1NAFA

Crystal structure of the human gga1 gat domain
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
129
structure length
124
Chain Sequence
DEEKSKMLARLLKSSHPEDLRAANKLIKEMVQEDQKRMEKISKRVNAIEEVNNNVKLLTEMVMSHSQGSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEILQANDNLTQVINLYKQLVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Structure of the GGA1-GAT Domain Reveals the Molecular Basis for ARF Binding and Membrane Association of GGAs
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein, membrane protein
molecule keywords ADP-ribosylation factor binding protein GGA1
total genus 37
structure length 124
sequence length 129
ec nomenclature
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03127 GAT GAT domain
A PF18308 GGA_N-GAT GGA N-GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1nafA01
1.20.58.160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1nafA02
4JYCA 3P7KA 2H7HA 3HE5A 2WWWA 3HTKA 1WRDA 1A02F 3V4WA 1MUUA 5AVZB 1MFZA 1NWQA 3M06A 3VMXA 1SP4A 4HYTB 4AQRD 5AW3B 4M3LA 3TNUB 4RESB 5APUA 3LIDA 5APTA 3M0AA 3A7OA 2IPPA 4C7NA 2QM8A 2P2UA 3MD0A 3VTPC 4I6MC 1JNMA 3L37A 5AW0B 2R32A 4GKGA 5AW2B 2P7JA 3TYYA 3LIEA 1CZQA 2BASA 1SLQA 2XZRA 2P67A 3M0DA 5AVXB 3M9BA 5APVA 1FOSF 2Q7CA 1YD8G 1OWAA 5AVUB 4XE5B 2KP8A 4GT1A 3HE4A 3I5CA 3O8ZA 2Z5HA 4C46A 4B86A 2W27A 3P32A 1IO4A 2ZXEB 1GZLA 3HE5B 3P8MC 4JYBA 1NWMX 2C9LY 4AUWA 2R5DA 5CMZA 5APWA 1O3XA 1WR6A 2XV5A 5AW7B 1FAVA 1S9KD 4LC1A 2E43A 3TNUA 1DH3A 1KQLA 3L35A 2YNYA 3MGNA 2N9DA 2C9NY 1CSBA 3SWFA 1X8YA 3NMDA 2R5BA 5AVQB 5AVRB 2WT7A 2QM7A 1GK6A 1MV8A 5AVVB 5AW9B 1H89A 1GTWA 1X79A 5AVTB 1S9KE 3IR9A 5AW8B 2Q3IA 2VRSA 1OXZA 2Z5IA 5AW5B 5AVYB 2ZFCA 4I2LC 1JUNA 3A3YB 3B8EB 1CI6B 3NXSA 2WT7B 5APYA 2YO3A 3V5BA 3KQGA 5APXA 2JJLA 3HE4B 3KDPB 4AYCA 2XU6A 1J2JB 1A02J 2N9BA 1HBWA 1HUCA 5AVSB 3VMZA 2WTYA 3A2AA 3NFQA 5AW1B 5APSA 3UIAA 5APQA 3TK1A 1G2CB 3M9HA 3L36A 1H8AA 1T2KC 3VYIA 3OAKA 1NAFA 1GK4A 1GD2E 2YO2A 1YYCA 3VMYA 2R3CA 5AVWB 4DZOA 4EOTA 1FOSE 2E42A 2Q5UA 3VN0A 4KHXA 3A5TA 1GU5A 1H88A 2N2NA 3M91A 4C7NB 1HWTC 1GU4A 2WPSA 5AW6B 2WPQA 5AW4B 1HJBA 1T2KD 2W6AA 3V4QA 2WPRA 1CI6A 3T97A 3NTNA
chains in the Genus database with same CATH superfamily
1IBKT 3AE2A 2BBJA 3HUSA 1Y64B 2MAWA 1SQBK 4PJJA 4U3FJ 5EK4A 2NZ2A 4O9BA 3AB3B 5KLIC 5K5GB 2BS4A 3VTPC 3A5XA 4JI4T 4JPZB 2K9JA 3Q3DA 2E75B 3AE9A 3O1IA 5HEGA 4HTEA 2M6IA 1FZBA 2C0SA 1FJKA 2WSFH 1Q2NA 2CBIA 3S4UA 2UXCT 2E74B 4EIJA 1IFMA 3O8ZA 1ZOYC 2PG8A 1VPCA 2ES0A 3AEDC 4X64T 1L0ND 3AE6C 1OVVA 5J0ZA 4X65T 2B88A 1LTBC 4H44D 4D6TE 2N9DA 2YNYA 3AEAA 2JR8A 5EK2A 3VP8A 3NMDA 3SWKA 3HD7A 3AECA 2D9DA 5TISE 3L72J 3RH3A 1IFPA 2XAGB 2MKVA 3VU7H 4U7IA 2NW8A 3I1AA 3C50A 4JLEA 2K9JB 1LTJB 2H89C 4CQIA 3VKHA 5C39A 4OWFA 3H25A 3LSVA 5KLVE 2CCQA 1YW0A 2W0GA 5C8YE 4BWNA 1BE3E 2MYSA 3BQKA 3TF5A 3IF8B 2OA5A 1JM0A 4EXTA 3WUVA 3AECC 4JF7A 5B5EH 3OKQA 5HXHA 2NW9A 3I9YA 1NTKG 4OH8B 3RGUA 5BR8T 2F4VT 1PL5A 3UIAA 3LG7A 3QC9A 1G2CB 1GDTA 3ZEFB 1I6ZA 3ABVA 3L09A 1LT9B 1H8AA 5ABFB 2E9XB 4CXYA 4ZI2D 2Q1KA 3GF7A 2X66A 1SQBJ 1VQ7P 2Q5UA 1UCUA 3RIAA 2NRGA 1KQFB 2YMYA 1S5LX 1K73Q 3P4RA 2ZVNB 4RJTA 3MJXA 1J1DC 3EI0A 2VASA 5FP3A 3HI2A 5FXWA 1OZHA 3HE5A 3ZT6A 3L72G 3UUMA 4HGAA 2JMHA 4E7ZA 1P84D 1LTGC 1NKZB 2VB6A 1RHZB 1EDJA 3H1HJ 3RIFA 3WMM0 1BDDA 3LIDA 5APUA 3U59A 3HKEE 3T97B 2AXCA 4JUYA 2D2CC 1M57D 4M1PA 1L0NG 2XQ3A 1SQQK 5CCHC 5L3DB 3MIWA 5AW2B 2AXTH 5B66E 1KC8Q 1T6AA 3L75J 2I6HA 4MFRA 4U7JA 4O2AE 4V1Av 3W68A 2KINB 4YSZA 4PW8A 4HE8A 4DR2T 1K05A 3O4XE 4ZZCA 2D2CB 5KAFE 4U7YA 4CXWA 4GK0E 1VQPP 2J47A 4HKAA 3V6IA 4K0UA 3AE4A 2BCCJ 2RH0A 3PDYA 5AVUB 3Q2MA 2VL8A 1SUMB 5HEHA 5ABGA 4WY4A 4ZKPA 1IO4A 5IHYA 1PP9G 3NZPA 3KV5A 2KSJA 3SFEA 3V2PA 2KNDA 4XA4A 2AEMA 1IBMT 2N1TB 1FAVA 3E1RA 3LK2B 4BAYB 3CPZA 3CMLA 3O6QA 1M56D 1HS7A 2WT7A 2VVNA 4O2BE 3SWYA 5AW9B 3G9RA 3ETVA 3PP5A 2H88C 5HXSA 1VL2A 4KJMA 3BCCG 2YOEA 1JEKA 1P84H 4X1IE 5DJTB 2L9QA 3L71J 4N78D 1SS1A 4YHJA 5F8PA 4EDFA 2YO3A 2YKOA 2JKVA 2KMFA 2X9WA 3F2EA 3P50A 4BA9A 3CQXC 5CA1E 1HUCA 2R6GF 1E1HB 1Y8AA 4NUVA 3BATA 1YQ4A 2N1TA 4DR7T 3TKLB 5IWAT 2VVSA 4H44B 1AQTA 5KMGP 3B4SA 2YMKA 4Q25A 2XHEB 5CCHA 4JI6T 5DJQC 1IC2A 2MJZA 3HUSB 4LF4T 5JVDE 2W2UA 4DV0T 4OVNF 2AXDS 1YKHB 3B5NB 2IBZG 3T97A 4KHPT 3GHGB 2HPCA 1KILB 2V5CA 4IIJE 2V6YA 3W15B 4BJMA 1OFCX 2AE9A 3FZFB 3GWHA 1BR1A 3R4YA 4DV7T 3E22E 3UU3A 1SQVE 1SQVG 3AE8A 3L37A 5LGTB 3AE5C 1VF5D 3CMAP 3UUBA 2XUEA 2XM2A 2ZM2A 1RE4A 2FYNC 2YKPA 2YXQB 3HD7D 4LMLA 2FUPA 1YD8G 1BCCG 1WR0A 5HWXA 2CLYB 2X0LB 3L8RA 4P0AA 3I5CA 4WYVA 2ZT9D 3WAKA 3USSA 3L74E 3P8MC 1IAPA 3FGAD 5JREA 5LGNB 2YK0A 1JCDA 3GN5A 4GODA 1O3XA 1JOCA 1G2CA 5LBQB 3S4RA 3RK2B 3B57A 4YTMA 4ASKA 2L5GB 3TGUJ 1KN7A 2I59A 1VQ9P 4JBWF 2WSSH 3J7Yq 1BR4A 2XSBA 4LF9T 1LJ2A 5LJNA 1T98A 3CXHE 4NPEA 3AEEC 3VKGA 3RK3E 4YJ2E 4JI5T 2ZYGA 1R8EA 1LWUB 2SPZA 5CJ5A 1T3UA 5J2TE 3H3MA 2OGUA 5AQKB 4X1KE 4WBNE 4WBOA 4ZZBA 5JDNA 1W0BA 2HH7A 3L4FA 3UU6A 1KFYA 3JC22 4C91A 2LRLA 2V7KA 1VRBA 1M1JB 2C0WA 3S1KA 1NVOA 3GLMA 5ABFA 2FYUJ 4K3AA 1T8ZA 1D0ZA 4CN1A 3CCUP 3MTUE 1A02J 4H44C 2N9BA 1FZEA 5JR9A 2E74D 3FZKB 4H9QC 3TGUE 1M7LA 1P84I 2CXFA 3OYXA 4OYJA 3CCVP 3L73D 2K48A 2WSEJ 4ZI3D 5A1LA 3EUHA 2OV9A 4Z8XA 3OAKA 3C4ZA 2E75D 4GYSA 1VQMP 5AQFB 4LMKA 2WMMA 1PP9E 4DVDA 1QX8A 3T1YT 2GA1A 2C5JA 3I55P 3ONLC 1HWTC 3NBXX 4KT0J 4ZI3C 3V4QA 3IHRA 2FKWB 3U1AA 1WT6A 1HG2A 4X62T 4U2ZA 1FBMA 4IGUA 1A02F 5LNKA 5CA0E 1L0LG 2BVLA 2WBLA 4QH5A 5TJHA 4H13C 4TNWA 2QE7H 2OYIC 2G8YA 4H0LB 5APTA 2B87B 1VQKP 1SQXK 3CC4P 1BR2A 4DJGA 5HEJA 4C7NA 1HJ0A 3NRXA 2QM8A 3BRVB 1J1EB 3L39A 1NTZJ 1FMVA 2Y0CA 2PTFA 4TLFA 2UXXB 1J1EC 2M5AA 2W62A 1JY3P 3PUAA 1EZVG 5AQMB 3AE3A 2QSIA 3D71A 3PRJA 2W63A 1N7SB 2E8IA 2RMZA 3FBLA 1FIOA 3HE5B 2H8PD 4CN4A 1FU1A 2QGSA 4QX8B 5CFBA 4ZXLA 1PGJA 2DL1A 2XAFB 2IZ1A 1N73A 3TNUA 1LT9A 4O4JE 4EB6E 1JB0J 4KUMB 3W67A 3KYQA 2A06G 2QEXP 2ZM8A 3N9LA 2BCCG 1H7CA 1X79A 4AISA 3RPUA 3B5ND 1T72A 2ZT9B 3PHLA 1D7MA 2JJ9A 2Q3IA 1UK5A 2Z5IA 2QJPB 4A56A 2P9BA 4NXMT 2BBHA 2WU5A 1U4QA 2VK9A 3ZJ2A 2B1EA 4COFA 1XTCC 4L9IA 4YSXA 3ZYKA 5BMVE 4UB8H 5APXA 2N1GA 3RIUA 2WITA 4WWIA 2IZ0A 2LXCB 3Q2YA 4UV8B 2NOXA 3TLTA 3NFQA 5LCYA 5AW1B 1MNEA 2D0TA 5CJ4A 3FWLA 4GOUA 2ZAEB 3AE1A 4ILUA 4DO0A 1BCCE 1E5WA 5AQOB 2K5BB 1NJIQ 4KP3C 1R8IA 1YYCA 4U3CA 4ASVA 1OX3A 1SQBG 3ANWB 1ZMEC 4YXDA 2IYOA 2K9AA 1DD3A 4F6RC 1KFNA 3IA3A 4LGDE 4PD4I 2DHRA 4Z91A 2UU9T 2W6AA 1LKXA 3EFFK 3RGLA 3ZN1B 4TUYE 3L75G 2KS1B 2Z4EA 2FJDA 1VQ8P 3HTKA 4FI5A 3L70D 1MMAA 2W61A 2BKPA 3M06A 3VMXA 2VKJA 1SP4A 5GTHH 3KVBA 3ONJA 3N9PA 4IL4A 2YKQA 3H1JE 2UXBT 1N7SD 3RL0D 2K3RA 2SPCA 2E5LT 1YJNP 2GUSA 3V5UA 3E0ZA 4GKGA 2KNCA 4UEMA 4PV1B 2OYIB 3L71D 2BG9E 4H9NC 2BASA 1S35A 4QWNB 4WY4B 3RI5A 4PJLA 2BCCD 3AAEB 4LF6T 2DWGA 1JTHB 4EZHA 1JMMA 1NTKK 2LHRA 2W90A 3DJBA 2MTQA 3ZPOA 2YINA 1OW6A 1Y9BA 3H1JJ 4B86A 3AE8C 3H37A 3Q9DA 4GIFA 1OW7A 5JR9B 2OYHC 3H32A 4AUWA 3CX7B 1NTKE 2LE8A 3ZJ1A 4LC1A 1BGYG 5CCGA 1RE4C 1G8XA 4ANJA 2Q3EA 3V2QA 1Q7YQ 1LVFA 3FXDB 1HNXT 2RA1A 3CX8B 3A0HE 3AE1C 4L0RA 4N78E 1HF8A 3AVSA 3JC6C 1GW4A 1MIYA 3OJAA 1D0XA 1PGQA 1URQA 1NTMG 3RYHE 3N4XA 1DU2A 3B5NC 4HJGH 4B3TT 5FYMA 2XJ7A 3KZIH 3V5BA 2XQ8A 3D70A 3HE4B 5CCGC 2WY2A 1N7SA 3KDPB 2XU6A 1WYCA 3T8OA 2X9HA 5F3JA 4H13D 2KSEA 4D6TJ 2EHOA 3TLWA 2IYPA 4PJ0E 1SQVJ 1OEDA 2BS2A 4IL6X 1J5ET 1Z0PA 2DNXA 2KWHA 3BCCD 1UX4A 2WDQA 4HFBA 1QLED 2XNXA 1UURA 1FMWA 1PFIA 1GK4A 1LVKA 2M5AB 3RRCA 3GHGC 2VQFT 1K04A 2OTKE 2A3DA 1JMBA 5L8RJ 1SQXD 2NTYA 2ZM6T 3PUVF 2WU2A 5JDLA 1KD1Q 5AQUB 1CI6A 5H2FE 1RQUA 4DCKA 1ZP0A 2H7HA 3C51A 1SQVD 5LOVE 3V4WA 4NXNT 3MHVA 5JH7E 2K88A 2KLQA 1FZCB 4PJNA 3AE7C 3EFGA 2K1AA 3GHGA 2HPCB 4XAXB 4AQFC 2BEZF 4H13B 3TYYA 2PRRA 4UB8E 4WBAA 1N73C 1SLQA 5ABEA 1VF5B 4UB6H 2LLYA 4TX5A 4HWFA 2KI7B 2YU2A 1JY3O 3A7MA 1NU1K 3VHLA 1AA0A 3L71G 1JNZA 4HFVA 2CE7A 3M65A 3RK2D 3HTKB 1WYBA 2O01H 5HCJA 2FJEA 5E79H 1OMIA 3G06A 5JTGA 4H0LC 2XTLA 4QHOA 2QVAA 1KQLA 3MGNA 1MMNA 3H3AA 2L8KA 2PFXA 3K3OA 2M6BA 2LOSA 1NTKD 1U57A 2DLRA 3HD7C 2R44A 3F5HA 1NOHA 3IR9A 4HB1A 4L73A 2E76C 3KFWX 1FJPA 5KXJA 1YXRA 3AXJA 1Y47A 2ZFCA 1JUNA 4WZXA 4K35A 4OX9T 3RHWA 2E9XD 1IFDA 3NXSA 4QH4A 1SQVK 4X1YE 2IBZE 2DI4A 4HFIA 2CRBA 3KPEA 4IE7A 4DMVA 3WUUA 3Q5WA 3ZYLA 1YQ3A 2Y0EA 4BXLA 1IFIA 2IFNA 3CWBJ 2VWAA 3C4XA 2MPKA 1CW5A 3CXHI 3E7KA 3K5BA 5APSA 2M3EA 2W6JH 2UUCT 2CXLA 3UULA 4HFCA 3BVHA 1Z8UA 2ZLYA 4PV1C 1ZN5A 3CCLP 1G73A 3PUXF 1HVVA 1X79B 5EZYE 2WSCJ 3VN0A 3R84B 5C3JA 2LSGA 3CLQA 2HPLA 2BDEA 3C1LA 1KV4A 2FYZA 1HCIA 2WCAA 1XNQT 1GU4A 4O4HE 5LMNT 4GIWA 2R3SA 3NTNA 1T7SA 4O4IE 2WMNA 1SQPK 1MUUA 5J1GA 3KINB 2MOZA 4XFJA 5KLVJ 2IC9A 3QOFA 1HFAA 4DR6T 2X0YA 2V4HA 2WWUA 1USEA 3P8CD 2KUBA 3ZMSB 3PUSA 3Q5EA 1SQQD 2YXRB 4CN6A 1RH5B 3MD0A 3P4QA 2NPSD 1EDLA 2CHNA 4DUYT 1ZKEA 1BGYD 1ZV8A 3EVYA 2E9XA 3AA7B 4B3ST 1R5SA 2G3AA 1EXIA 5JRCA 4W7ZA 2K3WA 2V7LA 1QVGO 2HHHT 3L70J 2VKHA 2KP8A 3UUXB 3AE4C 1QL1A 5KJ7D 2UXDT 1RQVA 1URQC 2W27A 4BRYB 5BU8B 2NW7A 4YXWH 3ZMVB 1PPJG 3MXZA 3AEFC 3GG2A 4W80A 2RPAA 1N7SC 5F5WA 1LT1A 4B3MT 2WSEH 3MKDA 3K8PC 4IDOA 2Q9QB 1FC2C 1GL2C 4L74A 3ZDMA 1N2DC 2WSSV 4L75A 4Y99C 1OEDC 1OVUA 1QUUA 1SFCD 4EZ4A 3HKBE 1RF1C 1IJDB 2HODA 2H88A 3CCMP 4ZI7E 4TWDA 4AXPA 3BQLA 4DNDA 3CVRA 5IUXA 2WT7B 1NTZK 4YFSA 1RF0A 1PGPA 2JQHA 2E74C 3L70G 3Q5XA 2J62A 1HGZA 2ZMAA 3BQIA 4OGQB 1AJYA 1AV1A 2CPSA 1HTLC 1J2JB 1MKMA 3H1LE 1VQ4P 1GL2A 4IDZA 3C9IA 4DV6T 1ZP0C 2IBZD 3WI3A 4YTPC 4L5GA 2WZHA 2KYVA 3CI9A 3MP7B 1MIWA 3RKOA 5L3GB 1SE7A 1T8BA 4DV1T 1HGVA 3CQGB 2ZVOB 4IOIH 2VL0A 3RQWA 5KX5E 4K0KT 3PV0F 1ZOYA 2E5VA 4DZOA 1GU5A 1SQQJ 5GTHE 3AE6A 2C0XA 3A0BE 3N9MA 2O01J 5E0OA 4F8HA 1ZXGA 5J2UE 2FXPA 2WWWA 1M1JA 5AVZB 4IL9A 4HKZH 5E79E 2WB5A 4AQRD 2BZBA 2LOPA 3ZC1A 4YTNA 5LYJE 4QXBB 1U7JA 1PV3A 1I94T 3VR8A 1AVOA 1VDFA 4NPFX 2ZJSE 3NKZA 3AE5A 4I55E 1NTMD 4PK5A 5TAOA 4G2AA 2IHR1 1SQPD 2EHOD 3GW6A 2QA4P 2HN1A 3K1SA 1X9VA 2X51A 2ODVA 2D2SA 2BEQD 3N2GE 4CXXA 4UXNB 4ZHQE 3HR0A 2G0UA 3SFDC 2NPSB 1G1JA 1NU1E 1EDKA 1KB9D 1NEKA 2ZYDA 1KZUB 3CC7P 2BKOA 5HCMA 3VRAA 5AW7B 2YIUC 2W4XA 3AXJB 1DH3A 1LP1B 1N7LA 5KKZB 2B87A 1CSBA 4YSYA 4ASWA 2OYHB 3OBVE 1SQQG 1L0LJ 4DOJA 1YKEB 4IFFA 2ACZA 3ZLIA 2FXMA 2HLOA 5C2TA 4C7RA 2VRSA 1OXZA 2HG5D 4LLHA 3ZSTA 1N86A 5AVYB 1GL2B 2FYNB 3OYZA 4KX6A 2CPTA 1GMJA 1ZRTE 3CXHD 4KI0F 2KK7A 1SFCC 3HD7B 5BU5A 1K8AQ 2FY8A 2B9BA 2ACXA 4AKHA 1CHUA 4B6XA 5HXCA 2O1JA 4H0LD 1L4AC 2KZ7B 3F57A 5B5EE 2KSRA 2VURA 4J2CA 4IL6H 1KYOE 1DX7A 4DBQA 2UXNB 1RE3A 3MK7C 4TN7B 1Q86Q 1ZV4X 2KS1A 2FJBA 4PNIA 1YITP 4DR4T 4H63V 1KILD 2E42A 1KB9H 3KVAA 3L73E 1S5LH 3M91A 2E9XC 1YJ9P 3MA9A 4UVAB 2Q6QA 4P1NA 1UIXA 4AKGA 3JAEA 1N32T 4CZZB 4BRYA 3PURA 3VRBA 4AQYT 3GMIA 3RC8A 4OGQC 3CCEP 4ZOLE 3PUZF 2NTXA 1W2BO 3PUWF 1RE3C 1L2PA 4TWFA 2WP9A 2LEHA 5JDHA 2IPPA 2ZXXA 2IW5B 4EEBA 2J1DG 3IBPA 5AW0B 1VQ6P 3KBTA 3RRWA 1RF1B 3K3NA 4YJ3E 4I50E 2PGDA 3BCCJ 1BSNA 3FXEA 5AFUL 3M3ZB 1HR0T 1G1IA 2OARA 2N9YB 2XAHB 3IF4A 4Z90A 1LP1A 1HX1B 2N1TC 4QX7B 1B7TA 2RKLA 1L0LK 2QJYC 4U3FG 2C5KT 4TNVA 5ETWA 5JDFA 5L4EA 2IDOB 1RF0C 3K3QC 1NTZG 2C9LY 4P09A 3KBUA 4Y99B 1OEDB 2XAJB 4BJNA 3OJAB 3I56P 5M1BA 1X8YA 3EHZA 1U5PA 3CIRA 1AQ5A 2H7OA 3EABA 3TLSA 3N2OA 4JQ0D 5HEUA 5FY1A 5EK3A 5AW5B 3CKDA 1GW3A 3A3YB 4GDOA 1OVRA 1SA0E 3AEFA 3G71P 1ZEEA 5DABA 5APYA 1SQBD 3OVUA 4NPDA 5DQVA 1FZAA 2Y0DA 2W83C 4ILCA 4IDQA 1X9BA 3CCQP 1ZRTD 5FY0A 2FYUE 2IAKA 3N2KE 4TT3H 2KB7P 1N8RQ 1XNRT 3VMZA 3II6A 3OA7A 1NU1J 3PU3A 1JCCA 3CC2P 1J5WA 2YIUB 1L4AD 2IFMA 3M9HA 3RK3B 3OPCA 2KLUA 3D6ZA 2L91A 1JY2N 4N3YB 3CWZB 5CB4E 5CCGD 1V9DA 5LG4A 2N2NA 1BCCD 2FFDC 3FZMB 2GM4A 1T2KD 3M9QA 3PUGA 2BG9B 5KAIE 3U78A 1SQPG 2XASB 4QKNA 3HA4A 3WU2E 4NIQA 2GK9A 5LHIB 2JEEA 2O3JA 1KTMA 2CMRA 3O6QB 3J9X1 4ERRA 4OGQD 3LW5J 5FVLA 3ZYMA 3H1IG 1JNMA 5AQIB 2CK3H 2HYNA 2CHOA 1L0LE 4GKKT 2P67A 3SOLA 3C98B 4ISTA 5LHGB 4AI6A 1FOSF 4YY3T 4UVCB 3G3ZA 3OTOT 5JR9C 4ZKUA 5AQRB 3N5LA 4A97A 1KYOH 5H6QB 4ILBA 3MZWB 1BDCA 5IYZE 2CXDA 2HN2A 5CCHD 3QWOC 2YU1A 1ZLLA 3AA6B 4PD4H 2PP6A 3H6PA 2Y9ZA 1K9MQ 2B89A 1L0NJ 3RL0C 2WVRA 1S9KD 4ZS2A 4PJ0H 2XQAA 2C9NY 2H7VC 1WRGA 3RL0g 3ONXA 3H1HG 1EZVI 2LKHA 5AVQB 4H9OC 3T1HT 1MV8A 5AVVB 2WAUA 1HH0A 3PLNA 4L76A 3CCRP 3NWIA 3EWKA 4D6TD 2H89A 3F31A 4DUZT 2I8DA 3WUTA 1W0AA 3FXEB 4U72A 1UIIA 3JC6D 1M90Q 1MMGA 2BS3A 1CI6B 3H1LD 2O01N 2KZJA 4JI1T 1PPJD 3IEEA 1S4XA 1NH4A 3GMAA 5FXVA 4X66T 4OK0A 1TU3F 2K24A 2NWBA 1XWMA 3CPWO 2HPJA 1H0TA 3RYCE 3UQ4A 3PTRB 3QH9A 5HXEA 4CI2B 5KDMC 3GA8A 5HYAA 4CI3B 3MUDA 5APQA 1W5CE 2MBGA 1NTMJ 3DP7A 1IFNA 3JCUH 4HEAA 2LSKA 3AE3C 3A8YC 1UGOA 3E1IA 3FXDA 1FDMA 1FZGA 1MMDA 2JWAA 4WY4C 2Z6EA 4EOTA 4ISSA 4UELA 2LJLA 1EZVD 3CMEP 4WVZA 2WQYA 3SFEC 3HRNA 1BSHA 5GONE 3RKGA 1FZFA 3AAAB 2L3LA 2WPQA 1VQ5P 2QA7A 4XZCA 1LTIC 2V7JA 1Q82Q 1AJ3A 4I1LA 4ADZA 4JYCA 3P7KA 3CD6P 2E76D 2XDJA 4P0BA 5LP6E 1NTKJ 3Q5SA 2KLVA 1KNRA 3JADA 1NWQA 5BVZA 2KWIB 3KHUA 2CBJA 4PK6A 3H1KJ 1U7MA 5AW3B 4U2YA 1S2EA 3KXDA 1N33T 3IN6A 2OYOA 3D6YA 2HR3A 2XQ9A 1JTHA 2K37A 2WQYC 1ZHCA 4IE6A 2FBWA 2LHNA 1S3JA 3C64A 3RK3C 2R32A 1L0VA 4LF5T 3M9BA 1XTGB 2FYUG 2Y9YA 4GK5E 4JI8T 1NAYA 1NU1D 2ZYAA 1SHZC 1L0LD 4EEDA 4DBRA 3C4WA 3UT5E 4IE5A 2BKNA 2XAQB 2J5UA 5JDGA 2A06D 2UUAT 3RF1A 3HKDE 3O1JA 1NWMX 3LK3B 3CWBE 3FZLB 1ZW0A 2A72A 2XV5A 1KF6A 3CWBG 3AEGA 4HN9A 1YBKA 2E43A 5HWYA 2Q9IA 4I7ZB 1VQLP 4XBFB 1LT9C 1BE3G 5AQVB 2QJPC 3TGUG 2QM7A 5KLVG 1GK6A 1NENA 2PBIA 1S9KE 2XNDH 1OW8A 4AQGA 3JCFA 1AVYA 5H6RB 4ZI2C 3CX5E 2M0BA 2XM1A 2PFVA 2WPVB 3JSVC 3B8EB 4UF0B 4EGWA 1IK7A 2EHOB 2FJAA 3KV9A 2V7QH 5AQQB 2XSAA 4AKRB 3JAFA 2BG9C 3LJCA 4IDNA 5M4YA 2FFDA 4IHJE 1YTZT 4WY4D 2UWJE 3UU5A 4AYCA 3H1IE 1FZCA 2QRXA 2LSJA 1YIJP 5AQNB 4JI3T 1QGKB 3A2AA 4HWCA 5JDMA 1YI2P 3QB5K 3EQ2A 2FXOA 2FYUK 4JBZA 3O1HA 1XZYA 2WMOA 3UUNA 2YEVC 3P7IA 1N34T 2AEJA 1GD2E 4TV9E 2QJKC 1DEBA 2A45I 5FXZA 3A5TA 4KHXA 2V6XA 4Z1MH 2QG4A 2D5UA 2WZ7A 2XQ7A 4AKIA 2V7MA 5AQJB 3PJAA 2NP9A 1EC5A 1YTZI 4I0UA 1EZVE 4DV4T 2H3RA 3M0DC 3FZHB 2ODUA 3CCJP 1NU1G 2XKMA 2XQ6A 2WDRA 4O4LE 4HYTB 4IL6E 2I1KA 4QH1A 3LBXA 2LXBA 3QUJA 1DD4A 4PD4D 5L3FB 4UVBB 4OFZA 3U1CA 4JEHB 2E5YA 2KOGA 3AEGC 3WU2H 2P7JA 1S1CX 4R4MA 5L4HA 1M8OB 3AA0B 3H1HD 1IJ6A 4DR5T 4UIGA 4PK4A 1YQ4C 1KQSO 5FVKA 1WCRA 4DR1T 1HTJF 5LHHB 1OWAA 3L72D 5LA6E 4XE5B 2E75C 2KNCB 3ZT7A 3V2NA 3B13A 4H9RC 3RYFE 2XPKA 2Z5HA 4N6JA 3UQ7A 3V2RA 1WFDA 2Q9QA 4MALA 4CI1B 3VR9A 3P32A 5DJUB 1XMOT 2ZXEB 2KXPB 3H1LG 1NHLA 3NRYA 2J4GA 2W6BA 3ZSSA 1FZCC 3ETUA 1WR6A 4IE4A 5HAXA 2JWDA 4GYRA 1UX5A 3PJSK 1EZ3A 2LT3A 1PGOA 4IE0A 3AEEA 3IFMA 3MUDC 2V8SV 3HKCE 4HFEA 1HX8A 3LFMA 4UV9B 4EAHA 1E7PA 5AW8B 2Q9QC 1FS0E 4O8SA 3RK3D 4H9SE 1X0TA 4YLHA 5DQWA 3CX5D 2P10A 1YHQP 4AQFA 3TSIA 4A98A 2J59M 3L75E 5JDQA 2XQ4A 1KNZA 1HBWA 4UB6E 3ZKRA 3MZKB 4ZEYA 2CEAA 1SQPJ 3ANWA 3PTZA 2OTJP 2XZEA 3H1ID 1IJ5A 2KT9A 5KLVK 5KKZC 3FX0A 4TV8E 3EDUA 3H1JG 4JI2T 1T2KC 1FDIA 4LFCT 1KNPA 3TGUD 3TLVA 4EV6A 3VMYA 3SRZA 4AKLA 2HFED 3EDVA 3CX6B 4CPGA 1HJBA 3BRTB 4WB4A 4JYAT 2CWOA 2W8ZA 1PP9D 2Y48B 5LGUB 1LTAC 5H2FH 2RP4A 2CWYA 3H1IJ 3ESLA 4KMCA 1MFZA 4U33A 1IFJA 3L74J 3ITKA 4EIWA 4RESB 5FL1A 5JRCB 3M0AA 1Y01A 3B5NA 1OEDE 2LSYA 1BCCJ 1VQOP 2IUBA 3AVRA 4HWIB 4MHCA 1EDIA 5LBMA 1LNQA 3KV6A 5L3BB 3RIUC 2NR4A 4PD4E 3ZT5A 2LM2A 5CBOA 2W66A 3CCSP 4MBQA 4DV2T 2C5IT 2JIWA 1OIPA 3H32B 5CBNA 2QIWA 4B3RT 1NTME 4X20E 3O9XA 4LFBT 3Q5PA 4NUUA 1KEYA 1JO5A 1BR0A 3L72E 3CL3D 3UU4A 2IDBA 4YXDC 2HODB 3N9OA 4MLKA 2E76B 3P4SA 1KB9E 3B71A 3L35A 1KB9I 5KLIB 2X9YA 5FY7A 3SWFA 4TWHA 2A45H 2XQ5A 3SWHA 1H89A 5AVTB 2A9UA 1PPJE 4Y28J 5AQTB 2Q9QD 2D0UA 3EAMA 2WSFJ 2JP3A 3FBZA 2CLYC 1KILC 3ZMUB 2M3BA 2JQ9A 4UR9A 3WAJA 1MNDA 2X68A 3U3IA 4PJMA 3I9WA 3FHNA 4YT0A 4A7PA 1X22A 4IREA 4A5XA 4ILAA 3LW5H 5AVSB 1EXJA 5LJMA 4WNKA 1S94A 5FMNA 3IAOA 4D6TG 1NTMK 3B5MA 2UUBT 1J1JA 2YDRA 3RX6A 3H1KE 1VOMA 3FB2A 5ABHA 2VQET 2BG9A 3H1KG 4JEUB 1FOSE 3ZMTB 5ADXL 3R2PA 1M1KQ 4EI2A 3AEBA 3X1DA 3KZIE 1IBLT 2WPSA 4YHHT 3RYIE 4LF8T 3PH0A 3P4WA 5KJ7A 2PAJA 1DEEG 5GTIE 3PUQA 3Q5RA 1ZR4A 1GQEA 3PU8A 1WRDA 1USDA 4LMJA 4IFDK 4LF7T 4X5TA 5HEOA 2V5DA 3CX5I 2VKOA 3N9QA 1J1DB 4M3LA 3TNUB 1N73B 4LFAT 2P2UA 2JQKA 3RBZA 4JV5T 2CM0A 4QMAA 3AEBC 1LTSC 4PFPA 3H1JD 2V7IA 4ZS3A 3M0DA 5APVA 5KJ7C 1MZ9A 1URQB 3F89A 2JRKA 4HWDA 3SS1A 2A06E 5FL0A 3GN5B 2EHOC 1MIVA 4I4TE 1LGHB 3CWBD 4GOFA 4C46A 4C90A 2BCCE 1SQXJ 5AQGB 1KILA 5AQLB 2W67A 3OW2O 4HWHA 1KQGB 4JYBA 3QK6A 5LB7B 2BVMA 4HFHA 3A0BH 2R5DA 5APWA 4KBMB 3AA1B 3UFEA 3RQUA 1YJWP 2N1TD 3SSUA 3DTOA 1L0NE 4FJOA 2B76A 4U3FD 5AVRB 3L73J 1W09A 1HNWT 2Y8DA 1GTWA 4RKUJ 2WSCH 3VP9A 2JQQA 4AIUA 1NTZE 1M1JC 4HH2A 1D1CA 1LRZA 4EYYQ 4YPCA 2E5TA 1JY2O 5TISH 4OHFA 1SQBE 5KLVD 2WTYA 4EOZB 5AQHB 3TK1A 2V7QJ 3RK2C 3L36A 1PP9J 2DCFA 3UU8A 1URQD 1W2EA 2LSIA 3KV4A 1E2AA 1FE6A 2R3CA 3ZCJA 3BASA 1H88A 3BCCE 3CX5H 1JY2P 1BE3J 1IK9A 3ZN0B 5AW6B 3A0HH 2WPRA 5GTIH 5KTBA 3TLUA 3AE9C 1AFOA 1SVFA 3GF3A 2K9YA 1SQXE 3LDQB 3Q5DA 2OYIA 3L73G 2XY8B 5LXTE 1FDOA 2A45G 1PIXA 3AE7A 5FKYA 2XQYA 3A7OA 4MN4C 2WS3A 2KZIA 3H1HE 2O1KA 4G63A 3AEDA 1P84E 1WMKA 4GOEA 1SQPE 4ZMDA 3FWNA 1CZQA 1FJGT 1LWUA 2A2FX 2XZRA 2WDVA 5AVXB 3LBXB 1YQ3C 3CK6A 4R4LA 1W9RA 5HXRA 2LKGA 2QJYB 1Z56A 1FEWA 2YN6A 4YTPA 2V1DB 2Q7CA 1L4AA 3CQCB 3AE2C 2QYWA 2OQQA 1WLXA 4GT1A 2OTLP 3N7NA 3HE4A 1VCTA 4PFOA 4PV1D 4DIDB 4I43B 3UFGA 2IIUA 1R5LA 5FXXA 3TDKA 2VKDA 2X67A 1KK7A 3QNUA 5CMZA 5B66H 2AXTE 2V26A 3JCUE 1PZQA 3QB5A 2ZT9C 3HL6A 2R5BA 4EYUA 1JY3N 3KDSE 3V5SA 2IC6A 4U3FE 1E79H 1H0TB 2RN0A 3CXHH 1HNZT 2DW3A 4I2LC 3ABVC 4ZNCA 3L75D 1D1AA 4QXCB 1L4AB 1D0YA 1NTZD 2JJLA 4PAGA 5AQSB 5CGMA 1KYOI 2IX7C 2M8RA 1KYOD 2IMLA 1N36T 3L74G 2Y6XA 1CUNA 1KORA 1VQNP 3PE0A 3D0TA 2YDSA 2PJQA 2IBZI 3RLFF 1NYHA 1KILE 1IZNB 4IT4A 3BK9A 2LM9A 3L3PA 4EYYR 1NAFA 3RC3A 4DV5T 2AEFA 5AVWB 2WM9A 4HFDA 1LWUC 4KHZF 1S5LE 3L70E 5AW4B 2QJKB 4UF0A 1SFCB 4H63H 4OYKA 3G6EP 5LG3A 2JO1A 4TZ4C 2I1JA 1ZR2A 2FFDB 2X9XA 3I0OA 2W00A 2YKSA 3R6NA 1RF1A 2JDIH 5L2LA 5EFWB 1HF9A 3L71E 3VOPA 2KIKA 5CHXA 1SFCA 3Q1MA 2LRKA 2JMKA 1EQ7A 1JNRA 1QSDA 4I6MC 1M62A 3I0QA 3NVOA 1L0NK 2FBWC 3LIEA 4JI0T 3P8CE 1LTJA 1M7KA 1NO4A 1SQQE 1NGMB 2NPSC 1NKNA 2LR2A 1VCSA 4IFMA 1BGYE 4GKJT 1GL2D 2I0MA 4DR3T 3E08A 2ITAA 3RL0B 1BGYJ 1LTTC 2OYHA 5FNVE 4I7ZC 2GUVA 3ZMZB 2J58A 1GZLA 1RY3A 4DT0A 1Q81Q 5CJ0A 2WWVA 2CPBA 3P4PA 3H1LJ 1Q90D 3LK42 4DV3T 2YDQA 3PUYF 2LKMA 4DMWA 1QLBA 5L3EB 1MFTA 3L74D 2X0HA 3C8VA 2NPSA 5KAIH 4NPPA 3ZCIA 1XDPA 1DIPA 1UUSA 1KMIZ 3AAIA 2ZM0A 1QVFO 1SQXG 3S9OA 3N9NA 2P58A 1VF5C 4H9PC 4RO0A 1BE3D 2FYUD 2CA5A 2WZIA 3G4SP 2E2AA 3KQGA 2D2CD 4WW0A 3UTKA 2M67A 3PJAJ 1QEXA 5JQGE 1T3JA 4IDPA 2DWKA 1S72P 2P1JA 4W7YA 3H1KD 3AEAC 1HG5A 5L47A 5KAFH 2POHA 5AQPB 5L3CB 3VMAA 3HUSC 3NZQA 1US7B 1KFMA 1XDOA 3VYIA 5LMUT 4U74A 1XMQT 3SFDA 4E7SA 4JI7T 2YO2A 1QL2A 2V6YB 1LTJC 4QXHB 4U31A 3MACA 2OLTA 2H43A 3RBXA 3ZC0A 1D1BA 4C7NB 2JPFA
chains in the Genus database with same CATH topology
2Z4EA 5LGUB 1LTAC 4CZZB 2RP4A 2CWYA 3PURA 3ESLA 3HTKA 3GMIA 4FI5A 3RC8A 3HUSA 1MMAA 1Y64B 1SQBK 1MFZA 2W61A 4KMCA 4PJJA 3M06A 1IFJA 4ZOLE 3VMXA 2VKJA 1SP4A 4EIWA 3KVBA 2NTXA 5EK4A 1RE3C 4RESB 3N9PA 2YKQA 5JRCB 2LEHA 3M0AA 4O9BA 3AB3B 1N7SD 2IPPA 3B5NA 3RL0D 2LSYA 2IW5B 5JDHA 2SPCA 3AVRA 4MHCA 2J1DG 5LBMA 3IBPA 3VTPC 3A5XA 3KV6A 2GUSA 5AW0B 3E0ZA 3KBTA 3V5UA 4GKGA 5L3BB 4UEMA 2OYIB 3RRWA 4H9NC 1RF1B 2BASA 3K3NA 1S35A 4YJ3E 4I50E 4WY4B 3O1IA 4QWNB 4MBQA 4PJLA 5AFUL 2C5IT 4HTEA 3AAEB 3H32B 1G1IA 1FZBA 1JTHB 1JMMA 1NTKK 2OARA 1FJKA 2WSFH 2C0SA 2LHRA 3S4UA 2XAHB 2MTQA 3DJBA 3ZPOA 2YINA 4EIJA 1IFMA 2N1TC 3O8ZA 4QX7B 4B86A 4X20E 2PG8A 1VPCA 3O9XA 1B7TA 1L0LK 2ES0A 5JDFA 2C5KT 3H37A 3Q9DA 4NUUA 5ETWA 1JO5A 1BR0A 4GIFA 1RF0C 3K3QC 5JR9B 2OYHC 3H32A 3CL3D 2C9LY 4P09A 4AUWA 3CX7B 3KBUA 4Y99B 2LE8A 2HODB 2XAJB 3N9OA 4MLKA 3ZJ1A 4LC1A 4BJNA 5CCGA 1LTBC 3OJAB 1RE4C 1G8XA 4ANJA 3L35A 2YNYA 2N9DA 2X9YA 3V2QA 1LVFA 3FXDB 5FY7A 3SWFA 1X8YA 3VP8A 5EK2A 2A45H 3NMDA 1U5PA 3HD7A 2RA1A 3CX8B 1AQ5A 3SWHA 2H7OA 1H89A 3RH3A 4L0RA 2XAGB 5AVTB 3VU7H 4N78E 1HF8A 3AVSA 3N2OA 2NW8A 3I1AA 3C50A 3JC6C 4JLEA 1GW4A 5FY1A 1LTJB 5EK3A 1MIYA 4CQIA 5AW5B 2Q9QD 3CKDA 3OJAA 1D0XA 2D0UA 3VKHA 1GW3A 1URQA 3A3YB 3RYHE 3N4XA 1SA0E 3B5NC 1ZEEA 5DABA 5APYA 5FYMA 3FBZA 2CLYC 1KILC 1FZAA 3V5BA 2CCQA 1YW0A 5DQVA 3ZMUB 2M3BA 2W0GA 5C8YE 3HE4B 5CCGC 3WAJA 1N7SA 3KDPB 1MNDA 2X68A 3U3IA 2XU6A 1WYCA 3I9WA 2X9HA 2MYSA 3BQKA 4PJMA 5FY0A 2IAKA 3FHNA 3IF8B 3N2KE 2OA5A 4EXTA 2KB7P 4JF7A 3OKQA 5HXHA 2NW9A 3LW5H 5AVSB 3VMZA 5LJMA 2EHOA 3II6A 3I9YA 3OA7A 4OH8B 3PU3A 4WNKA 1JCCA 3UIAA 3LG7A 3QC9A 1S94A 1G2CB 3M9HA 1L4AD 2IFMA 1GDTA 1NTMK 5FMNA 1Z0PA 2DNXA 3ZEFB 2KWHA 3RK3B 1UX4A 3L09A 1LT9B 1H8AA 3RX6A 2E9XB 1VOMA 2XNXA 4CXYA 1FMWA 1PFIA 4ZI2D 3FB2A 1JY2N 4N3YB 3CWZB 1GK4A 5CB4E 5CCGD 1V9DA 1LVKA 4JEUB 2X66A 1FOSE 2Q5UA 1UCUA 3RRCA 3GHGC 2N2NA 3ZMTB 5ADXL 5LG4A 3R2PA 2YMYA 2A3DA 2FFDC 4EZHA 2NTYA 2WPSA 5JDLA 2GM4A 1T2KD 4AKRB 3RYIE 3M9QA 1CI6A 1J1DC 3MJXA 3PUGA 5KJ7A 2VASA 2PAJA 5FP3A 3PUQA 3U78A 2H7HA 3C51A 3HI2A 3HE5A 1ZR4A 3PU8A 1WRDA 2XASB 5FXWA 5LOVE 3V4WA 3UUMA 4HGAA 4IFDK 2JMHA 4QKNA 3HA4A 4E7ZA 5JH7E 1LTGC 1NKZB 2KLQA 2GK9A 1FZCB 2VKOA 2VB6A 3N9QA 5LHIB 1J1DB 2JEEA 4M3LA 3TNUB 5APUA 3LIDA 3WMM0 1N73B 3U59A 2CMRA 4PJNA 3HKEE 4JUYA 3EFGA 3J9X1 4ERRA 4M1PA 3GHGA 2P2UA 2HPCB 4XAXB 3ZYMA 4AQFC 1SQQK 5CCHC 1JNMA 5L3DB 2CM0A 3MIWA 5AW2B 4EB6E 3TYYA 1LTSC 2HYNA 4MFRA 4O2AE 4PFPA 4WBAA 1N73C 4V1Av 1SLQA 2V7IA 4ZS3A 2KINB 4PW8A 2P67A 3M0DA 4HE8A 3SOLA 3C98B 3O4XE 5APVA 4ISTA 5KJ7C 1MZ9A 1URQB 1FOSF 2JRKA 5LHGB 4AI6A 3SS1A 4CXWA 4UVCB 4TX5A 4GK0E 3GN5B 2EHOC 4HKAA 3G3ZA 1MIVA 2YU2A 1JY3O 4K0UA 3PDYA 1NU1K 5AVUB 4I4TE 4ZKUA 5JR9C 3VHLA 3N5LA 1LGHB 3Q2MA 5H6QB 2VL8A 4C46A 4C90A 4WY4A 4ZKPA 1IO4A 4HFVA 5IHYA 3NZPA 3KV5A 2CE7A 2CXDA 3M65A 1KILA 5IYZE 3RK2D 3HTKB 5CCHD 2YU1A 1WYBA 1ZLLA 4JYBA 2O01H 2KSJA 3AA6B 3QK6A 2PP6A 3H6PA 3V2PA 2BVMA 2KNDA 2R5DA 4XA4A 5APWA 4KBMB 3AA1B 2N1TB 3RL0C 1FAVA 1S9KD 3LK2B 4ZS2A 4BAYB 2XTLA 3CPZA 4QHOA 3UFEA 1KQLA 3MGNA 2N1TD 1MMNA 3CMLA 3DTOA 2C9NY 2H7VC 1WRGA 3H3AA 3ONXA 4FJOA 2L8KA 1HS7A 3K3OA 5AVQB 2WT7A 5AVRB 4H9OC 4O2BE 2LOSA 1MV8A 5AVVB 5AW9B 3SWYA 2WAUA 1HH0A 1GTWA 2Y8DA 2DLRA 3HD7C 2WSCH 3VP9A 1NOHA 3IR9A 3PP5A 2JQQA 3ETVA 5HXSA 3F31A 3KFWX 1M1JC 4HH2A 1FJPA 2ZFCA 3FXEB 4X1IE 1JUNA 4U72A 1D1CA 3JC6D 2L9QA 1MMGA 2E9XD 1CI6B 1IFDA 3NXSA 4N78D 4YHJA 1LRZA 1SQVK 5F8PA 4X1YE 3IEEA 2YO3A 1NH4A 2DI4A 2YKOA 2KMFA 2X9WA 3KPEA 5FXVA 3F2EA 4OK0A 4IE7A 2K24A 2NWBA 4BA9A 4DMVA 3Q5WA 3ZYLA 3CQXC 2HPJA 1JY2O 5CA1E 3VKGA 1IFIA 2IFNA 3RYCE 2VWAA 3PTRB 4OHFA 1HUCA 3C4XA 2WTYA 1E1HB 1CW5A 4EOZB 5HXEA 4CI2B 5KDMC 3GA8A 5HYAA 5APSA 4CI3B 3MUDA 3BATA 5APQA 3TK1A 2N1TA 3RK2C 4NUVA 2MBGA 3DP7A 2CXLA 1IFNA 3L36A 4HEAA 3UULA 3TKLB 3BVHA 2DCFA 2LSKA 2ZLYA 1URQD 1W2EA 2LSIA 3E1IA 1ZN5A 1G73A 5KMGP 3KV4A 1FDMA 1FZGA 1MMDA 4WY4C 2XHEB 3ZCJA 5CCHA 2Z6EA 4EOTA 4ISSA 2R3CA 1HVVA 1X79B 1IC2A 5DJQC 4UELA 2LJLA 5EZYE 3VN0A 3BASA 2MJZA 3HUSB 3CLQA 1H88A 2HPLA 2BDEA 2LSGA 3R84B 1JY2P 3HRNA 5GONE 2FYZA 1HCIA 5JVDE 1FZFA 4ZHQE 1IK9A 3AAAB 3ZN0B 2L3LA 1GU4A 5AW6B 2WPQA 4O4HE 2QA7A 4XZCA 1LTIC 4GIWA 1YKHB 3B5NB 5KTBA 2WPRA 2V7JA 4I1LA 3NTNA 3T97A 4O4IE 4ADZA 1AJ3A 4JYCA 3GHGB 3P7KA 2XDJA 1KILB 2HPCA 1AFOA 1SVFA 4P0BA 2WMNA 5LP6E 1SQPK 5JREA 1MUUA 4IIJE 2KLVA 5J1GA 3W15B 3KINB 3ZN1B 2OYIA 2MOZA 1NWQA 3GWHA 5BVZA 2KWIB 2IC9A 4BJMA 4PK6A 1HFAA 1BR1A 5LXTE 2WWUA 5AW3B 3E22E 2A45G 3P8CD 2XQYA 3A7OA 3ZMSB 3PUSA 4CI1B 1JTHA 1ZHCA 2O1KA 4G63A 4IE6A 2LHNA 3MD0A 2NPSD 3L37A 3RK3C 3C64A 2R32A 5LGTB 1ZKEA 1ZV8A 3EVYA 1CZQA 2E9XA 3AA7B 1LWUA 2A2FX 2XZRA 2XUEA 5AVXB 3LBXB 3M9BA 1XTGB 5HXRA 2ZM2A 1RE4A 5JRCA 2YKPA 4GK5E 1Z56A 4W7ZA 1FEWA 3HD7D 2V7LA 2V1DB 2Q7CA 1YD8G 1L4AA 1SHZC 2VKHA 3CQCB 2KP8A 1WLXA 4GT1A 2CLYB 2X0LB 3UUXB 5HWXA 3N7NA 1QL1A 3HE4A 5KJ7D 4DBRA 4P0AA 3I5CA 3C4WA 4PFOA 1URQC 4IE5A 2XAQB 4I43B 3UT5E 5JDGA 2W27A 3WAKA 5FXXA 3P8MC 5BU8B 1IAPA 2VKDA 3HKDE 3O1JA 2X67A 2NW7A 2YK0A 1JCDA 1NWMX 3LK3B 3GN5A 3MXZA 3ZMVB 5LGNB 1KK7A 4W80A 5CMZA 1O3XA 1JOCA 2V26A 1G2CA 1N7SC 2A72A 2XV5A 5LBQB 3RK2B 3B57A 2E43A 4HN9A 2L5GB 5HWYA 2I59A 4ASKA 3HL6A 2Q9IA 2WSEH 3MKDA 4XBFB 1LT9C 4UVBB 3K8PC 2Q9QB 1GL2C 1BR4A 3J7Yq 2R5BA 1N2DC 2QM7A 2WSSV 1GK6A 1JY3N 1T98A 3KDSE 4EYUA 5LJNA 3V5SA 4Y99C 1QUUA 2IC6A 1S9KE 2PBIA 1SFCD 4EZ4A 3HKBE 1RF1C 4AQGA 1IJDB 4YJ2E 1LWUB 5H6RB 2HODA 1T3UA 4ZI2C 5J2TE 4ZI7E 2PFVA 4I2LC 4X1KE 4WBNE 4WBOA 5JDNA 3B8EB 4UF0B 4AXPA 3BQLA 2EHOB 3KV9A 4DNDA 1D1AA 2HH7A 3L4FA 1NTZK 2WT7B 3CVRA 4QXCB 4YFSA 1L4AB 1RF0A 1D0YA 3LJCA 5M4YA 5F3JA 4C91A 2V7KA 1VRBA 2JJLA 4PAGA 1M1JB 2FFDA 3Q5XA 4IHJE 1YTZT 4WY4D 1HGZA 2C0WA 2IX7C 2M8RA 2ZMAA 3BQIA 4AYCA 2CPSA 1HTLC 1FZCA 1J2JB 1T8ZA 2LSJA 1D0ZA 2Y6XA 3MTUE 1GL2A 1A02J 1CUNA 2N9BA 4IDZA 3C9IA 1FZEA 3PE0A 3D0TA 3WI3A 5JR9A 4H9QC 3A2AA 2PJQA 1M7LA 4L5GA 5JDMA 3EQ2A 2KYVA 2FYUK 2CXFA 3O1HA 3CI9A 1MIWA 1IZNB 3OYXA 4OYJA 3RKOA 2WMOA 5L3GB 3UUNA 2K48A 2YEVC 1HGVA 3BK9A 3CQGB 2LM9A 4ZI3D 5A1LA 3L3PA 3EUHA 5KX5E 3P7IA 4Z8XA 4EYYR 3OAKA 3C4ZA 1NAFA 1GD2E 4GYSA 4TV9E 3RC3A 1DEBA 2A45I 4DZOA 5AVWB 2WM9A 3A5TA 4KHXA 1GU5A 5FXZA 4DVDA 2D5UA 2WZ7A 1LWUC 2C5JA 4AKIA 2C0XA 2V7MA 1HWTC 3NBXX 5AW4B 4ZI3C 2NP9A 3N9MA 1YTZI 4UF0A 1SFCB 3V4QA 3IHRA 4H63H 2FKWB 3U1AA 2H3RA 3M0DC 4OYKA 2ODUA 5E0OA 1WT6A 1HG2A 4TZ4C 2WWWA 1FBMA 2I1JA 1ZR2A 1A02F 4IGUA 1M1JA 2FFDB 5J2UE 2XKMA 5AVZB 2X9XA 3I0OA 2W00A 5CA0E 5LNKA 3R6NA 1RF1A 2BVLA 4O4LE 4TUYE 4HYTB 2WBLA 5L2LA 2I1KA 4AQRD 3LBXA 2OYIC 2BZBA 3QUJA 2LOPA 3ZC1A 5LYJE 3VOPA 5CHXA 5APTA 1SQXK 1SFCA 1BR2A 5L3FB 4C7NA 4OFZA 2JMKA 3NRXA 2QM8A 3BRVB 3U1CA 4JEHB 4QXBB 1EQ7A 1J1EB 1QSDA 1FMVA 2KOGA 4I6MC 1VDFA 3I0QA 1L0NK 2P7JA 3LIEA 3P8CE 1LTJA 1NO4A 2UXXB 1IJ6A 3AA0B 4I55E 1J1EC 4PK5A 2W62A 4PK4A 2NPSC 4G2AA 1JY3P 4UIGA 1NKNA 3PUAA 5TAOA 1HTJF 2EHOD 5LHHB 1OWAA 4IFMA 1X9VA 2X51A 4XE5B 2ODVA 5LA6E 1GL2D 2D2SA 2W63A 4CXXA 3N2GE 3E08A 3V2NA 3B13A 1N7SB 4H9RC 4UXNB 2Z5HA 4N6JA 3RL0B 2E8IA 3V2RA 3RYFE 1LTTC 2Q9QA 2G0UA 3HR0A 4MALA 2NPSB 1G1JA 3P32A 2OYHA 3FBLA 2ZXEB 2GUVA 2KXPB 2J58A 5FNVE 1GZLA 1FIOA 3HE5B 3ZMZB 1NHLA 1RY3A 3NRYA 2H8PD 5CJ0A 1FU1A 2CPBA 2QGSA 1KZUB 4QX8B 2W6BA 3LK42 1FZCC 3ETUA 1WR6A 5AW7B 2LKMA 2DWGA 4DMWA 2XAFB 4IE4A 5HAXA 3TNUA 1N7LA 1LT9A 1N73A 1DH3A 1UX5A 4GYRA 4KUMB 4O4JE 5L3EB 1CSBA 3KYQA 1EZ3A 2ZM8A 2NPSA 2OYHB 3N9LA 2LT3A 3OBVE 3ZCIA 1H7CA 4IE0A 4DOJA 3IFMA 1YKEB 4IFFA 1X79A 3HKCE 3RPUA 3ZLIA 4UV9B 1HX8A 3B5ND 3AAIA 3LFMA 4EAHA 2FXMA 2ZM0A 2HLOA 5AW8B 2JJ9A 2Q3IA 2VRSA 4C7RA 1OXZA 2Z5IA 2HG5D 4LLHA 3N9NA 1N86A 5AVYB 1GL2B 2Q9QC 4A56A 2P9BA 3OYZA 4H9PC 4O8SA 1U4QA 2VK9A 3RK3D 3ZJ2A 1SFCC 2CA5A 3HD7B 4H9SE 2B1EA 4YLHA 5DQWA 5BU5A 1XTCC 4L9IA 3KQGA 3ZYKA 5APXA 2N1GA 5BMVE 3T8OA 4WW0A 2WITA 3UTKA 2M67A 4AQFA 3TSIA 2ACXA 4AKHA 5JQGE 1T3JA 4B6XA 5HXCA 2DWKA 4UV8B 2J59M 5JDQA 2O1JA 2P1JA 1KNZA 4W7YA 1HBWA 1L4AC 2KZ7B 1HG5A 3F57A 3MZKB 2NOXA 3NFQA 2POHA 5AW1B 2CEAA 3ANWA 1MNEA 5LCYA 2D0TA 5CJ4A 4J2CA 2CWOA 5L3CB 4GOUA 1DX7A 3HUSC 1IJ5A 3NZQA 2KT9A 5KLVK 1US7B 4ILUA 4DO0A 4DBQA 1E5WA 2UXNB 1KFMA 4TV8E 3EDUA 1T2KC 3VYIA 2K5BB 1RE3A 4U74A 3MK7C 4TN7B 4KP3C 1ZV4X 4PNIA 4E7SA 2YO2A 4H63V 1YYCA 3VMYA 1KILD 2E42A 3SRZA 1QL2A 3KVAA 3ANWB 4AKLA 1LTJC 2HFED 2K9AA 3M91A 2E9XC 3EDVA 3MA9A 4QXHB 4UVAB 4F6RC 1KFNA 4LGDE 2DHRA 3MACA 3CX6B 1HJBA 3BRTB 4WB4A 2W6AA 1LKXA 2H43A 3ZC0A 4AKGA 1D1BA 4C7NB 2JPFA 2Y48B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYC A;  3P7K A;  2H7H A;  3HE5 A;  2WWW A;  3HTK A;  1WRD A;  1A02 F;  3V4W A;  1MUU A;  5AVZ B;  1MFZ A;  1NWQ A;  3M06 A;  3VMX A;  1SP4 A;  4HYT B;  4AQR D;  5AW3 B;  4M3L A;  3TNU B;  4RES B;  5APU A;  3LID A;  5APT A;  3M0A A;  3A7O A;  2IPP A;  4C7N A;  2QM8 A;  2P2U A;  3MD0 A;  3VTP C;  4I6M C;  1JNM A;  3L37 A;  5AW0 B;  2R32 A;  4GKG A;  5AW2 B;  2P7J A;  3TYY A;  3LIE A;  1CZQ A;  2BAS A;  1SLQ A;  2XZR A;  2P67 A;  3M0D A;  5AVX B;  3M9B A;  5APV A;  1FOS F;  2Q7C A;  1YD8 G;  1OWA A;  5AVU B;  4XE5 B;  2KP8 A;  4GT1 A;  3HE4 A;  3I5C A;  3O8Z A;  2Z5H A;  4C46 A;  4B86 A;  2W27 A;  3P32 A;  1IO4 A;  2ZXE B;  1GZL A;  3HE5 B;  3P8M C;  4JYB A;  1NWM X;  2C9L Y;  4AUW A;  2R5D A;  5CMZ A;  5APW A;  1O3X A;  1WR6 A;  2XV5 A;  5AW7 B;  1FAV A;  1S9K D;  4LC1 A;  2E43 A;  3TNU A;  1DH3 A;  1KQL A;  3L35 A;  2YNY A;  3MGN A;  2N9D A;  2C9N Y;  1CSB A;  3SWF A;  1X8Y A;  3NMD A;  2R5B A;  5AVQ B;  5AVR B;  2WT7 A;  2QM7 A;  1GK6 A;  1MV8 A;  5AVV B;  5AW9 B;  1H89 A;  1GTW A;  1X79 A;  5AVT B;  1S9K E;  3IR9 A;  5AW8 B;  2Q3I A;  2VRS A;  1OXZ A;  2Z5I A;  5AW5 B;  5AVY B;  2ZFC A;  4I2L C;  1JUN A;  3A3Y B;  3B8E B;  1CI6 B;  3NXS A;  2WT7 B;  5APY A;  2YO3 A;  3V5B A;  3KQG A;  5APX A;  2JJL A;  3HE4 B;  3KDP B;  4AYC A;  2XU6 A;  1J2J B;  1A02 J;  2N9B A;  1HBW A;  1HUC A;  5AVS B;  3VMZ A;  2WTY A;  3A2A A;  3NFQ A;  5AW1 B;  5APS A;  3UIA A;  5APQ A;  3TK1 A;  1G2C B;  3M9H A;  3L36 A;  1H8A A;  1T2K C;  3VYI A;  3OAK A;  1NAF A;  1GK4 A;  1GD2 E;  2YO2 A;  1YYC A;  3VMY A;  2R3C A;  5AVW B;  4DZO A;  4EOT A;  1FOS E;  2E42 A;  2Q5U A;  3VN0 A;  4KHX A;  3A5T A;  1GU5 A;  1H88 A;  2N2N A;  3M91 A;  4C7N B;  1HWT C;  1GU4 A;  2WPS A;  5AW6 B;  2WPQ A;  5AW4 B;  1HJB A;  1T2K D;  2W6A A;  3V4Q A;  2WPR A;  1CI6 A;  3T97 A;  3NTN A; 
#chains in the Genus database with same CATH topology
 1IBK T;  3AE2 A;  2BBJ A;  3HUS A;  1Y64 B;  2MAW A;  1SQB K;  4PJJ A;  4U3F J;  5EK4 A;  2NZ2 A;  4O9B A;  3AB3 B;  5KLI C;  5K5G B;  2BS4 A;  3VTP C;  3A5X A;  4JI4 T;  4JPZ B;  2K9J A;  3Q3D A;  2E75 B;  3AE9 A;  3O1I A;  5HEG A;  4HTE A;  2M6I A;  1FZB A;  2C0S A;  1FJK A;  2WSF H;  1Q2N A;  2CBI A;  3S4U A;  2UXC T;  2E74 B;  4EIJ A;  1IFM A;  3O8Z A;  1ZOY C;  2PG8 A;  1VPC A;  2ES0 A;  3AED C;  4X64 T;  1L0N D;  3AE6 C;  1OVV A;  5J0Z A;  4X65 T;  2B88 A;  1LTB C;  4H44 D;  4D6T E;  2N9D A;  2YNY A;  3AEA A;  2JR8 A;  5EK2 A;  3VP8 A;  3NMD A;  3SWK A;  3HD7 A;  3AEC A;  2D9D A;  5TIS E;  3L72 J;  3RH3 A;  1IFP A;  2XAG B;  2MKV A;  3VU7 H;  4U7I A;  2NW8 A;  3I1A A;  3C50 A;  4JLE A;  2K9J B;  1LTJ B;  2H89 C;  4CQI A;  3VKH A;  5C39 A;  4OWF A;  3H25 A;  3LSV A;  5KLV E;  2CCQ A;  1YW0 A;  2W0G A;  5C8Y E;  4BWN A;  1BE3 E;  2MYS A;  3BQK A;  3TF5 A;  3IF8 B;  2OA5 A;  1JM0 A;  4EXT A;  3WUV A;  3AEC C;  4JF7 A;  5B5E H;  3OKQ A;  5HXH A;  2NW9 A;  3I9Y A;  1NTK G;  4OH8 B;  3RGU A;  5BR8 T;  2F4V T;  1PL5 A;  3UIA A;  3LG7 A;  3QC9 A;  1G2C B;  1GDT A;  3ZEF B;  1I6Z A;  3ABV A;  3L09 A;  1LT9 B;  1H8A A;  5ABF B;  2E9X B;  4CXY A;  4ZI2 D;  2Q1K A;  3GF7 A;  2X66 A;  1SQB J;  1VQ7 P;  2Q5U A;  1UCU A;  3RIA A;  2NRG A;  1KQF B;  2YMY A;  1S5L X;  1K73 Q;  3P4R A;  2ZVN B;  4RJT A;  3MJX A;  1J1D C;  3EI0 A;  2VAS A;  5FP3 A;  3HI2 A;  5FXW A;  1OZH A;  3HE5 A;  3ZT6 A;  3L72 G;  3UUM A;  4HGA A;  2JMH A;  4E7Z A;  1P84 D;  1LTG C;  1NKZ B;  2VB6 A;  1RHZ B;  1EDJ A;  3H1H J;  3RIF A;  3WMM 0;  1BDD A;  3LID A;  5APU A;  3U59 A;  3HKE E;  3T97 B;  2AXC A;  4JUY A;  2D2C C;  1M57 D;  4M1P A;  1L0N G;  2XQ3 A;  1SQQ K;  5CCH C;  5L3D B;  3MIW A;  5AW2 B;  2AXT H;  5B66 E;  1KC8 Q;  1T6A A;  3L75 J;  2I6H A;  4MFR A;  4U7J A;  4O2A E;  4V1A v;  3W68 A;  2KIN B;  4YSZ A;  4PW8 A;  4HE8 A;  4DR2 T;  1K05 A;  3O4X E;  4ZZC A;  2D2C B;  5KAF E;  4U7Y A;  4CXW A;  4GK0 E;  1VQP P;  2J47 A;  4HKA A;  3V6I A;  4K0U A;  3AE4 A;  2BCC J;  2RH0 A;  3PDY A;  5AVU B;  3Q2M A;  2VL8 A;  1SUM B;  5HEH A;  5ABG A;  4WY4 A;  4ZKP A;  1IO4 A;  5IHY A;  1PP9 G;  3NZP A;  3KV5 A;  2KSJ A;  3SFE A;  3V2P A;  2KND A;  4XA4 A;  2AEM A;  1IBM T;  2N1T B;  1FAV A;  3E1R A;  3LK2 B;  4BAY B;  3CPZ A;  3CML A;  3O6Q A;  1M56 D;  1HS7 A;  2WT7 A;  2VVN A;  4O2B E;  3SWY A;  5AW9 B;  3G9R A;  3ETV A;  3PP5 A;  2H88 C;  5HXS A;  1VL2 A;  4KJM A;  3BCC G;  2YOE A;  1JEK A;  1P84 H;  4X1I E;  5DJT B;  2L9Q A;  3L71 J;  4N78 D;  1SS1 A;  4YHJ A;  5F8P A;  4EDF A;  2YO3 A;  2YKO A;  2JKV A;  2KMF A;  2X9W A;  3F2E A;  3P50 A;  4BA9 A;  3CQX C;  5CA1 E;  1HUC A;  2R6G F;  1E1H B;  1Y8A A;  4NUV A;  3BAT A;  1YQ4 A;  2N1T A;  4DR7 T;  3TKL B;  5IWA T;  2VVS A;  4H44 B;  1AQT A;  5KMG P;  3B4S A;  2YMK A;  4Q25 A;  2XHE B;  5CCH A;  4JI6 T;  5DJQ C;  1IC2 A;  2MJZ A;  3HUS B;  4LF4 T;  5JVD E;  2W2U A;  4DV0 T;  4OVN F;  2AXD S;  1YKH B;  3B5N B;  2IBZ G;  3T97 A;  4KHP T;  3GHG B;  2HPC A;  1KIL B;  2V5C A;  4IIJ E;  2V6Y A;  3W15 B;  4BJM A;  1OFC X;  2AE9 A;  3FZF B;  3GWH A;  1BR1 A;  3R4Y A;  4DV7 T;  3E22 E;  3UU3 A;  1SQV E;  1SQV G;  3AE8 A;  3L37 A;  5LGT B;  3AE5 C;  1VF5 D;  3CMA P;  3UUB A;  2XUE A;  2XM2 A;  2ZM2 A;  1RE4 A;  2FYN C;  2YKP A;  2YXQ B;  3HD7 D;  4LML A;  2FUP A;  1YD8 G;  1BCC G;  1WR0 A;  5HWX A;  2CLY B;  2X0L B;  3L8R A;  4P0A A;  3I5C A;  4WYV A;  2ZT9 D;  3WAK A;  3USS A;  3L74 E;  3P8M C;  1IAP A;  3FGA D;  5JRE A;  5LGN B;  2YK0 A;  1JCD A;  3GN5 A;  4GOD A;  1O3X A;  1JOC A;  1G2C A;  5LBQ B;  3S4R A;  3RK2 B;  3B57 A;  4YTM A;  4ASK A;  2L5G B;  3TGU J;  1KN7 A;  2I59 A;  1VQ9 P;  4JBW F;  2WSS H;  3J7Y q;  1BR4 A;  2XSB A;  4LF9 T;  1LJ2 A;  5LJN A;  1T98 A;  3CXH E;  4NPE A;  3AEE C;  3VKG A;  3RK3 E;  4YJ2 E;  4JI5 T;  2ZYG A;  1R8E A;  1LWU B;  2SPZ A;  5CJ5 A;  1T3U A;  5J2T E;  3H3M A;  2OGU A;  5AQK B;  4X1K E;  4WBN E;  4WBO A;  4ZZB A;  5JDN A;  1W0B A;  2HH7 A;  3L4F A;  3UU6 A;  1KFY A;  3JC2 2;  4C91 A;  2LRL A;  2V7K A;  1VRB A;  1M1J B;  2C0W A;  3S1K A;  1NVO A;  3GLM A;  5ABF A;  2FYU J;  4K3A A;  1T8Z A;  1D0Z A;  4CN1 A;  3CCU P;  3MTU E;  1A02 J;  4H44 C;  2N9B A;  1FZE A;  5JR9 A;  2E74 D;  3FZK B;  4H9Q C;  3TGU E;  1M7L A;  1P84 I;  2CXF A;  3OYX A;  4OYJ A;  3CCV P;  3L73 D;  2K48 A;  2WSE J;  4ZI3 D;  5A1L A;  3EUH A;  2OV9 A;  4Z8X A;  3OAK A;  3C4Z A;  2E75 D;  4GYS A;  1VQM P;  5AQF B;  4LMK A;  2WMM A;  1PP9 E;  4DVD A;  1QX8 A;  3T1Y T;  2GA1 A;  2C5J A;  3I55 P;  3ONL C;  1HWT C;  3NBX X;  4KT0 J;  4ZI3 C;  3V4Q A;  3IHR A;  2FKW B;  3U1A A;  1WT6 A;  1HG2 A;  4X62 T;  4U2Z A;  1FBM A;  4IGU A;  1A02 F;  5LNK A;  5CA0 E;  1L0L G;  2BVL A;  2WBL A;  4QH5 A;  5TJH A;  4H13 C;  4TNW A;  2QE7 H;  2OYI C;  2G8Y A;  4H0L B;  5APT A;  2B87 B;  1VQK P;  1SQX K;  3CC4 P;  1BR2 A;  4DJG A;  5HEJ A;  4C7N A;  1HJ0 A;  3NRX A;  2QM8 A;  3BRV B;  1J1E B;  3L39 A;  1NTZ J;  1FMV A;  2Y0C A;  2PTF A;  4TLF A;  2UXX B;  1J1E C;  2M5A A;  2W62 A;  1JY3 P;  3PUA A;  1EZV G;  5AQM B;  3AE3 A;  2QSI A;  3D71 A;  3PRJ A;  2W63 A;  1N7S B;  2E8I A;  2RMZ A;  3FBL A;  1FIO A;  3HE5 B;  2H8P D;  4CN4 A;  1FU1 A;  2QGS A;  4QX8 B;  5CFB A;  4ZXL A;  1PGJ A;  2DL1 A;  2XAF B;  2IZ1 A;  1N73 A;  3TNU A;  1LT9 A;  4O4J E;  4EB6 E;  1JB0 J;  4KUM B;  3W67 A;  3KYQ A;  2A06 G;  2QEX P;  2ZM8 A;  3N9L A;  2BCC G;  1H7C A;  1X79 A;  4AIS A;  3RPU A;  3B5N D;  1T72 A;  2ZT9 B;  3PHL A;  1D7M A;  2JJ9 A;  2Q3I A;  1UK5 A;  2Z5I A;  2QJP B;  4A56 A;  2P9B A;  4NXM T;  2BBH A;  2WU5 A;  1U4Q A;  2VK9 A;  3ZJ2 A;  2B1E A;  4COF A;  1XTC C;  4L9I A;  4YSX A;  3ZYK A;  5BMV E;  4UB8 H;  5APX A;  2N1G A;  3RIU A;  2WIT A;  4WWI A;  2IZ0 A;  2LXC B;  3Q2Y A;  4UV8 B;  2NOX A;  3TLT A;  3NFQ A;  5LCY A;  5AW1 B;  1MNE A;  2D0T A;  5CJ4 A;  3FWL A;  4GOU A;  2ZAE B;  3AE1 A;  4ILU A;  4DO0 A;  1BCC E;  1E5W A;  5AQO B;  2K5B B;  1NJI Q;  4KP3 C;  1R8I A;  1YYC A;  4U3C A;  4ASV A;  1OX3 A;  1SQB G;  3ANW B;  1ZME C;  4YXD A;  2IYO A;  2K9A A;  1DD3 A;  4F6R C;  1KFN A;  3IA3 A;  4LGD E;  4PD4 I;  2DHR A;  4Z91 A;  2UU9 T;  2W6A A;  1LKX A;  3EFF K;  3RGL A;  3ZN1 B;  4TUY E;  3L75 G;  2KS1 B;  2Z4E A;  2FJD A;  1VQ8 P;  3HTK A;  4FI5 A;  3L70 D;  1MMA A;  2W61 A;  2BKP A;  3M06 A;  3VMX A;  2VKJ A;  1SP4 A;  5GTH H;  3KVB A;  3ONJ A;  3N9P A;  4IL4 A;  2YKQ A;  3H1J E;  2UXB T;  1N7S D;  3RL0 D;  2K3R A;  2SPC A;  2E5L T;  1YJN P;  2GUS A;  3V5U A;  3E0Z A;  4GKG A;  2KNC A;  4UEM A;  4PV1 B;  2OYI B;  3L71 D;  2BG9 E;  4H9N C;  2BAS A;  1S35 A;  4QWN B;  4WY4 B;  3RI5 A;  4PJL A;  2BCC D;  3AAE B;  4LF6 T;  2DWG A;  1JTH B;  4EZH A;  1JMM A;  1NTK K;  2LHR A;  2W90 A;  3DJB A;  2MTQ A;  3ZPO A;  2YIN A;  1OW6 A;  1Y9B A;  3H1J J;  4B86 A;  3AE8 C;  3H37 A;  3Q9D A;  4GIF A;  1OW7 A;  5JR9 B;  2OYH C;  3H32 A;  4AUW A;  3CX7 B;  1NTK E;  2LE8 A;  3ZJ1 A;  4LC1 A;  1BGY G;  5CCG A;  1RE4 C;  1G8X A;  4ANJ A;  2Q3E A;  3V2Q A;  1Q7Y Q;  1LVF A;  3FXD B;  1HNX T;  2RA1 A;  3CX8 B;  3A0H E;  3AE1 C;  4L0R A;  4N78 E;  1HF8 A;  3AVS A;  3JC6 C;  1GW4 A;  1MIY A;  3OJA A;  1D0X A;  1PGQ A;  1URQ A;  1NTM G;  3RYH E;  3N4X A;  1DU2 A;  3B5N C;  4HJG H;  4B3T T;  5FYM A;  2XJ7 A;  3KZI H;  3V5B A;  2XQ8 A;  3D70 A;  3HE4 B;  5CCG C;  2WY2 A;  1N7S A;  3KDP B;  2XU6 A;  1WYC A;  3T8O A;  2X9H A;  5F3J A;  4H13 D;  2KSE A;  4D6T J;  2EHO A;  3TLW A;  2IYP A;  4PJ0 E;  1SQV J;  1OED A;  2BS2 A;  4IL6 X;  1J5E T;  1Z0P A;  2DNX A;  2KWH A;  3BCC D;  1UX4 A;  2WDQ A;  4HFB A;  1QLE D;  2XNX A;  1UUR A;  1FMW A;  1PFI A;  1GK4 A;  1LVK A;  2M5A B;  3RRC A;  3GHG C;  2VQF T;  1K04 A;  2OTK E;  2A3D A;  1JMB A;  5L8R J;  1SQX D;  2NTY A;  2ZM6 T;  3PUV F;  2WU2 A;  5JDL A;  1KD1 Q;  5AQU B;  1CI6 A;  5H2F E;  1RQU A;  4DCK A;  1ZP0 A;  2H7H A;  3C51 A;  1SQV D;  5LOV E;  3V4W A;  4NXN T;  3MHV A;  5JH7 E;  2K88 A;  2KLQ A;  1FZC B;  4PJN A;  3AE7 C;  3EFG A;  2K1A A;  3GHG A;  2HPC B;  4XAX B;  4AQF C;  2BEZ F;  4H13 B;  3TYY A;  2PRR A;  4UB8 E;  4WBA A;  1N73 C;  1SLQ A;  5ABE A;  1VF5 B;  4UB6 H;  2LLY A;  4TX5 A;  4HWF A;  2KI7 B;  2YU2 A;  1JY3 O;  3A7M A;  1NU1 K;  3VHL A;  1AA0 A;  3L71 G;  1JNZ A;  4HFV A;  2CE7 A;  3M65 A;  3RK2 D;  3HTK B;  1WYB A;  2O01 H;  5HCJ A;  2FJE A;  5E79 H;  1OMI A;  3G06 A;  5JTG A;  4H0L C;  2XTL A;  4QHO A;  2QVA A;  1KQL A;  3MGN A;  1MMN A;  3H3A A;  2L8K A;  2PFX A;  3K3O A;  2M6B A;  2LOS A;  1NTK D;  1U57 A;  2DLR A;  3HD7 C;  2R44 A;  3F5H A;  1NOH A;  3IR9 A;  4HB1 A;  4L73 A;  2E76 C;  3KFW X;  1FJP A;  5KXJ A;  1YXR A;  3AXJ A;  1Y47 A;  2ZFC A;  1JUN A;  4WZX A;  4K35 A;  4OX9 T;  3RHW A;  2E9X D;  1IFD A;  3NXS A;  4QH4 A;  1SQV K;  4X1Y E;  2IBZ E;  2DI4 A;  4HFI A;  2CRB A;  3KPE A;  4IE7 A;  4DMV A;  3WUU A;  3Q5W A;  3ZYL A;  1YQ3 A;  2Y0E A;  4BXL A;  1IFI A;  2IFN A;  3CWB J;  2VWA A;  3C4X A;  2MPK A;  1CW5 A;  3CXH I;  3E7K A;  3K5B A;  5APS A;  2M3E A;  2W6J H;  2UUC T;  2CXL A;  3UUL A;  4HFC A;  3BVH A;  1Z8U A;  2ZLY A;  4PV1 C;  1ZN5 A;  3CCL P;  1G73 A;  3PUX F;  1HVV A;  1X79 B;  5EZY E;  2WSC J;  3VN0 A;  3R84 B;  5C3J A;  2LSG A;  3CLQ A;  2HPL A;  2BDE A;  3C1L A;  1KV4 A;  2FYZ A;  1HCI A;  2WCA A;  1XNQ T;  1GU4 A;  4O4H E;  5LMN T;  4GIW A;  2R3S A;  3NTN A;  1T7S A;  4O4I E;  2WMN A;  1SQP K;  1MUU A;  5J1G A;  3KIN B;  2MOZ A;  4XFJ A;  5KLV J;  2IC9 A;  3QOF A;  1HFA A;  4DR6 T;  2X0Y A;  2V4H A;  2WWU A;  1USE A;  3P8C D;  2KUB A;  3ZMS B;  3PUS A;  3Q5E A;  1SQQ D;  2YXR B;  4CN6 A;  1RH5 B;  3MD0 A;  3P4Q A;  2NPS D;  1EDL A;  2CHN A;  4DUY T;  1ZKE A;  1BGY D;  1ZV8 A;  3EVY A;  2E9X A;  3AA7 B;  4B3S T;  1R5S A;  2G3A A;  1EXI A;  5JRC A;  4W7Z A;  2K3W A;  2V7L A;  1QVG O;  2HHH T;  3L70 J;  2VKH A;  2KP8 A;  3UUX B;  3AE4 C;  1QL1 A;  5KJ7 D;  2UXD T;  1RQV A;  1URQ C;  2W27 A;  4BRY B;  5BU8 B;  2NW7 A;  4YXW H;  3ZMV B;  1PPJ G;  3MXZ A;  3AEF C;  3GG2 A;  4W80 A;  2RPA A;  1N7S C;  5F5W A;  1LT1 A;  4B3M T;  2WSE H;  3MKD A;  3K8P C;  4IDO A;  2Q9Q B;  1FC2 C;  1GL2 C;  4L74 A;  3ZDM A;  1N2D C;  2WSS V;  4L75 A;  4Y99 C;  1OED C;  1OVU A;  1QUU A;  1SFC D;  4EZ4 A;  3HKB E;  1RF1 C;  1IJD B;  2HOD A;  2H88 A;  3CCM P;  4ZI7 E;  4TWD A;  4AXP A;  3BQL A;  4DND A;  3CVR A;  5IUX A;  2WT7 B;  1NTZ K;  4YFS A;  1RF0 A;  1PGP A;  2JQH A;  2E74 C;  3L70 G;  3Q5X A;  2J62 A;  1HGZ A;  2ZMA A;  3BQI A;  4OGQ B;  1AJY A;  1AV1 A;  2CPS A;  1HTL C;  1J2J B;  1MKM A;  3H1L E;  1VQ4 P;  1GL2 A;  4IDZ A;  3C9I A;  4DV6 T;  1ZP0 C;  2IBZ D;  3WI3 A;  4YTP C;  4L5G A;  2WZH A;  2KYV A;  3CI9 A;  3MP7 B;  1MIW A;  3RKO A;  5L3G B;  1SE7 A;  1T8B A;  4DV1 T;  1HGV A;  3CQG B;  2ZVO B;  4IOI H;  2VL0 A;  3RQW A;  5KX5 E;  4K0K T;  3PV0 F;  1ZOY A;  2E5V A;  4DZO A;  1GU5 A;  1SQQ J;  5GTH E;  3AE6 A;  2C0X A;  3A0B E;  3N9M A;  2O01 J;  5E0O A;  4F8H A;  1ZXG A;  5J2U E;  2FXP A;  2WWW A;  1M1J A;  5AVZ B;  4IL9 A;  4HKZ H;  5E79 E;  2WB5 A;  4AQR D;  2BZB A;  2LOP A;  3ZC1 A;  4YTN A;  5LYJ E;  4QXB B;  1U7J A;  1PV3 A;  1I94 T;  3VR8 A;  1AVO A;  1VDF A;  4NPF X;  2ZJS E;  3NKZ A;  3AE5 A;  4I55 E;  1NTM D;  4PK5 A;  5TAO A;  4G2A A;  2IHR 1;  1SQP D;  2EHO D;  3GW6 A;  2QA4 P;  2HN1 A;  3K1S A;  1X9V A;  2X51 A;  2ODV A;  2D2S A;  2BEQ D;  3N2G E;  4CXX A;  4UXN B;  4ZHQ E;  3HR0 A;  2G0U A;  3SFD C;  2NPS B;  1G1J A;  1NU1 E;  1EDK A;  1KB9 D;  1NEK A;  2ZYD A;  1KZU B;  3CC7 P;  2BKO A;  5HCM A;  3VRA A;  5AW7 B;  2YIU C;  2W4X A;  3AXJ B;  1DH3 A;  1LP1 B;  1N7L A;  5KKZ B;  2B87 A;  1CSB A;  4YSY A;  4ASW A;  2OYH B;  3OBV E;  1SQQ G;  1L0L J;  4DOJ A;  1YKE B;  4IFF A;  2ACZ A;  3ZLI A;  2FXM A;  2HLO A;  5C2T A;  4C7R A;  2VRS A;  1OXZ A;  2HG5 D;  4LLH A;  3ZST A;  1N86 A;  5AVY B;  1GL2 B;  2FYN B;  3OYZ A;  4KX6 A;  2CPT A;  1GMJ A;  1ZRT E;  3CXH D;  4KI0 F;  2KK7 A;  1SFC C;  3HD7 B;  5BU5 A;  1K8A Q;  2FY8 A;  2B9B A;  2ACX A;  4AKH A;  1CHU A;  4B6X A;  5HXC A;  2O1J A;  4H0L D;  1L4A C;  2KZ7 B;  3F57 A;  5B5E E;  2KSR A;  2VUR A;  4J2C A;  4IL6 H;  1KYO E;  1DX7 A;  4DBQ A;  2UXN B;  1RE3 A;  3MK7 C;  4TN7 B;  1Q86 Q;  1ZV4 X;  2KS1 A;  2FJB A;  4PNI A;  1YIT P;  4DR4 T;  4H63 V;  1KIL D;  2E42 A;  1KB9 H;  3KVA A;  3L73 E;  1S5L H;  3M91 A;  2E9X C;  1YJ9 P;  3MA9 A;  4UVA B;  2Q6Q A;  4P1N A;  1UIX A;  4AKG A;  3JAE A;  1N32 T;  4CZZ B;  4BRY A;  3PUR A;  3VRB A;  4AQY T;  3GMI A;  3RC8 A;  4OGQ C;  3CCE P;  4ZOL E;  3PUZ F;  2NTX A;  1W2B O;  3PUW F;  1RE3 C;  1L2P A;  4TWF A;  2WP9 A;  2LEH A;  5JDH A;  2IPP A;  2ZXX A;  2IW5 B;  4EEB A;  2J1D G;  3IBP A;  5AW0 B;  1VQ6 P;  3KBT A;  3RRW A;  1RF1 B;  3K3N A;  4YJ3 E;  4I50 E;  2PGD A;  3BCC J;  1BSN A;  3FXE A;  5AFU L;  3M3Z B;  1HR0 T;  1G1I A;  2OAR A;  2N9Y B;  2XAH B;  3IF4 A;  4Z90 A;  1LP1 A;  1HX1 B;  2N1T C;  4QX7 B;  1B7T A;  2RKL A;  1L0L K;  2QJY C;  4U3F G;  2C5K T;  4TNV A;  5ETW A;  5JDF A;  5L4E A;  2IDO B;  1RF0 C;  3K3Q C;  1NTZ G;  2C9L Y;  4P09 A;  3KBU A;  4Y99 B;  1OED B;  2XAJ B;  4BJN A;  3OJA B;  3I56 P;  5M1B A;  1X8Y A;  3EHZ A;  1U5P A;  3CIR A;  1AQ5 A;  2H7O A;  3EAB A;  3TLS A;  3N2O A;  4JQ0 D;  5HEU A;  5FY1 A;  5EK3 A;  5AW5 B;  3CKD A;  1GW3 A;  3A3Y B;  4GDO A;  1OVR A;  1SA0 E;  3AEF A;  3G71 P;  1ZEE A;  5DAB A;  5APY A;  1SQB D;  3OVU A;  4NPD A;  5DQV A;  1FZA A;  2Y0D A;  2W83 C;  4ILC A;  4IDQ A;  1X9B A;  3CCQ P;  1ZRT D;  5FY0 A;  2FYU E;  2IAK A;  3N2K E;  4TT3 H;  2KB7 P;  1N8R Q;  1XNR T;  3VMZ A;  3II6 A;  3OA7 A;  1NU1 J;  3PU3 A;  1JCC A;  3CC2 P;  1J5W A;  2YIU B;  1L4A D;  2IFM A;  3M9H A;  3RK3 B;  3OPC A;  2KLU A;  3D6Z A;  2L91 A;  1JY2 N;  4N3Y B;  3CWZ B;  5CB4 E;  5CCG D;  1V9D A;  5LG4 A;  2N2N A;  1BCC D;  2FFD C;  3FZM B;  2GM4 A;  1T2K D;  3M9Q A;  3PUG A;  2BG9 B;  5KAI E;  3U78 A;  1SQP G;  2XAS B;  4QKN A;  3HA4 A;  3WU2 E;  4NIQ A;  2GK9 A;  5LHI B;  2JEE A;  2O3J A;  1KTM A;  2CMR A;  3O6Q B;  3J9X 1;  4ERR A;  4OGQ D;  3LW5 J;  5FVL A;  3ZYM A;  3H1I G;  1JNM A;  5AQI B;  2CK3 H;  2HYN A;  2CHO A;  1L0L E;  4GKK T;  2P67 A;  3SOL A;  3C98 B;  4IST A;  5LHG B;  4AI6 A;  1FOS F;  4YY3 T;  4UVC B;  3G3Z A;  3OTO T;  5JR9 C;  4ZKU A;  5AQR B;  3N5L A;  4A97 A;  1KYO H;  5H6Q B;  4ILB A;  3MZW B;  1BDC A;  5IYZ E;  2CXD A;  2HN2 A;  5CCH D;  3QWO C;  2YU1 A;  1ZLL A;  3AA6 B;  4PD4 H;  2PP6 A;  3H6P A;  2Y9Z A;  1K9M Q;  2B89 A;  1L0N J;  3RL0 C;  2WVR A;  1S9K D;  4ZS2 A;  4PJ0 H;  2XQA A;  2C9N Y;  2H7V C;  1WRG A;  3RL0 g;  3ONX A;  3H1H G;  1EZV I;  2LKH A;  5AVQ B;  4H9O C;  3T1H T;  1MV8 A;  5AVV B;  2WAU A;  1HH0 A;  3PLN A;  4L76 A;  3CCR P;  3NWI A;  3EWK A;  4D6T D;  2H89 A;  3F31 A;  4DUZ T;  2I8D A;  3WUT A;  1W0A A;  3FXE B;  4U72 A;  1UII A;  3JC6 D;  1M90 Q;  1MMG A;  2BS3 A;  1CI6 B;  3H1L D;  2O01 N;  2KZJ A;  4JI1 T;  1PPJ D;  3IEE A;  1S4X A;  1NH4 A;  3GMA A;  5FXV A;  4X66 T;  4OK0 A;  1TU3 F;  2K24 A;  2NWB A;  1XWM A;  3CPW O;  2HPJ A;  1H0T A;  3RYC E;  3UQ4 A;  3PTR B;  3QH9 A;  5HXE A;  4CI2 B;  5KDM C;  3GA8 A;  5HYA A;  4CI3 B;  3MUD A;  5APQ A;  1W5C E;  2MBG A;  1NTM J;  3DP7 A;  1IFN A;  3JCU H;  4HEA A;  2LSK A;  3AE3 C;  3A8Y C;  1UGO A;  3E1I A;  3FXD A;  1FDM A;  1FZG A;  1MMD A;  2JWA A;  4WY4 C;  2Z6E A;  4EOT A;  4ISS A;  4UEL A;  2LJL A;  1EZV D;  3CME P;  4WVZ A;  2WQY A;  3SFE C;  3HRN A;  1BSH A;  5GON E;  3RKG A;  1FZF A;  3AAA B;  2L3L A;  2WPQ A;  1VQ5 P;  2QA7 A;  4XZC A;  1LTI C;  2V7J A;  1Q82 Q;  1AJ3 A;  4I1L A;  4ADZ A;  4JYC A;  3P7K A;  3CD6 P;  2E76 D;  2XDJ A;  4P0B A;  5LP6 E;  1NTK J;  3Q5S A;  2KLV A;  1KNR A;  3JAD A;  1NWQ A;  5BVZ A;  2KWI B;  3KHU A;  2CBJ A;  4PK6 A;  3H1K J;  1U7M A;  5AW3 B;  4U2Y A;  1S2E A;  3KXD A;  1N33 T;  3IN6 A;  2OYO A;  3D6Y A;  2HR3 A;  2XQ9 A;  1JTH A;  2K37 A;  2WQY C;  1ZHC A;  4IE6 A;  2FBW A;  2LHN A;  1S3J A;  3C64 A;  3RK3 C;  2R32 A;  1L0V A;  4LF5 T;  3M9B A;  1XTG B;  2FYU G;  2Y9Y A;  4GK5 E;  4JI8 T;  1NAY A;  1NU1 D;  2ZYA A;  1SHZ C;  1L0L D;  4EED A;  4DBR A;  3C4W A;  3UT5 E;  4IE5 A;  2BKN A;  2XAQ B;  2J5U A;  5JDG A;  2A06 D;  2UUA T;  3RF1 A;  3HKD E;  3O1J A;  1NWM X;  3LK3 B;  3CWB E;  3FZL B;  1ZW0 A;  2A72 A;  2XV5 A;  1KF6 A;  3CWB G;  3AEG A;  4HN9 A;  1YBK A;  2E43 A;  5HWY A;  2Q9I A;  4I7Z B;  1VQL P;  4XBF B;  1LT9 C;  1BE3 G;  5AQV B;  2QJP C;  3TGU G;  2QM7 A;  5KLV G;  1GK6 A;  1NEN A;  2PBI A;  1S9K E;  2XND H;  1OW8 A;  4AQG A;  3JCF A;  1AVY A;  5H6R B;  4ZI2 C;  3CX5 E;  2M0B A;  2XM1 A;  2PFV A;  2WPV B;  3JSV C;  3B8E B;  4UF0 B;  4EGW A;  1IK7 A;  2EHO B;  2FJA A;  3KV9 A;  2V7Q H;  5AQQ B;  2XSA A;  4AKR B;  3JAF A;  2BG9 C;  3LJC A;  4IDN A;  5M4Y A;  2FFD A;  4IHJ E;  1YTZ T;  4WY4 D;  2UWJ E;  3UU5 A;  4AYC A;  3H1I E;  1FZC A;  2QRX A;  2LSJ A;  1YIJ P;  5AQN B;  4JI3 T;  1QGK B;  3A2A A;  4HWC A;  5JDM A;  1YI2 P;  3QB5 K;  3EQ2 A;  2FXO A;  2FYU K;  4JBZ A;  3O1H A;  1XZY A;  2WMO A;  3UUN A;  2YEV C;  3P7I A;  1N34 T;  2AEJ A;  1GD2 E;  4TV9 E;  2QJK C;  1DEB A;  2A45 I;  5FXZ A;  3A5T A;  4KHX A;  2V6X A;  4Z1M H;  2QG4 A;  2D5U A;  2WZ7 A;  2XQ7 A;  4AKI A;  2V7M A;  5AQJ B;  3PJA A;  2NP9 A;  1EC5 A;  1YTZ I;  4I0U A;  1EZV E;  4DV4 T;  2H3R A;  3M0D C;  3FZH B;  2ODU A;  3CCJ P;  1NU1 G;  2XKM A;  2XQ6 A;  2WDR A;  4O4L E;  4HYT B;  4IL6 E;  2I1K A;  4QH1 A;  3LBX A;  2LXB A;  3QUJ A;  1DD4 A;  4PD4 D;  5L3F B;  4UVB B;  4OFZ A;  3U1C A;  4JEH B;  2E5Y A;  2KOG A;  3AEG C;  3WU2 H;  2P7J A;  1S1C X;  4R4M A;  5L4H A;  1M8O B;  3AA0 B;  3H1H D;  1IJ6 A;  4DR5 T;  4UIG A;  4PK4 A;  1YQ4 C;  1KQS O;  5FVK A;  1WCR A;  4DR1 T;  1HTJ F;  5LHH B;  1OWA A;  3L72 D;  5LA6 E;  4XE5 B;  2E75 C;  2KNC B;  3ZT7 A;  3V2N A;  3B13 A;  4H9R C;  3RYF E;  2XPK A;  2Z5H A;  4N6J A;  3UQ7 A;  3V2R A;  1WFD A;  2Q9Q A;  4MAL A;  4CI1 B;  3VR9 A;  3P32 A;  5DJU B;  1XMO T;  2ZXE B;  2KXP B;  3H1L G;  1NHL A;  3NRY A;  2J4G A;  2W6B A;  3ZSS A;  1FZC C;  3ETU A;  1WR6 A;  4IE4 A;  5HAX A;  2JWD A;  4GYR A;  1UX5 A;  3PJS K;  1EZ3 A;  2LT3 A;  1PGO A;  4IE0 A;  3AEE A;  3IFM A;  3MUD C;  2V8S V;  3HKC E;  4HFE A;  1HX8 A;  3LFM A;  4UV9 B;  4EAH A;  1E7P A;  5AW8 B;  2Q9Q C;  1FS0 E;  4O8S A;  3RK3 D;  4H9S E;  1X0T A;  4YLH A;  5DQW A;  3CX5 D;  2P10 A;  1YHQ P;  4AQF A;  3TSI A;  4A98 A;  2J59 M;  3L75 E;  5JDQ A;  2XQ4 A;  1KNZ A;  1HBW A;  4UB6 E;  3ZKR A;  3MZK B;  4ZEY A;  2CEA A;  1SQP J;  3ANW A;  3PTZ A;  2OTJ P;  2XZE A;  3H1I D;  1IJ5 A;  2KT9 A;  5KLV K;  5KKZ C;  3FX0 A;  4TV8 E;  3EDU A;  3H1J G;  4JI2 T;  1T2K C;  1FDI A;  4LFC T;  1KNP A;  3TGU D;  3TLV A;  4EV6 A;  3VMY A;  3SRZ A;  4AKL A;  2HFE D;  3EDV A;  3CX6 B;  4CPG A;  1HJB A;  3BRT B;  4WB4 A;  4JYA T;  2CWO A;  2W8Z A;  1PP9 D;  2Y48 B;  5LGU B;  1LTA C;  5H2F H;  2RP4 A;  2CWY A;  3H1I J;  3ESL A;  4KMC A;  1MFZ A;  4U33 A;  1IFJ A;  3L74 J;  3ITK A;  4EIW A;  4RES B;  5FL1 A;  5JRC B;  3M0A A;  1Y01 A;  3B5N A;  1OED E;  2LSY A;  1BCC J;  1VQO P;  2IUB A;  3AVR A;  4HWI B;  4MHC A;  1EDI A;  5LBM A;  1LNQ A;  3KV6 A;  5L3B B;  3RIU C;  2NR4 A;  4PD4 E;  3ZT5 A;  2LM2 A;  5CBO A;  2W66 A;  3CCS P;  4MBQ A;  4DV2 T;  2C5I T;  2JIW A;  1OIP A;  3H32 B;  5CBN A;  2QIW A;  4B3R T;  1NTM E;  4X20 E;  3O9X A;  4LFB T;  3Q5P A;  4NUU A;  1KEY A;  1JO5 A;  1BR0 A;  3L72 E;  3CL3 D;  3UU4 A;  2IDB A;  4YXD C;  2HOD B;  3N9O A;  4MLK A;  2E76 B;  3P4S A;  1KB9 E;  3B71 A;  3L35 A;  1KB9 I;  5KLI B;  2X9Y A;  5FY7 A;  3SWF A;  4TWH A;  2A45 H;  2XQ5 A;  3SWH A;  1H89 A;  5AVT B;  2A9U A;  1PPJ E;  4Y28 J;  5AQT B;  2Q9Q D;  2D0U A;  3EAM A;  2WSF J;  2JP3 A;  3FBZ A;  2CLY C;  1KIL C;  3ZMU B;  2M3B A;  2JQ9 A;  4UR9 A;  3WAJ A;  1MND A;  2X68 A;  3U3I A;  4PJM A;  3I9W A;  3FHN A;  4YT0 A;  4A7P A;  1X22 A;  4IRE A;  4A5X A;  4ILA A;  3LW5 H;  5AVS B;  1EXJ A;  5LJM A;  4WNK A;  1S94 A;  5FMN A;  3IAO A;  4D6T G;  1NTM K;  3B5M A;  2UUB T;  1J1J A;  2YDR A;  3RX6 A;  3H1K E;  1VOM A;  3FB2 A;  5ABH A;  2VQE T;  2BG9 A;  3H1K G;  4JEU B;  1FOS E;  3ZMT B;  5ADX L;  3R2P A;  1M1K Q;  4EI2 A;  3AEB A;  3X1D A;  3KZI E;  1IBL T;  2WPS A;  4YHH T;  3RYI E;  4LF8 T;  3PH0 A;  3P4W A;  5KJ7 A;  2PAJ A;  1DEE G;  5GTI E;  3PUQ A;  3Q5R A;  1ZR4 A;  1GQE A;  3PU8 A;  1WRD A;  1USD A;  4LMJ A;  4IFD K;  4LF7 T;  4X5T A;  5HEO A;  2V5D A;  3CX5 I;  2VKO A;  3N9Q A;  1J1D B;  4M3L A;  3TNU B;  1N73 B;  4LFA T;  2P2U A;  2JQK A;  3RBZ A;  4JV5 T;  2CM0 A;  4QMA A;  3AEB C;  1LTS C;  4PFP A;  3H1J D;  2V7I A;  4ZS3 A;  3M0D A;  5APV A;  5KJ7 C;  1MZ9 A;  1URQ B;  3F89 A;  2JRK A;  4HWD A;  3SS1 A;  2A06 E;  5FL0 A;  3GN5 B;  2EHO C;  1MIV A;  4I4T E;  1LGH B;  3CWB D;  4GOF A;  4C46 A;  4C90 A;  2BCC E;  1SQX J;  5AQG B;  1KIL A;  5AQL B;  2W67 A;  3OW2 O;  4HWH A;  1KQG B;  4JYB A;  3QK6 A;  5LB7 B;  2BVM A;  4HFH A;  3A0B H;  2R5D A;  5APW A;  4KBM B;  3AA1 B;  3UFE A;  3RQU A;  1YJW P;  2N1T D;  3SSU A;  3DTO A;  1L0N E;  4FJO A;  2B76 A;  4U3F D;  5AVR B;  3L73 J;  1W09 A;  1HNW T;  2Y8D A;  1GTW A;  4RKU J;  2WSC H;  3VP9 A;  2JQQ A;  4AIU A;  1NTZ E;  1M1J C;  4HH2 A;  1D1C A;  1LRZ A;  4EYY Q;  4YPC A;  2E5T A;  1JY2 O;  5TIS H;  4OHF A;  1SQB E;  5KLV D;  2WTY A;  4EOZ B;  5AQH B;  3TK1 A;  2V7Q J;  3RK2 C;  3L36 A;  1PP9 J;  2DCF A;  3UU8 A;  1URQ D;  1W2E A;  2LSI A;  3KV4 A;  1E2A A;  1FE6 A;  2R3C A;  3ZCJ A;  3BAS A;  1H88 A;  3BCC E;  3CX5 H;  1JY2 P;  1BE3 J;  1IK9 A;  3ZN0 B;  5AW6 B;  3A0H H;  2WPR A;  5GTI H;  5KTB A;  3TLU A;  3AE9 C;  1AFO A;  1SVF A;  3GF3 A;  2K9Y A;  1SQX E;  3LDQ B;  3Q5D A;  2OYI A;  3L73 G;  2XY8 B;  5LXT E;  1FDO A;  2A45 G;  1PIX A;  3AE7 A;  5FKY A;  2XQY A;  3A7O A;  4MN4 C;  2WS3 A;  2KZI A;  3H1H E;  2O1K A;  4G63 A;  3AED A;  1P84 E;  1WMK A;  4GOE A;  1SQP E;  4ZMD A;  3FWN A;  1CZQ A;  1FJG T;  1LWU A;  2A2F X;  2XZR A;  2WDV A;  5AVX B;  3LBX B;  1YQ3 C;  3CK6 A;  4R4L A;  1W9R A;  5HXR A;  2LKG A;  2QJY B;  1Z56 A;  1FEW A;  2YN6 A;  4YTP A;  2V1D B;  2Q7C A;  1L4A A;  3CQC B;  3AE2 C;  2QYW A;  2OQQ A;  1WLX A;  4GT1 A;  2OTL P;  3N7N A;  3HE4 A;  1VCT A;  4PFO A;  4PV1 D;  4DID B;  4I43 B;  3UFG A;  2IIU A;  1R5L A;  5FXX A;  3TDK A;  2VKD A;  2X67 A;  1KK7 A;  3QNU A;  5CMZ A;  5B66 H;  2AXT E;  2V26 A;  3JCU E;  1PZQ A;  3QB5 A;  2ZT9 C;  3HL6 A;  2R5B A;  4EYU A;  1JY3 N;  3KDS E;  3V5S A;  2IC6 A;  4U3F E;  1E79 H;  1H0T B;  2RN0 A;  3CXH H;  1HNZ T;  2DW3 A;  4I2L C;  3ABV C;  4ZNC A;  3L75 D;  1D1A A;  4QXC B;  1L4A B;  1D0Y A;  1NTZ D;  2JJL A;  4PAG A;  5AQS B;  5CGM A;  1KYO I;  2IX7 C;  2M8R A;  1KYO D;  2IML A;  1N36 T;  3L74 G;  2Y6X A;  1CUN A;  1KOR A;  1VQN P;  3PE0 A;  3D0T A;  2YDS A;  2PJQ A;  2IBZ I;  3RLF F;  1NYH A;  1KIL E;  1IZN B;  4IT4 A;  3BK9 A;  2LM9 A;  3L3P A;  4EYY R;  1NAF A;  3RC3 A;  4DV5 T;  2AEF A;  5AVW B;  2WM9 A;  4HFD A;  1LWU C;  4KHZ F;  1S5L E;  3L70 E;  5AW4 B;  2QJK B;  4UF0 A;  1SFC B;  4H63 H;  4OYK A;  3G6E P;  5LG3 A;  2JO1 A;  4TZ4 C;  2I1J A;  1ZR2 A;  2FFD B;  2X9X A;  3I0O A;  2W00 A;  2YKS A;  3R6N A;  1RF1 A;  2JDI H;  5L2L A;  5EFW B;  1HF9 A;  3L71 E;  3VOP A;  2KIK A;  5CHX A;  1SFC A;  3Q1M A;  2LRK A;  2JMK A;  1EQ7 A;  1JNR A;  1QSD A;  4I6M C;  1M62 A;  3I0Q A;  3NVO A;  1L0N K;  2FBW C;  3LIE A;  4JI0 T;  3P8C E;  1LTJ A;  1M7K A;  1NO4 A;  1SQQ E;  1NGM B;  2NPS C;  1NKN A;  2LR2 A;  1VCS A;  4IFM A;  1BGY E;  4GKJ T;  1GL2 D;  2I0M A;  4DR3 T;  3E08 A;  2ITA A;  3RL0 B;  1BGY J;  1LTT C;  2OYH A;  5FNV E;  4I7Z C;  2GUV A;  3ZMZ B;  2J58 A;  1GZL A;  1RY3 A;  4DT0 A;  1Q81 Q;  5CJ0 A;  2WWV A;  2CPB A;  3P4P A;  3H1L J;  1Q90 D;  3LK4 2;  4DV3 T;  2YDQ A;  3PUY F;  2LKM A;  4DMW A;  1QLB A;  5L3E B;  1MFT A;  3L74 D;  2X0H A;  3C8V A;  2NPS A;  5KAI H;  4NPP A;  3ZCI A;  1XDP A;  1DIP A;  1UUS A;  1KMI Z;  3AAI A;  2ZM0 A;  1QVF O;  1SQX G;  3S9O A;  3N9N A;  2P58 A;  1VF5 C;  4H9P C;  4RO0 A;  1BE3 D;  2FYU D;  2CA5 A;  2WZI A;  3G4S P;  2E2A A;  3KQG A;  2D2C D;  4WW0 A;  3UTK A;  2M67 A;  3PJA J;  1QEX A;  5JQG E;  1T3J A;  4IDP A;  2DWK A;  1S72 P;  2P1J A;  4W7Y A;  3H1K D;  3AEA C;  1HG5 A;  5L47 A;  5KAF H;  2POH A;  5AQP B;  5L3C B;  3VMA A;  3HUS C;  3NZQ A;  1US7 B;  1KFM A;  1XDO A;  3VYI A;  5LMU T;  4U74 A;  1XMQ T;  3SFD A;  4E7S A;  4JI7 T;  2YO2 A;  1QL2 A;  2V6Y B;  1LTJ C;  4QXH B;  4U31 A;  3MAC A;  2OLT A;  2H43 A;  3RBX A;  3ZC0 A;  1D1B A;  4C7N B;  2JPF A; 
#chains in the Genus database with same CATH homology
 2Z4E A;  5LGU B;  1LTA C;  4CZZ B;  2RP4 A;  2CWY A;  3PUR A;  3ESL A;  3HTK A;  3GMI A;  4FI5 A;  3RC8 A;  3HUS A;  1MMA A;  1Y64 B;  1SQB K;  1MFZ A;  2W61 A;  4KMC A;  4PJJ A;  3M06 A;  1IFJ A;  4ZOL E;  3VMX A;  2VKJ A;  1SP4 A;  4EIW A;  3KVB A;  2NTX A;  5EK4 A;  1RE3 C;  4RES B;  3N9P A;  2YKQ A;  5JRC B;  2LEH A;  3M0A A;  4O9B A;  3AB3 B;  1N7S D;  2IPP A;  3B5N A;  3RL0 D;  2LSY A;  2IW5 B;  5JDH A;  2SPC A;  3AVR A;  4MHC A;  2J1D G;  5LBM A;  3IBP A;  3VTP C;  3A5X A;  3KV6 A;  2GUS A;  5AW0 B;  3E0Z A;  3KBT A;  3V5U A;  4GKG A;  5L3B B;  4UEM A;  2OYI B;  3RRW A;  4H9N C;  1RF1 B;  2BAS A;  3K3N A;  1S35 A;  4YJ3 E;  4I50 E;  4WY4 B;  3O1I A;  4QWN B;  4MBQ A;  4PJL A;  5AFU L;  2C5I T;  4HTE A;  3AAE B;  3H32 B;  1G1I A;  1FZB A;  1JTH B;  1JMM A;  1NTK K;  2OAR A;  1FJK A;  2WSF H;  2C0S A;  2LHR A;  3S4U A;  2XAH B;  2MTQ A;  3DJB A;  3ZPO A;  2YIN A;  4EIJ A;  1IFM A;  2N1T C;  3O8Z A;  4QX7 B;  4B86 A;  4X20 E;  2PG8 A;  1VPC A;  3O9X A;  1B7T A;  1L0L K;  2ES0 A;  5JDF A;  2C5K T;  3H37 A;  3Q9D A;  4NUU A;  5ETW A;  1JO5 A;  1BR0 A;  4GIF A;  1RF0 C;  3K3Q C;  5JR9 B;  2OYH C;  3H32 A;  3CL3 D;  2C9L Y;  4P09 A;  4AUW A;  3CX7 B;  3KBU A;  4Y99 B;  2LE8 A;  2HOD B;  2XAJ B;  3N9O A;  4MLK A;  3ZJ1 A;  4LC1 A;  4BJN A;  5CCG A;  1LTB C;  3OJA B;  1RE4 C;  1G8X A;  4ANJ A;  3L35 A;  2YNY A;  2N9D A;  2X9Y A;  3V2Q A;  1LVF A;  3FXD B;  5FY7 A;  3SWF A;  1X8Y A;  3VP8 A;  5EK2 A;  2A45 H;  3NMD A;  1U5P A;  3HD7 A;  2RA1 A;  3CX8 B;  1AQ5 A;  3SWH A;  2H7O A;  1H89 A;  3RH3 A;  4L0R A;  2XAG B;  5AVT B;  3VU7 H;  4N78 E;  1HF8 A;  3AVS A;  3N2O A;  2NW8 A;  3I1A A;  3C50 A;  3JC6 C;  4JLE A;  1GW4 A;  5FY1 A;  1LTJ B;  5EK3 A;  1MIY A;  4CQI A;  5AW5 B;  2Q9Q D;  3CKD A;  3OJA A;  1D0X A;  2D0U A;  3VKH A;  1GW3 A;  1URQ A;  3A3Y B;  3RYH E;  3N4X A;  1SA0 E;  3B5N C;  1ZEE A;  5DAB A;  5APY A;  5FYM A;  3FBZ A;  2CLY C;  1KIL C;  1FZA A;  3V5B A;  2CCQ A;  1YW0 A;  5DQV A;  3ZMU B;  2M3B A;  2W0G A;  5C8Y E;  3HE4 B;  5CCG C;  3WAJ A;  1N7S A;  3KDP B;  1MND A;  2X68 A;  3U3I A;  2XU6 A;  1WYC A;  3I9W A;  2X9H A;  2MYS A;  3BQK A;  4PJM A;  5FY0 A;  2IAK A;  3FHN A;  3IF8 B;  3N2K E;  2OA5 A;  4EXT A;  2KB7 P;  4JF7 A;  3OKQ A;  5HXH A;  2NW9 A;  3LW5 H;  5AVS B;  3VMZ A;  5LJM A;  2EHO A;  3II6 A;  3I9Y A;  3OA7 A;  4OH8 B;  3PU3 A;  4WNK A;  1JCC A;  3UIA A;  3LG7 A;  3QC9 A;  1S94 A;  1G2C B;  3M9H A;  1L4A D;  2IFM A;  1GDT A;  1NTM K;  5FMN A;  1Z0P A;  2DNX A;  3ZEF B;  2KWH A;  3RK3 B;  1UX4 A;  3L09 A;  1LT9 B;  1H8A A;  3RX6 A;  2E9X B;  1VOM A;  2XNX A;  4CXY A;  1FMW A;  1PFI A;  4ZI2 D;  3FB2 A;  1JY2 N;  4N3Y B;  3CWZ B;  1GK4 A;  5CB4 E;  5CCG D;  1V9D A;  1LVK A;  4JEU B;  2X66 A;  1FOS E;  2Q5U A;  1UCU A;  3RRC A;  3GHG C;  2N2N A;  3ZMT B;  5ADX L;  5LG4 A;  3R2P A;  2YMY A;  2A3D A;  2FFD C;  4EZH A;  2NTY A;  2WPS A;  5JDL A;  2GM4 A;  1T2K D;  4AKR B;  3RYI E;  3M9Q A;  1CI6 A;  1J1D C;  3MJX A;  3PUG A;  5KJ7 A;  2VAS A;  2PAJ A;  5FP3 A;  3PUQ A;  3U78 A;  2H7H A;  3C51 A;  3HI2 A;  3HE5 A;  1ZR4 A;  3PU8 A;  1WRD A;  2XAS B;  5FXW A;  5LOV E;  3V4W A;  3UUM A;  4HGA A;  4IFD K;  2JMH A;  4QKN A;  3HA4 A;  4E7Z A;  5JH7 E;  1LTG C;  1NKZ B;  2KLQ A;  2GK9 A;  1FZC B;  2VKO A;  2VB6 A;  3N9Q A;  5LHI B;  1J1D B;  2JEE A;  4M3L A;  3TNU B;  5APU A;  3LID A;  3WMM 0;  1N73 B;  3U59 A;  2CMR A;  4PJN A;  3HKE E;  4JUY A;  3EFG A;  3J9X 1;  4ERR A;  4M1P A;  3GHG A;  2P2U A;  2HPC B;  4XAX B;  3ZYM A;  4AQF C;  1SQQ K;  5CCH C;  1JNM A;  5L3D B;  2CM0 A;  3MIW A;  5AW2 B;  4EB6 E;  3TYY A;  1LTS C;  2HYN A;  4MFR A;  4O2A E;  4PFP A;  4WBA A;  1N73 C;  4V1A v;  1SLQ A;  2V7I A;  4ZS3 A;  2KIN B;  4PW8 A;  2P67 A;  3M0D A;  4HE8 A;  3SOL A;  3C98 B;  3O4X E;  5APV A;  4IST A;  5KJ7 C;  1MZ9 A;  1URQ B;  1FOS F;  2JRK A;  5LHG B;  4AI6 A;  3SS1 A;  4CXW A;  4UVC B;  4TX5 A;  4GK0 E;  3GN5 B;  2EHO C;  4HKA A;  3G3Z A;  1MIV A;  2YU2 A;  1JY3 O;  4K0U A;  3PDY A;  1NU1 K;  5AVU B;  4I4T E;  4ZKU A;  5JR9 C;  3VHL A;  3N5L A;  1LGH B;  3Q2M A;  5H6Q B;  2VL8 A;  4C46 A;  4C90 A;  4WY4 A;  4ZKP A;  1IO4 A;  4HFV A;  5IHY A;  3NZP A;  3KV5 A;  2CE7 A;  2CXD A;  3M65 A;  1KIL A;  5IYZ E;  3RK2 D;  3HTK B;  5CCH D;  2YU1 A;  1WYB A;  1ZLL A;  4JYB A;  2O01 H;  2KSJ A;  3AA6 B;  3QK6 A;  2PP6 A;  3H6P A;  3V2P A;  2BVM A;  2KND A;  2R5D A;  4XA4 A;  5APW A;  4KBM B;  3AA1 B;  2N1T B;  3RL0 C;  1FAV A;  1S9K D;  3LK2 B;  4ZS2 A;  4BAY B;  2XTL A;  3CPZ A;  4QHO A;  3UFE A;  1KQL A;  3MGN A;  2N1T D;  1MMN A;  3CML A;  3DTO A;  2C9N Y;  2H7V C;  1WRG A;  3H3A A;  3ONX A;  4FJO A;  2L8K A;  1HS7 A;  3K3O A;  5AVQ B;  2WT7 A;  5AVR B;  4H9O C;  4O2B E;  2LOS A;  1MV8 A;  5AVV B;  5AW9 B;  3SWY A;  2WAU A;  1HH0 A;  1GTW A;  2Y8D A;  2DLR A;  3HD7 C;  2WSC H;  3VP9 A;  1NOH A;  3IR9 A;  3PP5 A;  2JQQ A;  3ETV A;  5HXS A;  3F31 A;  3KFW X;  1M1J C;  4HH2 A;  1FJP A;  2ZFC A;  3FXE B;  4X1I E;  1JUN A;  4U72 A;  1D1C A;  3JC6 D;  2L9Q A;  1MMG A;  2E9X D;  1CI6 B;  1IFD A;  3NXS A;  4N78 D;  4YHJ A;  1LRZ A;  1SQV K;  5F8P A;  4X1Y E;  3IEE A;  2YO3 A;  1NH4 A;  2DI4 A;  2YKO A;  2KMF A;  2X9W A;  3KPE A;  5FXV A;  3F2E A;  4OK0 A;  4IE7 A;  2K24 A;  2NWB A;  4BA9 A;  4DMV A;  3Q5W A;  3ZYL A;  3CQX C;  2HPJ A;  1JY2 O;  5CA1 E;  3VKG A;  1IFI A;  2IFN A;  3RYC E;  2VWA A;  3PTR B;  4OHF A;  1HUC A;  3C4X A;  2WTY A;  1E1H B;  1CW5 A;  4EOZ B;  5HXE A;  4CI2 B;  5KDM C;  3GA8 A;  5HYA A;  5APS A;  4CI3 B;  3MUD A;  3BAT A;  5APQ A;  3TK1 A;  2N1T A;  3RK2 C;  4NUV A;  2MBG A;  3DP7 A;  2CXL A;  1IFN A;  3L36 A;  4HEA A;  3UUL A;  3TKL B;  3BVH A;  2DCF A;  2LSK A;  2ZLY A;  1URQ D;  1W2E A;  2LSI A;  3E1I A;  1ZN5 A;  1G73 A;  5KMG P;  3KV4 A;  1FDM A;  1FZG A;  1MMD A;  4WY4 C;  2XHE B;  3ZCJ A;  5CCH A;  2Z6E A;  4EOT A;  4ISS A;  2R3C A;  1HVV A;  1X79 B;  1IC2 A;  5DJQ C;  4UEL A;  2LJL A;  5EZY E;  3VN0 A;  3BAS A;  2MJZ A;  3HUS B;  3CLQ A;  1H88 A;  2HPL A;  2BDE A;  2LSG A;  3R84 B;  1JY2 P;  3HRN A;  5GON E;  2FYZ A;  1HCI A;  5JVD E;  1FZF A;  4ZHQ E;  1IK9 A;  3AAA B;  3ZN0 B;  2L3L A;  1GU4 A;  5AW6 B;  2WPQ A;  4O4H E;  2QA7 A;  4XZC A;  1LTI C;  4GIW A;  1YKH B;  3B5N B;  5KTB A;  2WPR A;  2V7J A;  4I1L A;  3NTN A;  3T97 A;  4O4I E;  4ADZ A;  1AJ3 A;  4JYC A;  3GHG B;  3P7K A;  2XDJ A;  1KIL B;  2HPC A;  1AFO A;  1SVF A;  4P0B A;  2WMN A;  5LP6 E;  1SQP K;  5JRE A;  1MUU A;  4IIJ E;  2KLV A;  5J1G A;  3W15 B;  3KIN B;  3ZN1 B;  2OYI A;  2MOZ A;  1NWQ A;  3GWH A;  5BVZ A;  2KWI B;  2IC9 A;  4BJM A;  4PK6 A;  1HFA A;  1BR1 A;  5LXT E;  2WWU A;  5AW3 B;  3E22 E;  2A45 G;  3P8C D;  2XQY A;  3A7O A;  3ZMS B;  3PUS A;  4CI1 B;  1JTH A;  1ZHC A;  2O1K A;  4G63 A;  4IE6 A;  2LHN A;  3MD0 A;  2NPS D;  3L37 A;  3RK3 C;  3C64 A;  2R32 A;  5LGT B;  1ZKE A;  1ZV8 A;  3EVY A;  1CZQ A;  2E9X A;  3AA7 B;  1LWU A;  2A2F X;  2XZR A;  2XUE A;  5AVX B;  3LBX B;  3M9B A;  1XTG B;  5HXR A;  2ZM2 A;  1RE4 A;  5JRC A;  2YKP A;  4GK5 E;  1Z56 A;  4W7Z A;  1FEW A;  3HD7 D;  2V7L A;  2V1D B;  2Q7C A;  1YD8 G;  1L4A A;  1SHZ C;  2VKH A;  3CQC B;  2KP8 A;  1WLX A;  4GT1 A;  2CLY B;  2X0L B;  3UUX B;  5HWX A;  3N7N A;  1QL1 A;  3HE4 A;  5KJ7 D;  4DBR A;  4P0A A;  3I5C A;  3C4W A;  4PFO A;  1URQ C;  4IE5 A;  2XAQ B;  4I43 B;  3UT5 E;  5JDG A;  2W27 A;  3WAK A;  5FXX A;  3P8M C;  5BU8 B;  1IAP A;  2VKD A;  3HKD E;  3O1J A;  2X67 A;  2NW7 A;  2YK0 A;  1JCD A;  1NWM X;  3LK3 B;  3GN5 A;  3MXZ A;  3ZMV B;  5LGN B;  1KK7 A;  4W80 A;  5CMZ A;  1O3X A;  1JOC A;  2V26 A;  1G2C A;  1N7S C;  2A72 A;  2XV5 A;  5LBQ B;  3RK2 B;  3B57 A;  2E43 A;  4HN9 A;  2L5G B;  5HWY A;  2I59 A;  4ASK A;  3HL6 A;  2Q9I A;  2WSE H;  3MKD A;  4XBF B;  1LT9 C;  4UVB B;  3K8P C;  2Q9Q B;  1GL2 C;  1BR4 A;  3J7Y q;  2R5B A;  1N2D C;  2QM7 A;  2WSS V;  1GK6 A;  1JY3 N;  1T98 A;  3KDS E;  4EYU A;  5LJN A;  3V5S A;  4Y99 C;  1QUU A;  2IC6 A;  1S9K E;  2PBI A;  1SFC D;  4EZ4 A;  3HKB E;  1RF1 C;  4AQG A;  1IJD B;  4YJ2 E;  1LWU B;  5H6R B;  2HOD A;  1T3U A;  4ZI2 C;  5J2T E;  4ZI7 E;  2PFV A;  4I2L C;  4X1K E;  4WBN E;  4WBO A;  5JDN A;  3B8E B;  4UF0 B;  4AXP A;  3BQL A;  2EHO B;  3KV9 A;  4DND A;  1D1A A;  2HH7 A;  3L4F A;  1NTZ K;  2WT7 B;  3CVR A;  4QXC B;  4YFS A;  1L4A B;  1RF0 A;  1D0Y A;  3LJC A;  5M4Y A;  5F3J A;  4C91 A;  2V7K A;  1VRB A;  2JJL A;  4PAG A;  1M1J B;  2FFD A;  3Q5X A;  4IHJ E;  1YTZ T;  4WY4 D;  1HGZ A;  2C0W A;  2IX7 C;  2M8R A;  2ZMA A;  3BQI A;  4AYC A;  2CPS A;  1HTL C;  1FZC A;  1J2J B;  1T8Z A;  2LSJ A;  1D0Z A;  2Y6X A;  3MTU E;  1GL2 A;  1A02 J;  1CUN A;  2N9B A;  4IDZ A;  3C9I A;  1FZE A;  3PE0 A;  3D0T A;  3WI3 A;  5JR9 A;  4H9Q C;  3A2A A;  2PJQ A;  1M7L A;  4L5G A;  5JDM A;  3EQ2 A;  2KYV A;  2FYU K;  2CXF A;  3O1H A;  3CI9 A;  1MIW A;  1IZN B;  3OYX A;  4OYJ A;  3RKO A;  2WMO A;  5L3G B;  3UUN A;  2K48 A;  2YEV C;  1HGV A;  3BK9 A;  3CQG B;  2LM9 A;  4ZI3 D;  5A1L A;  3L3P A;  3EUH A;  5KX5 E;  3P7I A;  4Z8X A;  4EYY R;  3OAK A;  3C4Z A;  1NAF A;  1GD2 E;  4GYS A;  4TV9 E;  3RC3 A;  1DEB A;  2A45 I;  4DZO A;  5AVW B;  2WM9 A;  3A5T A;  4KHX A;  1GU5 A;  5FXZ A;  4DVD A;  2D5U A;  2WZ7 A;  1LWU C;  2C5J A;  4AKI A;  2C0X A;  2V7M A;  1HWT C;  3NBX X;  5AW4 B;  4ZI3 C;  2NP9 A;  3N9M A;  1YTZ I;  4UF0 A;  1SFC B;  3V4Q A;  3IHR A;  4H63 H;  2FKW B;  3U1A A;  2H3R A;  3M0D C;  4OYK A;  2ODU A;  5E0O A;  1WT6 A;  1HG2 A;  4TZ4 C;  2WWW A;  1FBM A;  2I1J A;  1ZR2 A;  1A02 F;  4IGU A;  1M1J A;  2FFD B;  5J2U E;  2XKM A;  5AVZ B;  2X9X A;  3I0O A;  2W00 A;  5CA0 E;  5LNK A;  3R6N A;  1RF1 A;  2BVL A;  4O4L E;  4TUY E;  4HYT B;  2WBL A;  5L2L A;  2I1K A;  4AQR D;  3LBX A;  2OYI C;  2BZB A;  3QUJ A;  2LOP A;  3ZC1 A;  5LYJ E;  3VOP A;  5CHX A;  5APT A;  1SQX K;  1SFC A;  1BR2 A;  5L3F B;  4C7N A;  4OFZ A;  2JMK A;  3NRX A;  2QM8 A;  3BRV B;  3U1C A;  4JEH B;  4QXB B;  1EQ7 A;  1J1E B;  1QSD A;  1FMV A;  2KOG A;  4I6M C;  1VDF A;  3I0Q A;  1L0N K;  2P7J A;  3LIE A;  3P8C E;  1LTJ A;  1NO4 A;  2UXX B;  1IJ6 A;  3AA0 B;  4I55 E;  1J1E C;  4PK5 A;  2W62 A;  4PK4 A;  2NPS C;  4G2A A;  1JY3 P;  4UIG A;  1NKN A;  3PUA A;  5TAO A;  1HTJ F;  2EHO D;  5LHH B;  1OWA A;  4IFM A;  1X9V A;  2X51 A;  4XE5 B;  2ODV A;  5LA6 E;  1GL2 D;  2D2S A;  2W63 A;  4CXX A;  3N2G E;  3E08 A;  3V2N A;  3B13 A;  1N7S B;  4H9R C;  4UXN B;  2Z5H A;  4N6J A;  3RL0 B;  2E8I A;  3V2R A;  3RYF E;  1LTT C;  2Q9Q A;  2G0U A;  3HR0 A;  4MAL A;  2NPS B;  1G1J A;  3P32 A;  2OYH A;  3FBL A;  2ZXE B;  2GUV A;  2KXP B;  2J58 A;  5FNV E;  1GZL A;  1FIO A;  3HE5 B;  3ZMZ B;  1NHL A;  1RY3 A;  3NRY A;  2H8P D;  5CJ0 A;  1FU1 A;  2CPB A;  2QGS A;  1KZU B;  4QX8 B;  2W6B A;  3LK4 2;  1FZC C;  3ETU A;  1WR6 A;  5AW7 B;  2LKM A;  2DWG A;  4DMW A;  2XAF B;  4IE4 A;  5HAX A;  3TNU A;  1N7L A;  1LT9 A;  1N73 A;  1DH3 A;  1UX5 A;  4GYR A;  4KUM B;  4O4J E;  5L3E B;  1CSB A;  3KYQ A;  1EZ3 A;  2ZM8 A;  2NPS A;  2OYH B;  3N9L A;  2LT3 A;  3OBV E;  3ZCI A;  1H7C A;  4IE0 A;  4DOJ A;  3IFM A;  1YKE B;  4IFF A;  1X79 A;  3HKC E;  3RPU A;  3ZLI A;  4UV9 B;  1HX8 A;  3B5N D;  3AAI A;  3LFM A;  4EAH A;  2FXM A;  2ZM0 A;  2HLO A;  5AW8 B;  2JJ9 A;  2Q3I A;  2VRS A;  4C7R A;  1OXZ A;  2Z5I A;  2HG5 D;  4LLH A;  3N9N A;  1N86 A;  5AVY B;  1GL2 B;  2Q9Q C;  4A56 A;  2P9B A;  3OYZ A;  4H9P C;  4O8S A;  1U4Q A;  2VK9 A;  3RK3 D;  3ZJ2 A;  1SFC C;  2CA5 A;  3HD7 B;  4H9S E;  2B1E A;  4YLH A;  5DQW A;  5BU5 A;  1XTC C;  4L9I A;  3KQG A;  3ZYK A;  5APX A;  2N1G A;  5BMV E;  3T8O A;  4WW0 A;  2WIT A;  3UTK A;  2M67 A;  4AQF A;  3TSI A;  2ACX A;  4AKH A;  5JQG E;  1T3J A;  4B6X A;  5HXC A;  2DWK A;  4UV8 B;  2J59 M;  5JDQ A;  2O1J A;  2P1J A;  1KNZ A;  4W7Y A;  1HBW A;  1L4A C;  2KZ7 B;  1HG5 A;  3F57 A;  3MZK B;  2NOX A;  3NFQ A;  2POH A;  5AW1 B;  2CEA A;  3ANW A;  1MNE A;  5LCY A;  2D0T A;  5CJ4 A;  4J2C A;  2CWO A;  5L3C B;  4GOU A;  1DX7 A;  3HUS C;  1IJ5 A;  3NZQ A;  2KT9 A;  5KLV K;  1US7 B;  4ILU A;  4DO0 A;  4DBQ A;  1E5W A;  2UXN B;  1KFM A;  4TV8 E;  3EDU A;  1T2K C;  3VYI A;  2K5B B;  1RE3 A;  4U74 A;  3MK7 C;  4TN7 B;  4KP3 C;  1ZV4 X;  4PNI A;  4E7S A;  2YO2 A;  4H63 V;  1YYC A;  3VMY A;  1KIL D;  2E42 A;  3SRZ A;  1QL2 A;  3KVA A;  3ANW B;  4AKL A;  1LTJ C;  2HFE D;  2K9A A;  3M91 A;  2E9X C;  3EDV A;  3MA9 A;  4QXH B;  4UVA B;  4F6R C;  1KFN A;  4LGD E;  2DHR A;  3MAC A;  3CX6 B;  1HJB A;  3BRT B;  4WB4 A;  2W6A A;  1LKX A;  2H43 A;  3ZC0 A;  4AKG A;  1D1B A;  4C7N B;  2JPF A;  2Y48 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...