1NAFA

Crystal structure of the human gga1 gat domain
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
129
structure length
124
Chain Sequence
DEEKSKMLARLLKSSHPEDLRAANKLIKEMVQEDQKRMEKISKRVNAIEEVNNNVKLLTEMVMSHSQGSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEILQANDNLTQVINLYKQLVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Structure of the GGA1-GAT Domain Reveals the Molecular Basis for ARF Binding and Membrane Association of GGAs
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein, membrane protein
molecule keywords ADP-ribosylation factor binding protein GGA1
total genus 37
structure length 124
sequence length 129
ec nomenclature
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03127 GAT GAT domain
A PF18308 GGA_N-GAT GGA N-GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1nafA01
1.20.58.160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1nafA02
5AW7B 1SLQA 1X8YA 2P7JA 3HE5A 1NWQA 3T97A 2WT7A 2ZFCA 4B86A 2P67A 2E43A 2Q5UA 2P2UA 1YD8G 1MUUA 3NMDA 3HE4A 2YO3A 3M9BA 1FAVA 1MV8A 5AVWB 1GK4A 4JYBA 4I2LC 5AVUB 5AW8B 4AYCA 1JNMA 3IR9A 5APYA 3A2AA 1JUNA 3P32A 1X79A 2QM8A 3TYYA 2Z5IA 1HWTC 3VYIA 3L35A 2Q3IA 2W27A 2W6AA 5AVQB 3VMXA 3M9HA 3HE5B 2R32A 5AVRB 1J2JB 1CI6B 3NFQA 5APUA 3VTPC 1HJBA 1A02F 1NAFA 2R5BA 3B8EB 2E42A 4GT1A 2H7HA 5APTA 3O8ZA 3LIDA 2Q7CA 5AW4B 1H88A 2XV5A 1GK6A 3I5CA 1GD2E 1GTWA 1OWAA 1GU4A 5AW5B 4C7NB 4RESB 3P8MC 1IO4A 3NXSA 4AUWA 4I6MC 3TNUA 1GZLA 3VN0A 2VRSA 1WRDA 1T2KD 3P7KA 2WTYA 3M0DA 4EOTA 2Z5HA 3M91A 4M3LA 3VMYA 1S9KD 3L37A 4XE5B 5AW9B 1OXZA 5CMZA 5AVVB 3A3YB 1CZQA 1CI6A 2JJLA 1NWMX 5APQA 2XU6A 3V4QA 2WT7B 3MD0A 1HUCA 3HTKA 3MGNA 3SWFA 2C9LY 1MFZA 2XZRA 5APVA 3UIAA 1O3XA 2WWWA 5APXA 1YYCA 2N9BA 2ZXEB 3VMZA 5AVYB 1H8AA 2R3CA 5AW2B 3V4WA 5AVXB 3HE4B 2WPSA 4JYCA 2N9DA 1G2CB 4LC1A 3KQGA 3NTNA 2YNYA 1KQLA 5APWA 5AW0B 2R5DA 2WPRA 1FOSF 2N2NA 1FOSE 5AVZB 1WR6A 1GU5A 1S9KE 3M0AA 5AVSB 4KHXA 1H89A 2BASA 1CSBA 1DH3A 3V5BA 3KDPB 3A7OA 5AVTB 5AW1B 1HBWA 3A5TA 2KP8A 4HYTB 3L36A 1T2KC 1SP4A 3OAKA 5APSA 5AW3B 1A02J 4C7NA 3M06A 5AW6B 4DZOA 2YO2A 3LIEA 3TNUB 4C46A 2WPQA 2C9NY 4GKGA 2IPPA 4AQRD 2QM7A 3TK1A
chains in the Genus database with same CATH superfamily
4Z91A 2OYHA 4UVAB 3L75D 4WBAA 2E43A 1NTKG 2IC6A 1MUUA 5LB7B 1FIOA 1FC2C 1MV8A 4QX8B 3GMAA 3TGUG 4LMKA 5HAXA 3MZWB 3H1HD 1QEXA 2KZ7B 3FBZA 2DHRA 3ZT5A 1HWTC 3AEDA 4CN4A 4ASVA 2W6AA 5AVQB 1XNQT 5C3JA 2LOSA 2E76B 2YK0A 5AVRB 2KSRA 4MBQA 1NTMJ 3HR0A 2AXTH 2QJPB 1SQQK 2MJZA 3B8EB 1W09A 5APTA 2E9XD 1VQ4P 3V2PA 3CQXC 2X68A 4H44C 1D0XA 4I6MC 1ZEEA 2B87B 1WRDA 2LHRA 1FU1A 1LKXA 2I1JA 3AE4C 5CMZA 3L74E 3A0HH 1VCSA 4IREA 3BRVB 1HUCA 2H89A 4HN9A 2V6YA 1ZR2A 4U2YA 5LGUB 2CWOA 1OVUA 2FBWC 2KK7A 3NRYA 2KYVA 3AEEA 1DD3A 1H8AA 3AE2C 5FXXA 3LW5J 3QC9A 1G2CB 4U33A 1Q90D 2IDBA 3H1LJ 2PP6A 2Z6EA 2NRGA 1FZAA 2ZVOB 1MZ9A 2KMFA 2IAKA 1PP9G 3RL0D 3N9NA 1L0LD 5JREA 2O01N 2YN6A 3HKCE 3NZQA 2W62A 3C4XA 4P09A 3R2PA 4DVDA 4MALA 1YQ3A 4DO0A 1JM0A 2N1TB 5KAIE 5KLIB 1PGQA 3HD7A 3CCQP 3I9WA 2QM7A 1ZLLA 2K1AA 2BG9C 3TNUB 5FXVA 2W6JH 3HI2A 5HEGA 3AEBC 3NVOA 4JI5T 2BS2A 4M3LA 2VK9A 1W0BA 2IUBA 3M9QA 2BEQD 1NWQA 4LMLA 3OJAB 3PJSK 2XAHB 1D0YA 2H43A 1KB9I 2PGDA 1VF5D 1W2BO 5KLVK 2IBZG 2NPSA 3M9BA 2KUBA 3F5HA 1Y8AA 5EK3A 1M1JC 1BE3G 1OVRA 1SQPJ 2H89C 3TLTA 3P4QA 1SQBJ 2KIKA 2VWAA 5AQPB 2AEJA 4OYJA 4TN7B 3UU8A 1UGOA 2UXXB 1VQOP 2IHR1 3FXDA 3H3AA 5JQGE 3N9LA 1VRBA 3CXHI 3N4XA 2CM0A 1J1JA 1NAFA 1VDFA 2QJYC 4TWFA 3CX8B 1T3JA 3GHGB 4K0UA 1H88A 4M1PA 5HXCA 2H3RA 2KLUA 1QSDA 2E75B 3EUHA 5BVZA 4UIGA 2AXTE 3M0DA 1SFCD 2W6BA 1IFJA 2E75D 3B4SA 2LRKA 2JJ9A 1NO4A 1VQ9P 1MNDA 1NWMX 3UU3A 1NKZB 1N34T 2FY8A 2FXMA 4WY4C 4L0RA 1URQD 5L4EA 1FZFA 3B13A 5H6QB 1JEKA 3CWBG 3DTOA 3F2EA 1GL2A 3RL0B 2UUBT 1U4QA 3RK3C 2LJLA 4E7SA 3RC3A 3L3PA 2NTXA 3RK2D 1IFPA 2A06E 1NENA 1YI2P 3EFGA 1FBMA 4PJJA 2WSEH 2Y0CA 3RYHE 4N6JA 5GONE 2RH0A 3KDPB 4IE6A 2ITAA 5AW1B 4EZHA 2JIWA 4AKIA 1H0TB 5APSA 1IFIA 2BKOA 2AE9A 3TDKA 2IYOA 5KLVJ 1LNQA 2QG4A 2HN1A 1KNPA 2M67A 5HEJA 2UXDT 2NW8A 3JC6C 2V7QH 2HLOA 2VB6A 4U7IA 3CC2P 2H7OA 1D1AA 1KF6A 1Z8UA 2DCFA 2OGUA 1LVFA 3KDSE 5L4HA 5AW7B 1X8YA 2V7LA 3T97A 4AQYT 4H63V 4OGQD 2ZFCA 3EABA 3ZMSB 1SQQJ 1EZVI 3LK3B 4LF9T 3ZLIA 4HWDA 1QVFO 4DV5T 4IL4A 4NPEA 4Y99B 1YQ4C 2V4HA 5AW8B 4OX9T 1YQ4A 4CXXA 4IL6H 1LTTC 4TWDA 2QM8A 3PTRB 4JI6T 2E76D 2LEHA 2ZMAA 1PZQA 4ZKUA 2W4XA 3ZYLA 5KAFH 1ZXGA 4WNKA 2A45H 4UV8B 2VL8A 3C1LA 3A8YC 2A06G 3PH0A 3CXHH 5B66H 1YKEB 3W67A 4HFDA 3T8OA 3V5UA 4GT1A 2D2CC 3SWKA 2YKPA 2E74B 4TUYE 3V6IA 4DV6T 1EXJA 1USEA 2BDEA 4U31A 5J2TE 2R3SA 3O1HA 1GZLA 2MYSA 2X0YA 4HFEA 5JR9B 2MTQA 1BDDA 1G1IA 1GL2D 2V5DA 5KJ7D 2Y6XA 1CZQA 4ISTA 1T3UA 3U59A 3EAMA 3IHRA 1RE3A 4D6TD 2E9XB 4QH1A 2KWIB 3K1SA 1LRZA 2Z4EA 1CW5A 1EZ3A 2BG9E 2H8PD 2NZ2A 3FBLA 1O3XA 1LT9B 2WU2A 4I0UA 5BU8B 5APXA 1GL2C 4YTNA 1YYCA 4KBMB 3VMZA 5AVYB 3GA8A 4JBZA 3CXHD 2V7MA 5LG4A 2XQAA 3RIAA 3WUTA 4R4LA 2PBIA 3CX5I 1GQEA 4OYKA 3CWBD 5JDNA 1JCCA 2P58A 1EDIA 3H1KJ 3P4RA 2E8IA 1SQPE 1N33T 2I8DA 3OYZA 4YTMA 3LBXA 1SHZC 3CMEP 1I94T 4U72A 1HBWA 1NTKK 3AAEB 1T8BA 3ZPOA 1S72P 4AKHA 2ZM0A 4C7NA 5KLVG 3ONXA 2BS3A 2IBZE 2Q1KA 4A7PA 4PD4D 2KSEA 2QEXP 4HJGH 4AQRD 4ZXLA 4LMJA 4O4HE 3GF7A 3LJCA 3UU6A 2XNDH 2ZT9B 1USDA 2LLYA 1H0TA 1HTJF 1LTJB 4YPCA 4IDOA 5JR9A 4EEDA 1ZV8A 3AE9A 5JR9C 2HODB 4DUYT 5APYA 4ZI2C 3L73D 1N86A 2K9AA 3VR8A 1T8ZA 1MIWA 4IDNA 4ANJA 3HUSB 5CCGC 1URQC 2Q9QA 5TJHA 1T72A 1IBKT 1NU1G 2FYUE 2JMHA 3JCUE 1ZV4X 3H32B 2BZBA 2Y8DA 4JYAT 5F8PA 2PAJA 4GOUA 3KXDA 3PP5A 1HCIA 2QJKB 2K48A 3UULA 3UUBA 3S4UA 5DJQC 1T98A 2WWVA 4GK0E 3I5CA 4LFBT 1H7CA 1GU4A 3H6PA 3AE3A 2YEVC 1G8XA 3BQIA 3PU3A 1EDJA 5L3CB 2P1JA 4ZI3C 2NP9A 2WSEJ 4PJ0E 3ZDMA 2QA7A 1JY2O 4WBOA 5AQJB 2IFNA 3KZIH 3AECA 1VOMA 5JRCA 5FY7A 3AECC 1IBLT 1AA0A 2X67A 4IL6X 3D6YA 5LJNA 3H1KE 3VHLA 1BR0A 2X9XA 3QNUA 5AW2B 3BCCD 1DEEG 4H63H 3CVRA 4CZZB 3AAAB 2ODVA 4Z8XA 1FZEA 4UR9A 3KZIE 2HH7A 4Q25A 2M0BA 2WWUA 2ZYDA 3C98B 3ANWB 3KBUA 2G3AA 3RK2B 5HXEA 4P0BA 3OVUA 1BGYG 2BVLA 1YBKA 1J1EC 2YDRA 1KILE 1WYBA 5GTIH 3ZMUB 2Q9QC 3F89A 1KQFB 3PUXF 2BCCG 2VQET 4U7JA 1WFDA 4HB1A 3CIRA 3T1YT 5AQSB 3HUSC 4N78E 4X65T 2J47A 3GW6A 3KHUA 3AVRA 1FDIA 4X5TA 1RQUA 4C46A 2KSJA 5FXZA 1SVFA 3AE1A 4JI2T 2WITA 3GG2A 2Q9QD 1PP9E 3CCRP 3TK1A 5AQLB 4PK5A 5AQTB 2WQYA 2LKMA 4JI0T 2WT7A 5A1LA 1NU1J 1KNRA 1KNZA 4UVCB 1YTZI 3C9IA 2V1DB 3HTKB 5AQMB 4TT3H 5AVWB 4PV1D 3GN5A 2POHA 4H13B 3J7Yq 2KZIA 4F8HA 4GKJT 3L73J 4ZS2A 3X1DA 4YTPA 2RN0A 2JWDA 3FB2A 3FXEB 3CL3D 3EDUA 1N7SA 4JEHB 2CK3H 3FX0A 2LSJA 3HE5B 2WZIA 2QJYB 2XHEB 3IF8B 2C0XA 4I4TE 5FY1A 3L74J 4JQ0D 3CCMP 4ISSA 3ZC0A 1ZW0A 5APUA 1YJWP 3FZKB 3AXJA 3WAKA 3AE7C 2OYIA 1SA0E 1BR1A 2V6YB 3B5NA 3LW5H 5AW4B 2FYNC 5AW5B 1M62A 3G9RA 3VKHA 1LP1A 4EDFA 5TISH 1KD1Q 3LFMA 2R6GF 3CPWO 2XQ6A 4PAGA 5FXWA 2IW5B 2Z5HA 3M91A 4EIWA 1J1DB 2Q3EA 3O1IA 1N7LA 4XBFB 1KFNA 2E2AA 3SSUA 3HTKA 2ES0A 5IHYA 3UU5A 4L74A 2FJEA 4NPPA 5H6RB 1KN7A 2DL1A 2P10A 4JBWF 1SFCA 4FI5A 3Q2MA 4HWFA 4PW8A 3QB5K 3KBTA 4B3ST 1AVOA 4WY4D 2V5CA 4MHCA 2WMNA 4N78D 2FFDB 4XZCA 3UQ7A 1R5LA 1KB9D 3K3OA 4TWHA 2NW9A 1JY3O 2FFDC 2WZ7A 4CN1A 4JUYA 4HH2A 3CLQA 2L8KA 4OVNF 4AQFA 3B5ND 2BVMA 4AQFC 1UIIA 1YQ3C 3SFDC 4DV3T 1U7MA 2D9DA 3NBXX 2X9YA 4GYSA 4YXWH 2IPPA 2H88A 3RIUC 2D5UA 3ZMTB 2CBIA 5HYAA 5LA6E 4EYYQ 2RPAA 5CFBA 3BVHA 5JDQA 1BGYJ 2BCCE 2X66A 3HKBE 4IE7A 3RC8A 2P67A 2JR8A 3Q1MA 1L0NJ 3KVBA 1RH5B 3TKLB 4JPZB 3B71A 4ZZCA 1Q81Q 1FAVA 2IX7C 1PPJG 2XTLA 4JI4T 1VQLP 4IFDK 1NTME 1NEKA 4X1IE 5HXHA 1M1JA 1N73C 4YJ3E 3VP9A 2I6HA 3RGLA 3HD7D 1G2CA 4H44B 4R4MA 5FVKA 3RIFA 1E1HB 5KMGP 2IZ1A 3W15B 3QH9A 5EZYE 2KS1B 4X1KE 3TLSA 3AE5A 2GUVA 3ZCJA 5LOVE 3HKDE 2Q7CA 4GYRA 3TLUA 1GTWA 1MMNA 2SPCA 4DR4T 4RESB 2FFDA 4YHHT 3P8MC 1IO4A 4H13C 2VKJA 4XAXB 3RL0C 4UXNB 1NTMK 2FXPA 5JDFA 1OXZA 2J58A 2WDRA 2ZM8A 3GN5B 2B88A 1SQVD 5FVLA 4YXDA 2E5VA 5CGMA 1NHLA 3O6QA 3V2NA 3AEBA 2K9YA 4H13D 2ZT9D 1LTJA 4DT0A 2WQYC 3U1AA 3KV4A 1I6ZA 2VKHA 2WDQA 5EK2A 4RJTA 1L0LE 1FZBA 3U3IA 3CWBJ 3KQGA 3ZMZB 5CJ5A 1IC2A 1KQLA 4MLKA 1UUSA 1Z56A 4ZS3A 5CHXA 2CHNA 1L4AA 4U3FG 2WPRA 3L74G 1S5LE 1AJ3A 1FMWA 3L73E 1GU5A 3H1HG 2WSSH 4F6RC 2EHOD 5HXSA 2M6IA 3RK2C 1AJYA 3TGUD 1JNRA 1HF8A 5LHHB 3H1JG 4CXYA 2PJQA 1JTHA 3P4PA 2DLRA 3KFWX 3SS1A 4DV7T 3NWIA 5FL1A 2O3JA 4O4IE 1BE3E 2CWYA 2HPLA 2G8YA 1RE4A 3PRJA 4U3FE 3FXEA 3GF3A 3PUAA 1W2EA 2K37A 1SLQA 4EAHA 5JRCB 1IFMA 3S1KA 2FJDA 4YSZA 3TLVA 2OYOA 4KMCA 2KI7B 4EV6A 2LSKA 3WU2E 2R44A 5M1BA 4K0KT 2IMLA 1Q86Q 3L75E 3O6QB 2QIWA 3AE1C 5LMNT 2BG9B 1SQPD 1X79A 3GWHA 2KB7P 4NPFX 4X66T 5J2UE 4CXWA 2GM4A 3L35A 3RRCA 3CWBE 2R32A 5CCGA 1M7LA 1PP9D 4QKNA 1HS7A 2QRXA 3Q5XA 4B6XA 2KINB 2XUEA 1KYOE 1IFNA 3VP8A 2UU9T 4DV1T 2FKWB 3RK3D 4I7ZC 2EHOA 3KV5A 3SOLA 2WSCH 3LIDA 3RK3B 3G4SP 3ZJ1A 1HNWT 3ONLC 3GLMA 4TLFA 3ZSSA 3KINB 3TNUA 3BK9A 3HD7B 3P7KA 3MJXA 4PD4I 1LTBC 5IYZE 1Y64B 2M5AA 3CMLA 1RF1A 3A3YB 2KS1A 1SS1A 2JJLA 2YINA 3MP7B 2XU6A 2W00A 5GTIE 2QA4P 5L3GB 1W0AA 3ZT7A 1PPJE 1AQ5A 3U1CA 3JC6D 1RF0A 3IEEA 4OGQB 4W80A 2CXLA 5KDMC 5ABFB 4TV8E 3N9QA 1T6AA 3BRTB 1E5WA 4OGQC 3ONJA 4HEAA 1PGPA 4IE5A 2FYUK 3UTKA 1T7SA 5M4YA 3QWOC 2RMZA 3VRAA 5CA0E 4TV9E 4PJMA 1IK7A 1BE3D 5DJUB 3B5NB 3CX5H 3CCUP 1CSBA 3P4WA 4ZI7E 4QMAA 5CJ4A 5GTHE 3JCFA 1LVKA 1R8IA 3E08A 5CB4E 1K05A 4UB6H 3NZPA 1CUNA 2C5IT 4QX7B 2HPJA 2BS4A 1KFMA 1P84I 2YO2A 2MOZA 1WRGA 3LIEA 2QYWA 1JY3N 2DW3A 2C9NY 3RRWA 4TNVA 2WSFJ 1G1JA 2LSIA 2YIUB 3A5XA 4H9NC 3H1HJ 3QB5A 1IJ6A 5DABA 4OK0A 5CA1E 3HE4A 3N7NA 4EOZB 4YJ2E 2UUAT 3MXZA 2V7JA 4IT4A 3PUYF 2W0GA 3TF5A 4CQIA 5BU5A 3A2AA 2ZAEB 4MN4C 4EGWA 1L2PA 1ZN5A 2K9JB 5J0ZA 4D6TJ 2RA1A 1XTCC 2YIUC 3SWHA 4ADZA 5HWYA 2C5JA 2ZVNB 3JADA 3R6NA 1Q82Q 5LHGB 1LTGC 1QGKB 1E79H 1NTZE 4GDOA 3L74D 2HPCA 1NTMG 4U3FD 5CCHA 2WB5A 5ETWA 2ZXXA 3Q5PA 2A45G 2A2FX 1CHUA 2BKPA 3O8ZA 3H1KG 2ZLYA 2XV5A 1BE3J 2ZJSE 4UELA 2HODA 4LFAT 1FS0E 3ANWA 2D2SA 4Y99C 4ZHQE 4UV9B 4B3TT 3WMM0 4A56A 1HH0A 1NTKJ 2XAFB 2FYZA 1YTZT 5CJ0A 2FYUD 1NU1K 4IDQA 3ZN1B 3ZSTA 1MMAA 2G0UA 2XZRA 1LWUB 3UIAA 2XSAA 1HX8A 3PE0A 3CPZA 3AEFC 1Q7YQ 3V4WA 2D0UA 3NKZA 2NTYA 3HE4B 5LGNB 2JPFA 2X9WA 3RX6A 3AE8C 4LC1A 3SWYA 4IIJE 2KLVA 3UUNA 3TGUE 3JC22 1DEBA 2R5DA 2M5AB 2X0LB 2W67A 3M3ZB 1L0VA 3R4YA 4BRYA 2XQ8A 3ZYMA 2LKGA 1S5LX 1S35A 2E76C 4W7YA 5LBQB 2LM9A 5JDHA 2E5LT 3AE6A 5IUXA 3TSIA 2OA5A 1JNZA 1US7B 1OZHA 5CCGD 5IWAT 5ADXL 1N2DC 2FXOA 1XMQT 3BCCJ 5LBMA 3N2OA 3ITKA 5DJTB 3P8CE 2W83C 1NH4A 1SQQD 2WPQA 2A9UA 2QVAA 3TLWA 5LNKA 1VQPP 4WY4B 1J1EB 3VR9A 3CC4P 5AQKB 3L72D 1X22A 3A0BE 3L09A 4QH4A 4LF4T 4H9RC 5FMNA 3RHWA 5JDLA 1IJ5A 1XDPA 2X9HA 4IE4A 2OARA 4IL6E 5B66E 4P0AA 3Q2YA 4O9BA 3AEGA 2JP3A 1NTMD 2I0MA 3V5SA 2NW7A 4A5XA 4BAYB 3N2GE 1DU2A 3CI9A 2XM2A 1JY2N 1OEDB 2IYPA 3M9HA 1N7SC 1BR2A 2V7QJ 3KPEA 2V8SV 5CCHC 4NIQA 1WLXA 1HR0T 1VQ7P 3WUUA 1PPJD 3PUWF 1HJBA 1A02F 2R5BA 3BATA 4HFIA 4A98A 3II6A 4Y28J 2ACZA 4O2AE 3I55P 1OW6A 3UUMA 2OTLP 1MKMA 2QGSA 4J2CA 4HGAA 3I1AA 2CA5A 1V9DA 3VMYA 2VASA 2F4VT 2H7VC 4H0LD 4XE5B 4HKZH 1QLED 4ERRA 4L76A 5JH7E 1NTKE 1Y9BA 2IC9A 5CBOA 3V2RA 3AA1B 3CKDA 3MGNA 1KYOD 1M8OB 1MFZA 2YXQB 4PV1B 5FP3A 2K9JA 5JVDE 2KNCB 2N9BA 3VOPA 2L91A 3PDYA 4PJLA 2WZHA 2DWGA 5AQOB 1D1CA 1KK7A 2ACXA 4KJMA 1OMIA 4OFZA 1FZGA 1FOSF 4DNDA 3CK6A 3RQUA 2KWHA 1RF0C 2WSCJ 2BASA 2VKDA 4DMVA 2NOXA 1N73A 4A97A 1K9MQ 2Q9IA 3ETVA 2V26A 1UURA 1SQXJ 3Q5SA 1JOCA 3AE4A 4EB6E 2XQ5A 2WAUA 3FWLA 4AI6A 2FYNB 3BQLA 4DIDB 1SUMB 4ZNCA 3EFFK 2XAQB 3B5NC 3H1IE 2XAGB 5J1GA 3AEEC 3P4SA 2JRKA 2PRRA 4UF0B 1Q2NA 4B86A 3D71A 2Q5UA 1YD8G 1BCCE 3AA6B 2J59M 1VCTA 2XY8B 4JF7A 4I2LC 2WSSV 1W5CE 3PUVF 1OFCX 1JMMA 2GK9A 2CXFA 1GL2B 1LT9C 1NVOA 4PNIA 1KZUB 1LT9A 3AVSA 1L0LK 1BDCA 1KV4A 5ABEA 2B1EA 2QJPC 3F57A 4NUUA 1J2JB 1IZNB 1QX8A 3HD7C 4QXCB 3NFQA 1BCCG 1NTZK 1EZVE 1PP9J 2AEFA 3VTPC 1RE3C 1X9VA 2KLQA 3AE9C 2E42A 1J5ET 4LF8T 4X62T 1SQQE 3ZC1A 1HNXT 3OKQA 1OWAA 4YTPC 3MA9A 4I7ZB 1EDLA 1KTMA 1WR0A 3IA3A 2D2CB 3LG7A 1X0TA 1NJIQ 2D2CD 4EOTA 1AFOA 1VQMP 3KYQA 2RKLA 3L37A 1NU1E 2FYUG 4NUVA 2CMRA 5KLVE 5APQA 4LF5T 3WUVA 3D6ZA 2LXCB 2E5YA 1XDOA 2LSYA 3Q5DA 5TAOA 5KJ7C 3CQGB 5LGTB 1E2AA 5KJ7A 4AISA 5LMUT 1KMIZ 3RLFF 1NTZG 1NTZJ 3I56P 3H1KD 4JYCA 2N9DA 5DQVA 2YNYA 2M3EA 3H37A 1R8EA 2YU1A 1DD4A 3IFMA 3ZCIA 1L4AC 3RYCE 5AVZB 5FYMA 5LP6E 2VQFT 5AVSB 3N9OA 1S1CX 1KB9E 3V5BA 1S4XA 1Z0PA 5AVTB 3K5BA 3L71D 3GHGA 4U3FJ 4DUZT 3NRXA 1JCDA 4IFFA 4PFOA 3FZHB 1VL2A 1AVYA 2O01H 4QWNB 2BCCJ 1N7SD 3M06A 1A02J 2XQ7A 1SQXD 2XQ4A 5CCHD 1LTSC 2J4GA 4EZ4A 1VF5C 4H0LB 1QLBA 3FZFB 2WU5A 4GK5E 3ZN0B 1XNRT 1LWUA 3J9X1 3UQ4A 4PK6A 3CXHE 1URQB 3AEAC 1N8RQ 1RHZB 1XWMA 3P50A 4BJMA 2KT9A 2IDOB 1JNMA 2WM9A 2Y9ZA 2ZM2A 1EZVD 3C64A 2K5BB 3ZEFB 1LTJC 1XZYA 3R84B 4H9SE 4U2ZA 2ZT9C 2N1TA 1E7PA 1QL1A 1L0NG 5B5EH 1FMVA 4V1Av 2N1GA 3ABVC 1ZHCA 4L73A 3L8RA 3CX7B 4I50E 2Y0EA 1UIXA 1B7TA 3N9PA 2QSIA 2VL0A 4H9OC 3L70G 3W68A 1LTIC 5ABGA 1NYHA 1GK6A 2BBJA 3I0OA 4KI0F 4IDZA 2XAJB 1SQXG 4C7NB 4TZ4C 5AFUL 3NXSA 3VKGA 3GHGC 4WVZA 2VRSA 4NPDA 2WTYA 3LDQB 3AE2A 3CCLP 3L71E 3L70J 5KLVD 4LLHA 1YW0A 4EIJA 5L47A 3PV0F 5LCYA 4ZI3D 2ODUA 4OH8B 1MIVA 5DQWA 1N73B 1GW4A 2WSFH 4EXTA 3A0HE 3I0QA 5EFWB 2WVRA 3MTUE 2PTFA 2VVSA 1ZOYC 3N5LA 1ZR4A 3KV9A 4HFCA 3N2KE 3WI3A 4ZKPA 5KAIH 4HWCA 5ABHA 1JY3P 3NTNA 4UF0A 2CPTA 1R5SA 1SQXK 1ZP0C 3PUQA 2E9XC 1WT6A 1RF1B 3N9MA 3K3NA 5KKZC 1KILA 2YKQA 4G2AA 5TISE 3BQKA 2JO1A 1JB0J 3P7IA 2LHNA 1RQVA 4P1NA 2JKVA 3DP7A 4AQGA 2HG5D 2CBJA 4KP3C 4QXBB 2WMMA 5KKZB 2M6BA 3RKOA 2OV9A 1M57D 3JCUH 3L36A 1BR4A 2JMKA 4B3RT 2MBGA 4D6TG 2X0HA 1YJNP 2YDSA 2NPSC 4EYUA 5AW6B 2LSGA 4CI3B 1N32T 1SQQG 2E74C 2FJAA 2QJKC 3AA0B 4CN6A 4LF7T 4YFSA 3VMAA 1X9BA 3M65A 2ZYAA 2HPCB 2BKNA 1M1KQ 3MACA 3CX6B 5JDMA 4PD4H 2VVNA 3O1JA 4IFMA 3U78A 3HA4A 2NPSD 2FYUJ 3AAIA 3CC7P 2FUPA 3EHZA 1BSHA 2P2UA 1G73A 4DMWA 3AXJB 4B3MT 3SFDA 3L4FA 2KNCA 5B5EE 2OYIC 3L73G 5F5WA 1JUNA 4GOEA 4ZMDA 2Z5IA 3TGUJ 3IAOA 2Q3IA 4O4LE 3VMXA 4DV4T 1ZOYA 4DBQA 4QXHB 5AQRB 4WWIA 1J1DC 3RYIE 4LGDE 1UX5A 4LF6T 5JTGA 5E79E 1Y01A 2BEZF 1PFIA 2CRBA 4OHFA 3CX5D 1KILD 2XJ7A 3QUJA 1GMJA 2YKSA 1OEDE 2J1DG 4HE8A 2WP9A 1JTHB 4IE0A 2AEMA 3CX5E 5FKYA 3MUDA 2SPZA 1HG5A 3RPUA 3AE5C 1KQSO 3C4ZA 2MAWA 4HTEA 1HG2A 1OIPA 1VQ5P 1RE4C 2IFMA 4BXLA 4U74A 3MD0A 3RL0g 3PURA 2GA1A 4H9PC 3SWFA 3MK7C 1J5WA 4XFJA 5KTBA 3AEDC 2LR2A 2LT3A 3PLNA 2Y48B 1PV3A 3IBPA 1BSNA 4U7YA 1VF5B 2R3CA 4GKKT 2E5TA 1WCRA 3EI0A 2IBZI 2LOPA 5AQQB 2VURA 1ZMEC 5LJMA 4YXDC 3AEGC 4ASKA 1SQBD 3HKEE 3IN6A 1KC8Q 1DH3A 3JSVC 2UUCT 2K3WA 2AXDS 1M90Q 2KP8A 4HYTB 3FWNA 3H32A 5HEOA 2E75C 3G6EP 4PJ0H 3L75J 3PJAA 3SFEA 2Q9QB 1Y47A 1P84H 1IJDB 3L71J 3L70E 3SRZA 3C8VA 2IBZD 4IHJE 3H1IJ 1S2EA 4YY3T 4GKGA 4DR7T 2CLYC 2CXDA 3RI5A 1YXRA 2W61A 2V7KA 1D7MA 2P7JA 3KV6A 2HYNA 3LBXB 3MUDC 5HEUA 3C50A 2PFVA 1D0ZA 2O01J 4ZI2D 4UB6E 2UXCT 3H1LG 2YO3A 3G3ZA 1AQTA 2WMOA 2GUSA 3T1HT 1FDOA 1NU1D 2XZEA 1HVVA 1DX7A 2MKVA 2W63A 5L2LA 3RGUA 4HWIB 1NKNA 3H1LD 2W2UA 4HFHA 3AEFA 5E0OA 2W90A 1UCUA 5HCMA 3E1RA 2XKMA 3Q3DA 2WS3A 3E0ZA 3CD6P 4L5GA 3L72G 2B76A 3L72E 1EDKA 5F3JA 1SE7A 1NGMB 1ZP0A 4GIWA 1SQBE 1VQ8P 2H7HA 4ILCA 2A45I 3LSVA 5KLIC 1VQKP 2P9BA 5HXRA 1SQVG 1WYCA 2WDVA 3OPCA 1X79B 4E7ZA 4EI2A 4QHOA 4AKLA 4HFVA 2YMKA 3VN0A 2FJBA 3PJAJ 5AQVB 5FNVE 4BJNA 4ZEYA 4WYVA 2YOEA 5KX5E 4UB8H 5L3EB 3ZMVB 3B57A 3AA7B 2XM1A 3EVYA 2CCQA 5KXJA 3UU4A 1CI6A 4DCKA 2XNXA 3V4QA 4HWHA 4ASWA 4NXMT 1N36T 1SQBG 3KVAA 3ESLA 2C9LY 2JQHA 5APVA 1JO5A 1VQNP 1UX4A 1IK9A 4L9IA 2K3RA 3RIUA 3MIWA 4CPGA 2N9YB 5AVXB 4I55E 4ILAA 3L70D 3PUSA 1SQVK 2M3BA 2UXBT 1QL2A 1GW3A 4MFRA 2JEEA 3G71P 3G06A 4UEMA 1H89A 2KZJA 3H25A 4O8SA 4AKRB 2XSBA 4JI1T 3A5TA 2HN2A 1T2KC 1L0NE 4I1LA 4KX6A 4JI8T 5C8YE 1SP4A 1K8AQ 5AW3B 1FZCA 1OVVA 2OYIB 3BASA 2YKOA 2BG9A 1EC5A 1KB9H 2K24A 3E7KA 1OX3A 2CE7A 3FXDB 2FBWA 5LXTE 4IDPA 4WW0A 4GODA 2OYHC 2WY2A 3B5MA 4WZXA 3IF4A 1P84D 2I59A 4JI7T 5FY0A 1YIJP 2A3DA 3MKDA 2XPKA 4AKGA 2HFED 2JWAA 3NMDA 2EHOB 2JDIH 4JYBA 5AVUB 4AYCA 2A06D 4H0LC 5H2FE 5L8RJ 2A72A 3Q9DA 2YMYA 2J62A 3RKGA 2K88A 2L5GB 2KNDA 3D0TA 4RO0A 5EK4A 4H44D 4X1YE 3OJAA 2C5KT 3H3MA 4EEBA 5L3BB 5BR8T 4H9QC 4DR3T 1KILB 1RF1C 4DR5T 4G63A 5L3DB 4JV5T 3HL6A 2Q6QA 1M7KA 3BCCE 2Y0DA 1HJ0A 1GD2E 3H1HE 1JMBA 1OEDC 3FZMB 5ABFA 1IFDA 3RQWA 3JAFA 4C91A 3EQ2A 2RP4A 4JI3T 1EQ7A 3WU2H 1FZCC 1S9KD 3MHVA 1L0LG 2CEAA 2E74D 2JQ9A 2CPSA 2HHHT 2PFXA 2LXBA 3H1JD 3CCVP 1D1BA 1YKHB 4AIUA 1URQA 1SQVJ 5AQNB 4TNWA 1LJ2A 4O2BE 1PL5A 4X64T 2YDQA 2OLTA 1L0ND 2WCAA 4BWNA 3HUSA 1W9RA 2W66A 3L72J 5LYJE 1FOSE 5AQHB 4UB8E 1FE6A 3H1JJ 5CBNA 1L0LJ 4WBNE 3QK6A 2E9XA 1EZVG 3V2QA 3K3QC 1IBMT 3T97B 4KHXA 3RH3A 3Q5EA 3H1ID 3FZLB 1HNZT 1SQPK 3M0DC 3ZKRA 3OA7A 3AB3B 4JLEA 3OAKA 1U5PA 1MFTA 2V7IA 2NWBA 1MMDA 2C0WA 2XDJA 1PGOA 5LG3A 1GDTA 1VQ6P 3F31A 1BCCJ 2O1KA 4AXPA 5C2TA 1TU3F 2DI4A 4XA4A 4PK4A 4YLHA 3CWZB 3HRNA 4DOJA 2PG8A 2V6XA 2L9QA 3HE5A 3FGAD 5C39A 1LWUC 4WB4A 2ZYGA 1MIYA 4LFCT 4KUMB 1KYOH 1AV1A 3FHNA 3RF1A 2JQQA 3A0BH 3CCEP 3PU8A 4BRYB 3L71G 3CCJP 1GK4A 3H1IG 3IR9A 1SQPG 1OW8A 4YHJA 1BGYD 1SQXE 1PGJA 1LT1A 3VYIA 3I9YA 3P8CD 2OQQA 2QE7H 1NTKD 3S4RA 5L3FB 4ZOLE 4COFA 2DNXA 1QVGO 1CI6B 1FZCB 4DV2T 1L4AB 1NOHA 3H1LE 2J5UA 1NAYA 4BA9A 1FJGT 5HWXA 2B89A 2WPVB 4KT0J 2Y9YA 1ZRTD 1L4AD 1SQBK 5JDGA 1IAPA 2BBHA 3LK2B 2W8ZA 4CI1B 1SFCB 4AUWA 2CHOA 5H2FH 2BCCD 5E79H 4W7ZA 4IL9A 5AW9B 4DJGA 1UK5A 4PV1C 2XQYA 2L3LA 5AQUB 1L0NK 1S3JA 3JAEA 1U57A 4EYYR 2WT7B 3PUGA 4N3YB 1HTLC 4X20E 2O1JA 1M1JB 5BMVE 1S5LH 4NXNT 1HFAA 2WWWA 3ETUA 3C51A 3CQCB 3AEAA 2YU2A 2NPSB 1NTZD 3EDVA 2WPSA 2EHOC 5K5GB 3PUZF 4DBRA 4JEUB 2WBLA 1WR6A 2HR3A 5KAFE 3O9XA 1SQVE 1XMOT 2UWJE 2IIUA 2D0TA 2OYHB 4C90A 2OTKE 3AE3C 3A7OA 4DR2T 4KHPT 2N1TC 3ZJ2A 4O4JE 3L39A 2LKHA 1ZRTE 1SFCC 3OBVE 4GIFA 5HEHA 4Z90A 3E1IA 4RKUJ 3K8PC 4DR6T 2ZM6T 3OYXA 3ZT6A 1FJPA 1S94A 2X51A 1M56D 1OEDA 3USSA 4FJOA 2N1TD 1BCCD 3C4WA 2KOGA 2B87A 2XASB 3MZKB 1KYOI 2AXCA 2I1KA 4DV0T 2YXRB 2OTJP 5FL0A 4DR1T 4IGUA 5HCJA 2XQ3A 4CI2B 3RBZA 4TX5A 3O4XE 1MNEA 1FEWA 3RBXA 3P32A 3TYYA 4I43B 3GMIA 1DIPA 2W27A 4PD4E 1HGZA 3A7MA 4ILUA 3VRBA 4UVBB 4HKAA 1YITP 4Z1MH 5GTHH 1HGVA 4GOFA 4YT0A 3UFEA 4OWFA 4D6TE 2M8RA 3AE8A 4ZZBA 4HFBA 3L75G 1OW7A 4KHZF 4PFPA 3BCCG 1BGYE 3E22E 1VPCA 2H88C 3VU7H 4WY4A 2IZ0A 1KFYA 2UXNB 4PJNA 2VKOA 3ZYKA 1HX1B 1XTGB 1RY3A 3S9OA 1T2KD 1K04A 3AE6C 1JY2P 3DJBA 5AQIB 4YSYA 1QUUA 4K3AA 2LRLA 2NR4A 4L75A 3LK42 3UT5E 5AVVB 1MMGA 5LHIB 1U7JA 1YHQP 1EXIA 4IOIH 3WAJA 4ILBA 4YSXA 1PIXA 3OW2O 3CMAP 2ZXEB 3OTOT 1FJKA 1LP1B 2B9BA 1KQGB 3H1JE 3PHLA 2MPKA 2DWKA 1P84E 2KXPB 1KEYA 2CPBA 4U3CA 4C7RA 3RYFE 5APWA 5AQFB 2XQ9A 5AW0B 3EWKA 1FDMA 3AE7A 2N2NA 3UUXB 3Q5WA 2LM2A 1S9KE 2LE8A 1HF9A 2JQKA 4QH5A 3M0AA 2CLYB 1N7SB 1ZKEA 3UFGA 3ABVA 3QOFA 3RK3E 3PTZA 1K73Q 1LTAC 2C0SA 3Q5RA 4DZOA 1YJ9P 3SFEC 5AQGB 3CCSP 1WMKA 1LGHB 4K35A 3D70A 1KILC 1KORA
chains in the Genus database with same CATH topology
2V7KA 2P7JA 4PK5A 3KV6A 2HYNA 2LKMA 2OYHA 3L09A 3LBXB 2WT7A 4H9RC 5FMNA 5A1LA 5JDLA 1IJ5A 4UVAB 3C50A 4WBAA 2X9HA 2PFVA 2E43A 1D0ZA 1YTZI 3C9IA 2OARA 4IE4A 2V1DB 4UVCB 4ZI2D 1KNZA 2IC6A 3HTKB 1MUUA 4O9BA 1FIOA 4P0AA 2YO3A 3G3ZA 1MV8A 5AVWB 3GN5A 4QX8B 2POHA 3J7Yq 3V5SA 2NW7A 2WMOA 2GUSA 3N2GE 5HAXA 4BAYB 4BJNA 3CI9A 1HVVA 2KZ7B 3FBZA 4ZS2A 1DX7A 2DHRA 5DQWA 2W63A 3FB2A 3FXEB 5L2LA 1HWTC 1JY2N 3CL3D 3EDUA 1NKNA 2W6AA 5AVQB 1N7SA 4JEHB 3M9HA 5E0OA 1UCUA 1N7SC 3HE5B 2LOSA 2LSJA 2YK0A 5AVRB 1BR2A 3KPEA 2XHEB 2XKMA 3IF8B 5CCHC 2C0XA 1WLXA 4I4TE 3E0ZA 4MBQA 3HR0A 4L5GA 5FY1A 4ISSA 3ZC0A 1SQQK 5APUA 5F3JA 1HJBA 1A02F 2MJZA 3WAKA 2R5BA 3B8EB 4GIWA 2OYIA 2H7HA 5APTA 3BATA 2A45I 1BR1A 1SA0E 2E9XD 3B5NA 3LW5H 5AW4B 3V2PA 3CQXC 2X68A 2P9BA 5HXRA 3II6A 1WYCA 5AW5B 4E7ZA 4O2AE 1X79B 4QHOA 1D0XA 3VKHA 4AKLA 3LFMA 4HFVA 3UUMA 4I6MC 3VN0A 1ZEEA 2QGSA 1WRDA 2LHRA 4HGAA 4J2CA 3I1AA 1FU1A 4PAGA 5FNVE 5FXWA 2Z5HA 3M91A 1V9DA 2CA5A 2IW5B 3VMYA 3ZMVB 2VASA 4EIWA 1J1DB 5KX5E 1LKXA 5L3EB 2H7VC 4XE5B 3AA7B 3B57A 2CCQA 3EVYA 2I1JA 5CMZA 4ERRA 5JH7E 1CI6A 1N7LA 2IC9A 3O1IA 2XNXA 1KFNA 4XBFB 3V4QA 3V2RA 3BRVB 1HUCA 3AA1B 3CKDA 3KVAA 3MGNA 3HTKA 2C9LY 2ES0A 3ESLA 1MFZA 5APVA 4HN9A 1JO5A 5IHYA 1ZR2A 5LGUB 1UX4A 2CWOA 1IK9A 5FP3A 3NRYA 4L9IA 5H6RB 5JVDE 2KYVA 2N9BA 1H8AA 3VOPA 3MIWA 3PDYA 4PJLA 1SFCA 5AVXB 4I55E 2DWGA 4FI5A 3Q2MA 1D1CA 5FXXA 3QC9A 1G2CB 1KK7A 2ACXA 4PW8A 3KBTA 4OFZA 3PUSA 1FZGA 1SQVK 4WY4D 2M3BA 2PP6A 1QL2A 2Z6EA 4MHCA 2WMNA 1GW3A 1FZAA 4N78D 1MZ9A 2FFDB 1FOSF 2KMFA 4MFRA 4XZCA 4DNDA 2JEEA 2IAKA 2KWHA 1RF0C 3K3OA 4UEMA 1H89A 2BASA 2VKDA 3RL0D 2NOXA 3N9NA 2NW9A 4DMVA 1JY3O 1N73A 4O8SA 2FFDC 4AKRB 2WZ7A 2Q9IA 5JREA 3ETVA 4JUYA 4HH2A 3CLQA 3A5TA 2L8KA 2V26A 2W62A 1T2KC 4I1LA 3C4XA 3HKCE 3NZQA 3B5ND 3R2PA 4P09A 1JOCA 1SP4A 2BVMA 5AW3B 4AQFA 4AQFC 4MALA 4DVDA 4EB6E 2WAUA 1FZCA 4DO0A 4AI6A 2N1TB 2OYIB 3BQLA 3BASA 2YKOA 3HD7A 3I9WA 1ZLLA 5FXVA 3TNUB 2K24A 3NBXX 3HI2A 2CE7A 3B5NC 2X9YA 2XAQB 3FXDB 4GYSA 5LXTE 2XAGB 2IPPA 5J1GA 4WW0A 4M3LA 2VK9A 2D5UA 2OYHC 3M9QA 3ZMTB 1NWQA 3OJAB 2JRKA 5LA6E 5HYAA 2XAHB 3BVHA 2I59A 2X66A 5JDQA 3HKBE 4IE7A 1D0YA 4UF0B 5FY0A 4B86A 2H43A 3RC8A 2P67A 2A3DA 3MKDA 4AKGA 2HFED 2Q5UA 1YD8G 5KLVK 3KVBA 3TKLB 2NPSA 3NMDA 3AA6B 2J59M 3M9BA 2EHOB 1FAVA 2IX7C 4JF7A 2XTLA 4JYBA 4I2LC 5AVUB 4AYCA 4IFDK 2WSSV 1JMMA 2GK9A 1M1JC 2CXFA 4X1IE 5EK3A 5HXHA 2A72A 1GL2B 1M1JA 1N73C 3Q9DA 4YJ3E 1LT9C 4PNIA 1KZUB 2YMYA 3VP9A 1LT9A 3HD7D 3AVSA 1G2CA 2VWAA 4ISTA 1L0LK 2L5GB 1E1HB 2KNDA 3D0TA 5KMGP 5EK4A 4OYJA 4TN7B 4X1YE 2B1EA 3OJAA 2C5KT 3F57A 3W15B 4NUUA 5EZYE 5L3BB 1J2JB 1IZNB 2UXXB 3H3AA 4H9QC 3HD7C 1KILB 4QXCB 3N9LA 4X1KE 3NFQA 1RF1C 2GUVA 1VRBA 3N4XA 1NTZK 3VTPC 2CM0A 4G63A 5L3DB 1RE3C 1NAFA 1X9VA 3ZCJA 1VDFA 2KLQA 2E42A 3HL6A 3CX8B 5LOVE 1T3JA 3GHGB 2Q7CA 3HKDE 4GYRA 4K0UA 1H88A 4M1PA 3ZC1A 1GD2E 5HXCA 3OKQA 1GTWA 1OWAA 1MMNA 2H3RA 2SPCA 3MA9A 1IFDA 4RESB 2FFDA 1QSDA 3P8MC 1IO4A 3EUHA 3LG7A 5BVZA 2VKJA 4UIGA 4XAXB 3RL0C 3EQ2A 4C91A 4UXNB 3M0DA 4EOTA 1SFCD 1NTMK 2W6BA 1IFJA 1EQ7A 2RP4A 1AFOA 3KYQA 1S9KD 1FZCC 3L37A 5JDFA 2JJ9A 4NUVA 1OXZA 2CMRA 2J58A 2CEAA 1NO4A 1MNDA 1NWMX 2ZM8A 3GN5B 5APQA 2CPSA 1NKZB 1NHLA 3V2NA 2FXMA 4WY4C 4L0RA 1URQD 1LTJA 2LSYA 1FZFA 3B13A 5TAOA 5KJ7C 3CQGB 3U1AA 5H6QB 1D1BA 5LGTB 3DTOA 5KJ7A 1YKHB 3F2EA 3KV4A 2VKHA 1URQA 5EK2A 1GL2A 3RL0B 1U4QA 1FZBA 4JYCA 3RK3C 2LJLA 2N9DA 4O2BE 5DQVA 3U3IA 4E7SA 3RC3A 3L3PA 3KQGA 3ZMZB 2YNYA 1IC2A 1KQLA 2NTXA 4MLKA 3RK2D 1Z56A 4ZS3A 3H37A 3HUSA 5CHXA 2YU1A 1L4AA 3IFMA 2WPRA 3ZCIA 3EFGA 5LYJE 1L4AC 1FBMA 1FOSE 4PJJA 2WSEH 5AVZB 5FYMA 3RYCE 1FMWA 5LP6E 1GU5A 3RYHE 4WBNE 3QK6A 2E9XA 3V2QA 4N6JA 3K3QC 4F6RC 5AVSB 4KHXA 3RH3A 3N9OA 2EHOD 5GONE 3V5BA 3KDPB 5HXSA 1SQPK 3RK2C 3M0DC 5AVTB 1Z0PA 5AW1B 1HF8A 4IE6A 5LHHB 4EZHA 4CXYA 3GHGA 2PJQA 4AKIA 1JTHA 3OA7A 3SS1A 2DLRA 1JCDA 3AB3B 3KFWX 3NRXA 5APSA 3OAKA 1IFIA 4IFFA 4JLEA 1U5PA 4PFOA 4QWNB 2O01H 2V7IA 1A02J 1N7SD 3M06A 1MMDA 2NWBA 2C0WA 2XDJA 4O4IE 5CCHD 1GDTA 2HPLA 2CWYA 2M67A 2NW8A 1RE4A 1LTSC 3F31A 2O1KA 2HLOA 2VB6A 3JC6C 4AXPA 4EZ4A 2H7OA 2DI4A 4XA4A 1D1AA 2DCFA 3PUAA 4PK4A 3CWZB 1W2EA 4GK5E 4YLHA 3HRNA 4DOJA 2PG8A 1LVFA 3KDSE 3ZN0B 1LWUA 1SLQA 1X8YA 3HE5A 5AW7B 2L9QA 2V7LA 1LWUC 4WB4A 1IFMA 3T97A 4H63V 3J9X1 5JRCB 1MIYA 4PK6A 2ZFCA 3ZMSB 4KUMB 1URQB 3FHNA 3LK3B 3ZLIA 2JQQA 3PU8A 4KMCA 4BJMA 1GK4A 2KT9A 2LSKA 4Y99B 5AW8B 1JNMA 2WM9A 3IR9A 4CXXA 1LTTC 4YHJA 2ZM2A 4EYYR 3C64A 2K5BB 1X79A 3GWHA 2KB7P 2QM8A 3ZEFB 3PTRB 1LTJC 3R84B 5J2UE 2LEHA 4CXWA 2GM4A 2ZMAA 3VYIA 3L35A 4H9SE 4ZKUA 3I9YA 3RRCA 3ZYLA 3P8CD 2N1TA 1QL1A 4WNKA 2A45H 2R32A 4UV8B 5CCGA 1FMVA 2VL8A 4V1Av 4ZOLE 5L3FB 2N1GA 1M7LA 1ZHCA 4QKNA 1HS7A 2DNXA 3Q5XA 4B6XA 2KINB 3CX7B 1CI6B 2XUEA 4I50E 1IFNA 3VP8A 1B7TA 1YKEB 1FZCB 3N9PA 1L4AB 1NOHA 4H9OC 3T8OA 2FKWB 3RK3D 4BA9A 2EHOA 3KV5A 3V5UA 3SOLA 4GT1A 2WSCH 1LTIC 5HWXA 3LIDA 2YKPA 4TUYE 1GK6A 3RK3B 3I0OA 4IDZA 3ZJ1A 5JDGA 1L4AD 1SQBK 1IAPA 2XAJB 5AFUL 4C7NB 4TZ4C 3KINB 3LK2B 4CI1B 2BDEA 1SFCB 3NXSA 4AUWA 3TNUA 3BK9A 3GHGC 1GZLA 3O1HA 2MYSA 2VRSA 5J2TE 3HD7B 3P7KA 4W7ZA 2WTYA 3MJXA 5JR9B 2MTQA 1G1IA 1GL2D 1LTBC 5AW9B 5IYZE 1Y64B 5KJ7D 2XQYA 2L3LA 2Y6XA 3A3YB 1CZQA 4LLHA 1RF1A 2JJLA 1L0NK 1YW0A 1T3UA 3U59A 4EIJA 2YINA 3IHRA 1RE3A 2XU6A 2E9XB 2WT7B 2Q9QD 2W00A 5LCYA 2KWIB 3PUGA 1LRZA 4N3YB 2ODUA 4ZI3D 4OH8B 1HTLC 2Z4EA 2O1JA 1N73B 1GW4A 2WSFH 3U1CA 1AQ5A 1CW5A 1EZ3A 1MIVA 1M1JB 3JC6D 4EXTA 1RF0A 3I0QA 3IEEA 2H8PD 5BMVE 4W80A 1O3XA 2CXLA 1LT9B 1HFAA 3FBLA 3MTUE 2WWWA 5APXA 1GL2C 5BU8B 3ETUA 5KDMC 1YYCA 4KBMB 3VMZA 3C51A 5AVYB 1ZR4A 3GA8A 3KV9A 3N5LA 2V7MA 4TV8E 3CQCB 3N2KE 5LG4A 2YU2A 2NPSB 3WI3A 3N9QA 4ZKPA 3EDVA 2WPSA 2PBIA 4OYKA 3BRTB 1E5WA 2EHOC 5C8YE 4HEAA 1JY3P 3NTNA 4IE5A 1JCCA 2FYUK 3UTKA 4UF0A 5JDNA 5M4YA 4DBRA 4JEUB 1SQXK 2WBLA 5CA0E 3PUQA 4TV9E 4PJMA 2E9XC 1WT6A 1RF1B 3N9MA 3K3NA 1WR6A 2E8IA 3O9XA 3OYZA 1KILA 3B5NB 2D0TA 2OYHB 2YKQA 3LBXA 1SHZC 4G2AA 4X20E 1CSBA 3BQKA 3P7IA 4ZI7E 2LHNA 4AQGA 3DP7A 3A7OA 2HG5D 4U72A 1HBWA 4KP3C 4QXBB 2N1TC 3RKOA 3ZJ2A 5CJ4A 3L36A 1NTKK 1BR4A 2JMKA 4O4JE 3OBVE 1SFCC 1LVKA 3AAEB 3E08A 5CB4E 2MBGA 3ZPOA 4GIFA 2NPSC 2ZM0A 4EYUA 4C7NA 4AKHA 5AW6B 2LSGA 3NZPA 4CI3B 4C90A 3ONXA 1CUNA 3E1IA 2C5IT 3AA0B 3K8PC 2HPJA 4QX7B 1AJ3A 1KFMA 2YO2A 4YFSA 3OYXA 2MOZA 1WRGA 3LIEA 1FJPA 1S94A 2X51A 3M65A 1JY3N 3RRWA 2HPCB 2C9NY 3MACA 5L3GB 4FJOA 2N1TD 4AQRD 3CX6B 5JDMA 3C4WA 3O1JA 4O4HE 1G1JA 4IFMA 2LSIA 3HA4A 2KOGA 2XASB 3A5XA 3LJCA 3U78A 4H9NC 3MZKB 2NPSD 2I1KA 3AAIA 1IJ6A 5DABA 4OK0A 5CA1E 2P2UA 1G73A 4DMWA 3HE4A 1HTJF 4IGUA 4CI2B 1LTJB 3N7NA 4EOZB 4YJ2E 3L4FA 3MXZA 2V7JA 4TX5A 5JR9A 2OYIC 2W0GA 1ZV8A 3O4XE 1MNEA 5JR9C 2HODB 1FEWA 5APYA 5BU5A 3A2AA 1JUNA 3P32A 4CQIA 4ZI2C 1ZN5A 2Z5IA 3TYYA 4I43B 1N86A 2K9AA 1T8ZA 1MIWA 4ANJA 3HUSB 3GMIA 2Q3IA 2W27A 4O4LE 2RA1A 1HGZA 1XTCC 5CCGC 1URQC 3VMXA 4ILUA 5HWYA 2C5JA 2Q9QA 4QXHB 4UVBB 3R6NA 4ADZA 4DBQA 1LTGC 4HKAA 5LHGB 1J1DC 3CMLA 2JMHA 3RYIE 4LGDE 1HGVA 3H32B 1UX5A 1ZV4X 2BZBA 2HPCA 2CLYC 5CCHA 2Y8DA 3UFEA 5F8PA 2PAJA 4GOUA 3PP5A 5ETWA 1HCIA 2M8RA 1PFIA 2A45G 2A2FX 4OHFA 2K48A 1KILD 3UULA 3O8ZA 3S4UA 5DJQC 2ZLYA 2XV5A 1T98A 4PFPA 3QUJA 3I5CA 4GK0E 2HODA 1H7CA 3E22E 1VPCA 4UELA 1GU4A 2J1DG 3H6PA 4WY4A 4HE8A 2UXNB 3ANWA 4PJNA 2VKOA 3VU7H 3ZYKA 2D2SA 1JTHB 2YEVC 1G8XA 4Y99C 3BQIA 4IE0A 3PU3A 3MUDA 1XTGB 4ZHQE 5L3CB 2P1JA 1HG5A 1RY3A 1T2KD 2NP9A 4ZI3C 3RPUA 1JY2P 4UV9B 3VKGA 3DJBA 2QA7A 3WMM0 1QUUA 1JY2O 3C4ZA 4WBOA 4HTEA 4A56A 1HH0A 3LK42 3UT5E 2IFNA 5AVVB 1HG2A 1MMGA 5JQGE 2XAFB 2FYZA 1VOMA 1RE4C 5JRCA 1YTZT 2IFMA 5CJ0A 1NU1K 4U74A 5FY7A 3ZN1B 3MD0A 5LHIB 3PURA 1MMAA 2X67A 4H9PC 5LJNA 3SWFA 2G0UA 3WAJA 2XZRA 1LWUB 3UIAA 3MK7C 1HX8A 5KTBA 3VHLA 1BR0A 3PE0A 2X9XA 2LT3A 3CPZA 2Y48B 3IBPA 2ZXEB 1FJKA 2R3CA 5AW2B 3V4WA 2D0UA 4H63H 3CVRA 4CZZB 2NTYA 3AAAB 3HE4B 2LOPA 2DWKA 2ODVA 5LGNB 4Z8XA 2JPFA 2X9WA 2KXPB 1FZEA 4LC1A 3RX6A 2CPBA 3SWYA 4C7RA 3RYFE 5APWA 2HH7A 4IIJE 2KLVA 3UUNA 5AW0B 5LJMA 2WWUA 1DEBA 2R5DA 1FDMA 3ANWB 2N2NA 3RK2B 3C98B 3KBUA 3UUXB 3Q5WA 2X0LB 3HKEE 4ASKA 4EAHA 5HXEA 4P0BA 1S9KE 2LE8A 3M0AA 2BVLA 3ZYMA 1S35A 4W7YA 1J1EC 1DH3A 1N7SB 2CLYB 2LM9A 5LBQB 1WYBA 5JDHA 1ZKEA 3ZMUB 2Q9QC 2KP8A 4HYTB 3TSIA 2OA5A 3SWHA 3H32A 1US7B 5CCGD 1LTAC 3HUSC 4N78E 2C0SA 5ADXL 1N2DC 4DZOA 2Q9QB 1IJDB 3AVRA 3SRZA 5LBMA 3N2OA 2KSJA 4C46A 3P8CE 4IHJE 1NH4A 2WPQA 5FXZA 1SVFA 5LNKA 1LGHB 4GKGA 2WITA 4WY4B 1J1EB 2CXDA 2QM7A 1KILC 3TK1A 2W61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AW7 B;  1SLQ A;  1X8Y A;  2P7J A;  3HE5 A;  1NWQ A;  3T97 A;  2WT7 A;  2ZFC A;  4B86 A;  2P67 A;  2E43 A;  2Q5U A;  2P2U A;  1YD8 G;  1MUU A;  3NMD A;  3HE4 A;  2YO3 A;  3M9B A;  1FAV A;  1MV8 A;  5AVW B;  1GK4 A;  4JYB A;  4I2L C;  5AVU B;  5AW8 B;  4AYC A;  1JNM A;  3IR9 A;  5APY A;  3A2A A;  1JUN A;  3P32 A;  1X79 A;  2QM8 A;  3TYY A;  2Z5I A;  1HWT C;  3VYI A;  3L35 A;  2Q3I A;  2W27 A;  2W6A A;  5AVQ B;  3VMX A;  3M9H A;  3HE5 B;  2R32 A;  5AVR B;  1J2J B;  1CI6 B;  3NFQ A;  5APU A;  3VTP C;  1HJB A;  1A02 F;  1NAF A;  2R5B A;  3B8E B;  2E42 A;  4GT1 A;  2H7H A;  5APT A;  3O8Z A;  3LID A;  2Q7C A;  5AW4 B;  1H88 A;  2XV5 A;  1GK6 A;  3I5C A;  1GD2 E;  1GTW A;  1OWA A;  1GU4 A;  5AW5 B;  4C7N B;  4RES B;  3P8M C;  1IO4 A;  3NXS A;  4AUW A;  4I6M C;  3TNU A;  1GZL A;  3VN0 A;  2VRS A;  1WRD A;  1T2K D;  3P7K A;  2WTY A;  3M0D A;  4EOT A;  2Z5H A;  3M91 A;  4M3L A;  3VMY A;  1S9K D;  3L37 A;  4XE5 B;  5AW9 B;  1OXZ A;  5CMZ A;  5AVV B;  3A3Y B;  1CZQ A;  1CI6 A;  2JJL A;  1NWM X;  5APQ A;  2XU6 A;  3V4Q A;  2WT7 B;  3MD0 A;  1HUC A;  3HTK A;  3MGN A;  3SWF A;  2C9L Y;  1MFZ A;  2XZR A;  5APV A;  3UIA A;  1O3X A;  2WWW A;  5APX A;  1YYC A;  2N9B A;  2ZXE B;  3VMZ A;  5AVY B;  1H8A A;  2R3C A;  5AW2 B;  3V4W A;  5AVX B;  3HE4 B;  2WPS A;  4JYC A;  2N9D A;  1G2C B;  4LC1 A;  3KQG A;  3NTN A;  2YNY A;  1KQL A;  5APW A;  5AW0 B;  2R5D A;  2WPR A;  1FOS F;  2N2N A;  1FOS E;  5AVZ B;  1WR6 A;  1GU5 A;  1S9K E;  3M0A A;  5AVS B;  4KHX A;  1H89 A;  2BAS A;  1CSB A;  1DH3 A;  3V5B A;  3KDP B;  3A7O A;  5AVT B;  5AW1 B;  1HBW A;  3A5T A;  2KP8 A;  4HYT B;  3L36 A;  1T2K C;  1SP4 A;  3OAK A;  5APS A;  5AW3 B;  1A02 J;  4C7N A;  3M06 A;  5AW6 B;  4DZO A;  2YO2 A;  3LIE A;  3TNU B;  4C46 A;  2WPQ A;  2C9N Y;  4GKG A;  2IPP A;  4AQR D;  2QM7 A;  3TK1 A; 
#chains in the Genus database with same CATH topology
 4Z91 A;  2OYH A;  4UVA B;  3L75 D;  4WBA A;  2E43 A;  1NTK G;  2IC6 A;  1MUU A;  5LB7 B;  1FIO A;  1FC2 C;  1MV8 A;  4QX8 B;  3GMA A;  3TGU G;  4LMK A;  5HAX A;  3MZW B;  3H1H D;  1QEX A;  2KZ7 B;  3FBZ A;  2DHR A;  3ZT5 A;  1HWT C;  3AED A;  4CN4 A;  4ASV A;  2W6A A;  5AVQ B;  1XNQ T;  5C3J A;  2LOS A;  2E76 B;  2YK0 A;  5AVR B;  2KSR A;  4MBQ A;  1NTM J;  3HR0 A;  2AXT H;  2QJP B;  1SQQ K;  2MJZ A;  3B8E B;  1W09 A;  5APT A;  2E9X D;  1VQ4 P;  3V2P A;  3CQX C;  2X68 A;  4H44 C;  1D0X A;  4I6M C;  1ZEE A;  2B87 B;  1WRD A;  2LHR A;  1FU1 A;  1LKX A;  2I1J A;  3AE4 C;  5CMZ A;  3L74 E;  3A0H H;  1VCS A;  4IRE A;  3BRV B;  1HUC A;  2H89 A;  4HN9 A;  2V6Y A;  1ZR2 A;  4U2Y A;  5LGU B;  2CWO A;  1OVU A;  2FBW C;  2KK7 A;  3NRY A;  2KYV A;  3AEE A;  1DD3 A;  1H8A A;  3AE2 C;  5FXX A;  3LW5 J;  3QC9 A;  1G2C B;  4U33 A;  1Q90 D;  2IDB A;  3H1L J;  2PP6 A;  2Z6E A;  2NRG A;  1FZA A;  2ZVO B;  1MZ9 A;  2KMF A;  2IAK A;  1PP9 G;  3RL0 D;  3N9N A;  1L0L D;  5JRE A;  2O01 N;  2YN6 A;  3HKC E;  3NZQ A;  2W62 A;  3C4X A;  4P09 A;  3R2P A;  4DVD A;  4MAL A;  1YQ3 A;  4DO0 A;  1JM0 A;  2N1T B;  5KAI E;  5KLI B;  1PGQ A;  3HD7 A;  3CCQ P;  3I9W A;  2QM7 A;  1ZLL A;  2K1A A;  2BG9 C;  3TNU B;  5FXV A;  2W6J H;  3HI2 A;  5HEG A;  3AEB C;  3NVO A;  4JI5 T;  2BS2 A;  4M3L A;  2VK9 A;  1W0B A;  2IUB A;  3M9Q A;  2BEQ D;  1NWQ A;  4LML A;  3OJA B;  3PJS K;  2XAH B;  1D0Y A;  2H43 A;  1KB9 I;  2PGD A;  1VF5 D;  1W2B O;  5KLV K;  2IBZ G;  2NPS A;  3M9B A;  2KUB A;  3F5H A;  1Y8A A;  5EK3 A;  1M1J C;  1BE3 G;  1OVR A;  1SQP J;  2H89 C;  3TLT A;  3P4Q A;  1SQB J;  2KIK A;  2VWA A;  5AQP B;  2AEJ A;  4OYJ A;  4TN7 B;  3UU8 A;  1UGO A;  2UXX B;  1VQO P;  2IHR 1;  3FXD A;  3H3A A;  5JQG E;  3N9L A;  1VRB A;  3CXH I;  3N4X A;  2CM0 A;  1J1J A;  1NAF A;  1VDF A;  2QJY C;  4TWF A;  3CX8 B;  1T3J A;  3GHG B;  4K0U A;  1H88 A;  4M1P A;  5HXC A;  2H3R A;  2KLU A;  1QSD A;  2E75 B;  3EUH A;  5BVZ A;  4UIG A;  2AXT E;  3M0D A;  1SFC D;  2W6B A;  1IFJ A;  2E75 D;  3B4S A;  2LRK A;  2JJ9 A;  1NO4 A;  1VQ9 P;  1MND A;  1NWM X;  3UU3 A;  1NKZ B;  1N34 T;  2FY8 A;  2FXM A;  4WY4 C;  4L0R A;  1URQ D;  5L4E A;  1FZF A;  3B13 A;  5H6Q B;  1JEK A;  3CWB G;  3DTO A;  3F2E A;  1GL2 A;  3RL0 B;  2UUB T;  1U4Q A;  3RK3 C;  2LJL A;  4E7S A;  3RC3 A;  3L3P A;  2NTX A;  3RK2 D;  1IFP A;  2A06 E;  1NEN A;  1YI2 P;  3EFG A;  1FBM A;  4PJJ A;  2WSE H;  2Y0C A;  3RYH E;  4N6J A;  5GON E;  2RH0 A;  3KDP B;  4IE6 A;  2ITA A;  5AW1 B;  4EZH A;  2JIW A;  4AKI A;  1H0T B;  5APS A;  1IFI A;  2BKO A;  2AE9 A;  3TDK A;  2IYO A;  5KLV J;  1LNQ A;  2QG4 A;  2HN1 A;  1KNP A;  2M67 A;  5HEJ A;  2UXD T;  2NW8 A;  3JC6 C;  2V7Q H;  2HLO A;  2VB6 A;  4U7I A;  3CC2 P;  2H7O A;  1D1A A;  1KF6 A;  1Z8U A;  2DCF A;  2OGU A;  1LVF A;  3KDS E;  5L4H A;  5AW7 B;  1X8Y A;  2V7L A;  3T97 A;  4AQY T;  4H63 V;  4OGQ D;  2ZFC A;  3EAB A;  3ZMS B;  1SQQ J;  1EZV I;  3LK3 B;  4LF9 T;  3ZLI A;  4HWD A;  1QVF O;  4DV5 T;  4IL4 A;  4NPE A;  4Y99 B;  1YQ4 C;  2V4H A;  5AW8 B;  4OX9 T;  1YQ4 A;  4CXX A;  4IL6 H;  1LTT C;  4TWD A;  2QM8 A;  3PTR B;  4JI6 T;  2E76 D;  2LEH A;  2ZMA A;  1PZQ A;  4ZKU A;  2W4X A;  3ZYL A;  5KAF H;  1ZXG A;  4WNK A;  2A45 H;  4UV8 B;  2VL8 A;  3C1L A;  3A8Y C;  2A06 G;  3PH0 A;  3CXH H;  5B66 H;  1YKE B;  3W67 A;  4HFD A;  3T8O A;  3V5U A;  4GT1 A;  2D2C C;  3SWK A;  2YKP A;  2E74 B;  4TUY E;  3V6I A;  4DV6 T;  1EXJ A;  1USE A;  2BDE A;  4U31 A;  5J2T E;  2R3S A;  3O1H A;  1GZL A;  2MYS A;  2X0Y A;  4HFE A;  5JR9 B;  2MTQ A;  1BDD A;  1G1I A;  1GL2 D;  2V5D A;  5KJ7 D;  2Y6X A;  1CZQ A;  4IST A;  1T3U A;  3U59 A;  3EAM A;  3IHR A;  1RE3 A;  4D6T D;  2E9X B;  4QH1 A;  2KWI B;  3K1S A;  1LRZ A;  2Z4E A;  1CW5 A;  1EZ3 A;  2BG9 E;  2H8P D;  2NZ2 A;  3FBL A;  1O3X A;  1LT9 B;  2WU2 A;  4I0U A;  5BU8 B;  5APX A;  1GL2 C;  4YTN A;  1YYC A;  4KBM B;  3VMZ A;  5AVY B;  3GA8 A;  4JBZ A;  3CXH D;  2V7M A;  5LG4 A;  2XQA A;  3RIA A;  3WUT A;  4R4L A;  2PBI A;  3CX5 I;  1GQE A;  4OYK A;  3CWB D;  5JDN A;  1JCC A;  2P58 A;  1EDI A;  3H1K J;  3P4R A;  2E8I A;  1SQP E;  1N33 T;  2I8D A;  3OYZ A;  4YTM A;  3LBX A;  1SHZ C;  3CME P;  1I94 T;  4U72 A;  1HBW A;  1NTK K;  3AAE B;  1T8B A;  3ZPO A;  1S72 P;  4AKH A;  2ZM0 A;  4C7N A;  5KLV G;  3ONX A;  2BS3 A;  2IBZ E;  2Q1K A;  4A7P A;  4PD4 D;  2KSE A;  2QEX P;  4HJG H;  4AQR D;  4ZXL A;  4LMJ A;  4O4H E;  3GF7 A;  3LJC A;  3UU6 A;  2XND H;  2ZT9 B;  1USD A;  2LLY A;  1H0T A;  1HTJ F;  1LTJ B;  4YPC A;  4IDO A;  5JR9 A;  4EED A;  1ZV8 A;  3AE9 A;  5JR9 C;  2HOD B;  4DUY T;  5APY A;  4ZI2 C;  3L73 D;  1N86 A;  2K9A A;  3VR8 A;  1T8Z A;  1MIW A;  4IDN A;  4ANJ A;  3HUS B;  5CCG C;  1URQ C;  2Q9Q A;  5TJH A;  1T72 A;  1IBK T;  1NU1 G;  2FYU E;  2JMH A;  3JCU E;  1ZV4 X;  3H32 B;  2BZB A;  2Y8D A;  4JYA T;  5F8P A;  2PAJ A;  4GOU A;  3KXD A;  3PP5 A;  1HCI A;  2QJK B;  2K48 A;  3UUL A;  3UUB A;  3S4U A;  5DJQ C;  1T98 A;  2WWV A;  4GK0 E;  3I5C A;  4LFB T;  1H7C A;  1GU4 A;  3H6P A;  3AE3 A;  2YEV C;  1G8X A;  3BQI A;  3PU3 A;  1EDJ A;  5L3C B;  2P1J A;  4ZI3 C;  2NP9 A;  2WSE J;  4PJ0 E;  3ZDM A;  2QA7 A;  1JY2 O;  4WBO A;  5AQJ B;  2IFN A;  3KZI H;  3AEC A;  1VOM A;  5JRC A;  5FY7 A;  3AEC C;  1IBL T;  1AA0 A;  2X67 A;  4IL6 X;  3D6Y A;  5LJN A;  3H1K E;  3VHL A;  1BR0 A;  2X9X A;  3QNU A;  5AW2 B;  3BCC D;  1DEE G;  4H63 H;  3CVR A;  4CZZ B;  3AAA B;  2ODV A;  4Z8X A;  1FZE A;  4UR9 A;  3KZI E;  2HH7 A;  4Q25 A;  2M0B A;  2WWU A;  2ZYD A;  3C98 B;  3ANW B;  3KBU A;  2G3A A;  3RK2 B;  5HXE A;  4P0B A;  3OVU A;  1BGY G;  2BVL A;  1YBK A;  1J1E C;  2YDR A;  1KIL E;  1WYB A;  5GTI H;  3ZMU B;  2Q9Q C;  3F89 A;  1KQF B;  3PUX F;  2BCC G;  2VQE T;  4U7J A;  1WFD A;  4HB1 A;  3CIR A;  3T1Y T;  5AQS B;  3HUS C;  4N78 E;  4X65 T;  2J47 A;  3GW6 A;  3KHU A;  3AVR A;  1FDI A;  4X5T A;  1RQU A;  4C46 A;  2KSJ A;  5FXZ A;  1SVF A;  3AE1 A;  4JI2 T;  2WIT A;  3GG2 A;  2Q9Q D;  1PP9 E;  3CCR P;  3TK1 A;  5AQL B;  4PK5 A;  5AQT B;  2WQY A;  2LKM A;  4JI0 T;  2WT7 A;  5A1L A;  1NU1 J;  1KNR A;  1KNZ A;  4UVC B;  1YTZ I;  3C9I A;  2V1D B;  3HTK B;  5AQM B;  4TT3 H;  5AVW B;  4PV1 D;  3GN5 A;  2POH A;  4H13 B;  3J7Y q;  2KZI A;  4F8H A;  4GKJ T;  3L73 J;  4ZS2 A;  3X1D A;  4YTP A;  2RN0 A;  2JWD A;  3FB2 A;  3FXE B;  3CL3 D;  3EDU A;  1N7S A;  4JEH B;  2CK3 H;  3FX0 A;  2LSJ A;  3HE5 B;  2WZI A;  2QJY B;  2XHE B;  3IF8 B;  2C0X A;  4I4T E;  5FY1 A;  3L74 J;  4JQ0 D;  3CCM P;  4ISS A;  3ZC0 A;  1ZW0 A;  5APU A;  1YJW P;  3FZK B;  3AXJ A;  3WAK A;  3AE7 C;  2OYI A;  1SA0 E;  1BR1 A;  2V6Y B;  3B5N A;  3LW5 H;  5AW4 B;  2FYN C;  5AW5 B;  1M62 A;  3G9R A;  3VKH A;  1LP1 A;  4EDF A;  5TIS H;  1KD1 Q;  3LFM A;  2R6G F;  3CPW O;  2XQ6 A;  4PAG A;  5FXW A;  2IW5 B;  2Z5H A;  3M91 A;  4EIW A;  1J1D B;  2Q3E A;  3O1I A;  1N7L A;  4XBF B;  1KFN A;  2E2A A;  3SSU A;  3HTK A;  2ES0 A;  5IHY A;  3UU5 A;  4L74 A;  2FJE A;  4NPP A;  5H6R B;  1KN7 A;  2DL1 A;  2P10 A;  4JBW F;  1SFC A;  4FI5 A;  3Q2M A;  4HWF A;  4PW8 A;  3QB5 K;  3KBT A;  4B3S T;  1AVO A;  4WY4 D;  2V5C A;  4MHC A;  2WMN A;  4N78 D;  2FFD B;  4XZC A;  3UQ7 A;  1R5L A;  1KB9 D;  3K3O A;  4TWH A;  2NW9 A;  1JY3 O;  2FFD C;  2WZ7 A;  4CN1 A;  4JUY A;  4HH2 A;  3CLQ A;  2L8K A;  4OVN F;  4AQF A;  3B5N D;  2BVM A;  4AQF C;  1UII A;  1YQ3 C;  3SFD C;  4DV3 T;  1U7M A;  2D9D A;  3NBX X;  2X9Y A;  4GYS A;  4YXW H;  2IPP A;  2H88 A;  3RIU C;  2D5U A;  3ZMT B;  2CBI A;  5HYA A;  5LA6 E;  4EYY Q;  2RPA A;  5CFB A;  3BVH A;  5JDQ A;  1BGY J;  2BCC E;  2X66 A;  3HKB E;  4IE7 A;  3RC8 A;  2P67 A;  2JR8 A;  3Q1M A;  1L0N J;  3KVB A;  1RH5 B;  3TKL B;  4JPZ B;  3B71 A;  4ZZC A;  1Q81 Q;  1FAV A;  2IX7 C;  1PPJ G;  2XTL A;  4JI4 T;  1VQL P;  4IFD K;  1NTM E;  1NEK A;  4X1I E;  5HXH A;  1M1J A;  1N73 C;  4YJ3 E;  3VP9 A;  2I6H A;  3RGL A;  3HD7 D;  1G2C A;  4H44 B;  4R4M A;  5FVK A;  3RIF A;  1E1H B;  5KMG P;  2IZ1 A;  3W15 B;  3QH9 A;  5EZY E;  2KS1 B;  4X1K E;  3TLS A;  3AE5 A;  2GUV A;  3ZCJ A;  5LOV E;  3HKD E;  2Q7C A;  4GYR A;  3TLU A;  1GTW A;  1MMN A;  2SPC A;  4DR4 T;  4RES B;  2FFD A;  4YHH T;  3P8M C;  1IO4 A;  4H13 C;  2VKJ A;  4XAX B;  3RL0 C;  4UXN B;  1NTM K;  2FXP A;  5JDF A;  1OXZ A;  2J58 A;  2WDR A;  2ZM8 A;  3GN5 B;  2B88 A;  1SQV D;  5FVL A;  4YXD A;  2E5V A;  5CGM A;  1NHL A;  3O6Q A;  3V2N A;  3AEB A;  2K9Y A;  4H13 D;  2ZT9 D;  1LTJ A;  4DT0 A;  2WQY C;  3U1A A;  3KV4 A;  1I6Z A;  2VKH A;  2WDQ A;  5EK2 A;  4RJT A;  1L0L E;  1FZB A;  3U3I A;  3CWB J;  3KQG A;  3ZMZ B;  5CJ5 A;  1IC2 A;  1KQL A;  4MLK A;  1UUS A;  1Z56 A;  4ZS3 A;  5CHX A;  2CHN A;  1L4A A;  4U3F G;  2WPR A;  3L74 G;  1S5L E;  1AJ3 A;  1FMW A;  3L73 E;  1GU5 A;  3H1H G;  2WSS H;  4F6R C;  2EHO D;  5HXS A;  2M6I A;  3RK2 C;  1AJY A;  3TGU D;  1JNR A;  1HF8 A;  5LHH B;  3H1J G;  4CXY A;  2PJQ A;  1JTH A;  3P4P A;  2DLR A;  3KFW X;  3SS1 A;  4DV7 T;  3NWI A;  5FL1 A;  2O3J A;  4O4I E;  1BE3 E;  2CWY A;  2HPL A;  2G8Y A;  1RE4 A;  3PRJ A;  4U3F E;  3FXE A;  3GF3 A;  3PUA A;  1W2E A;  2K37 A;  1SLQ A;  4EAH A;  5JRC B;  1IFM A;  3S1K A;  2FJD A;  4YSZ A;  3TLV A;  2OYO A;  4KMC A;  2KI7 B;  4EV6 A;  2LSK A;  3WU2 E;  2R44 A;  5M1B A;  4K0K T;  2IML A;  1Q86 Q;  3L75 E;  3O6Q B;  2QIW A;  3AE1 C;  5LMN T;  2BG9 B;  1SQP D;  1X79 A;  3GWH A;  2KB7 P;  4NPF X;  4X66 T;  5J2U E;  4CXW A;  2GM4 A;  3L35 A;  3RRC A;  3CWB E;  2R32 A;  5CCG A;  1M7L A;  1PP9 D;  4QKN A;  1HS7 A;  2QRX A;  3Q5X A;  4B6X A;  2KIN B;  2XUE A;  1KYO E;  1IFN A;  3VP8 A;  2UU9 T;  4DV1 T;  2FKW B;  3RK3 D;  4I7Z C;  2EHO A;  3KV5 A;  3SOL A;  2WSC H;  3LID A;  3RK3 B;  3G4S P;  3ZJ1 A;  1HNW T;  3ONL C;  3GLM A;  4TLF A;  3ZSS A;  3KIN B;  3TNU A;  3BK9 A;  3HD7 B;  3P7K A;  3MJX A;  4PD4 I;  1LTB C;  5IYZ E;  1Y64 B;  2M5A A;  3CML A;  1RF1 A;  3A3Y B;  2KS1 A;  1SS1 A;  2JJL A;  2YIN A;  3MP7 B;  2XU6 A;  2W00 A;  5GTI E;  2QA4 P;  5L3G B;  1W0A A;  3ZT7 A;  1PPJ E;  1AQ5 A;  3U1C A;  3JC6 D;  1RF0 A;  3IEE A;  4OGQ B;  4W80 A;  2CXL A;  5KDM C;  5ABF B;  4TV8 E;  3N9Q A;  1T6A A;  3BRT B;  1E5W A;  4OGQ C;  3ONJ A;  4HEA A;  1PGP A;  4IE5 A;  2FYU K;  3UTK A;  1T7S A;  5M4Y A;  3QWO C;  2RMZ A;  3VRA A;  5CA0 E;  4TV9 E;  4PJM A;  1IK7 A;  1BE3 D;  5DJU B;  3B5N B;  3CX5 H;  3CCU P;  1CSB A;  3P4W A;  4ZI7 E;  4QMA A;  5CJ4 A;  5GTH E;  3JCF A;  1LVK A;  1R8I A;  3E08 A;  5CB4 E;  1K05 A;  4UB6 H;  3NZP A;  1CUN A;  2C5I T;  4QX7 B;  2HPJ A;  2BS4 A;  1KFM A;  1P84 I;  2YO2 A;  2MOZ A;  1WRG A;  3LIE A;  2QYW A;  1JY3 N;  2DW3 A;  2C9N Y;  3RRW A;  4TNV A;  2WSF J;  1G1J A;  2LSI A;  2YIU B;  3A5X A;  4H9N C;  3H1H J;  3QB5 A;  1IJ6 A;  5DAB A;  4OK0 A;  5CA1 E;  3HE4 A;  3N7N A;  4EOZ B;  4YJ2 E;  2UUA T;  3MXZ A;  2V7J A;  4IT4 A;  3PUY F;  2W0G A;  3TF5 A;  4CQI A;  5BU5 A;  3A2A A;  2ZAE B;  4MN4 C;  4EGW A;  1L2P A;  1ZN5 A;  2K9J B;  5J0Z A;  4D6T J;  2RA1 A;  1XTC C;  2YIU C;  3SWH A;  4ADZ A;  5HWY A;  2C5J A;  2ZVN B;  3JAD A;  3R6N A;  1Q82 Q;  5LHG B;  1LTG C;  1QGK B;  1E79 H;  1NTZ E;  4GDO A;  3L74 D;  2HPC A;  1NTM G;  4U3F D;  5CCH A;  2WB5 A;  5ETW A;  2ZXX A;  3Q5P A;  2A45 G;  2A2F X;  1CHU A;  2BKP A;  3O8Z A;  3H1K G;  2ZLY A;  2XV5 A;  1BE3 J;  2ZJS E;  4UEL A;  2HOD A;  4LFA T;  1FS0 E;  3ANW A;  2D2S A;  4Y99 C;  4ZHQ E;  4UV9 B;  4B3T T;  3WMM 0;  4A56 A;  1HH0 A;  1NTK J;  2XAF B;  2FYZ A;  1YTZ T;  5CJ0 A;  2FYU D;  1NU1 K;  4IDQ A;  3ZN1 B;  3ZST A;  1MMA A;  2G0U A;  2XZR A;  1LWU B;  3UIA A;  2XSA A;  1HX8 A;  3PE0 A;  3CPZ A;  3AEF C;  1Q7Y Q;  3V4W A;  2D0U A;  3NKZ A;  2NTY A;  3HE4 B;  5LGN B;  2JPF A;  2X9W A;  3RX6 A;  3AE8 C;  4LC1 A;  3SWY A;  4IIJ E;  2KLV A;  3UUN A;  3TGU E;  3JC2 2;  1DEB A;  2R5D A;  2M5A B;  2X0L B;  2W67 A;  3M3Z B;  1L0V A;  3R4Y A;  4BRY A;  2XQ8 A;  3ZYM A;  2LKG A;  1S5L X;  1S35 A;  2E76 C;  4W7Y A;  5LBQ B;  2LM9 A;  5JDH A;  2E5L T;  3AE6 A;  5IUX A;  3TSI A;  2OA5 A;  1JNZ A;  1US7 B;  1OZH A;  5CCG D;  5IWA T;  5ADX L;  1N2D C;  2FXO A;  1XMQ T;  3BCC J;  5LBM A;  3N2O A;  3ITK A;  5DJT B;  3P8C E;  2W83 C;  1NH4 A;  1SQQ D;  2WPQ A;  2A9U A;  2QVA A;  3TLW A;  5LNK A;  1VQP P;  4WY4 B;  1J1E B;  3VR9 A;  3CC4 P;  5AQK B;  3L72 D;  1X22 A;  3A0B E;  3L09 A;  4QH4 A;  4LF4 T;  4H9R C;  5FMN A;  3RHW A;  5JDL A;  1IJ5 A;  1XDP A;  2X9H A;  4IE4 A;  2OAR A;  4IL6 E;  5B66 E;  4P0A A;  3Q2Y A;  4O9B A;  3AEG A;  2JP3 A;  1NTM D;  2I0M A;  3V5S A;  2NW7 A;  4A5X A;  4BAY B;  3N2G E;  1DU2 A;  3CI9 A;  2XM2 A;  1JY2 N;  1OED B;  2IYP A;  3M9H A;  1N7S C;  1BR2 A;  2V7Q J;  3KPE A;  2V8S V;  5CCH C;  4NIQ A;  1WLX A;  1HR0 T;  1VQ7 P;  3WUU A;  1PPJ D;  3PUW F;  1HJB A;  1A02 F;  2R5B A;  3BAT A;  4HFI A;  4A98 A;  3II6 A;  4Y28 J;  2ACZ A;  4O2A E;  3I55 P;  1OW6 A;  3UUM A;  2OTL P;  1MKM A;  2QGS A;  4J2C A;  4HGA A;  3I1A A;  2CA5 A;  1V9D A;  3VMY A;  2VAS A;  2F4V T;  2H7V C;  4H0L D;  4XE5 B;  4HKZ H;  1QLE D;  4ERR A;  4L76 A;  5JH7 E;  1NTK E;  1Y9B A;  2IC9 A;  5CBO A;  3V2R A;  3AA1 B;  3CKD A;  3MGN A;  1KYO D;  1M8O B;  1MFZ A;  2YXQ B;  4PV1 B;  5FP3 A;  2K9J A;  5JVD E;  2KNC B;  2N9B A;  3VOP A;  2L91 A;  3PDY A;  4PJL A;  2WZH A;  2DWG A;  5AQO B;  1D1C A;  1KK7 A;  2ACX A;  4KJM A;  1OMI A;  4OFZ A;  1FZG A;  1FOS F;  4DND A;  3CK6 A;  3RQU A;  2KWH A;  1RF0 C;  2WSC J;  2BAS A;  2VKD A;  4DMV A;  2NOX A;  1N73 A;  4A97 A;  1K9M Q;  2Q9I A;  3ETV A;  2V26 A;  1UUR A;  1SQX J;  3Q5S A;  1JOC A;  3AE4 A;  4EB6 E;  2XQ5 A;  2WAU A;  3FWL A;  4AI6 A;  2FYN B;  3BQL A;  4DID B;  1SUM B;  4ZNC A;  3EFF K;  2XAQ B;  3B5N C;  3H1I E;  2XAG B;  5J1G A;  3AEE C;  3P4S A;  2JRK A;  2PRR A;  4UF0 B;  1Q2N A;  4B86 A;  3D71 A;  2Q5U A;  1YD8 G;  1BCC E;  3AA6 B;  2J59 M;  1VCT A;  2XY8 B;  4JF7 A;  4I2L C;  2WSS V;  1W5C E;  3PUV F;  1OFC X;  1JMM A;  2GK9 A;  2CXF A;  1GL2 B;  1LT9 C;  1NVO A;  4PNI A;  1KZU B;  1LT9 A;  3AVS A;  1L0L K;  1BDC A;  1KV4 A;  5ABE A;  2B1E A;  2QJP C;  3F57 A;  4NUU A;  1J2J B;  1IZN B;  1QX8 A;  3HD7 C;  4QXC B;  3NFQ A;  1BCC G;  1NTZ K;  1EZV E;  1PP9 J;  2AEF A;  3VTP C;  1RE3 C;  1X9V A;  2KLQ A;  3AE9 C;  2E42 A;  1J5E T;  4LF8 T;  4X62 T;  1SQQ E;  3ZC1 A;  1HNX T;  3OKQ A;  1OWA A;  4YTP C;  3MA9 A;  4I7Z B;  1EDL A;  1KTM A;  1WR0 A;  3IA3 A;  2D2C B;  3LG7 A;  1X0T A;  1NJI Q;  2D2C D;  4EOT A;  1AFO A;  1VQM P;  3KYQ A;  2RKL A;  3L37 A;  1NU1 E;  2FYU G;  4NUV A;  2CMR A;  5KLV E;  5APQ A;  4LF5 T;  3WUV A;  3D6Z A;  2LXC B;  2E5Y A;  1XDO A;  2LSY A;  3Q5D A;  5TAO A;  5KJ7 C;  3CQG B;  5LGT B;  1E2A A;  5KJ7 A;  4AIS A;  5LMU T;  1KMI Z;  3RLF F;  1NTZ G;  1NTZ J;  3I56 P;  3H1K D;  4JYC A;  2N9D A;  5DQV A;  2YNY A;  2M3E A;  3H37 A;  1R8E A;  2YU1 A;  1DD4 A;  3IFM A;  3ZCI A;  1L4A C;  3RYC E;  5AVZ B;  5FYM A;  5LP6 E;  2VQF T;  5AVS B;  3N9O A;  1S1C X;  1KB9 E;  3V5B A;  1S4X A;  1Z0P A;  5AVT B;  3K5B A;  3L71 D;  3GHG A;  4U3F J;  4DUZ T;  3NRX A;  1JCD A;  4IFF A;  4PFO A;  3FZH B;  1VL2 A;  1AVY A;  2O01 H;  4QWN B;  2BCC J;  1N7S D;  3M06 A;  1A02 J;  2XQ7 A;  1SQX D;  2XQ4 A;  5CCH D;  1LTS C;  2J4G A;  4EZ4 A;  1VF5 C;  4H0L B;  1QLB A;  3FZF B;  2WU5 A;  4GK5 E;  3ZN0 B;  1XNR T;  1LWU A;  3J9X 1;  3UQ4 A;  4PK6 A;  3CXH E;  1URQ B;  3AEA C;  1N8R Q;  1RHZ B;  1XWM A;  3P50 A;  4BJM A;  2KT9 A;  2IDO B;  1JNM A;  2WM9 A;  2Y9Z A;  2ZM2 A;  1EZV D;  3C64 A;  2K5B B;  3ZEF B;  1LTJ C;  1XZY A;  3R84 B;  4H9S E;  4U2Z A;  2ZT9 C;  2N1T A;  1E7P A;  1QL1 A;  1L0N G;  5B5E H;  1FMV A;  4V1A v;  2N1G A;  3ABV C;  1ZHC A;  4L73 A;  3L8R A;  3CX7 B;  4I50 E;  2Y0E A;  1UIX A;  1B7T A;  3N9P A;  2QSI A;  2VL0 A;  4H9O C;  3L70 G;  3W68 A;  1LTI C;  5ABG A;  1NYH A;  1GK6 A;  2BBJ A;  3I0O A;  4KI0 F;  4IDZ A;  2XAJ B;  1SQX G;  4C7N B;  4TZ4 C;  5AFU L;  3NXS A;  3VKG A;  3GHG C;  4WVZ A;  2VRS A;  4NPD A;  2WTY A;  3LDQ B;  3AE2 A;  3CCL P;  3L71 E;  3L70 J;  5KLV D;  4LLH A;  1YW0 A;  4EIJ A;  5L47 A;  3PV0 F;  5LCY A;  4ZI3 D;  2ODU A;  4OH8 B;  1MIV A;  5DQW A;  1N73 B;  1GW4 A;  2WSF H;  4EXT A;  3A0H E;  3I0Q A;  5EFW B;  2WVR A;  3MTU E;  2PTF A;  2VVS A;  1ZOY C;  3N5L A;  1ZR4 A;  3KV9 A;  4HFC A;  3N2K E;  3WI3 A;  4ZKP A;  5KAI H;  4HWC A;  5ABH A;  1JY3 P;  3NTN A;  4UF0 A;  2CPT A;  1R5S A;  1SQX K;  1ZP0 C;  3PUQ A;  2E9X C;  1WT6 A;  1RF1 B;  3N9M A;  3K3N A;  5KKZ C;  1KIL A;  2YKQ A;  4G2A A;  5TIS E;  3BQK A;  2JO1 A;  1JB0 J;  3P7I A;  2LHN A;  1RQV A;  4P1N A;  2JKV A;  3DP7 A;  4AQG A;  2HG5 D;  2CBJ A;  4KP3 C;  4QXB B;  2WMM A;  5KKZ B;  2M6B A;  3RKO A;  2OV9 A;  1M57 D;  3JCU H;  3L36 A;  1BR4 A;  2JMK A;  4B3R T;  2MBG A;  4D6T G;  2X0H A;  1YJN P;  2YDS A;  2NPS C;  4EYU A;  5AW6 B;  2LSG A;  4CI3 B;  1N32 T;  1SQQ G;  2E74 C;  2FJA A;  2QJK C;  3AA0 B;  4CN6 A;  4LF7 T;  4YFS A;  3VMA A;  1X9B A;  3M65 A;  2ZYA A;  2HPC B;  2BKN A;  1M1K Q;  3MAC A;  3CX6 B;  5JDM A;  4PD4 H;  2VVN A;  3O1J A;  4IFM A;  3U78 A;  3HA4 A;  2NPS D;  2FYU J;  3AAI A;  3CC7 P;  2FUP A;  3EHZ A;  1BSH A;  2P2U A;  1G73 A;  4DMW A;  3AXJ B;  4B3M T;  3SFD A;  3L4F A;  2KNC A;  5B5E E;  2OYI C;  3L73 G;  5F5W A;  1JUN A;  4GOE A;  4ZMD A;  2Z5I A;  3TGU J;  3IAO A;  2Q3I A;  4O4L E;  3VMX A;  4DV4 T;  1ZOY A;  4DBQ A;  4QXH B;  5AQR B;  4WWI A;  1J1D C;  3RYI E;  4LGD E;  1UX5 A;  4LF6 T;  5JTG A;  5E79 E;  1Y01 A;  2BEZ F;  1PFI A;  2CRB A;  4OHF A;  3CX5 D;  1KIL D;  2XJ7 A;  3QUJ A;  1GMJ A;  2YKS A;  1OED E;  2J1D G;  4HE8 A;  2WP9 A;  1JTH B;  4IE0 A;  2AEM A;  3CX5 E;  5FKY A;  3MUD A;  2SPZ A;  1HG5 A;  3RPU A;  3AE5 C;  1KQS O;  3C4Z A;  2MAW A;  4HTE A;  1HG2 A;  1OIP A;  1VQ5 P;  1RE4 C;  2IFM A;  4BXL A;  4U74 A;  3MD0 A;  3RL0 g;  3PUR A;  2GA1 A;  4H9P C;  3SWF A;  3MK7 C;  1J5W A;  4XFJ A;  5KTB A;  3AED C;  2LR2 A;  2LT3 A;  3PLN A;  2Y48 B;  1PV3 A;  3IBP A;  1BSN A;  4U7Y A;  1VF5 B;  2R3C A;  4GKK T;  2E5T A;  1WCR A;  3EI0 A;  2IBZ I;  2LOP A;  5AQQ B;  2VUR A;  1ZME C;  5LJM A;  4YXD C;  3AEG C;  4ASK A;  1SQB D;  3HKE E;  3IN6 A;  1KC8 Q;  1DH3 A;  3JSV C;  2UUC T;  2K3W A;  2AXD S;  1M90 Q;  2KP8 A;  4HYT B;  3FWN A;  3H32 A;  5HEO A;  2E75 C;  3G6E P;  4PJ0 H;  3L75 J;  3PJA A;  3SFE A;  2Q9Q B;  1Y47 A;  1P84 H;  1IJD B;  3L71 J;  3L70 E;  3SRZ A;  3C8V A;  2IBZ D;  4IHJ E;  3H1I J;  1S2E A;  4YY3 T;  4GKG A;  4DR7 T;  2CLY C;  2CXD A;  3RI5 A;  1YXR A;  2W61 A;  2V7K A;  1D7M A;  2P7J A;  3KV6 A;  2HYN A;  3LBX B;  3MUD C;  5HEU A;  3C50 A;  2PFV A;  1D0Z A;  2O01 J;  4ZI2 D;  4UB6 E;  2UXC T;  3H1L G;  2YO3 A;  3G3Z A;  1AQT A;  2WMO A;  2GUS A;  3T1H T;  1FDO A;  1NU1 D;  2XZE A;  1HVV A;  1DX7 A;  2MKV A;  2W63 A;  5L2L A;  3RGU A;  4HWI B;  1NKN A;  3H1L D;  2W2U A;  4HFH A;  3AEF A;  5E0O A;  2W90 A;  1UCU A;  5HCM A;  3E1R A;  2XKM A;  3Q3D A;  2WS3 A;  3E0Z A;  3CD6 P;  4L5G A;  3L72 G;  2B76 A;  3L72 E;  1EDK A;  5F3J A;  1SE7 A;  1NGM B;  1ZP0 A;  4GIW A;  1SQB E;  1VQ8 P;  2H7H A;  4ILC A;  2A45 I;  3LSV A;  5KLI C;  1VQK P;  2P9B A;  5HXR A;  1SQV G;  1WYC A;  2WDV A;  3OPC A;  1X79 B;  4E7Z A;  4EI2 A;  4QHO A;  4AKL A;  4HFV A;  2YMK A;  3VN0 A;  2FJB A;  3PJA J;  5AQV B;  5FNV E;  4BJN A;  4ZEY A;  4WYV A;  2YOE A;  5KX5 E;  4UB8 H;  5L3E B;  3ZMV B;  3B57 A;  3AA7 B;  2XM1 A;  3EVY A;  2CCQ A;  5KXJ A;  3UU4 A;  1CI6 A;  4DCK A;  2XNX A;  3V4Q A;  4HWH A;  4ASW A;  4NXM T;  1N36 T;  1SQB G;  3KVA A;  3ESL A;  2C9L Y;  2JQH A;  5APV A;  1JO5 A;  1VQN P;  1UX4 A;  1IK9 A;  4L9I A;  2K3R A;  3RIU A;  3MIW A;  4CPG A;  2N9Y B;  5AVX B;  4I55 E;  4ILA A;  3L70 D;  3PUS A;  1SQV K;  2M3B A;  2UXB T;  1QL2 A;  1GW3 A;  4MFR A;  2JEE A;  3G71 P;  3G06 A;  4UEM A;  1H89 A;  2KZJ A;  3H25 A;  4O8S A;  4AKR B;  2XSB A;  4JI1 T;  3A5T A;  2HN2 A;  1T2K C;  1L0N E;  4I1L A;  4KX6 A;  4JI8 T;  5C8Y E;  1SP4 A;  1K8A Q;  5AW3 B;  1FZC A;  1OVV A;  2OYI B;  3BAS A;  2YKO A;  2BG9 A;  1EC5 A;  1KB9 H;  2K24 A;  3E7K A;  1OX3 A;  2CE7 A;  3FXD B;  2FBW A;  5LXT E;  4IDP A;  4WW0 A;  4GOD A;  2OYH C;  2WY2 A;  3B5M A;  4WZX A;  3IF4 A;  1P84 D;  2I59 A;  4JI7 T;  5FY0 A;  1YIJ P;  2A3D A;  3MKD A;  2XPK A;  4AKG A;  2HFE D;  2JWA A;  3NMD A;  2EHO B;  2JDI H;  4JYB A;  5AVU B;  4AYC A;  2A06 D;  4H0L C;  5H2F E;  5L8R J;  2A72 A;  3Q9D A;  2YMY A;  2J62 A;  3RKG A;  2K88 A;  2L5G B;  2KND A;  3D0T A;  4RO0 A;  5EK4 A;  4H44 D;  4X1Y E;  3OJA A;  2C5K T;  3H3M A;  4EEB A;  5L3B B;  5BR8 T;  4H9Q C;  4DR3 T;  1KIL B;  1RF1 C;  4DR5 T;  4G63 A;  5L3D B;  4JV5 T;  3HL6 A;  2Q6Q A;  1M7K A;  3BCC E;  2Y0D A;  1HJ0 A;  1GD2 E;  3H1H E;  1JMB A;  1OED C;  3FZM B;  5ABF A;  1IFD A;  3RQW A;  3JAF A;  4C91 A;  3EQ2 A;  2RP4 A;  4JI3 T;  1EQ7 A;  3WU2 H;  1FZC C;  1S9K D;  3MHV A;  1L0L G;  2CEA A;  2E74 D;  2JQ9 A;  2CPS A;  2HHH T;  2PFX A;  2LXB A;  3H1J D;  3CCV P;  1D1B A;  1YKH B;  4AIU A;  1URQ A;  1SQV J;  5AQN B;  4TNW A;  1LJ2 A;  4O2B E;  1PL5 A;  4X64 T;  2YDQ A;  2OLT A;  1L0N D;  2WCA A;  4BWN A;  3HUS A;  1W9R A;  2W66 A;  3L72 J;  5LYJ E;  1FOS E;  5AQH B;  4UB8 E;  1FE6 A;  3H1J J;  5CBN A;  1L0L J;  4WBN E;  3QK6 A;  2E9X A;  1EZV G;  3V2Q A;  3K3Q C;  1IBM T;  3T97 B;  4KHX A;  3RH3 A;  3Q5E A;  3H1I D;  3FZL B;  1HNZ T;  1SQP K;  3M0D C;  3ZKR A;  3OA7 A;  3AB3 B;  4JLE A;  3OAK A;  1U5P A;  1MFT A;  2V7I A;  2NWB A;  1MMD A;  2C0W A;  2XDJ A;  1PGO A;  5LG3 A;  1GDT A;  1VQ6 P;  3F31 A;  1BCC J;  2O1K A;  4AXP A;  5C2T A;  1TU3 F;  2DI4 A;  4XA4 A;  4PK4 A;  4YLH A;  3CWZ B;  3HRN A;  4DOJ A;  2PG8 A;  2V6X A;  2L9Q A;  3HE5 A;  3FGA D;  5C39 A;  1LWU C;  4WB4 A;  2ZYG A;  1MIY A;  4LFC T;  4KUM B;  1KYO H;  1AV1 A;  3FHN A;  3RF1 A;  2JQQ A;  3A0B H;  3CCE P;  3PU8 A;  4BRY B;  3L71 G;  3CCJ P;  1GK4 A;  3H1I G;  3IR9 A;  1SQP G;  1OW8 A;  4YHJ A;  1BGY D;  1SQX E;  1PGJ A;  1LT1 A;  3VYI A;  3I9Y A;  3P8C D;  2OQQ A;  2QE7 H;  1NTK D;  3S4R A;  5L3F B;  4ZOL E;  4COF A;  2DNX A;  1QVG O;  1CI6 B;  1FZC B;  4DV2 T;  1L4A B;  1NOH A;  3H1L E;  2J5U A;  1NAY A;  4BA9 A;  1FJG T;  5HWX A;  2B89 A;  2WPV B;  4KT0 J;  2Y9Y A;  1ZRT D;  1L4A D;  1SQB K;  5JDG A;  1IAP A;  2BBH A;  3LK2 B;  2W8Z A;  4CI1 B;  1SFC B;  4AUW A;  2CHO A;  5H2F H;  2BCC D;  5E79 H;  4W7Z A;  4IL9 A;  5AW9 B;  4DJG A;  1UK5 A;  4PV1 C;  2XQY A;  2L3L A;  5AQU B;  1L0N K;  1S3J A;  3JAE A;  1U57 A;  4EYY R;  2WT7 B;  3PUG A;  4N3Y B;  1HTL C;  4X20 E;  2O1J A;  1M1J B;  5BMV E;  1S5L H;  4NXN T;  1HFA A;  2WWW A;  3ETU A;  3C51 A;  3CQC B;  3AEA A;  2YU2 A;  2NPS B;  1NTZ D;  3EDV A;  2WPS A;  2EHO C;  5K5G B;  3PUZ F;  4DBR A;  4JEU B;  2WBL A;  1WR6 A;  2HR3 A;  5KAF E;  3O9X A;  1SQV E;  1XMO T;  2UWJ E;  2IIU A;  2D0T A;  2OYH B;  4C90 A;  2OTK E;  3AE3 C;  3A7O A;  4DR2 T;  4KHP T;  2N1T C;  3ZJ2 A;  4O4J E;  3L39 A;  2LKH A;  1ZRT E;  1SFC C;  3OBV E;  4GIF A;  5HEH A;  4Z90 A;  3E1I A;  4RKU J;  3K8P C;  4DR6 T;  2ZM6 T;  3OYX A;  3ZT6 A;  1FJP A;  1S94 A;  2X51 A;  1M56 D;  1OED A;  3USS A;  4FJO A;  2N1T D;  1BCC D;  3C4W A;  2KOG A;  2B87 A;  2XAS B;  3MZK B;  1KYO I;  2AXC A;  2I1K A;  4DV0 T;  2YXR B;  2OTJ P;  5FL0 A;  4DR1 T;  4IGU A;  5HCJ A;  2XQ3 A;  4CI2 B;  3RBZ A;  4TX5 A;  3O4X E;  1MNE A;  1FEW A;  3RBX A;  3P32 A;  3TYY A;  4I43 B;  3GMI A;  1DIP A;  2W27 A;  4PD4 E;  1HGZ A;  3A7M A;  4ILU A;  3VRB A;  4UVB B;  4HKA A;  1YIT P;  4Z1M H;  5GTH H;  1HGV A;  4GOF A;  4YT0 A;  3UFE A;  4OWF A;  4D6T E;  2M8R A;  3AE8 A;  4ZZB A;  4HFB A;  3L75 G;  1OW7 A;  4KHZ F;  4PFP A;  3BCC G;  1BGY E;  3E22 E;  1VPC A;  2H88 C;  3VU7 H;  4WY4 A;  2IZ0 A;  1KFY A;  2UXN B;  4PJN A;  2VKO A;  3ZYK A;  1HX1 B;  1XTG B;  1RY3 A;  3S9O A;  1T2K D;  1K04 A;  3AE6 C;  1JY2 P;  3DJB A;  5AQI B;  4YSY A;  1QUU A;  4K3A A;  2LRL A;  2NR4 A;  4L75 A;  3LK4 2;  3UT5 E;  5AVV B;  1MMG A;  5LHI B;  1U7J A;  1YHQ P;  1EXI A;  4IOI H;  3WAJ A;  4ILB A;  4YSX A;  1PIX A;  3OW2 O;  3CMA P;  2ZXE B;  3OTO T;  1FJK A;  1LP1 B;  2B9B A;  1KQG B;  3H1J E;  3PHL A;  2MPK A;  2DWK A;  1P84 E;  2KXP B;  1KEY A;  2CPB A;  4U3C A;  4C7R A;  3RYF E;  5APW A;  5AQF B;  2XQ9 A;  5AW0 B;  3EWK A;  1FDM A;  3AE7 A;  2N2N A;  3UUX B;  3Q5W A;  2LM2 A;  1S9K E;  2LE8 A;  1HF9 A;  2JQK A;  4QH5 A;  3M0A A;  2CLY B;  1N7S B;  1ZKE A;  3UFG A;  3ABV A;  3QOF A;  3RK3 E;  3PTZ A;  1K73 Q;  1LTA C;  2C0S A;  3Q5R A;  4DZO A;  1YJ9 P;  3SFE C;  5AQG B;  3CCS P;  1WMK A;  1LGH B;  4K35 A;  3D70 A;  1KIL C;  1KOR A; 
#chains in the Genus database with same CATH homology
 2V7K A;  2P7J A;  4PK5 A;  3KV6 A;  2HYN A;  2LKM A;  2OYH A;  3L09 A;  3LBX B;  2WT7 A;  4H9R C;  5FMN A;  5A1L A;  5JDL A;  1IJ5 A;  4UVA B;  3C50 A;  4WBA A;  2X9H A;  2PFV A;  2E43 A;  1D0Z A;  1YTZ I;  3C9I A;  2OAR A;  4IE4 A;  2V1D B;  4UVC B;  4ZI2 D;  1KNZ A;  2IC6 A;  3HTK B;  1MUU A;  4O9B A;  1FIO A;  4P0A A;  2YO3 A;  3G3Z A;  1MV8 A;  5AVW B;  3GN5 A;  4QX8 B;  2POH A;  3J7Y q;  3V5S A;  2NW7 A;  2WMO A;  2GUS A;  3N2G E;  5HAX A;  4BAY B;  4BJN A;  3CI9 A;  1HVV A;  2KZ7 B;  3FBZ A;  4ZS2 A;  1DX7 A;  2DHR A;  5DQW A;  2W63 A;  3FB2 A;  3FXE B;  5L2L A;  1HWT C;  1JY2 N;  3CL3 D;  3EDU A;  1NKN A;  2W6A A;  5AVQ B;  1N7S A;  4JEH B;  3M9H A;  5E0O A;  1UCU A;  1N7S C;  3HE5 B;  2LOS A;  2LSJ A;  2YK0 A;  5AVR B;  1BR2 A;  3KPE A;  2XHE B;  2XKM A;  3IF8 B;  5CCH C;  2C0X A;  1WLX A;  4I4T E;  3E0Z A;  4MBQ A;  3HR0 A;  4L5G A;  5FY1 A;  4ISS A;  3ZC0 A;  1SQQ K;  5APU A;  5F3J A;  1HJB A;  1A02 F;  2MJZ A;  3WAK A;  2R5B A;  3B8E B;  4GIW A;  2OYI A;  2H7H A;  5APT A;  3BAT A;  2A45 I;  1BR1 A;  1SA0 E;  2E9X D;  3B5N A;  3LW5 H;  5AW4 B;  3V2P A;  3CQX C;  2X68 A;  2P9B A;  5HXR A;  3II6 A;  1WYC A;  5AW5 B;  4E7Z A;  4O2A E;  1X79 B;  4QHO A;  1D0X A;  3VKH A;  4AKL A;  3LFM A;  4HFV A;  3UUM A;  4I6M C;  3VN0 A;  1ZEE A;  2QGS A;  1WRD A;  2LHR A;  4HGA A;  4J2C A;  3I1A A;  1FU1 A;  4PAG A;  5FNV E;  5FXW A;  2Z5H A;  3M91 A;  1V9D A;  2CA5 A;  2IW5 B;  3VMY A;  3ZMV B;  2VAS A;  4EIW A;  1J1D B;  5KX5 E;  1LKX A;  5L3E B;  2H7V C;  4XE5 B;  3AA7 B;  3B57 A;  2CCQ A;  3EVY A;  2I1J A;  5CMZ A;  4ERR A;  5JH7 E;  1CI6 A;  1N7L A;  2IC9 A;  3O1I A;  2XNX A;  1KFN A;  4XBF B;  3V4Q A;  3V2R A;  3BRV B;  1HUC A;  3AA1 B;  3CKD A;  3KVA A;  3MGN A;  3HTK A;  2C9L Y;  2ES0 A;  3ESL A;  1MFZ A;  5APV A;  4HN9 A;  1JO5 A;  5IHY A;  1ZR2 A;  5LGU B;  1UX4 A;  2CWO A;  1IK9 A;  5FP3 A;  3NRY A;  4L9I A;  5H6R B;  5JVD E;  2KYV A;  2N9B A;  1H8A A;  3VOP A;  3MIW A;  3PDY A;  4PJL A;  1SFC A;  5AVX B;  4I55 E;  2DWG A;  4FI5 A;  3Q2M A;  1D1C A;  5FXX A;  3QC9 A;  1G2C B;  1KK7 A;  2ACX A;  4PW8 A;  3KBT A;  4OFZ A;  3PUS A;  1FZG A;  1SQV K;  4WY4 D;  2M3B A;  2PP6 A;  1QL2 A;  2Z6E A;  4MHC A;  2WMN A;  1GW3 A;  1FZA A;  4N78 D;  1MZ9 A;  2FFD B;  1FOS F;  2KMF A;  4MFR A;  4XZC A;  4DND A;  2JEE A;  2IAK A;  2KWH A;  1RF0 C;  3K3O A;  4UEM A;  1H89 A;  2BAS A;  2VKD A;  3RL0 D;  2NOX A;  3N9N A;  2NW9 A;  4DMV A;  1JY3 O;  1N73 A;  4O8S A;  2FFD C;  4AKR B;  2WZ7 A;  2Q9I A;  5JRE A;  3ETV A;  4JUY A;  4HH2 A;  3CLQ A;  3A5T A;  2L8K A;  2V26 A;  2W62 A;  1T2K C;  4I1L A;  3C4X A;  3HKC E;  3NZQ A;  3B5N D;  3R2P A;  4P09 A;  1JOC A;  1SP4 A;  2BVM A;  5AW3 B;  4AQF A;  4AQF C;  4MAL A;  4DVD A;  4EB6 E;  2WAU A;  1FZC A;  4DO0 A;  4AI6 A;  2N1T B;  2OYI B;  3BQL A;  3BAS A;  2YKO A;  3HD7 A;  3I9W A;  1ZLL A;  5FXV A;  3TNU B;  2K24 A;  3NBX X;  3HI2 A;  2CE7 A;  3B5N C;  2X9Y A;  2XAQ B;  3FXD B;  4GYS A;  5LXT E;  2XAG B;  2IPP A;  5J1G A;  4WW0 A;  4M3L A;  2VK9 A;  2D5U A;  2OYH C;  3M9Q A;  3ZMT B;  1NWQ A;  3OJA B;  2JRK A;  5LA6 E;  5HYA A;  2XAH B;  3BVH A;  2I59 A;  2X66 A;  5JDQ A;  3HKB E;  4IE7 A;  1D0Y A;  4UF0 B;  5FY0 A;  4B86 A;  2H43 A;  3RC8 A;  2P67 A;  2A3D A;  3MKD A;  4AKG A;  2HFE D;  2Q5U A;  1YD8 G;  5KLV K;  3KVB A;  3TKL B;  2NPS A;  3NMD A;  3AA6 B;  2J59 M;  3M9B A;  2EHO B;  1FAV A;  2IX7 C;  4JF7 A;  2XTL A;  4JYB A;  4I2L C;  5AVU B;  4AYC A;  4IFD K;  2WSS V;  1JMM A;  2GK9 A;  1M1J C;  2CXF A;  4X1I E;  5EK3 A;  5HXH A;  2A72 A;  1GL2 B;  1M1J A;  1N73 C;  3Q9D A;  4YJ3 E;  1LT9 C;  4PNI A;  1KZU B;  2YMY A;  3VP9 A;  1LT9 A;  3HD7 D;  3AVS A;  1G2C A;  2VWA A;  4IST A;  1L0L K;  2L5G B;  1E1H B;  2KND A;  3D0T A;  5KMG P;  5EK4 A;  4OYJ A;  4TN7 B;  4X1Y E;  2B1E A;  3OJA A;  2C5K T;  3F57 A;  3W15 B;  4NUU A;  5EZY E;  5L3B B;  1J2J B;  1IZN B;  2UXX B;  3H3A A;  4H9Q C;  3HD7 C;  1KIL B;  4QXC B;  3N9L A;  4X1K E;  3NFQ A;  1RF1 C;  2GUV A;  1VRB A;  3N4X A;  1NTZ K;  3VTP C;  2CM0 A;  4G63 A;  5L3D B;  1RE3 C;  1NAF A;  1X9V A;  3ZCJ A;  1VDF A;  2KLQ A;  2E42 A;  3HL6 A;  3CX8 B;  5LOV E;  1T3J A;  3GHG B;  2Q7C A;  3HKD E;  4GYR A;  4K0U A;  1H88 A;  4M1P A;  3ZC1 A;  1GD2 E;  5HXC A;  3OKQ A;  1GTW A;  1OWA A;  1MMN A;  2H3R A;  2SPC A;  3MA9 A;  1IFD A;  4RES B;  2FFD A;  1QSD A;  3P8M C;  1IO4 A;  3EUH A;  3LG7 A;  5BVZ A;  2VKJ A;  4UIG A;  4XAX B;  3RL0 C;  3EQ2 A;  4C91 A;  4UXN B;  3M0D A;  4EOT A;  1SFC D;  1NTM K;  2W6B A;  1IFJ A;  1EQ7 A;  2RP4 A;  1AFO A;  3KYQ A;  1S9K D;  1FZC C;  3L37 A;  5JDF A;  2JJ9 A;  4NUV A;  1OXZ A;  2CMR A;  2J58 A;  2CEA A;  1NO4 A;  1MND A;  1NWM X;  2ZM8 A;  3GN5 B;  5APQ A;  2CPS A;  1NKZ B;  1NHL A;  3V2N A;  2FXM A;  4WY4 C;  4L0R A;  1URQ D;  1LTJ A;  2LSY A;  1FZF A;  3B13 A;  5TAO A;  5KJ7 C;  3CQG B;  3U1A A;  5H6Q B;  1D1B A;  5LGT B;  3DTO A;  5KJ7 A;  1YKH B;  3F2E A;  3KV4 A;  2VKH A;  1URQ A;  5EK2 A;  1GL2 A;  3RL0 B;  1U4Q A;  1FZB A;  4JYC A;  3RK3 C;  2LJL A;  2N9D A;  4O2B E;  5DQV A;  3U3I A;  4E7S A;  3RC3 A;  3L3P A;  3KQG A;  3ZMZ B;  2YNY A;  1IC2 A;  1KQL A;  2NTX A;  4MLK A;  3RK2 D;  1Z56 A;  4ZS3 A;  3H37 A;  3HUS A;  5CHX A;  2YU1 A;  1L4A A;  3IFM A;  2WPR A;  3ZCI A;  3EFG A;  5LYJ E;  1L4A C;  1FBM A;  1FOS E;  4PJJ A;  2WSE H;  5AVZ B;  5FYM A;  3RYC E;  1FMW A;  5LP6 E;  1GU5 A;  3RYH E;  4WBN E;  3QK6 A;  2E9X A;  3V2Q A;  4N6J A;  3K3Q C;  4F6R C;  5AVS B;  4KHX A;  3RH3 A;  3N9O A;  2EHO D;  5GON E;  3V5B A;  3KDP B;  5HXS A;  1SQP K;  3RK2 C;  3M0D C;  5AVT B;  1Z0P A;  5AW1 B;  1HF8 A;  4IE6 A;  5LHH B;  4EZH A;  4CXY A;  3GHG A;  2PJQ A;  4AKI A;  1JTH A;  3OA7 A;  3SS1 A;  2DLR A;  1JCD A;  3AB3 B;  3KFW X;  3NRX A;  5APS A;  3OAK A;  1IFI A;  4IFF A;  4JLE A;  1U5P A;  4PFO A;  4QWN B;  2O01 H;  2V7I A;  1A02 J;  1N7S D;  3M06 A;  1MMD A;  2NWB A;  2C0W A;  2XDJ A;  4O4I E;  5CCH D;  1GDT A;  2HPL A;  2CWY A;  2M67 A;  2NW8 A;  1RE4 A;  1LTS C;  3F31 A;  2O1K A;  2HLO A;  2VB6 A;  3JC6 C;  4AXP A;  4EZ4 A;  2H7O A;  2DI4 A;  4XA4 A;  1D1A A;  2DCF A;  3PUA A;  4PK4 A;  3CWZ B;  1W2E A;  4GK5 E;  4YLH A;  3HRN A;  4DOJ A;  2PG8 A;  1LVF A;  3KDS E;  3ZN0 B;  1LWU A;  1SLQ A;  1X8Y A;  3HE5 A;  5AW7 B;  2L9Q A;  2V7L A;  1LWU C;  4WB4 A;  1IFM A;  3T97 A;  4H63 V;  3J9X 1;  5JRC B;  1MIY A;  4PK6 A;  2ZFC A;  3ZMS B;  4KUM B;  1URQ B;  3FHN A;  3LK3 B;  3ZLI A;  2JQQ A;  3PU8 A;  4KMC A;  4BJM A;  1GK4 A;  2KT9 A;  2LSK A;  4Y99 B;  5AW8 B;  1JNM A;  2WM9 A;  3IR9 A;  4CXX A;  1LTT C;  4YHJ A;  2ZM2 A;  4EYY R;  3C64 A;  2K5B B;  1X79 A;  3GWH A;  2KB7 P;  2QM8 A;  3ZEF B;  3PTR B;  1LTJ C;  3R84 B;  5J2U E;  2LEH A;  4CXW A;  2GM4 A;  2ZMA A;  3VYI A;  3L35 A;  4H9S E;  4ZKU A;  3I9Y A;  3RRC A;  3ZYL A;  3P8C D;  2N1T A;  1QL1 A;  4WNK A;  2A45 H;  2R32 A;  4UV8 B;  5CCG A;  1FMV A;  2VL8 A;  4V1A v;  4ZOL E;  5L3F B;  2N1G A;  1M7L A;  1ZHC A;  4QKN A;  1HS7 A;  2DNX A;  3Q5X A;  4B6X A;  2KIN B;  3CX7 B;  1CI6 B;  2XUE A;  4I50 E;  1IFN A;  3VP8 A;  1B7T A;  1YKE B;  1FZC B;  3N9P A;  1L4A B;  1NOH A;  4H9O C;  3T8O A;  2FKW B;  3RK3 D;  4BA9 A;  2EHO A;  3KV5 A;  3V5U A;  3SOL A;  4GT1 A;  2WSC H;  1LTI C;  5HWX A;  3LID A;  2YKP A;  4TUY E;  1GK6 A;  3RK3 B;  3I0O A;  4IDZ A;  3ZJ1 A;  5JDG A;  1L4A D;  1SQB K;  1IAP A;  2XAJ B;  5AFU L;  4C7N B;  4TZ4 C;  3KIN B;  3LK2 B;  4CI1 B;  2BDE A;  1SFC B;  3NXS A;  4AUW A;  3TNU A;  3BK9 A;  3GHG C;  1GZL A;  3O1H A;  2MYS A;  2VRS A;  5J2T E;  3HD7 B;  3P7K A;  4W7Z A;  2WTY A;  3MJX A;  5JR9 B;  2MTQ A;  1G1I A;  1GL2 D;  1LTB C;  5AW9 B;  5IYZ E;  1Y64 B;  5KJ7 D;  2XQY A;  2L3L A;  2Y6X A;  3A3Y B;  1CZQ A;  4LLH A;  1RF1 A;  2JJL A;  1L0N K;  1YW0 A;  1T3U A;  3U59 A;  4EIJ A;  2YIN A;  3IHR A;  1RE3 A;  2XU6 A;  2E9X B;  2WT7 B;  2Q9Q D;  2W00 A;  5LCY A;  2KWI B;  3PUG A;  1LRZ A;  4N3Y B;  2ODU A;  4ZI3 D;  4OH8 B;  1HTL C;  2Z4E A;  2O1J A;  1N73 B;  1GW4 A;  2WSF H;  3U1C A;  1AQ5 A;  1CW5 A;  1EZ3 A;  1MIV A;  1M1J B;  3JC6 D;  4EXT A;  1RF0 A;  3I0Q A;  3IEE A;  2H8P D;  5BMV E;  4W80 A;  1O3X A;  2CXL A;  1LT9 B;  1HFA A;  3FBL A;  3MTU E;  2WWW A;  5APX A;  1GL2 C;  5BU8 B;  3ETU A;  5KDM C;  1YYC A;  4KBM B;  3VMZ A;  3C51 A;  5AVY B;  1ZR4 A;  3GA8 A;  3KV9 A;  3N5L A;  2V7M A;  4TV8 E;  3CQC B;  3N2K E;  5LG4 A;  2YU2 A;  2NPS B;  3WI3 A;  3N9Q A;  4ZKP A;  3EDV A;  2WPS A;  2PBI A;  4OYK A;  3BRT B;  1E5W A;  2EHO C;  5C8Y E;  4HEA A;  1JY3 P;  3NTN A;  4IE5 A;  1JCC A;  2FYU K;  3UTK A;  4UF0 A;  5JDN A;  5M4Y A;  4DBR A;  4JEU B;  1SQX K;  2WBL A;  5CA0 E;  3PUQ A;  4TV9 E;  4PJM A;  2E9X C;  1WT6 A;  1RF1 B;  3N9M A;  3K3N A;  1WR6 A;  2E8I A;  3O9X A;  3OYZ A;  1KIL A;  3B5N B;  2D0T A;  2OYH B;  2YKQ A;  3LBX A;  1SHZ C;  4G2A A;  4X20 E;  1CSB A;  3BQK A;  3P7I A;  4ZI7 E;  2LHN A;  4AQG A;  3DP7 A;  3A7O A;  2HG5 D;  4U72 A;  1HBW A;  4KP3 C;  4QXB B;  2N1T C;  3RKO A;  3ZJ2 A;  5CJ4 A;  3L36 A;  1NTK K;  1BR4 A;  2JMK A;  4O4J E;  3OBV E;  1SFC C;  1LVK A;  3AAE B;  3E08 A;  5CB4 E;  2MBG A;  3ZPO A;  4GIF A;  2NPS C;  2ZM0 A;  4EYU A;  4C7N A;  4AKH A;  5AW6 B;  2LSG A;  3NZP A;  4CI3 B;  4C90 A;  3ONX A;  1CUN A;  3E1I A;  2C5I T;  3AA0 B;  3K8P C;  2HPJ A;  4QX7 B;  1AJ3 A;  1KFM A;  2YO2 A;  4YFS A;  3OYX A;  2MOZ A;  1WRG A;  3LIE A;  1FJP A;  1S94 A;  2X51 A;  3M65 A;  1JY3 N;  3RRW A;  2HPC B;  2C9N Y;  3MAC A;  5L3G B;  4FJO A;  2N1T D;  4AQR D;  3CX6 B;  5JDM A;  3C4W A;  3O1J A;  4O4H E;  1G1J A;  4IFM A;  2LSI A;  3HA4 A;  2KOG A;  2XAS B;  3A5X A;  3LJC A;  3U78 A;  4H9N C;  3MZK B;  2NPS D;  2I1K A;  3AAI A;  1IJ6 A;  5DAB A;  4OK0 A;  5CA1 E;  2P2U A;  1G73 A;  4DMW A;  3HE4 A;  1HTJ F;  4IGU A;  4CI2 B;  1LTJ B;  3N7N A;  4EOZ B;  4YJ2 E;  3L4F A;  3MXZ A;  2V7J A;  4TX5 A;  5JR9 A;  2OYI C;  2W0G A;  1ZV8 A;  3O4X E;  1MNE A;  5JR9 C;  2HOD B;  1FEW A;  5APY A;  5BU5 A;  3A2A A;  1JUN A;  3P32 A;  4CQI A;  4ZI2 C;  1ZN5 A;  2Z5I A;  3TYY A;  4I43 B;  1N86 A;  2K9A A;  1T8Z A;  1MIW A;  4ANJ A;  3HUS B;  3GMI A;  2Q3I A;  2W27 A;  4O4L E;  2RA1 A;  1HGZ A;  1XTC C;  5CCG C;  1URQ C;  3VMX A;  4ILU A;  5HWY A;  2C5J A;  2Q9Q A;  4QXH B;  4UVB B;  3R6N A;  4ADZ A;  4DBQ A;  1LTG C;  4HKA A;  5LHG B;  1J1D C;  3CML A;  2JMH A;  3RYI E;  4LGD E;  1HGV A;  3H32 B;  1UX5 A;  1ZV4 X;  2BZB A;  2HPC A;  2CLY C;  5CCH A;  2Y8D A;  3UFE A;  5F8P A;  2PAJ A;  4GOU A;  3PP5 A;  5ETW A;  1HCI A;  2M8R A;  1PFI A;  2A45 G;  2A2F X;  4OHF A;  2K48 A;  1KIL D;  3UUL A;  3O8Z A;  3S4U A;  5DJQ C;  2ZLY A;  2XV5 A;  1T98 A;  4PFP A;  3QUJ A;  3I5C A;  4GK0 E;  2HOD A;  1H7C A;  3E22 E;  1VPC A;  4UEL A;  1GU4 A;  2J1D G;  3H6P A;  4WY4 A;  4HE8 A;  2UXN B;  3ANW A;  4PJN A;  2VKO A;  3VU7 H;  3ZYK A;  2D2S A;  1JTH B;  2YEV C;  1G8X A;  4Y99 C;  3BQI A;  4IE0 A;  3PU3 A;  3MUD A;  1XTG B;  4ZHQ E;  5L3C B;  2P1J A;  1HG5 A;  1RY3 A;  1T2K D;  2NP9 A;  4ZI3 C;  3RPU A;  1JY2 P;  4UV9 B;  3VKG A;  3DJB A;  2QA7 A;  3WMM 0;  1QUU A;  1JY2 O;  3C4Z A;  4WBO A;  4HTE A;  4A56 A;  1HH0 A;  3LK4 2;  3UT5 E;  2IFN A;  5AVV B;  1HG2 A;  1MMG A;  5JQG E;  2XAF B;  2FYZ A;  1VOM A;  1RE4 C;  5JRC A;  1YTZ T;  2IFM A;  5CJ0 A;  1NU1 K;  4U74 A;  5FY7 A;  3ZN1 B;  3MD0 A;  5LHI B;  3PUR A;  1MMA A;  2X67 A;  4H9P C;  5LJN A;  3SWF A;  2G0U A;  3WAJ A;  2XZR A;  1LWU B;  3UIA A;  3MK7 C;  1HX8 A;  5KTB A;  3VHL A;  1BR0 A;  3PE0 A;  2X9X A;  2LT3 A;  3CPZ A;  2Y48 B;  3IBP A;  2ZXE B;  1FJK A;  2R3C A;  5AW2 B;  3V4W A;  2D0U A;  4H63 H;  3CVR A;  4CZZ B;  2NTY A;  3AAA B;  3HE4 B;  2LOP A;  2DWK A;  2ODV A;  5LGN B;  4Z8X A;  2JPF A;  2X9W A;  2KXP B;  1FZE A;  4LC1 A;  3RX6 A;  2CPB A;  3SWY A;  4C7R A;  3RYF E;  5APW A;  2HH7 A;  4IIJ E;  2KLV A;  3UUN A;  5AW0 B;  5LJM A;  2WWU A;  1DEB A;  2R5D A;  1FDM A;  3ANW B;  2N2N A;  3RK2 B;  3C98 B;  3KBU A;  3UUX B;  3Q5W A;  2X0L B;  3HKE E;  4ASK A;  4EAH A;  5HXE A;  4P0B A;  1S9K E;  2LE8 A;  3M0A A;  2BVL A;  3ZYM A;  1S35 A;  4W7Y A;  1J1E C;  1DH3 A;  1N7S B;  2CLY B;  2LM9 A;  5LBQ B;  1WYB A;  5JDH A;  1ZKE A;  3ZMU B;  2Q9Q C;  2KP8 A;  4HYT B;  3TSI A;  2OA5 A;  3SWH A;  3H32 A;  1US7 B;  5CCG D;  1LTA C;  3HUS C;  4N78 E;  2C0S A;  5ADX L;  1N2D C;  4DZO A;  2Q9Q B;  1IJD B;  3AVR A;  3SRZ A;  5LBM A;  3N2O A;  2KSJ A;  4C46 A;  3P8C E;  4IHJ E;  1NH4 A;  2WPQ A;  5FXZ A;  1SVF A;  5LNK A;  1LGH B;  4GKG A;  2WIT A;  4WY4 B;  1J1E B;  2CXD A;  2QM7 A;  1KIL C;  3TK1 A;  2W61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...