A 4WY4B 5BU8B 3V4QA 1IC2A 5AVTB 4L9IA 1G1JA 2KXPB 1WYBA 5AW4B 4O9BA 2BDEA 3VMXA 3UTKA 5CCGC 3CL3D 5E0OA 1L4AA 2WITA 2WWWA 4QX8B 2ZXEB 1D0XA 3U1AA 4O2BE 5C8YE 4TX5A 4B86A 4MALA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AW8 B;  3V5B A;  1A02 F;  2E43 A;  4KHX A;  2N9B A;  1T2K D;  2P67 A;  3HTK A;  3O8Z A;  3VMY A;  4I6M C;  3M06 A;  2XV5 A;  1OWA A;  4GT1 A;  1GZL A;  4HYT B;  2W27 A;  5AVY B;  2C9L Y;  2VRS A;  5AVZ B;  5APQ A;  2R3C A;  4AUW A;  2N9D A;  4GKG A;  1GTW A;  1G2C B;  3IR9 A;  1OXZ A;  1H89 A;  1H8A A;  2P2U A;  3LIE A;  3P7K A;  5APW A;  5AVV B;  5AW7 B;  1IO4 A;  3VYI A;  3A7O A;  5AVR B;  3A3Y B;  3A5T A;  3NFQ A;  2E42 A;  1WRD A;  5AW0 B;  1H88 A;  3HE5 B;  2QM8 A;  4C46 A;  3L35 A;  3NTN A;  5APV A;  1GK6 A;  1YYC A;  2Z5H A;  1WR6 A;  3NMD A;  3L37 A;  1MUU A;  2ZFC A;  1NAF A;  2KP8 A;  3M9B A;  3MD0 A;  1HUC A;  1GU4 A;  1O3X A;  2R5B A;  3B8E B;  3M0A A;  5APX A;  1FOS E;  3HE5 A;  3T97 A;  3M91 A;  3P8M C;  5AW2 B;  5AW3 B;  2WPR A;  5APY A;  2N2N A;  1S9K D;  4DZO A;  5APS A;  3VTP C;  1KQL A;  1S9K E;  4JYC A;  4LC1 A;  1HJB A;  1CI6 A;  2BAS A;  1T2K C;  1CZQ A;  2QM7 A;  3UIA A;  4EOT A;  1GD2 E;  1HBW A;  2R32 A;  2WPS A;  5CMZ A;  3MGN A;  5AVX B;  2WTY A;  2YO3 A;  3OAK A;  2P7J A;  2C9N Y;  5APT A;  2Q5U A;  1J2J B;  4AYC A;  1JNM A;  1FOS F;  3TYY A;  2YNY A;  4AQR D;  1CI6 B;  3KDP B;  2Z5I A;  1YD8 G;  3HE4 B;  5AVQ B;  5AW5 B;  1CSB A;  4XE5 B;  5AW1 B;  2WPQ A;  4M3L A;  4RES B;  2WT7 A;  3L36 A;  1SLQ A;  1X8Y A;  3LID A;  2IPP A;  2R5D A;  1FAV A;  3M0D A;  1SP4 A;  2YO2 A;  3V4Q A;  3KQG A;  3VMZ A;  5AVT B;  3HE4 A;  4C7N B;  1GK4 A;  1GU5 A;  3SWF A;  5AW9 B;  5AVW B;  4JYB A;  5AW6 B;  2Q7C A;  1JUN A;  3TK1 A;  1A02 J;  5AW4 B;  2WT7 B;  5AVS B;  3NXS A;  1X79 A;  3TNU B;  3VMX A;  1MV8 A;  2XZR A;  3VN0 A;  2JJL A;  2WWW A;  4I2L C;  4C7N A;  1MFZ A;  2XU6 A;  3V4W A;  2ZXE B;  3A2A A;  1HWT C;  1DH3 A;  2H7H A;  3I5C A;  3M9H A;  1NWQ A;  5AVU B;  2Q3I A;  1NWM X;  3P32 A;  2W6A A;  4B86 A;  3TNU A;  5APU A; 
#chains in the Genus database with same CATH topology
 2D2C B;  4HFB A;  5L3G B;  2YIN A;  2ODV A;  1AVY A;  2IX7 C;  3HTK A;  3B5N C;  4XZC A;  1U4Q A;  2LXB A;  2YKP A;  4PV1 B;  3TGU G;  3A5X A;  3P8C E;  1QUU A;  5HEG A;  1GL2 B;  3Q3D A;  5LA6 E;  3CWB G;  3EQ2 A;  1XNR T;  4ZNC A;  2Z6E A;  3ETU A;  4AUW A;  2FJE A;  3ONX A;  3QUJ A;  1D0Y A;  3RK3 B;  5APW A;  4WZX A;  4DND A;  3OYZ A;  3H1H E;  3A3Y B;  2V1D B;  2R44 A;  5L2L A;  5HXS A;  4DMW A;  4PD4 D;  4XBF B;  1N8R Q;  4QH4 A;  2GK9 A;  1KIL D;  4EIJ A;  5CFB A;  2B89 A;  1HUC A;  1UII A;  2X9Y A;  3ZYL A;  4WBN E;  3RI5 A;  4YTP A;  2IIU A;  4HJG H;  3GWH A;  1VF5 B;  3CCV P;  4PK4 A;  3H1H G;  4HN9 A;  3BK9 A;  1MZ9 A;  1J5W A;  1S2E A;  3UU5 A;  1FDM A;  2O1K A;  2WZ7 A;  4GDO A;  1HNX T;  5AQV B;  3UIA A;  4A7P A;  5HEJ A;  4DR7 T;  1GD2 E;  3PLN A;  2XSA A;  3AEE C;  4JF7 A;  1YQ3 A;  3ZC1 A;  4XAX B;  1ZXG A;  4A97 A;  4YTN A;  3LJC A;  1JNM A;  1FOS F;  5HXC A;  4DMV A;  5DJU B;  1NU1 E;  1RF1 A;  3O9X A;  2H88 C;  2XNX A;  2BG9 A;  3HKE E;  5LJN A;  3R6N A;  3V5U A;  1J1E B;  2YIU C;  1BE3 G;  3CD6 P;  1BGY D;  1M1J C;  2E5T A;  2NR4 A;  2ZYA A;  2OYH A;  3WUT A;  1BCC E;  1NEK A;  1RE4 A;  1PP9 E;  1SQP K;  4C7N B;  2VAS A;  3S4U A;  1J5E T;  1NTK K;  2C0S A;  5AW6 B;  2L9Q A;  5L3D B;  3TK1 A;  3CCR P;  1KV4 A;  2A2F X;  1X79 A;  3PUR A;  2Y9Y A;  3KXD A;  3H1J G;  4UF0 A;  4TLF A;  3CPW O;  1FC2 C;  5ABF B;  2NW8 A;  3L75 G;  2BBJ A;  2YDQ A;  5TIS H;  1LJ2 A;  5CJ0 A;  2H7H A;  1EZ3 A;  4KHZ F;  2WSE H;  5B66 E;  3RQU A;  5H6Q B;  1T2K D;  4H13 B;  2X66 A;  1J1D C;  2LHN A;  3O8Z A;  3HD7 C;  3RK2 B;  3VMY A;  2ACX A;  4LML A;  2V7J A;  4K0K T;  1M62 A;  2O01 N;  5KJ7 C;  3AE8 C;  2HOD A;  1VQ6 P;  1OWA A;  4EXT A;  2N1T C;  3E7K A;  2J47 A;  3TGU D;  3N5L A;  1SQQ G;  5APQ A;  2R3C A;  1HF9 A;  3CWB D;  4IST A;  3L70 G;  3CCU P;  1SFC C;  4UV9 B;  4AQF A;  3I55 P;  2FFD B;  1TU3 F;  2OYI A;  5AVR B;  1KZU B;  1D1B A;  4JI5 T;  1KNZ A;  3Q1M A;  3BCC E;  1ZN5 A;  1IAP A;  2JIW A;  2VK9 A;  2WMN A;  3WAJ A;  1KOR A;  1FZE A;  5TIS E;  2POH A;  4D6T G;  2MOZ A;  4NPF X;  2XZE A;  2M6B A;  2ZFC A;  1JY2 P;  2CK3 H;  1YQ4 C;  3N4X A;  5APX A;  2VVS A;  3T97 A;  3P8M C;  4QH1 A;  1FU1 A;  3RQW A;  3ZC0 A;  5ABE A;  4PJJ A;  1BR1 A;  2BBH A;  1L4A D;  3JC6 D;  4GIW A;  3VTP C;  1KQL A;  3C4X A;  2X9X A;  4ASV A;  2RH0 A;  4IDO A;  3EDV A;  3H1H D;  1CI6 A;  2JP3 A;  2H43 A;  1JMM A;  1MND A;  4B3T T;  3C4Z A;  1SQB E;  4C7R A;  1ZP0 A;  2LJL A;  3LBX A;  3AA0 B;  3CQX C;  1Q2N A;  5KKZ C;  1JCD A;  2BZB A;  4JPZ B;  4DV1 T;  2BCC J;  4NPE A;  3E1I A;  2OAR A;  3ZJ1 A;  2WSS H;  4ZI2 C;  5LG4 A;  2I6H A;  1LTJ C;  1HTL C;  1L0L E;  1BE3 D;  5KMG P;  5ADX L;  4P0B A;  1OW7 A;  3B13 A;  2Q7C A;  3ITK A;  1V9D A;  1URQ A;  1SQV G;  3JCF A;  3CX5 I;  4DJG A;  4WY4 A;  3FXE B;  2E74 B;  3IAO A;  4I2L C;  3P7I A;  1KIL B;  4L76 A;  4JUY A;  3CML A;  3H1I G;  2K5B B;  2KYV A;  1EQ7 A;  1HJ0 A;  3H1J D;  2D9D A;  1QL2 A;  3CMA P;  2RA1 A;  2E76 D;  3L72 G;  3L75 D;  1FZC B;  1EXJ A;  2WZI A;  3PUZ F;  3QNU A;  4YSY A;  3K3O A;  5JR9 B;  4U7J A;  4WW0 A;  5FP3 A;  3AEF A;  4JEH B;  1AQT A;  3LSV A;  2UUC T;  4CXW A;  5F3J A;  4O4I E;  5J1G A;  5LXT E;  2YMY A;  2LEH A;  2XM1 A;  3UFE A;  1OXZ A;  2A45 G;  2JEE A;  2NPS A;  3JSV C;  1Y64 B;  4H9S E;  4UVA B;  4N6J A;  1GL2 A;  1SQQ D;  3KVA A;  4BWN A;  3L70 D;  1BDD A;  2ACZ A;  4LF5 T;  1OW8 A;  4I1L A;  4C46 A;  1L0N E;  5AQH B;  3VP8 A;  2V5C A;  3N9O A;  5CBN A;  3CXH I;  4DCK A;  2C0X A;  2WU2 A;  3CCE P;  3MUD A;  1YI2 P;  2HN1 A;  2UXX B;  2XAS B;  3M9B A;  4WYV A;  3EUH A;  4D6T D;  5EZY E;  3F57 A;  1P84 H;  1K73 Q;  5AW2 B;  3R4Y A;  5AW3 B;  2Z4E A;  2CXL A;  3FBZ A;  4NXN T;  1BR4 A;  4H44 D;  1RF0 A;  1USD A;  4H0L C;  3ZN0 B;  4ZKU A;  3RYC E;  5HWX A;  1UUS A;  4DR3 T;  5H6R B;  1AQ5 A;  3PJS K;  3AA7 B;  2VL0 A;  1SQX G;  1MMN A;  5CCH D;  1MMA A;  3Q5D A;  4DV4 T;  3CVR A;  3WUU A;  1NAY A;  2LRL A;  4YTM A;  1IFN A;  4I0U A;  4HFD A;  3L73 J;  5LHG B;  2K1A A;  4ZI3 D;  4CXX A;  5AQG B;  3GHG B;  4X66 T;  3RK3 E;  2JQQ A;  3ZST A;  2WDR A;  2LKM A;  2E9X C;  3HE4 B;  1NVO A;  1VQM P;  5AQP B;  5FY7 A;  1ZW0 A;  4QXH B;  5AW5 B;  1CSB A;  2WT7 A;  2NW7 A;  2AXC A;  3LID A;  3Q2M A;  2R5D A;  1N34 T;  2XM2 A;  2HR3 A;  3RKG A;  3G4S P;  5HEH A;  3CCL P;  3HUS C;  4BXL A;  3ZCJ A;  1P84 E;  4HWD A;  4ASK A;  5L3B B;  1QEX A;  3L74 G;  1G73 A;  3B71 A;  1US7 B;  2JJL A;  2KLU A;  5JQG E;  1SQV D;  4AQY T;  4C7N A;  3OJA A;  1JM0 A;  1KYO H;  2KMF A;  4CN6 A;  1I94 T;  1PPJ E;  3KV6 A;  5AVU B;  3H1L E;  3RYH E;  2AEJ A;  3P32 A;  4ZZC A;  4IE4 A;  3H1I D;  3K3Q C;  5AW8 B;  4LF9 T;  2EHO C;  3CIR A;  3T1Y T;  4JEU B;  1L4A B;  5ABF A;  4P1N A;  3L72 D;  3CCQ P;  3O1I A;  2P10 A;  3AEA C;  4V1A v;  3AE4 C;  3GW6 A;  4I6M C;  4A5X A;  4PW8 A;  1N73 C;  4UB6 E;  2E5Y A;  3GF3 A;  3G6E P;  1ZHC A;  1N33 T;  3KVB A;  3FZL B;  1SA0 E;  2VRS A;  3HTK B;  5IUX A;  5LOV E;  3SFE C;  3AXJ B;  4PFP A;  3C64 A;  2G0U A;  2FBW C;  4EB6 E;  1EZV I;  3LG7 A;  4DV6 T;  5KLV J;  3HE5 B;  1DEE G;  5FL1 A;  3EVY A;  1XTC C;  2JQH A;  2XQ9 A;  5FVL A;  1KYO E;  2IZ1 A;  1NTZ G;  4Y99 B;  2ZT9 C;  2VKH A;  2KWI B;  4EED A;  2UXC T;  3B8E B;  1LRZ A;  2JPF A;  1PV3 A;  3PUY F;  4DZO A;  3CCM P;  4KX6 A;  2IBZ E;  2E2A A;  2LT3 A;  3EWK A;  4MLK A;  2E76 B;  2WPS A;  1JO5 A;  4DR6 T;  5CBO A;  1SQX D;  1XTG B;  2IML A;  4ILU A;  1VDF A;  2O1J A;  3RPU A;  1NTM J;  4PFO A;  2IBZ G;  3OTO T;  5LGT B;  3QB5 K;  2G3A A;  4YT0 A;  2XAQ B;  1SHZ C;  2VKJ A;  2NPS D;  4P0A A;  3O4X E;  4NPP A;  4UEL A;  3H1K G;  2WBL A;  3L71 G;  2BG9 B;  3GA8 A;  3AED C;  1KQF B;  4ZEY A;  4JBW F;  2GA1 A;  2XQ8 A;  1MV8 A;  4PD4 H;  2C5K T;  2OYH B;  3N2K E;  3L8R A;  3L74 D;  3AE9 A;  1XDP A;  3AE7 A;  4C90 A;  4PJ0 H;  5GTH E;  3AE2 A;  3M9H A;  1RH5 B;  5JRC B;  1UUR A;  5JDL A;  3M3Z B;  3UQ4 A;  3E08 A;  4UF0 B;  4H44 B;  1KIL A;  5B5E H;  1IFI A;  2P67 A;  1JY3 P;  4KMC A;  3AEC A;  1M7K A;  4DV3 T;  5FY0 A;  3QWO C;  1LT9 C;  2BVM A;  1FZC A;  2FYU K;  2JWA A;  3UQ7 A;  1GZL A;  3AVR A;  2XQ6 A;  2N9D A;  1JOC A;  1N7S C;  3AEG A;  5JR9 A;  2PRR A;  2YMK A;  2Y0E A;  3P7K A;  3II6 A;  2ZM2 A;  2B9B A;  5TAO A;  2QJK B;  2QJY B;  2HOD B;  2YEV C;  3TDK A;  4FI5 A;  3VHL A;  2LSI A;  3AB3 B;  3H1H J;  1LGH B;  2QA4 P;  2BS4 A;  3RIF A;  4PD4 E;  3NWI A;  2VWA A;  3AE5 A;  2RMZ A;  2J5U A;  2JDI H;  5JDN A;  1KIL E;  3U3I A;  3SWY A;  1NAF A;  4XA4 A;  2OYI B;  3Q5X A;  2LHR A;  4TNV A;  1NTZ D;  4B3M T;  3Q5W A;  2X0Y A;  1NKZ B;  2MAW A;  2WQY A;  3T1H T;  5APS A;  3P4S A;  5KLI C;  2FYU G;  1JB0 J;  3ABV A;  1GW4 A;  1W09 A;  3K5B A;  5KLV K;  1JY2 N;  3T97 B;  1Q81 Q;  4HWC A;  4LF4 T;  4PJN A;  1LWU B;  5APT A;  3G06 A;  4AYC A;  1URQ C;  4AKH A;  3BRT B;  1CI6 B;  5LJM A;  2CXD A;  2IAK A;  5LHI B;  3S9O A;  1LTS C;  3F2E A;  4QH5 A;  5DQV A;  5HXR A;  1NU1 J;  3LBX B;  5AW1 B;  4H63 H;  4DBQ A;  3H3A A;  1SLQ A;  1NHL A;  2IBZ D;  3C50 A;  1BGY E;  2D2S A;  3KBT A;  1LVF A;  3M0D A;  3EAB A;  3AAE B;  3I56 P;  2I0M A;  2RPA A;  3AE1 A;  3HE4 A;  3NBX X;  4H9R C;  5CJ4 A;  1BCC J;  4U3F G;  3CK6 A;  1PP9 J;  1YXR A;  2WSC H;  3C98 B;  1HNW T;  3H1K D;  3N9L A;  4EYY R;  3ZYK A;  1VQ5 P;  1DD4 A;  2Y0D A;  3L71 D;  3TNU B;  1OED C;  4I50 E;  1NTM K;  5E79 H;  4HKZ H;  2D2C C;  1IBM T;  3RX6 A;  1YTZ T;  1W9R A;  4H9N C;  3RIU A;  5IHY A;  1RY3 A;  2IZ0 A;  4PV1 C;  1HS7 A;  1CW5 A;  3GMI A;  3GMA A;  4I55 E;  4EIW A;  3CKD A;  1FEW A;  3Q5P A;  3W68 A;  3L09 A;  2E75 D;  1JTH B;  2K9A A;  3RK3 C;  4GT1 A;  2AEM A;  3A0B H;  5AVY B;  3AEB A;  2W27 A;  1WMK A;  4KBM B;  1HX8 A;  5CA1 E;  1NH4 A;  2LXC B;  1EDL A;  4GKG A;  2B1E A;  3ZKR A;  2KND A;  3PTR B;  2WWV A;  1H89 A;  2J4G A;  1H8A A;  1E1H B;  4M1P A;  3AA1 B;  4YY3 T;  5JDF A;  2IW5 B;  5BMV E;  4DV5 T;  3A8Y C;  2PFV A;  1RHZ B;  1AJY A;  1HTJ F;  5E79 E;  1X0T A;  1YYC A;  3AE6 C;  1IBL T;  3BCC J;  1VF5 C;  2NPS B;  4DR5 T;  4KJM A;  2VKD A;  3AXJ A;  4DBR A;  2JMK A;  2N1T D;  3ANW A;  1H0T B;  1S3J A;  3HE5 A;  1Y8A A;  2NP9 A;  4WNK A;  2WSE J;  2P9B A;  4YXD C;  3X1D A;  4A98 A;  5APY A;  5BU5 A;  3GN5 B;  1KFN A;  1S9K D;  2XQ4 A;  3UU4 A;  2V4H A;  3A0B E;  4HTE A;  1N86 A;  2MTQ A;  4ISS A;  5JDH A;  4CI2 B;  4K35 A;  4G2A A;  5AVX B;  2LSY A;  3EFG A;  1SQB J;  3PH0 A;  2C9N Y;  4K0U A;  2WDV A;  4AKR B;  4E7S A;  1J1E C;  3P4W A;  1JNZ A;  3M9Q A;  1H7C A;  2XQY A;  3HKD E;  2XND H;  5EK4 A;  2WPQ A;  5H2F H;  1WLX A;  1EZV G;  4TT3 H;  2IPP A;  3KHU A;  1IFM A;  2W90 A;  4BAY B;  2MJZ A;  1BE3 E;  3BAT A;  1PZQ A;  4HWI B;  4NPD A;  4JI0 T;  1JUN A;  1L0L J;  4H9Q C;  4CI1 B;  4W7Y A;  2WT7 B;  5B66 H;  3NXS A;  4HFI A;  2J59 M;  4U3F D;  1AFO A;  1RE3 C;  3RYF E;  3A2A A;  1HWT C;  1NU1 K;  4JQ0 D;  1VL2 A;  4E7Z A;  3H1J E;  5J2T E;  3RK2 C;  1YIT P;  2ZMA A;  4X65 T;  2Q1K A;  3S4R A;  1QVG O;  3L75 E;  2KZI A;  2XQ3 A;  2CLY C;  2R3S A;  3OJA B;  1KB9 E;  3M06 A;  2JMH A;  5JRC A;  2CRB A;  1YTZ I;  5C3J A;  1BDC A;  5H2F E;  4EI2 A;  2FFD C;  1ZLL A;  2O01 H;  1XNQ T;  2KIN B;  5EFW B;  5LMN T;  1G2C B;  4EYY Q;  2JKV A;  3LIE A;  2AEF A;  1M8O B;  5AVV B;  3UT5 E;  5CCH A;  1BSH A;  1S72 P;  1CUN A;  1SQQ E;  1JNR A;  4WBA A;  2BG9 E;  1NTK E;  3L70 E;  3RRW A;  3RL0 D;  3NFQ A;  3FZK B;  4JI3 T;  2CPS A;  1X9V A;  1RQU A;  3OW2 O;  4TV9 E;  4ZS2 A;  2Z5H A;  3WU2 E;  5JDM A;  3N9N A;  4KP3 C;  1L0N J;  3SSU A;  1AA0 A;  5M4Y A;  4D6T E;  4CXY A;  1NO4 A;  1KK7 A;  1SQP G;  4X20 E;  4I7Z B;  4G63 A;  1NTK G;  1AV1 A;  2YU1 A;  3KZI H;  2CEA A;  2WM9 A;  4Q25 A;  1VQP P;  2CHO A;  3LFM A;  2IYP A;  3WUV A;  2AXD S;  2ZM6 T;  1FS0 E;  3CCJ P;  3NVO A;  4HFE A;  4DV2 T;  2BVL A;  1W5C E;  4UIG A;  4ERR A;  3IHR A;  4EOT A;  2OTL P;  3FZF B;  2NW9 A;  2K48 A;  5JH7 E;  4WB4 A;  4ILB A;  4LLH A;  2YXQ B;  2K37 A;  4K3A A;  3T8O A;  2YKQ A;  1IFD A;  4ILA A;  1CHU A;  5A1L A;  2E75 B;  3CI9 A;  4OGQ C;  2WZH A;  1LWU A;  4H0L D;  4QX7 B;  3TLT A;  1LNQ A;  1X8Y A;  2WDQ A;  2LM9 A;  4HKA A;  3TLW A;  5FYM A;  2ZAE B;  2H89 A;  2X0L B;  4OK0 A;  3SWF A;  2E74 C;  2ODU A;  4YSX A;  3ETV A;  4GYR A;  3A0H E;  2Q3E A;  4ASW A;  5J2U E;  4J2C A;  3KZI E;  1K9M Q;  1UGO A;  5LBM A;  1LTI C;  2CBI A;  3VN0 A;  1DEB A;  5F8P A;  1SQV E;  5AQM B;  2XU6 A;  2E9X D;  1YIJ P;  4EEB A;  2A06 E;  4F8H A;  1FZF A;  2V6Y A;  2PBI A;  2K9J B;  3TNU A;  1FDO A;  1UX4 A;  2L91 A;  3H1I E;  5AFU L;  4A56 A;  1BSN A;  3H1L J;  3L72 E;  2V26 A;  2LKH A;  2XY8 B;  2OQQ A;  1L0L K;  2LKG A;  4LMK A;  4U7Y A;  5JVD E;  1B7T A;  2FYN B;  1I6Z A;  2A06 G;  5AQQ B;  3WAK A;  4XFJ A;  1WT6 A;  2C5J A;  2Q9Q A;  3PDY A;  2NRG A;  2KSJ A;  1JY3 N;  1JTH A;  1LTB C;  3B57 A;  5KAF E;  3FHN A;  2I59 A;  1WRD A;  5DQW A;  3ESL A;  4IDZ A;  5DAB A;  2V6X A;  5APV A;  3ZPO A;  4YHH T;  1KB9 D;  1KTM A;  3Q5S A;  2KB7 P;  2M5A A;  2KLV A;  3AE3 C;  1M56 D;  1LTG C;  3PUG A;  1ZOY A;  5CHX A;  3FGA D;  2W63 A;  1GU4 A;  4DOJ A;  1O3X A;  3PUV F;  2I1K A;  3ZT7 A;  3VR8 A;  2ZM8 A;  2WPR A;  2N2N A;  3D0T A;  1SQP D;  2FXM A;  1PGJ A;  3RIA A;  1NTK D;  1T2K C;  1H0T A;  2LSK A;  5AQR B;  4IE5 A;  2Y8D A;  3GHG C;  3PUW F;  2W61 A;  4DR4 T;  1D7M A;  4YXW H;  1EDK A;  3GN5 A;  1LTJ B;  2E5V A;  1SQX E;  3ZCI A;  1L0N K;  2YKS A;  3JAD A;  3J9X 1;  2KK7 A;  5IYZ E;  5KAI E;  2XAJ B;  2MKV A;  1YD8 G;  4YHJ A;  2WMM A;  4QKN A;  4M3L A;  3NKZ A;  1EC5 A;  2I1J A;  1KNP A;  2X68 A;  2WSS V;  5FNV E;  5FXW A;  5LB7 B;  2HPL A;  2IDO B;  2N9Y B;  4R4L A;  3RL0 B;  4P09 A;  3QH9 A;  5M1B A;  5AVS B;  2H3R A;  4DR1 T;  4NIQ A;  4IE7 A;  1UX5 A;  1DU2 A;  1ZME C;  3VRA A;  1T6A A;  3L74 E;  1L4A C;  4UB6 H;  3KFW X;  4Y28 J;  3ZMT B;  3ZMV B;  3B4S A;  2CE7 A;  5LGN B;  3MAC A;  2GM4 A;  3B5N A;  2E43 A;  2M3E A;  4H9P C;  4EZ4 A;  5FMN A;  1FJK A;  2PFX A;  2ZYD A;  2FYZ A;  1QX8 A;  2AE9 A;  4YJ2 E;  4WVZ A;  2W67 A;  3HR0 A;  3GG2 A;  3PUA A;  5EK2 A;  3HRN A;  4U74 A;  3TLV A;  2OLT A;  1SE7 A;  3R84 B;  1GTW A;  1VCT A;  1LP1 B;  1T8Z A;  3RYI E;  3DP7 A;  2A06 D;  2CMR A;  3PTZ A;  3CX6 B;  3MZW B;  4LF7 T;  4Y99 C;  2KUB A;  2YXR B;  2M6I A;  1KMI Z;  5AW0 B;  1VQN P;  4H0L B;  1SS1 A;  5AQF B;  1G2C A;  5BVZ A;  1NOH A;  2SPC A;  2JQ9 A;  4IT4 A;  4HWH A;  4GOU A;  2DHR A;  3V2Q A;  1OVU A;  4N78 D;  2N1G A;  3E0Z A;  3MHV A;  3UU3 A;  3P4P A;  1NTZ E;  4CZZ B;  2BS3 A;  4IE0 A;  4YLH A;  2FY8 A;  4YTP C;  3CX8 B;  3VMA A;  1MFT A;  2ZVN B;  1HJB A;  4QXC B;  2V8S V;  3BRV B;  4IDQ A;  3AEE A;  3ANW B;  3I9W A;  1GMJ A;  4B3S T;  3C9I A;  3RGU A;  2G8Y A;  4JI2 T;  3MGN A;  4JLE A;  2BCC G;  1HVV A;  3OAK A;  1YKE B;  1R8I A;  1YQ3 C;  2PGD A;  2V7Q H;  1MNE A;  3HUS B;  1WFD A;  4PJM A;  3ZYM A;  3O1H A;  2BKO A;  2Z5I A;  5AVQ B;  2CWO A;  1M1J A;  2I8D A;  4YFS A;  1RF1 C;  4Z90 A;  1OVV A;  4UVB B;  2BG9 C;  2XAG B;  3I1A A;  2KWH A;  2CM0 A;  4PK5 A;  2Q9Q D;  4OH8 B;  3RF1 A;  3D70 A;  3VRB A;  5AQI B;  1BGY J;  1GK4 A;  3C51 A;  4EOZ B;  2VQE T;  2OYH C;  3U1C A;  5GTH H;  1RE4 C;  1IJ5 A;  3DTO A;  4U7I A;  4KI0 F;  3QB5 A;  3M65 A;  3H1K E;  4EZH A;  3HA4 A;  1S5L E;  3L71 E;  1MMG A;  2XQ5 A;  5FKY A;  3GF7 A;  5ABH A;  1MFZ A;  4X1Y E;  1Q82 Q;  3H37 A;  3RRC A;  4H44 C;  3MTU E;  3NZQ A;  5HEO A;  4GKJ T;  2HPC A;  1YKH B;  1FZG A;  3BQI A;  2IC6 A;  3CWZ B;  5FXZ A;  2OTJ P;  3JCU H;  2BS2 A;  1HGZ A;  1Q90 D;  3HD7 A;  5L3F B;  3V5B A;  2AXT H;  2B87 A;  4GOF A;  5LMU T;  5KJ7 A;  2UUA T;  3AE8 A;  2H7V C;  1N7L A;  4GYS A;  2N1T A;  2WAU A;  1FDI A;  1HR0 T;  2PTF A;  2K9J A;  1VCS A;  2QJK C;  2QJY C;  2PG8 A;  1SFC A;  4DID B;  4W7Z A;  1UCU A;  3AA6 B;  1LT1 A;  1NKN A;  1HCI A;  3TGU J;  2L8K A;  4PNI A;  2IDB A;  2JR8 A;  1R8E A;  3CWB J;  5HCM A;  2XTL A;  1HFA A;  1FMW A;  1MMD A;  1T72 A;  2V5D A;  1PGQ A;  4AQF C;  2V7I A;  4BA9 A;  2WSC J;  2OYI C;  2IFM A;  4BJN A;  4PK6 A;  2XPK A;  2WP9 A;  2X67 A;  1YQ4 A;  1AVO A;  4AIU A;  4RKU J;  4AXP A;  3GLM A;  3ONL C;  3CX5 E;  2KP8 A;  4MN4 C;  3UUN A;  3JCU E;  4JI1 T;  5CCG D;  3PJA A;  3KYQ A;  3W15 B;  2AXT E;  3IN6 A;  2CPT A;  1VPC A;  3PUS A;  1S9K E;  4MHC A;  1DIP A;  4U33 A;  3L73 G;  1VQ4 P;  1Z8U A;  3VKH A;  3RL0 g;  1KQS O;  3I9Y A;  3FWN A;  3E22 E;  4DVD A;  3VKG A;  3N7N A;  5F5W A;  2FYU E;  2W6J H;  2H89 C;  4IL4 A;  3B5N D;  3SFD A;  1ZP0 C;  4AQR D;  1OZH A;  4OYK A;  3MP7 B;  3L3P A;  1QGK B;  5LGU B;  3DJB A;  2VKO A;  5HXH A;  1LTJ A;  2CHN A;  4UEM A;  3L36 A;  3ZSS A;  3A7M A;  1D0Z A;  1FAV A;  1S5L X;  4OVN F;  1IFP A;  3JAE A;  1USE A;  1E2A A;  4IGU A;  3KQG A;  3N9P A;  4JI8 T;  5DJT B;  5LBQ B;  1T3J A;  2XAF B;  5LYJ E;  2QA7 A;  2VUR A;  3LK4 2;  3PRJ A;  1BE3 J;  4IOI H;  1T98 A;  4EDF A;  3CXH E;  4BRY A;  4CQI A;  4U3F E;  5JDG A;  2IC9 A;  3OKQ A;  1LT9 B;  2W62 A;  3HKB E;  1M90 Q;  4WY4 C;  1Y9B A;  4IIJ E;  4AI6 A;  1U57 A;  1Z0P A;  1J1J A;  2R6G F;  3UUM A;  5L8R J;  4IL6 E;  1JY2 O;  5KLV E;  2Q3I A;  4B3R T;  3PUQ A;  4RJT A;  3VMZ A;  3H1J J;  5HAX A;  2DNX A;  1KD1 Q;  3L75 J;  4Z8X A;  3UFG A;  1UK5 A;  2C5I T;  1KQG B;  3EAM A;  3FZM B;  1XWM A;  3C4W A;  3LDQ B;  2V6Y B;  5TJH A;  3AEF C;  5CJ5 A;  1LTT C;  3H32 A;  4ZKP A;  2XSB A;  3IA3 A;  2GUS A;  3FWL A;  2KS1 B;  5KLV G;  2OTK E;  3IR9 A;  5CA0 E;  5C2T A;  2K24 A;  3KV9 A;  5L47 A;  2P2U A;  2XUE A;  3VYI A;  3A7O A;  2NPS C;  2IYO A;  2ZM0 A;  3LK2 B;  5AQO B;  1GL2 C;  3K1S A;  1SQQ J;  1XMO T;  1T3U A;  1H88 A;  2FUP A;  1NTK J;  3FB2 A;  3RH3 A;  3L70 J;  3NTN A;  2ZLY A;  1LP1 A;  2PJQ A;  3ZLI A;  1GK6 A;  5L4E A;  2Q9Q B;  2W0G A;  3G3Z A;  4UXN B;  1K8A Q;  3M0A A;  3MUD C;  3Q5R A;  3M91 A;  1VRB A;  2J1D G;  2WMO A;  3IBP A;  1OMI A;  4D6T J;  3TSI A;  1IJD B;  2XJ7 A;  4HEA A;  2M5A B;  4GK5 E;  3PP5 A;  2LM2 A;  2W00 A;  4ANJ A;  2VL8 A;  1RF0 C;  3BQL A;  3E1R A;  2QJP B;  3CPZ A;  1NTM G;  4EAH A;  3L73 D;  2R32 A;  1L2P A;  4L73 A;  5CMZ A;  3HD7 D;  2JO1 A;  5GTI E;  1MIV A;  4TN7 B;  2Q5U A;  1J2J B;  5KJ7 D;  1LVK A;  2O01 J;  2D5U A;  3F31 A;  2E9X A;  4U2Z A;  4ZOL E;  3CME P;  2RP4 A;  3CX5 D;  4DV0 T;  3MK7 C;  3LW5 J;  3KDS E;  2D0T A;  4WWI A;  3S1K A;  2QRX A;  3IF4 A;  1OED B;  1SFC D;  3SWH A;  4LF8 T;  1FJP A;  3HUS A;  3SWK A;  4O2A E;  1YBK A;  5BR8 T;  4H63 V;  4TUY E;  3C1L A;  1EZV E;  2KZ7 B;  2FYU D;  2UU9 T;  1SUM B;  2KNC A;  1A02 J;  2WY2 A;  1VOM A;  4IL6 X;  4TZ4 C;  1FIO A;  1G8X A;  3FXD B;  2FKW B;  2MYS A;  5FVK A;  2JJ9 A;  5AQK B;  1IK9 A;  1KB9 H;  4LF6 T;  3CX7 B;  1XZY A;  4H9O C;  5LG3 A;  1SQV J;  4HFH A;  4OGQ D;  2YU2 A;  2EHO A;  5CB4 E;  4F6R C;  2O3J A;  2W6A A;  5APU A;  3AEA A;  1A02 F;  3AE4 A;  4AKG A;  1BR0 A;  1N73 A;  2MPK A;  3CC4 P;  3H1I J;  2HHH T;  2E74 D;  3L72 J;  4JI4 T;  1E79 H;  4UR9 A;  3CXH D;  2UXN B;  3MKD A;  4HYT B;  1Y01 A;  4U3C A;  1NYH A;  3IF8 B;  1N32 T;  3B5N B;  3FBL A;  3WU2 H;  3SFE A;  3ZDM A;  4H13 C;  2X9H A;  2FBW A;  3KIN B;  1IJ6 A;  5KLV D;  3PU3 A;  1QL1 A;  4X62 T;  4ZI2 D;  3RC3 A;  2DLR A;  2E42 A;  1X9B A;  1ZRT D;  2QM8 A;  1P84 I;  1WR6 A;  2OA5 A;  1QVF O;  4TWD A;  3UUB A;  2J58 A;  4I7Z C;  3OPC A;  4O4H E;  2DL1 A;  2XDJ A;  1E7P A;  2K3W A;  4JI6 T;  4NUU A;  3D71 A;  3ZMU B;  2R5B A;  4OWF A;  2A3D A;  5HWY A;  3CLQ A;  1KN7 A;  4KUM B;  3P4Q A;  3WMM 0;  4KT0 J;  3I0Q A;  4JYC A;  3LW5 H;  1DD3 A;  1SQP E;  2RN0 A;  4EGW A;  3EI0 A;  5IWA T;  2QM7 A;  1SQQ K;  3V2P A;  4CI3 B;  2FJD A;  4IFF A;  5KTB A;  3TLS A;  4YSZ A;  3RLF F;  2WTY A;  4I43 B;  2E75 C;  1NU1 G;  1NTM D;  2E8I A;  4X5T A;  2IHR 1;  2KIK A;  1SQX J;  1M7L A;  2YNY A;  2X0H A;  3CCS P;  2B76 A;  3RKO A;  2YDR A;  4Z1M H;  3H25 A;  2JRK A;  3A0H H;  1BCC G;  5HEU A;  1PP9 G;  4UV8 B;  2ES0 A;  3RC8 A;  2V7L A;  3OA7 A;  3AED A;  4W80 A;  4BJM A;  4UVC B;  1KYO I;  1S4X A;  4FJO A;  3SRZ A;  1M57 D;  2YIU B;  1VQ9 P;  4L5G A;  2L3L A;  1M1J B;  2CLY B;  1XMQ T;  2UWJ E;  3QK6 A;  3TLU A;  1RQV A;  4CN4 A;  3L39 A;  2HG5 D;  2W2U A;  1FZA A;  4TNW A;  3NRX A;  2NWB A;  3QC9 A;  2IBZ I;  2KOG A;  1NWQ A;  3AE9 C;  3L74 J;  1NWM X;  3AE7 C;  3AE2 C;  3VR9 A;  2ZYG A;  2XKM A;  3QOF A;  1LT9 A;  2FYN C;  2N9B A;  1YJ9 P;  2M8R A;  1EZV D;  1S94 A;  2BKP A;  4OFZ A;  3P8C D;  1YHQ P;  1KIL C;  2W6B A;  2HPC B;  1SQB K;  3AEC C;  5KAF H;  4GIF A;  2A45 H;  1N7S A;  3PUX F;  3C8V A;  4R4M A;  2C0W A;  3ZMZ B;  4AQG A;  1J1D B;  2NZ2 A;  3HD7 B;  1FZC C;  2B87 B;  3UU8 A;  4GK0 E;  2Y0C A;  3VOP A;  1SQV K;  2N1T B;  3AEG C;  3BCC G;  5JR9 C;  3ZN1 B;  3ZT6 A;  4L74 A;  3N9Q A;  1G1I A;  2KSR A;  4L75 A;  5CGM A;  3D6Z A;  4LMJ A;  3ZT5 A;  2KS1 A;  2XHE B;  4DUZ T;  1SFC B;  1OIP A;  2CPB A;  1Q86 Q;  2LSJ A;  4LFB T;  4IE6 A;  3NMD A;  1FMV A;  3AVS A;  2LE8 A;  3AE5 C;  2L5G B;  3SFD C;  2QGS A;  3I0O A;  2DCF A;  2W8Z A;  3OYX A;  4N78 E;  3U78 A;  1HGV A;  1FOS E;  1JEK A;  1YJW P;  1X22 A;  3MZK B;  1NTZ J;  4HH2 A;  3KPE A;  3CC7 P;  4AIS A;  2SPZ A;  1HH0 A;  1SQB G;  1IBK T;  5KAI H;  5EK3 A;  4OYJ A;  2WQY C;  2BAS A;  1OVR A;  4DR2 T;  4OGQ B;  2EHO D;  2LOP A;  1PGO A;  3ABV C;  2KT9 A;  3NRY A;  3FZH B;  3IFM A;  2QEX P;  1VQL P;  1LKX A;  3K3N A;  2WWU A;  3V5S A;  3RHW A;  5HYA A;  1NU1 D;  1MKM A;  1JY3 O;  5K5G B;  2DI4 A;  1LTA C;  1W2E A;  1SVF A;  1QLB A;  5JRE A;  1L0L G;  1DX7 A;  5KKZ B;  2YDS A;  3O6Q B;  3RL0 C;  2PP6 A;  1YJN P;  1BCC D;  1SP4 A;  1PP9 D;  2YO2 A;  4PD4 I;  2J62 A;  3HI2 A;  2FJA A;  3TKL B;  3M0D C;  5AW9 B;  3CQG B;  5AQL B;  3AE1 C;  1OED A;  3RBZ A;  3MA9 A;  3O1J A;  1PIX A;  4Z91 A;  1ZV8 A;  2ZT9 D;  1SQX K;  2Q6Q A;  3UUL A;  2MBG A;  2OYO A;  1MIW A;  3BAS A;  5LCY A;  3H1K J;  1M1K Q;  3V4W A;  3WI3 A;  3L71 J;  3JC2 2;  4EV6 A;  3U59 A;  1HG2 A;  3V2N A;  4YPC A;  5L3E B;  1K05 A;  3FXD A;  4BRY B;  3RIU C;  4KHX A;  2K88 A;  4IHJ E;  4QWN B;  3W67 A;  4ZMD A;  2V7Q J;  4AKI A;  5CCG A;  1YW0 A;  2HPJ A;  4ADZ A;  2KI7 B;  1KNR A;  4OX9 T;  2C9L Y;  3D6Y A;  1OED E;  5DJQ C;  2BEQ D;  5FL0 A;  4DUY T;  1FBM A;  3AEB C;  4MFR A;  1EDJ A;  2Q9I A;  2CA5 A;  3JC6 C;  5AW7 B;  2Y9Z A;  4NXM T;  2UUB T;  2UXB T;  1L0N G;  4X64 T;  2JWD A;  2P58 A;  3H32 B;  5GON E;  1NGM B;  3AE6 A;  3BCC D;  2M3B A;  2A72 A;  1N36 T;  2VB6 A;  3FX0 A;  2W83 C;  2H8P D;  3R2P A;  1IZN B;  4NUV A;  5ABG A;  4LFC T;  4TWH A;  3ZMS B;  3RGL A;  1MUU A;  2WU5 A;  2CWY A;  4YXD A;  2XAH B;  3ONJ A;  4PAG A;  1EXI A;  2WCA A;  2V7K A;  1KEY A;  4JV5 T;  2X9W A;  2ZXX A;  1D1A A;  2BKN A;  4HE8 A;  1XDO A;  1N2D C;  1U7J A;  5AQT B;  4LGD E;  1ZKE A;  3Q2Y A;  2V7M A;  3EHZ A;  5HXE A;  2YOE A;  1SQB D;  4PJL A;  3JAF A;  4U72 A;  1BR2 A;  5C39 A;  2P7J A;  2Y6X A;  2FYU J;  1E5W A;  1ZEE A;  4HFV A;  4JI7 T;  2LRK A;  2BCC E;  4DO0 A;  2CCQ A;  1R5L A;  2A9U A;  5KX5 E;  5L4H A;  1N7S D;  2FXO A;  1NTZ K;  5HCJ A;  3USS A;  1NJI Q;  2E76 C;  4JBZ A;  1S5L H;  3UUX B;  2XQA A;  1W0A A;  2E9X B;  2RKL A;  3PJA J;  1L0L D;  1PGP A;  2UXD T;  3SS1 A;  4CN1 A;  5AVW B;  4JYB A;  4ZS3 A;  2D0U A;  1RE3 A;  2IFN A;  2WPV B;  3HKC E;  2NTY A;  2H88 A;  2QIW A;  1PPJ G;  1QLE D;  1VQO P;  3H1L G;  4IDN A;  3G9R A;  4U3F J;  4UB8 H;  4KHP T;  4U31 A;  4GKK T;  2XQ7 A;  2KNC B;  2BEZ F;  1QSD A;  1JMB A;  4U2Y A;  5JTG A;  3KV4 A;  3J7Y q;  1L0V A;  5KDM C;  2CBJ A;  1ZR2 A;  3Q9D A;  3B5M A;  1GW3 A;  2FJB A;  3V6I A;  2DWG A;  2FFD A;  1GDT A;  1T8B A;  3H6P A;  2EHO B;  3IEE A;  5L3C B;  1URQ D;  5FY1 A;  5AVZ B;  1EDI A;  3MJX A;  1N73 B;  4WY4 D;  2Y48 B;  2LR2 A;  2QVA A;  3VP9 A;  4ZXL A;  4COF A;  4EYU A;  1HF8 A;  4O4J E;  3CX5 H;  5CCH C;  3N2O A;  4ZZB A;  4N3Y B;  1L0N D;  1GQE A;  2M0B A;  3L35 A;  4LFA T;  2W66 A;  3EFF K;  3VU7 H;  2HYN A;  1HX1 B;  4UB8 E;  2KSE A;  4IDP A;  3F5H A;  3TF5 A;  3PV0 F;  4ZI3 C;  2KZJ A;  4OHF A;  3SOL A;  4GOD A;  1Z56 A;  3BVH A;  2LOS A;  2D2C D;  4GOE A;  5ETW A;  1WR0 A;  1HG5 A;  4IRE A;  2ZT9 B;  1KFM A;  4L0R A;  3AAA B;  1ZV4 X;  4PV1 D;  1FZB A;  1OX3 A;  1GL2 D;  2QSI A;  1KB9 I;  4IFM A;  1RF1 B;  2QYW A;  1U7M A;  3L73 E;  3BQK A;  2YO3 A;  3AAI A;  2W4X A;  2M67 A;  3RK3 D;  3MXZ A;  3PE0 A;  2ITA A;  1PL5 A;  2X51 A;  1S1C X;  2HH7 A;  1ZR4 A;  4YJ3 E;  3CXH H;  4DV7 T;  4RES B;  2WB5 A;  1X79 B;  3FXE A;  5AQJ B;  3EDU A;  1LWU C;  1PFI A;  4HB1 A;  2P1J A;  1GU5 A;  2LLY A;  2NTX A;  1P84 D;  2WSF J;  4IL6 H;  4HGA A;  3NZP A;  2JQK A;  2QE7 H;  2YK0 A;  1FJG T;  1VF5 D;  3O6Q A;  4ZHQ E;  1VQ8 P;  3MIW A;  2XZR A;  3L4F A;  5AQU B;  2BCC D;  2HLO A;  2FXP A;  4X1I E;  1DH3 A;  5AQN B;  2DWK A;  1PPJ D;  3I5C A;  3UU6 A;  4AKL A;  3RBX A;  3H1L D;  2K3R A;  1IK7 A;  2GUV A;  4MBQ A;  4HFC A;  4ZI7 E;  5JDQ A;  2LSG A;  4TV8 E;  1VQK P;  1WCR A;  3Q5E A;  2CXF A;  3ZEF B;  3F89 A;  3N9M A;  2XV5 A;  2ZJS E;  4PJ0 E;  3V2R A;  1OFC X;  4DT0 A;  1NEN A;  2YKO A;  5FXX A;  2KLQ A;  1WYC A;  4HWF A;  1JCC A;  4IFD K;  5AQS B;  5B5E E;  3CC2 P;  3P50 A;  2E5L T;  1IO4 A;  5LNK A;  1W2B O;  2Q9Q C;  4ILC A;  1WRG A;  5LHH B;  1N7S B;  3A5T A;  1W0B A;  3PHL A;  1T7S A;  3PU8 A;  4IL9 A;  3AE3 A;  1ZRT E;  4B6X A;  5FXV A;  1KYO D;  2PAJ A;  3L37 A;  1HNZ T;  2DW3 A;  3MD0 A;  2YN6 A;  3CQC B;  5LP6 E;  1UIX A;  4O8S A;  3N2G E;  1ZOY C;  2ZVO B;  2QJP C;  1VQ7 P;  2H7O A;  5GTI H;  4QHO A;  4WBO A;  2B88 A;  4H13 D;  4QXB B;  3KBU A;  3LK3 B;  1S35 A;  1D1C A;  3P4R A;  4X1K E;  3RK2 D;  3ZJ2 A;  3GHG A;  4LC1 A;  1MIY A;  1CZQ A;  4C91 A;  1R5S A;  1OW6 A;  3K8P C;  1SQP J;  1HBW A;  2VVN A;  5KXJ A;  2OV9 A;  5KLI B;  1U5P A;  1KF6 A;  3HL6 A;  2QG4 A;  3OBV E;  4I4T E;  1NTM E;  2HFE D;  2IUB A;  4O4L E;  3TYY A;  2WSF H;  1Q7Y Q;  2WS3 A;  3KDP B;  1FE6 A;  1BGY G;  2NOX A;  1KC8 Q;  1IFJ A;  4XE5 B;  1URQ B;  3KV5 A;  2F4V T;  1KFY A;  1Y47 A;  4RO0 A;  2A45 I;  1AJ3 A;  4JYA T;  4WY4 B;  5BU8 B;  3V4Q A;  3G71 P;  1IC2 A;  2WVR A;  4CPG A;  5AVT B;  4L9I A;  5J0Z A;  2VQF T;  1G1J A;  2KXP B;  1WYB A;  5AW4 B;  4O9B A;  1K04 A;  2BDE A;  4TWF A;  3VMX A;  3UTK A;  5CCG C;  3CL3 D;  3TGU E;  1L4A A;  3H3M A;  2WIT A;  2WWW A;  5E0O A;  4QX8 B;  2K9Y A;  3OVU A;  2ZXE B;  3CWB E;  1D0X A;  2OGU A;  3U1A A;  4O2B E;  5C8Y E;  4QMA A;  2HN2 A;  4TX5 A;  4B86 A;  4MAL A; 
#chains in the Genus database with same CATH homology
 5L3G B;  2YIN A;  2ODV A;  2IX7 C;  3HTK A;  3B5N C;  4XZC A;  1U4Q A;  2YKP A;  3A5X A;  3P8C E;  1QUU A;  1GL2 B;  5LA6 E;  3EQ2 A;  2Z6E A;  3ETU A;  4AUW A;  3ONX A;  3QUJ A;  1D0Y A;  3RK3 B;  5APW A;  4DND A;  3OYZ A;  3A3Y B;  2V1D B;  5L2L A;  5HXS A;  4DMW A;  4XBF B;  2GK9 A;  1KIL D;  4EIJ A;  1HUC A;  2X9Y A;  3ZYL A;  4WBN E;  3GWH A;  4PK4 A;  4HN9 A;  3BK9 A;  1MZ9 A;  1FDM A;  2O1K A;  2WZ7 A;  3UIA A;  1GD2 E;  4JF7 A;  3ZC1 A;  4XAX B;  3LJC A;  1JNM A;  1FOS F;  5HXC A;  4DMV A;  1RF1 A;  3O9X A;  2XNX A;  3HKE E;  5LJN A;  3R6N A;  3V5U A;  1J1E B;  1M1J C;  2OYH A;  1RE4 A;  1SQP K;  4C7N B;  2VAS A;  3S4U A;  1NTK K;  2C0S A;  5AW6 B;  2L9Q A;  5L3D B;  3TK1 A;  2A2F X;  1X79 A;  3PUR A;  4UF0 A;  2NW8 A;  5CJ0 A;  2H7H A;  1EZ3 A;  2WSE H;  5H6Q B;  1T2K D;  2X66 A;  1J1D C;  2LHN A;  3O8Z A;  3HD7 C;  3RK2 B;  3VMY A;  2ACX A;  2V7J A;  5KJ7 C;  2HOD A;  1OWA A;  4EXT A;  2N1T C;  3N5L A;  5APQ A;  2R3C A;  4IST A;  1SFC C;  4UV9 B;  4AQF A;  2FFD B;  2OYI A;  5AVR B;  1KZU B;  1D1B A;  1KNZ A;  1ZN5 A;  1IAP A;  2VK9 A;  2WMN A;  3WAJ A;  1FZE A;  2POH A;  2MOZ A;  2ZFC A;  1JY2 P;  3N4X A;  5APX A;  3T97 A;  3P8M C;  1FU1 A;  3ZC0 A;  4PJJ A;  1BR1 A;  4GIW A;  3JC6 D;  1L4A D;  3VTP C;  1KQL A;  3C4X A;  2X9X A;  3EDV A;  1CI6 A;  2H43 A;  1JMM A;  1MND A;  3C4Z A;  4C7R A;  3LBX A;  2LJL A;  3AA0 B;  3CQX C;  1JCD A;  2BZB A;  3E1I A;  2OAR A;  3ZJ1 A;  4ZI2 C;  5LG4 A;  1LTJ C;  1HTL C;  5KMG P;  5ADX L;  4P0B A;  3B13 A;  2Q7C A;  1V9D A;  1URQ A;  4WY4 A;  3FXE B;  4I2L C;  3P7I A;  1KIL B;  4JUY A;  3CML A;  2K5B B;  2KYV A;  1EQ7 A;  1QL2 A;  2RA1 A;  1FZC B;  3K3O A;  5JR9 B;  4WW0 A;  5FP3 A;  4JEH B;  4CXW A;  5F3J A;  4O4I E;  5J1G A;  5LXT E;  2YMY A;  2LEH A;  3UFE A;  1OXZ A;  2A45 G;  2JEE A;  2NPS A;  1Y64 B;  4H9S E;  4UVA B;  4N6J A;  1GL2 A;  3KVA A;  4I1L A;  4C46 A;  3VP8 A;  3N9O A;  2C0X A;  3MUD A;  2UXX B;  2XAS B;  3M9B A;  3EUH A;  5EZY E;  3F57 A;  5AW2 B;  5AW3 B;  2Z4E A;  2CXL A;  3FBZ A;  1BR4 A;  1RF0 A;  3ZN0 B;  4ZKU A;  3RYC E;  5HWX A;  5H6R B;  1AQ5 A;  3AA7 B;  1MMN A;  5CCH D;  1MMA A;  3CVR A;  1IFN A;  5LHG B;  4ZI3 D;  4CXX A;  3GHG B;  2JQQ A;  2LKM A;  2E9X C;  3HE4 B;  5FY7 A;  4QXH B;  5AW5 B;  1CSB A;  2WT7 A;  2NW7 A;  3LID A;  3Q2M A;  2R5D A;  3HUS C;  3ZCJ A;  4ASK A;  5L3B B;  1G73 A;  1US7 B;  2JJL A;  5JQG E;  4C7N A;  3OJA A;  2KMF A;  3KV6 A;  5AVU B;  3RYH E;  3P32 A;  4IE4 A;  3K3Q C;  5AW8 B;  2EHO C;  4JEU B;  1L4A B;  3O1I A;  4V1A v;  4I6M C;  4PW8 A;  1N73 C;  1ZHC A;  3KVB A;  1SA0 E;  2VRS A;  3HTK B;  5LOV E;  4PFP A;  3C64 A;  2G0U A;  4EB6 E;  3LG7 A;  3HE5 B;  3EVY A;  1XTC C;  4Y99 B;  2VKH A;  2KWI B;  3B8E B;  1LRZ A;  2JPF A;  4DZO A;  2LT3 A;  4MLK A;  2WPS A;  1JO5 A;  1XTG B;  4ILU A;  1VDF A;  2O1J A;  3RPU A;  4PFO A;  5LGT B;  2XAQ B;  1SHZ C;  2VKJ A;  2NPS D;  4P0A A;  3O4X E;  4UEL A;  2WBL A;  3GA8 A;  1MV8 A;  2C5K T;  2OYH B;  3N2K E;  4C90 A;  3M9H A;  5JRC B;  5JDL A;  3E08 A;  4UF0 B;  1KIL A;  1IFI A;  2P67 A;  1JY3 P;  4KMC A;  5FY0 A;  1LT9 C;  2BVM A;  1FZC A;  2FYU K;  1GZL A;  3AVR A;  2N9D A;  1JOC A;  1N7S C;  5JR9 A;  3P7K A;  3II6 A;  2ZM2 A;  5TAO A;  2HOD B;  2YEV C;  4FI5 A;  3VHL A;  2LSI A;  3AB3 B;  1LGH B;  2VWA A;  5JDN A;  3U3I A;  3SWY A;  1NAF A;  4XA4 A;  2OYI B;  3Q5X A;  2LHR A;  3Q5W A;  1NKZ B;  5APS A;  1GW4 A;  5KLV K;  1JY2 N;  4PJN A;  1LWU B;  5APT A;  4AYC A;  1URQ C;  4AKH A;  3BRT B;  1CI6 B;  5LJM A;  2CXD A;  2IAK A;  5LHI B;  1LTS C;  3F2E A;  5DQV A;  5HXR A;  3LBX B;  5AW1 B;  4H63 H;  4DBQ A;  3H3A A;  1SLQ A;  1NHL A;  3C50 A;  2D2S A;  3KBT A;  1LVF A;  3M0D A;  3AAE B;  3HE4 A;  3NBX X;  4H9R C;  5CJ4 A;  2WSC H;  3C98 B;  3N9L A;  4EYY R;  3ZYK A;  3TNU B;  4I50 E;  1NTM K;  3RX6 A;  1YTZ T;  4H9N C;  5IHY A;  1RY3 A;  1HS7 A;  1CW5 A;  3GMI A;  4I55 E;  4EIW A;  3CKD A;  1FEW A;  3L09 A;  2K9A A;  1JTH B;  3RK3 C;  4GT1 A;  5AVY B;  2W27 A;  4KBM B;  1HX8 A;  5CA1 E;  1NH4 A;  4GKG A;  2B1E A;  2KND A;  3PTR B;  1H89 A;  1H8A A;  1E1H B;  4M1P A;  3AA1 B;  5JDF A;  2IW5 B;  5BMV E;  2PFV A;  1HTJ F;  1YYC A;  2NPS B;  2VKD A;  4DBR A;  2JMK A;  2N1T D;  3ANW A;  3HE5 A;  2NP9 A;  4WNK A;  2P9B A;  5APY A;  5BU5 A;  3GN5 B;  1KFN A;  1S9K D;  4HTE A;  1N86 A;  2MTQ A;  4ISS A;  5JDH A;  4CI2 B;  4G2A A;  5AVX B;  2LSY A;  3EFG A;  2C9N Y;  4K0U A;  4AKR B;  4E7S A;  1J1E C;  3M9Q A;  1H7C A;  2XQY A;  3HKD E;  5EK4 A;  2WPQ A;  1WLX A;  2IPP A;  1IFM A;  4BAY B;  2MJZ A;  3BAT A;  1JUN A;  4H9Q C;  4CI1 B;  4W7Y A;  2WT7 B;  3NXS A;  2J59 M;  1AFO A;  1RE3 C;  3RYF E;  3A2A A;  1HWT C;  1NU1 K;  4E7Z A;  5J2T E;  3RK2 C;  2ZMA A;  2CLY C;  3OJA B;  3M06 A;  2JMH A;  5JRC A;  1YTZ I;  2FFD C;  1ZLL A;  2O01 H;  2KIN B;  1G2C B;  3LIE A;  5AVV B;  3UT5 E;  5CCH A;  1CUN A;  4WBA A;  3RRW A;  3RL0 D;  3NFQ A;  2CPS A;  1X9V A;  4TV9 E;  4ZS2 A;  2Z5H A;  5JDM A;  3N9N A;  4KP3 C;  5M4Y A;  4CXY A;  1NO4 A;  1KK7 A;  4X20 E;  4G63 A;  2YU1 A;  2CEA A;  2WM9 A;  3LFM A;  2BVL A;  4UIG A;  4ERR A;  3IHR A;  4EOT A;  2NW9 A;  2K48 A;  5JH7 E;  4WB4 A;  4LLH A;  3T8O A;  2YKQ A;  1IFD A;  5A1L A;  3CI9 A;  1LWU A;  4QX7 B;  1X8Y A;  2LM9 A;  4HKA A;  5FYM A;  2X0L B;  4OK0 A;  3SWF A;  2ODU A;  3ETV A;  4GYR A;  5J2U E;  4J2C A;  5LBM A;  1LTI C;  3VN0 A;  1DEB A;  5F8P A;  2XU6 A;  2E9X D;  1FZF A;  2PBI A;  3TNU A;  1UX4 A;  5AFU L;  4A56 A;  2V26 A;  1L0L K;  5JVD E;  1B7T A;  3WAK A;  1WT6 A;  2C5J A;  2Q9Q A;  3PDY A;  2KSJ A;  1JY3 N;  1JTH A;  1LTB C;  3B57 A;  3FHN A;  2I59 A;  1WRD A;  5DQW A;  3ESL A;  4IDZ A;  5DAB A;  3ZPO A;  5APV A;  2KB7 P;  2KLV A;  1LTG C;  3PUG A;  5CHX A;  2W63 A;  1GU4 A;  4DOJ A;  1O3X A;  2I1K A;  2ZM8 A;  2WPR A;  2N2N A;  3D0T A;  2FXM A;  1T2K C;  2LSK A;  4IE5 A;  2Y8D A;  3GHG C;  2W61 A;  3GN5 A;  1LTJ B;  3ZCI A;  1L0N K;  3J9X 1;  5IYZ E;  2XAJ B;  1YD8 G;  4YHJ A;  4QKN A;  4M3L A;  2I1J A;  2X68 A;  2WSS V;  5FNV E;  5FXW A;  2HPL A;  4P09 A;  3RL0 B;  5AVS B;  2H3R A;  4IE7 A;  1UX5 A;  3ZMT B;  1L4A C;  3KFW X;  3ZMV B;  2CE7 A;  5LGN B;  3MAC A;  2GM4 A;  3B5N A;  2E43 A;  4H9P C;  4EZ4 A;  5FMN A;  1FJK A;  2FYZ A;  4YJ2 E;  3HR0 A;  3PUA A;  5EK2 A;  3HRN A;  4U74 A;  3R84 B;  1GTW A;  1T8Z A;  3RYI E;  3DP7 A;  2CMR A;  3CX6 B;  4Y99 C;  5AW0 B;  1G2C A;  5BVZ A;  1NOH A;  2SPC A;  4GOU A;  2DHR A;  3V2Q A;  4N78 D;  2N1G A;  3E0Z A;  4CZZ B;  4IE0 A;  4YLH A;  3CX8 B;  1HJB A;  4QXC B;  3BRV B;  3I9W A;  3ANW B;  3C9I A;  3MGN A;  4JLE A;  1HVV A;  3OAK A;  1YKE B;  1MNE A;  4PJM A;  3HUS B;  3ZYM A;  3O1H A;  2Z5I A;  5AVQ B;  2CWO A;  1M1J A;  4YFS A;  1RF1 C;  4UVB B;  2XAG B;  3I1A A;  2KWH A;  2CM0 A;  4PK5 A;  2Q9Q D;  4OH8 B;  1GK4 A;  3C51 A;  4EOZ B;  2OYH C;  3U1C A;  1RE4 C;  1IJ5 A;  3DTO A;  3M65 A;  4EZH A;  3HA4 A;  1MMG A;  1MFZ A;  4X1Y E;  3H37 A;  3RRC A;  3MTU E;  3NZQ A;  2HPC A;  1YKH B;  1FZG A;  3BQI A;  2IC6 A;  3CWZ B;  5FXZ A;  1HGZ A;  3HD7 A;  5L3F B;  3V5B A;  5KJ7 A;  2H7V C;  1N7L A;  4GYS A;  2N1T A;  2WAU A;  2PG8 A;  1SFC A;  4W7Z A;  1UCU A;  3AA6 B;  1NKN A;  1HCI A;  2L8K A;  4PNI A;  2XTL A;  1HFA A;  1FMW A;  1MMD A;  4AQF C;  2V7I A;  4BA9 A;  4BJN A;  2OYI C;  2IFM A;  4PK6 A;  2X67 A;  4AXP A;  2KP8 A;  3UUN A;  5CCG D;  3KYQ A;  3W15 B;  1VPC A;  3PUS A;  1S9K E;  4MHC A;  3VKH A;  3I9Y A;  3E22 E;  4DVD A;  3VKG A;  3N7N A;  3B5N D;  4AQR D;  4OYK A;  3L3P A;  5LGU B;  3DJB A;  2VKO A;  5HXH A;  1LTJ A;  4UEM A;  3L36 A;  1D0Z A;  1FAV A;  4IGU A;  3KQG A;  3N9P A;  5LBQ B;  1T3J A;  2XAF B;  5LYJ E;  2QA7 A;  3LK4 2;  1T98 A;  4CQI A;  5JDG A;  2IC9 A;  3OKQ A;  1LT9 B;  2W62 A;  3HKB E;  4WY4 C;  4IIJ E;  4AI6 A;  1Z0P A;  3UUM A;  1JY2 O;  2Q3I A;  3PUQ A;  3VMZ A;  5HAX A;  2DNX A;  4Z8X A;  2C5I T;  3C4W A;  1LTT C;  3H32 A;  4ZKP A;  2GUS A;  3IR9 A;  5CA0 E;  2K24 A;  3KV9 A;  2P2U A;  2XUE A;  3VYI A;  3A7O A;  2NPS C;  2ZM0 A;  3LK2 B;  1GL2 C;  1T3U A;  1H88 A;  3FB2 A;  3RH3 A;  3NTN A;  2ZLY A;  2PJQ A;  3ZLI A;  1GK6 A;  2Q9Q B;  2W0G A;  3G3Z A;  4UXN B;  3M0A A;  3M91 A;  1VRB A;  2J1D G;  2WMO A;  3IBP A;  3TSI A;  1IJD B;  4HEA A;  4GK5 E;  3PP5 A;  2W00 A;  4ANJ A;  2VL8 A;  1RF0 C;  3BQL A;  3CPZ A;  4EAH A;  2R32 A;  5CMZ A;  3HD7 D;  1MIV A;  4TN7 B;  2Q5U A;  1J2J B;  5KJ7 D;  1LVK A;  2D5U A;  3F31 A;  4ZOL E;  2E9X A;  2RP4 A;  3MK7 C;  3KDS E;  2D0T A;  1SFC D;  3SWH A;  1FJP A;  3HUS A;  4O2A E;  4H63 V;  4TUY E;  2KZ7 B;  1A02 J;  4TZ4 C;  1VOM A;  1FIO A;  1G8X A;  3FXD B;  2FKW B;  2MYS A;  2JJ9 A;  1IK9 A;  3CX7 B;  4H9O C;  2YU2 A;  2EHO A;  5CB4 E;  4F6R C;  2W6A A;  5APU A;  1A02 F;  4AKG A;  1BR0 A;  1N73 A;  2UXN B;  3MKD A;  4HYT B;  3IF8 B;  3B5N B;  3FBL A;  2X9H A;  3KIN B;  1IJ6 A;  3PU3 A;  1QL1 A;  4ZI2 D;  3RC3 A;  2DLR A;  2E42 A;  2QM8 A;  1WR6 A;  2OA5 A;  2J58 A;  4O4H E;  2XDJ A;  3ZMU B;  4NUU A;  2R5B A;  2A3D A;  5HWY A;  3CLQ A;  4KUM B;  3WMM 0;  3I0Q A;  4JYC A;  3LW5 H;  2QM7 A;  1SQQ K;  3V2P A;  4CI3 B;  4IFF A;  5KTB A;  2WTY A;  4I43 B;  2E8I A;  1M7L A;  2YNY A;  3RKO A;  2JRK A;  4UV8 B;  2ES0 A;  3RC8 A;  2V7L A;  3OA7 A;  4W80 A;  4BJM A;  4UVC B;  4FJO A;  3SRZ A;  4L5G A;  2L3L A;  1M1J B;  2CLY B;  3QK6 A;  2HG5 D;  1FZA A;  3NRX A;  2NWB A;  3QC9 A;  2KOG A;  1NWQ A;  1NWM X;  2XKM A;  1LT9 A;  2N9B A;  2M8R A;  1S94 A;  4OFZ A;  3P8C D;  1KIL C;  2W6B A;  2HPC B;  1SQB K;  4GIF A;  2A45 H;  1N7S A;  2C0W A;  3ZMZ B;  4AQG A;  1J1D B;  3HD7 B;  1FZC C;  4GK0 E;  3VOP A;  1SQV K;  2N1T B;  5JR9 C;  3ZN1 B;  3N9Q A;  1G1I A;  2XHE B;  1SFC B;  2CPB A;  2LSJ A;  4IE6 A;  3NMD A;  1FMV A;  3AVS A;  2LE8 A;  2L5G B;  2QGS A;  3I0O A;  2DCF A;  3OYX A;  4N78 E;  3U78 A;  1HGV A;  1FOS E;  3MZK B;  4HH2 A;  3KPE A;  1HH0 A;  5EK3 A;  4OYJ A;  2BAS A;  2EHO D;  2LOP A;  2KT9 A;  3NRY A;  3IFM A;  1LKX A;  3K3N A;  2WWU A;  3V5S A;  5HYA A;  1JY3 O;  2DI4 A;  1LTA C;  1W2E A;  1SVF A;  5JRE A;  1DX7 A;  3RL0 C;  2PP6 A;  1SP4 A;  2YO2 A;  3HI2 A;  3TKL B;  3M0D C;  5AW9 B;  3CQG B;  3MA9 A;  3O1J A;  1ZV8 A;  1SQX K;  3UUL A;  2MBG A;  1MIW A;  3BAS A;  5LCY A;  3V4W A;  3WI3 A;  3U59 A;  1HG2 A;  3V2N A;  5L3E B;  4KHX A;  4IHJ E;  4QWN B;  4AKI A;  5CCG A;  1YW0 A;  2HPJ A;  4ADZ A;  2C9L Y;  5DJQ C;  1FBM A;  4MFR A;  2Q9I A;  2CA5 A;  3JC6 C;  5AW7 B;  3H32 B;  5GON E;  2M3B A;  2A72 A;  2VB6 A;  2H8P D;  3R2P A;  1IZN B;  4NUV A;  3ZMS B;  1MUU A;  2CWY A;  2XAH B;  4PAG A;  2V7K A;  2X9W A;  1D1A A;  4HE8 A;  1N2D C;  4LGD E;  1ZKE A;  2V7M A;  5HXE A;  4PJL A;  4U72 A;  1BR2 A;  2P7J A;  2Y6X A;  1E5W A;  1ZEE A;  4HFV A;  4DO0 A;  2CCQ A;  5KX5 E;  1N7S D;  1NTZ K;  3UUX B;  2E9X B;  3SS1 A;  5AVW B;  4JYB A;  4ZS3 A;  2D0U A;  1RE3 A;  2IFN A;  3HKC E;  2NTY A;  1QSD A;  3KV4 A;  3J7Y q;  5KDM C;  1ZR2 A;  3Q9D A;  1GW3 A;  2DWG A;  2FFD A;  1GDT A;  3H6P A;  2EHO B;  3IEE A;  5L3C B;  1URQ D;  5FY1 A;  5AVZ B;  3MJX A;  1N73 B;  4WY4 D;  2Y48 B;  3VP9 A;  4EYU A;  1HF8 A;  4O4J E;  5CCH C;  3N2O A;  4N3Y B;  3L35 A;  3VU7 H;  2HYN A;  4ZI3 C;  4OHF A;  3SOL A;  1Z56 A;  3BVH A;  2LOS A;  5ETW A;  1HG5 A;  1KFM A;  4L0R A;  3AAA B;  1ZV4 X;  1FZB A;  1GL2 D;  4IFM A;  1RF1 B;  3BQK A;  2YO3 A;  3AAI A;  2M67 A;  3RK3 D;  3MXZ A;  3PE0 A;  2X51 A;  2HH7 A;  1ZR4 A;  4YJ3 E;  4RES B;  1X79 B;  3EDU A;  1LWU C;  1PFI A;  2P1J A;  1GU5 A;  2NTX A;  4HGA A;  3NZP A;  2YK0 A;  4ZHQ E;  3MIW A;  2XZR A;  3L4F A;  2HLO A;  4X1I E;  1DH3 A;  2DWK A;  3I5C A;  4AKL A;  2GUV A;  4MBQ A;  4ZI7 E;  5JDQ A;  2LSG A;  4TV8 E;  3ZEF B;  2CXF A;  3N9M A;  2XV5 A;  3V2R A;  2YKO A;  5FXX A;  2KLQ A;  1WYC A;  1JCC A;  4IFD K;  1IO4 A;  5LNK A;  2Q9Q C;  1WRG A;  5LHH B;  1N7S B;  3A5T A;  3PU8 A;  4B6X A;  5FXV A;  2PAJ A;  3L37 A;  3MD0 A;  3CQC B;  5LP6 E;  4O8S A;  3N2G E;  2H7O A;  4QHO A;  4WBO A;  4QXB B;  3KBU A;  3LK3 B;  1S35 A;  4X1K E;  3ZJ2 A;  1D1C A;  3RK2 D;  3GHG A;  4LC1 A;  1MIY A;  1CZQ A;  4C91 A;  3K8P C;  1HBW A;  1U5P A;  3HL6 A;  3OBV E;  4I4T E;  2HFE D;  4O4L E;  3TYY A;  2WSF H;  3KDP B;  2NOX A;  1IFJ A;  4XE5 B;  1URQ B;  3KV5 A;  2A45 I;  1AJ3 A;  4WY4 B;  5BU8 B;  3V4Q A;  1IC2 A;  5AVT B;  4L9I A;  1G1J A;  2KXP B;  1WYB A;  5AW4 B;  4O9B A;  2BDE A;  3VMX A;  3UTK A;  5CCG C;  3CL3 D;  5E0O A;  1L4A A;  2WIT A;  2WWW A;  4QX8 B;  2ZXE B;  1D0X A;  3U1A A;  4O2B E;  5C8Y E;  4TX5 A;  4B86 A;  4MAL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...