1NAFA

Crystal structure of the human gga1 gat domain
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
129
structure length
124
Chain Sequence
DEEKSKMLARLLKSSHPEDLRAANKLIKEMVQEDQKRMEKISKRVNAIEEVNNNVKLLTEMVMSHSQGSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEILQANDNLTQVINLYKQLVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADP-ribosylation factor binding protein GGA1
publication title The Structure of the GGA1-GAT Domain Reveals the Molecular Basis for ARF Binding and Membrane Association of GGAs
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein, membrane protein
total genus 37
structure length 124
sequence length 129
ec nomenclature
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03127 GAT GAT domain
A PF18308 GGA_N-GAT GGA N-GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1nafA01
1.20.58.160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1nafA02
2JJLA 3A7OA 3MD0A 5AW3B 5AW8B 4XE5B 3IR9A 5APTA 1JNMA 1CSBA 3V5BA 3HE5B 3M0DA 2XU6A 2BASA 4B86A 2WWWA 3T97A 1GZLA 3B8EB 1YD8G 5AVVB 1FOSE 2ZFCA 2Z5HA 1GU4A 1IO4A 5APUA 4AUWA 3UIAA 2WTYA 3L36A 1NWQA 3VMXA 4KHXA 2YO2A 4GKGA 2Q5UA 1YYCA 2QM8A 2YO3A 5AVSB 3VN0A 1MFZA 2WT7A 1HWTC 3A2AA 1H89A 1OWAA 5AVXB 3HTKA 1MV8A 4C7NA 1GK6A 2H7HA 1SLQA 5AVYB 1NWMX 2N9BA 4AQRD 3L37A 2Q7CA 2E42A 5AW4B 1CI6B 5APYA 3P7KA 3P32A 3M0AA 5AW1B 3KDPB 5AVRB 3HE4B 3A5TA 3NTNA 5APWA 1JUNA 2VRSA 3TK1A 4HYTB 2C9LY 2XZRA 1WRDA 1GK4A 3MGNA 2YNYA 3VMZA 3O8ZA 2R5DA 2P2UA 1A02F 5AVUB 3HE5A 2IPPA 2W6AA 1OXZA 3NMDA 5APXA 5AW6B 1O3XA 2W27A 3TNUB 1NAFA 1KQLA 3NXSA 1X8YA 2P67A 5AW7B 5AVWB 3KQGA 5AW2B 1GD2E 3L35A 2R3CA 3M9BA 1MUUA 3M06A 4RESB 2WPRA 5AVZB 2XV5A 4GT1A 5APQA 3M91A 1GTWA 5AW9B 1T2KD 2N9DA 5AW0B 4I6MC 3P8MC 1DH3A 1WR6A 5AW5B 3SWFA 5AVQB 3VTPC 1S9KD 4DZOA 1CI6A 1HJBA 2KP8A 1H8AA 3VYIA 1G2CB 1HBWA 3HE4A 3LIDA 5CMZA 2C9NY 1J2JB 2WT7B 2E43A 5AVTB 2R5BA 4LC1A 2Q3IA 2WPQA 4C7NB 3M9HA 1FOSF 1H88A 5APSA 2R32A 4EOTA 4C46A 4AYCA 4M3LA 2QM7A 2WPSA 3VMYA 1FAVA 3NFQA 1HUCA 1X79A 3V4QA 2ZXEB 3TYYA 2P7JA 1T2KC 3A3YB 5APVA 4JYBA 1CZQA 1GU5A 2Z5IA 2N2NA 1S9KE 3V4WA 3TNUA 1A02J 3OAKA 4I2LC 1SP4A 4JYCA 3I5CA 3LIEA
chains in the Genus database with same CATH superfamily
2LOPA 3CQCB 3AE8A 5H2FE 3O1JA 2VKOA 2W6JH 4IE5A 3S9OA 2KSJA 3KV4A 3Q5EA 3Q2YA 1BGYE 1LWUA 4U3FE 3B8EB 3CK6A 3JCFA 2WSCH 2PRRA 1BR0A 2GA1A 1VQNP 4UVCB 1JMBA 3PUQA 4ISSA 1G2CA 4GK0E 2YO2A 4GKGA 2LEHA 4UF0B 4TWDA 3AA7B 2XQ5A 1W5CE 1R8IA 1HWTC 3FGAD 3E1IA 2IDOB 3H1HJ 3EAMA 2HHHT 2A45H 3CPWO 1YI2P 4ERRA 5JH7E 1Q82Q 2V7JA 4IL6H 4ANJA 3NRXA 5FL1A 2WDRA 4NPFX 1OEDE 1LVKA 5AW4B 2YDSA 4B6XA 3P50A 1FZGA 3KINB 2N1TC 2CPSA 4DV6T 1GL2A 3RHWA 2WDQA 4EB6E 2C5KT 2H89C 2E76B 1X79B 1JNRA 5HEHA 5HAXA 2Q6QA 3VKHA 1A02F 2D2CB 2FYUE 1H7CA 1T8BA 2KIKA 1N7LA 1L2PA 2IDBA 4U74A 1ZEEA 2X9XA 2ZT9C 2X66A 3B57A 1NTZE 3L75J 2WITA 1KN7A 5AW7B 2BS4A 1XTGB 5FY0A 1IJ6A 1BR2A 1JM0A 4UVAB 4PD4E 5AVZB 1N7SD 1FJPA 4YXDA 1J1JA 2GUVA 3GN5B 2KNCB 1T2KD 2RKLA 3HD7D 2V26A 1ZP0A 4HFHA 2Y48B 5KX5E 3PTRB 1YQ4C 2XASB 4ASVA 3ANWB 4OGQD 1HCIA 4I7ZB 2K1AA 4DCKA 1S9KD 3NBXX 4Z90A 5KLIC 5KLVK 3SRZA 5LB7B 2JQHA 1AJ3A 4IFFA 3SFDC 3RRWA 1KYOH 5GTIH 1US7B 2CMRA 1QLBA 2KLUA 4LC1A 1GMJA 2WSEH 1H88A 4LLHA 2PGDA 1PPJD 3TLUA 2WQYC 1KQFB 2K9JB 1D1CA 3L8RA 4OFZA 4B3RT 1RE3A 3AE7A 3HI2A 4ZS2A 3BASA 3E08A 1SFCC 3N9NA 2Z5IA 2RP4A 4ZI3C 2UUAT 2Q1KA 4JPZB 4I2LC 1SP4A 3AAAB 2XAHB 1OIPA 3ZCJA 1SQPJ 2KOGA 4WVZA 4WY4D 3CX5D 2LKGA 3ONXA 4DR5T 1E2AA 2NZ2A 3ZYLA 2Z4EA 4O4LE 1ZRTD 4HWCA 1J1DC 2YIUC 1W2BO 4NUUA 2J5UA 5DABA 3CCUP 3JC6D 1T6AA 5L8RJ 4DUYT 2MYSA 4I55E 2WT7A 3CMAP 1T3JA 2ITAA 5CCHD 2X9YA 2QJPC 4IE7A 4LF8T 3D70A 2E74C 2N9BA 3WU2E 2HN1A 3GHGC 4UV8B 1NU1J 1VQ4P 5HEUA 5KKZC 4XZCA 2M6BA 3Q2MA 2XNXA 1KEYA 5AW1B 2FFDA 4U72A 2L8KA 3HE4B 4CI3B 3H1LG 3B4SA 1XDPA 1HTLC 3II6A 5J2UE 2QJYC 1HVVA 2WVRA 1SQBJ 3VRAA 1IFIA 2OV9A 3CMEP 5JDFA 3D71A 3AVSA 2ZYGA 4QXBB 1E5WA 3IEEA 3RRCA 3R2PA 2V6YA 1VDFA 3CX5I 5H6QB 2B76A 2W00A 5AQJB 2LHNA 4HFEA 1PGOA 4TWFA 3RX6A 4PJ0E 1HR0T 1KFYA 1GD2E 2C0SA 5J1GA 1SQPE 4GDOA 5LA6E 2XQ8A 1G8XA 1UUSA 2YN6A 2QEXP 3PRJA 5B66E 5AW9B 4WZXA 4EGWA 1BGYG 3T97B 3W67A 5TISH 1JTHA 2BS3A 4PAGA 3K8PC 5DQWA 5BU5A 1P84I 2EHOC 5M1BA 5ETWA 4H13C 3VYIA 5LYJE 3O1IA 3TGUD 3KZIE 3RK2D 2LSGA 2E43A 1YJ9P 5TJHA 3G6EP 5HEOA 2P10A 2V5CA 5JR9B 2WPSA 1NU1E 4IGUA 5GONE 3RGLA 3LK3B 2YMYA 4UB6E 1J1DB 2DWGA 2AXTH 1ZN5A 2CCQA 2YIUB 3QOFA 4KHZF 2NPSA 2RPAA 3AA1B 3ONJA 4IFDK 5FXXA 3GA8A 5L3EB 3NWIA 3C50A 4YTPC 5LGUB 1NGMB 4H9NC 2HPCB 4IDOA 2MKVA 2QJPB 4H0LC 1YHQP 3B5ND 4OVNF 3GHGB 2FYUG 1Y9BA 1ZOYA 3AAIA 5AQPB 2YKSA 1VQPP 3V2PA 1KILA 1NTZG 3FB2A 3L73D 5HEJA 2WP9A 1YYCA 3BRTB 3P7IA 2CXDA 1OWAA 1N36T 4CXYA 2H43A 3BK9A 2ZVNB 3EWKA 4EYYR 4H44B 2UU9T 2ZT9D 2IYOA 2C5JA 4PK5A 3RLFF 5APYA 4MLKA 1UURA 2W83C 4E7ZA 3AE4A 1Z8UA 4YT0A 2O3JA 4JI8T 2QGSA 3CCQP 3NTNA 3RI5A 4BJMA 3H1HG 4GKKT 2ZVOB 2KZJA 1VQ5P 3QC9A 3BVHA 2JJ9A 3I55P 4H9OC 2JEEA 2LXCB 1DD4A 2FJBA 4PV1C 3QNUA 3VHLA 5L4HA 5CBNA 5EK3A 2OLTA 3KQGA 1OEDB 3PUZF 5FY1A 3RKOA 3L35A 5KMGP 4NPEA 5ABEA 3LFMA 3AE3C 2XSBA 4JBZA 2XAGB 4WB4A 4J2CA 1SS1A 2CWYA 4JUYA 1LTTC 1SFCD 1Q86Q 2N9DA 2YU2A 4CN6A 3I1AA 3L75G 3F89A 2YKOA 3ZEFB 2HPJA 3FWLA 2Q9QC 1RF1A 4ILAA 3QB5A 2M5AA 3E0ZA 3HUSC 3NZPA 5L3CB 1N7SA 2R5BA 2YXQB 2O01N 3CWBD 3IHRA 4DBRA 3HD7A 4DV0T 2E9XC 2JWAA 3N9MA 3PUXF 1MIVA 1S3JA 5JDLA 2N9YB 4TUYE 4JBWF 3P8CD 4XBFB 5CJ4A 2OA5A 3NRYA 4ILCA 3G71P 5AQTB 3EHZA 4RO0A 1S9KE 5FXWA 3ZJ2A 2HYNA 2WMNA 1PGJA 3Q1MA 5DQVA 3A7OA 3PJAJ 4UV9B 1FU1A 5AQUB 2E74D 4Y28J 1XWMA 5KJ7C 1KB9I 4L0RA 4AQGA 3VOPA 1RY3A 1PPJE 2R3SA 2LR2A 1YQ3C 3ZPOA 3Q5XA 4WW0A 2IW5B 3JCUE 2UWJE 3IAOA 2YXRB 3RL0g 2H8PD 2ODUA 1VQ6P 1KC8Q 1SQPG 3RPUA 2HR3A 2O1JA 4WY4A 4O2BE 1MV8A 3EABA 3G4SP 5L4EA 3L37A 3CX5E 5IUXA 1SVFA 1KNPA 1PP9E 4UF0A 1XDOA 2OYIB 3A5TA 5CCHA 4TLFA 4YHHT 2BG9C 3ZJ1A 1KORA 3TGUJ 4DR1T 4OX9T 1NU1G 2QE7H 2XDJA 2ODVA 3HKEE 3PJAA 1RQVA 2EHOD 1P84E 2V7QJ 4H13D 1CW5A 2OYHA 3CIRA 3CPZA 2LRLA 2FXOA 3C1LA 3HUSB 1OVUA 1SQBG 2LKHA 4HFIA 1LRZA 1PV3A 1WT6A 4RKUJ 3L70D 1IK7A 4YXWH 3VRBA 2FBWA 3GG2A 4HKZH 5CA0E 3KVBA 1FZCB 4DNDA 2W4XA 3AEEC 1UX4A 2L9QA 5LP6E 4YFSA 5FY7A 1U7JA 1H8AA 4KBMB 3T1HT 4IE0A 4QXHB 5GTHH 2IYPA 3FXEB 3MZWB 5CMZA 4QKNA 1L0LK 1PGQA 2KXPB 2MTQA 3AE2A 3L73J 2SPZA 2IMLA 2X0YA 4LMJA 4KI0F 2Y0EA 2XZEA 4JI4T 2ZXEB 4HB1A 3CKDA 1IFPA 1VF5C 1M1JB 5L47A 1U5PA 1FDIA 5LCYA 4LF5T 2XNDH 3OPCA 1SQVK 4BRYB 1JY2O 4PW8A 3N9OA 3LG7A 2FXMA 2J47A 1JCDA 1T7SA 2JJLA 1S5LE 4L73A 3F31A 1OW8A 5H2FH 3TGUE 2PJQA 5AW3B 3AEBC 1WYCA 3A0BE 4IDZA 1PIXA 3KV9A 2CPBA 5CJ5A 3H3AA 2KT9A 3TDKA 3TLSA 2IIUA 2G8YA 3DTOA 1FDOA 1X22A 4ZHQE 4O4IE 1AA0A 4OYKA 3LBXB 5JRCB 5LHGB 2YO3A 2BG9B 2UUCT 2R44A 1NVOA 3TSIA 4W7YA 2D2SA 4FI5A 3AEGC 3PHLA 2JQ9A 5LHIB 2B88A 3V6IA 4PV1D 4DJGA 2A72A 5EK4A 1URQB 1IAPA 4JI0T 2N1TA 3UQ7A 4N6JA 4ZI2C 3L73E 2JIWA 2H89A 2Q3EA 4ADZA 2Q9IA 2XZRA 1WRDA 5BR8T 3Q5DA 1DX7A 4X1YE 5JDNA 2WSSH 3LW5H 2Q9QD 2VL0A 3CWBJ 4A5XA 4HKAA 3RIAA 2WU2A 3LSVA 2O01J 1HX1B 3NXSA 1X8YA 4U2ZA 5AW2B 1UIXA 1VCTA 1VQOP 5AQRB 3PLNA 1FZBA 2K24A 4PD4H 1YQ4A 4PFPA 1ZV4X 1PL5A 1SQPK 4HFDA 3ZCIA 4JQ0D 1HJ0A 1D0ZA 4YSZA 5TAOA 3RBXA 1BE3D 1S2EA 1PPJG 1S4XA 3SFDA 3VTPC 3U78A 1FZEA 4KJMA 2JQQA 3Q5SA 3AE1C 2KP8A 3PU3A 3V2RA 2ZM8A 1I6ZA 5HXHA 2C9NY 2VKHA 2WQYA 5DJTB 3GMIA 3UFGA 5KJ7D 1ZKEA 1KB9E 4DUZT 1SFCA 5J0ZA 4AYCA 3AAEB 3VMYA 2NWBA 4HFVA 2QJKC 2NRGA 4JF7A 1N86A 2MPKA 4EIJA 5CFBA 1Q2NA 1NU1K 3A3YB 3B71A 1NTMD 2MOZA 1U4QA 2K3WA 2V7IA 2E76C 3RYHE 5LHHB 1LP1B 2VVNA 2VURA 3GF7A 3MJXA 5LG3A 2NPSD 5AFUL 3TLTA 4F8HA 4TNVA 2WZIA 1KQSO 2QYWA 3JADA 3MXZA 4IT4A 3P8CE 3M0DC 1DD3A 1FZAA 1VL2A 2VB6A 4U7YA 2Q5UA 4I7ZC 4IDQA 1LTJB 4TN7B 1KILD 1UX5A 2WSSV 2ZMAA 3ONLC 2PBIA 3N2OA 3WU2H 4KUMB 2XY8B 4GK5E 3L70J 2Q7CA 1KYOD 2FYNB 3KV5A 1LT9C 3J7Yq 3BCCD 5AQSB 2XQ7A 4H9PC 5KAFE 4GOFA 1WMKA 2F4VT 2M3EA 1DEEG 5JDMA 3A8YC 4DR2T 1T8ZA 1M7LA 3OA7A 1YKHB 1AVOA 2PTFA 3S4RA 2W6AA 5AQNB 3MHVA 4R4LA 4GKJT 2BKNA 4AKHA 5IWAT 2BEQD 3MTUE 4X65T 2DL1A 4PJ0H 4BA9A 4QH5A 3CCLP 3KDSE 2H7VC 3EDVA 4NPDA 2HG5D 3K3NA 3TGUG 1GDTA 5EK2A 4GT1A 3QUJA 5B66H 1VQ9P 2QJKB 1VF5D 3O6QB 1IFDA 2EHOA 3OJAA 4XFJA 3B5MA 3FBZA 4QXCB 4H9QC 3SWFA 5AQFB 3CCVP 2LE8A 2W61A 1Z56A 1L4AC 4GIFA 2YK0A 4AIUA 1M57D 3KZIH 1U57A 4MFRA 2CHOA 3H32A 4P1NA 2AEMA 4C7NB 2B1EA 1Q90D 3R84B 1GQEA 2B89A 1D1BA 2A9UA 4EOTA 4QHOA 4MN4C 4UB6H 2XUEA 3RIUC 2B87A 2XJ7A 4YTPA 2KSEA 1GU5A 2OTLP 1D0XA 3HKCE 2X0HA 2KUBA 3L73G 4JI6T 5CHXA 5ABFA 3UUBA 4WBOA 5HXEA 1HH0A 1N32T 2XQ6A 3B13A 3N7NA 4HJGH 3V5BA 3H1HE 3H6PA 3HE5B 4A97A 3J9X1 1YTZT 2X67A 2DNXA 1EDJA 2DW3A 1LT9B 4GOEA 1GZLA 3D6YA 2N1GA 2D0UA 4ZI2D 5CCGC 2ZFCA 2OYOA 5KLVD 2QM8A 4U2YA 4UR9A 3PJSK 3SWKA 1Q81Q 3HTKA 1NTKK 1L0ND 2L5GB 1EXJA 2M67A 4HFCA 1NWMX 1T72A 1QL2A 2BKOA 3RK2B 1DIPA 2I6HA 4GYRA 2NW9A 2WSCJ 2WZHA 4IE4A 5JR9C 1BE3J 1S5LX 3L75E 2BEZF 2LOSA 1DU2A 3KBUA 2J59M 3HRNA 4LF7T 3V2NA 2ZAEB 4YJ3E 2KLVA 4HYTB 3RK3E 1M1KQ 4YY3T 1Y47A 1IC2A 2IZ1A 4N78D 4AKRB 3AA0B 3Q5WA 3O9XA 1YW0A 3I0QA 2YU1A 1IFMA 1OFCX 1L4AB 1NAFA 1S1CX 3B5NB 5FNVE 4DR7T 3AE3A 3VKGA 5FP3A 2V7MA 5LOVE 3IF4A 1NTMJ 4DV1T 1KFMA 2Y6XA 4A56A 3H1JD 3DJBA 4RESB 1V9DA 3V5SA 3F57A 2Q9QA 3CWBG 2A2FX 2BVMA 2WMOA 4R4MA 2E76D 4ZEYA 4YPCA 4KT0J 1LT1A 2D2CD 2KZIA 4H44C 1BDCA 2RA1A 2HODA 3SOLA 2E9XA 3AE8C 2K9AA 3IA3A 3UU5A 3HR0A 2BBHA 2JDIH 4B3ST 3PUYF 3EQ2A 4YJ2E 2DHRA 1BE3E 3IFMA 2LHRA 1EQ7A 3RQUA 1CZQA 4OYJA 4OWFA 3ZMUB 2DCFA 3AA6B 1BCCD 3L3PA 3H3MA 4M1PA 5KJ7A 3PV0F 1HNWT 4EOZB 2QA4P 3O4XE 4CXXA 3BCCJ 3E22E 1AVYA 3G06A 2GK9A 1WR0A 3IR9A 1YQ3A 1OEDC 5KAIE 3MK7C 1KF6A 2XU6A 3EFFK 4D6TD 1JY3P 1Q7YQ 2K5BB 5BMVE 3QWOC 4ILUA 3JCUH 4N3YB 1FIOA 3PDYA 3UUNA 1IO4A 5APUA 4AUWA 3F5HA 1H0TA 3KYQA 3EVYA 4B3TT 2HPLA 3HL6A 3GMAA 3BQKA 1EC5A 4U7JA 3K3QC 5AQIB 2KS1A 2E5YA 1GK6A 5LBQB 1SQBE 2MJZA 1IJDB 3CX5H 2PG8A 1FBMA 1VCSA 4X1KE 5JTGA 2LM9A 1J1EB 2FXPA 4EYUA 3FXDA 2KWIB 3BRVB 1NYHA 3AEDC 4Z8XA 3CVRA 2P9BA 2N1TD 2VRSA 2Z6EA 4XA4A 5FMNA 2JMHA 4EIWA 3H25A 3L71D 1KILE 2K37A 3AEFA 5LNKA 3L70G 2LKMA 5L2LA 3OTOT 2LSKA 4U3CA 3Q5PA 5HWYA 1IZNB 1JY3N 1P84H 3R4YA 3TNUB 3ZSSA 1KQLA 2DWKA 2A06D 3E7KA 3N9QA 3HKDE 4Z91A 5E79E 4AISA 3ZMSB 5KTBA 3AEEA 3R6NA 2BCCD 5LBMA 3ITKA 5AQMB 1RE3C 1DH3A 5AW5B 3UU4A 2GUSA 2WMMA 1CI6A 4P09A 4I4TE 3AXJA 3UUXB 2M6IA 3PUSA 3I9YA 1G2CB 1RQUA 3AEAC 3QH9A 3C64A 2OYIC 1KFNA 5KLVJ 2KNDA 2C0XA 2XAFB 2P7JA 2QSIA 2IFMA 1B7TA 1IK9A 1AV1A 5CCGD 1L0NJ 1NJIQ 3N4XA 1A02J 3CMLA 3BATA 4JYCA 3AEBA 3PH0A 3IBPA 3ZMVB 4ZI3D 1GL2B 1S5LH 3CLQA 2IUBA 1JMMA 4WBNE 3PTZA 4DIDB 3TF5A 3A0BH 1SUMB 1QX8A 5APTA 1XNRT 3PU8A 1HG5A 1N2DC 2V7QH 2FKWB 2FUPA 4IHJE 4ASKA 2WBLA 1ZXGA 2J58A 3WI3A 4GIWA 1RHZB 1FZCC 1UIIA 1LVFA 3JAEA 2WTYA 1MMNA 3AEGA 2CWOA 4KHXA 1G73A 4PJMA 4AQFC 3O1HA 3H1JJ 3RL0B 3H1KD 3UQ4A 1D0YA 2BKPA 4UEMA 4QX7B 3HA4A 3G3ZA 1RE4C 4CZZB 4EV6A 1ZMEC 2JMKA 3Q5RA 4IDPA 2FJAA 1ZHCA 1M1JC 4UB8E 3CCEP 1MKMA 4NPPA 1ZW0A 1X0TA 2C9LY 2K3RA 2P1JA 3MGNA 5K5GB 4AQYT 1L0NE 3ZYKA 5FVKA 3P4PA 2HN2A 1BE3G 3W15B 4H44D 5CA1E 2E5LT 2M0BA 1D1AA 2WU5A 1SQQD 1Y8AA 3PP5A 1K73Q 1IBLT 3OYXA 3P4WA 1BGYD 1ZRTE 4U3FD 2QIWA 1BCCJ 1NO4A 3MA9A 4IE6A 3GLMA 1YIJP 5BVZA 4HTEA 1XZYA 2QG4A 4JLEA 3EDUA 3RK3B 3GWHA 2WY2A 3V2QA 3ZT7A 3P4QA 3AE6C 3SSUA 4D6TJ 3OKQA 1ZV8A 2FYUK 3LIDA 1URQC 2WT7B 4I1LA 1KB9H 2OGUA 3O6QA 1J5WA 3AE9C 2G0UA 1NTZK 3RF1A 1M8OB 1BSNA 5JREA 3A7MA 3NFQA 4WBAA 1X79A 2JWDA 3TYYA 4JI2T 2D9DA 4LFAT 2WSFH 2E75C 2ZXXA 2I8DA 4K35A 2FFDB 4EAHA 3I9WA 1FJKA 2CXFA 2XTLA 5C8YE 2E2AA 3SWYA 1EZVD 3E1RA 4QMAA 3M0DA 2L3LA 4H0LD 3BQIA 2KNCA 3GN5A 2BASA 4H9RC 4B86A 2V6YB 1NOHA 4L5GA 3GF3A 3L71J 3ANWA 3LK2B 1GW4A 4IL4A 4O2AE 5AVVB 4PD4D 4UXNB 1Y01A 4YSXA 3FZLB 1NHLA 1BCCE 4QH1A 2KK7A 2CM0A 2WWUA 2OARA 2ZJSE 3VN0A 3ETVA 4JI5T 2W90A 1EDLA 4B3MT 1EDIA 1QVFO 2H7HA 1LT9A 1SLQA 1L0LD 2SPCA 5AVYB 4NXMT 3QK6A 2BVLA 2K9JA 3CXHD 1JNZA 1JTHB 3KVAA 1HF8A 4D6TE 2BCCJ 2I1KA 3P32A 1K04A 1OVRA 2NTYA 1YBKA 5AVRB 3VR8A 4DR6T 3ZYMA 1OW6A 5KAFH 4HH2A 5B5EH 3VP9A 2W62A 1SQVD 4IIJE 3OYZA 5LMUT 3C4ZA 5JDGA 1EZVI 1RF0C 2XQ4A 5APXA 1RH5B 2CE7A 4HE8A 2XQ9A 1KTMA 4JEUB 1RF1C 3UT5E 5EZYE 1FJGT 1T3UA 2LT3A 4EEDA 3AECC 4PD4I 4DO0A 1AJYA 2NW8A 1BR1A 3N9PA 3ZMTB 3L71E 4OGQC 2E75B 1LTJC 2JR8A 1KILB 3KFWX 2ES0A 4ILBA 2JO1A 2KSRA 3KHUA 3L39A 3CXHI 4WWIA 3ZLIA 4WNKA 3UU3A 4O4JE 5JDQA 1HBWA 3HE4A 3LDQB 2FYNC 2WB5A 1JEKA 1K05A 2A06E 1L0VA 1E7PA 3RIUA 3RC8A 2KMFA 2CRBA 1QVGO 5HYAA 4GOUA 1UCUA 2QM7A 2UXDT 1EZ3A 2E9XD 4I0UA 2BBJA 2XPKA 2JKVA 2WPVB 4Q25A 5DJQC 1VQKP 2VL8A 3PUWF 3A0HE 3T1YT 3H1KJ 3I5CA 2I0MA 3VP8A 3MD0A 1WFDA 5KLVG 1FE6A 2CHNA 2V6XA 1MNDA 3K1SA 4CI2B 2FJDA 5CCGA 1L0NG 4TT3H 3CWZB 1MMDA 3T97A 1VOMA 1BSHA 3RH3A 2IZ0A 4K0KT 4UELA 3C9IA 1LKXA 2ZYAA 1UGOA 3FZKB 1PGPA 4IOIH 3P4SA 3AVRA 4Z1MH 2NP9A 1KNZA 4P0BA 5HWXA 1SQQJ 5AVXB 1R5LA 1BGYJ 2LSYA 1LTIC 3N9LA 1FMVA 4C7RA 4U3FJ 4KX6A 5JR9A 2BDEA 1SQBK 1E1HB 2M3BA 2Y0DA 1RF1B 3CWBE 2M5AB 3W68A 3PE0A 3IF8B 3ZMZB 1HNZT 4LFBT 1N7SB 4LMKA 4WYVA 2YKQA 2HPCA 1ZR2A 3OVUA 3HD7B 3H1JG 4OGQB 1ZLLA 1HS7A 2A45I 2YKPA 2ACXA 3GHGA 2W6BA 2E8IA 3CX6B 3H1KE 5C3JA 3H37A 3C51A 1GW3A 1LTSC 1NEKA 2CK3H 4NXNT 5C39A 4JI7T 3HKBE 3NVOA 3U1AA 1BR4A 5J2TE 4LMLA 5B5EE 2D0TA 2FJEA 5CB4E 2W63A 4L75A 1S94A 1SQXD 4CI1B 2XM1A 1I94T 4DZOA 3L72D 1HJBA 3L09A 2KYVA 3JSVC 3RK2C 4NIQA 1BCCG 1SQQE 4WY4B 3L74D 3T8OA 3P4RA 3U59A 4W7ZA 5FXVA 3ETUA 1XNQT 4G63A 5F8PA 3RKGA 1UK5A 2ZLYA 2KB7P 4XAXB 4D6TG 3F2EA 2W0GA 1L0LJ 2N2NA 4H63V 1EXIA 1KNRA 5DJUB 3CD6P 3V4WA 3OAKA 4PNIA 4JYAT 5LG4A 1OEDA 2Y9YA 2JP3A 4U7IA 1N34T 2I59A 1KYOI 3B5NC 5KAIH 1SQVJ 2CA5A 3QB5K 2OYHB 3L70E 2LLYA 4Y99C 1VRBA 3SS1A 3CCRP 1KQGB 1NWQA 2IBZD 1USDA 4X66T 2JRKA 1AFOA 5CJ0A 3DP7A 3K3OA 1IBMT 1EZVE 4JI1T 2X0LB 4A7PA 3ZDMA 4DR3T 1TU3F 3H1ID 3L71G 4DR4T 4DMVA 5LMNT 3AEDA 3UULA 2RN0A 1VQ8P 5HXRA 3FBLA 3MUDC 5LGNB 5ABHA 2KINB 3FZFB 2XQYA 2ZM2A 2A06G 2W8ZA 4QWNB 2YNYA 3VMZA 3C98B 5AVUB 1L0LE 2BCCG 2IPPA 3NMDA 2VKDA 3FZHB 4EDFA 5FKYA 3CXHE 1E79H 1L0NK 3KXDA 3X1DA 3CI9A 4C90A 2XHEB 1YITP 2WM9A 2GM4A 1QUUA 5HCMA 5AQQB 5AVWB 5BU8B 4UVBB 2R3CA 2XQAA 3M9BA 2PP6A 5E79H 3SFEC 1MIYA 3AE5C 1IJ5A 4YTNA 1SQVE 2IBZI 4DVDA 1QLED 3M91A 1HG2A 5M4YA 1GTWA 1N8RQ 1YXRA 3ABVC 3C4XA 1WYBA 3WAKA 3CCJP 2CLYC 2OTKE 3AEAA 1NTKD 5AVQB 1MNEA 3WUTA 4IDNA 4HN9A 3Q9DA 4KMCA 4YSYA 1J1EC 2OYIA 3ZC1A 2Q3IA 2WPQA 4COFA 3RYCE 5IYZE 3D0TA 1PP9D 2VK9A 3MP7B 4OK0A 1N73C 2CPTA 3KBTA 2NTXA 4DBQA 5LJMA 2N1TB 2H88C 4EYYQ 4Y99B 4AKGA 1OMIA 5C2TA 3PUGA 2FYZA 2XAJB 3LIEA 3HUSA 4L76A 2AEFA 2QRXA 1PZQA 1JO5A 1P84D 4DV4T 2ZT9B 4XE5B 5AQOB 2UXCT 4ZZBA 3N2KE 1YJWP 3NZQA 3ZN1B 1WRGA 1FZCA 5FYMA 4BJNA 4AI6A 4O9BA 3FWNA 3RC3A 4AQFA 3H1KG 2WS3A 3AB3B 1XTCC 2YINA 2IC9A 1LWUC 2LJLA 2VASA 4ISTA 4JEHB 3FXEA 5AVSB 3MZKB 1H89A 3ZN0B 4CXWA 2WAUA 5KLIB 5HCJA 2A3DA 4ZS3A 4EXTA 3CX8B 2WSEJ 4IL6E 2IX7C 1RE4A 4AQRD 1LTGC 2NW7A 3D6ZA 4V1Av 1MZ9A 1M1JA 3P7KA 2J1DG 3C4WA 4W80A 4IFMA 5JQGE 3LJCA 4BRYA 1SQXJ 4BAYB 4UB8H 4MALA 1SQQG 4MHCA 2WCAA 2LSIA 3L72J 1JUNA 1NTME 4LFCT 2HH7A 1SFCB 4ZKUA 1GK4A 4U3FG 1T98A 2W67A 1W2EA 2R5DA 2P2UA 1GL2C 5F5WA 2ZYDA 4YLHA 5A1LA 3L74J 2BZBA 2CLYB 4PJJA 5E0OA 1G1JA 2AE9A 2YDRA 5AW6B 1O3XA 1BDDA 4FJOA 3KPEA 1NAYA 2W27A 2AEJA 4JI3T 2UXNB 2V5DA 4UIGA 4PJLA 1M7KA 4HGAA 3LBXA 5JRCA 2B9BA 3I0OA 4IL9A 2BG9A 1AQTA 1ZR4A 1N73B 4HWFA 5FL0A 5APQA 1USEA 3AE6A 2BG9E 3CC2P 4I43B 1FDMA 4YXDC 1FMWA 3K5BA 4YHJA 1URQA 3EUHA 3UU8A 1ZP0C 3FX0A 3RL0C 3AE9A 4HWIB 1L4AD 2E74B 4TZ4C 2C0WA 1KYOE 5GTIE 5KXJA 3MIWA 2O1KA 3RBZA 5KKZB 1S35A 4QX8B 1EZVG 2R32A 3BCCE 4HEAA 1FAVA 5CGMA 2J4GA 3V4QA 4ZKPA 3I56P 4LF4T 2K9YA 2QJYB 4X1IE 1SQXE 1LWUB 3H1IJ 3AE7C 3L72E 1R5SA 1CHUA 1HNXT 3CL3D 2LM2A 4K0UA 5AW8B 3L74E 1WCRA 3ZT5A 1CSBA 1SA0E 1JOCA 1PFIA 1L0LG 3L4FA 4DOJA 3WMM0 1NKNA 2XKMA 1HFAA 4G2AA 2V4HA 2VQET 1FOSE 1OZHA 3UIAA 3RK3C 3L36A 4CQIA 5L3FB 3VMXA 4HFBA 1M62A 4EEBA 1OX3A 2XM2A 4X5TA 3A2AA 4LF6T 2HLOA 1SQVG 3G9RA 3M65A 3UTKA 4DV7T 2EHOB 3OJAB 1HX8A 1KMIZ 4CPGA 4H13B 4HWHA 4CN1A 2E5TA 1FS0E 2E42A 1KV4A 2LXBA 1HGVA 2KLQA 5ABGA 1J5ET 3GW6A 1KB9D 3M0AA 4PK4A 1M56D 1LP1A 1JY2P 4GODA 1G1IA 1NTKJ 3JC22 5JVDE 2AXCA 3H32B 1MFTA 1RF0A 2FFDC 2IBZE 1CUNA 3TK1A 2AXDS 4PFOA 4TV8E 2OQQA 4QH4A 2OTJP 3FZMB 2B87B 3CC7P 3TLVA 1VQ7P 1OXZA 1PP9J 3H1IE 2VVSA 2VQFT 3AECA 4YTMA 3LK42 3RYIE 3H1LD 2P67A 1NH4A 2XQ3A 4ZZCA 4H0LB 5ABFB 4JV5T 2ACZA 3ZT6A 4MBQA 4ASWA 1LTJA 3C8VA 3VR9A 3CCMP 1JY3O 4O8SA 2Y0CA 4ZNCA 4LGDE 5KLVE 1WR6A 1W0BA 4A98A 2Y8DA 3MKDA 4GYSA 1LGHB 3ZSTA 5TISE 5HXSA 3CQXC 3WAJA 1YTZI 2RMZA 2X51A 3FHNA 1IFJA 1FZFA 1JY2N 1OW7A 2NOXA 2UXXB 1J2JB 5AVTB 1QSDA 3HTKB 2UXBT 3M9HA 2MAWA 1SQQK 2I1JA 3KV6A 5APSA 1SE7A 2M8RA 2A45G 1FEWA 1QL1A 4I50E 3S4UA 2Y9ZA 2JQKA 2IFNA 3RQWA 4ZMDA 1S72P 2AXTE 5APVA 1DEBA 4K3AA 1NENA 4DV5T 1NTKE 3AE1A 1LNQA 2X9HA 2IC6A 3A0HH 4N78E 2H3RA 2WWVA 2DI4A 1NKZB 2NPSC 1MMGA 1NTMG 5L3DB 2V7LA 1JCCA 4PV1B 2IHR1 1JNMA 2PAJA 2WZ7A 5JDHA 3OBVE 5LGTB 5FXZA 4EZ4A 1YJNP 3H1JE 4IREA 5ADXL 4AKLA 4X64T 4OH8B 4X62T 1ZOYC 2V8SV 1QGKB 4L9IA 2ZM6T 4TWHA 1KILC 1MFZA 1GL2D 4C7NA 2KZ7B 2Q9QB 1IBKT 2FYUD 4AKIA 1X9BA 3AEFC 2K48A 3UUMA 3BQLA 4KP3C 2BS2A 1N33T 4NUVA 4AXPA 1NTZD 4BXLA 2JPFA 2NR4A 4H9SE 1HTJF 2G3AA 2P58A 2HODB 2O01H 2E9XB 4P0AA 2W66A 3N5LA 4DMWA 2POHA 3CC4P 3AE4C 3ZC0A 1QEXA 3A5XA 1XMQT 3WUUA 4TX5A 2RH0A 1K9MQ 3BCCG 2MBGA 3HE5A 4TV9E 3USSA 3RL0D 4C91A 1SQXG 1M90Q 2VKJA 3VU7H 4KHPT 3MACA 4ZOLE 3H1HD 3L72G 2H7OA 2YEVC 1FC2C 1HF9A 3M06A 2PFXA 2E5VA 5KDMC 4IL6X 2QVAA 2XV5A 1X9VA 3L74G 3NKZA 5LJNA 2LRKA 2UUBT 4I6MC 2V1DB 3CX7B 2CBJA 5CBOA 4F6RC 3TLWA 1H0TB 2HFED 2NPSB 4BWNA 1K8AQ 1EDKA 1Z0PA 4PK6A 2KS1B 4PJNA 1W9RA 3OW2O 2V7KA 2L91A 1N7SC 3L75D 4O4HE 4OHFA 2IAKA 1IFNA 1T2KC 3HD7C 4JYBA 3FXDB 5F3JA 4ZXLA 4DV3T 3RK3D 5IHYA 1W0AA 1L4AA 3SWHA 3M3ZB 4HWDA 3B5NA 2J62A 1MMAA 4EI2A 3ZKRA 2IBZG 3VMAA 1KD1Q 2CXLA 3IN6A 3CCSP 4LF9T 2WSFJ 2WWWA 1U7MA 3H1IG 1R8EA 1YD8G 1YKEB 5AQVB 2BCCE 4U31A 2Z5HA 1VPCA 1GU4A 2ZM0A 1W09A 1OVVA 1VQLP 1LTBC 5AQHB 3H1LJ 1KK7A 2WDVA 3UU6A 1XMOT 1MIWA 2DLRA 3MUDA 3ESLA 1HGZA 4U33A 2X9WA 2XSAA 3M9QA 4DV2T 4WY4C 1CI6B 3RIFA 3EI0A 3AXJB 3KDPB 1SQPD 3V5UA 5EFWB 3PUVF 5APWA 2YMKA 5L3GB 1LTAC 2LSJA 3PUAA 3JC6C 2PFVA 1VF5B 3WUVA 4H63H 5H6RB 5HXCA 1NTMK 3O8ZA 2QA7A 1SHZC 5CCHC 2CEAA 5LXTE 2KWHA 4X20E 3CXHH 1NTKG 3SFEA 4RJTA 3EFGA 3AE5A 3PURA 3UFEA 3TKLB 2FY8A 2OYHC 5HEGA 5AQLB 2K88A 4E7SA 4ZI7E 1MUUA 4DT0A 3ABVA 2WPRA 1NU1D 5AQGB 2XAQB 2YDQA 1Y64B 3CQGB 1PP9G 2W2UA 5AW0B 3P8MC 2D2CC 3S1KA 2X68A 3N2GE 3U1CA 4EZHA 2FBWC 2KI7B 3RYFE 1KZUB 1WLXA 1VQMP 1SQBD 3Q3DA 3H1LE 5GTHE 1N73A 5AQKB 2CBIA 1D7MA 1URQD 5L3BB 2C5IT 1FOSF 2H88A 1LJ2A 3JAFA 4C46A 4M3LA 3RGUA 3AE2C 1HUCA 2R6GF 4CN4A 2VWAA 5FVLA 4L74A 3U3IA 2YOEA 2FYUJ 1AQ5A 2D5UA 1JB0J 3LW5J 2E75D 3TNUA 1NTZJ 4TNWA 1SQXK
chains in the Genus database with same CATH topology
2LOPA 3CQCB 3O1JA 2VKOA 4IE5A 2KSJA 3KV4A 1LWUA 3B8EB 2WSCH 1BR0A 4UVCB 3PUQA 4ISSA 1G2CA 4GK0E 2YO2A 4GKGA 2LEHA 4UF0B 3AA7B 1HWTC 3E1IA 2A45H 4ERRA 5JH7E 2V7JA 4ANJA 3NRXA 1LVKA 5AW4B 4B6XA 1FZGA 3KINB 2N1TC 2CPSA 1GL2A 4EB6E 2C5KT 1X79B 5HAXA 3VKHA 1A02F 1H7CA 1N7LA 4U74A 1ZEEA 2X9XA 2X66A 3B57A 2WITA 5AW7B 1XTGB 5FY0A 1IJ6A 1BR2A 4UVAB 5AVZB 1FJPA 1N7SD 2GUVA 3GN5B 1T2KD 3HD7D 2V26A 2Y48B 5KX5E 3PTRB 2XASB 3ANWB 1HCIA 1S9KD 3NBXX 5KLVK 3SRZA 1AJ3A 4IFFA 3RRWA 1US7B 2CMRA 4LC1A 2WSEH 1H88A 4LLHA 1D1CA 4OFZA 1RE3A 3HI2A 4ZS2A 3BASA 3E08A 1SFCC 3N9NA 2Z5IA 2RP4A 4ZI3C 4I2LC 1SP4A 3AAAB 2XAHB 3ZCJA 2KOGA 4WY4D 3ONXA 3ZYLA 2Z4EA 4O4LE 1J1DC 4NUUA 5DABA 3JC6D 2MYSA 4I55E 2WT7A 1T3JA 5CCHD 2X9YA 4IE7A 2N9BA 3GHGC 4UV8B 4XZCA 3Q2MA 2XNXA 5AW1B 2FFDA 4U72A 2L8KA 3HE4B 4CI3B 1HTLC 3II6A 5J2UE 1HVVA 1IFIA 5JDFA 3AVSA 4QXBB 1E5WA 3IEEA 3RRCA 3R2PA 1VDFA 5H6QB 2W00A 2LHNA 3RX6A 1GD2E 2C0SA 5J1GA 5LA6E 1G8XA 5AW9B 1JTHA 4PAGA 3K8PC 5DQWA 5BU5A 2EHOC 5ETWA 3VYIA 5LYJE 3O1IA 3RK2D 2LSGA 2E43A 5JR9B 2WPSA 4IGUA 5GONE 3LK3B 2YMYA 1J1DB 2DWGA 1ZN5A 2CCQA 2NPSA 3AA1B 4IFDK 5FXXA 3GA8A 5L3EB 3C50A 5LGUB 4H9NC 2HPCB 3B5ND 3GHGB 3AAIA 3V2PA 1KILA 3FB2A 1YYCA 3BRTB 3P7IA 2CXDA 1OWAA 4CXYA 2H43A 3BK9A 4EYYR 2C5JA 4PK5A 5APYA 4MLKA 4E7ZA 2QGSA 3NTNA 4BJMA 3QC9A 3BVHA 2JJ9A 4H9OC 2JEEA 3VHLA 5EK3A 3KQGA 5FY1A 3RKOA 3L35A 5KMGP 3LFMA 2XAGB 4WB4A 4J2CA 2CWYA 4JUYA 1LTTC 1SFCD 2N9DA 2YU2A 3I1AA 2YKOA 3ZEFB 2HPJA 2Q9QC 1RF1A 3E0ZA 3HUSC 3NZPA 5L3CB 1N7SA 2R5BA 3IHRA 4DBRA 3HD7A 2E9XC 3N9MA 1MIVA 5JDLA 4TUYE 3P8CD 4XBFB 3NRYA 5CJ4A 2OA5A 1S9KE 5FXWA 3ZJ2A 2HYNA 2WMNA 5DQVA 3A7OA 4UV9B 1FU1A 5KJ7C 4L0RA 4AQGA 3VOPA 1RY3A 3ZPOA 3Q5XA 4WW0A 2IW5B 2H8PD 2ODUA 3RPUA 2O1JA 4WY4A 4O2BE 1MV8A 3L37A 1SVFA 4UF0A 2OYIB 3A5TA 5CCHA 3ZJ1A 2XDJA 2ODVA 3HKEE 2EHOD 1CW5A 2OYHA 3CPZA 3HUSB 1LRZA 1WT6A 5CA0E 3KVBA 1FZCB 4DNDA 1UX4A 2L9QA 5LP6E 4YFSA 5FY7A 1H8AA 4KBMB 4IE0A 4QXHB 3FXEB 5CMZA 4QKNA 1L0LK 2KXPB 2MTQA 2ZXEB 3CKDA 1M1JB 1U5PA 5LCYA 1SQVK 1JY2O 4PW8A 3N9OA 3LG7A 2FXMA 1JCDA 2JJLA 3F31A 2PJQA 5AW3B 1WYCA 4IDZA 3KV9A 2CPBA 3H3AA 2KT9A 3DTOA 4ZHQE 4O4IE 4OYKA 3LBXB 5JRCB 5LHGB 2YO3A 3TSIA 4W7YA 2D2SA 4FI5A 5LHIB 2A72A 5EK4A 1URQB 1IAPA 2N1TA 4N6JA 4ZI2C 4ADZA 2Q9IA 2XZRA 1WRDA 1DX7A 4X1YE 5JDNA 3LW5H 2Q9QD 4HKAA 3NXSA 1X8YA 5AW2B 1FZBA 2K24A 4PFPA 1ZV4X 1SQPK 3ZCIA 1D0ZA 5TAOA 3VTPC 3U78A 1FZEA 2JQQA 2KP8A 3PU3A 3V2RA 2ZM8A 5HXHA 2C9NY 2VKHA 3GMIA 5KJ7D 1ZKEA 1SFCA 4AYCA 3AAEB 3VMYA 2NWBA 4HFVA 4JF7A 1N86A 4EIJA 1NU1K 3A3YB 2MOZA 1U4QA 2V7IA 5LHHB 3RYHE 3MJXA 2NPSD 5AFUL 3MXZA 3P8CE 3M0DC 1FZAA 2VB6A 2Q5UA 1LTJB 4TN7B 1KILD 1UX5A 2WSSV 2ZMAA 2PBIA 3N2OA 4KUMB 4GK5E 2Q7CA 3KV5A 1LT9C 3J7Yq 4H9PC 5JDMA 1T8ZA 1M7LA 3OA7A 1YKHB 2W6AA 4AKHA 3MTUE 4BA9A 3KDSE 2H7VC 3EDVA 2HG5D 3K3NA 1GDTA 5EK2A 4GT1A 3QUJA 1IFDA 2EHOA 3OJAA 3FBZA 4QXCB 4H9QC 3SWFA 2LE8A 2W61A 1Z56A 1L4AC 4GIFA 2YK0A 4MFRA 3H32A 4C7NB 2B1EA 3R84B 1D1BA 4EOTA 4QHOA 2XUEA 1GU5A 1D0XA 3HKCE 5CHXA 4WBOA 5HXEA 1HH0A 3B13A 3N7NA 3V5BA 3H6PA 3HE5B 3J9X1 1YTZT 2X67A 2DNXA 1LT9B 1GZLA 2N1GA 2D0UA 4ZI2D 5CCGC 2ZFCA 2QM8A 3HTKA 1NTKK 2L5GB 2M67A 1NWMX 1QL2A 3RK2B 4GYRA 2NW9A 4IE4A 5JR9C 2LOSA 3KBUA 2J59M 3HRNA 3V2NA 4YJ3E 2KLVA 4HYTB 1IC2A 4N78D 4AKRB 3AA0B 3Q5WA 3O9XA 1YW0A 3I0QA 2YU1A 1IFMA 1L4AB 1NAFA 3B5NB 5FNVE 3VKGA 5FP3A 2V7MA 5LOVE 1KFMA 2Y6XA 4A56A 3DJBA 4RESB 1V9DA 3V5SA 3F57A 2Q9QA 2A2FX 2BVMA 2WMOA 2RA1A 2HODA 3SOLA 2E9XA 2K9AA 3HR0A 3EQ2A 4YJ2E 2DHRA 3IFMA 2LHRA 1EQ7A 1CZQA 4OYJA 3ZMUB 2DCFA 3AA6B 3L3PA 4M1PA 5KJ7A 4EOZB 3O4XE 4CXXA 3E22E 2GK9A 3IR9A 3MK7C 2XU6A 1JY3P 2K5BB 5BMVE 4ILUA 4N3YB 1FIOA 3PDYA 3UUNA 1IO4A 5APUA 4AUWA 3EVYA 3KYQA 2HPLA 3HL6A 3BQKA 3K3QC 1GK6A 5LBQB 2MJZA 1IJDB 2PG8A 4X1KE 1FBMA 2LM9A 1J1EB 4EYUA 2KWIB 3BRVB 4Z8XA 3CVRA 2P9BA 2N1TD 2VRSA 2Z6EA 4XA4A 5FMNA 2JMHA 4EIWA 5LNKA 2LKMA 5L2LA 2LSKA 5HWYA 1JY3N 1IZNB 3TNUB 1KQLA 2DWKA 3N9QA 3HKDE 3ZMSB 5KTBA 3R6NA 5LBMA 1RE3C 1DH3A 5AW5B 2GUSA 1CI6A 4P09A 4I4TE 3UUXB 3PUSA 3I9YA 1G2CB 3C64A 2OYIC 1KFNA 2KNDA 2C0XA 2XAFB 2IFMA 2P7JA 1B7TA 1IK9A 5CCGD 3N4XA 1A02J 3CMLA 3BATA 4JYCA 3IBPA 3ZMVB 4ZI3D 1GL2B 3CLQA 1JMMA 4WBNE 5APTA 3PU8A 1HG5A 1N2DC 2FKWB 4IHJE 4ASKA 2WBLA 2J58A 3WI3A 4GIWA 1FZCC 1LVFA 2WTYA 1MMNA 2CWOA 4KHXA 1G73A 4PJMA 4AQFC 3O1HA 3RL0B 1D0YA 4UEMA 4QX7B 3HA4A 3G3ZA 1RE4C 4CZZB 2JMKA 1ZHCA 1M1JC 2C9LY 2P1JA 3MGNA 3ZYKA 3W15B 5CA1E 1D1AA 3PP5A 3OYXA 1NO4A 3MA9A 4IE6A 5BVZA 4HTEA 4JLEA 3EDUA 3RK3B 3GWHA 3V2QA 3OKQA 1ZV8A 2FYUK 3LIDA 1URQC 2WT7B 4I1LA 2G0UA 1NTZK 5JREA 3NFQA 4WBAA 1X79A 3TYYA 2WSFH 2FFDB 4EAHA 3I9WA 1FJKA 2CXFA 2XTLA 5C8YE 3SWYA 3M0DA 2L3LA 3BQIA 3GN5A 2BASA 4H9RC 4B86A 1NOHA 4L5GA 3LK2B 3ANWA 4O2AE 1GW4A 5AVVB 4UXNB 1NHLA 2CM0A 2WWUA 2OARA 3VN0A 3ETVA 2H7HA 1LT9A 1SLQA 2SPCA 5AVYB 3QK6A 2BVLA 3KVAA 1JTHB 1HF8A 2I1KA 3P32A 2NTYA 5AVRB 3ZYMA 4HH2A 3VP9A 2W62A 4IIJE 3OYZA 3C4ZA 5JDGA 1RF0C 5APXA 2CE7A 4HE8A 4JEUB 1RF1C 3UT5E 5EZYE 1T3UA 2LT3A 4DO0A 2NW8A 1BR1A 3N9PA 3ZMTB 1LTJC 1KILB 3KFWX 2ES0A 3ZLIA 4WNKA 4O4JE 5JDQA 1HBWA 3HE4A 3RC8A 2KMFA 5HYAA 4GOUA 1UCUA 2QM7A 1EZ3A 2E9XD 5DJQC 2VL8A 3I5CA 3VP8A 3MD0A 1MNDA 4CI2B 5CCGA 3CWZB 1MMDA 3T97A 1VOMA 3RH3A 4UELA 3C9IA 1LKXA 3AVRA 1KNZA 2NP9A 4P0BA 5HWXA 5AVXB 2LSYA 1LTIC 3N9LA 1FMVA 4C7RA 5JR9A 2BDEA 1SQBK 1E1HB 2M3BA 1RF1B 3PE0A 3IF8B 3ZMZB 1N7SB 2YKQA 2HPCA 1ZR2A 3HD7B 1ZLLA 1HS7A 2A45I 2YKPA 2ACXA 3GHGA 2W6BA 2E8IA 3CX6B 3H37A 3C51A 1GW3A 1LTSC 3HKBE 3U1AA 1BR4A 5J2TE 2D0TA 5CB4E 2W63A 1S94A 4CI1B 4DZOA 1HJBA 3L09A 2KYVA 3RK2C 4WY4B 3T8OA 3U59A 4W7ZA 5FXVA 3ETUA 4G63A 5F8PA 2ZLYA 2KB7P 4XAXB 3F2EA 2W0GA 2N2NA 4H63V 3V4WA 3OAKA 4PNIA 5LG4A 2I59A 3B5NC 2CA5A 2OYHB 4Y99C 1VRBA 3SS1A 1NWQA 2JRKA 1AFOA 5CJ0A 3DP7A 3K3OA 2X0LB 4DMVA 3UULA 5HXRA 3FBLA 5LGNB 2KINB 2XQYA 2ZM2A 4QWNB 2YNYA 3VMZA 3C98B 5AVUB 2IPPA 3NMDA 2VKDA 1L0NK 4C90A 3CI9A 2XHEB 2WM9A 2GM4A 1QUUA 5AVWB 5BU8B 4UVBB 2R3CA 3M9BA 2PP6A 1MIYA 1IJ5A 4DVDA 3M91A 1HG2A 5M4YA 1GTWA 3C4XA 3WAKA 1WYBA 2CLYC 5AVQB 1MNEA 4HN9A 3Q9DA 4KMCA 1J1EC 2OYIA 3ZC1A 2Q3IA 2WPQA 3RYCE 5IYZE 3D0TA 2VK9A 4OK0A 1N73C 3KBTA 2NTXA 4DBQA 5LJMA 2N1TB 4Y99B 4AKGA 3PUGA 2FYZA 2XAJB 3LIEA 3HUSA 1JO5A 4XE5B 3N2KE 3NZQA 3ZN1B 1WRGA 1FZCA 5FYMA 4BJNA 4AI6A 4O9BA 3RC3A 4AQFA 3AB3B 1XTCC 2YINA 2IC9A 1LWUC 2LJLA 2VASA 4ISTA 4JEHB 5AVSB 3MZKB 1H89A 3ZN0B 4CXWA 2WAUA 2A3DA 4ZS3A 4EXTA 3CX8B 2IX7C 1RE4A 4AQRD 1LTGC 2NW7A 4V1Av 1MZ9A 1M1JA 3P7KA 2J1DG 3C4WA 4W80A 4IFMA 5JQGE 3LJCA 4BAYB 4MALA 4MHCA 2LSIA 1JUNA 2HH7A 1SFCB 4ZKUA 1GK4A 1T98A 1W2EA 2R5DA 2P2UA 1GL2C 4YLHA 5A1LA 2BZBA 2CLYB 4PJJA 5E0OA 1G1JA 5AW6B 1O3XA 4FJOA 3KPEA 2W27A 2UXNB 4UIGA 4PJLA 4HGAA 3LBXA 5JRCA 3I0OA 1ZR4A 1N73B 5APQA 4I43B 1FDMA 1FMWA 4YHJA 1URQA 3EUHA 3RL0C 1L4AD 4TZ4C 2C0WA 3MIWA 2O1KA 1S35A 4QX8B 2R32A 4HEAA 1FAVA 3V4QA 4ZKPA 4X1IE 1LWUB 3CL3D 4K0UA 5AW8B 1CSBA 1SA0E 1JOCA 1PFIA 3L4FA 4DOJA 3WMM0 1NKNA 2XKMA 1HFAA 4G2AA 1FOSE 3UIAA 3RK3C 3L36A 4CQIA 5L3FB 3VMXA 3A2AA 2HLOA 3M65A 3UTKA 2EHOB 3OJAB 1HX8A 2E42A 1HGVA 2KLQA 3M0AA 4PK4A 1JY2P 1G1IA 5JVDE 3H32B 1RF0A 2FFDC 1CUNA 3TK1A 4PFOA 4TV8E 1OXZA 3LK42 3RYIE 2P67A 1NH4A 4MBQA 1LTJA 1JY3O 4O8SA 4LGDE 1WR6A 2Y8DA 3MKDA 4GYSA 1LGHB 5HXSA 3CQXC 3WAJA 1YTZI 2X51A 3FHNA 1IFJA 1FZFA 1JY2N 2NOXA 2UXXB 1J2JB 5AVTB 1QSDA 3HTKB 3M9HA 1SQQK 2I1JA 3KV6A 5APSA 2M8RA 2A45G 1FEWA 1QL1A 4I50E 3S4UA 2IFNA 5APVA 1DEBA 2X9HA 2IC6A 4N78E 2H3RA 2DI4A 1NKZB 2NPSC 1MMGA 5L3DB 2V7LA 1JCCA 1JNMA 2PAJA 2WZ7A 5JDHA 3OBVE 5LGTB 5FXZA 4EZ4A 5ADXL 4AKLA 4OH8B 4L9IA 1KILC 1MFZA 1GL2D 4C7NA 2KZ7B 2Q9QB 4AKIA 2K48A 3UUMA 3BQLA 4KP3C 4NUVA 4AXPA 2JPFA 4H9SE 1HTJF 2HODB 2O01H 2E9XB 4P0AA 3N5LA 4DMWA 2POHA 3ZC0A 3A5XA 4TX5A 2MBGA 3HE5A 4TV9E 3RL0D 4C91A 2VKJA 3VU7H 3MACA 4ZOLE 2H7OA 2YEVC 3M06A 5KDMC 2XV5A 1X9VA 5LJNA 4I6MC 2V1DB 3CX7B 4F6RC 2HFED 2NPSB 1Z0PA 4PK6A 4PJNA 2V7KA 4O4HE 4OHFA 1N7SC 2IAKA 1IFNA 1T2KC 3HD7C 4JYBA 3FXDB 5F3JA 3RK3D 5IHYA 1L4AA 3SWHA 3B5NA 1MMAA 2CXLA 2WWWA 1YD8G 1YKEB 2Z5HA 1VPCA 1GU4A 2ZM0A 1LTBC 1KK7A 1MIWA 2DLRA 3MUDA 3ESLA 1HGZA 2X9WA 3M9QA 4WY4C 1CI6B 3KDPB 3V5UA 5APWA 5L3GB 1LTAC 2LSJA 3PUAA 3JC6C 2PFVA 4H63H 5HXCA 5H6RB 1NTMK 3O8ZA 2QA7A 1SHZC 5CCHC 2CEAA 5LXTE 2KWHA 4X20E 3EFGA 3PURA 3UFEA 3TKLB 2OYHC 4E7SA 4ZI7E 1MUUA 2WPRA 2XAQB 1Y64B 3CQGB 5AW0B 3P8MC 2X68A 3N2GE 4EZHA 3U1CA 3RYFE 1KZUB 1WLXA 1N73A 1URQD 5L3BB 2C5IT 1FOSF 4C46A 4M3LA 1HUCA 2VWAA 3U3IA 1AQ5A 2D5UA 3TNUA 1SQXK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JJL A;  3A7O A;  3MD0 A;  5AW3 B;  5AW8 B;  4XE5 B;  3IR9 A;  5APT A;  1JNM A;  1CSB A;  3V5B A;  3HE5 B;  3M0D A;  2XU6 A;  2BAS A;  4B86 A;  2WWW A;  3T97 A;  1GZL A;  3B8E B;  1YD8 G;  5AVV B;  1FOS E;  2ZFC A;  2Z5H A;  1GU4 A;  1IO4 A;  5APU A;  4AUW A;  3UIA A;  2WTY A;  3L36 A;  1NWQ A;  3VMX A;  4KHX A;  2YO2 A;  4GKG A;  2Q5U A;  1YYC A;  2QM8 A;  2YO3 A;  5AVS B;  3VN0 A;  1MFZ A;  2WT7 A;  1HWT C;  3A2A A;  1H89 A;  1OWA A;  5AVX B;  3HTK A;  1MV8 A;  4C7N A;  1GK6 A;  2H7H A;  1SLQ A;  5AVY B;  1NWM X;  2N9B A;  4AQR D;  3L37 A;  2Q7C A;  2E42 A;  5AW4 B;  1CI6 B;  5APY A;  3P7K A;  3P32 A;  3M0A A;  5AW1 B;  3KDP B;  5AVR B;  3HE4 B;  3A5T A;  3NTN A;  5APW A;  1JUN A;  2VRS A;  3TK1 A;  4HYT B;  2C9L Y;  2XZR A;  1WRD A;  1GK4 A;  3MGN A;  2YNY A;  3VMZ A;  3O8Z A;  2R5D A;  2P2U A;  1A02 F;  5AVU B;  3HE5 A;  2IPP A;  2W6A A;  1OXZ A;  3NMD A;  5APX A;  5AW6 B;  1O3X A;  2W27 A;  3TNU B;  1NAF A;  1KQL A;  3NXS A;  1X8Y A;  2P67 A;  5AW7 B;  5AVW B;  3KQG A;  5AW2 B;  1GD2 E;  3L35 A;  2R3C A;  3M9B A;  1MUU A;  3M06 A;  4RES B;  2WPR A;  5AVZ B;  2XV5 A;  4GT1 A;  5APQ A;  3M91 A;  1GTW A;  5AW9 B;  1T2K D;  2N9D A;  5AW0 B;  4I6M C;  3P8M C;  1DH3 A;  1WR6 A;  5AW5 B;  3SWF A;  5AVQ B;  3VTP C;  1S9K D;  4DZO A;  1CI6 A;  1HJB A;  2KP8 A;  1H8A A;  3VYI A;  1G2C B;  1HBW A;  3HE4 A;  3LID A;  5CMZ A;  2C9N Y;  1J2J B;  2WT7 B;  2E43 A;  5AVT B;  2R5B A;  4LC1 A;  2Q3I A;  2WPQ A;  4C7N B;  3M9H A;  1FOS F;  1H88 A;  5APS A;  2R32 A;  4EOT A;  4C46 A;  4AYC A;  4M3L A;  2QM7 A;  2WPS A;  3VMY A;  1FAV A;  3NFQ A;  1HUC A;  1X79 A;  3V4Q A;  2ZXE B;  3TYY A;  2P7J A;  1T2K C;  3A3Y B;  5APV A;  4JYB A;  1CZQ A;  1GU5 A;  2Z5I A;  2N2N A;  1S9K E;  3V4W A;  3TNU A;  1A02 J;  3OAK A;  4I2L C;  1SP4 A;  4JYC A;  3I5C A;  3LIE A; 
#chains in the Genus database with same CATH topology
 2LOP A;  3CQC B;  3AE8 A;  5H2F E;  3O1J A;  2VKO A;  2W6J H;  4IE5 A;  3S9O A;  2KSJ A;  3KV4 A;  3Q5E A;  3Q2Y A;  1BGY E;  1LWU A;  4U3F E;  3B8E B;  3CK6 A;  3JCF A;  2WSC H;  2PRR A;  1BR0 A;  2GA1 A;  1VQN P;  4UVC B;  1JMB A;  3PUQ A;  4ISS A;  1G2C A;  4GK0 E;  2YO2 A;  4GKG A;  2LEH A;  4UF0 B;  4TWD A;  3AA7 B;  2XQ5 A;  1W5C E;  1R8I A;  1HWT C;  3FGA D;  3E1I A;  2IDO B;  3H1H J;  3EAM A;  2HHH T;  2A45 H;  3CPW O;  1YI2 P;  4ERR A;  5JH7 E;  1Q82 Q;  2V7J A;  4IL6 H;  4ANJ A;  3NRX A;  5FL1 A;  2WDR A;  4NPF X;  1OED E;  1LVK A;  5AW4 B;  2YDS A;  4B6X A;  3P50 A;  1FZG A;  3KIN B;  2N1T C;  2CPS A;  4DV6 T;  1GL2 A;  3RHW A;  2WDQ A;  4EB6 E;  2C5K T;  2H89 C;  2E76 B;  1X79 B;  1JNR A;  5HEH A;  5HAX A;  2Q6Q A;  3VKH A;  1A02 F;  2D2C B;  2FYU E;  1H7C A;  1T8B A;  2KIK A;  1N7L A;  1L2P A;  2IDB A;  4U74 A;  1ZEE A;  2X9X A;  2ZT9 C;  2X66 A;  3B57 A;  1NTZ E;  3L75 J;  2WIT A;  1KN7 A;  5AW7 B;  2BS4 A;  1XTG B;  5FY0 A;  1IJ6 A;  1BR2 A;  1JM0 A;  4UVA B;  4PD4 E;  5AVZ B;  1N7S D;  1FJP A;  4YXD A;  1J1J A;  2GUV A;  3GN5 B;  2KNC B;  1T2K D;  2RKL A;  3HD7 D;  2V26 A;  1ZP0 A;  4HFH A;  2Y48 B;  5KX5 E;  3PTR B;  1YQ4 C;  2XAS B;  4ASV A;  3ANW B;  4OGQ D;  1HCI A;  4I7Z B;  2K1A A;  4DCK A;  1S9K D;  3NBX X;  4Z90 A;  5KLI C;  5KLV K;  3SRZ A;  5LB7 B;  2JQH A;  1AJ3 A;  4IFF A;  3SFD C;  3RRW A;  1KYO H;  5GTI H;  1US7 B;  2CMR A;  1QLB A;  2KLU A;  4LC1 A;  1GMJ A;  2WSE H;  1H88 A;  4LLH A;  2PGD A;  1PPJ D;  3TLU A;  2WQY C;  1KQF B;  2K9J B;  1D1C A;  3L8R A;  4OFZ A;  4B3R T;  1RE3 A;  3AE7 A;  3HI2 A;  4ZS2 A;  3BAS A;  3E08 A;  1SFC C;  3N9N A;  2Z5I A;  2RP4 A;  4ZI3 C;  2UUA T;  2Q1K A;  4JPZ B;  4I2L C;  1SP4 A;  3AAA B;  2XAH B;  1OIP A;  3ZCJ A;  1SQP J;  2KOG A;  4WVZ A;  4WY4 D;  3CX5 D;  2LKG A;  3ONX A;  4DR5 T;  1E2A A;  2NZ2 A;  3ZYL A;  2Z4E A;  4O4L E;  1ZRT D;  4HWC A;  1J1D C;  2YIU C;  1W2B O;  4NUU A;  2J5U A;  5DAB A;  3CCU P;  3JC6 D;  1T6A A;  5L8R J;  4DUY T;  2MYS A;  4I55 E;  2WT7 A;  3CMA P;  1T3J A;  2ITA A;  5CCH D;  2X9Y A;  2QJP C;  4IE7 A;  4LF8 T;  3D70 A;  2E74 C;  2N9B A;  3WU2 E;  2HN1 A;  3GHG C;  4UV8 B;  1NU1 J;  1VQ4 P;  5HEU A;  5KKZ C;  4XZC A;  2M6B A;  3Q2M A;  2XNX A;  1KEY A;  5AW1 B;  2FFD A;  4U72 A;  2L8K A;  3HE4 B;  4CI3 B;  3H1L G;  3B4S A;  1XDP A;  1HTL C;  3II6 A;  5J2U E;  2QJY C;  1HVV A;  2WVR A;  1SQB J;  3VRA A;  1IFI A;  2OV9 A;  3CME P;  5JDF A;  3D71 A;  3AVS A;  2ZYG A;  4QXB B;  1E5W A;  3IEE A;  3RRC A;  3R2P A;  2V6Y A;  1VDF A;  3CX5 I;  5H6Q B;  2B76 A;  2W00 A;  5AQJ B;  2LHN A;  4HFE A;  1PGO A;  4TWF A;  3RX6 A;  4PJ0 E;  1HR0 T;  1KFY A;  1GD2 E;  2C0S A;  5J1G A;  1SQP E;  4GDO A;  5LA6 E;  2XQ8 A;  1G8X A;  1UUS A;  2YN6 A;  2QEX P;  3PRJ A;  5B66 E;  5AW9 B;  4WZX A;  4EGW A;  1BGY G;  3T97 B;  3W67 A;  5TIS H;  1JTH A;  2BS3 A;  4PAG A;  3K8P C;  5DQW A;  5BU5 A;  1P84 I;  2EHO C;  5M1B A;  5ETW A;  4H13 C;  3VYI A;  5LYJ E;  3O1I A;  3TGU D;  3KZI E;  3RK2 D;  2LSG A;  2E43 A;  1YJ9 P;  5TJH A;  3G6E P;  5HEO A;  2P10 A;  2V5C A;  5JR9 B;  2WPS A;  1NU1 E;  4IGU A;  5GON E;  3RGL A;  3LK3 B;  2YMY A;  4UB6 E;  1J1D B;  2DWG A;  2AXT H;  1ZN5 A;  2CCQ A;  2YIU B;  3QOF A;  4KHZ F;  2NPS A;  2RPA A;  3AA1 B;  3ONJ A;  4IFD K;  5FXX A;  3GA8 A;  5L3E B;  3NWI A;  3C50 A;  4YTP C;  5LGU B;  1NGM B;  4H9N C;  2HPC B;  4IDO A;  2MKV A;  2QJP B;  4H0L C;  1YHQ P;  3B5N D;  4OVN F;  3GHG B;  2FYU G;  1Y9B A;  1ZOY A;  3AAI A;  5AQP B;  2YKS A;  1VQP P;  3V2P A;  1KIL A;  1NTZ G;  3FB2 A;  3L73 D;  5HEJ A;  2WP9 A;  1YYC A;  3BRT B;  3P7I A;  2CXD A;  1OWA A;  1N36 T;  4CXY A;  2H43 A;  3BK9 A;  2ZVN B;  3EWK A;  4EYY R;  4H44 B;  2UU9 T;  2ZT9 D;  2IYO A;  2C5J A;  4PK5 A;  3RLF F;  5APY A;  4MLK A;  1UUR A;  2W83 C;  4E7Z A;  3AE4 A;  1Z8U A;  4YT0 A;  2O3J A;  4JI8 T;  2QGS A;  3CCQ P;  3NTN A;  3RI5 A;  4BJM A;  3H1H G;  4GKK T;  2ZVO B;  2KZJ A;  1VQ5 P;  3QC9 A;  3BVH A;  2JJ9 A;  3I55 P;  4H9O C;  2JEE A;  2LXC B;  1DD4 A;  2FJB A;  4PV1 C;  3QNU A;  3VHL A;  5L4H A;  5CBN A;  5EK3 A;  2OLT A;  3KQG A;  1OED B;  3PUZ F;  5FY1 A;  3RKO A;  3L35 A;  5KMG P;  4NPE A;  5ABE A;  3LFM A;  3AE3 C;  2XSB A;  4JBZ A;  2XAG B;  4WB4 A;  4J2C A;  1SS1 A;  2CWY A;  4JUY A;  1LTT C;  1SFC D;  1Q86 Q;  2N9D A;  2YU2 A;  4CN6 A;  3I1A A;  3L75 G;  3F89 A;  2YKO A;  3ZEF B;  2HPJ A;  3FWL A;  2Q9Q C;  1RF1 A;  4ILA A;  3QB5 A;  2M5A A;  3E0Z A;  3HUS C;  3NZP A;  5L3C B;  1N7S A;  2R5B A;  2YXQ B;  2O01 N;  3CWB D;  3IHR A;  4DBR A;  3HD7 A;  4DV0 T;  2E9X C;  2JWA A;  3N9M A;  3PUX F;  1MIV A;  1S3J A;  5JDL A;  2N9Y B;  4TUY E;  4JBW F;  3P8C D;  4XBF B;  5CJ4 A;  2OA5 A;  3NRY A;  4ILC A;  3G71 P;  5AQT B;  3EHZ A;  4RO0 A;  1S9K E;  5FXW A;  3ZJ2 A;  2HYN A;  2WMN A;  1PGJ A;  3Q1M A;  5DQV A;  3A7O A;  3PJA J;  4UV9 B;  1FU1 A;  5AQU B;  2E74 D;  4Y28 J;  1XWM A;  5KJ7 C;  1KB9 I;  4L0R A;  4AQG A;  3VOP A;  1RY3 A;  1PPJ E;  2R3S A;  2LR2 A;  1YQ3 C;  3ZPO A;  3Q5X A;  4WW0 A;  2IW5 B;  3JCU E;  2UWJ E;  3IAO A;  2YXR B;  3RL0 g;  2H8P D;  2ODU A;  1VQ6 P;  1KC8 Q;  1SQP G;  3RPU A;  2HR3 A;  2O1J A;  4WY4 A;  4O2B E;  1MV8 A;  3EAB A;  3G4S P;  5L4E A;  3L37 A;  3CX5 E;  5IUX A;  1SVF A;  1KNP A;  1PP9 E;  4UF0 A;  1XDO A;  2OYI B;  3A5T A;  5CCH A;  4TLF A;  4YHH T;  2BG9 C;  3ZJ1 A;  1KOR A;  3TGU J;  4DR1 T;  4OX9 T;  1NU1 G;  2QE7 H;  2XDJ A;  2ODV A;  3HKE E;  3PJA A;  1RQV A;  2EHO D;  1P84 E;  2V7Q J;  4H13 D;  1CW5 A;  2OYH A;  3CIR A;  3CPZ A;  2LRL A;  2FXO A;  3C1L A;  3HUS B;  1OVU A;  1SQB G;  2LKH A;  4HFI A;  1LRZ A;  1PV3 A;  1WT6 A;  4RKU J;  3L70 D;  1IK7 A;  4YXW H;  3VRB A;  2FBW A;  3GG2 A;  4HKZ H;  5CA0 E;  3KVB A;  1FZC B;  4DND A;  2W4X A;  3AEE C;  1UX4 A;  2L9Q A;  5LP6 E;  4YFS A;  5FY7 A;  1U7J A;  1H8A A;  4KBM B;  3T1H T;  4IE0 A;  4QXH B;  5GTH H;  2IYP A;  3FXE B;  3MZW B;  5CMZ A;  4QKN A;  1L0L K;  1PGQ A;  2KXP B;  2MTQ A;  3AE2 A;  3L73 J;  2SPZ A;  2IML A;  2X0Y A;  4LMJ A;  4KI0 F;  2Y0E A;  2XZE A;  4JI4 T;  2ZXE B;  4HB1 A;  3CKD A;  1IFP A;  1VF5 C;  1M1J B;  5L47 A;  1U5P A;  1FDI A;  5LCY A;  4LF5 T;  2XND H;  3OPC A;  1SQV K;  4BRY B;  1JY2 O;  4PW8 A;  3N9O A;  3LG7 A;  2FXM A;  2J47 A;  1JCD A;  1T7S A;  2JJL A;  1S5L E;  4L73 A;  3F31 A;  1OW8 A;  5H2F H;  3TGU E;  2PJQ A;  5AW3 B;  3AEB C;  1WYC A;  3A0B E;  4IDZ A;  1PIX A;  3KV9 A;  2CPB A;  5CJ5 A;  3H3A A;  2KT9 A;  3TDK A;  3TLS A;  2IIU A;  2G8Y A;  3DTO A;  1FDO A;  1X22 A;  4ZHQ E;  4O4I E;  1AA0 A;  4OYK A;  3LBX B;  5JRC B;  5LHG B;  2YO3 A;  2BG9 B;  2UUC T;  2R44 A;  1NVO A;  3TSI A;  4W7Y A;  2D2S A;  4FI5 A;  3AEG C;  3PHL A;  2JQ9 A;  5LHI B;  2B88 A;  3V6I A;  4PV1 D;  4DJG A;  2A72 A;  5EK4 A;  1URQ B;  1IAP A;  4JI0 T;  2N1T A;  3UQ7 A;  4N6J A;  4ZI2 C;  3L73 E;  2JIW A;  2H89 A;  2Q3E A;  4ADZ A;  2Q9I A;  2XZR A;  1WRD A;  5BR8 T;  3Q5D A;  1DX7 A;  4X1Y E;  5JDN A;  2WSS H;  3LW5 H;  2Q9Q D;  2VL0 A;  3CWB J;  4A5X A;  4HKA A;  3RIA A;  2WU2 A;  3LSV A;  2O01 J;  1HX1 B;  3NXS A;  1X8Y A;  4U2Z A;  5AW2 B;  1UIX A;  1VCT A;  1VQO P;  5AQR B;  3PLN A;  1FZB A;  2K24 A;  4PD4 H;  1YQ4 A;  4PFP A;  1ZV4 X;  1PL5 A;  1SQP K;  4HFD A;  3ZCI A;  4JQ0 D;  1HJ0 A;  1D0Z A;  4YSZ A;  5TAO A;  3RBX A;  1BE3 D;  1S2E A;  1PPJ G;  1S4X A;  3SFD A;  3VTP C;  3U78 A;  1FZE A;  4KJM A;  2JQQ A;  3Q5S A;  3AE1 C;  2KP8 A;  3PU3 A;  3V2R A;  2ZM8 A;  1I6Z A;  5HXH A;  2C9N Y;  2VKH A;  2WQY A;  5DJT B;  3GMI A;  3UFG A;  5KJ7 D;  1ZKE A;  1KB9 E;  4DUZ T;  1SFC A;  5J0Z A;  4AYC A;  3AAE B;  3VMY A;  2NWB A;  4HFV A;  2QJK C;  2NRG A;  4JF7 A;  1N86 A;  2MPK A;  4EIJ A;  5CFB A;  1Q2N A;  1NU1 K;  3A3Y B;  3B71 A;  1NTM D;  2MOZ A;  1U4Q A;  2K3W A;  2V7I A;  2E76 C;  3RYH E;  5LHH B;  1LP1 B;  2VVN A;  2VUR A;  3GF7 A;  3MJX A;  5LG3 A;  2NPS D;  5AFU L;  3TLT A;  4F8H A;  4TNV A;  2WZI A;  1KQS O;  2QYW A;  3JAD A;  3MXZ A;  4IT4 A;  3P8C E;  3M0D C;  1DD3 A;  1FZA A;  1VL2 A;  2VB6 A;  4U7Y A;  2Q5U A;  4I7Z C;  4IDQ A;  1LTJ B;  4TN7 B;  1KIL D;  1UX5 A;  2WSS V;  2ZMA A;  3ONL C;  2PBI A;  3N2O A;  3WU2 H;  4KUM B;  2XY8 B;  4GK5 E;  3L70 J;  2Q7C A;  1KYO D;  2FYN B;  3KV5 A;  1LT9 C;  3J7Y q;  3BCC D;  5AQS B;  2XQ7 A;  4H9P C;  5KAF E;  4GOF A;  1WMK A;  2F4V T;  2M3E A;  1DEE G;  5JDM A;  3A8Y C;  4DR2 T;  1T8Z A;  1M7L A;  3OA7 A;  1YKH B;  1AVO A;  2PTF A;  3S4R A;  2W6A A;  5AQN B;  3MHV A;  4R4L A;  4GKJ T;  2BKN A;  4AKH A;  5IWA T;  2BEQ D;  3MTU E;  4X65 T;  2DL1 A;  4PJ0 H;  4BA9 A;  4QH5 A;  3CCL P;  3KDS E;  2H7V C;  3EDV A;  4NPD A;  2HG5 D;  3K3N A;  3TGU G;  1GDT A;  5EK2 A;  4GT1 A;  3QUJ A;  5B66 H;  1VQ9 P;  2QJK B;  1VF5 D;  3O6Q B;  1IFD A;  2EHO A;  3OJA A;  4XFJ A;  3B5M A;  3FBZ A;  4QXC B;  4H9Q C;  3SWF A;  5AQF B;  3CCV P;  2LE8 A;  2W61 A;  1Z56 A;  1L4A C;  4GIF A;  2YK0 A;  4AIU A;  1M57 D;  3KZI H;  1U57 A;  4MFR A;  2CHO A;  3H32 A;  4P1N A;  2AEM A;  4C7N B;  2B1E A;  1Q90 D;  3R84 B;  1GQE A;  2B89 A;  1D1B A;  2A9U A;  4EOT A;  4QHO A;  4MN4 C;  4UB6 H;  2XUE A;  3RIU C;  2B87 A;  2XJ7 A;  4YTP A;  2KSE A;  1GU5 A;  2OTL P;  1D0X A;  3HKC E;  2X0H A;  2KUB A;  3L73 G;  4JI6 T;  5CHX A;  5ABF A;  3UUB A;  4WBO A;  5HXE A;  1HH0 A;  1N32 T;  2XQ6 A;  3B13 A;  3N7N A;  4HJG H;  3V5B A;  3H1H E;  3H6P A;  3HE5 B;  4A97 A;  3J9X 1;  1YTZ T;  2X67 A;  2DNX A;  1EDJ A;  2DW3 A;  1LT9 B;  4GOE A;  1GZL A;  3D6Y A;  2N1G A;  2D0U A;  4ZI2 D;  5CCG C;  2ZFC A;  2OYO A;  5KLV D;  2QM8 A;  4U2Y A;  4UR9 A;  3PJS K;  3SWK A;  1Q81 Q;  3HTK A;  1NTK K;  1L0N D;  2L5G B;  1EXJ A;  2M67 A;  4HFC A;  1NWM X;  1T72 A;  1QL2 A;  2BKO A;  3RK2 B;  1DIP A;  2I6H A;  4GYR A;  2NW9 A;  2WSC J;  2WZH A;  4IE4 A;  5JR9 C;  1BE3 J;  1S5L X;  3L75 E;  2BEZ F;  2LOS A;  1DU2 A;  3KBU A;  2J59 M;  3HRN A;  4LF7 T;  3V2N A;  2ZAE B;  4YJ3 E;  2KLV A;  4HYT B;  3RK3 E;  1M1K Q;  4YY3 T;  1Y47 A;  1IC2 A;  2IZ1 A;  4N78 D;  4AKR B;  3AA0 B;  3Q5W A;  3O9X A;  1YW0 A;  3I0Q A;  2YU1 A;  1IFM A;  1OFC X;  1L4A B;  1NAF A;  1S1C X;  3B5N B;  5FNV E;  4DR7 T;  3AE3 A;  3VKG A;  5FP3 A;  2V7M A;  5LOV E;  3IF4 A;  1NTM J;  4DV1 T;  1KFM A;  2Y6X A;  4A56 A;  3H1J D;  3DJB A;  4RES B;  1V9D A;  3V5S A;  3F57 A;  2Q9Q A;  3CWB G;  2A2F X;  2BVM A;  2WMO A;  4R4M A;  2E76 D;  4ZEY A;  4YPC A;  4KT0 J;  1LT1 A;  2D2C D;  2KZI A;  4H44 C;  1BDC A;  2RA1 A;  2HOD A;  3SOL A;  2E9X A;  3AE8 C;  2K9A A;  3IA3 A;  3UU5 A;  3HR0 A;  2BBH A;  2JDI H;  4B3S T;  3PUY F;  3EQ2 A;  4YJ2 E;  2DHR A;  1BE3 E;  3IFM A;  2LHR A;  1EQ7 A;  3RQU A;  1CZQ A;  4OYJ A;  4OWF A;  3ZMU B;  2DCF A;  3AA6 B;  1BCC D;  3L3P A;  3H3M A;  4M1P A;  5KJ7 A;  3PV0 F;  1HNW T;  4EOZ B;  2QA4 P;  3O4X E;  4CXX A;  3BCC J;  3E22 E;  1AVY A;  3G06 A;  2GK9 A;  1WR0 A;  3IR9 A;  1YQ3 A;  1OED C;  5KAI E;  3MK7 C;  1KF6 A;  2XU6 A;  3EFF K;  4D6T D;  1JY3 P;  1Q7Y Q;  2K5B B;  5BMV E;  3QWO C;  4ILU A;  3JCU H;  4N3Y B;  1FIO A;  3PDY A;  3UUN A;  1IO4 A;  5APU A;  4AUW A;  3F5H A;  1H0T A;  3KYQ A;  3EVY A;  4B3T T;  2HPL A;  3HL6 A;  3GMA A;  3BQK A;  1EC5 A;  4U7J A;  3K3Q C;  5AQI B;  2KS1 A;  2E5Y A;  1GK6 A;  5LBQ B;  1SQB E;  2MJZ A;  1IJD B;  3CX5 H;  2PG8 A;  1FBM A;  1VCS A;  4X1K E;  5JTG A;  2LM9 A;  1J1E B;  2FXP A;  4EYU A;  3FXD A;  2KWI B;  3BRV B;  1NYH A;  3AED C;  4Z8X A;  3CVR A;  2P9B A;  2N1T D;  2VRS A;  2Z6E A;  4XA4 A;  5FMN A;  2JMH A;  4EIW A;  3H25 A;  3L71 D;  1KIL E;  2K37 A;  3AEF A;  5LNK A;  3L70 G;  2LKM A;  5L2L A;  3OTO T;  2LSK A;  4U3C A;  3Q5P A;  5HWY A;  1IZN B;  1JY3 N;  1P84 H;  3R4Y A;  3TNU B;  3ZSS A;  1KQL A;  2DWK A;  2A06 D;  3E7K A;  3N9Q A;  3HKD E;  4Z91 A;  5E79 E;  4AIS A;  3ZMS B;  5KTB A;  3AEE A;  3R6N A;  2BCC D;  5LBM A;  3ITK A;  5AQM B;  1RE3 C;  1DH3 A;  5AW5 B;  3UU4 A;  2GUS A;  2WMM A;  1CI6 A;  4P09 A;  4I4T E;  3AXJ A;  3UUX B;  2M6I A;  3PUS A;  3I9Y A;  1G2C B;  1RQU A;  3AEA C;  3QH9 A;  3C64 A;  2OYI C;  1KFN A;  5KLV J;  2KND A;  2C0X A;  2XAF B;  2P7J A;  2QSI A;  2IFM A;  1B7T A;  1IK9 A;  1AV1 A;  5CCG D;  1L0N J;  1NJI Q;  3N4X A;  1A02 J;  3CML A;  3BAT A;  4JYC A;  3AEB A;  3PH0 A;  3IBP A;  3ZMV B;  4ZI3 D;  1GL2 B;  1S5L H;  3CLQ A;  2IUB A;  1JMM A;  4WBN E;  3PTZ A;  4DID B;  3TF5 A;  3A0B H;  1SUM B;  1QX8 A;  5APT A;  1XNR T;  3PU8 A;  1HG5 A;  1N2D C;  2V7Q H;  2FKW B;  2FUP A;  4IHJ E;  4ASK A;  2WBL A;  1ZXG A;  2J58 A;  3WI3 A;  4GIW A;  1RHZ B;  1FZC C;  1UII A;  1LVF A;  3JAE A;  2WTY A;  1MMN A;  3AEG A;  2CWO A;  4KHX A;  1G73 A;  4PJM A;  4AQF C;  3O1H A;  3H1J J;  3RL0 B;  3H1K D;  3UQ4 A;  1D0Y A;  2BKP A;  4UEM A;  4QX7 B;  3HA4 A;  3G3Z A;  1RE4 C;  4CZZ B;  4EV6 A;  1ZME C;  2JMK A;  3Q5R A;  4IDP A;  2FJA A;  1ZHC A;  1M1J C;  4UB8 E;  3CCE P;  1MKM A;  4NPP A;  1ZW0 A;  1X0T A;  2C9L Y;  2K3R A;  2P1J A;  3MGN A;  5K5G B;  4AQY T;  1L0N E;  3ZYK A;  5FVK A;  3P4P A;  2HN2 A;  1BE3 G;  3W15 B;  4H44 D;  5CA1 E;  2E5L T;  2M0B A;  1D1A A;  2WU5 A;  1SQQ D;  1Y8A A;  3PP5 A;  1K73 Q;  1IBL T;  3OYX A;  3P4W A;  1BGY D;  1ZRT E;  4U3F D;  2QIW A;  1BCC J;  1NO4 A;  3MA9 A;  4IE6 A;  3GLM A;  1YIJ P;  5BVZ A;  4HTE A;  1XZY A;  2QG4 A;  4JLE A;  3EDU A;  3RK3 B;  3GWH A;  2WY2 A;  3V2Q A;  3ZT7 A;  3P4Q A;  3AE6 C;  3SSU A;  4D6T J;  3OKQ A;  1ZV8 A;  2FYU K;  3LID A;  1URQ C;  2WT7 B;  4I1L A;  1KB9 H;  2OGU A;  3O6Q A;  1J5W A;  3AE9 C;  2G0U A;  1NTZ K;  3RF1 A;  1M8O B;  1BSN A;  5JRE A;  3A7M A;  3NFQ A;  4WBA A;  1X79 A;  2JWD A;  3TYY A;  4JI2 T;  2D9D A;  4LFA T;  2WSF H;  2E75 C;  2ZXX A;  2I8D A;  4K35 A;  2FFD B;  4EAH A;  3I9W A;  1FJK A;  2CXF A;  2XTL A;  5C8Y E;  2E2A A;  3SWY A;  1EZV D;  3E1R A;  4QMA A;  3M0D A;  2L3L A;  4H0L D;  3BQI A;  2KNC A;  3GN5 A;  2BAS A;  4H9R C;  4B86 A;  2V6Y B;  1NOH A;  4L5G A;  3GF3 A;  3L71 J;  3ANW A;  3LK2 B;  1GW4 A;  4IL4 A;  4O2A E;  5AVV B;  4PD4 D;  4UXN B;  1Y01 A;  4YSX A;  3FZL B;  1NHL A;  1BCC E;  4QH1 A;  2KK7 A;  2CM0 A;  2WWU A;  2OAR A;  2ZJS E;  3VN0 A;  3ETV A;  4JI5 T;  2W90 A;  1EDL A;  4B3M T;  1EDI A;  1QVF O;  2H7H A;  1LT9 A;  1SLQ A;  1L0L D;  2SPC A;  5AVY B;  4NXM T;  3QK6 A;  2BVL A;  2K9J A;  3CXH D;  1JNZ A;  1JTH B;  3KVA A;  1HF8 A;  4D6T E;  2BCC J;  2I1K A;  3P32 A;  1K04 A;  1OVR A;  2NTY A;  1YBK A;  5AVR B;  3VR8 A;  4DR6 T;  3ZYM A;  1OW6 A;  5KAF H;  4HH2 A;  5B5E H;  3VP9 A;  2W62 A;  1SQV D;  4IIJ E;  3OYZ A;  5LMU T;  3C4Z A;  5JDG A;  1EZV I;  1RF0 C;  2XQ4 A;  5APX A;  1RH5 B;  2CE7 A;  4HE8 A;  2XQ9 A;  1KTM A;  4JEU B;  1RF1 C;  3UT5 E;  5EZY E;  1FJG T;  1T3U A;  2LT3 A;  4EED A;  3AEC C;  4PD4 I;  4DO0 A;  1AJY A;  2NW8 A;  1BR1 A;  3N9P A;  3ZMT B;  3L71 E;  4OGQ C;  2E75 B;  1LTJ C;  2JR8 A;  1KIL B;  3KFW X;  2ES0 A;  4ILB A;  2JO1 A;  2KSR A;  3KHU A;  3L39 A;  3CXH I;  4WWI A;  3ZLI A;  4WNK A;  3UU3 A;  4O4J E;  5JDQ A;  1HBW A;  3HE4 A;  3LDQ B;  2FYN C;  2WB5 A;  1JEK A;  1K05 A;  2A06 E;  1L0V A;  1E7P A;  3RIU A;  3RC8 A;  2KMF A;  2CRB A;  1QVG O;  5HYA A;  4GOU A;  1UCU A;  2QM7 A;  2UXD T;  1EZ3 A;  2E9X D;  4I0U A;  2BBJ A;  2XPK A;  2JKV A;  2WPV B;  4Q25 A;  5DJQ C;  1VQK P;  2VL8 A;  3PUW F;  3A0H E;  3T1Y T;  3H1K J;  3I5C A;  2I0M A;  3VP8 A;  3MD0 A;  1WFD A;  5KLV G;  1FE6 A;  2CHN A;  2V6X A;  1MND A;  3K1S A;  4CI2 B;  2FJD A;  5CCG A;  1L0N G;  4TT3 H;  3CWZ B;  1MMD A;  3T97 A;  1VOM A;  1BSH A;  3RH3 A;  2IZ0 A;  4K0K T;  4UEL A;  3C9I A;  1LKX A;  2ZYA A;  1UGO A;  3FZK B;  1PGP A;  4IOI H;  3P4S A;  3AVR A;  4Z1M H;  2NP9 A;  1KNZ A;  4P0B A;  5HWX A;  1SQQ J;  5AVX B;  1R5L A;  1BGY J;  2LSY A;  1LTI C;  3N9L A;  1FMV A;  4C7R A;  4U3F J;  4KX6 A;  5JR9 A;  2BDE A;  1SQB K;  1E1H B;  2M3B A;  2Y0D A;  1RF1 B;  3CWB E;  2M5A B;  3W68 A;  3PE0 A;  3IF8 B;  3ZMZ B;  1HNZ T;  4LFB T;  1N7S B;  4LMK A;  4WYV A;  2YKQ A;  2HPC A;  1ZR2 A;  3OVU A;  3HD7 B;  3H1J G;  4OGQ B;  1ZLL A;  1HS7 A;  2A45 I;  2YKP A;  2ACX A;  3GHG A;  2W6B A;  2E8I A;  3CX6 B;  3H1K E;  5C3J A;  3H37 A;  3C51 A;  1GW3 A;  1LTS C;  1NEK A;  2CK3 H;  4NXN T;  5C39 A;  4JI7 T;  3HKB E;  3NVO A;  3U1A A;  1BR4 A;  5J2T E;  4LML A;  5B5E E;  2D0T A;  2FJE A;  5CB4 E;  2W63 A;  4L75 A;  1S94 A;  1SQX D;  4CI1 B;  2XM1 A;  1I94 T;  4DZO A;  3L72 D;  1HJB A;  3L09 A;  2KYV A;  3JSV C;  3RK2 C;  4NIQ A;  1BCC G;  1SQQ E;  4WY4 B;  3L74 D;  3T8O A;  3P4R A;  3U59 A;  4W7Z A;  5FXV A;  3ETU A;  1XNQ T;  4G63 A;  5F8P A;  3RKG A;  1UK5 A;  2ZLY A;  2KB7 P;  4XAX B;  4D6T G;  3F2E A;  2W0G A;  1L0L J;  2N2N A;  4H63 V;  1EXI A;  1KNR A;  5DJU B;  3CD6 P;  3V4W A;  3OAK A;  4PNI A;  4JYA T;  5LG4 A;  1OED A;  2Y9Y A;  2JP3 A;  4U7I A;  1N34 T;  2I59 A;  1KYO I;  3B5N C;  5KAI H;  1SQV J;  2CA5 A;  3QB5 K;  2OYH B;  3L70 E;  2LLY A;  4Y99 C;  1VRB A;  3SS1 A;  3CCR P;  1KQG B;  1NWQ A;  2IBZ D;  1USD A;  4X66 T;  2JRK A;  1AFO A;  5CJ0 A;  3DP7 A;  3K3O A;  1IBM T;  1EZV E;  4JI1 T;  2X0L B;  4A7P A;  3ZDM A;  4DR3 T;  1TU3 F;  3H1I D;  3L71 G;  4DR4 T;  4DMV A;  5LMN T;  3AED A;  3UUL A;  2RN0 A;  1VQ8 P;  5HXR A;  3FBL A;  3MUD C;  5LGN B;  5ABH A;  2KIN B;  3FZF B;  2XQY A;  2ZM2 A;  2A06 G;  2W8Z A;  4QWN B;  2YNY A;  3VMZ A;  3C98 B;  5AVU B;  1L0L E;  2BCC G;  2IPP A;  3NMD A;  2VKD A;  3FZH B;  4EDF A;  5FKY A;  3CXH E;  1E79 H;  1L0N K;  3KXD A;  3X1D A;  3CI9 A;  4C90 A;  2XHE B;  1YIT P;  2WM9 A;  2GM4 A;  1QUU A;  5HCM A;  5AQQ B;  5AVW B;  5BU8 B;  4UVB B;  2R3C A;  2XQA A;  3M9B A;  2PP6 A;  5E79 H;  3SFE C;  1MIY A;  3AE5 C;  1IJ5 A;  4YTN A;  1SQV E;  2IBZ I;  4DVD A;  1QLE D;  3M91 A;  1HG2 A;  5M4Y A;  1GTW A;  1N8R Q;  1YXR A;  3ABV C;  3C4X A;  1WYB A;  3WAK A;  3CCJ P;  2CLY C;  2OTK E;  3AEA A;  1NTK D;  5AVQ B;  1MNE A;  3WUT A;  4IDN A;  4HN9 A;  3Q9D A;  4KMC A;  4YSY A;  1J1E C;  2OYI A;  3ZC1 A;  2Q3I A;  2WPQ A;  4COF A;  3RYC E;  5IYZ E;  3D0T A;  1PP9 D;  2VK9 A;  3MP7 B;  4OK0 A;  1N73 C;  2CPT A;  3KBT A;  2NTX A;  4DBQ A;  5LJM A;  2N1T B;  2H88 C;  4EYY Q;  4Y99 B;  4AKG A;  1OMI A;  5C2T A;  3PUG A;  2FYZ A;  2XAJ B;  3LIE A;  3HUS A;  4L76 A;  2AEF A;  2QRX A;  1PZQ A;  1JO5 A;  1P84 D;  4DV4 T;  2ZT9 B;  4XE5 B;  5AQO B;  2UXC T;  4ZZB A;  3N2K E;  1YJW P;  3NZQ A;  3ZN1 B;  1WRG A;  1FZC A;  5FYM A;  4BJN A;  4AI6 A;  4O9B A;  3FWN A;  3RC3 A;  4AQF A;  3H1K G;  2WS3 A;  3AB3 B;  1XTC C;  2YIN A;  2IC9 A;  1LWU C;  2LJL A;  2VAS A;  4IST A;  4JEH B;  3FXE A;  5AVS B;  3MZK B;  1H89 A;  3ZN0 B;  4CXW A;  2WAU A;  5KLI B;  5HCJ A;  2A3D A;  4ZS3 A;  4EXT A;  3CX8 B;  2WSE J;  4IL6 E;  2IX7 C;  1RE4 A;  4AQR D;  1LTG C;  2NW7 A;  3D6Z A;  4V1A v;  1MZ9 A;  1M1J A;  3P7K A;  2J1D G;  3C4W A;  4W80 A;  4IFM A;  5JQG E;  3LJC A;  4BRY A;  1SQX J;  4BAY B;  4UB8 H;  4MAL A;  1SQQ G;  4MHC A;  2WCA A;  2LSI A;  3L72 J;  1JUN A;  1NTM E;  4LFC T;  2HH7 A;  1SFC B;  4ZKU A;  1GK4 A;  4U3F G;  1T98 A;  2W67 A;  1W2E A;  2R5D A;  2P2U A;  1GL2 C;  5F5W A;  2ZYD A;  4YLH A;  5A1L A;  3L74 J;  2BZB A;  2CLY B;  4PJJ A;  5E0O A;  1G1J A;  2AE9 A;  2YDR A;  5AW6 B;  1O3X A;  1BDD A;  4FJO A;  3KPE A;  1NAY A;  2W27 A;  2AEJ A;  4JI3 T;  2UXN B;  2V5D A;  4UIG A;  4PJL A;  1M7K A;  4HGA A;  3LBX A;  5JRC A;  2B9B A;  3I0O A;  4IL9 A;  2BG9 A;  1AQT A;  1ZR4 A;  1N73 B;  4HWF A;  5FL0 A;  5APQ A;  1USE A;  3AE6 A;  2BG9 E;  3CC2 P;  4I43 B;  1FDM A;  4YXD C;  1FMW A;  3K5B A;  4YHJ A;  1URQ A;  3EUH A;  3UU8 A;  1ZP0 C;  3FX0 A;  3RL0 C;  3AE9 A;  4HWI B;  1L4A D;  2E74 B;  4TZ4 C;  2C0W A;  1KYO E;  5GTI E;  5KXJ A;  3MIW A;  2O1K A;  3RBZ A;  5KKZ B;  1S35 A;  4QX8 B;  1EZV G;  2R32 A;  3BCC E;  4HEA A;  1FAV A;  5CGM A;  2J4G A;  3V4Q A;  4ZKP A;  3I56 P;  4LF4 T;  2K9Y A;  2QJY B;  4X1I E;  1SQX E;  1LWU B;  3H1I J;  3AE7 C;  3L72 E;  1R5S A;  1CHU A;  1HNX T;  3CL3 D;  2LM2 A;  4K0U A;  5AW8 B;  3L74 E;  1WCR A;  3ZT5 A;  1CSB A;  1SA0 E;  1JOC A;  1PFI A;  1L0L G;  3L4F A;  4DOJ A;  3WMM 0;  1NKN A;  2XKM A;  1HFA A;  4G2A A;  2V4H A;  2VQE T;  1FOS E;  1OZH A;  3UIA A;  3RK3 C;  3L36 A;  4CQI A;  5L3F B;  3VMX A;  4HFB A;  1M62 A;  4EEB A;  1OX3 A;  2XM2 A;  4X5T A;  3A2A A;  4LF6 T;  2HLO A;  1SQV G;  3G9R A;  3M65 A;  3UTK A;  4DV7 T;  2EHO B;  3OJA B;  1HX8 A;  1KMI Z;  4CPG A;  4H13 B;  4HWH A;  4CN1 A;  2E5T A;  1FS0 E;  2E42 A;  1KV4 A;  2LXB A;  1HGV A;  2KLQ A;  5ABG A;  1J5E T;  3GW6 A;  1KB9 D;  3M0A A;  4PK4 A;  1M56 D;  1LP1 A;  1JY2 P;  4GOD A;  1G1I A;  1NTK J;  3JC2 2;  5JVD E;  2AXC A;  3H32 B;  1MFT A;  1RF0 A;  2FFD C;  2IBZ E;  1CUN A;  3TK1 A;  2AXD S;  4PFO A;  4TV8 E;  2OQQ A;  4QH4 A;  2OTJ P;  3FZM B;  2B87 B;  3CC7 P;  3TLV A;  1VQ7 P;  1OXZ A;  1PP9 J;  3H1I E;  2VVS A;  2VQF T;  3AEC A;  4YTM A;  3LK4 2;  3RYI E;  3H1L D;  2P67 A;  1NH4 A;  2XQ3 A;  4ZZC A;  4H0L B;  5ABF B;  4JV5 T;  2ACZ A;  3ZT6 A;  4MBQ A;  4ASW A;  1LTJ A;  3C8V A;  3VR9 A;  3CCM P;  1JY3 O;  4O8S A;  2Y0C A;  4ZNC A;  4LGD E;  5KLV E;  1WR6 A;  1W0B A;  4A98 A;  2Y8D A;  3MKD A;  4GYS A;  1LGH B;  3ZST A;  5TIS E;  5HXS A;  3CQX C;  3WAJ A;  1YTZ I;  2RMZ A;  2X51 A;  3FHN A;  1IFJ A;  1FZF A;  1JY2 N;  1OW7 A;  2NOX A;  2UXX B;  1J2J B;  5AVT B;  1QSD A;  3HTK B;  2UXB T;  3M9H A;  2MAW A;  1SQQ K;  2I1J A;  3KV6 A;  5APS A;  1SE7 A;  2M8R A;  2A45 G;  1FEW A;  1QL1 A;  4I50 E;  3S4U A;  2Y9Z A;  2JQK A;  2IFN A;  3RQW A;  4ZMD A;  1S72 P;  2AXT E;  5APV A;  1DEB A;  4K3A A;  1NEN A;  4DV5 T;  1NTK E;  3AE1 A;  1LNQ A;  2X9H A;  2IC6 A;  3A0H H;  4N78 E;  2H3R A;  2WWV A;  2DI4 A;  1NKZ B;  2NPS C;  1MMG A;  1NTM G;  5L3D B;  2V7L A;  1JCC A;  4PV1 B;  2IHR 1;  1JNM A;  2PAJ A;  2WZ7 A;  5JDH A;  3OBV E;  5LGT B;  5FXZ A;  4EZ4 A;  1YJN P;  3H1J E;  4IRE A;  5ADX L;  4AKL A;  4X64 T;  4OH8 B;  4X62 T;  1ZOY C;  2V8S V;  1QGK B;  4L9I A;  2ZM6 T;  4TWH A;  1KIL C;  1MFZ A;  1GL2 D;  4C7N A;  2KZ7 B;  2Q9Q B;  1IBK T;  2FYU D;  4AKI A;  1X9B A;  3AEF C;  2K48 A;  3UUM A;  3BQL A;  4KP3 C;  2BS2 A;  1N33 T;  4NUV A;  4AXP A;  1NTZ D;  4BXL A;  2JPF A;  2NR4 A;  4H9S E;  1HTJ F;  2G3A A;  2P58 A;  2HOD B;  2O01 H;  2E9X B;  4P0A A;  2W66 A;  3N5L A;  4DMW A;  2POH A;  3CC4 P;  3AE4 C;  3ZC0 A;  1QEX A;  3A5X A;  1XMQ T;  3WUU A;  4TX5 A;  2RH0 A;  1K9M Q;  3BCC G;  2MBG A;  3HE5 A;  4TV9 E;  3USS A;  3RL0 D;  4C91 A;  1SQX G;  1M90 Q;  2VKJ A;  3VU7 H;  4KHP T;  3MAC A;  4ZOL E;  3H1H D;  3L72 G;  2H7O A;  2YEV C;  1FC2 C;  1HF9 A;  3M06 A;  2PFX A;  2E5V A;  5KDM C;  4IL6 X;  2QVA A;  2XV5 A;  1X9V A;  3L74 G;  3NKZ A;  5LJN A;  2LRK A;  2UUB T;  4I6M C;  2V1D B;  3CX7 B;  2CBJ A;  5CBO A;  4F6R C;  3TLW A;  1H0T B;  2HFE D;  2NPS B;  4BWN A;  1K8A Q;  1EDK A;  1Z0P A;  4PK6 A;  2KS1 B;  4PJN A;  1W9R A;  3OW2 O;  2V7K A;  2L91 A;  1N7S C;  3L75 D;  4O4H E;  4OHF A;  2IAK A;  1IFN A;  1T2K C;  3HD7 C;  4JYB A;  3FXD B;  5F3J A;  4ZXL A;  4DV3 T;  3RK3 D;  5IHY A;  1W0A A;  1L4A A;  3SWH A;  3M3Z B;  4HWD A;  3B5N A;  2J62 A;  1MMA A;  4EI2 A;  3ZKR A;  2IBZ G;  3VMA A;  1KD1 Q;  2CXL A;  3IN6 A;  3CCS P;  4LF9 T;  2WSF J;  2WWW A;  1U7M A;  3H1I G;  1R8E A;  1YD8 G;  1YKE B;  5AQV B;  2BCC E;  4U31 A;  2Z5H A;  1VPC A;  1GU4 A;  2ZM0 A;  1W09 A;  1OVV A;  1VQL P;  1LTB C;  5AQH B;  3H1L J;  1KK7 A;  2WDV A;  3UU6 A;  1XMO T;  1MIW A;  2DLR A;  3MUD A;  3ESL A;  1HGZ A;  4U33 A;  2X9W A;  2XSA A;  3M9Q A;  4DV2 T;  4WY4 C;  1CI6 B;  3RIF A;  3EI0 A;  3AXJ B;  3KDP B;  1SQP D;  3V5U A;  5EFW B;  3PUV F;  5APW A;  2YMK A;  5L3G B;  1LTA C;  2LSJ A;  3PUA A;  3JC6 C;  2PFV A;  1VF5 B;  3WUV A;  4H63 H;  5H6R B;  5HXC A;  1NTM K;  3O8Z A;  2QA7 A;  1SHZ C;  5CCH C;  2CEA A;  5LXT E;  2KWH A;  4X20 E;  3CXH H;  1NTK G;  3SFE A;  4RJT A;  3EFG A;  3AE5 A;  3PUR A;  3UFE A;  3TKL B;  2FY8 A;  2OYH C;  5HEG A;  5AQL B;  2K88 A;  4E7S A;  4ZI7 E;  1MUU A;  4DT0 A;  3ABV A;  2WPR A;  1NU1 D;  5AQG B;  2XAQ B;  2YDQ A;  1Y64 B;  3CQG B;  1PP9 G;  2W2U A;  5AW0 B;  3P8M C;  2D2C C;  3S1K A;  2X68 A;  3N2G E;  3U1C A;  4EZH A;  2FBW C;  2KI7 B;  3RYF E;  1KZU B;  1WLX A;  1VQM P;  1SQB D;  3Q3D A;  3H1L E;  5GTH E;  1N73 A;  5AQK B;  2CBI A;  1D7M A;  1URQ D;  5L3B B;  2C5I T;  1FOS F;  2H88 A;  1LJ2 A;  3JAF A;  4C46 A;  4M3L A;  3RGU A;  3AE2 C;  1HUC A;  2R6G F;  4CN4 A;  2VWA A;  5FVL A;  4L74 A;  3U3I A;  2YOE A;  2FYU J;  1AQ5 A;  2D5U A;  1JB0 J;  3LW5 J;  2E75 D;  3TNU A;  1NTZ J;  4TNW A;  1SQX K; 
#chains in the Genus database with same CATH homology
 2LOP A;  3CQC B;  3O1J A;  2VKO A;  4IE5 A;  2KSJ A;  3KV4 A;  1LWU A;  3B8E B;  2WSC H;  1BR0 A;  4UVC B;  3PUQ A;  4ISS A;  1G2C A;  4GK0 E;  2YO2 A;  4GKG A;  2LEH A;  4UF0 B;  3AA7 B;  1HWT C;  3E1I A;  2A45 H;  4ERR A;  5JH7 E;  2V7J A;  4ANJ A;  3NRX A;  1LVK A;  5AW4 B;  4B6X A;  1FZG A;  3KIN B;  2N1T C;  2CPS A;  1GL2 A;  4EB6 E;  2C5K T;  1X79 B;  5HAX A;  3VKH A;  1A02 F;  1H7C A;  1N7L A;  4U74 A;  1ZEE A;  2X9X A;  2X66 A;  3B57 A;  2WIT A;  5AW7 B;  1XTG B;  5FY0 A;  1IJ6 A;  1BR2 A;  4UVA B;  5AVZ B;  1FJP A;  1N7S D;  2GUV A;  3GN5 B;  1T2K D;  3HD7 D;  2V26 A;  2Y48 B;  5KX5 E;  3PTR B;  2XAS B;  3ANW B;  1HCI A;  1S9K D;  3NBX X;  5KLV K;  3SRZ A;  1AJ3 A;  4IFF A;  3RRW A;  1US7 B;  2CMR A;  4LC1 A;  2WSE H;  1H88 A;  4LLH A;  1D1C A;  4OFZ A;  1RE3 A;  3HI2 A;  4ZS2 A;  3BAS A;  3E08 A;  1SFC C;  3N9N A;  2Z5I A;  2RP4 A;  4ZI3 C;  4I2L C;  1SP4 A;  3AAA B;  2XAH B;  3ZCJ A;  2KOG A;  4WY4 D;  3ONX A;  3ZYL A;  2Z4E A;  4O4L E;  1J1D C;  4NUU A;  5DAB A;  3JC6 D;  2MYS A;  4I55 E;  2WT7 A;  1T3J A;  5CCH D;  2X9Y A;  4IE7 A;  2N9B A;  3GHG C;  4UV8 B;  4XZC A;  3Q2M A;  2XNX A;  5AW1 B;  2FFD A;  4U72 A;  2L8K A;  3HE4 B;  4CI3 B;  1HTL C;  3II6 A;  5J2U E;  1HVV A;  1IFI A;  5JDF A;  3AVS A;  4QXB B;  1E5W A;  3IEE A;  3RRC A;  3R2P A;  1VDF A;  5H6Q B;  2W00 A;  2LHN A;  3RX6 A;  1GD2 E;  2C0S A;  5J1G A;  5LA6 E;  1G8X A;  5AW9 B;  1JTH A;  4PAG A;  3K8P C;  5DQW A;  5BU5 A;  2EHO C;  5ETW A;  3VYI A;  5LYJ E;  3O1I A;  3RK2 D;  2LSG A;  2E43 A;  5JR9 B;  2WPS A;  4IGU A;  5GON E;  3LK3 B;  2YMY A;  1J1D B;  2DWG A;  1ZN5 A;  2CCQ A;  2NPS A;  3AA1 B;  4IFD K;  5FXX A;  3GA8 A;  5L3E B;  3C50 A;  5LGU B;  4H9N C;  2HPC B;  3B5N D;  3GHG B;  3AAI A;  3V2P A;  1KIL A;  3FB2 A;  1YYC A;  3BRT B;  3P7I A;  2CXD A;  1OWA A;  4CXY A;  2H43 A;  3BK9 A;  4EYY R;  2C5J A;  4PK5 A;  5APY A;  4MLK A;  4E7Z A;  2QGS A;  3NTN A;  4BJM A;  3QC9 A;  3BVH A;  2JJ9 A;  4H9O C;  2JEE A;  3VHL A;  5EK3 A;  3KQG A;  5FY1 A;  3RKO A;  3L35 A;  5KMG P;  3LFM A;  2XAG B;  4WB4 A;  4J2C A;  2CWY A;  4JUY A;  1LTT C;  1SFC D;  2N9D A;  2YU2 A;  3I1A A;  2YKO A;  3ZEF B;  2HPJ A;  2Q9Q C;  1RF1 A;  3E0Z A;  3HUS C;  3NZP A;  5L3C B;  1N7S A;  2R5B A;  3IHR A;  4DBR A;  3HD7 A;  2E9X C;  3N9M A;  1MIV A;  5JDL A;  4TUY E;  3P8C D;  4XBF B;  3NRY A;  5CJ4 A;  2OA5 A;  1S9K E;  5FXW A;  3ZJ2 A;  2HYN A;  2WMN A;  5DQV A;  3A7O A;  4UV9 B;  1FU1 A;  5KJ7 C;  4L0R A;  4AQG A;  3VOP A;  1RY3 A;  3ZPO A;  3Q5X A;  4WW0 A;  2IW5 B;  2H8P D;  2ODU A;  3RPU A;  2O1J A;  4WY4 A;  4O2B E;  1MV8 A;  3L37 A;  1SVF A;  4UF0 A;  2OYI B;  3A5T A;  5CCH A;  3ZJ1 A;  2XDJ A;  2ODV A;  3HKE E;  2EHO D;  1CW5 A;  2OYH A;  3CPZ A;  3HUS B;  1LRZ A;  1WT6 A;  5CA0 E;  3KVB A;  1FZC B;  4DND A;  1UX4 A;  2L9Q A;  5LP6 E;  4YFS A;  5FY7 A;  1H8A A;  4KBM B;  4IE0 A;  4QXH B;  3FXE B;  5CMZ A;  4QKN A;  1L0L K;  2KXP B;  2MTQ A;  2ZXE B;  3CKD A;  1M1J B;  1U5P A;  5LCY A;  1SQV K;  1JY2 O;  4PW8 A;  3N9O A;  3LG7 A;  2FXM A;  1JCD A;  2JJL A;  3F31 A;  2PJQ A;  5AW3 B;  1WYC A;  4IDZ A;  3KV9 A;  2CPB A;  3H3A A;  2KT9 A;  3DTO A;  4ZHQ E;  4O4I E;  4OYK A;  3LBX B;  5JRC B;  5LHG B;  2YO3 A;  3TSI A;  4W7Y A;  2D2S A;  4FI5 A;  5LHI B;  2A72 A;  5EK4 A;  1URQ B;  1IAP A;  2N1T A;  4N6J A;  4ZI2 C;  4ADZ A;  2Q9I A;  2XZR A;  1WRD A;  1DX7 A;  4X1Y E;  5JDN A;  3LW5 H;  2Q9Q D;  4HKA A;  3NXS A;  1X8Y A;  5AW2 B;  1FZB A;  2K24 A;  4PFP A;  1ZV4 X;  1SQP K;  3ZCI A;  1D0Z A;  5TAO A;  3VTP C;  3U78 A;  1FZE A;  2JQQ A;  2KP8 A;  3PU3 A;  3V2R A;  2ZM8 A;  5HXH A;  2C9N Y;  2VKH A;  3GMI A;  5KJ7 D;  1ZKE A;  1SFC A;  4AYC A;  3AAE B;  3VMY A;  2NWB A;  4HFV A;  4JF7 A;  1N86 A;  4EIJ A;  1NU1 K;  3A3Y B;  2MOZ A;  1U4Q A;  2V7I A;  5LHH B;  3RYH E;  3MJX A;  2NPS D;  5AFU L;  3MXZ A;  3P8C E;  3M0D C;  1FZA A;  2VB6 A;  2Q5U A;  1LTJ B;  4TN7 B;  1KIL D;  1UX5 A;  2WSS V;  2ZMA A;  2PBI A;  3N2O A;  4KUM B;  4GK5 E;  2Q7C A;  3KV5 A;  1LT9 C;  3J7Y q;  4H9P C;  5JDM A;  1T8Z A;  1M7L A;  3OA7 A;  1YKH B;  2W6A A;  4AKH A;  3MTU E;  4BA9 A;  3KDS E;  2H7V C;  3EDV A;  2HG5 D;  3K3N A;  1GDT A;  5EK2 A;  4GT1 A;  3QUJ A;  1IFD A;  2EHO A;  3OJA A;  3FBZ A;  4QXC B;  4H9Q C;  3SWF A;  2LE8 A;  2W61 A;  1Z56 A;  1L4A C;  4GIF A;  2YK0 A;  4MFR A;  3H32 A;  4C7N B;  2B1E A;  3R84 B;  1D1B A;  4EOT A;  4QHO A;  2XUE A;  1GU5 A;  1D0X A;  3HKC E;  5CHX A;  4WBO A;  5HXE A;  1HH0 A;  3B13 A;  3N7N A;  3V5B A;  3H6P A;  3HE5 B;  3J9X 1;  1YTZ T;  2X67 A;  2DNX A;  1LT9 B;  1GZL A;  2N1G A;  2D0U A;  4ZI2 D;  5CCG C;  2ZFC A;  2QM8 A;  3HTK A;  1NTK K;  2L5G B;  2M67 A;  1NWM X;  1QL2 A;  3RK2 B;  4GYR A;  2NW9 A;  4IE4 A;  5JR9 C;  2LOS A;  3KBU A;  2J59 M;  3HRN A;  3V2N A;  4YJ3 E;  2KLV A;  4HYT B;  1IC2 A;  4N78 D;  4AKR B;  3AA0 B;  3Q5W A;  3O9X A;  1YW0 A;  3I0Q A;  2YU1 A;  1IFM A;  1L4A B;  1NAF A;  3B5N B;  5FNV E;  3VKG A;  5FP3 A;  2V7M A;  5LOV E;  1KFM A;  2Y6X A;  4A56 A;  3DJB A;  4RES B;  1V9D A;  3V5S A;  3F57 A;  2Q9Q A;  2A2F X;  2BVM A;  2WMO A;  2RA1 A;  2HOD A;  3SOL A;  2E9X A;  2K9A A;  3HR0 A;  3EQ2 A;  4YJ2 E;  2DHR A;  3IFM A;  2LHR A;  1EQ7 A;  1CZQ A;  4OYJ A;  3ZMU B;  2DCF A;  3AA6 B;  3L3P A;  4M1P A;  5KJ7 A;  4EOZ B;  3O4X E;  4CXX A;  3E22 E;  2GK9 A;  3IR9 A;  3MK7 C;  2XU6 A;  1JY3 P;  2K5B B;  5BMV E;  4ILU A;  4N3Y B;  1FIO A;  3PDY A;  3UUN A;  1IO4 A;  5APU A;  4AUW A;  3EVY A;  3KYQ A;  2HPL A;  3HL6 A;  3BQK A;  3K3Q C;  1GK6 A;  5LBQ B;  2MJZ A;  1IJD B;  2PG8 A;  4X1K E;  1FBM A;  2LM9 A;  1J1E B;  4EYU A;  2KWI B;  3BRV B;  4Z8X A;  3CVR A;  2P9B A;  2N1T D;  2VRS A;  2Z6E A;  4XA4 A;  5FMN A;  2JMH A;  4EIW A;  5LNK A;  2LKM A;  5L2L A;  2LSK A;  5HWY A;  1JY3 N;  1IZN B;  3TNU B;  1KQL A;  2DWK A;  3N9Q A;  3HKD E;  3ZMS B;  5KTB A;  3R6N A;  5LBM A;  1RE3 C;  1DH3 A;  5AW5 B;  2GUS A;  1CI6 A;  4P09 A;  4I4T E;  3UUX B;  3PUS A;  3I9Y A;  1G2C B;  3C64 A;  2OYI C;  1KFN A;  2KND A;  2C0X A;  2XAF B;  2IFM A;  2P7J A;  1B7T A;  1IK9 A;  5CCG D;  3N4X A;  1A02 J;  3CML A;  3BAT A;  4JYC A;  3IBP A;  3ZMV B;  4ZI3 D;  1GL2 B;  3CLQ A;  1JMM A;  4WBN E;  5APT A;  3PU8 A;  1HG5 A;  1N2D C;  2FKW B;  4IHJ E;  4ASK A;  2WBL A;  2J58 A;  3WI3 A;  4GIW A;  1FZC C;  1LVF A;  2WTY A;  1MMN A;  2CWO A;  4KHX A;  1G73 A;  4PJM A;  4AQF C;  3O1H A;  3RL0 B;  1D0Y A;  4UEM A;  4QX7 B;  3HA4 A;  3G3Z A;  1RE4 C;  4CZZ B;  2JMK A;  1ZHC A;  1M1J C;  2C9L Y;  2P1J A;  3MGN A;  3ZYK A;  3W15 B;  5CA1 E;  1D1A A;  3PP5 A;  3OYX A;  1NO4 A;  3MA9 A;  4IE6 A;  5BVZ A;  4HTE A;  4JLE A;  3EDU A;  3RK3 B;  3GWH A;  3V2Q A;  3OKQ A;  1ZV8 A;  2FYU K;  3LID A;  1URQ C;  2WT7 B;  4I1L A;  2G0U A;  1NTZ K;  5JRE A;  3NFQ A;  4WBA A;  1X79 A;  3TYY A;  2WSF H;  2FFD B;  4EAH A;  3I9W A;  1FJK A;  2CXF A;  2XTL A;  5C8Y E;  3SWY A;  3M0D A;  2L3L A;  3BQI A;  3GN5 A;  2BAS A;  4H9R C;  4B86 A;  1NOH A;  4L5G A;  3LK2 B;  3ANW A;  4O2A E;  1GW4 A;  5AVV B;  4UXN B;  1NHL A;  2CM0 A;  2WWU A;  2OAR A;  3VN0 A;  3ETV A;  2H7H A;  1LT9 A;  1SLQ A;  2SPC A;  5AVY B;  3QK6 A;  2BVL A;  3KVA A;  1JTH B;  1HF8 A;  2I1K A;  3P32 A;  2NTY A;  5AVR B;  3ZYM A;  4HH2 A;  3VP9 A;  2W62 A;  4IIJ E;  3OYZ A;  3C4Z A;  5JDG A;  1RF0 C;  5APX A;  2CE7 A;  4HE8 A;  4JEU B;  1RF1 C;  3UT5 E;  5EZY E;  1T3U A;  2LT3 A;  4DO0 A;  2NW8 A;  1BR1 A;  3N9P A;  3ZMT B;  1LTJ C;  1KIL B;  3KFW X;  2ES0 A;  3ZLI A;  4WNK A;  4O4J E;  5JDQ A;  1HBW A;  3HE4 A;  3RC8 A;  2KMF A;  5HYA A;  4GOU A;  1UCU A;  2QM7 A;  1EZ3 A;  2E9X D;  5DJQ C;  2VL8 A;  3I5C A;  3VP8 A;  3MD0 A;  1MND A;  4CI2 B;  5CCG A;  3CWZ B;  1MMD A;  3T97 A;  1VOM A;  3RH3 A;  4UEL A;  3C9I A;  1LKX A;  3AVR A;  1KNZ A;  2NP9 A;  4P0B A;  5HWX A;  5AVX B;  2LSY A;  1LTI C;  3N9L A;  1FMV A;  4C7R A;  5JR9 A;  2BDE A;  1SQB K;  1E1H B;  2M3B A;  1RF1 B;  3PE0 A;  3IF8 B;  3ZMZ B;  1N7S B;  2YKQ A;  2HPC A;  1ZR2 A;  3HD7 B;  1ZLL A;  1HS7 A;  2A45 I;  2YKP A;  2ACX A;  3GHG A;  2W6B A;  2E8I A;  3CX6 B;  3H37 A;  3C51 A;  1GW3 A;  1LTS C;  3HKB E;  3U1A A;  1BR4 A;  5J2T E;  2D0T A;  5CB4 E;  2W63 A;  1S94 A;  4CI1 B;  4DZO A;  1HJB A;  3L09 A;  2KYV A;  3RK2 C;  4WY4 B;  3T8O A;  3U59 A;  4W7Z A;  5FXV A;  3ETU A;  4G63 A;  5F8P A;  2ZLY A;  2KB7 P;  4XAX B;  3F2E A;  2W0G A;  2N2N A;  4H63 V;  3V4W A;  3OAK A;  4PNI A;  5LG4 A;  2I59 A;  3B5N C;  2CA5 A;  2OYH B;  4Y99 C;  1VRB A;  3SS1 A;  1NWQ A;  2JRK A;  1AFO A;  5CJ0 A;  3DP7 A;  3K3O A;  2X0L B;  4DMV A;  3UUL A;  5HXR A;  3FBL A;  5LGN B;  2KIN B;  2XQY A;  2ZM2 A;  4QWN B;  2YNY A;  3VMZ A;  3C98 B;  5AVU B;  2IPP A;  3NMD A;  2VKD A;  1L0N K;  4C90 A;  3CI9 A;  2XHE B;  2WM9 A;  2GM4 A;  1QUU A;  5AVW B;  5BU8 B;  4UVB B;  2R3C A;  3M9B A;  2PP6 A;  1MIY A;  1IJ5 A;  4DVD A;  3M91 A;  1HG2 A;  5M4Y A;  1GTW A;  3C4X A;  3WAK A;  1WYB A;  2CLY C;  5AVQ B;  1MNE A;  4HN9 A;  3Q9D A;  4KMC A;  1J1E C;  2OYI A;  3ZC1 A;  2Q3I A;  2WPQ A;  3RYC E;  5IYZ E;  3D0T A;  2VK9 A;  4OK0 A;  1N73 C;  3KBT A;  2NTX A;  4DBQ A;  5LJM A;  2N1T B;  4Y99 B;  4AKG A;  3PUG A;  2FYZ A;  2XAJ B;  3LIE A;  3HUS A;  1JO5 A;  4XE5 B;  3N2K E;  3NZQ A;  3ZN1 B;  1WRG A;  1FZC A;  5FYM A;  4BJN A;  4AI6 A;  4O9B A;  3RC3 A;  4AQF A;  3AB3 B;  1XTC C;  2YIN A;  2IC9 A;  1LWU C;  2LJL A;  2VAS A;  4IST A;  4JEH B;  5AVS B;  3MZK B;  1H89 A;  3ZN0 B;  4CXW A;  2WAU A;  2A3D A;  4ZS3 A;  4EXT A;  3CX8 B;  2IX7 C;  1RE4 A;  4AQR D;  1LTG C;  2NW7 A;  4V1A v;  1MZ9 A;  1M1J A;  3P7K A;  2J1D G;  3C4W A;  4W80 A;  4IFM A;  5JQG E;  3LJC A;  4BAY B;  4MAL A;  4MHC A;  2LSI A;  1JUN A;  2HH7 A;  1SFC B;  4ZKU A;  1GK4 A;  1T98 A;  1W2E A;  2R5D A;  2P2U A;  1GL2 C;  4YLH A;  5A1L A;  2BZB A;  2CLY B;  4PJJ A;  5E0O A;  1G1J A;  5AW6 B;  1O3X A;  4FJO A;  3KPE A;  2W27 A;  2UXN B;  4UIG A;  4PJL A;  4HGA A;  3LBX A;  5JRC A;  3I0O A;  1ZR4 A;  1N73 B;  5APQ A;  4I43 B;  1FDM A;  1FMW A;  4YHJ A;  1URQ A;  3EUH A;  3RL0 C;  1L4A D;  4TZ4 C;  2C0W A;  3MIW A;  2O1K A;  1S35 A;  4QX8 B;  2R32 A;  4HEA A;  1FAV A;  3V4Q A;  4ZKP A;  4X1I E;  1LWU B;  3CL3 D;  4K0U A;  5AW8 B;  1CSB A;  1SA0 E;  1JOC A;  1PFI A;  3L4F A;  4DOJ A;  3WMM 0;  1NKN A;  2XKM A;  1HFA A;  4G2A A;  1FOS E;  3UIA A;  3RK3 C;  3L36 A;  4CQI A;  5L3F B;  3VMX A;  3A2A A;  2HLO A;  3M65 A;  3UTK A;  2EHO B;  3OJA B;  1HX8 A;  2E42 A;  1HGV A;  2KLQ A;  3M0A A;  4PK4 A;  1JY2 P;  1G1I A;  5JVD E;  3H32 B;  1RF0 A;  2FFD C;  1CUN A;  3TK1 A;  4PFO A;  4TV8 E;  1OXZ A;  3LK4 2;  3RYI E;  2P67 A;  1NH4 A;  4MBQ A;  1LTJ A;  1JY3 O;  4O8S A;  4LGD E;  1WR6 A;  2Y8D A;  3MKD A;  4GYS A;  1LGH B;  5HXS A;  3CQX C;  3WAJ A;  1YTZ I;  2X51 A;  3FHN A;  1IFJ A;  1FZF A;  1JY2 N;  2NOX A;  2UXX B;  1J2J B;  5AVT B;  1QSD A;  3HTK B;  3M9H A;  1SQQ K;  2I1J A;  3KV6 A;  5APS A;  2M8R A;  2A45 G;  1FEW A;  1QL1 A;  4I50 E;  3S4U A;  2IFN A;  5APV A;  1DEB A;  2X9H A;  2IC6 A;  4N78 E;  2H3R A;  2DI4 A;  1NKZ B;  2NPS C;  1MMG A;  5L3D B;  2V7L A;  1JCC A;  1JNM A;  2PAJ A;  2WZ7 A;  5JDH A;  3OBV E;  5LGT B;  5FXZ A;  4EZ4 A;  5ADX L;  4AKL A;  4OH8 B;  4L9I A;  1KIL C;  1MFZ A;  1GL2 D;  4C7N A;  2KZ7 B;  2Q9Q B;  4AKI A;  2K48 A;  3UUM A;  3BQL A;  4KP3 C;  4NUV A;  4AXP A;  2JPF A;  4H9S E;  1HTJ F;  2HOD B;  2O01 H;  2E9X B;  4P0A A;  3N5L A;  4DMW A;  2POH A;  3ZC0 A;  3A5X A;  4TX5 A;  2MBG A;  3HE5 A;  4TV9 E;  3RL0 D;  4C91 A;  2VKJ A;  3VU7 H;  3MAC A;  4ZOL E;  2H7O A;  2YEV C;  3M06 A;  5KDM C;  2XV5 A;  1X9V A;  5LJN A;  4I6M C;  2V1D B;  3CX7 B;  4F6R C;  2HFE D;  2NPS B;  1Z0P A;  4PK6 A;  4PJN A;  2V7K A;  4O4H E;  4OHF A;  1N7S C;  2IAK A;  1IFN A;  1T2K C;  3HD7 C;  4JYB A;  3FXD B;  5F3J A;  3RK3 D;  5IHY A;  1L4A A;  3SWH A;  3B5N A;  1MMA A;  2CXL A;  2WWW A;  1YD8 G;  1YKE B;  2Z5H A;  1VPC A;  1GU4 A;  2ZM0 A;  1LTB C;  1KK7 A;  1MIW A;  2DLR A;  3MUD A;  3ESL A;  1HGZ A;  2X9W A;  3M9Q A;  4WY4 C;  1CI6 B;  3KDP B;  3V5U A;  5APW A;  5L3G B;  1LTA C;  2LSJ A;  3PUA A;  3JC6 C;  2PFV A;  4H63 H;  5HXC A;  5H6R B;  1NTM K;  3O8Z A;  2QA7 A;  1SHZ C;  5CCH C;  2CEA A;  5LXT E;  2KWH A;  4X20 E;  3EFG A;  3PUR A;  3UFE A;  3TKL B;  2OYH C;  4E7S A;  4ZI7 E;  1MUU A;  2WPR A;  2XAQ B;  1Y64 B;  3CQG B;  5AW0 B;  3P8M C;  2X68 A;  3N2G E;  4EZH A;  3U1C A;  3RYF E;  1KZU B;  1WLX A;  1N73 A;  1URQ D;  5L3B B;  2C5I T;  1FOS F;  4C46 A;  4M3L A;  1HUC A;  2VWA A;  3U3I A;  1AQ5 A;  2D5U A;  3TNU A;  1SQX K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...