1NAFA

Crystal structure of the human gga1 gat domain
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
129
structure length
124
Chain Sequence
b'DEEKSKMLARLLKSSHPEDLRAANKLIKEMVQEDQKRMEKISKRVNAIEEVNNNVKLLTEMVMSHSQGSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEILQANDNLTQVINLYKQLVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADP-ribosylation factor binding protein GGA1
publication title The Structure of the GGA1-GAT Domain Reveals the Molecular Basis for ARF Binding and Membrane Association of GGAs
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein, membrane protein
total genus 37
structure length 124
sequence length 129
ec nomenclature
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03127 GAT GAT domain
A PF18308 GGA_N-GAT GGA N-GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1nafA01
1.20.58.160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1nafA02
1H88A 2WPSA 3V4WA 4AQRD 3I5CA 3NFQA 5APQA 5AVTB 3VMXA 4AYCA 2E42A 2R3CA 3KQGA 3MGNA 2R5DA 4EOTA 5AVUB 2XU6A 3OAKA 1X79A 2P67A 1A02J 2XZRA 1MFZA 5APXA 1H8AA 4JYBA 5CMZA 1IO4A 1MV8A 1FOSF 5AVSB 5AVQB 4B86A 5APWA 3P7KA 2IPPA 5AW7B 1GU5A 1HWTC 3A2AA 3T97A 3L35A 3M0DA 2QM7A 2ZXEB 1MUUA 5AVVB 3O8ZA 3M9HA 1FAVA 2P2UA 3L36A 5AVYB 1NWQA 1KQLA 4I2LC 3NXSA 3HE4A 2Q5UA 2Z5HA 1CZQA 1S9KD 3VMYA 5AW6B 3KDPB 4M3LA 1GU4A 3VMZA 3A7OA 5AW2B 3VN0A 2C9NY 2QM8A 5AW1B 3L37A 1O3XA 1OWAA 3M0AA 2BASA 1GK6A 5APUA 1HJBA 1NAFA 3LIEA 1HUCA 4I6MC 5APTA 1SLQA 4C7NA 2E43A 5AVWB 1WR6A 2N2NA 3V4QA 1T2KD 2C9LY 1GD2E 1SP4A 1GZLA 2YO2A 1G2CB 3P8MC 4DZOA 1GK4A 2YNYA 1H89A 3M9BA 5AW4B 1HBWA 1YD8G 2Z5IA 1S9KE 3HE5A 2WT7A 3NTNA 2XV5A 1CSBA 3MD0A 4C46A 4KHXA 4XE5B 3V5BA 5APYA 2R5BA 4HYTB 3VYIA 1NWMX 2KP8A 2ZFCA 5APVA 2YO3A 3B8EB 3TYYA 3UIAA 3HE4B 3HE5B 3LIDA 2WT7B 1JUNA 2VRSA 2WTYA 5AW9B 1DH3A 5AVRB 5AVZB 3HTKA 3IR9A 3TNUA 3SWFA 5AW8B 1CI6A 1A02F 2W6AA 4GKGA 1GTWA 2WPRA 4LC1A 1T2KC 2N9BA 3P32A 1JNMA 4GT1A 2WWWA 4JYCA 2N9DA 2P7JA 3NMDA 1YYCA 5AW5B 2W27A 3A5TA 4C7NB 4AUWA 3M91A 3VTPC 3TNUB 1OXZA 2JJLA 1CI6B 3A3YB 4RESB 5APSA 1FOSE 3TK1A 5AW0B 1WRDA 5AW3B 2WPQA 2R32A 2Q3IA 3M06A 1X8YA 2Q7CA 1J2JB 2H7HA 5AVXB
chains in the Genus database with same CATH superfamily
2IZ0A 1NKZB 1Y64B 2E5YA 4BAYB 3KVBA 1JEKA 1S94A 5LXTE 2Q9QB 4H44D 4R4LA 3BQKA 2CXDA 4OHFA 3CCRP 1N86A 1SFCA 1OEDA 4KMCA 3CX5H 3OAKA 1PP9J 4O4HE 3RPUA 1IZNB 4JYBA 4I50E 4M1PA 5AVSB 2XQAA 2LJLA 3LBXA 4QXHB 2IC6A 1NH4A 1QLED 1HX8A 1L2PA 4IL6E 5AQFB 4NIQA 3E22E 4JI5T 1RE4A 5AQSB 2BCCJ 2Z5HA 4ZS2A 3KYQA 4F8HA 1IFMA 4KI0F 1U7JA 5JRCB 1PP9G 2J4GA 3U59A 3BATA 2VK9A 3H1ID 1QLBA 4IL9A 2PRRA 1GK6A 3RYHE 3UU4A 5L4HA 2YKQA 1HF8A 2CCQA 2POHA 2KYVA 2LKHA 3H1LD 1PPJG 3V4QA 1PP9E 1GD2E 4KJMA 2BCCG 2WQYC 2WS3A 1DEBA 2YN6A 3AB3B 4XZCA 4OYJA 3ZYLA 2FJAA 4U2YA 2WT7A 2Y48B 4OYKA 2D2CC 4DMVA 2FBWC 3V6IA 1FZFA 1R8IA 2OV9A 5B5EE 5LJNA 1PPJE 1XNRT 3ZMVB 1W9RA 1U5PA 1MMGA 2BCCE 3TYYA 4ERRA 2ZMAA 2C0SA 5AVZB 4WY4C 3PTZA 1KYOD 1YJ9P 2K1AA 4HFVA 2KNDA 1OW7A 1R5SA 3SWFA 5E79E 3LJCA 2WM9A 3PURA 1IFJA 2W6AA 2RH0A 3OA7A 1KB9D 4DV4T 2QJKC 1GW3A 5FXVA 2B89A 3VTPC 2LHNA 1HTLC 3PUAA 2DWKA 2WU5A 3GHGC 2L9QA 2EHOB 1WYCA 3O6QB 3PU3A 2QIWA 2OYHA 3E08A 3LG7A 1FZCB 2XSBA 1ZP0A 3T1HT 1H88A 1VQOP 4ISTA 3MUDA 1P84E 2ACZA 3KV6A 3A0BE 3I55P 2VVNA 3L75D 2CPTA 1FZAA 3SFDA 3VKHA 3EQ2A 2CPSA 2WU2A 1SQQJ 3E0ZA 1L0LJ 1ZMEC 5JVDE 1AQTA 3ZN1B 1KILB 3VP9A 1MV8A 2IIUA 4FJOA 5L3DB 1T98A 4CI2B 1OEDE 1VOMA 3CVRA 5KLVK 2A45I 4GYSA 2OQQA 5JRCA 1LTSC 3CX5D 4O4JE 2CM0A 3IEEA 3NVOA 3UU6A 4IFDK 2QJPB 1NWQA 5FL1A 3B13A 1URQA 1AQ5A 1SQQG 1NTKK 1N33T 1NU1J 2J5UA 1L0LG 3WAJA 4C7RA 3AE8C 3QK6A 3D6YA 3RIUC 4P09A 4OGQC 2CXFA 2XAQB 4B6XA 2X67A 1MFTA 3CQXC 3SFEC 3K3NA 5C2TA 4QH4A 4L75A 3JAEA 2HH7A 1SQQE 5AQIB 3P4RA 2KMFA 1L0LE 3O1IA 2VKOA 4ZI2D 2WZIA 4YXDA 4P1NA 3ZEFB 1NU1G 2YO2A 4H9OC 1RH5B 5CA0E 2GUVA 4NUUA 1LTBC 2RMZA 1D1CA 1KF6A 2V6XA 1SQBK 2E5LT 2WY2A 5HEOA 4IE5A 3MD0A 3K3QC 1S4XA 5KKZC 2M0BA 2H7OA 3JCFA 1BR1A 3AVRA 2M6BA 1NU1E 1FEWA 1BDCA 3ESLA 2FYUK 3HE4B 4YTNA 3GW6A 5HEGA 2QA4P 2WTYA 1BCCJ 3TF5A 1LTJB 2X9YA 2J62A 4CN1A 1I94T 1Q7YQ 2MYSA 2OYIB 4BRYB 1L0VA 2J1DG 1VCTA 2WPRA 3LK2B 2MTQA 3JAFA 1U4QA 1Z8UA 4YHJA 2K88A 5FMNA 2XQ4A 1DD4A 5JH7E 3UFEA 1BCCG 4QXBB 5HXSA 2R32A 2XM1A 4D6TD 3BRTB 2FXMA 5KAFH 4L9IA 1PGPA 3HD7B 2C5KT 2RN0A 1KILA 3JCUH 3AA6B 4AXPA 4HEAA 4AYCA 1T8BA 2LSKA 1BCCE 1MIVA 3CWZB 5KAIH 1GL2A 3KFWX 4GIFA 3MKDA 3Q5SA 1X79A 2NWBA 3KINB 1D0ZA 3O4XE 2HLOA 4HFEA 4UIGA 5BR8T 2IPPA 5AW7B 2VL8A 1GU5A 2VASA 3T97A 4AISA 3L35A 1LT9C 1NOHA 2G3AA 1VF5C 3CXHE 1OEDC 3RYFE 2R44A 1WMKA 3EI0A 3WAKA 2W8ZA 2G0UA 1EZVD 1JNRA 3AE4A 3SOLA 2ES0A 3BVHA 3PHLA 2ZT9D 2F4VT 1KMIZ 4QWNB 1L4AC 3B57A 3E7KA 4H63V 5APUA 1KD1Q 1RE4C 3AAEB 3NWIA 1K04A 1HUCA 4I6MC 1WR6A 1M57D 1M1JC 4ILAA 2C9LY 2DL1A 3ZN0B 3H32B 2XZEA 5LG4A 4KT0J 2RPAA 4LFCT 3WI3A 3KPEA 1S9KE 4JI7T 2WSEJ 2VB6A 4JI1T 2JP3A 1ZHCA 1WCRA 1LTJA 3S4RA 3DP7A 3OKQA 4NPDA 1NWMX 4KP3C 3CKDA 3ZSSA 4BRYA 3DJBA 4UB8H 1D0XA 3FZKB 5AVRB 5HXCA 4PD4H 3AECC 1S72P 1N7SC 2CHNA 4IDOA 4ZI3D 2WSCH 2CBIA 3H1KD 3RL0D 3Q5EA 5ETWA 3B5MA 4AKHA 2M8RA 1E5WA 4L76A 1T2KC 2FYZA 4U74A 4YT0A 4EGWA 1T7SA 3NMDA 5CFBA 2GK9A 4WBNE 1KTMA 4HJGH 2L3LA 4PD4I 3NBXX 3U1AA 5DJTB 1Y01A 3TKLB 1N34T 1G73A 1X8YA 1S2EA 4YPCA 3IHRA 2YKOA 3ZMSB 4E7ZA 4B3RT 1NJIQ 2XQYA 2ZYAA 3NFQA 1SVFA 4OFZA 2B76A 2Q9QC 4B3TT 1D1AA 1HGZA 4GIWA 2QE7H 2OTKE 1MNEA 2V7KA 2KZIA 2IZ1A 5CCGD 4AKGA 1ZP0C 4DV7T 1JCCA 4HWCA 3VU7H 2E76D 1OX3A 4H13D 1RF1A 4K3AA 3K5BA 2XAFB 1MUUA 1WYBA 4PK5A 1FMWA 2YOEA 2MPKA 2BKPA 1JO5A 2Q5UA 4GK0E 1IFNA 4HWIB 2E9XA 2KK7A 3ZYMA 5KMGP 1SQXD 2E2AA 4ASVA 2VQET 4DUZT 3N9PA 4A56A 3CI9A 1XWMA 1V9DA 3H3MA 1OIPA 2XQ3A 5EK2A 1VL2A 5HAXA 2E74D 1BE3E 4LF9T 2C5JA 4EOZB 1YTZI 1RY3A 3UUMA 1KZUB 2BS3A 4C7NA 2H88A 1KNZA 2W67A 1GZLA 3MIWA 1H89A 3UUBA 5KX5E 3C50A 3R4YA 3PV0F 3FZMB 3AE1A 5APYA 4GK5E 5EFWB 3P4WA 4LFAT 2SPZA 3HKBE 2V7MA 3PUQA 1YBKA 3LK3B 3AEFA 1SQVD 4X1KE 5CBNA 5KLVJ 2FFDB 4TV9E 1VDFA 2FJDA 1HNXT 3K8PC 4UELA 1YITP 2WVRA 2OARA 4KHZF 4QX8B 3RKOA 3CMEP 4KUMB 1LRZA 4TZ4C 4PD4D 2LKMA 3P4PA 4UV9B 2Y8DA 1NVOA 3LW5J 3PP5A 3AE2C 4GKJT 2WB5A 3I9YA 4I1LA 1NYHA 3UQ7A 4I43B 4WVZA 3KXDA 2ZYDA 1CI6B 4Y99B 3ZCIA 5L3FB 4IL6H 5APSA 5IYZE 4IL6X 3EHZA 5AW0B 2EHOC 5AW3B 3ZC0A 1NTME 1VQ5P 3QH9A 1OVRA 3V2RA 1FZCC 2CHOA 3NZQA 1WT6A 3L73J 3C8VA 1FZBA 4YSZA 1AVOA 3NRXA 2ODVA 4DV1T 3D0TA 4C90A 4LMJA 3L70E 1HGVA 1SQBJ 2XASB 5AVUB 4EXTA 1NEKA 2XU6A 1W0AA 4DV2T 4AIUA 3J7Yq 2I0MA 1BR4A 4IE4A 2FYUJ 3L73G 3BCCD 3AE7A 5AVVB 3EWKA 2D2CD 3ZT6A 4U3CA 3RBXA 1HH0A 5B5EH 1SQBG 1S1CX 2QJPC 3G06A 4YSXA 2QYWA 4AKLA 3KDPB 1BGYJ 1VQ7P 3ETVA 3L73E 4ZKPA 4WY4D 3KV9A 4WW0A 3ZMTB 1UURA 1OVUA 2M3EA 4UF0B 1O3XA 3N2KE 2FYUG 1SQBE 1IK9A 5E79H 2X9WA 2A2FX 4Z8XA 3GG2A 1J1EB 5APTA 4HN9A 1LNQA 5AQNB 4N78E 1SFCB 4OK0A 2KB7P 2NPSC 1BGYG 2ZJSE 5CCHA 1SQPK 2BS2A 2FYUE 1ZR4A 3PH0A 2WAUA 5LYJE 1CSBA 4N3YB 2R5BA 5CJ4A 2UWJE 1EDJA 4TT3H 1YKEB 3UFGA 5BU5A 1BGYE 3CL3D 3G3ZA 2NTXA 3HUSA 4DV6T 1M7LA 1P84H 2HPCB 1AJ3A 2XQ9A 3A0BH 2IBZI 3ZLIA 4MFRA 2JQHA 1KK7A 2JEEA 2WPVB 4WBOA 1CI6A 4QXCB 2PGDA 1JY2P 2OYIC 4EIJA 5ADXL 3EAMA 2XTLA 4EEBA 2PAJA 1D1BA 2N1GA 3A5TA 3RKGA 4B3ST 1P84I 4BXLA 4LMLA 3JC6C 2JMKA 2VKDA 1HS7A 1W09A 4JLEA 2H7HA 4IE7A 4CN6A 3KV5A 2FUPA 3F2EA 3FGAD 3P8CE 3HD7C 2YU1A 4L0RA 4OGQD 1PGOA 3AXJB 3AEEC 3BQIA 2JPFA 2W90A 3MGNA 2X0HA 1L0NK 2W63A 5FY7A 2I8DA 1IAPA 1G2CA 2IDOB 5CMZA 5L4EA 4JEUB 3VOPA 3EFFK 2LKGA 3RK2B 1HG5A 4H9QC 4YY3T 1PP9D 2QM7A 2A06G 5CGMA 5AVYB 4UF0A 1G1IA 5LMNT 4DV0T 5AW6B 1KN7A 4H0LB 4K0KT 1OMIA 2KSEA 2OYHB 1HF9A 3GWHA 2M5AA 3RRWA 4X5TA 3CQCB 1PPJD 4ZHQE 4JI6T 2A06E 4DR6T 2LEHA 3Q1MA 2BCCD 2W2UA 2XQ8A 4ASKA 1KFYA 5CB4E 4CZZB 3IAOA 5KXJA 2ACXA 1ZXGA 2WDRA 5JDGA 2YKPA 3VRBA 1M8OB 2M3BA 4DJGA 2G8YA 3AE9A 5M1BA 1YIJP 4YJ3E 5TISE 1FBMA 3RGLA 2HPCA 3TGUJ 2W6BA 5LGUB 3AAAB 3ITKA 3KDSE 2H88C 4UXNB 3L74J 4BWNA 1SUMB 3KBUA 2BVLA 5AQLB 4CXWA 1URQB 2IYOA 2UU9T 1VCSA 1Y47A 4OVNF 1HVVA 4HTEA 1QX8A 1JTHA 3FBZA 1IFDA 4J2CA 2K37A 1PV3A 2LXCB 5J0ZA 1P84D 3TGUG 3BRVB 5JDLA 2CPBA 1BR2A 3CC7P 2P1JA 3V5UA 1PIXA 3L74G 1Q86Q 2XQ7A 3TNUB 1T6AA 3CXHH 2W66A 4PJLA 1VF5D 3AXJA 2WPQA 2YKSA 3M06A 5GTIE 1OZHA 4G2AA 3M3ZB 3J9X1 3L74E 2V7QJ 5AVXB 4IREA 3SWKA 2IBZG 2MAWA 2ZM6T 3H1IJ 3C51A 1N36T 1QVGO 3D6ZA 2VWAA 3SWHA 4EEDA 3B4SA 3LSVA 1L4AD 2YDRA 3CXHI 3AA0B 4TNVA 1LTIC 3G6EP 2JKVA 3H1LJ 4EOTA 1XTCC 1MKMA 2IBZE 1SQQD 5LGNB 5APWA 2KSJA 3MACA 1L0LD 1Y9BA 4EZ4A 1RF0A 3H1IG 2HN1A 3II6A 4IDPA 5AQMB 3L36A 1UIXA 2WSFJ 1J5ET 3AVSA 3M9QA 2A45H 1RQVA 2KIKA 4ZXLA 4QKNA 1CW5A 5L3GB 1RE3A 3VMAA 3AEDC 3H1LG 4M3LA 3FB2A 2YEVC 5L2LA 1QUUA 1NTZK 5AQUB 1VRBA 1R8EA 2XUEA 5AQVB 2ZT9B 3L37A 1NU1D 5EK3A 1N7SD 3S9OA 3FXDB 4R4MA 3UU5A 4LF6T 2Q1KA 4RJTA 2WWVA 1VQKP 1GL2B 2IX7C 5AVWB 3Q2YA 4RKUJ 3KBTA 4CXXA 1T2KD 1GK4A 1X79B 1LWUC 3AEGA 2LSJA 3UUNA 5B66E 3RF1A 5LGTB 5J2UE 5HWYA 3T97B 1YQ3A 3T8OA 3ZPOA 4EYYR 1VQ4P 4DV3T 4LF5T 3U1CA 3ETUA 5FKYA 4UV8B 5CCHC 3UIAA 4QH5A 4BJMA 3HE5B 4ILCA 2VRSA 3N4XA 1XZYA 5A1LA 3AE3A 4B3MT 2WZ7A 2Q9QD 2FFDC 1YJNP 2JWAA 3CCEP 2PFVA 5KJ7C 4EDFA 4X62T 3TNUA 2I1KA 2UXXB 2W0GA 3FBLA 3KHUA 3HI2A 4X64T 3ZMUB 1GTWA 1BCCD 1EXJA 3L09A 2WWWA 3SSUA 1LP1A 3ONLC 4PK4A 3RL0B 2BBJA 4IE0A 1Q2NA 4IGUA 1N7LA 2R3SA 3ZMZB 1XMOT 4Y99C 3HL6A 4JYAT 3NZPA 2AXTE 2FKWB 2KWIB 1FU1A 4ZOLE 3PUWF 3BQLA 1QL1A 2VL0A 2AEMA 5H2FE 2V7LA 4XFJA 3CXHD 2X9XA 2WPSA 2YMKA 2W61A 5FXWA 2NW8A 4TNWA 2OGUA 5DQVA 3JSVC 3AE5A 1SQPJ 1FC2C 4OWFA 3AE6A 2QJYB 3UU8A 1YQ4A 2DI4A 3O1JA 3RL0g 2Q6QA 3S1KA 2PG8A 3G9RA 3UULA 1H0TB 2LE8A 1ZOYC 1GMJA 3ABVA 3H1HJ 4EYUA 4U33A 2HFED 3PTRB 5LNKA 3G71P 1LJ2A 2NZ2A 2AE9A 2IHR1 2JQ9A 3HKEE 1FAVA 2O1JA 1SQPG 2CXLA 2Y6XA 1KQLA 3FXDA 3CPZA 1S9KD 2RP4A 3PUXF 1B7TA 5ABEA 3H3AA 4H9PC 1R5LA 3QC9A 4EIWA 4ZZCA 1FJGT 3CLQA 4HFDA 1ZRTD 3H1HG 4JI0T 5AW1B 1FE6A 2KLVA 2BASA 1QVFO 1SQPE 5HCMA 1NAFA 2W83C 2XNXA 2JRKA 3CCLP 4ADZA 4YTMA 3SS1A 1K05A 1U57A 4PJ0E 1J1EC 2X51A 1W5CE 5FVLA 1Z0PA 1EDIA 1LT1A 1J5WA 2J58A 1SFCC 3P8MC 3P4QA 2O1KA 3H1HE 5IUXA 2OYOA 2WSSV 3GF3A 3RC8A 3F89A 3QWOC 2BKOA 4O2AE 2QVAA 3HE5A 2CWYA 1RF1B 2BS4A 3H1JJ 4XA4A 4IL4A 4KHXA 2EHOD 1L0NJ 1ZKEA 2K24A 3VYIA 2KP8A 1T3UA 2L5GB 4HWFA 3AE9C 3RK3B 4YLHA 3R6NA 1DH3A 2E9XB 5JTGA 2IDBA 3U3IA 2DNXA 2KWHA 1J1DB 1MMNA 2LRKA 3CC2P 3H1JG 4ILUA 3V5SA 1IBMT 1XMQT 4LC1A 3I1AA 1L0NG 2N1TD 2NW7A 4JYCA 1YYCA 3RLFF 5AQOB 2UUCT 4C7NB 3SRZA 3A3YB 3WU2E 1N2DC 2B88A 3OVUA 2CRBA 3H1JE 4PV1B 1L0NE 3PJSK 1JY3P 2XDJA 3VR8A 1H0TA 4EV6A 3L8RA 2KNCB 5CCGA 4ZZBA 5F3JA 4U7IA 4A5XA 3QOFA 1UX5A 1WRGA 4F6RC 1OW6A 4K35A 2MBGA 1N73A 5CHXA 1J1JA 4ZEYA 1MIYA 1EQ7A 1VQMP 5APXA 2X0YA 3GF7A 5JDQA 3RC3A 2I59A 3TDKA 3AAIA 1BE3D 4TWHA 2LSIA 2IMLA 3I56P 2NPSD 2KT9A 3PJAA 3RK2C 3M0DA 4DIDB 2XAGB 3Q9DA 3O8ZA 4JBWF 2O01J 3A0HE 3IN6A 1M62A 3A8YC 3F31A 4PJMA 3RI5A 2H7VC 4ZS3A 4HKAA 4YSYA 1BSNA 4PNIA 4JI2T 1NENA 3FX0A 2Q9IA 2V4HA 5HCJA 2BBHA 1GU4A 4PJNA 4H0LC 3AEBA 5HWXA 1JY2N 1KILE 2OYHC 3Q5WA 1WLXA 1N32T 4X1YE 3MUDC 4WY4B 2XKMA 5KTBA 1QL2A 1LTGC 1S3JA 4G63A 3SFDC 4PFPA 3EDVA 2LR2A 4BA9A 2Y0DA 2BKNA 3CC4P 3UU3A 1SP4A 1PL5A 2M6IA 2UUBT 4GODA 3RGUA 1PZQA 3E1IA 2L8KA 3D70A 2V26A 3BASA 5AQGB 3JC6D 4CI3B 4AQGA 3L4FA 2O01N 4C46A 4DCKA 4UEMA 4L73A 2E75B 3AEGC 3C4ZA 1NTMD 4I55E 1URQC 3HD7D 5AW9B 1HG2A 5LB7B 1H7CA 1G8XA 4MHCA 4PK6A 3RHWA 4JUYA 3HTKA 3OYXA 1Y8AA 3IR9A 1A02F 1XDOA 2XM2A 2QEXP 2Y9YA 3V2QA 2Z6EA 1DIPA 2Y0CA 3L70D 2X68A 2N9BA 3P32A 1SHZC 3F5HA 3ZSTA 3UQ4A 2DLRA 5AW5B 2DWGA 2QRXA 2FJBA 4H9SE 3RYIE 1NTZJ 4YXDC 5FNVE 2KNCA 2WP9A 4LF4T 3O9XA 5FP3A 1S5LE 3O1HA 1OVVA 2D9DA 4MN4C 2AEJA 2X9HA 3L71J 1FJPA 3RX6A 4P0AA 2WITA 4ASWA 4O9BA 2FYNB 1KEYA 3UTKA 1XTGB 2H43A 4DR1T 5AVTB 2YIUB 3HUSB 4OGQB 1NTKJ 1NTZG 3IF8B 3L73D 4TWDA 2WQYA 2HYNA 3B5NB 4OH8B 1H8AA 4ZKUA 3H37A 1SQBD 1FOSF 2Z4EA 2FBWA 5KLVG 3L71G 1VQ6P 5JDFA 4C91A 5TISH 4HWHA 5AQQB 1NTZE 4N78D 2D0UA 4O8SA 3RQWA 1JMBA 1NTKG 1RHZB 2FYUD 4DR7T 2YDQA 2ITAA 4WY4A 3ZC1A 5FY1A 5KLVE 3L71E 2CEAA 3VMZA 3GA8A 4L74A 3A7OA 2NW9A 4EZHA 1HX1B 4H44B 4YTPA 4NPFX 2D2SA 4EB6E 1NKNA 1LVFA 4ANJA 2LSYA 1HJBA 1BGYD 2I1JA 1KILC 1NTKE 1T8ZA 5H6QB 2JWDA 4LLHA 4IHJE 1BR0A 2N2NA 1GL2C 2KZJA 1Q82Q 3OPCA 3OW2O 2IC9A 3GHGA 1G2CB 2CLYB 1M7KA 1X22A 2JO1A 1G1JA 2N9YB 5AQHB 2P58A 3RK3E 5GTIH 4CQIA 4JPZB 3N9OA 2C0WA 2WDQA 3HR0A 3KZIE 2GA1A 4DR3T 5APVA 4OX9T 1M56D 3GMAA 5C8YE 3USSA 3AE4C 1YKHB 2QGSA 2M5AB 1VPCA 1AJYA 3P8CD 4TUYE 3CWBJ 1NHLA 3ZYKA 2GUSA 3RQUA 3ZT5A 4ZI3C 3QUJA 3BCCJ 4DBQA 1E1HB 1KNPA 5C3JA 4RESB 2KZ7B 3HKCE 3MHVA 3SWYA 3L72D 3AE8A 3RIUA 4JV5T 1MNDA 2K9JB 3UT5E 3CWBG 1VF5B 3SFEA 2V7QH 1LTJC 4U7JA 3V4WA 3B5NA 3W15B 2WDVA 4GOUA 3PLNA 2OTJP 3BCCG 3G4SP 3KQGA 2QJYC 1UCUA 4ILBA 3CWBE 2A06D 1JTHB 5J2TE 2XZRA 2W6JH 4UB6E 1E79H 5DJUB 4HB1A 5CCGC 1DD3A 1DEEG 3V2PA 1PFIA 1E2AA 2B9BA 1X9BA 1M1JB 5B66H 1VQNP 1IC2A 1USDA 5IHYA 2ZXEB 5ABFA 2LT3A 1KV4A 2L91A 2WSFH 1FDMA 2YMYA 4NXMT 5IWAT 1JOCA 4IDZA 2LHRA 2WMNA 1X0TA 2YXRB 3VP8A 3B71A 3AA1B 1IFIA 3LFMA 2XSAA 5KJ7D 2IUBA 3N9LA 4U3FJ 3TLTA 1K73Q 3CCMP 2E5VA 4IFMA 1AA0A 1IJ5A 1SLQA 4HE8A 3TLVA 2E43A 2Y0EA 5GTHE 1BSHA 4YJ2E 4DZOA 3EFGA 2HR3A 3M9BA 2KSRA 1KYOI 4I7ZB 1RF1C 3HKDE 2UXBT 2AXTH 3E1RA 1IK7A 2B87B 4XE5B 3ONJA 2LOPA 4U3FG 5H2FH 4ZNCA 2I6HA 4V1Av 1M90Q 5HEJA 1Q90D 3RK3C 1OW8A 1JUNA 3CPWO 2E9XC 1JCDA 3L74D 2FJEA 1J1DC 1N8RQ 1PGQA 3MTUE 1U7MA 4U3FE 1W2BO 4LF8T 4GKGA 3KV4A 1LT9A 4GT1A 2K9JA 3C64A 2V5CA 2IFMA 2RA1A 3EUHA 3Q2MA 2IBZD 2HN2A 2XQ6A 5FXXA 1EXIA 1OFCX 2WBLA 1MMAA 2Q3IA 4PV1C 3L39A 4HGAA 3ZJ2A 5LBQB 4U2ZA 1L4AA 2UXDT 3AE1C 4WWIA 3MJXA 2BDEA 4COFA 3CX5I 1FZGA 5HXRA 4NXNT 3CX8B 1M1JA 3FHNA 2NRGA 3AEFC 4Z1MH 5K5GB 4A98A 5ABHA 2R5DA 5FY0A 4DV5T 4PJ0H 4GOEA 4P0BA 3MA9A 2MKVA 1TU3F 3CCUP 3RIFA 1SFCD 3P7KA 3TGUE 1PGJA 2M67A 4DR2T 1QEXA 1LP1B 2V6YA 3HA4A 5LHGB 3CD6P 3WMM0 3ANWA 4PFOA 3VMYA 3AECA 1N7SA 2YU2A 2AXDS 4E7SA 3WUVA 3FWLA 1FDOA 1T3JA 3ZT7A 2PBIA 5HXEA 2UXCT 3CCJP 2W00A 2O3JA 3H25A 1LGHB 1KNRA 5H6RB 5LCYA 4X1IE 2B87A 4YTPC 2J47A 2IFNA 2NOXA 1KQSO 1VQ9P 4ISSA 3WU2H 2CMRA 1ZN5A 1CHUA 3NKZA 1JY3N 2HODA 4MBQA 3EVYA 3AE7C 2YINA 3H1IE 5LOVE 5C39A 3OBVE 2KLQA 4KBMB 4YFSA 2Q9QA 2E75C 2B1EA 4TV8E 3LIDA 2H8PD 5BVZA 1LVKA 4PAGA 4QX7B 2CE7A 1SQXK 3ZDMA 3H1LE 4DBRA 1IBKT 2WSSH 2BEZF 4NPEA 2YXQB 3OJAB 3CCQP 2QSIA 3JC22 1NTMK 3N2OA 2CWOA 2WSEH 3L3PA 2P7JA 3CQGB 4AQYT 4AUWA 2V5DA 2N1TB 2OLTA 1OXZA 4H63H 1BDDA 3RK2D 1JY2O 3A0HH 2LM9A 5L3BB 5KLIB 3NRYA 5LJMA 3OYZA 1NAYA 3RBZA 1WRDA 3MZWB 3P4SA 2V1DB 2IYPA 3W68A 1YTZT 3L75J 4WNKA 1KYOE 5HEHA 1SS1A 5AQKB 2FYNC 4H0LD 1UK5A 3R2PA 5APQA 1IJ6A 4JQ0D 1KB9E 4GDOA 2YIUC 3HUSC 1SQVK 3IF4A 4CI1B 2ZVOB 3AA7B 2NP9A 2XAHB 1EZVI 2A9UA 5FVKA 1LTAC 3VRAA 4XAXB 3B5NC 5TAOA 1SQPD 1IO4A 3FZFB 3X1DA 3L75G 3PUYF 5AVQB 1SA0E 3A5XA 1MIWA 1UX4A 3VR9A 3P50A 4MLKA 2NPSB 3M9HA 2O01H 3H1HD 2MOZA 3MZKB 2FY8A 4A7PA 4WB4A 3NXSA 2D5UA 5JR9B 3L75E 1FIOA 5FL0A 2HHHT 4Z90A 3I0OA 3Q5PA 3N9QA 1URQD 1HTJF 4H9NC 4H44C 3IFMA 2XHEB 3CMLA 5AFUL 2BG9B 1NO4A 2LSGA 4NUVA 3AE2A 5J1GA 1US7B 1Q81Q 3CIRA 3LIEA 4EYYQ 3PDYA 3CX5E 4ZI7E 2E76B 2PFXA 1N73B 2YK0A 4H13B 2YNYA 4LFBT 1FZEA 2EHOA 3AEAA 4GKKT 2CLYC 1HBWA 3O6QA 2Z5IA 1KC8Q 1FZCA 2DW3A 1S5LH 3V5BA 1S5LX 4HYTB 3Q5RA 1AFOA 1SE7A 4YHHT 2CK3H 3OJAA 2KOGA 2MJZA 2ZYGA 3H1JD 4NPPA 5TJHA 2P10A 3RRCA 1L0ND 5L47A 2E74B 1EZ3A 2N1TA 2E5TA 1UUSA 2CA5A 4MALA 5HYAA 2ZLYA 4CXYA 5JREA 2PTFA 2JR8A 2C5IT 4RO0A 4D6TJ 2LRLA 5DJQC 2XPKA 5CA1E 4AQFA 2V8SV 3WUTA 5LHHB 2BVMA 4AKRB 3R84B 4QMAA 5EK4A 2WMOA 1JNZA 1VQ8P 2UXNB 4IOIH 1HJ0A 2Y9ZA 2C0XA 4IDNA 2Q3EA 3FXEB 3PUSA 3ZKRA 2VVSA 4HKZH 1X9VA 2QA7A 2XNDH 5L3CB 4DR5T 5LHIB 4D6TG 2X66A 3LW5H 1W2EA 1KILD 3PRJA 4QH1A 2PJQA 4N6JA 4JF7A 2IAKA 2NPSA 3HTKB 2P67A 4JI8T 4HFCA 1GL2D 5CJ5A 5LG3A 5JR9A 4B86A 2XQ5A 3TLWA 4KX6A 4U31A 1RQUA 1HWTC 4O4LE 4D6TE 3H6PA 1EDKA 2A45G 5CBOA 4QHOA 1YXRA 1AVYA 2OA5A 3K1SA 1GQEA 4AI6A 2BG9A 4I2LC 3HE4A 1CUNA 3KZIH 2LLYA 1USEA 2DHRA 3KVAA 3IA3A 3A7MA 2A3DA 2JQQA 4CPGA 3FZLB 5JDNA 3VN0A 1ZRTE 2C9NY 2QM8A 4Q25A 1KQFB 2OYIA 3TLSA 1EC5A 3UUXB 1EZVG 3M0AA 2LXBA 3P7IA 1D0YA 4WBAA 2VKHA 1KORA 4Y28J 3MXZA 2H89A 4PW8A 1Z56A 1MZ9A 1EZVE 3GN5B 4DOJA 2D2CB 3NTNA 4I7ZC 1KFMA 4JI4T 2NTYA 3HD7A 3Q3DA 1RF0C 4O2BE 4TN7B 1T72A 1D7MA 1ZEEA 2X0LB 4IT4A 3AEEA 5AQPB 2P9BA 3F57A 3H1KJ 2K3WA 1RE3C 1JB0J 4LGDE 4UR9A 3CCSP 5LBMA 2K48A 4BJNA 4ZI2C 1BE3J 4W80A 4UB6H 1NGMB 1JNMA 3M65A 3Q5DA 2QJKB 2ZVNB 2N9DA 2W27A 3FXEA 5BMVE 2PP6A 2JJLA 2VURA 5HXHA 3GHGB 3H1KG 5GONE 3TK1A 1LKXA 2XAJB 4CN4A 2UUAT 1VQLP 4YXWH 2BZBA 4DO0A 2OTLP 1FDIA 4L5GA 1J2JB 1NTZD 1E7PA 4W7YA 3RIAA 3N9MA 1YQ3C 2KS1B 4HFHA 3CX7B 1BE3G 2R6GF 2WWUA 2LOSA 3H1KE 3EDUA 5M4YA 3D71A 1W0BA 2R3CA 2H3RA 3N2GE 5KLVD 3L71D 4EI2A 3QB5K 4PJJA 5AQJB 3AE3C 1ZV4X 2ZM8A 5FXZA 5GTHH 2FXPA 1A02J 1MFZA 3H32A 2K9AA 1JM0A 3HRNA 4K0UA 1NTKD 2HPLA 3PJAJ 4LF7T 1ZV8A 4WZXA 3DTOA 1KQGB 1ZLLA 1YI2P 1HCIA 1SQXJ 2XY8B 2K9YA 1LWUB 3FWNA 2P2UA 5F5WA 2GM4A 2W4XA 1CZQA 2ZM0A 2HG5D 1NTMJ 4U72A 2JQKA 5KAFE 2BG9E 2A72A 2AXCA 3RK3D 3MK7C 4IIJE 3JCUE 3C9IA 5FYMA 4HFIA 2RKLA 2E9XD 4GYRA 1IBLT 4KHPT 3PE0A 3RH3A 1OWAA 1VQPP 3S4UA 2VQFT 2QG4A 1QSDA 5KAIE 2ZAEB 3GN5A 1LTTC 4UVCB 3AE5C 3L70J 1SQXG 2XJ7A 1I6ZA 3AE6C 1YQ4C 1HNZT 1ZR2A 1ZW0A 2VKJA 3BK9A 1NTMG 4DR4T 5AW4B 4U7YA 3N9NA 1YW0A 3ABVC 1SQQK 3VHLA 1FMVA 1IFPA 3TLUA 1L0LK 4Z91A 1SQXE 5KKZB 3Q5XA 1SQVJ 4HWDA 4PV1D 5ABFB 1DX7A 3I9WA 2LM2A 4EAHA 2ZFCA 3L70G 3W67A 3AEAC 2ZT9C 4AKIA 2FXOA 4HFBA 1WFDA 4TWFA 2K5BB 5LMUT 2WZHA 4ZMDA 5AW8B 4X65T 2WSCJ 1NU1K 1SQVG 2DCFA 2V7IA 2KI7B 3N5LA 2ODUA 3CWBD 2V7JA 2ZXXA 2KS1A 2N1TC 1HNWT 5JDHA 1FOSE 1DU2A 1YJWP 3AEDA 5KLIC 4DVDA 4TLFA 5AQTB 1SQVE 2Q7CA 5KDMC 2K3RA 2BEQD 1XNQT 2D0TA 3ZCJA 1AV1A 4JBZA 1QGKB 4AQRD 3I5CA 4AQFC 1KFNA 5JDMA 4UB8E 1EDLA 3WUUA 4O4IE 3VMXA 4GOFA 2E42A 4PD4E 5BU8B 1IJDB 4UVAB 4JEHB 3GMIA 5CJ0A 5DABA 1JY3O 3RL0C 1UIIA 1LWUA 1YHQP 4HH2A 1GDTA 3ONXA 5L3EB 3FZHB 2NR4A 4LMKA 3T1YT 3A2AA 2JIWA 1LT9B 2AEFA 3PUVF 2KUBA 1OEDB 2KLUA 5L8RJ 3V2NA 1JMMA 2KINB 1HR0T 5AQRB 4I0UA 4IFFA 5JR9C 3PUGA 5F8PA 3CMAP 2WMMA 3U78A 3C4XA 2FFDA 3LBXB 2E75D 3PU8A 5KJ7A 3CCVP 3PUZF 1FJKA 3GLMA 5AW2B 4DUYT 1HFAA 5LA6E 1L4AB 4I4TE 4IE6A 5EZYE 2WCAA 5E0OA 4WYVA 3C1LA 2BG9C 2CBJA 3TSIA 3VKGA 2IW5B 2SPCA 1FS0E 3C98B 3BCCE 1GW4A 2ZM2A 2JMHA 2E76C 1N73C 4H13C 4U3FD 1YD8G 3MP7B 2JJ9A 3L72J 5HEUA 3QNUA 5DQWA 2XV5A 1MMDA 5CCHD 2H89C 1S35A 3M0DC 2J59M 2V6YB 3I0QA 1KYOH 1M1KQ 2KXPB 4FI5A 4DMWA 1K8AQ 4XBFB 2YO3A 3B8EB 3ANWB 4W7ZA 3LDQB 2WT7B 1N7SB 4X66T 1KB9H 3CK6A 4X20E 3AEBC 2YDSA 2E74C 1ZOYA 4DNDA 3C4WA 3L72G 5LP6E 1K9MQ 4IDQA 3K3OA 3B5ND 2W62A 3JADA 4JI3T 3M91A 3RYCE 5JQGE 2E8IA 4H9RC 3QB5A 3LK42 1KB9I 2JDIH 4DT0A 2HPJA 3CX6B 3L72E 4A97A 3IBPA 3ZJ1A 3TGUD 4TX5A 3N7NA 1XDPA 2HODB 1WR0A 3EABA 4UVBB 1UGOA 5ABGA 3OTOT
chains in the Genus database with same CATH topology
1NKZB 1Y64B 4BAYB 3KVBA 1S94A 5LXTE 2Q9QB 3BQKA 2CXDA 4OHFA 1N86A 1SFCA 4KMCA 3OAKA 4O4HE 3RPUA 4JYBA 1IZNB 4I50E 4M1PA 5AVSB 2LJLA 3LBXA 4QXHB 2IC6A 1NH4A 1HX8A 3E22E 1RE4A 2Z5HA 4ZS2A 3KYQA 1IFMA 5JRCB 3U59A 3BATA 2VK9A 1GK6A 3RYHE 2YKQA 1HF8A 2CCQA 2POHA 2KYVA 3V4QA 1GD2E 1DEBA 3AB3B 4XZCA 4OYJA 3ZYLA 2WT7A 2Y48B 4OYKA 4DMVA 1FZFA 5LJNA 3ZMVB 1U5PA 1MMGA 3TYYA 4ERRA 2ZMAA 2C0SA 5AVZB 4WY4C 4HFVA 2KNDA 3SWFA 3LJCA 2WM9A 3PURA 1IFJA 2W6AA 3OA7A 1GW3A 5FXVA 3VTPC 2LHNA 1HTLC 3PUAA 2DWKA 3GHGC 2L9QA 2EHOB 1WYCA 3PU3A 2OYHA 3E08A 3LG7A 1FZCB 1H88A 4ISTA 3MUDA 3KV6A 3VKHA 1FZAA 3EQ2A 2CPSA 3E0ZA 5JVDE 3ZN1B 1KILB 3VP9A 1MV8A 5L3DB 4FJOA 1T98A 4CI2B 1VOMA 3CVRA 5KLVK 2A45I 4GYSA 5JRCA 1LTSC 4O4JE 2CM0A 3IEEA 4IFDK 1NWQA 3B13A 1URQA 1AQ5A 1NTKK 3WAJA 4C7RA 3QK6A 4P09A 2CXFA 2XAQB 4B6XA 2X67A 3CQXC 3K3NA 2HH7A 2KMFA 3O1IA 2VKOA 4ZI2D 3ZEFB 2YO2A 4H9OC 5CA0E 2GUVA 4NUUA 1LTBC 1D1CA 1SQBK 4IE5A 3MD0A 3K3QC 2H7OA 1BR1A 3AVRA 1FEWA 3ESLA 2FYUK 3HE4B 2WTYA 2X9YA 1LTJB 2MYSA 2OYIB 2J1DG 2WPRA 3LK2B 2MTQA 1U4QA 4YHJA 5FMNA 5JH7E 3UFEA 4QXBB 5HXSA 2R32A 3BRTB 2FXMA 4L9IA 3HD7B 2C5KT 1KILA 3AA6B 4AXPA 4HEAA 4AYCA 2LSKA 1MIVA 3CWZB 1GL2A 3KFWX 4GIFA 3MKDA 1X79A 2NWBA 3KINB 1D0ZA 3O4XE 2HLOA 4UIGA 2IPPA 5AW7B 2VL8A 1GU5A 2VASA 3T97A 3L35A 1LT9C 1NOHA 3RYFE 3WAKA 2G0UA 3SOLA 2ES0A 3BVHA 4QWNB 1L4AC 3B57A 4H63V 5APUA 1RE4C 3AAEB 1HUCA 4I6MC 1WR6A 1M1JC 2C9LY 3ZN0B 3H32B 5LG4A 3WI3A 3KPEA 1S9KE 2VB6A 1ZHCA 1LTJA 3DP7A 3OKQA 1NWMX 4KP3C 3CKDA 3DJBA 1D0XA 5AVRB 5HXCA 1N7SC 4ZI3D 2WSCH 3RL0D 5ETWA 4AKHA 2M8RA 1E5WA 1T2KC 4U74A 2FYZA 3NMDA 2GK9A 4WBNE 2L3LA 3NBXX 3U1AA 3TKLB 1G73A 1X8YA 3IHRA 4E7ZA 2YKOA 3ZMSB 2XQYA 3NFQA 1SVFA 4OFZA 2Q9QC 1D1AA 1HGZA 4GIWA 1MNEA 2V7KA 5CCGD 4AKGA 1JCCA 3VU7H 1RF1A 2XAFB 1MUUA 1WYBA 4PK5A 1FMWA 4GK0E 1JO5A 2Q5UA 1IFNA 3ZYMA 2E9XA 5KMGP 3N9PA 4A56A 3CI9A 1V9DA 5EK2A 5HAXA 2C5JA 4EOZB 1YTZI 1RY3A 3UUMA 1KZUB 4C7NA 1KNZA 1GZLA 3MIWA 1H89A 5KX5E 3C50A 5APYA 4GK5E 3HKBE 2V7MA 3PUQA 3LK3B 4X1KE 2FFDB 4TV9E 1VDFA 3K8PC 4UELA 2OARA 4QX8B 3RKOA 4KUMB 1LRZA 4TZ4C 4UV9B 2LKMA 2Y8DA 3PP5A 3I9YA 4I1LA 4I43B 1CI6B 4Y99B 3ZCIA 5L3FB 5APSA 5IYZE 5AW0B 2EHOC 5AW3B 3ZC0A 1FZCC 3V2RA 3NZQA 1WT6A 1FZBA 3NRXA 2ODVA 3D0TA 4C90A 1HGVA 2XASB 5AVUB 4EXTA 2XU6A 3J7Yq 1BR4A 4IE4A 5AVVB 1HH0A 4AKLA 3KDPB 3ETVA 4ZKPA 4WY4D 3KV9A 4WW0A 3ZMTB 4UF0B 1O3XA 3N2KE 1IK9A 2X9WA 2A2FX 4Z8XA 1J1EB 5APTA 4HN9A 4N78E 1SFCB 4OK0A 2KB7P 2NPSC 5CCHA 1SQPK 1ZR4A 2WAUA 5LYJE 1CSBA 4N3YB 2R5BA 5CJ4A 1YKEB 5BU5A 3CL3D 2NTXA 3G3ZA 3HUSA 1M7LA 2HPCB 1AJ3A 3ZLIA 4MFRA 1KK7A 2JEEA 4WBOA 1CI6A 4QXCB 1JY2P 2OYIC 4EIJA 5ADXL 2XTLA 2PAJA 1D1BA 2N1GA 3A5TA 3JC6C 2JMKA 2VKDA 1HS7A 4JLEA 2H7HA 4IE7A 3KV5A 3F2EA 3P8CE 3HD7C 2YU1A 4L0RA 3BQIA 2JPFA 3MGNA 1L0NK 2W63A 5FY7A 1IAPA 1G2CA 5CMZA 4JEUB 3VOPA 3RK2B 1HG5A 4H9QC 2QM7A 5AVYB 4UF0A 1G1IA 5AW6B 2OYHB 3GWHA 3RRWA 3CQCB 4ZHQE 2LEHA 4ASKA 5CB4E 4CZZB 2ACXA 5JDGA 2YKPA 2M3BA 4YJ3E 1FBMA 2HPCA 2W6BA 5LGUB 3AAAB 3KDSE 4UXNB 3KBUA 2BVLA 4CXWA 1URQB 1HVVA 4HTEA 1JTHA 3FBZA 1IFDA 4J2CA 3BRVB 5JDLA 2CPBA 1BR2A 2P1JA 3V5UA 3TNUB 4PJLA 2WPQA 3M06A 4G2AA 3J9X1 5AVXB 3C51A 2VWAA 3SWHA 1L4AD 3AA0B 1LTIC 4EOTA 1XTCC 5LGNB 5APWA 2KSJA 3MACA 4EZ4A 1RF0A 3II6A 3L36A 3AVSA 3M9QA 2A45H 4QKNA 1CW5A 5L3GB 1RE3A 4M3LA 3FB2A 2YEVC 5L2LA 1QUUA 1NTZK 1VRBA 2XUEA 3L37A 5EK3A 1N7SD 3FXDB 1GL2B 2IX7C 5AVWB 4CXXA 3KBTA 1T2KD 1GK4A 1X79B 1LWUC 2LSJA 3UUNA 5LGTB 5J2UE 5HWYA 3T8OA 3ZPOA 4EYYR 3U1CA 3ETUA 4UV8B 5CCHC 3UIAA 4BJMA 3HE5B 2VRSA 3N4XA 5A1LA 2WZ7A 2Q9QD 2FFDC 2PFVA 5KJ7C 3TNUA 2I1KA 2UXXB 2W0GA 3FBLA 3HI2A 3ZMUB 1GTWA 3L09A 2WWWA 4PK4A 3RL0B 4IE0A 4IGUA 1N7LA 3ZMZB 4Y99C 3HL6A 3NZPA 2FKWB 2KWIB 1FU1A 4ZOLE 3BQLA 1QL1A 2V7LA 2X9XA 2WPSA 2W61A 5FXWA 2NW8A 5DQVA 2DI4A 3O1JA 2PG8A 3UULA 2LE8A 4EYUA 2HFED 3PTRB 5LNKA 3HKEE 1FAVA 2O1JA 2CXLA 2Y6XA 1KQLA 3CPZA 1S9KD 2RP4A 1B7TA 3H3AA 4H9PC 3QC9A 4EIWA 3CLQA 5AW1B 2KLVA 2BASA 1NAFA 2XNXA 2JRKA 4ADZA 3SS1A 2X51A 1J1EC 1Z0PA 2J58A 1SFCC 3P8MC 2O1KA 2WSSV 3RC8A 4O2AE 3HE5A 2CWYA 1RF1B 4XA4A 4KHXA 2EHOD 1ZKEA 2K24A 3VYIA 2KP8A 1T3UA 2L5GB 3RK3B 4YLHA 3R6NA 1DH3A 2E9XB 3U3IA 2DNXA 2KWHA 1J1DB 1MMNA 3V5SA 4ILUA 4LC1A 3I1AA 2N1TD 2NW7A 4JYCA 1YYCA 4C7NB 3SRZA 3A3YB 1N2DC 1JY3P 2XDJA 5CCGA 5F3JA 1UX5A 1WRGA 4F6RC 2MBGA 1N73A 5CHXA 1MIYA 1EQ7A 5APXA 5JDQA 3RC3A 2I59A 3AAIA 2LSIA 2NPSD 2KT9A 3RK2C 3M0DA 2XAGB 3Q9DA 3O8ZA 3F31A 4PJMA 2H7VC 4ZS3A 4HKAA 4PNIA 2Q9IA 1GU4A 4PJNA 5HWXA 1JY2N 2OYHC 3Q5WA 1WLXA 4X1YE 4WY4B 2XKMA 5KTBA 1QL2A 1LTGC 4G63A 4PFPA 3EDVA 4BA9A 1SP4A 3E1IA 2L8KA 2V26A 3BASA 3JC6D 4CI3B 4AQGA 3L4FA 4C46A 4UEMA 3C4ZA 4I55E 1URQC 3HD7D 5AW9B 1HG2A 1H7CA 1G8XA 4MHCA 4PK6A 4JUYA 3HTKA 3OYXA 3IR9A 1A02F 3V2QA 2Z6EA 2X68A 2N9BA 3P32A 1SHZC 2DLRA 5AW5B 2DWGA 3RYIE 4H9SE 5FNVE 3O9XA 5FP3A 3O1HA 2X9HA 1FJPA 4P0AA 3RX6A 2WITA 4O9BA 3UTKA 1XTGB 2H43A 5AVTB 3HUSB 3IF8B 2HYNA 3B5NB 4OH8B 1H8AA 4ZKUA 3H37A 1FOSF 2Z4EA 5JDFA 4C91A 4N78D 2D0UA 4O8SA 4WY4A 3ZC1A 5FY1A 2CEAA 3GA8A 3VMZA 3A7OA 2NW9A 4EZHA 2D2SA 4EB6E 1NKNA 1LVFA 4ANJA 2LSYA 1HJBA 2I1JA 1KILC 1T8ZA 5H6QB 4LLHA 4IHJE 1BR0A 2N2NA 1GL2C 2IC9A 3GHGA 1G2CB 2CLYB 1G1JA 4CQIA 3N9OA 2C0WA 3HR0A 5APVA 5C8YE 1YKHB 2QGSA 1VPCA 3P8CD 4TUYE 1NHLA 3ZYKA 2GUSA 4ZI3C 3QUJA 4DBQA 1E1HB 4RESB 2KZ7B 3HKCE 3SWYA 1MNDA 3UT5E 1LTJC 3V4WA 3B5NA 3W15B 4GOUA 3KQGA 1UCUA 1JTHB 5J2TE 2XZRA 5CCGC 3V2PA 1PFIA 1M1JB 1IC2A 5IHYA 2ZXEB 2LT3A 2WSFH 1FDMA 2YMYA 1JOCA 4IDZA 2LHRA 2WMNA 3VP8A 3AA1B 1IFIA 3LFMA 5KJ7D 3N9LA 4IFMA 1IJ5A 4HE8A 1SLQA 2E43A 4YJ2E 4DZOA 3EFGA 3M9BA 1RF1C 3HKDE 4XE5B 2LOPA 4V1Av 3RK3C 1JUNA 2E9XC 1JCDA 1J1DC 3MTUE 4GKGA 3KV4A 1LT9A 4GT1A 3C64A 2IFMA 2RA1A 3EUHA 3Q2MA 5FXXA 2WBLA 1MMAA 2Q3IA 4HGAA 3ZJ2A 5LBQB 1L4AA 3MJXA 2BDEA 1FZGA 5HXRA 3CX8B 1M1JA 3FHNA 2R5DA 5FY0A 4P0BA 3MA9A 1SFCD 3P7KA 2M67A 3HA4A 5LHGB 3WMM0 3ANWA 4PFOA 3VMYA 1N7SA 2YU2A 4E7SA 1T3JA 2PBIA 5HXEA 2W00A 1LGHB 5H6RB 5LCYA 4X1IE 2IFNA 2NOXA 4ISSA 2CMRA 1ZN5A 1JY3N 2HODA 4MBQA 3EVYA 2YINA 5LOVE 3OBVE 2KLQA 4KBMB 4YFSA 2Q9QA 2B1EA 4TV8E 3LIDA 2H8PD 5BVZA 1LVKA 4PAGA 4QX7B 2CE7A 1SQXK 4DBRA 3OJAB 1NTMK 3N2OA 2CWOA 2WSEH 3L3PA 2P7JA 3CQGB 4AUWA 2N1TB 1OXZA 4H63H 3RK2D 1JY2O 5L3BB 2LM9A 5LJMA 3NRYA 3OYZA 1WRDA 2V1DB 1YTZT 4WNKA 3R2PA 5APQA 1IJ6A 3HUSC 1SQVK 4CI1B 3AA7B 2NP9A 2XAHB 1LTAC 4XAXB 3B5NC 5TAOA 1IO4A 5AVQB 1SA0E 3A5XA 1MIWA 1UX4A 4MLKA 2NPSB 3M9HA 2O01H 2MOZA 3MZKB 4WB4A 3NXSA 2D5UA 5JR9B 1FIOA 3I0OA 3N9QA 1URQD 1HTJF 4H9NC 3IFMA 2XHEB 3CMLA 5AFUL 1NO4A 2LSGA 4NUVA 5J1GA 1US7B 3LIEA 3PDYA 4ZI7E 2YK0A 1N73B 2YNYA 1FZEA 2EHOA 2CLYC 1HBWA 2Z5IA 1FZCA 3V5BA 4HYTB 1AFOA 3OJAA 2KOGA 2MJZA 3RRCA 1EZ3A 2N1TA 2CA5A 4MALA 5HYAA 2ZLYA 4CXYA 5JREA 2C5IT 5DJQC 5CA1E 4AQFA 5LHHB 2BVMA 4AKRB 3R84B 5EK4A 2WMOA 2UXNB 2C0XA 3FXEB 3PUSA 1X9VA 2QA7A 5L3CB 5LHIB 2X66A 3LW5H 1W2EA 1KILD 2PJQA 4N6JA 4JF7A 2IAKA 2NPSA 3HTKB 2P67A 1GL2D 5JR9A 4B86A 1HWTC 4O4LE 3H6PA 2A45G 4QHOA 2OA5A 4AI6A 4I2LC 3HE4A 1CUNA 2DHRA 3KVAA 2A3DA 2JQQA 5JDNA 3VN0A 2C9NY 2QM8A 2OYIA 3UUXB 3M0AA 3P7IA 1D0YA 4WBAA 2VKHA 3MXZA 4PW8A 1Z56A 1MZ9A 3GN5B 4DOJA 3NTNA 1KFMA 2NTYA 3HD7A 1RF0C 4O2BE 4TN7B 2X0LB 1ZEEA 2P9BA 3F57A 1RE3C 4LGDE 5LBMA 2K48A 4BJNA 4ZI2C 4W80A 3M65A 1JNMA 2N9DA 2W27A 5BMVE 2PP6A 2JJLA 5HXHA 3GHGB 5GONE 3TK1A 1LKXA 2XAJB 2BZBA 4DO0A 4L5GA 1J2JB 4W7YA 3N9MA 3CX7B 2WWUA 2LOSA 3EDUA 5M4YA 2R3CA 2H3RA 3N2GE 4PJJA 1ZV4X 2ZM8A 5FXZA 1A02J 1MFZA 3H32A 2K9AA 3HRNA 4K0UA 2HPLA 1ZV8A 3DTOA 1ZLLA 1HCIA 1LWUB 2P2UA 2GM4A 1CZQA 2ZM0A 2HG5D 4U72A 2A72A 3MK7C 3RK3D 4IIJE 3C9IA 5FYMA 2E9XD 4GYRA 3PE0A 3S4UA 1OWAA 3RH3A 1QSDA 3GN5A 1LTTC 4UVCB 1ZR2A 2VKJA 3BK9A 5AW4B 3N9NA 1YW0A 1SQQK 3VHLA 1FMVA 1L0LK 3Q5XA 1DX7A 3I9WA 4EAHA 2ZFCA 4AKIA 2K5BB 5AW8B 1NU1K 2DCFA 2V7IA 3N5LA 2ODUA 2V7JA 2N1TC 5JDHA 1FOSE 4DVDA 2Q7CA 5KDMC 2D0TA 3ZCJA 4AQRD 3I5CA 4AQFC 1KFNA 5JDMA 4O4IE 3VMXA 2E42A 5BU8B 1IJDB 4UVAB 4JEHB 3GMIA 5CJ0A 5DABA 1JY3O 3RL0C 1LWUA 4HH2A 1GDTA 3ONXA 5L3EB 3A2AA 1LT9B 3V2NA 1JMMA 2KINB 4IFFA 5JR9C 3PUGA 5F8PA 3U78A 3C4XA 2FFDA 3LBXB 3PU8A 5KJ7A 1FJKA 5AW2B 1HFAA 5LA6E 1L4AB 4I4TE 4IE6A 5EZYE 5E0OA 3TSIA 3VKGA 2IW5B 2SPCA 3C98B 1GW4A 2ZM2A 2JMHA 1N73C 1YD8G 2JJ9A 5DQWA 2XV5A 1MMDA 5CCHD 1S35A 3M0DC 2J59M 3I0QA 2KXPB 4FI5A 4DMWA 4XBFB 2YO3A 3B8EB 3ANWB 4W7ZA 2WT7B 1N7SB 4X20E 4DNDA 3C4WA 5LP6E 3K3OA 3B5ND 2W62A 3M91A 3RYCE 5JQGE 2E8IA 4H9RC 3LK42 2HPJA 3CX6B 3IBPA 3ZJ1A 4TX5A 3N7NA 2HODB 4UVBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H88 A;  2WPS A;  3V4W A;  4AQR D;  3I5C A;  3NFQ A;  5APQ A;  5AVT B;  3VMX A;  4AYC A;  2E42 A;  2R3C A;  3KQG A;  3MGN A;  2R5D A;  4EOT A;  5AVU B;  2XU6 A;  3OAK A;  1X79 A;  2P67 A;  1A02 J;  2XZR A;  1MFZ A;  5APX A;  1H8A A;  4JYB A;  5CMZ A;  1IO4 A;  1MV8 A;  1FOS F;  5AVS B;  5AVQ B;  4B86 A;  5APW A;  3P7K A;  2IPP A;  5AW7 B;  1GU5 A;  1HWT C;  3A2A A;  3T97 A;  3L35 A;  3M0D A;  2QM7 A;  2ZXE B;  1MUU A;  5AVV B;  3O8Z A;  3M9H A;  1FAV A;  2P2U A;  3L36 A;  5AVY B;  1NWQ A;  1KQL A;  4I2L C;  3NXS A;  3HE4 A;  2Q5U A;  2Z5H A;  1CZQ A;  1S9K D;  3VMY A;  5AW6 B;  3KDP B;  4M3L A;  1GU4 A;  3VMZ A;  3A7O A;  5AW2 B;  3VN0 A;  2C9N Y;  2QM8 A;  5AW1 B;  3L37 A;  1O3X A;  1OWA A;  3M0A A;  2BAS A;  1GK6 A;  5APU A;  1HJB A;  1NAF A;  3LIE A;  1HUC A;  4I6M C;  5APT A;  1SLQ A;  4C7N A;  2E43 A;  5AVW B;  1WR6 A;  2N2N A;  3V4Q A;  1T2K D;  2C9L Y;  1GD2 E;  1SP4 A;  1GZL A;  2YO2 A;  1G2C B;  3P8M C;  4DZO A;  1GK4 A;  2YNY A;  1H89 A;  3M9B A;  5AW4 B;  1HBW A;  1YD8 G;  2Z5I A;  1S9K E;  3HE5 A;  2WT7 A;  3NTN A;  2XV5 A;  1CSB A;  3MD0 A;  4C46 A;  4KHX A;  4XE5 B;  3V5B A;  5APY A;  2R5B A;  4HYT B;  3VYI A;  1NWM X;  2KP8 A;  2ZFC A;  5APV A;  2YO3 A;  3B8E B;  3TYY A;  3UIA A;  3HE4 B;  3HE5 B;  3LID A;  2WT7 B;  1JUN A;  2VRS A;  2WTY A;  5AW9 B;  1DH3 A;  5AVR B;  5AVZ B;  3HTK A;  3IR9 A;  3TNU A;  3SWF A;  5AW8 B;  1CI6 A;  1A02 F;  2W6A A;  4GKG A;  1GTW A;  2WPR A;  4LC1 A;  1T2K C;  2N9B A;  3P32 A;  1JNM A;  4GT1 A;  2WWW A;  4JYC A;  2N9D A;  2P7J A;  3NMD A;  1YYC A;  5AW5 B;  2W27 A;  3A5T A;  4C7N B;  4AUW A;  3M91 A;  3VTP C;  3TNU B;  1OXZ A;  2JJL A;  1CI6 B;  3A3Y B;  4RES B;  5APS A;  1FOS E;  3TK1 A;  5AW0 B;  1WRD A;  5AW3 B;  2WPQ A;  2R32 A;  2Q3I A;  3M06 A;  1X8Y A;  2Q7C A;  1J2J B;  2H7H A;  5AVX B; 
#chains in the Genus database with same CATH topology
 2IZ0 A;  1NKZ B;  1Y64 B;  2E5Y A;  4BAY B;  3KVB A;  1JEK A;  1S94 A;  5LXT E;  2Q9Q B;  4H44 D;  4R4L A;  3BQK A;  2CXD A;  4OHF A;  3CCR P;  1N86 A;  1SFC A;  1OED A;  4KMC A;  3CX5 H;  3OAK A;  1PP9 J;  4O4H E;  3RPU A;  1IZN B;  4JYB A;  4I50 E;  4M1P A;  5AVS B;  2XQA A;  2LJL A;  3LBX A;  4QXH B;  2IC6 A;  1NH4 A;  1QLE D;  1HX8 A;  1L2P A;  4IL6 E;  5AQF B;  4NIQ A;  3E22 E;  4JI5 T;  1RE4 A;  5AQS B;  2BCC J;  2Z5H A;  4ZS2 A;  3KYQ A;  4F8H A;  1IFM A;  4KI0 F;  1U7J A;  5JRC B;  1PP9 G;  2J4G A;  3U59 A;  3BAT A;  2VK9 A;  3H1I D;  1QLB A;  4IL9 A;  2PRR A;  1GK6 A;  3RYH E;  3UU4 A;  5L4H A;  2YKQ A;  1HF8 A;  2CCQ A;  2POH A;  2KYV A;  2LKH A;  3H1L D;  1PPJ G;  3V4Q A;  1PP9 E;  1GD2 E;  4KJM A;  2BCC G;  2WQY C;  2WS3 A;  1DEB A;  2YN6 A;  3AB3 B;  4XZC A;  4OYJ A;  3ZYL A;  2FJA A;  4U2Y A;  2WT7 A;  2Y48 B;  4OYK A;  2D2C C;  4DMV A;  2FBW C;  3V6I A;  1FZF A;  1R8I A;  2OV9 A;  5B5E E;  5LJN A;  1PPJ E;  1XNR T;  3ZMV B;  1W9R A;  1U5P A;  1MMG A;  2BCC E;  3TYY A;  4ERR A;  2ZMA A;  2C0S A;  5AVZ B;  4WY4 C;  3PTZ A;  1KYO D;  1YJ9 P;  2K1A A;  4HFV A;  2KND A;  1OW7 A;  1R5S A;  3SWF A;  5E79 E;  3LJC A;  2WM9 A;  3PUR A;  1IFJ A;  2W6A A;  2RH0 A;  3OA7 A;  1KB9 D;  4DV4 T;  2QJK C;  1GW3 A;  5FXV A;  2B89 A;  3VTP C;  2LHN A;  1HTL C;  3PUA A;  2DWK A;  2WU5 A;  3GHG C;  2L9Q A;  2EHO B;  1WYC A;  3O6Q B;  3PU3 A;  2QIW A;  2OYH A;  3E08 A;  3LG7 A;  1FZC B;  2XSB A;  1ZP0 A;  3T1H T;  1H88 A;  1VQO P;  4IST A;  3MUD A;  1P84 E;  2ACZ A;  3KV6 A;  3A0B E;  3I55 P;  2VVN A;  3L75 D;  2CPT A;  1FZA A;  3SFD A;  3VKH A;  3EQ2 A;  2CPS A;  2WU2 A;  1SQQ J;  3E0Z A;  1L0L J;  1ZME C;  5JVD E;  1AQT A;  3ZN1 B;  1KIL B;  3VP9 A;  1MV8 A;  2IIU A;  4FJO A;  5L3D B;  1T98 A;  4CI2 B;  1OED E;  1VOM A;  3CVR A;  5KLV K;  2A45 I;  4GYS A;  2OQQ A;  5JRC A;  1LTS C;  3CX5 D;  4O4J E;  2CM0 A;  3IEE A;  3NVO A;  3UU6 A;  4IFD K;  2QJP B;  1NWQ A;  5FL1 A;  3B13 A;  1URQ A;  1AQ5 A;  1SQQ G;  1NTK K;  1N33 T;  1NU1 J;  2J5U A;  1L0L G;  3WAJ A;  4C7R A;  3AE8 C;  3QK6 A;  3D6Y A;  3RIU C;  4P09 A;  4OGQ C;  2CXF A;  2XAQ B;  4B6X A;  2X67 A;  1MFT A;  3CQX C;  3SFE C;  3K3N A;  5C2T A;  4QH4 A;  4L75 A;  3JAE A;  2HH7 A;  1SQQ E;  5AQI B;  3P4R A;  2KMF A;  1L0L E;  3O1I A;  2VKO A;  4ZI2 D;  2WZI A;  4YXD A;  4P1N A;  3ZEF B;  1NU1 G;  2YO2 A;  4H9O C;  1RH5 B;  5CA0 E;  2GUV A;  4NUU A;  1LTB C;  2RMZ A;  1D1C A;  1KF6 A;  2V6X A;  1SQB K;  2E5L T;  2WY2 A;  5HEO A;  4IE5 A;  3MD0 A;  3K3Q C;  1S4X A;  5KKZ C;  2M0B A;  2H7O A;  3JCF A;  1BR1 A;  3AVR A;  2M6B A;  1NU1 E;  1FEW A;  1BDC A;  3ESL A;  2FYU K;  3HE4 B;  4YTN A;  3GW6 A;  5HEG A;  2QA4 P;  2WTY A;  1BCC J;  3TF5 A;  1LTJ B;  2X9Y A;  2J62 A;  4CN1 A;  1I94 T;  1Q7Y Q;  2MYS A;  2OYI B;  4BRY B;  1L0V A;  2J1D G;  1VCT A;  2WPR A;  3LK2 B;  2MTQ A;  3JAF A;  1U4Q A;  1Z8U A;  4YHJ A;  2K88 A;  5FMN A;  2XQ4 A;  1DD4 A;  5JH7 E;  3UFE A;  1BCC G;  4QXB B;  5HXS A;  2R32 A;  2XM1 A;  4D6T D;  3BRT B;  2FXM A;  5KAF H;  4L9I A;  1PGP A;  3HD7 B;  2C5K T;  2RN0 A;  1KIL A;  3JCU H;  3AA6 B;  4AXP A;  4HEA A;  4AYC A;  1T8B A;  2LSK A;  1BCC E;  1MIV A;  3CWZ B;  5KAI H;  1GL2 A;  3KFW X;  4GIF A;  3MKD A;  3Q5S A;  1X79 A;  2NWB A;  3KIN B;  1D0Z A;  3O4X E;  2HLO A;  4HFE A;  4UIG A;  5BR8 T;  2IPP A;  5AW7 B;  2VL8 A;  1GU5 A;  2VAS A;  3T97 A;  4AIS A;  3L35 A;  1LT9 C;  1NOH A;  2G3A A;  1VF5 C;  3CXH E;  1OED C;  3RYF E;  2R44 A;  1WMK A;  3EI0 A;  3WAK A;  2W8Z A;  2G0U A;  1EZV D;  1JNR A;  3AE4 A;  3SOL A;  2ES0 A;  3BVH A;  3PHL A;  2ZT9 D;  2F4V T;  1KMI Z;  4QWN B;  1L4A C;  3B57 A;  3E7K A;  4H63 V;  5APU A;  1KD1 Q;  1RE4 C;  3AAE B;  3NWI A;  1K04 A;  1HUC A;  4I6M C;  1WR6 A;  1M57 D;  1M1J C;  4ILA A;  2C9L Y;  2DL1 A;  3ZN0 B;  3H32 B;  2XZE A;  5LG4 A;  4KT0 J;  2RPA A;  4LFC T;  3WI3 A;  3KPE A;  1S9K E;  4JI7 T;  2WSE J;  2VB6 A;  4JI1 T;  2JP3 A;  1ZHC A;  1WCR A;  1LTJ A;  3S4R A;  3DP7 A;  3OKQ A;  4NPD A;  1NWM X;  4KP3 C;  3CKD A;  3ZSS A;  4BRY A;  3DJB A;  4UB8 H;  1D0X A;  3FZK B;  5AVR B;  5HXC A;  4PD4 H;  3AEC C;  1S72 P;  1N7S C;  2CHN A;  4IDO A;  4ZI3 D;  2WSC H;  2CBI A;  3H1K D;  3RL0 D;  3Q5E A;  5ETW A;  3B5M A;  4AKH A;  2M8R A;  1E5W A;  4L76 A;  1T2K C;  2FYZ A;  4U74 A;  4YT0 A;  4EGW A;  1T7S A;  3NMD A;  5CFB A;  2GK9 A;  4WBN E;  1KTM A;  4HJG H;  2L3L A;  4PD4 I;  3NBX X;  3U1A A;  5DJT B;  1Y01 A;  3TKL B;  1N34 T;  1G73 A;  1X8Y A;  1S2E A;  4YPC A;  3IHR A;  2YKO A;  3ZMS B;  4E7Z A;  4B3R T;  1NJI Q;  2XQY A;  2ZYA A;  3NFQ A;  1SVF A;  4OFZ A;  2B76 A;  2Q9Q C;  4B3T T;  1D1A A;  1HGZ A;  4GIW A;  2QE7 H;  2OTK E;  1MNE A;  2V7K A;  2KZI A;  2IZ1 A;  5CCG D;  4AKG A;  1ZP0 C;  4DV7 T;  1JCC A;  4HWC A;  3VU7 H;  2E76 D;  1OX3 A;  4H13 D;  1RF1 A;  4K3A A;  3K5B A;  2XAF B;  1MUU A;  1WYB A;  4PK5 A;  1FMW A;  2YOE A;  2MPK A;  2BKP A;  1JO5 A;  2Q5U A;  4GK0 E;  1IFN A;  4HWI B;  2E9X A;  2KK7 A;  3ZYM A;  5KMG P;  1SQX D;  2E2A A;  4ASV A;  2VQE T;  4DUZ T;  3N9P A;  4A56 A;  3CI9 A;  1XWM A;  1V9D A;  3H3M A;  1OIP A;  2XQ3 A;  5EK2 A;  1VL2 A;  5HAX A;  2E74 D;  1BE3 E;  4LF9 T;  2C5J A;  4EOZ B;  1YTZ I;  1RY3 A;  3UUM A;  1KZU B;  2BS3 A;  4C7N A;  2H88 A;  1KNZ A;  2W67 A;  1GZL A;  3MIW A;  1H89 A;  3UUB A;  5KX5 E;  3C50 A;  3R4Y A;  3PV0 F;  3FZM B;  3AE1 A;  5APY A;  4GK5 E;  5EFW B;  3P4W A;  4LFA T;  2SPZ A;  3HKB E;  2V7M A;  3PUQ A;  1YBK A;  3LK3 B;  3AEF A;  1SQV D;  4X1K E;  5CBN A;  5KLV J;  2FFD B;  4TV9 E;  1VDF A;  2FJD A;  1HNX T;  3K8P C;  4UEL A;  1YIT P;  2WVR A;  2OAR A;  4KHZ F;  4QX8 B;  3RKO A;  3CME P;  4KUM B;  1LRZ A;  4TZ4 C;  4PD4 D;  2LKM A;  3P4P A;  4UV9 B;  2Y8D A;  1NVO A;  3LW5 J;  3PP5 A;  3AE2 C;  4GKJ T;  2WB5 A;  3I9Y A;  4I1L A;  1NYH A;  3UQ7 A;  4I43 B;  4WVZ A;  3KXD A;  2ZYD A;  1CI6 B;  4Y99 B;  3ZCI A;  5L3F B;  4IL6 H;  5APS A;  5IYZ E;  4IL6 X;  3EHZ A;  5AW0 B;  2EHO C;  5AW3 B;  3ZC0 A;  1NTM E;  1VQ5 P;  3QH9 A;  1OVR A;  3V2R A;  1FZC C;  2CHO A;  3NZQ A;  1WT6 A;  3L73 J;  3C8V A;  1FZB A;  4YSZ A;  1AVO A;  3NRX A;  2ODV A;  4DV1 T;  3D0T A;  4C90 A;  4LMJ A;  3L70 E;  1HGV A;  1SQB J;  2XAS B;  5AVU B;  4EXT A;  1NEK A;  2XU6 A;  1W0A A;  4DV2 T;  4AIU A;  3J7Y q;  2I0M A;  1BR4 A;  4IE4 A;  2FYU J;  3L73 G;  3BCC D;  3AE7 A;  5AVV B;  3EWK A;  2D2C D;  3ZT6 A;  4U3C A;  3RBX A;  1HH0 A;  5B5E H;  1SQB G;  1S1C X;  2QJP C;  3G06 A;  4YSX A;  2QYW A;  4AKL A;  3KDP B;  1BGY J;  1VQ7 P;  3ETV A;  3L73 E;  4ZKP A;  4WY4 D;  3KV9 A;  4WW0 A;  3ZMT B;  1UUR A;  1OVU A;  2M3E A;  4UF0 B;  1O3X A;  3N2K E;  2FYU G;  1SQB E;  1IK9 A;  5E79 H;  2X9W A;  2A2F X;  4Z8X A;  3GG2 A;  1J1E B;  5APT A;  4HN9 A;  1LNQ A;  5AQN B;  4N78 E;  1SFC B;  4OK0 A;  2KB7 P;  2NPS C;  1BGY G;  2ZJS E;  5CCH A;  1SQP K;  2BS2 A;  2FYU E;  1ZR4 A;  3PH0 A;  2WAU A;  5LYJ E;  1CSB A;  4N3Y B;  2R5B A;  5CJ4 A;  2UWJ E;  1EDJ A;  4TT3 H;  1YKE B;  3UFG A;  5BU5 A;  1BGY E;  3CL3 D;  3G3Z A;  2NTX A;  3HUS A;  4DV6 T;  1M7L A;  1P84 H;  2HPC B;  1AJ3 A;  2XQ9 A;  3A0B H;  2IBZ I;  3ZLI A;  4MFR A;  2JQH A;  1KK7 A;  2JEE A;  2WPV B;  4WBO A;  1CI6 A;  4QXC B;  2PGD A;  1JY2 P;  2OYI C;  4EIJ A;  5ADX L;  3EAM A;  2XTL A;  4EEB A;  2PAJ A;  1D1B A;  2N1G A;  3A5T A;  3RKG A;  4B3S T;  1P84 I;  4BXL A;  4LML A;  3JC6 C;  2JMK A;  2VKD A;  1HS7 A;  1W09 A;  4JLE A;  2H7H A;  4IE7 A;  4CN6 A;  3KV5 A;  2FUP A;  3F2E A;  3FGA D;  3P8C E;  3HD7 C;  2YU1 A;  4L0R A;  4OGQ D;  1PGO A;  3AXJ B;  3AEE C;  3BQI A;  2JPF A;  2W90 A;  3MGN A;  2X0H A;  1L0N K;  2W63 A;  5FY7 A;  2I8D A;  1IAP A;  1G2C A;  2IDO B;  5CMZ A;  5L4E A;  4JEU B;  3VOP A;  3EFF K;  2LKG A;  3RK2 B;  1HG5 A;  4H9Q C;  4YY3 T;  1PP9 D;  2QM7 A;  2A06 G;  5CGM A;  5AVY B;  4UF0 A;  1G1I A;  5LMN T;  4DV0 T;  5AW6 B;  1KN7 A;  4H0L B;  4K0K T;  1OMI A;  2KSE A;  2OYH B;  1HF9 A;  3GWH A;  2M5A A;  3RRW A;  4X5T A;  3CQC B;  1PPJ D;  4ZHQ E;  4JI6 T;  2A06 E;  4DR6 T;  2LEH A;  3Q1M A;  2BCC D;  2W2U A;  2XQ8 A;  4ASK A;  1KFY A;  5CB4 E;  4CZZ B;  3IAO A;  5KXJ A;  2ACX A;  1ZXG A;  2WDR A;  5JDG A;  2YKP A;  3VRB A;  1M8O B;  2M3B A;  4DJG A;  2G8Y A;  3AE9 A;  5M1B A;  1YIJ P;  4YJ3 E;  5TIS E;  1FBM A;  3RGL A;  2HPC A;  3TGU J;  2W6B A;  5LGU B;  3AAA B;  3ITK A;  3KDS E;  2H88 C;  4UXN B;  3L74 J;  4BWN A;  1SUM B;  3KBU A;  2BVL A;  5AQL B;  4CXW A;  1URQ B;  2IYO A;  2UU9 T;  1VCS A;  1Y47 A;  4OVN F;  1HVV A;  4HTE A;  1QX8 A;  1JTH A;  3FBZ A;  1IFD A;  4J2C A;  2K37 A;  1PV3 A;  2LXC B;  5J0Z A;  1P84 D;  3TGU G;  3BRV B;  5JDL A;  2CPB A;  1BR2 A;  3CC7 P;  2P1J A;  3V5U A;  1PIX A;  3L74 G;  1Q86 Q;  2XQ7 A;  3TNU B;  1T6A A;  3CXH H;  2W66 A;  4PJL A;  1VF5 D;  3AXJ A;  2WPQ A;  2YKS A;  3M06 A;  5GTI E;  1OZH A;  4G2A A;  3M3Z B;  3J9X 1;  3L74 E;  2V7Q J;  5AVX B;  4IRE A;  3SWK A;  2IBZ G;  2MAW A;  2ZM6 T;  3H1I J;  3C51 A;  1N36 T;  1QVG O;  3D6Z A;  2VWA A;  3SWH A;  4EED A;  3B4S A;  3LSV A;  1L4A D;  2YDR A;  3CXH I;  3AA0 B;  4TNV A;  1LTI C;  3G6E P;  2JKV A;  3H1L J;  4EOT A;  1XTC C;  1MKM A;  2IBZ E;  1SQQ D;  5LGN B;  5APW A;  2KSJ A;  3MAC A;  1L0L D;  1Y9B A;  4EZ4 A;  1RF0 A;  3H1I G;  2HN1 A;  3II6 A;  4IDP A;  5AQM B;  3L36 A;  1UIX A;  2WSF J;  1J5E T;  3AVS A;  3M9Q A;  2A45 H;  1RQV A;  2KIK A;  4ZXL A;  4QKN A;  1CW5 A;  5L3G B;  1RE3 A;  3VMA A;  3AED C;  3H1L G;  4M3L A;  3FB2 A;  2YEV C;  5L2L A;  1QUU A;  1NTZ K;  5AQU B;  1VRB A;  1R8E A;  2XUE A;  5AQV B;  2ZT9 B;  3L37 A;  1NU1 D;  5EK3 A;  1N7S D;  3S9O A;  3FXD B;  4R4M A;  3UU5 A;  4LF6 T;  2Q1K A;  4RJT A;  2WWV A;  1VQK P;  1GL2 B;  2IX7 C;  5AVW B;  3Q2Y A;  4RKU J;  3KBT A;  4CXX A;  1T2K D;  1GK4 A;  1X79 B;  1LWU C;  3AEG A;  2LSJ A;  3UUN A;  5B66 E;  3RF1 A;  5LGT B;  5J2U E;  5HWY A;  3T97 B;  1YQ3 A;  3T8O A;  3ZPO A;  4EYY R;  1VQ4 P;  4DV3 T;  4LF5 T;  3U1C A;  3ETU A;  5FKY A;  4UV8 B;  5CCH C;  3UIA A;  4QH5 A;  4BJM A;  3HE5 B;  4ILC A;  2VRS A;  3N4X A;  1XZY A;  5A1L A;  3AE3 A;  4B3M T;  2WZ7 A;  2Q9Q D;  2FFD C;  1YJN P;  2JWA A;  3CCE P;  2PFV A;  5KJ7 C;  4EDF A;  4X62 T;  3TNU A;  2I1K A;  2UXX B;  2W0G A;  3FBL A;  3KHU A;  3HI2 A;  4X64 T;  3ZMU B;  1GTW A;  1BCC D;  1EXJ A;  3L09 A;  2WWW A;  3SSU A;  1LP1 A;  3ONL C;  4PK4 A;  3RL0 B;  2BBJ A;  4IE0 A;  1Q2N A;  4IGU A;  1N7L A;  2R3S A;  3ZMZ B;  1XMO T;  4Y99 C;  3HL6 A;  4JYA T;  3NZP A;  2AXT E;  2FKW B;  2KWI B;  1FU1 A;  4ZOL E;  3PUW F;  3BQL A;  1QL1 A;  2VL0 A;  2AEM A;  5H2F E;  2V7L A;  4XFJ A;  3CXH D;  2X9X A;  2WPS A;  2YMK A;  2W61 A;  5FXW A;  2NW8 A;  4TNW A;  2OGU A;  5DQV A;  3JSV C;  3AE5 A;  1SQP J;  1FC2 C;  4OWF A;  3AE6 A;  2QJY B;  3UU8 A;  1YQ4 A;  2DI4 A;  3O1J A;  3RL0 g;  2Q6Q A;  3S1K A;  2PG8 A;  3G9R A;  3UUL A;  1H0T B;  2LE8 A;  1ZOY C;  1GMJ A;  3ABV A;  3H1H J;  4EYU A;  4U33 A;  2HFE D;  3PTR B;  5LNK A;  3G71 P;  1LJ2 A;  2NZ2 A;  2AE9 A;  2IHR 1;  2JQ9 A;  3HKE E;  1FAV A;  2O1J A;  1SQP G;  2CXL A;  2Y6X A;  1KQL A;  3FXD A;  3CPZ A;  1S9K D;  2RP4 A;  3PUX F;  1B7T A;  5ABE A;  3H3A A;  4H9P C;  1R5L A;  3QC9 A;  4EIW A;  4ZZC A;  1FJG T;  3CLQ A;  4HFD A;  1ZRT D;  3H1H G;  4JI0 T;  5AW1 B;  1FE6 A;  2KLV A;  2BAS A;  1QVF O;  1SQP E;  5HCM A;  1NAF A;  2W83 C;  2XNX A;  2JRK A;  3CCL P;  4ADZ A;  4YTM A;  3SS1 A;  1K05 A;  1U57 A;  4PJ0 E;  1J1E C;  2X51 A;  1W5C E;  5FVL A;  1Z0P A;  1EDI A;  1LT1 A;  1J5W A;  2J58 A;  1SFC C;  3P8M C;  3P4Q A;  2O1K A;  3H1H E;  5IUX A;  2OYO A;  2WSS V;  3GF3 A;  3RC8 A;  3F89 A;  3QWO C;  2BKO A;  4O2A E;  2QVA A;  3HE5 A;  2CWY A;  1RF1 B;  2BS4 A;  3H1J J;  4XA4 A;  4IL4 A;  4KHX A;  2EHO D;  1L0N J;  1ZKE A;  2K24 A;  3VYI A;  2KP8 A;  1T3U A;  2L5G B;  4HWF A;  3AE9 C;  3RK3 B;  4YLH A;  3R6N A;  1DH3 A;  2E9X B;  5JTG A;  2IDB A;  3U3I A;  2DNX A;  2KWH A;  1J1D B;  1MMN A;  2LRK A;  3CC2 P;  3H1J G;  4ILU A;  3V5S A;  1IBM T;  1XMQ T;  4LC1 A;  3I1A A;  1L0N G;  2N1T D;  2NW7 A;  4JYC A;  1YYC A;  3RLF F;  5AQO B;  2UUC T;  4C7N B;  3SRZ A;  3A3Y B;  3WU2 E;  1N2D C;  2B88 A;  3OVU A;  2CRB A;  3H1J E;  4PV1 B;  1L0N E;  3PJS K;  1JY3 P;  2XDJ A;  3VR8 A;  1H0T A;  4EV6 A;  3L8R A;  2KNC B;  5CCG A;  4ZZB A;  5F3J A;  4U7I A;  4A5X A;  3QOF A;  1UX5 A;  1WRG A;  4F6R C;  1OW6 A;  4K35 A;  2MBG A;  1N73 A;  5CHX A;  1J1J A;  4ZEY A;  1MIY A;  1EQ7 A;  1VQM P;  5APX A;  2X0Y A;  3GF7 A;  5JDQ A;  3RC3 A;  2I59 A;  3TDK A;  3AAI A;  1BE3 D;  4TWH A;  2LSI A;  2IML A;  3I56 P;  2NPS D;  2KT9 A;  3PJA A;  3RK2 C;  3M0D A;  4DID B;  2XAG B;  3Q9D A;  3O8Z A;  4JBW F;  2O01 J;  3A0H E;  3IN6 A;  1M62 A;  3A8Y C;  3F31 A;  4PJM A;  3RI5 A;  2H7V C;  4ZS3 A;  4HKA A;  4YSY A;  1BSN A;  4PNI A;  4JI2 T;  1NEN A;  3FX0 A;  2Q9I A;  2V4H A;  5HCJ A;  2BBH A;  1GU4 A;  4PJN A;  4H0L C;  3AEB A;  5HWX A;  1JY2 N;  1KIL E;  2OYH C;  3Q5W A;  1WLX A;  1N32 T;  4X1Y E;  3MUD C;  4WY4 B;  2XKM A;  5KTB A;  1QL2 A;  1LTG C;  1S3J A;  4G63 A;  3SFD C;  4PFP A;  3EDV A;  2LR2 A;  4BA9 A;  2Y0D A;  2BKN A;  3CC4 P;  3UU3 A;  1SP4 A;  1PL5 A;  2M6I A;  2UUB T;  4GOD A;  3RGU A;  1PZQ A;  3E1I A;  2L8K A;  3D70 A;  2V26 A;  3BAS A;  5AQG B;  3JC6 D;  4CI3 B;  4AQG A;  3L4F A;  2O01 N;  4C46 A;  4DCK A;  4UEM A;  4L73 A;  2E75 B;  3AEG C;  3C4Z A;  1NTM D;  4I55 E;  1URQ C;  3HD7 D;  5AW9 B;  1HG2 A;  5LB7 B;  1H7C A;  1G8X A;  4MHC A;  4PK6 A;  3RHW A;  4JUY A;  3HTK A;  3OYX A;  1Y8A A;  3IR9 A;  1A02 F;  1XDO A;  2XM2 A;  2QEX P;  2Y9Y A;  3V2Q A;  2Z6E A;  1DIP A;  2Y0C A;  3L70 D;  2X68 A;  2N9B A;  3P32 A;  1SHZ C;  3F5H A;  3ZST A;  3UQ4 A;  2DLR A;  5AW5 B;  2DWG A;  2QRX A;  2FJB A;  4H9S E;  3RYI E;  1NTZ J;  4YXD C;  5FNV E;  2KNC A;  2WP9 A;  4LF4 T;  3O9X A;  5FP3 A;  1S5L E;  3O1H A;  1OVV A;  2D9D A;  4MN4 C;  2AEJ A;  2X9H A;  3L71 J;  1FJP A;  3RX6 A;  4P0A A;  2WIT A;  4ASW A;  4O9B A;  2FYN B;  1KEY A;  3UTK A;  1XTG B;  2H43 A;  4DR1 T;  5AVT B;  2YIU B;  3HUS B;  4OGQ B;  1NTK J;  1NTZ G;  3IF8 B;  3L73 D;  4TWD A;  2WQY A;  2HYN A;  3B5N B;  4OH8 B;  1H8A A;  4ZKU A;  3H37 A;  1SQB D;  1FOS F;  2Z4E A;  2FBW A;  5KLV G;  3L71 G;  1VQ6 P;  5JDF A;  4C91 A;  5TIS H;  4HWH A;  5AQQ B;  1NTZ E;  4N78 D;  2D0U A;  4O8S A;  3RQW A;  1JMB A;  1NTK G;  1RHZ B;  2FYU D;  4DR7 T;  2YDQ A;  2ITA A;  4WY4 A;  3ZC1 A;  5FY1 A;  5KLV E;  3L71 E;  2CEA A;  3VMZ A;  3GA8 A;  4L74 A;  3A7O A;  2NW9 A;  4EZH A;  1HX1 B;  4H44 B;  4YTP A;  4NPF X;  2D2S A;  4EB6 E;  1NKN A;  1LVF A;  4ANJ A;  2LSY A;  1HJB A;  1BGY D;  2I1J A;  1KIL C;  1NTK E;  1T8Z A;  5H6Q B;  2JWD A;  4LLH A;  4IHJ E;  1BR0 A;  2N2N A;  1GL2 C;  2KZJ A;  1Q82 Q;  3OPC A;  3OW2 O;  2IC9 A;  3GHG A;  1G2C B;  2CLY B;  1M7K A;  1X22 A;  2JO1 A;  1G1J A;  2N9Y B;  5AQH B;  2P58 A;  3RK3 E;  5GTI H;  4CQI A;  4JPZ B;  3N9O A;  2C0W A;  2WDQ A;  3HR0 A;  3KZI E;  2GA1 A;  4DR3 T;  5APV A;  4OX9 T;  1M56 D;  3GMA A;  5C8Y E;  3USS A;  3AE4 C;  1YKH B;  2QGS A;  2M5A B;  1VPC A;  1AJY A;  3P8C D;  4TUY E;  3CWB J;  1NHL A;  3ZYK A;  2GUS A;  3RQU A;  3ZT5 A;  4ZI3 C;  3QUJ A;  3BCC J;  4DBQ A;  1E1H B;  1KNP A;  5C3J A;  4RES B;  2KZ7 B;  3HKC E;  3MHV A;  3SWY A;  3L72 D;  3AE8 A;  3RIU A;  4JV5 T;  1MND A;  2K9J B;  3UT5 E;  3CWB G;  1VF5 B;  3SFE A;  2V7Q H;  1LTJ C;  4U7J A;  3V4W A;  3B5N A;  3W15 B;  2WDV A;  4GOU A;  3PLN A;  2OTJ P;  3BCC G;  3G4S P;  3KQG A;  2QJY C;  1UCU A;  4ILB A;  3CWB E;  2A06 D;  1JTH B;  5J2T E;  2XZR A;  2W6J H;  4UB6 E;  1E79 H;  5DJU B;  4HB1 A;  5CCG C;  1DD3 A;  1DEE G;  3V2P A;  1PFI A;  1E2A A;  2B9B A;  1X9B A;  1M1J B;  5B66 H;  1VQN P;  1IC2 A;  1USD A;  5IHY A;  2ZXE B;  5ABF A;  2LT3 A;  1KV4 A;  2L91 A;  2WSF H;  1FDM A;  2YMY A;  4NXM T;  5IWA T;  1JOC A;  4IDZ A;  2LHR A;  2WMN A;  1X0T A;  2YXR B;  3VP8 A;  3B71 A;  3AA1 B;  1IFI A;  3LFM A;  2XSA A;  5KJ7 D;  2IUB A;  3N9L A;  4U3F J;  3TLT A;  1K73 Q;  3CCM P;  2E5V A;  4IFM A;  1AA0 A;  1IJ5 A;  1SLQ A;  4HE8 A;  3TLV A;  2E43 A;  2Y0E A;  5GTH E;  1BSH A;  4YJ2 E;  4DZO A;  3EFG A;  2HR3 A;  3M9B A;  2KSR A;  1KYO I;  4I7Z B;  1RF1 C;  3HKD E;  2UXB T;  2AXT H;  3E1R A;  1IK7 A;  2B87 B;  4XE5 B;  3ONJ A;  2LOP A;  4U3F G;  5H2F H;  4ZNC A;  2I6H A;  4V1A v;  1M90 Q;  5HEJ A;  1Q90 D;  3RK3 C;  1OW8 A;  1JUN A;  3CPW O;  2E9X C;  1JCD A;  3L74 D;  2FJE A;  1J1D C;  1N8R Q;  1PGQ A;  3MTU E;  1U7M A;  4U3F E;  1W2B O;  4LF8 T;  4GKG A;  3KV4 A;  1LT9 A;  4GT1 A;  2K9J A;  3C64 A;  2V5C A;  2IFM A;  2RA1 A;  3EUH A;  3Q2M A;  2IBZ D;  2HN2 A;  2XQ6 A;  5FXX A;  1EXI A;  1OFC X;  2WBL A;  1MMA A;  2Q3I A;  4PV1 C;  3L39 A;  4HGA A;  3ZJ2 A;  5LBQ B;  4U2Z A;  1L4A A;  2UXD T;  3AE1 C;  4WWI A;  3MJX A;  2BDE A;  4COF A;  3CX5 I;  1FZG A;  5HXR A;  4NXN T;  3CX8 B;  1M1J A;  3FHN A;  2NRG A;  3AEF C;  4Z1M H;  5K5G B;  4A98 A;  5ABH A;  2R5D A;  5FY0 A;  4DV5 T;  4PJ0 H;  4GOE A;  4P0B A;  3MA9 A;  2MKV A;  1TU3 F;  3CCU P;  3RIF A;  1SFC D;  3P7K A;  3TGU E;  1PGJ A;  2M67 A;  4DR2 T;  1QEX A;  1LP1 B;  2V6Y A;  3HA4 A;  5LHG B;  3CD6 P;  3WMM 0;  3ANW A;  4PFO A;  3VMY A;  3AEC A;  1N7S A;  2YU2 A;  2AXD S;  4E7S A;  3WUV A;  3FWL A;  1FDO A;  1T3J A;  3ZT7 A;  2PBI A;  5HXE A;  2UXC T;  3CCJ P;  2W00 A;  2O3J A;  3H25 A;  1LGH B;  1KNR A;  5H6R B;  5LCY A;  4X1I E;  2B87 A;  4YTP C;  2J47 A;  2IFN A;  2NOX A;  1KQS O;  1VQ9 P;  4ISS A;  3WU2 H;  2CMR A;  1ZN5 A;  1CHU A;  3NKZ A;  1JY3 N;  2HOD A;  4MBQ A;  3EVY A;  3AE7 C;  2YIN A;  3H1I E;  5LOV E;  5C39 A;  3OBV E;  2KLQ A;  4KBM B;  4YFS A;  2Q9Q A;  2E75 C;  2B1E A;  4TV8 E;  3LID A;  2H8P D;  5BVZ A;  1LVK A;  4PAG A;  4QX7 B;  2CE7 A;  1SQX K;  3ZDM A;  3H1L E;  4DBR A;  1IBK T;  2WSS H;  2BEZ F;  4NPE A;  2YXQ B;  3OJA B;  3CCQ P;  2QSI A;  3JC2 2;  1NTM K;  3N2O A;  2CWO A;  2WSE H;  3L3P A;  2P7J A;  3CQG B;  4AQY T;  4AUW A;  2V5D A;  2N1T B;  2OLT A;  1OXZ A;  4H63 H;  1BDD A;  3RK2 D;  1JY2 O;  3A0H H;  2LM9 A;  5L3B B;  5KLI B;  3NRY A;  5LJM A;  3OYZ A;  1NAY A;  3RBZ A;  1WRD A;  3MZW B;  3P4S A;  2V1D B;  2IYP A;  3W68 A;  1YTZ T;  3L75 J;  4WNK A;  1KYO E;  5HEH A;  1SS1 A;  5AQK B;  2FYN C;  4H0L D;  1UK5 A;  3R2P A;  5APQ A;  1IJ6 A;  4JQ0 D;  1KB9 E;  4GDO A;  2YIU C;  3HUS C;  1SQV K;  3IF4 A;  4CI1 B;  2ZVO B;  3AA7 B;  2NP9 A;  2XAH B;  1EZV I;  2A9U A;  5FVK A;  1LTA C;  3VRA A;  4XAX B;  3B5N C;  5TAO A;  1SQP D;  1IO4 A;  3FZF B;  3X1D A;  3L75 G;  3PUY F;  5AVQ B;  1SA0 E;  3A5X A;  1MIW A;  1UX4 A;  3VR9 A;  3P50 A;  4MLK A;  2NPS B;  3M9H A;  2O01 H;  3H1H D;  2MOZ A;  3MZK B;  2FY8 A;  4A7P A;  4WB4 A;  3NXS A;  2D5U A;  5JR9 B;  3L75 E;  1FIO A;  5FL0 A;  2HHH T;  4Z90 A;  3I0O A;  3Q5P A;  3N9Q A;  1URQ D;  1HTJ F;  4H9N C;  4H44 C;  3IFM A;  2XHE B;  3CML A;  5AFU L;  2BG9 B;  1NO4 A;  2LSG A;  4NUV A;  3AE2 A;  5J1G A;  1US7 B;  1Q81 Q;  3CIR A;  3LIE A;  4EYY Q;  3PDY A;  3CX5 E;  4ZI7 E;  2E76 B;  2PFX A;  1N73 B;  2YK0 A;  4H13 B;  2YNY A;  4LFB T;  1FZE A;  2EHO A;  3AEA A;  4GKK T;  2CLY C;  1HBW A;  3O6Q A;  2Z5I A;  1KC8 Q;  1FZC A;  2DW3 A;  1S5L H;  3V5B A;  1S5L X;  4HYT B;  3Q5R A;  1AFO A;  1SE7 A;  4YHH T;  2CK3 H;  3OJA A;  2KOG A;  2MJZ A;  2ZYG A;  3H1J D;  4NPP A;  5TJH A;  2P10 A;  3RRC A;  1L0N D;  5L47 A;  2E74 B;  1EZ3 A;  2N1T A;  2E5T A;  1UUS A;  2CA5 A;  4MAL A;  5HYA A;  2ZLY A;  4CXY A;  5JRE A;  2PTF A;  2JR8 A;  2C5I T;  4RO0 A;  4D6T J;  2LRL A;  5DJQ C;  2XPK A;  5CA1 E;  4AQF A;  2V8S V;  3WUT A;  5LHH B;  2BVM A;  4AKR B;  3R84 B;  4QMA A;  5EK4 A;  2WMO A;  1JNZ A;  1VQ8 P;  2UXN B;  4IOI H;  1HJ0 A;  2Y9Z A;  2C0X A;  4IDN A;  2Q3E A;  3FXE B;  3PUS A;  3ZKR A;  2VVS A;  4HKZ H;  1X9V A;  2QA7 A;  2XND H;  5L3C B;  4DR5 T;  5LHI B;  4D6T G;  2X66 A;  3LW5 H;  1W2E A;  1KIL D;  3PRJ A;  4QH1 A;  2PJQ A;  4N6J A;  4JF7 A;  2IAK A;  2NPS A;  3HTK B;  2P67 A;  4JI8 T;  4HFC A;  1GL2 D;  5CJ5 A;  5LG3 A;  5JR9 A;  4B86 A;  2XQ5 A;  3TLW A;  4KX6 A;  4U31 A;  1RQU A;  1HWT C;  4O4L E;  4D6T E;  3H6P A;  1EDK A;  2A45 G;  5CBO A;  4QHO A;  1YXR A;  1AVY A;  2OA5 A;  3K1S A;  1GQE A;  4AI6 A;  2BG9 A;  4I2L C;  3HE4 A;  1CUN A;  3KZI H;  2LLY A;  1USE A;  2DHR A;  3KVA A;  3IA3 A;  3A7M A;  2A3D A;  2JQQ A;  4CPG A;  3FZL B;  5JDN A;  3VN0 A;  1ZRT E;  2C9N Y;  2QM8 A;  4Q25 A;  1KQF B;  2OYI A;  3TLS A;  1EC5 A;  3UUX B;  1EZV G;  3M0A A;  2LXB A;  3P7I A;  1D0Y A;  4WBA A;  2VKH A;  1KOR A;  4Y28 J;  3MXZ A;  2H89 A;  4PW8 A;  1Z56 A;  1MZ9 A;  1EZV E;  3GN5 B;  4DOJ A;  2D2C B;  3NTN A;  4I7Z C;  1KFM A;  4JI4 T;  2NTY A;  3HD7 A;  3Q3D A;  1RF0 C;  4O2B E;  4TN7 B;  1T72 A;  1D7M A;  1ZEE A;  2X0L B;  4IT4 A;  3AEE A;  5AQP B;  2P9B A;  3F57 A;  3H1K J;  2K3W A;  1RE3 C;  1JB0 J;  4LGD E;  4UR9 A;  3CCS P;  5LBM A;  2K48 A;  4BJN A;  4ZI2 C;  1BE3 J;  4W80 A;  4UB6 H;  1NGM B;  1JNM A;  3M65 A;  3Q5D A;  2QJK B;  2ZVN B;  2N9D A;  2W27 A;  3FXE A;  5BMV E;  2PP6 A;  2JJL A;  2VUR A;  5HXH A;  3GHG B;  3H1K G;  5GON E;  3TK1 A;  1LKX A;  2XAJ B;  4CN4 A;  2UUA T;  1VQL P;  4YXW H;  2BZB A;  4DO0 A;  2OTL P;  1FDI A;  4L5G A;  1J2J B;  1NTZ D;  1E7P A;  4W7Y A;  3RIA A;  3N9M A;  1YQ3 C;  2KS1 B;  4HFH A;  3CX7 B;  1BE3 G;  2R6G F;  2WWU A;  2LOS A;  3H1K E;  3EDU A;  5M4Y A;  3D71 A;  1W0B A;  2R3C A;  2H3R A;  3N2G E;  5KLV D;  3L71 D;  4EI2 A;  3QB5 K;  4PJJ A;  5AQJ B;  3AE3 C;  1ZV4 X;  2ZM8 A;  5FXZ A;  5GTH H;  2FXP A;  1A02 J;  1MFZ A;  3H32 A;  2K9A A;  1JM0 A;  3HRN A;  4K0U A;  1NTK D;  2HPL A;  3PJA J;  4LF7 T;  1ZV8 A;  4WZX A;  3DTO A;  1KQG B;  1ZLL A;  1YI2 P;  1HCI A;  1SQX J;  2XY8 B;  2K9Y A;  1LWU B;  3FWN A;  2P2U A;  5F5W A;  2GM4 A;  2W4X A;  1CZQ A;  2ZM0 A;  2HG5 D;  1NTM J;  4U72 A;  2JQK A;  5KAF E;  2BG9 E;  2A72 A;  2AXC A;  3RK3 D;  3MK7 C;  4IIJ E;  3JCU E;  3C9I A;  5FYM A;  4HFI A;  2RKL A;  2E9X D;  4GYR A;  1IBL T;  4KHP T;  3PE0 A;  3RH3 A;  1OWA A;  1VQP P;  3S4U A;  2VQF T;  2QG4 A;  1QSD A;  5KAI E;  2ZAE B;  3GN5 A;  1LTT C;  4UVC B;  3AE5 C;  3L70 J;  1SQX G;  2XJ7 A;  1I6Z A;  3AE6 C;  1YQ4 C;  1HNZ T;  1ZR2 A;  1ZW0 A;  2VKJ A;  3BK9 A;  1NTM G;  4DR4 T;  5AW4 B;  4U7Y A;  3N9N A;  1YW0 A;  3ABV C;  1SQQ K;  3VHL A;  1FMV A;  1IFP A;  3TLU A;  1L0L K;  4Z91 A;  1SQX E;  5KKZ B;  3Q5X A;  1SQV J;  4HWD A;  4PV1 D;  5ABF B;  1DX7 A;  3I9W A;  2LM2 A;  4EAH A;  2ZFC A;  3L70 G;  3W67 A;  3AEA C;  2ZT9 C;  4AKI A;  2FXO A;  4HFB A;  1WFD A;  4TWF A;  2K5B B;  5LMU T;  2WZH A;  4ZMD A;  5AW8 B;  4X65 T;  2WSC J;  1NU1 K;  1SQV G;  2DCF A;  2V7I A;  2KI7 B;  3N5L A;  2ODU A;  3CWB D;  2V7J A;  2ZXX A;  2KS1 A;  2N1T C;  1HNW T;  5JDH A;  1FOS E;  1DU2 A;  1YJW P;  3AED A;  5KLI C;  4DVD A;  4TLF A;  5AQT B;  1SQV E;  2Q7C A;  5KDM C;  2K3R A;  2BEQ D;  1XNQ T;  2D0T A;  3ZCJ A;  1AV1 A;  4JBZ A;  1QGK B;  4AQR D;  3I5C A;  4AQF C;  1KFN A;  5JDM A;  4UB8 E;  1EDL A;  3WUU A;  4O4I E;  3VMX A;  4GOF A;  2E42 A;  4PD4 E;  5BU8 B;  1IJD B;  4UVA B;  4JEH B;  3GMI A;  5CJ0 A;  5DAB A;  1JY3 O;  3RL0 C;  1UII A;  1LWU A;  1YHQ P;  4HH2 A;  1GDT A;  3ONX A;  5L3E B;  3FZH B;  2NR4 A;  4LMK A;  3T1Y T;  3A2A A;  2JIW A;  1LT9 B;  2AEF A;  3PUV F;  2KUB A;  1OED B;  2KLU A;  5L8R J;  3V2N A;  1JMM A;  2KIN B;  1HR0 T;  5AQR B;  4I0U A;  4IFF A;  5JR9 C;  3PUG A;  5F8P A;  3CMA P;  2WMM A;  3U78 A;  3C4X A;  2FFD A;  3LBX B;  2E75 D;  3PU8 A;  5KJ7 A;  3CCV P;  3PUZ F;  1FJK A;  3GLM A;  5AW2 B;  4DUY T;  1HFA A;  5LA6 E;  1L4A B;  4I4T E;  4IE6 A;  5EZY E;  2WCA A;  5E0O A;  4WYV A;  3C1L A;  2BG9 C;  2CBJ A;  3TSI A;  3VKG A;  2IW5 B;  2SPC A;  1FS0 E;  3C98 B;  3BCC E;  1GW4 A;  2ZM2 A;  2JMH A;  2E76 C;  1N73 C;  4H13 C;  4U3F D;  1YD8 G;  3MP7 B;  2JJ9 A;  3L72 J;  5HEU A;  3QNU A;  5DQW A;  2XV5 A;  1MMD A;  5CCH D;  2H89 C;  1S35 A;  3M0D C;  2J59 M;  2V6Y B;  3I0Q A;  1KYO H;  1M1K Q;  2KXP B;  4FI5 A;  4DMW A;  1K8A Q;  4XBF B;  2YO3 A;  3B8E B;  3ANW B;  4W7Z A;  3LDQ B;  2WT7 B;  1N7S B;  4X66 T;  1KB9 H;  3CK6 A;  4X20 E;  3AEB C;  2YDS A;  2E74 C;  1ZOY A;  4DND A;  3C4W A;  3L72 G;  5LP6 E;  1K9M Q;  4IDQ A;  3K3O A;  3B5N D;  2W62 A;  3JAD A;  4JI3 T;  3M91 A;  3RYC E;  5JQG E;  2E8I A;  4H9R C;  3QB5 A;  3LK4 2;  1KB9 I;  2JDI H;  4DT0 A;  2HPJ A;  3CX6 B;  3L72 E;  4A97 A;  3IBP A;  3ZJ1 A;  3TGU D;  4TX5 A;  3N7N A;  1XDP A;  2HOD B;  1WR0 A;  3EAB A;  4UVB B;  1UGO A;  5ABG A;  3OTO T; 
#chains in the Genus database with same CATH homology
 1NKZ B;  1Y64 B;  4BAY B;  3KVB A;  1S94 A;  5LXT E;  2Q9Q B;  3BQK A;  2CXD A;  4OHF A;  1N86 A;  1SFC A;  4KMC A;  3OAK A;  4O4H E;  3RPU A;  4JYB A;  1IZN B;  4I50 E;  4M1P A;  5AVS B;  2LJL A;  3LBX A;  4QXH B;  2IC6 A;  1NH4 A;  1HX8 A;  3E22 E;  1RE4 A;  2Z5H A;  4ZS2 A;  3KYQ A;  1IFM A;  5JRC B;  3U59 A;  3BAT A;  2VK9 A;  1GK6 A;  3RYH E;  2YKQ A;  1HF8 A;  2CCQ A;  2POH A;  2KYV A;  3V4Q A;  1GD2 E;  1DEB A;  3AB3 B;  4XZC A;  4OYJ A;  3ZYL A;  2WT7 A;  2Y48 B;  4OYK A;  4DMV A;  1FZF A;  5LJN A;  3ZMV B;  1U5P A;  1MMG A;  3TYY A;  4ERR A;  2ZMA A;  2C0S A;  5AVZ B;  4WY4 C;  4HFV A;  2KND A;  3SWF A;  3LJC A;  2WM9 A;  3PUR A;  1IFJ A;  2W6A A;  3OA7 A;  1GW3 A;  5FXV A;  3VTP C;  2LHN A;  1HTL C;  3PUA A;  2DWK A;  3GHG C;  2L9Q A;  2EHO B;  1WYC A;  3PU3 A;  2OYH A;  3E08 A;  3LG7 A;  1FZC B;  1H88 A;  4IST A;  3MUD A;  3KV6 A;  3VKH A;  1FZA A;  3EQ2 A;  2CPS A;  3E0Z A;  5JVD E;  3ZN1 B;  1KIL B;  3VP9 A;  1MV8 A;  5L3D B;  4FJO A;  1T98 A;  4CI2 B;  1VOM A;  3CVR A;  5KLV K;  2A45 I;  4GYS A;  5JRC A;  1LTS C;  4O4J E;  2CM0 A;  3IEE A;  4IFD K;  1NWQ A;  3B13 A;  1URQ A;  1AQ5 A;  1NTK K;  3WAJ A;  4C7R A;  3QK6 A;  4P09 A;  2CXF A;  2XAQ B;  4B6X A;  2X67 A;  3CQX C;  3K3N A;  2HH7 A;  2KMF A;  3O1I A;  2VKO A;  4ZI2 D;  3ZEF B;  2YO2 A;  4H9O C;  5CA0 E;  2GUV A;  4NUU A;  1LTB C;  1D1C A;  1SQB K;  4IE5 A;  3MD0 A;  3K3Q C;  2H7O A;  1BR1 A;  3AVR A;  1FEW A;  3ESL A;  2FYU K;  3HE4 B;  2WTY A;  2X9Y A;  1LTJ B;  2MYS A;  2OYI B;  2J1D G;  2WPR A;  3LK2 B;  2MTQ A;  1U4Q A;  4YHJ A;  5FMN A;  5JH7 E;  3UFE A;  4QXB B;  5HXS A;  2R32 A;  3BRT B;  2FXM A;  4L9I A;  3HD7 B;  2C5K T;  1KIL A;  3AA6 B;  4AXP A;  4HEA A;  4AYC A;  2LSK A;  1MIV A;  3CWZ B;  1GL2 A;  3KFW X;  4GIF A;  3MKD A;  1X79 A;  2NWB A;  3KIN B;  1D0Z A;  3O4X E;  2HLO A;  4UIG A;  2IPP A;  5AW7 B;  2VL8 A;  1GU5 A;  2VAS A;  3T97 A;  3L35 A;  1LT9 C;  1NOH A;  3RYF E;  3WAK A;  2G0U A;  3SOL A;  2ES0 A;  3BVH A;  4QWN B;  1L4A C;  3B57 A;  4H63 V;  5APU A;  1RE4 C;  3AAE B;  1HUC A;  4I6M C;  1WR6 A;  1M1J C;  2C9L Y;  3ZN0 B;  3H32 B;  5LG4 A;  3WI3 A;  3KPE A;  1S9K E;  2VB6 A;  1ZHC A;  1LTJ A;  3DP7 A;  3OKQ A;  1NWM X;  4KP3 C;  3CKD A;  3DJB A;  1D0X A;  5AVR B;  5HXC A;  1N7S C;  4ZI3 D;  2WSC H;  3RL0 D;  5ETW A;  4AKH A;  2M8R A;  1E5W A;  1T2K C;  4U74 A;  2FYZ A;  3NMD A;  2GK9 A;  4WBN E;  2L3L A;  3NBX X;  3U1A A;  3TKL B;  1G73 A;  1X8Y A;  3IHR A;  4E7Z A;  2YKO A;  3ZMS B;  2XQY A;  3NFQ A;  1SVF A;  4OFZ A;  2Q9Q C;  1D1A A;  1HGZ A;  4GIW A;  1MNE A;  2V7K A;  5CCG D;  4AKG A;  1JCC A;  3VU7 H;  1RF1 A;  2XAF B;  1MUU A;  1WYB A;  4PK5 A;  1FMW A;  4GK0 E;  1JO5 A;  2Q5U A;  1IFN A;  3ZYM A;  2E9X A;  5KMG P;  3N9P A;  4A56 A;  3CI9 A;  1V9D A;  5EK2 A;  5HAX A;  2C5J A;  4EOZ B;  1YTZ I;  1RY3 A;  3UUM A;  1KZU B;  4C7N A;  1KNZ A;  1GZL A;  3MIW A;  1H89 A;  5KX5 E;  3C50 A;  5APY A;  4GK5 E;  3HKB E;  2V7M A;  3PUQ A;  3LK3 B;  4X1K E;  2FFD B;  4TV9 E;  1VDF A;  3K8P C;  4UEL A;  2OAR A;  4QX8 B;  3RKO A;  4KUM B;  1LRZ A;  4TZ4 C;  4UV9 B;  2LKM A;  2Y8D A;  3PP5 A;  3I9Y A;  4I1L A;  4I43 B;  1CI6 B;  4Y99 B;  3ZCI A;  5L3F B;  5APS A;  5IYZ E;  5AW0 B;  2EHO C;  5AW3 B;  3ZC0 A;  1FZC C;  3V2R A;  3NZQ A;  1WT6 A;  1FZB A;  3NRX A;  2ODV A;  3D0T A;  4C90 A;  1HGV A;  2XAS B;  5AVU B;  4EXT A;  2XU6 A;  3J7Y q;  1BR4 A;  4IE4 A;  5AVV B;  1HH0 A;  4AKL A;  3KDP B;  3ETV A;  4ZKP A;  4WY4 D;  3KV9 A;  4WW0 A;  3ZMT B;  4UF0 B;  1O3X A;  3N2K E;  1IK9 A;  2X9W A;  2A2F X;  4Z8X A;  1J1E B;  5APT A;  4HN9 A;  4N78 E;  1SFC B;  4OK0 A;  2KB7 P;  2NPS C;  5CCH A;  1SQP K;  1ZR4 A;  2WAU A;  5LYJ E;  1CSB A;  4N3Y B;  2R5B A;  5CJ4 A;  1YKE B;  5BU5 A;  3CL3 D;  2NTX A;  3G3Z A;  3HUS A;  1M7L A;  2HPC B;  1AJ3 A;  3ZLI A;  4MFR A;  1KK7 A;  2JEE A;  4WBO A;  1CI6 A;  4QXC B;  1JY2 P;  2OYI C;  4EIJ A;  5ADX L;  2XTL A;  2PAJ A;  1D1B A;  2N1G A;  3A5T A;  3JC6 C;  2JMK A;  2VKD A;  1HS7 A;  4JLE A;  2H7H A;  4IE7 A;  3KV5 A;  3F2E A;  3P8C E;  3HD7 C;  2YU1 A;  4L0R A;  3BQI A;  2JPF A;  3MGN A;  1L0N K;  2W63 A;  5FY7 A;  1IAP A;  1G2C A;  5CMZ A;  4JEU B;  3VOP A;  3RK2 B;  1HG5 A;  4H9Q C;  2QM7 A;  5AVY B;  4UF0 A;  1G1I A;  5AW6 B;  2OYH B;  3GWH A;  3RRW A;  3CQC B;  4ZHQ E;  2LEH A;  4ASK A;  5CB4 E;  4CZZ B;  2ACX A;  5JDG A;  2YKP A;  2M3B A;  4YJ3 E;  1FBM A;  2HPC A;  2W6B A;  5LGU B;  3AAA B;  3KDS E;  4UXN B;  3KBU A;  2BVL A;  4CXW A;  1URQ B;  1HVV A;  4HTE A;  1JTH A;  3FBZ A;  1IFD A;  4J2C A;  3BRV B;  5JDL A;  2CPB A;  1BR2 A;  2P1J A;  3V5U A;  3TNU B;  4PJL A;  2WPQ A;  3M06 A;  4G2A A;  3J9X 1;  5AVX B;  3C51 A;  2VWA A;  3SWH A;  1L4A D;  3AA0 B;  1LTI C;  4EOT A;  1XTC C;  5LGN B;  5APW A;  2KSJ A;  3MAC A;  4EZ4 A;  1RF0 A;  3II6 A;  3L36 A;  3AVS A;  3M9Q A;  2A45 H;  4QKN A;  1CW5 A;  5L3G B;  1RE3 A;  4M3L A;  3FB2 A;  2YEV C;  5L2L A;  1QUU A;  1NTZ K;  1VRB A;  2XUE A;  3L37 A;  5EK3 A;  1N7S D;  3FXD B;  1GL2 B;  2IX7 C;  5AVW B;  4CXX A;  3KBT A;  1T2K D;  1GK4 A;  1X79 B;  1LWU C;  2LSJ A;  3UUN A;  5LGT B;  5J2U E;  5HWY A;  3T8O A;  3ZPO A;  4EYY R;  3U1C A;  3ETU A;  4UV8 B;  5CCH C;  3UIA A;  4BJM A;  3HE5 B;  2VRS A;  3N4X A;  5A1L A;  2WZ7 A;  2Q9Q D;  2FFD C;  2PFV A;  5KJ7 C;  3TNU A;  2I1K A;  2UXX B;  2W0G A;  3FBL A;  3HI2 A;  3ZMU B;  1GTW A;  3L09 A;  2WWW A;  4PK4 A;  3RL0 B;  4IE0 A;  4IGU A;  1N7L A;  3ZMZ B;  4Y99 C;  3HL6 A;  3NZP A;  2FKW B;  2KWI B;  1FU1 A;  4ZOL E;  3BQL A;  1QL1 A;  2V7L A;  2X9X A;  2WPS A;  2W61 A;  5FXW A;  2NW8 A;  5DQV A;  2DI4 A;  3O1J A;  2PG8 A;  3UUL A;  2LE8 A;  4EYU A;  2HFE D;  3PTR B;  5LNK A;  3HKE E;  1FAV A;  2O1J A;  2CXL A;  2Y6X A;  1KQL A;  3CPZ A;  1S9K D;  2RP4 A;  1B7T A;  3H3A A;  4H9P C;  3QC9 A;  4EIW A;  3CLQ A;  5AW1 B;  2KLV A;  2BAS A;  1NAF A;  2XNX A;  2JRK A;  4ADZ A;  3SS1 A;  2X51 A;  1J1E C;  1Z0P A;  2J58 A;  1SFC C;  3P8M C;  2O1K A;  2WSS V;  3RC8 A;  4O2A E;  3HE5 A;  2CWY A;  1RF1 B;  4XA4 A;  4KHX A;  2EHO D;  1ZKE A;  2K24 A;  3VYI A;  2KP8 A;  1T3U A;  2L5G B;  3RK3 B;  4YLH A;  3R6N A;  1DH3 A;  2E9X B;  3U3I A;  2DNX A;  2KWH A;  1J1D B;  1MMN A;  3V5S A;  4ILU A;  4LC1 A;  3I1A A;  2N1T D;  2NW7 A;  4JYC A;  1YYC A;  4C7N B;  3SRZ A;  3A3Y B;  1N2D C;  1JY3 P;  2XDJ A;  5CCG A;  5F3J A;  1UX5 A;  1WRG A;  4F6R C;  2MBG A;  1N73 A;  5CHX A;  1MIY A;  1EQ7 A;  5APX A;  5JDQ A;  3RC3 A;  2I59 A;  3AAI A;  2LSI A;  2NPS D;  2KT9 A;  3RK2 C;  3M0D A;  2XAG B;  3Q9D A;  3O8Z A;  3F31 A;  4PJM A;  2H7V C;  4ZS3 A;  4HKA A;  4PNI A;  2Q9I A;  1GU4 A;  4PJN A;  5HWX A;  1JY2 N;  2OYH C;  3Q5W A;  1WLX A;  4X1Y E;  4WY4 B;  2XKM A;  5KTB A;  1QL2 A;  1LTG C;  4G63 A;  4PFP A;  3EDV A;  4BA9 A;  1SP4 A;  3E1I A;  2L8K A;  2V26 A;  3BAS A;  3JC6 D;  4CI3 B;  4AQG A;  3L4F A;  4C46 A;  4UEM A;  3C4Z A;  4I55 E;  1URQ C;  3HD7 D;  5AW9 B;  1HG2 A;  1H7C A;  1G8X A;  4MHC A;  4PK6 A;  4JUY A;  3HTK A;  3OYX A;  3IR9 A;  1A02 F;  3V2Q A;  2Z6E A;  2X68 A;  2N9B A;  3P32 A;  1SHZ C;  2DLR A;  5AW5 B;  2DWG A;  3RYI E;  4H9S E;  5FNV E;  3O9X A;  5FP3 A;  3O1H A;  2X9H A;  1FJP A;  4P0A A;  3RX6 A;  2WIT A;  4O9B A;  3UTK A;  1XTG B;  2H43 A;  5AVT B;  3HUS B;  3IF8 B;  2HYN A;  3B5N B;  4OH8 B;  1H8A A;  4ZKU A;  3H37 A;  1FOS F;  2Z4E A;  5JDF A;  4C91 A;  4N78 D;  2D0U A;  4O8S A;  4WY4 A;  3ZC1 A;  5FY1 A;  2CEA A;  3GA8 A;  3VMZ A;  3A7O A;  2NW9 A;  4EZH A;  2D2S A;  4EB6 E;  1NKN A;  1LVF A;  4ANJ A;  2LSY A;  1HJB A;  2I1J A;  1KIL C;  1T8Z A;  5H6Q B;  4LLH A;  4IHJ E;  1BR0 A;  2N2N A;  1GL2 C;  2IC9 A;  3GHG A;  1G2C B;  2CLY B;  1G1J A;  4CQI A;  3N9O A;  2C0W A;  3HR0 A;  5APV A;  5C8Y E;  1YKH B;  2QGS A;  1VPC A;  3P8C D;  4TUY E;  1NHL A;  3ZYK A;  2GUS A;  4ZI3 C;  3QUJ A;  4DBQ A;  1E1H B;  4RES B;  2KZ7 B;  3HKC E;  3SWY A;  1MND A;  3UT5 E;  1LTJ C;  3V4W A;  3B5N A;  3W15 B;  4GOU A;  3KQG A;  1UCU A;  1JTH B;  5J2T E;  2XZR A;  5CCG C;  3V2P A;  1PFI A;  1M1J B;  1IC2 A;  5IHY A;  2ZXE B;  2LT3 A;  2WSF H;  1FDM A;  2YMY A;  1JOC A;  4IDZ A;  2LHR A;  2WMN A;  3VP8 A;  3AA1 B;  1IFI A;  3LFM A;  5KJ7 D;  3N9L A;  4IFM A;  1IJ5 A;  4HE8 A;  1SLQ A;  2E43 A;  4YJ2 E;  4DZO A;  3EFG A;  3M9B A;  1RF1 C;  3HKD E;  4XE5 B;  2LOP A;  4V1A v;  3RK3 C;  1JUN A;  2E9X C;  1JCD A;  1J1D C;  3MTU E;  4GKG A;  3KV4 A;  1LT9 A;  4GT1 A;  3C64 A;  2IFM A;  2RA1 A;  3EUH A;  3Q2M A;  5FXX A;  2WBL A;  1MMA A;  2Q3I A;  4HGA A;  3ZJ2 A;  5LBQ B;  1L4A A;  3MJX A;  2BDE A;  1FZG A;  5HXR A;  3CX8 B;  1M1J A;  3FHN A;  2R5D A;  5FY0 A;  4P0B A;  3MA9 A;  1SFC D;  3P7K A;  2M67 A;  3HA4 A;  5LHG B;  3WMM 0;  3ANW A;  4PFO A;  3VMY A;  1N7S A;  2YU2 A;  4E7S A;  1T3J A;  2PBI A;  5HXE A;  2W00 A;  1LGH B;  5H6R B;  5LCY A;  4X1I E;  2IFN A;  2NOX A;  4ISS A;  2CMR A;  1ZN5 A;  1JY3 N;  2HOD A;  4MBQ A;  3EVY A;  2YIN A;  5LOV E;  3OBV E;  2KLQ A;  4KBM B;  4YFS A;  2Q9Q A;  2B1E A;  4TV8 E;  3LID A;  2H8P D;  5BVZ A;  1LVK A;  4PAG A;  4QX7 B;  2CE7 A;  1SQX K;  4DBR A;  3OJA B;  1NTM K;  3N2O A;  2CWO A;  2WSE H;  3L3P A;  2P7J A;  3CQG B;  4AUW A;  2N1T B;  1OXZ A;  4H63 H;  3RK2 D;  1JY2 O;  5L3B B;  2LM9 A;  5LJM A;  3NRY A;  3OYZ A;  1WRD A;  2V1D B;  1YTZ T;  4WNK A;  3R2P A;  5APQ A;  1IJ6 A;  3HUS C;  1SQV K;  4CI1 B;  3AA7 B;  2NP9 A;  2XAH B;  1LTA C;  4XAX B;  3B5N C;  5TAO A;  1IO4 A;  5AVQ B;  1SA0 E;  3A5X A;  1MIW A;  1UX4 A;  4MLK A;  2NPS B;  3M9H A;  2O01 H;  2MOZ A;  3MZK B;  4WB4 A;  3NXS A;  2D5U A;  5JR9 B;  1FIO A;  3I0O A;  3N9Q A;  1URQ D;  1HTJ F;  4H9N C;  3IFM A;  2XHE B;  3CML A;  5AFU L;  1NO4 A;  2LSG A;  4NUV A;  5J1G A;  1US7 B;  3LIE A;  3PDY A;  4ZI7 E;  2YK0 A;  1N73 B;  2YNY A;  1FZE A;  2EHO A;  2CLY C;  1HBW A;  2Z5I A;  1FZC A;  3V5B A;  4HYT B;  1AFO A;  3OJA A;  2KOG A;  2MJZ A;  3RRC A;  1EZ3 A;  2N1T A;  2CA5 A;  4MAL A;  5HYA A;  2ZLY A;  4CXY A;  5JRE A;  2C5I T;  5DJQ C;  5CA1 E;  4AQF A;  5LHH B;  2BVM A;  4AKR B;  3R84 B;  5EK4 A;  2WMO A;  2UXN B;  2C0X A;  3FXE B;  3PUS A;  1X9V A;  2QA7 A;  5L3C B;  5LHI B;  2X66 A;  3LW5 H;  1W2E A;  1KIL D;  2PJQ A;  4N6J A;  4JF7 A;  2IAK A;  2NPS A;  3HTK B;  2P67 A;  1GL2 D;  5JR9 A;  4B86 A;  1HWT C;  4O4L E;  3H6P A;  2A45 G;  4QHO A;  2OA5 A;  4AI6 A;  4I2L C;  3HE4 A;  1CUN A;  2DHR A;  3KVA A;  2A3D A;  2JQQ A;  5JDN A;  3VN0 A;  2C9N Y;  2QM8 A;  2OYI A;  3UUX B;  3M0A A;  3P7I A;  1D0Y A;  4WBA A;  2VKH A;  3MXZ A;  4PW8 A;  1Z56 A;  1MZ9 A;  3GN5 B;  4DOJ A;  3NTN A;  1KFM A;  2NTY A;  3HD7 A;  1RF0 C;  4O2B E;  4TN7 B;  2X0L B;  1ZEE A;  2P9B A;  3F57 A;  1RE3 C;  4LGD E;  5LBM A;  2K48 A;  4BJN A;  4ZI2 C;  4W80 A;  3M65 A;  1JNM A;  2N9D A;  2W27 A;  5BMV E;  2PP6 A;  2JJL A;  5HXH A;  3GHG B;  5GON E;  3TK1 A;  1LKX A;  2XAJ B;  2BZB A;  4DO0 A;  4L5G A;  1J2J B;  4W7Y A;  3N9M A;  3CX7 B;  2WWU A;  2LOS A;  3EDU A;  5M4Y A;  2R3C A;  2H3R A;  3N2G E;  4PJJ A;  1ZV4 X;  2ZM8 A;  5FXZ A;  1A02 J;  1MFZ A;  3H32 A;  2K9A A;  3HRN A;  4K0U A;  2HPL A;  1ZV8 A;  3DTO A;  1ZLL A;  1HCI A;  1LWU B;  2P2U A;  2GM4 A;  1CZQ A;  2ZM0 A;  2HG5 D;  4U72 A;  2A72 A;  3MK7 C;  3RK3 D;  4IIJ E;  3C9I A;  5FYM A;  2E9X D;  4GYR A;  3PE0 A;  3S4U A;  1OWA A;  3RH3 A;  1QSD A;  3GN5 A;  1LTT C;  4UVC B;  1ZR2 A;  2VKJ A;  3BK9 A;  5AW4 B;  3N9N A;  1YW0 A;  1SQQ K;  3VHL A;  1FMV A;  1L0L K;  3Q5X A;  1DX7 A;  3I9W A;  4EAH A;  2ZFC A;  4AKI A;  2K5B B;  5AW8 B;  1NU1 K;  2DCF A;  2V7I A;  3N5L A;  2ODU A;  2V7J A;  2N1T C;  5JDH A;  1FOS E;  4DVD A;  2Q7C A;  5KDM C;  2D0T A;  3ZCJ A;  4AQR D;  3I5C A;  4AQF C;  1KFN A;  5JDM A;  4O4I E;  3VMX A;  2E42 A;  5BU8 B;  1IJD B;  4UVA B;  4JEH B;  3GMI A;  5CJ0 A;  5DAB A;  1JY3 O;  3RL0 C;  1LWU A;  4HH2 A;  1GDT A;  3ONX A;  5L3E B;  3A2A A;  1LT9 B;  3V2N A;  1JMM A;  2KIN B;  4IFF A;  5JR9 C;  3PUG A;  5F8P A;  3U78 A;  3C4X A;  2FFD A;  3LBX B;  3PU8 A;  5KJ7 A;  1FJK A;  5AW2 B;  1HFA A;  5LA6 E;  1L4A B;  4I4T E;  4IE6 A;  5EZY E;  5E0O A;  3TSI A;  3VKG A;  2IW5 B;  2SPC A;  3C98 B;  1GW4 A;  2ZM2 A;  2JMH A;  1N73 C;  1YD8 G;  2JJ9 A;  5DQW A;  2XV5 A;  1MMD A;  5CCH D;  1S35 A;  3M0D C;  2J59 M;  3I0Q A;  2KXP B;  4FI5 A;  4DMW A;  4XBF B;  2YO3 A;  3B8E B;  3ANW B;  4W7Z A;  2WT7 B;  1N7S B;  4X20 E;  4DND A;  3C4W A;  5LP6 E;  3K3O A;  3B5N D;  2W62 A;  3M91 A;  3RYC E;  5JQG E;  2E8I A;  4H9R C;  3LK4 2;  2HPJ A;  3CX6 B;  3IBP A;  3ZJ1 A;  4TX5 A;  3N7N A;  2HOD B;  4UVB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...