1NAFA

Crystal structure of the human gga1 gat domain
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
129
structure length
124
Chain Sequence
DEEKSKMLARLLKSSHPEDLRAANKLIKEMVQEDQKRMEKISKRVNAIEEVNNNVKLLTEMVMSHSQGSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEILQANDNLTQVINLYKQLVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADP-ribosylation factor binding protein GGA1
publication title The Structure of the GGA1-GAT Domain Reveals the Molecular Basis for ARF Binding and Membrane Association of GGAs
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein, membrane protein
total genus 37
structure length 124
sequence length 129
ec nomenclature
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03127 GAT GAT domain
A PF18308 GGA_N-GAT GGA N-GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1nafA01
1.20.58.160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1nafA02
3NMDA 4DZOA 5AW7B 4I2LC 5AVVB 4C46A 5AW3B 2QM8A 2WT7B 5AVRB 1GU5A 1H88A 2ZFCA 4GKGA 1X8YA 1HUCA 2Z5HA 3NXSA 3VMZA 3T97A 4B86A 4RESB 3HE5B 3V4WA 5AVUB 3NTNA 1GD2E 1A02J 1OXZA 1FOSF 4XE5B 2XZRA 1MUUA 2YO2A 3VYIA 1DH3A 1T2KC 2C9LY 2YO3A 2E42A 2N2NA 2H7HA 5APTA 1YYCA 3B8EB 2Q7CA 4C7NB 2P7JA 2E43A 1J2JB 1X79A 1GU4A 2IPPA 1GK4A 4KHXA 5AVZB 3V5BA 2JJLA 2N9BA 2W27A 3UIAA 4EOTA 5AW0B 2R5DA 4JYCA 1CI6B 4HYTB 1NWMX 1NAFA 1SLQA 2YNYA 2KP8A 2Q3IA 1FOSE 1SP4A 2Z5IA 3HE4B 5AW2B 3TNUB 3TK1A 3VTPC 3HTKA 5AW5B 1KQLA 2WPSA 3M0AA 1S9KE 3VN0A 3A3YB 3M91A 2WTYA 3A5TA 1HBWA 3M9BA 5AVXB 5APWA 1IO4A 1O3XA 3M9HA 1H8AA 5AVYB 3KDPB 2XU6A 1HWTC 2R5BA 3V4QA 2WT7A 1HJBA 1T2KD 5AVSB 5APUA 1CI6A 3NFQA 5APQA 2C9NY 1GTWA 3L35A 1WR6A 1FAVA 4GT1A 4AYCA 1MV8A 3HE5A 4AQRD 1JUNA 4AUWA 5APYA 3KQGA 5APSA 5APVA 3TYYA 2R32A 5AVWB 2XV5A 1WRDA 3OAKA 5AW6B 2WPQA 5AW8B 1MFZA 3L36A 2P67A 2WWWA 4JYBA 5AW1B 1NWQA 4I6MC 3M06A 4C7NA 1H89A 2VRSA 3A7OA 2WPRA 4LC1A 1G2CB 3VMXA 1A02F 3L37A 1CSBA 3VMYA 3LIDA 2W6AA 3MD0A 3IR9A 3A2AA 3I5CA 3O8ZA 3P7KA 1JNMA 1OWAA 5CMZA 4M3LA 1YD8G 3P8MC 2N9DA 1CZQA 5APXA 3HE4A 3TNUA 5AW9B 3MGNA 1GK6A 2ZXEB 3M0DA 2Q5UA 2P2UA 5AW4B 5AVTB 2R3CA 3P32A 2QM7A 3SWFA 1GZLA 1S9KD 2BASA 3LIEA 5AVQB
chains in the Genus database with same CATH superfamily
1JY3P 2J62A 3AE1A 3S4UA 4BJMA 3L70D 1G2CA 4TNVA 4ZS2A 3Q5DA 1YI2P 2DNXA 2YKQA 2KZJA 1L0LK 3WU2E 2OA5A 1IJ6A 1UGOA 3MUDA 2XZEA 3AA7B 2KYVA 2YO2A 1RY3A 1UIXA 5AQLB 4CN1A 4RO0A 5JTGA 4ZI2C 3B8EB 4HFCA 3OJAB 1YJ9P 3SFEA 2P7JA 2E43A 3IFMA 1J1JA 2X9WA 2W4XA 2UXDT 1HNXT 4EOTA 2CBJA 4A7PA 2R5DA 4PD4D 3H1IE 1EZVE 2V8SV 3R4YA 2V7QJ 2YU2A 3CLQA 4PJMA 3AE7C 4G2AA 5H2FH 2MPKA 2GM4A 2BZBA 5CBOA 3TK1A 4JI0T 5JDNA 5DQWA 5KMGP 2WPSA 3Q2MA 3OA7A 1T3JA 2FXOA 4JEHB 2FYNC 2K48A 2ZM8A 5APWA 4KJMA 1FU1A 1VQ4P 4JI6T 1XNQT 1LTJC 1OW6A 1L0LD 2WM9A 3F5HA 2BKPA 3F2EA 2I1JA 3RL0g 5AQOB 4AQGA 3O1JA 3AEGA 2CWOA 3Q2YA 3NBXX 1KILC 3H1IG 1EZVG 3N2KE 4GK5E 2XSAA 4ZZBA 3AXJA 4PNIA 2KUBA 2NTXA 4K3AA 1KV4A 4AQYT 3FX0A 3KDSE 3PUZF 2WMNA 3L74E 4DNDA 3L36A 1X79B 3RK3E 4OFZA 4KT0J 2WWVA 1OVVA 3A7OA 2CBIA 2ZM2A 1YW0A 5AQJB 1CSBA 5C39A 2YU1A 2UXXB 2VB6A 4AKIA 2YOEA 2KWIB 5HEHA 3ZCJA 5AQTB 5FXXA 5APXA 4X1YE 3JAEA 3CWZB 3AE8A 2PBIA 1UX5A 1SHZC 5B5EH 3BASA 2FFDA 4DR3T 4L0RA 3L74G 1Y9BA 4OGQC 3HUSB 5KAFH 3RBZA 2CXFA 2WMOA 2HPJA 3MIWA 1YJWP 2DLRA 4C7RA 2OYHB 4HH2A 2O3JA 5TISE 2NPSA 1QVFO 4DV2T 2OQQA 2WWUA 3UQ7A 2BG9B 4LFBT 4IL9A 3AEFC 1NTKD 5JDLA 5L4HA 2XAQB 2WSEH 1Y01A 5FKYA 4E7ZA 2B76A 4AKHA 4GKJT 2IPPA 3N9PA 3SFDA 2OTLP 1HX8A 2IIUA 3E0ZA 2W27A 3B5MA 3I9YA 1E1HB 4NPFX 4Y28J 1XDPA 3L72D 2FBWC 2AXDS 3GN5A 3OPCA 1YIJP 3PHLA 1ZP0A 2J4GA 1PPJD 2OYIB 2XAGB 2XQ3A 4B3TT 2W66A 4O4IE 3JC6D 2C0WA 3GG2A 4O4HE 3HR0A 1JY2N 1RF0A 3M0AA 3PUXF 1BE3E 5ABFB 1R5LA 5E0OA 1X0TA 3HD7D 2M3EA 2MBGA 3X1DA 1FS0E 4R4LA 3UU6A 3K3OA 1JB0J 5LHHB 5LJNA 1AVYA 2ES0A 2PGDA 1FIOA 3UU8A 1ZN5A 3CX5I 3RKGA 3L73E 4HWHA 2XASB 1RQVA 3BCCD 3H1HE 1KB9I 2K5BB 4QXHB 3N2OA 2FJAA 2IHR1 3RH3A 2WSSV 2XQ7A 3VP9A 1BE3G 4I55E 5C2TA 5LCYA 2WITA 1YXRA 2W62A 3TGUD 3VMXA 5CJ4A 2OTKE 2ZVNB 3L37A 3LW5J 1HJ0A 1OEDA 1QEXA 1BCCD 2LSYA 3ZT5A 1FDMA 2V4HA 1N7SA 4W7YA 4ZKPA 4DV4T 2IW5B 2MTQA 3L73G 1NTMD 1VL2A 4QH5A 5AVTB 2YDQA 2F4VT 1MNDA 3HD7B 2VASA 3H1HG 2IMLA 4IREA 4O8SA 2DHRA 4ILUA 5F8PA 3E08A 2ZLYA 4WBAA 1W2BO 4MHCA 2E5YA 2I59A 5L47A 1RE4A 3KVBA 1XTCC 3EUHA 2MKVA 2XQ5A 4MLKA 1EDLA 4AISA 3PU8A 2WZ7A 2YIUB 4DMVA 3SS1A 1KYOH 3VYIA 4YHJA 2HHHT 5CFBA 1VQ5P 2E9XC 1Z56A 1IFJA 5APTA 2Q7CA 1SQVJ 1KEYA 1LJ2A 3PLNA 4PJLA 5M1BA 5BU5A 4IFFA 1MZ9A 2H43A 1BGYJ 4KHXA 1EZVI 2N9BA 3RK2C 1H0TB 1NWMX 4TZ4C 1SQBJ 4YSZA 1VQMP 2BEZF 2AE9A 1KNRA 1SFCA 1MNEA 3H25A 3IA3A 2H89C 4JI7T 2H7OA 4YJ2E 2RH0A 1NVOA 5AW5B 2W8ZA 4MFRA 1KQFB 1JY2O 4EEBA 2E76C 4HKAA 3PUQA 4ILBA 4DR6T 3HRNA 3NZPA 3A5TA 2FYUK 1LTGC 3QC9A 2XM2A 1I6ZA 5HEJA 2VKOA 1H8AA 4ASWA 1NEKA 3OBVE 2J59M 2P58A 3T97B 5CBNA 2W6JH 2WT7A 3OKQA 4EGWA 3OYXA 4ISTA 2IC9A 3WUTA 2Z6EA 1URQA 2AEJA 3C50A 1ZOYA 2PRRA 3U3IA 3M3ZB 3RLFF 4O4LE 4GYSA 5LXTE 3MUDC 4EDFA 1DU2A 1HCIA 5KDMC 1WMKA 2D2CC 4K0KT 1FZAA 3ZC0A 3VKGA 2UXNB 2O1JA 1D1AA 2BBHA 4ADZA 3SFEC 4WZXA 4D6TD 2GK9A 3TDKA 4XBFB 4NIQA 4XAXB 2FYUD 4XA4A 3P8CD 3AE4A 2JMKA 2WP9A 4HE8A 2L8KA 3L8RA 2QVAA 5AW4B 3JCUE 4YLHA 3SWFA 1IJDB 3P32A 1LVFA 3JADA 1N32T 2NWBA 1NO4A 4DV0T 1KILD 5FYMA 5TAOA 1ZRTD 5IUXA 1HUCA 2R3SA 1MIVA 1EQ7A 4H13C 2O01N 2VL8A 1PP9D 4UB8E 1YKHB 5LJMA 1LP1A 4JF7A 1JY3N 2BBJA 2QJYB 4GIFA 3RRWA 5JRCB 3AEGC 4EIWA 1K9MQ 2K1AA 1PL5A 4DVDA 3JC22 5CCGA 3AE6A 3KPEA 2V6YA 3ZYKA 3L4FA 3MJXA 4TV9E 3AA1B 2YN6A 1KFNA 1JEKA 3BRTB 4IFMA 3P7IA 3PV0F 1QGKB 4HYTB 1USDA 4TNWA 2FYNB 2KP8A 4OWFA 2E74C 2CLYC 5HAXA 2PG8A 3H1IJ 2CEAA 2JWAA 2M6BA 3V5UA 1NKNA 4LMKA 1LTJB 4UB6E 4OGQD 4H9NC 4F6RC 4CQIA 1XWMA 2LRKA 1KILB 4AXPA 2R5BA 3V2NA 2ZT9C 1L0ND 1PV3A 3MHVA 1VQNP 3UU5A 3FBLA 3ZYMA 3ZCIA 5ABGA 4AQRD 3ITKA 4AKGA 5APVA 1IK9A 2E2AA 3FWLA 4NUUA 3EVYA 3RBXA 5KKZC 4EYUA 3G4SP 3LW5H 2Y9YA 2NPSC 2ODVA 2J5UA 2BS2A 2WWWA 1NWQA 5L4EA 3BQLA 1TU3F 4C7NA 2JIWA 1L0VA 4TWDA 1Y47A 3BVHA 1L0LJ 1VQ8P 1M56D 2B88A 4HJGH 5AQNB 3RRCA 2E5VA 1HF9A 3HKEE 3OYZA 4IE4A 4DBRA 1GL2A 4UELA 2VWAA 2X9YA 3SFDC 2FXMA 3O8ZA 1QLBA 1L4AA 4M3LA 2W0GA 1JCCA 4QWNB 4C90A 4UF0A 4X62T 2W90A 5AW9B 4OVNF 4OGQB 2D0UA 4DR4T 1ZP0C 2Q5UA 2OYOA 3L75E 2P2UA 3TSIA 2XY8B 4PK5A 1AV1A 3AE9A 2K3RA 2V7KA 2Q6QA 2YK0A 1VDFA 1DD4A 1ZKEA 1X22A 2KS1A 4IL6X 1SQQD 5AVVB 1RF0C 3TLSA 1EDKA 2G3AA 2RA1A 2HODA 3J9X1 4I43B 4IL4A 1WLXA 1YTZT 1OMIA 2HH7A 4MALA 4LFAT 5L3CB 3ZMVB 5HEGA 2I8DA 4J2CA 2YXQB 4X5TA 5FP3A 4YT0A 3C4XA 4IL6H 4OX9T 3AEBA 3FXEA 4TT3H 3ONLC 2D5UA 2LSKA 1GU4A 1S35A 3L75G 4U3FE 5JH7E 3IBPA 4X64T 5AW0B 3UFEA 2M8RA 1CW5A 2XPKA 3KBTA 3H3MA 2K88A 3ESLA 4NXMT 3DJBA 4NPDA 4X20E 2B89A 1R8IA 5L3GB 3I1AA 1OEDC 2GUSA 4BRYB 3H1KE 3MXZA 4H9PC 1BGYE 2RN0A 3GWHA 1PIXA 1N7SC 3CQGB 2FJDA 3C1LA 1N73A 1ZHCA 1BE3J 2V7IA 3KV4A 1Y64B 1T8BA 4TLFA 3WMM0 2HG5D 3LK2B 3L72J 2E9XD 4U3FG 1HGVA 1QL1A 4H0LC 2KSJA 1M1KQ 3IF8B 5GTHH 5HXSA 4IE0A 3CX5H 1VQ6P 1RE4C 1K04A 3RK2D 1KB9H 4QXCB 2K37A 3H37A 3LSVA 3QB5K 3L73J 4CN4A 3UUBA 1SQVG 1VPCA 3H1HJ 4JYBA 1WYCA 2JPFA 5DJQC 2PFXA 1BGYG 2XQ6A 3AEEA 1IFMA 4LC1A 2YDSA 1N33T 3AE3A 1SQXK 2E76D 1DEEG 2G8YA 3MD0A 4GODA 2IDBA 4KP3C 3B57A 2N1TA 4ZI3C 1FZFA 1Q82Q 2LR2A 1RF1A 3P4RA 1E7PA 1S3JA 2J47A 4I0UA 3I55P 3NRXA 1SFCC 1GZLA 1S9KD 5LGUB 2BASA 3LIEA 2B9BA 4I4TE 2HR3A 4A5XA 4YHHT 3CKDA 2CCQA 3O1IA 2PJQA 5AVRB 4UVCB 4EZHA 1SA0E 3NXSA 2QSIA 2E9XB 5LGTB 3TLVA 1U5PA 3WU2H 3V4WA 1R8EA 3KHUA 2WAUA 2XAFB 4WB4A 1KNPA 4A56A 1NGMB 2XQAA 1T3UA 2OV9A 2D2CD 3W15B 4YTPA 4LF7T 2VK9A 3HKBE 3RK2B 2W2UA 2LJLA 1URQC 1DIPA 4HGAA 5J2TE 1ZOYC 1J2JB 5AVZB 2K9YA 1FJKA 4U74A 1AA0A 1QX8A 2QJKC 4JYCA 4YSXA 1CI6B 5CJ5A 3PUVF 1MFTA 2E76B 3KINB 1NU1K 3CCUP 3AVSA 2Z5IA 3N9QA 3PE0A 3EFFK 3O4XE 5AQQB 2B1EA 2UUCT 3VTPC 2P10A 1SQXE 3CXHH 1KQLA 5KAIE 1RE3A 3OTOT 3GF7A 1FBMA 2XQYA 1PFIA 1OW7A 3RYCE 3AE4C 3RL0C 5GTIE 2JJ9A 2LXBA 1S2EA 4H13D 2DI4A 4PV1C 1M1JA 2SPZA 1LNQA 3L70E 5AVYB 5AQRB 3KDPB 3M65A 3UT5E 1KFMA 2KMFA 5BU8B 4ZKUA 5AVSB 4YPCA 4UVBB 1BR2A 3MACA 4UV9B 1KMIZ 2GUVA 1J1DC 3KV5A 3LG7A 3ZLIA 4TWHA 1EXJA 2D2CB 2FXPA 4U72A 3II6A 3KZIE 1XDOA 1VF5D 4KHPT 1KF6A 1CUNA 1SQXG 3ETVA 1RH5B 4PD4E 2E74D 3CXHD 1NU1D 3UULA 1P84H 5CCGC 3LJCA 3ZMUB 2JWDA 1IBMT 4EI2A 1EC5A 2DWKA 3N9NA 4OYKA 1D1CA 5JDQA 4KI0F 1PGPA 3IR9A 4RJTA 2O01J 1NJIQ 3P7KA 1NENA 4E7SA 1JNMA 1FZBA 5CMZA 5J0ZA 1VQPP 3P8MC 2QJPC 3H1JD 3N2GE 1MKMA 3TNUA 5B66E 1W9RA 2H88A 2HN1A 4YTMA 4H44C 2ZT9D 3UU4A 1JTHA 4WBOA 3Q3DA 1L0LE 4H13B 2R44A 3CMAP 2WBLA 4DO0A 3CCEP 1GU5A 1NTKK 1PGJA 2JQHA 3RYIE 5M4YA 2KLUA 1T72A 4CZZB 5JR9B 4JI5T 2A3DA 4IE5A 5TISH 1P84D 2NPSD 2BG9E 2UXCT 1OXZA 4XE5B 2C0XA 5F5WA 5H2FE 3VU7H 2WZHA 1AJ3A 5LB7B 4IGUA 2X66A 1VF5B 3BQIA 1IC2A 1YYCA 4LF4T 3BRVB 4QHOA 1FJGT 3K8PC 2E74B 4EYYQ 2Y9ZA 1BR1A 2CLYB 2ACZA 2BVLA 4ASKA 3H3AA 1L0LG 4GOEA 1KC8Q 2IYPA 4IE6A 3C8VA 5JQGE 1M7LA 3RYFE 3AEDA 2I1KA 1OZHA 2OYHA 3TLUA 5AQMB 1BR4A 2CRBA 4HTEA 1ZW0A 1GL2C 2BG9A 1FE6A 1MMDA 2ZT9B 1L4AC 3KYQA 3CCLP 4LGDE 4WW0A 2WSFJ 3N7NA 4DV3T 5HXHA 2WCAA 3V2RA 4HWCA 1V9DA 2QG4A 1W2EA 1FZCA 2X0YA 3GMAA 1HTJF 5E79H 5LGNB 4YFSA 4LFCT 4H63H 2WS3A 4GOUA 3AE9C 1VCSA 5APUA 5KKZB 3B5NA 1S94A 1LTIC 4WY4C 1FAVA 1YQ4A 4X1IE 2NPSB 2WSCJ 1XZYA 1NTKE 2I6HA 1QL2A 2JO1A 4COFA 4JI4T 1NTZK 2WPQA 2Q3EA 3ZSTA 3DTOA 2KLQA 2Q1KA 4LF8T 2P67A 1M8OB 3V5SA 5LMNT 1N34T 3L72E 3N9OA 3AEBC 1PPJE 1NTMK 3GN5B 2IBZD 5FMNA 4N3YB 2P1JA 4A98A 3L71D 3NRYA 1N7SD 1YBKA 3BATA 5HYAA 3HE4A 4IFDK 4HWIB 3M0DA 5DJUB 2K3WA 3ZN0B 2VURA 1BDCA 1NAYA 5FY1A 2XJ7A 1N86A 4H0LD 3K5BA 4DR5T 4WWIA 3ZMZB 4DZOA 1BSHA 3L75J 2B87A 4P09A 1OW8A 4GKGA 4L74A 5LOVE 2VQET 4PAGA 3L72G 5AQUB 2MOZA 1NTZD 1N73C 1DD3A 1YITP 2NP9A 3WI3A 1T6AA 3ABVA 3BCCE 3QOFA 1PPJG 3BQKA 4DBQA 2XAJB 5AFUL 4N78D 3HI2A 4ILCA 3O6QB 1IBKT 1HR0T 1T2KC 2JRKA 2ZYGA 5LHGB 5HEUA 1X9VA 2E42A 2YINA 3GHGA 1HG2A 3ZT7A 4B3ST 3NKZA 1IFIA 3D70A 4GYRA 1LT9A 2A06D 3TGUE 3RYHE 2P9BA 1GK4A 2JQKA 4ZI3D 3FXDA 2BCCD 1HG5A 1OEDB 4N6JA 4GK0E 1BCCE 1N7LA 1OVRA 3CWBD 2DCFA 4U3FJ 1U7JA 1SFCD 2NW8A 2NR4A 4X1KE 1FOSE 1N7SB 3AEEC 3G9RA 3QWOC 1Q86Q 1NTME 4BA9A 3AE3C 2JP3A 2G0UA 2CMRA 4Z8XA 3BCCG 2N9YB 3B71A 2JEEA 3S9OA 1KTMA 5KX5E 1KQGB 3RF1A 4H0LB 3H6PA 2SPCA 4GDOA 1D7MA 2KB7P 3H1KJ 2V7QH 3VRBA 1RF1C 2XQ4A 2VVSA 3AAEB 3H32A 3PJSK 5KLIB 3V4QA 1H0TA 1BSNA 3TGUG 2H8PD 2LXCB 3CX8B 2K9AA 2HLOA 3NVOA 2C9NY 1URQD 3MZWB 1WR6A 2KZ7B 3HE5A 1BCCG 1KK7A 1HS7A 4OH8B 5APYA 2DWGA 3EI0A 3ZJ1A 2R32A 4DOJA 1WRDA 1QSDA 4PD4I 1NTMG 3PUAA 1S5LE 4Z90A 3V2PA 2LLYA 4DR7T 3P50A 4YTPC 5AW1B 2O01H 3VOPA 1KYOD 4U31A 2Y0CA 4ZI7E 2C5JA 3L3PA 2HPCA 1HGZA 4EB6E 1Z0PA 5CCHA 1ZV8A 1FMVA 2IC6A 1SFCB 4ZI2D 1G73A 3RL0D 4TN7B 3F31A 4UVAB 1D0XA 1CZQA 4PV1D 5ABEA 3AE1C 2Y8DA 3JCUH 1QVGO 4TX5A 5GONE 4U7JA 5AVQB 2RP4A 2FJBA 3NMDA 5AW7B 2A72A 5IYZE 1RE3C 1IFPA 2QM8A 2WT7B 1SUMB 2QA4P 2M67A 5FY7A 2Y6XA 2L9QA 1URQB 1M1JC 4UB8H 3D6ZA 3Q5RA 2XQ9A 2W83C 1YJNP 1W0AA 2CXDA 2LKHA 3G3ZA 2X0HA 3FZKB 2NW7A 3GLMA 2LRLA 2Q9QA 1WR0A 5CCGD 1HNZT 2ZYAA 2V7MA 2XTLA 2J58A 2QE7H 1KFYA 5HXRA 4D6TE 1GW3A 2BS3A 1ZMEC 5L8RJ 3C51A 2FYUE 4H44D 3P8CE 4YXWH 4EIJA 3RL0B 2WSFH 2IDOB 2CPBA 3A0BE 4UB6H 3HL6A 4PV1B 3R6NA 1L0NK 1KN7A 2NZ2A 4NPEA 3FZHB 2WTYA 1AVOA 1KILE 2PP6A 1HBWA 4KX6A 3T1HT 1ZRTE 3RIAA 1SQXJ 2H88C 1J1DB 3AA6B 4ZXLA 1LTAC 1Q81Q 1LWUA 2KNCA 1LRZA 2QRXA 3FGAD 4BWNA 1PP9E 1HX1B 3H1LD 3L70J 5JDMA 4D6TG 4PK6A 3JCFA 5LG3A 1LP1B 4JEUB 3VR9A 2FYUG 2XSBA 3LK3B 1LTTC 3AA0B 1US7B 1PGOA 2V6YB 1G1IA 4MN4C 1S1CX 3ZMSB 2WDQA 4I6MC 4UEMA 2FKWB 2QJPB 1SVFA 2UUBT 3AE8C 1SQPK 1Q90D 1GL2D 3ZPOA 2M5AA 1OX3A 1WT6A 4H44B 5EK4A 2FFDC 3N9MA 4ZMDA 4PJ0E 2K9JA 1SQQK 1OWAA 1SE7A 1MIWA 3Q5WA 3RK3C 2N9DA 2VKHA 5LMUT 1E79H 3AEDC 2ZXEB 1LKXA 4QXBB 4ASVA 3T8OA 2YMYA 3RC8A 4H9OC 4P1NA 3SWKA 4WY4D 5ADXL 1L0NE 1NU1J 3L09A 2ZFCA 1JY2P 1X8YA 5CJ0A 3LBXA 4XZCA 4RKUJ 3TKLB 1FZCC 3I0QA 3HTKB 3WAKA 2X9HA 4H9QC 3B5NC 4WBNE 1QUUA 1AQ5A 2ZVOB 3LFMA 2JQQA 2N2NA 3G06A 3QNUA 2LKMA 4NPPA 1SQPD 2R6GF 1OFCX 4C7NB 3FZFB 1D0ZA 3EAMA 1JCDA 5AQKB 2ZM6T 5JVDE 3V5BA 1U7MA 1FC2C 3PUSA 3UIAA 1WCRA 3CPZA 2IYOA 4Y99C 3L39A 2WU5A 1GL2B 2XKMA 1NAFA 1L0NG 3PH0A 3KV6A 4L9IA 4UF0B 3N5LA 4L73A 5LBMA 2Q3IA 5AW2B 4JBZA 1JY3O 4JI1T 5KLVK 4EZ4A 4ZHQE 2DW3A 1SQQE 3G6EP 1D1BA 5FNVE 3U78A 2AXTH 2KS1B 4WY4B 4DUZT 5FVKA 3SSUA 3ANWA 3ETUA 2CK3H 2CXLA 3M0DC 2Q9IA 4L75A 3CX6B 2A2FX 1E5WA 2I0MA 4O9BA 1T2KD 2XAHB 3P4WA 3NFQA 4DR2T 2WY2A 5HWXA 2D9DA 4AYCA 1KD1Q 3TLTA 3MZKB 1AQTA 2Y0DA 2WQYA 1MMGA 3FXEB 3S1KA 5IHYA 3ABVC 1NTKJ 3D6YA 1ZLLA 5JDGA 3U59A 4WNKA 3GF3A 3AEAA 5KTBA 1BDDA 2OARA 2OTJP 1LGHB 1SQQG 1H89A 5CA1E 3GHGC 1CHUA 3VRAA 1A02F 1SQBD 2RPAA 1LT9C 2ZAEB 5KLVD 4DV6T 3RKOA 1NHLA 4U7IA 4PJNA 3GMIA 2HFED 4IDNA 3ONJA 2LSJA 5KJ7A 1HNWT 3VR8A 1HFAA 4IL6E 2IZ1A 5LHIB 2LM9A 2EHOA 1T8ZA 4CPGA 3H1KG 1IJ5A 2KZIA 2CE7A 4P0AA 1K8AQ 3K1SA 2FYZA 4JUYA 1VQKP 1GD2E 4JQ0D 2M6IA 2AEFA 1A02J 1FOSF 1Y8AA 2XZRA 5FVLA 3QUJA 1IAPA 3RC3A 5AQFB 1IFNA 4LMLA 3BCCJ 2KI7B 2V5DA 5DQVA 4ERRA 1G1JA 4CN6A 4GKKT 2H7HA 5BVZA 3CX5D 4EOZB 1MIYA 3AVRA 5FXVA 2LHRA 1KB9D 3OW2O 1NOHA 4AIUA 4YTNA 2WMMA 3TGUJ 1USEA 4OK0A 1XMQT 3QH9A 3A0HE 2A45G 1NTZJ 2VKDA 4IDPA 1BCCJ 4QKNA 4KBMB 5L3DB 2ACXA 5GTHE 3O9XA 4DMWA 5CCHC 4K35A 1S9KE 1N8RQ 5GTIH 5EK2A 3CCSP 1NTMJ 2CM0A 2BEQD 1IO4A 2NTYA 1LT1A 5L3BB 3P4PA 3AAIA 2KWHA 4B6XA 2BCCJ 3F57A 3VKHA 1W0BA 1CI6A 1FJPA 4NUVA 2BKNA 1WFDA 2WU2A 5LBQB 3ZC1A 5C3JA 3RGUA 3CPWO 3KBUA 3KZIH 3WAJA 3CX7B 3Q5PA 2YKOA 1LVKA 3TYYA 2YKPA 1IBLT 2ZYDA 4IT4A 4TUYE 3R84B 5JREA 4PD4H 2FUPA 4HEAA 3AE5A 2Q9QC 3OJAA 4HFIA 3E1IA 2WPRA 1G2CB 1IK7A 1FEWA 3VMYA 3LIDA 5ETWA 3ZDMA 2NOXA 5HWYA 1HTLC 3H1ID 1EZVD 3Q9DA 4CI2B 5B66H 3QB5A 1YD8G 2IZ0A 4YJ3E 4YXDA 1T7SA 2C5KT 1M7KA 1OVUA 4HFHA 4DR1T 1VQLP 1IZNB 4DCKA 1DX7A 2CPTA 4JPZB 3P4SA 1M1JB 2QJYC 3MK7C 1FZGA 4O2AE 5AW3B 1VQOP 2Z5HA 3AE6C 1U57A 5H6QB 4RESB 3RIUA 4ISSA 2X0LB 3L70G 1LWUC 2DL1A 3CC7P 4IE7A 4I7ZC 2YO3A 2FJEA 1UCUA 3CXHE 4GOFA 2QIWA 1NU1E 4IOIH 1Q7YQ 1X79A 4QH1A 3RI5A 3BK9A 3L74D 3PUYF 2WSSH 5CGMA 3RK3D 4ZOLE 2AXCA 2LOSA 3AAAB 3IF4A 4QX8B 2QEXP 3H1JE 3JSVC 1G8XA 1FDIA 1J1EC 5JR9A 4D6TJ 4JI3T 2UU9T 1M90Q 3TNUB 3AXJB 5HXCA 2FYUJ 1LTBC 3JAFA 4C91A 1JTHB 1S4XA 3VN0A 3A3YB 3M91A 1S72P 5KXJA 3MA9A 4MBQA 3F89A 3PUWF 3B13A 2X51A 1NU1G 1UIIA 4EV6A 1P84E 3B5ND 2YXRB 2VKJA 3HUSA 3AECA 5J1GA 2WDVA 3UUNA 1JUNA 3FZMB 5L3FB 5LP6E 4U2ZA 3NWIA 1PP9J 3H1JG 5LG4A 5AQVB 4EEDA 2KOGA 3RHWA 3WUUA 3O1HA 3P4QA 4DV1T 4HFVA 2FFDB 1XMOT 3C64A 3ZN1B 4PFOA 3VHLA 5F3JA 4A97A 3RK3B 4R4MA 4X65T 2POHA 3G71P 1JOCA 3CCMP 1WRGA 4FI5A 2K24A 3UTKA 2WZIA 4EXTA 1KNZA 3H1LJ 4OHFA 2D2SA 3CK6A 3C9IA 3C98B 3SWHA 1B7TA 1JMBA 1XNRT 2OYIA 3D71A 1AFOA 3Q1MA 1NKZB 1K73Q 3PTRB 3MP7B 5ABFA 2A45I 1FZCB 2LEHA 4XFJA 1BE3D 5HCJA 4IHJE 4X66T 5B5EE 3DP7A 3RGLA 1YQ3A 5CB4E 3ZYLA 1DEBA 2MJZA 3B5NB 3EDVA 3AE2A 5EK3A 5KAFE 1L0NJ 4DV5T 2E5TA 5AVUB 3UQ4A 4ILAA 1ZR2A 2X68A 1FDOA 4OYJA 4HFEA 1MUUA 4UR9A 4Y99B 4AKLA 3L73D 3A8YC 3GW6A 2IUBA 5DJTB 3V6IA 1NTKG 3H1HD 3SWYA 1OEDE 1YHQP 2WQYC 3E1RA 2IBZE 4YY3T 4LF6T 2LE8A 4AQFA 2JJLA 2A9UA 5E79E 3L71E 3CD6P 4HB1A 2XUEA 3U1AA 2V7LA 3AEAC 5HCMA 2KXPB 2OGUA 3PU3A 3HE4B 2QA7A 2ODUA 3KV9A 2L3LA 4IDQA 3O6QA 1HF8A 3WUVA 3IEEA 5AQIB 5H6RB 3I56P 1SQPJ 3HKCE 1O3XA 3HD7A 2B87B 3TF5A 5IWAT 1S5LX 5KJ7C 3CL3D 1SQQJ 4IDOA 1NTZE 2VQFT 5ABHA 2IBZG 2EHOC 4JBWF 4DJGA 4QH4A 4N78E 3L35A 2Y48B 4ANJA 3L71G 2XM1A 1E2AA 4H9RC 3KQGA 5AQSB 2Y0EA 5AVWB 2VL0A 4HWFA 2QYWA 2L5GB 3GHGB 3S4RA 1D0YA 2E75C 5FL0A 2A06E 5AW6B 1S5LH 2WDRA 5FXWA 2N1TC 1LT9B 4TWFA 2BCCE 2FY8A 3V2QA 3FXDB 4EAHA 3CWBE 2CPSA 4KHZF 1NH4A 3MKDA 4V1Av 2AEMA 4U33A 5CCHD 4DIDB 1JNZA 5JDFA 1KZUB 2D0TA 3A2AA 1NTZG 2BKOA 2RKLA 3OVUA 1ZEEA 2HPLA 2H3RA 3IHRA 4EYYR 4U2YA 1EDJA 4CXWA 2QM7A 3U1CA 2A06G 3H32B 4LMJA 3W67A 2XNDH 4C46A 2UWJE 2W63A 4H63V 2IX7C 2BCCG 5EFWB 4PW8A 5DABA 4BXLA 2JKVA 4ZZCA 3T97A 4B3RT 3PJAA 3K3NA 3CWBG 5KLVJ 3HE5B 3C4WA 3RPUA 1AJYA 2UXBT 4AI6A 2CHNA 2Q9QD 2V26A 4HN9A 3CXHI 3UU3A 1DH3A 2C9LY 3CVRA 3C4ZA 2W6BA 4JYAT 1KYOE 2LOPA 2M0BA 2BVMA 4ZNCA 1XTGB 2HPCB 1VOMA 3RQWA 2LSGA 3ZEFB 1H7CA 3CCQP 3AE5C 2W67A 4I50E 2Z4EA 3A0BH 3EWKA 2E5LT 4P0BA 3ONXA 4M1PA 2O1KA 3I9WA 3ZSSA 2QJKB 1M62A 1VRBA 3M9BA 4YXDC 2MAWA 2OLTA 3EABA 2CWYA 4BJNA 4NXNT 1P84I 2KIKA 4U7YA 1IFDA 3IN6A 2W61A 1UUSA 2C0SA 2KLVA 4HFDA 4HKZH 4GT1A 5EZYE 1Q2NA 1K05A 4AUWA 1UK5A 5APSA 2Q9QB 1MMNA 3RIUC 1RQUA 5AW8B 5TJHA 1MFZA 5CHXA 1GW4A 5JRCA 3PRJA 2ITAA 4ZEYA 3CCRP 2LHNA 3M06A 4LLHA 2WSCH 4KMCA 4UIGA 2VRSA 3AE7A 3SOLA 4L76A 4PJ0H 2W6AA 1JM0A 3I5CA 4H9SE 3MTUE 3A5XA 4JI2T 2HN2A 2MYSA 5JR9C 2JQ9A 4HWDA 1LTJA 4KUMB 5HXEA 1UX4A 4G63A 2KINB 1PZQA 1LWUB 4I2LC 2XQ8A 2KNCB 2JMHA 2BS4A 1KILA 3H1LE 1VF5C 3Q5XA 5FXZA 2L91A 3FWNA 4I7ZB 2KK7A 3FZLB 1WYBA 1HH0A 4ZS3A 4BAYB 2JDIH 1L4AD 4WVZA 3E22E 4UXNB 3EDUA 1NYHA 3D0TA 3CIRA 2PTFA 4LF9T 3FB2A 1SS1A 3VP8A 1PP9G 3HUSC 3CMEP 2YMKA 3AECC 3RQUA 1VCTA 3I0OA 3CI9A 2IBZI 2OYHC 1J1EB 1GDTA 4QMAA 4QX7B 2CA5A 4Q25A 2ZMAA 2W00A 2V6XA 4O4JE 2BG9C 4K0UA 2M5AB 4PK4A 5AQPB 1L2PA 2K9JB 2YNYA 3H1LG 3AB3B 2VVNA 2X67A 1SP4A 2KSRA 3ZKRA 2RMZA 3EFGA 2V1DB 5FL1A 3HTKA 3H1JJ 4B3MT 3K3QC 1FZEA 1UURA 3IAOA 1YQ4C 3RIFA 3LK42 4L5GA 2J1DG 3KXDA 5AVXB 4AKRB 4WYVA 2OYIC 2KT9A 3EQ2A 5BR8T 3L75D 3GA8A 3L74J 2LKGA 2XU6A 2E8IA 1HWTC 3LBXB 1SQVK 1W5CE 1HJBA 4IDZA 4Z91A 1W09A 2YKSA 5FY0A 3N4XA 3UFGA 5A1LA 1L4AB 3AEFA 4LF5T 1YQ3C 1MV8A 2ZJSE 3ZMTB 5LNKA 2IFMA 3AE2C 1SQPE 5CA0E 1SQBK 3ZT6A 3UUMA 1VQ9P 2JR8A 4O2BE 5L2LA 4W80A 2QGSA 2FBWA 5J2UE 2PAJA 4WY4A 3ZJ2A 1MMAA 1GMJA 1RHZB 2HODB 2YEVC 3LDQB 1I94T 4U3FD 1J5ET 4TV8E 2WPVB 3VMAA 3EHZA 2XHEB 4AQFC 4CXXA 4GIWA 3FHNA 4DV7T 1OIPA 2WVRA 4UV8B 5KJ7D 4FJOA 3MGNA 4BRYA 2C5IT 2EHOD 2R3CA 1SQVD 1SQPG 3H1KD 3ANWB 5L3EB 2A45H 1BGYD 3USSA 2HYNA 3CCVP 3JC6C 1N36T 2N1GA 1H88A 2PFVA 1X9BA 3PUGA 4DUYT 2UUAT 3VMZA 3HKDE 4B86A 2E75D 1EXIA 1R5SA 2ZM0A 4PFPA 5JDHA 3HD7C 3NTNA 2N1TD 3PTZA 3A7MA 3CC4P 2WB5A 1M57D 3R2PA 1JO5A 3HA4A 1SQVE 2KSEA 3Q5EA 1KYOI 1ZV4X 2X9XA 2H7VC 4HFBA 2GA1A 3CQXC 4CXYA 3B4SA 1PGQA 1N73B 1GQEA 2AXTE 1U4QA 2YIUC 4PJJA 2LM2A 1SQBE 5KLVE 1J5WA 3PP5A 2CHOA 3A0HH 1EDIA 1VQ7P 4F8HA 2LT3A 2WSEJ 3CMLA 1SLQA 4W7ZA 3TLWA 3M9QA 5BMVE 2IAKA 3L71J 4I1LA 3CCJP 5AQGB 3E7KA 5K5GB 2YDRA 5KLIC 5LYJE 1ZXGA 3FBZA 4Z1MH 2V7JA 1FMWA 1T98A 2XDJA 2EHOB 1KORA 3SRZA 3M9HA 2V5CA 4U3CA 2LSIA 1Z8UA 3KVAA 3J7Yq 1YKEB 2E75B 5APQA 1SQBG 5C8YE 4IIJE 5KLVG 1GTWA 2E9XA 2N1TB 3UUXB 3KFWX 3PURA 1HVVA 4JLEA 3Q5SA 1RF1B 1KQSO 1LTSC 5KAIH 3CX5E 2XV5A 4CI1B 3OAKA 2KNDA 5HEOA 2NW9A 3T1YT 4JI8T 1KB9E 2NRGA 3W68A 1QLED 3CC2P 2XNXA 1JNRA 3QK6A 2H89A 3PJAJ 3CWBJ 3PDYA 1BR0A 1JMMA 2M3BA 2ZXXA 4YSYA 2BDEA 1YTZI 3NZQA 4DT0A 1N2DC 3CQCB 4JV5T 5AQHB 3N9LA 1GK6A 5LA6E 1ZR4A 2IFNA 4CI3B 1SQXD 3RX6A 1EZ3A
chains in the Genus database with same CATH topology
1JY3P 3S4UA 4BJMA 4ZS2A 1G2CA 2DNXA 2YKQA 1L0LK 2OA5A 1IJ6A 3MUDA 3AA7B 2KYVA 2YO2A 1RY3A 4ZI2C 3B8EB 3OJAB 2P7JA 2E43A 3IFMA 2X9WA 4EOTA 2R5DA 2YU2A 3CLQA 4PJMA 4G2AA 2GM4A 2BZBA 3TK1A 5JDNA 5DQWA 5KMGP 2WPSA 3Q2MA 3OA7A 1T3JA 4JEHB 2K48A 2ZM8A 5APWA 1FU1A 1LTJC 2WM9A 3F2EA 2I1JA 4AQGA 3O1JA 2CWOA 3NBXX 1KILC 3N2KE 4GK5E 4PNIA 2NTXA 3KDSE 2WMNA 4DNDA 3L36A 1X79B 4OFZA 3A7OA 2ZM2A 1YW0A 1CSBA 2YU1A 2UXXB 2VB6A 4AKIA 2KWIB 3ZCJA 5FXXA 5APXA 4X1YE 3CWZB 2PBIA 1UX5A 1SHZC 3BASA 2FFDA 4L0RA 3HUSB 2WMOA 2CXFA 2HPJA 3MIWA 2DLRA 4C7RA 2OYHB 4HH2A 2NPSA 2WWUA 5JDLA 2XAQB 2WSEH 4E7ZA 4AKHA 2IPPA 3N9PA 1HX8A 3E0ZA 2W27A 3I9YA 1E1HB 3GN5A 2OYIB 2XAGB 4O4IE 3JC6D 2C0WA 4O4HE 3HR0A 1JY2N 1RF0A 3M0AA 5E0OA 3HD7D 2MBGA 3K3OA 5LHHB 5LJNA 2ES0A 1FIOA 1ZN5A 2XASB 2K5BB 4QXHB 3N2OA 3RH3A 2WSSV 4I55E 3VP9A 5LCYA 2WITA 2W62A 3VMXA 5CJ4A 3L37A 2LSYA 1FDMA 1N7SA 4W7YA 4ZKPA 2IW5B 2MTQA 5AVTB 1MNDA 3HD7B 2VASA 4O8SA 2DHRA 4ILUA 5F8PA 3E08A 2ZLYA 4WBAA 4MHCA 2I59A 1RE4A 3KVBA 1XTCC 3EUHA 4MLKA 3PU8A 2WZ7A 4DMVA 3SS1A 3VYIA 4YHJA 2E9XC 1Z56A 1IFJA 5APTA 2Q7CA 4PJLA 5BU5A 4IFFA 1MZ9A 2H43A 4KHXA 2N9BA 3RK2C 1NWMX 4TZ4C 1SFCA 1MNEA 2H7OA 4YJ2E 5AW5B 4MFRA 1JY2O 4HKAA 3PUQA 3HRNA 3NZPA 3A5TA 2FYUK 1LTGC 3QC9A 2VKOA 1H8AA 3OBVE 2J59M 2WT7A 3OKQA 3OYXA 4ISTA 2IC9A 2Z6EA 1URQA 3C50A 3U3IA 4O4LE 4GYSA 5LXTE 1HCIA 5KDMC 1FZAA 3ZC0A 3VKGA 2UXNB 2O1JA 1D1AA 4ADZA 2GK9A 4XBFB 4XAXB 4XA4A 3P8CD 2JMKA 4HE8A 2L8KA 5AW4B 4YLHA 3SWFA 1IJDB 3P32A 1LVFA 2NWBA 1NO4A 1KILD 5FYMA 5TAOA 1HUCA 1MIVA 1EQ7A 2VL8A 1YKHB 5LJMA 4JF7A 1JY3N 4GIFA 3RRWA 5JRCB 4EIWA 4DVDA 5CCGA 3KPEA 3ZYKA 3L4FA 3MJXA 4TV9E 3AA1B 1KFNA 3BRTB 4IFMA 3P7IA 4HYTB 2KP8A 5HAXA 2CLYC 2PG8A 2CEAA 3V5UA 1NKNA 1LTJB 4H9NC 4F6RC 4CQIA 1KILB 4AXPA 2R5BA 3V2NA 3FBLA 3ZYMA 3ZCIA 4AQRD 4AKGA 5APVA 1IK9A 4NUUA 3EVYA 4EYUA 3LW5H 2ODVA 2NPSC 2WWWA 1NWQA 3BQLA 4C7NA 3BVHA 3RRCA 3HKEE 4IE4A 3OYZA 4DBRA 1GL2A 4UELA 2VWAA 2X9YA 2FXMA 3O8ZA 1L4AA 4M3LA 2W0GA 1JCCA 4QWNB 4C90A 4UF0A 5AW9B 2D0UA 2Q5UA 2P2UA 3TSIA 4PK5A 2V7KA 2YK0A 1ZKEA 1VDFA 5AVVB 1RF0C 2RA1A 2HODA 3J9X1 4I43B 1WLXA 1YTZT 2HH7A 4MALA 5L3CB 3ZMVB 5FP3A 4J2CA 3C4XA 2D5UA 2LSKA 1GU4A 1S35A 5JH7E 3IBPA 5AW0B 3UFEA 2M8RA 1CW5A 3KBTA 3ESLA 3DJBA 4X20E 5L3GB 3I1AA 2GUSA 3MXZA 4H9PC 3GWHA 1N7SC 3CQGB 1N73A 1ZHCA 2V7IA 3KV4A 1Y64B 3WMM0 2HG5D 3LK2B 2E9XD 1HGVA 1QL1A 2KSJA 3IF8B 5HXSA 4IE0A 1RE4C 3RK2D 4QXCB 3H37A 1VPCA 4JYBA 1WYCA 2JPFA 5DJQC 1IFMA 4LC1A 1SQXK 3MD0A 4KP3C 3B57A 2N1TA 4ZI3C 1FZFA 1RF1A 3NRXA 1SFCC 1GZLA 1S9KD 5LGUB 2BASA 3LIEA 4I4TE 3CKDA 2CCQA 3O1IA 2PJQA 5AVRB 4UVCB 4EZHA 1SA0E 3NXSA 2E9XB 5LGTB 1U5PA 3V4WA 2WAUA 2XAFB 4WB4A 4A56A 1T3UA 3W15B 2VK9A 3HKBE 3RK2B 2LJLA 1URQC 4HGAA 5J2TE 1J2JB 5AVZB 1FJKA 4U74A 4JYCA 1CI6B 3KINB 1NU1K 3AVSA 2Z5IA 3N9QA 3PE0A 3O4XE 2B1EA 3VTPC 1KQLA 1RE3A 1FBMA 2XQYA 1PFIA 3RYCE 3RL0C 2JJ9A 2DI4A 1M1JA 5AVYB 3KDPB 3M65A 3UT5E 1KFMA 2KMFA 5BU8B 4ZKUA 5AVSB 4UVBB 1BR2A 3MACA 4UV9B 2GUVA 1J1DC 3KV5A 3LG7A 3ZLIA 4U72A 3II6A 1CUNA 3ETVA 3UULA 5CCGC 3LJCA 3ZMUB 2DWKA 3N9NA 4OYKA 1D1CA 5JDQA 3IR9A 3P7KA 4E7SA 1JNMA 1FZBA 5CMZA 3P8MC 3N2GE 3TNUA 1JTHA 4WBOA 2WBLA 4DO0A 1GU5A 1NTKK 3RYIE 5M4YA 4CZZB 5JR9B 2A3DA 4IE5A 2NPSD 1OXZA 4XE5B 2C0XA 3VU7H 1AJ3A 4IGUA 2X66A 3BQIA 1IC2A 1YYCA 3BRVB 4QHOA 3K8PC 1BR1A 2CLYB 2BVLA 4ASKA 3H3AA 4IE6A 5JQGE 1M7LA 3RYFE 2I1KA 2OYHA 1BR4A 4HTEA 1GL2C 1MMDA 1L4AC 3KYQA 4LGDE 4WW0A 3N7NA 5HXHA 3V2RA 1V9DA 1W2EA 1FZCA 1HTJF 5LGNB 4YFSA 4H63H 4GOUA 5APUA 3B5NA 1S94A 1LTIC 4WY4C 1FAVA 4X1IE 2NPSB 1QL2A 1NTZK 2WPQA 3DTOA 2KLQA 2P67A 3V5SA 3N9OA 3GN5B 1NTMK 5FMNA 4N3YB 2P1JA 3NRYA 1N7SD 3BATA 5HYAA 3HE4A 4IFDK 3M0DA 3ZN0B 5FY1A 1N86A 3ZMZB 4DZOA 4P09A 4GKGA 5LOVE 4PAGA 2MOZA 1N73C 3WI3A 2NP9A 3BQKA 4DBQA 2XAJB 5AFUL 4N78D 3HI2A 1T2KC 2JRKA 5LHGB 1X9VA 2E42A 2YINA 3GHGA 1HG2A 1IFIA 4GYRA 1LT9A 3RYHE 2P9BA 1GK4A 4ZI3D 1HG5A 4N6JA 4GK0E 1N7LA 2DCFA 1SFCD 2NW8A 4X1KE 1FOSE 1N7SB 4BA9A 2G0UA 2CMRA 4Z8XA 2JEEA 5KX5E 2SPCA 3H6PA 2KB7P 1RF1C 3AAEB 3H32A 3V4QA 2H8PD 3CX8B 2K9AA 2HLOA 2C9NY 1URQD 1WR6A 2KZ7B 3HE5A 1KK7A 1HS7A 4OH8B 5APYA 2DWGA 3ZJ1A 2R32A 4DOJA 1WRDA 1QSDA 3PUAA 3V2PA 5AW1B 2O01H 3VOPA 4ZI7E 2C5JA 3L3PA 2HPCA 1HGZA 4EB6E 1Z0PA 5CCHA 1ZV8A 1FMVA 2IC6A 1SFCB 4ZI2D 1G73A 3RL0D 4TN7B 4UVAB 3F31A 1D0XA 1CZQA 2Y8DA 4TX5A 5GONE 5AVQB 2RP4A 3NMDA 5AW7B 2A72A 5IYZE 1RE3C 2QM8A 2WT7B 2M67A 5FY7A 2Y6XA 2L9QA 1URQB 1M1JC 2CXDA 3G3ZA 2NW7A 2Q9QA 5CCGD 2V7MA 2XTLA 2J58A 5HXRA 1GW3A 3C51A 3P8CE 4EIJA 3RL0B 2WSFH 2CPBA 3HL6A 3R6NA 1L0NK 2WTYA 2PP6A 1HBWA 1J1DB 3AA6B 1LTAC 1LWUA 1LRZA 5JDMA 4PK6A 4JEUB 3LK3B 1LTTC 3AA0B 1US7B 1G1IA 3ZMSB 4I6MC 4UEMA 2FKWB 1SVFA 1SQPK 1GL2D 3ZPOA 1WT6A 5EK4A 2FFDC 3N9MA 1SQQK 1OWAA 1MIWA 3Q5WA 3RK3C 2N9DA 2VKHA 2ZXEB 1LKXA 4QXBB 3T8OA 2YMYA 3RC8A 4H9OC 4WY4D 5ADXL 3L09A 2ZFCA 1JY2P 1X8YA 5CJ0A 3LBXA 4XZCA 3TKLB 1FZCC 3I0QA 3HTKB 3WAKA 2X9HA 4H9QC 3B5NC 4WBNE 1QUUA 1AQ5A 3LFMA 2JQQA 2N2NA 2LKMA 4C7NB 1D0ZA 1JCDA 5JVDE 3V5BA 3PUSA 3UIAA 3CPZA 4Y99C 1GL2B 2XKMA 1NAFA 3KV6A 4L9IA 4UF0B 3N5LA 5LBMA 2Q3IA 5AW2B 1JY3O 5KLVK 4EZ4A 4ZHQE 1D1BA 5FNVE 3U78A 4WY4B 3ANWA 3ETUA 2CXLA 3M0DC 2Q9IA 3CX6B 2A2FX 1E5WA 4O9BA 1T2KD 2XAHB 3NFQA 5HWXA 4AYCA 3MZKB 1MMGA 3FXEB 5IHYA 1ZLLA 5JDGA 3U59A 4WNKA 5KTBA 2OARA 1LGHB 1H89A 5CA1E 3GHGC 1A02F 1LT9C 3RKOA 1NHLA 4PJNA 3GMIA 2HFED 2LSJA 5KJ7A 1HFAA 5LHIB 2LM9A 2EHOA 1T8ZA 1IJ5A 2CE7A 4P0AA 2FYZA 4JUYA 1GD2E 1A02J 1FOSF 2XZRA 3QUJA 1IAPA 3RC3A 1IFNA 5DQVA 4ERRA 1G1JA 2H7HA 5BVZA 4EOZB 1MIYA 3AVRA 5FXVA 2LHRA 1NOHA 4OK0A 2A45G 2VKDA 4QKNA 4KBMB 5L3DB 2ACXA 3O9XA 4DMWA 5CCHC 1S9KE 5EK2A 2CM0A 1IO4A 2NTYA 5L3BB 3AAIA 2KWHA 4B6XA 3F57A 3VKHA 1CI6A 1FJPA 4NUVA 3ZC1A 5LBQB 3KBUA 3WAJA 3CX7B 2YKOA 1LVKA 3TYYA 2YKPA 4TUYE 5JREA 3R84B 4HEAA 2Q9QC 3OJAA 3E1IA 2WPRA 1G2CB 1FEWA 3VMYA 3LIDA 5ETWA 2NOXA 5HWYA 1HTLC 3Q9DA 4CI2B 1YD8G 4YJ3E 2C5KT 1IZNB 1DX7A 1M1JB 3MK7C 1FZGA 4O2AE 5AW3B 2Z5HA 5H6QB 4RESB 4ISSA 2X0LB 1LWUC 4IE7A 2YO3A 1UCUA 1X79A 3BK9A 3RK3D 4ZOLE 2LOSA 3AAAB 4QX8B 1G8XA 1J1EC 5JR9A 3TNUB 5HXCA 1LTBC 4C91A 1JTHB 3VN0A 3A3YB 3M91A 3MA9A 4MBQA 3B13A 2X51A 3B5ND 2VKJA 3HUSA 5J1GA 3UUNA 1JUNA 5L3FB 5LP6E 5LG4A 2KOGA 3O1HA 4HFVA 2FFDB 3C64A 3ZN1B 4PFOA 3VHLA 5F3JA 3RK3B 2POHA 1JOCA 1WRGA 4FI5A 2K24A 3UTKA 4EXTA 1KNZA 4OHFA 2D2SA 3C9IA 3C98B 3SWHA 1B7TA 2OYIA 1AFOA 1NKZB 3PTRB 2A45I 1FZCB 2LEHA 4IHJE 3DP7A 5CB4E 3ZYLA 1DEBA 2MJZA 3B5NB 3EDVA 5EK3A 5AVUB 1ZR2A 2X68A 4OYJA 1MUUA 4Y99B 4AKLA 3SWYA 2LE8A 4AQFA 2JJLA 2XUEA 3U1AA 2V7LA 2KXPB 3PU3A 3HE4B 2QA7A 2ODUA 3KV9A 2L3LA 1HF8A 3IEEA 5H6RB 3HKCE 1O3XA 3HD7A 5KJ7C 3CL3D 2EHOC 4N78E 3L35A 2Y48B 4ANJA 4H9RC 3KQGA 5AVWB 2L5GB 3GHGB 1D0YA 5AW6B 5FXWA 2N1TC 1LT9B 3V2QA 3FXDB 4EAHA 2CPSA 1NH4A 3MKDA 4V1Av 5CCHD 5JDFA 1KZUB 2D0TA 3A2AA 1ZEEA 2HPLA 2H3RA 3IHRA 4EYYR 4CXWA 2QM7A 3U1CA 3H32B 4C46A 2W63A 4H63V 2IX7C 4PW8A 5DABA 3T97A 3K3NA 3HE5B 3C4WA 3RPUA 4AI6A 2Q9QD 2V26A 4HN9A 1DH3A 2C9LY 3CVRA 3C4ZA 2W6BA 2LOPA 2BVMA 1XTGB 2HPCB 1VOMA 2LSGA 3ZEFB 1H7CA 4I50E 2Z4EA 4P0BA 3ONXA 4M1PA 2O1KA 3I9WA 1VRBA 3M9BA 2CWYA 4BJNA 1IFDA 2W61A 2C0SA 2KLVA 4GT1A 5EZYE 4AUWA 2Q9QB 5APSA 1MMNA 5AW8B 1MFZA 5CHXA 1GW4A 5JRCA 2LHNA 3M06A 4LLHA 2WSCH 4KMCA 4UIGA 2VRSA 3SOLA 2W6AA 3I5CA 4H9SE 3MTUE 3A5XA 2MYSA 5JR9C 1LTJA 4KUMB 5HXEA 1UX4A 4G63A 2KINB 1LWUB 4I2LC 2JMHA 1KILA 3Q5XA 5FXZA 1WYBA 1HH0A 4ZS3A 4BAYB 1L4AD 3E22E 4UXNB 3EDUA 3D0TA 3FB2A 3VP8A 3HUSC 3I0OA 3CI9A 2OYHC 1J1EB 1GDTA 4QX7B 2CA5A 2ZMAA 2W00A 4O4JE 4K0UA 4PK4A 2YNYA 3AB3B 2X67A 1SP4A 3EFGA 2V1DB 3HTKA 3K3QC 1FZEA 3LK42 4L5GA 2J1DG 5AVXB 4AKRB 2OYIC 2KT9A 3EQ2A 3GA8A 2XU6A 2E8IA 1HWTC 3LBXB 1SQVK 1HJBA 4IDZA 5FY0A 3N4XA 5A1LA 1L4AB 1MV8A 3ZMTB 5LNKA 2IFMA 5CA0E 1SQBK 3UUMA 4O2BE 5L2LA 4W80A 2QGSA 5J2UE 2PAJA 4WY4A 3ZJ2A 1MMAA 2YEVC 2HODB 4TV8E 2XHEB 4AQFC 4CXXA 4GIWA 3FHNA 4UV8B 5KJ7D 4FJOA 3MGNA 2C5IT 2EHOD 2R3CA 3ANWB 5L3EB 2A45H 2HYNA 3JC6C 2N1GA 1H88A 2PFVA 3PUGA 3VMZA 3HKDE 4B86A 2ZM0A 5JDHA 4PFPA 3HD7C 3NTNA 2N1TD 3R2PA 1JO5A 3HA4A 1ZV4X 2X9XA 2H7VC 3CQXC 4CXYA 1N73B 1U4QA 4PJJA 3PP5A 2LT3A 3CMLA 1SLQA 4W7ZA 3M9QA 5BMVE 2IAKA 4I1LA 5LYJE 3FBZA 2V7JA 1FMWA 1T98A 2XDJA 2EHOB 3SRZA 3M9HA 2LSIA 3KVAA 3J7Yq 1YKEB 5APQA 5C8YE 4IIJE 1GTWA 2E9XA 3UUXB 2N1TB 3KFWX 3PURA 1HVVA 4JLEA 1RF1B 1LTSC 2XV5A 4CI1B 3OAKA 2KNDA 2NW9A 2XNXA 3QK6A 3PDYA 1BR0A 1JMMA 2M3BA 2BDEA 1YTZI 3NZQA 1N2DC 3CQCB 3N9LA 1GK6A 5LA6E 1ZR4A 2IFNA 4CI3B 3RX6A 1EZ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NMD A;  4DZO A;  5AW7 B;  4I2L C;  5AVV B;  4C46 A;  5AW3 B;  2QM8 A;  2WT7 B;  5AVR B;  1GU5 A;  1H88 A;  2ZFC A;  4GKG A;  1X8Y A;  1HUC A;  2Z5H A;  3NXS A;  3VMZ A;  3T97 A;  4B86 A;  4RES B;  3HE5 B;  3V4W A;  5AVU B;  3NTN A;  1GD2 E;  1A02 J;  1OXZ A;  1FOS F;  4XE5 B;  2XZR A;  1MUU A;  2YO2 A;  3VYI A;  1DH3 A;  1T2K C;  2C9L Y;  2YO3 A;  2E42 A;  2N2N A;  2H7H A;  5APT A;  1YYC A;  3B8E B;  2Q7C A;  4C7N B;  2P7J A;  2E43 A;  1J2J B;  1X79 A;  1GU4 A;  2IPP A;  1GK4 A;  4KHX A;  5AVZ B;  3V5B A;  2JJL A;  2N9B A;  2W27 A;  3UIA A;  4EOT A;  5AW0 B;  2R5D A;  4JYC A;  1CI6 B;  4HYT B;  1NWM X;  1NAF A;  1SLQ A;  2YNY A;  2KP8 A;  2Q3I A;  1FOS E;  1SP4 A;  2Z5I A;  3HE4 B;  5AW2 B;  3TNU B;  3TK1 A;  3VTP C;  3HTK A;  5AW5 B;  1KQL A;  2WPS A;  3M0A A;  1S9K E;  3VN0 A;  3A3Y B;  3M91 A;  2WTY A;  3A5T A;  1HBW A;  3M9B A;  5AVX B;  5APW A;  1IO4 A;  1O3X A;  3M9H A;  1H8A A;  5AVY B;  3KDP B;  2XU6 A;  1HWT C;  2R5B A;  3V4Q A;  2WT7 A;  1HJB A;  1T2K D;  5AVS B;  5APU A;  1CI6 A;  3NFQ A;  5APQ A;  2C9N Y;  1GTW A;  3L35 A;  1WR6 A;  1FAV A;  4GT1 A;  4AYC A;  1MV8 A;  3HE5 A;  4AQR D;  1JUN A;  4AUW A;  5APY A;  3KQG A;  5APS A;  5APV A;  3TYY A;  2R32 A;  5AVW B;  2XV5 A;  1WRD A;  3OAK A;  5AW6 B;  2WPQ A;  5AW8 B;  1MFZ A;  3L36 A;  2P67 A;  2WWW A;  4JYB A;  5AW1 B;  1NWQ A;  4I6M C;  3M06 A;  4C7N A;  1H89 A;  2VRS A;  3A7O A;  2WPR A;  4LC1 A;  1G2C B;  3VMX A;  1A02 F;  3L37 A;  1CSB A;  3VMY A;  3LID A;  2W6A A;  3MD0 A;  3IR9 A;  3A2A A;  3I5C A;  3O8Z A;  3P7K A;  1JNM A;  1OWA A;  5CMZ A;  4M3L A;  1YD8 G;  3P8M C;  2N9D A;  1CZQ A;  5APX A;  3HE4 A;  3TNU A;  5AW9 B;  3MGN A;  1GK6 A;  2ZXE B;  3M0D A;  2Q5U A;  2P2U A;  5AW4 B;  5AVT B;  2R3C A;  3P32 A;  2QM7 A;  3SWF A;  1GZL A;  1S9K D;  2BAS A;  3LIE A;  5AVQ B; 
#chains in the Genus database with same CATH topology
 1JY3 P;  2J62 A;  3AE1 A;  3S4U A;  4BJM A;  3L70 D;  1G2C A;  4TNV A;  4ZS2 A;  3Q5D A;  1YI2 P;  2DNX A;  2YKQ A;  2KZJ A;  1L0L K;  3WU2 E;  2OA5 A;  1IJ6 A;  1UGO A;  3MUD A;  2XZE A;  3AA7 B;  2KYV A;  2YO2 A;  1RY3 A;  1UIX A;  5AQL B;  4CN1 A;  4RO0 A;  5JTG A;  4ZI2 C;  3B8E B;  4HFC A;  3OJA B;  1YJ9 P;  3SFE A;  2P7J A;  2E43 A;  3IFM A;  1J1J A;  2X9W A;  2W4X A;  2UXD T;  1HNX T;  4EOT A;  2CBJ A;  4A7P A;  2R5D A;  4PD4 D;  3H1I E;  1EZV E;  2V8S V;  3R4Y A;  2V7Q J;  2YU2 A;  3CLQ A;  4PJM A;  3AE7 C;  4G2A A;  5H2F H;  2MPK A;  2GM4 A;  2BZB A;  5CBO A;  3TK1 A;  4JI0 T;  5JDN A;  5DQW A;  5KMG P;  2WPS A;  3Q2M A;  3OA7 A;  1T3J A;  2FXO A;  4JEH B;  2FYN C;  2K48 A;  2ZM8 A;  5APW A;  4KJM A;  1FU1 A;  1VQ4 P;  4JI6 T;  1XNQ T;  1LTJ C;  1OW6 A;  1L0L D;  2WM9 A;  3F5H A;  2BKP A;  3F2E A;  2I1J A;  3RL0 g;  5AQO B;  4AQG A;  3O1J A;  3AEG A;  2CWO A;  3Q2Y A;  3NBX X;  1KIL C;  3H1I G;  1EZV G;  3N2K E;  4GK5 E;  2XSA A;  4ZZB A;  3AXJ A;  4PNI A;  2KUB A;  2NTX A;  4K3A A;  1KV4 A;  4AQY T;  3FX0 A;  3KDS E;  3PUZ F;  2WMN A;  3L74 E;  4DND A;  3L36 A;  1X79 B;  3RK3 E;  4OFZ A;  4KT0 J;  2WWV A;  1OVV A;  3A7O A;  2CBI A;  2ZM2 A;  1YW0 A;  5AQJ B;  1CSB A;  5C39 A;  2YU1 A;  2UXX B;  2VB6 A;  4AKI A;  2YOE A;  2KWI B;  5HEH A;  3ZCJ A;  5AQT B;  5FXX A;  5APX A;  4X1Y E;  3JAE A;  3CWZ B;  3AE8 A;  2PBI A;  1UX5 A;  1SHZ C;  5B5E H;  3BAS A;  2FFD A;  4DR3 T;  4L0R A;  3L74 G;  1Y9B A;  4OGQ C;  3HUS B;  5KAF H;  3RBZ A;  2CXF A;  2WMO A;  2HPJ A;  3MIW A;  1YJW P;  2DLR A;  4C7R A;  2OYH B;  4HH2 A;  2O3J A;  5TIS E;  2NPS A;  1QVF O;  4DV2 T;  2OQQ A;  2WWU A;  3UQ7 A;  2BG9 B;  4LFB T;  4IL9 A;  3AEF C;  1NTK D;  5JDL A;  5L4H A;  2XAQ B;  2WSE H;  1Y01 A;  5FKY A;  4E7Z A;  2B76 A;  4AKH A;  4GKJ T;  2IPP A;  3N9P A;  3SFD A;  2OTL P;  1HX8 A;  2IIU A;  3E0Z A;  2W27 A;  3B5M A;  3I9Y A;  1E1H B;  4NPF X;  4Y28 J;  1XDP A;  3L72 D;  2FBW C;  2AXD S;  3GN5 A;  3OPC A;  1YIJ P;  3PHL A;  1ZP0 A;  2J4G A;  1PPJ D;  2OYI B;  2XAG B;  2XQ3 A;  4B3T T;  2W66 A;  4O4I E;  3JC6 D;  2C0W A;  3GG2 A;  4O4H E;  3HR0 A;  1JY2 N;  1RF0 A;  3M0A A;  3PUX F;  1BE3 E;  5ABF B;  1R5L A;  5E0O A;  1X0T A;  3HD7 D;  2M3E A;  2MBG A;  3X1D A;  1FS0 E;  4R4L A;  3UU6 A;  3K3O A;  1JB0 J;  5LHH B;  5LJN A;  1AVY A;  2ES0 A;  2PGD A;  1FIO A;  3UU8 A;  1ZN5 A;  3CX5 I;  3RKG A;  3L73 E;  4HWH A;  2XAS B;  1RQV A;  3BCC D;  3H1H E;  1KB9 I;  2K5B B;  4QXH B;  3N2O A;  2FJA A;  2IHR 1;  3RH3 A;  2WSS V;  2XQ7 A;  3VP9 A;  1BE3 G;  4I55 E;  5C2T A;  5LCY A;  2WIT A;  1YXR A;  2W62 A;  3TGU D;  3VMX A;  5CJ4 A;  2OTK E;  2ZVN B;  3L37 A;  3LW5 J;  1HJ0 A;  1OED A;  1QEX A;  1BCC D;  2LSY A;  3ZT5 A;  1FDM A;  2V4H A;  1N7S A;  4W7Y A;  4ZKP A;  4DV4 T;  2IW5 B;  2MTQ A;  3L73 G;  1NTM D;  1VL2 A;  4QH5 A;  5AVT B;  2YDQ A;  2F4V T;  1MND A;  3HD7 B;  2VAS A;  3H1H G;  2IML A;  4IRE A;  4O8S A;  2DHR A;  4ILU A;  5F8P A;  3E08 A;  2ZLY A;  4WBA A;  1W2B O;  4MHC A;  2E5Y A;  2I59 A;  5L47 A;  1RE4 A;  3KVB A;  1XTC C;  3EUH A;  2MKV A;  2XQ5 A;  4MLK A;  1EDL A;  4AIS A;  3PU8 A;  2WZ7 A;  2YIU B;  4DMV A;  3SS1 A;  1KYO H;  3VYI A;  4YHJ A;  2HHH T;  5CFB A;  1VQ5 P;  2E9X C;  1Z56 A;  1IFJ A;  5APT A;  2Q7C A;  1SQV J;  1KEY A;  1LJ2 A;  3PLN A;  4PJL A;  5M1B A;  5BU5 A;  4IFF A;  1MZ9 A;  2H43 A;  1BGY J;  4KHX A;  1EZV I;  2N9B A;  3RK2 C;  1H0T B;  1NWM X;  4TZ4 C;  1SQB J;  4YSZ A;  1VQM P;  2BEZ F;  2AE9 A;  1KNR A;  1SFC A;  1MNE A;  3H25 A;  3IA3 A;  2H89 C;  4JI7 T;  2H7O A;  4YJ2 E;  2RH0 A;  1NVO A;  5AW5 B;  2W8Z A;  4MFR A;  1KQF B;  1JY2 O;  4EEB A;  2E76 C;  4HKA A;  3PUQ A;  4ILB A;  4DR6 T;  3HRN A;  3NZP A;  3A5T A;  2FYU K;  1LTG C;  3QC9 A;  2XM2 A;  1I6Z A;  5HEJ A;  2VKO A;  1H8A A;  4ASW A;  1NEK A;  3OBV E;  2J59 M;  2P58 A;  3T97 B;  5CBN A;  2W6J H;  2WT7 A;  3OKQ A;  4EGW A;  3OYX A;  4IST A;  2IC9 A;  3WUT A;  2Z6E A;  1URQ A;  2AEJ A;  3C50 A;  1ZOY A;  2PRR A;  3U3I A;  3M3Z B;  3RLF F;  4O4L E;  4GYS A;  5LXT E;  3MUD C;  4EDF A;  1DU2 A;  1HCI A;  5KDM C;  1WMK A;  2D2C C;  4K0K T;  1FZA A;  3ZC0 A;  3VKG A;  2UXN B;  2O1J A;  1D1A A;  2BBH A;  4ADZ A;  3SFE C;  4WZX A;  4D6T D;  2GK9 A;  3TDK A;  4XBF B;  4NIQ A;  4XAX B;  2FYU D;  4XA4 A;  3P8C D;  3AE4 A;  2JMK A;  2WP9 A;  4HE8 A;  2L8K A;  3L8R A;  2QVA A;  5AW4 B;  3JCU E;  4YLH A;  3SWF A;  1IJD B;  3P32 A;  1LVF A;  3JAD A;  1N32 T;  2NWB A;  1NO4 A;  4DV0 T;  1KIL D;  5FYM A;  5TAO A;  1ZRT D;  5IUX A;  1HUC A;  2R3S A;  1MIV A;  1EQ7 A;  4H13 C;  2O01 N;  2VL8 A;  1PP9 D;  4UB8 E;  1YKH B;  5LJM A;  1LP1 A;  4JF7 A;  1JY3 N;  2BBJ A;  2QJY B;  4GIF A;  3RRW A;  5JRC B;  3AEG C;  4EIW A;  1K9M Q;  2K1A A;  1PL5 A;  4DVD A;  3JC2 2;  5CCG A;  3AE6 A;  3KPE A;  2V6Y A;  3ZYK A;  3L4F A;  3MJX A;  4TV9 E;  3AA1 B;  2YN6 A;  1KFN A;  1JEK A;  3BRT B;  4IFM A;  3P7I A;  3PV0 F;  1QGK B;  4HYT B;  1USD A;  4TNW A;  2FYN B;  2KP8 A;  4OWF A;  2E74 C;  2CLY C;  5HAX A;  2PG8 A;  3H1I J;  2CEA A;  2JWA A;  2M6B A;  3V5U A;  1NKN A;  4LMK A;  1LTJ B;  4UB6 E;  4OGQ D;  4H9N C;  4F6R C;  4CQI A;  1XWM A;  2LRK A;  1KIL B;  4AXP A;  2R5B A;  3V2N A;  2ZT9 C;  1L0N D;  1PV3 A;  3MHV A;  1VQN P;  3UU5 A;  3FBL A;  3ZYM A;  3ZCI A;  5ABG A;  4AQR D;  3ITK A;  4AKG A;  5APV A;  1IK9 A;  2E2A A;  3FWL A;  4NUU A;  3EVY A;  3RBX A;  5KKZ C;  4EYU A;  3G4S P;  3LW5 H;  2Y9Y A;  2NPS C;  2ODV A;  2J5U A;  2BS2 A;  2WWW A;  1NWQ A;  5L4E A;  3BQL A;  1TU3 F;  4C7N A;  2JIW A;  1L0V A;  4TWD A;  1Y47 A;  3BVH A;  1L0L J;  1VQ8 P;  1M56 D;  2B88 A;  4HJG H;  5AQN B;  3RRC A;  2E5V A;  1HF9 A;  3HKE E;  3OYZ A;  4IE4 A;  4DBR A;  1GL2 A;  4UEL A;  2VWA A;  2X9Y A;  3SFD C;  2FXM A;  3O8Z A;  1QLB A;  1L4A A;  4M3L A;  2W0G A;  1JCC A;  4QWN B;  4C90 A;  4UF0 A;  4X62 T;  2W90 A;  5AW9 B;  4OVN F;  4OGQ B;  2D0U A;  4DR4 T;  1ZP0 C;  2Q5U A;  2OYO A;  3L75 E;  2P2U A;  3TSI A;  2XY8 B;  4PK5 A;  1AV1 A;  3AE9 A;  2K3R A;  2V7K A;  2Q6Q A;  2YK0 A;  1VDF A;  1DD4 A;  1ZKE A;  1X22 A;  2KS1 A;  4IL6 X;  1SQQ D;  5AVV B;  1RF0 C;  3TLS A;  1EDK A;  2G3A A;  2RA1 A;  2HOD A;  3J9X 1;  4I43 B;  4IL4 A;  1WLX A;  1YTZ T;  1OMI A;  2HH7 A;  4MAL A;  4LFA T;  5L3C B;  3ZMV B;  5HEG A;  2I8D A;  4J2C A;  2YXQ B;  4X5T A;  5FP3 A;  4YT0 A;  3C4X A;  4IL6 H;  4OX9 T;  3AEB A;  3FXE A;  4TT3 H;  3ONL C;  2D5U A;  2LSK A;  1GU4 A;  1S35 A;  3L75 G;  4U3F E;  5JH7 E;  3IBP A;  4X64 T;  5AW0 B;  3UFE A;  2M8R A;  1CW5 A;  2XPK A;  3KBT A;  3H3M A;  2K88 A;  3ESL A;  4NXM T;  3DJB A;  4NPD A;  4X20 E;  2B89 A;  1R8I A;  5L3G B;  3I1A A;  1OED C;  2GUS A;  4BRY B;  3H1K E;  3MXZ A;  4H9P C;  1BGY E;  2RN0 A;  3GWH A;  1PIX A;  1N7S C;  3CQG B;  2FJD A;  3C1L A;  1N73 A;  1ZHC A;  1BE3 J;  2V7I A;  3KV4 A;  1Y64 B;  1T8B A;  4TLF A;  3WMM 0;  2HG5 D;  3LK2 B;  3L72 J;  2E9X D;  4U3F G;  1HGV A;  1QL1 A;  4H0L C;  2KSJ A;  1M1K Q;  3IF8 B;  5GTH H;  5HXS A;  4IE0 A;  3CX5 H;  1VQ6 P;  1RE4 C;  1K04 A;  3RK2 D;  1KB9 H;  4QXC B;  2K37 A;  3H37 A;  3LSV A;  3QB5 K;  3L73 J;  4CN4 A;  3UUB A;  1SQV G;  1VPC A;  3H1H J;  4JYB A;  1WYC A;  2JPF A;  5DJQ C;  2PFX A;  1BGY G;  2XQ6 A;  3AEE A;  1IFM A;  4LC1 A;  2YDS A;  1N33 T;  3AE3 A;  1SQX K;  2E76 D;  1DEE G;  2G8Y A;  3MD0 A;  4GOD A;  2IDB A;  4KP3 C;  3B57 A;  2N1T A;  4ZI3 C;  1FZF A;  1Q82 Q;  2LR2 A;  1RF1 A;  3P4R A;  1E7P A;  1S3J A;  2J47 A;  4I0U A;  3I55 P;  3NRX A;  1SFC C;  1GZL A;  1S9K D;  5LGU B;  2BAS A;  3LIE A;  2B9B A;  4I4T E;  2HR3 A;  4A5X A;  4YHH T;  3CKD A;  2CCQ A;  3O1I A;  2PJQ A;  5AVR B;  4UVC B;  4EZH A;  1SA0 E;  3NXS A;  2QSI A;  2E9X B;  5LGT B;  3TLV A;  1U5P A;  3WU2 H;  3V4W A;  1R8E A;  3KHU A;  2WAU A;  2XAF B;  4WB4 A;  1KNP A;  4A56 A;  1NGM B;  2XQA A;  1T3U A;  2OV9 A;  2D2C D;  3W15 B;  4YTP A;  4LF7 T;  2VK9 A;  3HKB E;  3RK2 B;  2W2U A;  2LJL A;  1URQ C;  1DIP A;  4HGA A;  5J2T E;  1ZOY C;  1J2J B;  5AVZ B;  2K9Y A;  1FJK A;  4U74 A;  1AA0 A;  1QX8 A;  2QJK C;  4JYC A;  4YSX A;  1CI6 B;  5CJ5 A;  3PUV F;  1MFT A;  2E76 B;  3KIN B;  1NU1 K;  3CCU P;  3AVS A;  2Z5I A;  3N9Q A;  3PE0 A;  3EFF K;  3O4X E;  5AQQ B;  2B1E A;  2UUC T;  3VTP C;  2P10 A;  1SQX E;  3CXH H;  1KQL A;  5KAI E;  1RE3 A;  3OTO T;  3GF7 A;  1FBM A;  2XQY A;  1PFI A;  1OW7 A;  3RYC E;  3AE4 C;  3RL0 C;  5GTI E;  2JJ9 A;  2LXB A;  1S2E A;  4H13 D;  2DI4 A;  4PV1 C;  1M1J A;  2SPZ A;  1LNQ A;  3L70 E;  5AVY B;  5AQR B;  3KDP B;  3M65 A;  3UT5 E;  1KFM A;  2KMF A;  5BU8 B;  4ZKU A;  5AVS B;  4YPC A;  4UVB B;  1BR2 A;  3MAC A;  4UV9 B;  1KMI Z;  2GUV A;  1J1D C;  3KV5 A;  3LG7 A;  3ZLI A;  4TWH A;  1EXJ A;  2D2C B;  2FXP A;  4U72 A;  3II6 A;  3KZI E;  1XDO A;  1VF5 D;  4KHP T;  1KF6 A;  1CUN A;  1SQX G;  3ETV A;  1RH5 B;  4PD4 E;  2E74 D;  3CXH D;  1NU1 D;  3UUL A;  1P84 H;  5CCG C;  3LJC A;  3ZMU B;  2JWD A;  1IBM T;  4EI2 A;  1EC5 A;  2DWK A;  3N9N A;  4OYK A;  1D1C A;  5JDQ A;  4KI0 F;  1PGP A;  3IR9 A;  4RJT A;  2O01 J;  1NJI Q;  3P7K A;  1NEN A;  4E7S A;  1JNM A;  1FZB A;  5CMZ A;  5J0Z A;  1VQP P;  3P8M C;  2QJP C;  3H1J D;  3N2G E;  1MKM A;  3TNU A;  5B66 E;  1W9R A;  2H88 A;  2HN1 A;  4YTM A;  4H44 C;  2ZT9 D;  3UU4 A;  1JTH A;  4WBO A;  3Q3D A;  1L0L E;  4H13 B;  2R44 A;  3CMA P;  2WBL A;  4DO0 A;  3CCE P;  1GU5 A;  1NTK K;  1PGJ A;  2JQH A;  3RYI E;  5M4Y A;  2KLU A;  1T72 A;  4CZZ B;  5JR9 B;  4JI5 T;  2A3D A;  4IE5 A;  5TIS H;  1P84 D;  2NPS D;  2BG9 E;  2UXC T;  1OXZ A;  4XE5 B;  2C0X A;  5F5W A;  5H2F E;  3VU7 H;  2WZH A;  1AJ3 A;  5LB7 B;  4IGU A;  2X66 A;  1VF5 B;  3BQI A;  1IC2 A;  1YYC A;  4LF4 T;  3BRV B;  4QHO A;  1FJG T;  3K8P C;  2E74 B;  4EYY Q;  2Y9Z A;  1BR1 A;  2CLY B;  2ACZ A;  2BVL A;  4ASK A;  3H3A A;  1L0L G;  4GOE A;  1KC8 Q;  2IYP A;  4IE6 A;  3C8V A;  5JQG E;  1M7L A;  3RYF E;  3AED A;  2I1K A;  1OZH A;  2OYH A;  3TLU A;  5AQM B;  1BR4 A;  2CRB A;  4HTE A;  1ZW0 A;  1GL2 C;  2BG9 A;  1FE6 A;  1MMD A;  2ZT9 B;  1L4A C;  3KYQ A;  3CCL P;  4LGD E;  4WW0 A;  2WSF J;  3N7N A;  4DV3 T;  5HXH A;  2WCA A;  3V2R A;  4HWC A;  1V9D A;  2QG4 A;  1W2E A;  1FZC A;  2X0Y A;  3GMA A;  1HTJ F;  5E79 H;  5LGN B;  4YFS A;  4LFC T;  4H63 H;  2WS3 A;  4GOU A;  3AE9 C;  1VCS A;  5APU A;  5KKZ B;  3B5N A;  1S94 A;  1LTI C;  4WY4 C;  1FAV A;  1YQ4 A;  4X1I E;  2NPS B;  2WSC J;  1XZY A;  1NTK E;  2I6H A;  1QL2 A;  2JO1 A;  4COF A;  4JI4 T;  1NTZ K;  2WPQ A;  2Q3E A;  3ZST A;  3DTO A;  2KLQ A;  2Q1K A;  4LF8 T;  2P67 A;  1M8O B;  3V5S A;  5LMN T;  1N34 T;  3L72 E;  3N9O A;  3AEB C;  1PPJ E;  1NTM K;  3GN5 B;  2IBZ D;  5FMN A;  4N3Y B;  2P1J A;  4A98 A;  3L71 D;  3NRY A;  1N7S D;  1YBK A;  3BAT A;  5HYA A;  3HE4 A;  4IFD K;  4HWI B;  3M0D A;  5DJU B;  2K3W A;  3ZN0 B;  2VUR A;  1BDC A;  1NAY A;  5FY1 A;  2XJ7 A;  1N86 A;  4H0L D;  3K5B A;  4DR5 T;  4WWI A;  3ZMZ B;  4DZO A;  1BSH A;  3L75 J;  2B87 A;  4P09 A;  1OW8 A;  4GKG A;  4L74 A;  5LOV E;  2VQE T;  4PAG A;  3L72 G;  5AQU B;  2MOZ A;  1NTZ D;  1N73 C;  1DD3 A;  1YIT P;  2NP9 A;  3WI3 A;  1T6A A;  3ABV A;  3BCC E;  3QOF A;  1PPJ G;  3BQK A;  4DBQ A;  2XAJ B;  5AFU L;  4N78 D;  3HI2 A;  4ILC A;  3O6Q B;  1IBK T;  1HR0 T;  1T2K C;  2JRK A;  2ZYG A;  5LHG B;  5HEU A;  1X9V A;  2E42 A;  2YIN A;  3GHG A;  1HG2 A;  3ZT7 A;  4B3S T;  3NKZ A;  1IFI A;  3D70 A;  4GYR A;  1LT9 A;  2A06 D;  3TGU E;  3RYH E;  2P9B A;  1GK4 A;  2JQK A;  4ZI3 D;  3FXD A;  2BCC D;  1HG5 A;  1OED B;  4N6J A;  4GK0 E;  1BCC E;  1N7L A;  1OVR A;  3CWB D;  2DCF A;  4U3F J;  1U7J A;  1SFC D;  2NW8 A;  2NR4 A;  4X1K E;  1FOS E;  1N7S B;  3AEE C;  3G9R A;  3QWO C;  1Q86 Q;  1NTM E;  4BA9 A;  3AE3 C;  2JP3 A;  2G0U A;  2CMR A;  4Z8X A;  3BCC G;  2N9Y B;  3B71 A;  2JEE A;  3S9O A;  1KTM A;  5KX5 E;  1KQG B;  3RF1 A;  4H0L B;  3H6P A;  2SPC A;  4GDO A;  1D7M A;  2KB7 P;  3H1K J;  2V7Q H;  3VRB A;  1RF1 C;  2XQ4 A;  2VVS A;  3AAE B;  3H32 A;  3PJS K;  5KLI B;  3V4Q A;  1H0T A;  1BSN A;  3TGU G;  2H8P D;  2LXC B;  3CX8 B;  2K9A A;  2HLO A;  3NVO A;  2C9N Y;  1URQ D;  3MZW B;  1WR6 A;  2KZ7 B;  3HE5 A;  1BCC G;  1KK7 A;  1HS7 A;  4OH8 B;  5APY A;  2DWG A;  3EI0 A;  3ZJ1 A;  2R32 A;  4DOJ A;  1WRD A;  1QSD A;  4PD4 I;  1NTM G;  3PUA A;  1S5L E;  4Z90 A;  3V2P A;  2LLY A;  4DR7 T;  3P50 A;  4YTP C;  5AW1 B;  2O01 H;  3VOP A;  1KYO D;  4U31 A;  2Y0C A;  4ZI7 E;  2C5J A;  3L3P A;  2HPC A;  1HGZ A;  4EB6 E;  1Z0P A;  5CCH A;  1ZV8 A;  1FMV A;  2IC6 A;  1SFC B;  4ZI2 D;  1G73 A;  3RL0 D;  4TN7 B;  3F31 A;  4UVA B;  1D0X A;  1CZQ A;  4PV1 D;  5ABE A;  3AE1 C;  2Y8D A;  3JCU H;  1QVG O;  4TX5 A;  5GON E;  4U7J A;  5AVQ B;  2RP4 A;  2FJB A;  3NMD A;  5AW7 B;  2A72 A;  5IYZ E;  1RE3 C;  1IFP A;  2QM8 A;  2WT7 B;  1SUM B;  2QA4 P;  2M67 A;  5FY7 A;  2Y6X A;  2L9Q A;  1URQ B;  1M1J C;  4UB8 H;  3D6Z A;  3Q5R A;  2XQ9 A;  2W83 C;  1YJN P;  1W0A A;  2CXD A;  2LKH A;  3G3Z A;  2X0H A;  3FZK B;  2NW7 A;  3GLM A;  2LRL A;  2Q9Q A;  1WR0 A;  5CCG D;  1HNZ T;  2ZYA A;  2V7M A;  2XTL A;  2J58 A;  2QE7 H;  1KFY A;  5HXR A;  4D6T E;  1GW3 A;  2BS3 A;  1ZME C;  5L8R J;  3C51 A;  2FYU E;  4H44 D;  3P8C E;  4YXW H;  4EIJ A;  3RL0 B;  2WSF H;  2IDO B;  2CPB A;  3A0B E;  4UB6 H;  3HL6 A;  4PV1 B;  3R6N A;  1L0N K;  1KN7 A;  2NZ2 A;  4NPE A;  3FZH B;  2WTY A;  1AVO A;  1KIL E;  2PP6 A;  1HBW A;  4KX6 A;  3T1H T;  1ZRT E;  3RIA A;  1SQX J;  2H88 C;  1J1D B;  3AA6 B;  4ZXL A;  1LTA C;  1Q81 Q;  1LWU A;  2KNC A;  1LRZ A;  2QRX A;  3FGA D;  4BWN A;  1PP9 E;  1HX1 B;  3H1L D;  3L70 J;  5JDM A;  4D6T G;  4PK6 A;  3JCF A;  5LG3 A;  1LP1 B;  4JEU B;  3VR9 A;  2FYU G;  2XSB A;  3LK3 B;  1LTT C;  3AA0 B;  1US7 B;  1PGO A;  2V6Y B;  1G1I A;  4MN4 C;  1S1C X;  3ZMS B;  2WDQ A;  4I6M C;  4UEM A;  2FKW B;  2QJP B;  1SVF A;  2UUB T;  3AE8 C;  1SQP K;  1Q90 D;  1GL2 D;  3ZPO A;  2M5A A;  1OX3 A;  1WT6 A;  4H44 B;  5EK4 A;  2FFD C;  3N9M A;  4ZMD A;  4PJ0 E;  2K9J A;  1SQQ K;  1OWA A;  1SE7 A;  1MIW A;  3Q5W A;  3RK3 C;  2N9D A;  2VKH A;  5LMU T;  1E79 H;  3AED C;  2ZXE B;  1LKX A;  4QXB B;  4ASV A;  3T8O A;  2YMY A;  3RC8 A;  4H9O C;  4P1N A;  3SWK A;  4WY4 D;  5ADX L;  1L0N E;  1NU1 J;  3L09 A;  2ZFC A;  1JY2 P;  1X8Y A;  5CJ0 A;  3LBX A;  4XZC A;  4RKU J;  3TKL B;  1FZC C;  3I0Q A;  3HTK B;  3WAK A;  2X9H A;  4H9Q C;  3B5N C;  4WBN E;  1QUU A;  1AQ5 A;  2ZVO B;  3LFM A;  2JQQ A;  2N2N A;  3G06 A;  3QNU A;  2LKM A;  4NPP A;  1SQP D;  2R6G F;  1OFC X;  4C7N B;  3FZF B;  1D0Z A;  3EAM A;  1JCD A;  5AQK B;  2ZM6 T;  5JVD E;  3V5B A;  1U7M A;  1FC2 C;  3PUS A;  3UIA A;  1WCR A;  3CPZ A;  2IYO A;  4Y99 C;  3L39 A;  2WU5 A;  1GL2 B;  2XKM A;  1NAF A;  1L0N G;  3PH0 A;  3KV6 A;  4L9I A;  4UF0 B;  3N5L A;  4L73 A;  5LBM A;  2Q3I A;  5AW2 B;  4JBZ A;  1JY3 O;  4JI1 T;  5KLV K;  4EZ4 A;  4ZHQ E;  2DW3 A;  1SQQ E;  3G6E P;  1D1B A;  5FNV E;  3U78 A;  2AXT H;  2KS1 B;  4WY4 B;  4DUZ T;  5FVK A;  3SSU A;  3ANW A;  3ETU A;  2CK3 H;  2CXL A;  3M0D C;  2Q9I A;  4L75 A;  3CX6 B;  2A2F X;  1E5W A;  2I0M A;  4O9B A;  1T2K D;  2XAH B;  3P4W A;  3NFQ A;  4DR2 T;  2WY2 A;  5HWX A;  2D9D A;  4AYC A;  1KD1 Q;  3TLT A;  3MZK B;  1AQT A;  2Y0D A;  2WQY A;  1MMG A;  3FXE B;  3S1K A;  5IHY A;  3ABV C;  1NTK J;  3D6Y A;  1ZLL A;  5JDG A;  3U59 A;  4WNK A;  3GF3 A;  3AEA A;  5KTB A;  1BDD A;  2OAR A;  2OTJ P;  1LGH B;  1SQQ G;  1H89 A;  5CA1 E;  3GHG C;  1CHU A;  3VRA A;  1A02 F;  1SQB D;  2RPA A;  1LT9 C;  2ZAE B;  5KLV D;  4DV6 T;  3RKO A;  1NHL A;  4U7I A;  4PJN A;  3GMI A;  2HFE D;  4IDN A;  3ONJ A;  2LSJ A;  5KJ7 A;  1HNW T;  3VR8 A;  1HFA A;  4IL6 E;  2IZ1 A;  5LHI B;  2LM9 A;  2EHO A;  1T8Z A;  4CPG A;  3H1K G;  1IJ5 A;  2KZI A;  2CE7 A;  4P0A A;  1K8A Q;  3K1S A;  2FYZ A;  4JUY A;  1VQK P;  1GD2 E;  4JQ0 D;  2M6I A;  2AEF A;  1A02 J;  1FOS F;  1Y8A A;  2XZR A;  5FVL A;  3QUJ A;  1IAP A;  3RC3 A;  5AQF B;  1IFN A;  4LML A;  3BCC J;  2KI7 B;  2V5D A;  5DQV A;  4ERR A;  1G1J A;  4CN6 A;  4GKK T;  2H7H A;  5BVZ A;  3CX5 D;  4EOZ B;  1MIY A;  3AVR A;  5FXV A;  2LHR A;  1KB9 D;  3OW2 O;  1NOH A;  4AIU A;  4YTN A;  2WMM A;  3TGU J;  1USE A;  4OK0 A;  1XMQ T;  3QH9 A;  3A0H E;  2A45 G;  1NTZ J;  2VKD A;  4IDP A;  1BCC J;  4QKN A;  4KBM B;  5L3D B;  2ACX A;  5GTH E;  3O9X A;  4DMW A;  5CCH C;  4K35 A;  1S9K E;  1N8R Q;  5GTI H;  5EK2 A;  3CCS P;  1NTM J;  2CM0 A;  2BEQ D;  1IO4 A;  2NTY A;  1LT1 A;  5L3B B;  3P4P A;  3AAI A;  2KWH A;  4B6X A;  2BCC J;  3F57 A;  3VKH A;  1W0B A;  1CI6 A;  1FJP A;  4NUV A;  2BKN A;  1WFD A;  2WU2 A;  5LBQ B;  3ZC1 A;  5C3J A;  3RGU A;  3CPW O;  3KBU A;  3KZI H;  3WAJ A;  3CX7 B;  3Q5P A;  2YKO A;  1LVK A;  3TYY A;  2YKP A;  1IBL T;  2ZYD A;  4IT4 A;  4TUY E;  3R84 B;  5JRE A;  4PD4 H;  2FUP A;  4HEA A;  3AE5 A;  2Q9Q C;  3OJA A;  4HFI A;  3E1I A;  2WPR A;  1G2C B;  1IK7 A;  1FEW A;  3VMY A;  3LID A;  5ETW A;  3ZDM A;  2NOX A;  5HWY A;  1HTL C;  3H1I D;  1EZV D;  3Q9D A;  4CI2 B;  5B66 H;  3QB5 A;  1YD8 G;  2IZ0 A;  4YJ3 E;  4YXD A;  1T7S A;  2C5K T;  1M7K A;  1OVU A;  4HFH A;  4DR1 T;  1VQL P;  1IZN B;  4DCK A;  1DX7 A;  2CPT A;  4JPZ B;  3P4S A;  1M1J B;  2QJY C;  3MK7 C;  1FZG A;  4O2A E;  5AW3 B;  1VQO P;  2Z5H A;  3AE6 C;  1U57 A;  5H6Q B;  4RES B;  3RIU A;  4ISS A;  2X0L B;  3L70 G;  1LWU C;  2DL1 A;  3CC7 P;  4IE7 A;  4I7Z C;  2YO3 A;  2FJE A;  1UCU A;  3CXH E;  4GOF A;  2QIW A;  1NU1 E;  4IOI H;  1Q7Y Q;  1X79 A;  4QH1 A;  3RI5 A;  3BK9 A;  3L74 D;  3PUY F;  2WSS H;  5CGM A;  3RK3 D;  4ZOL E;  2AXC A;  2LOS A;  3AAA B;  3IF4 A;  4QX8 B;  2QEX P;  3H1J E;  3JSV C;  1G8X A;  1FDI A;  1J1E C;  5JR9 A;  4D6T J;  4JI3 T;  2UU9 T;  1M90 Q;  3TNU B;  3AXJ B;  5HXC A;  2FYU J;  1LTB C;  3JAF A;  4C91 A;  1JTH B;  1S4X A;  3VN0 A;  3A3Y B;  3M91 A;  1S72 P;  5KXJ A;  3MA9 A;  4MBQ A;  3F89 A;  3PUW F;  3B13 A;  2X51 A;  1NU1 G;  1UII A;  4EV6 A;  1P84 E;  3B5N D;  2YXR B;  2VKJ A;  3HUS A;  3AEC A;  5J1G A;  2WDV A;  3UUN A;  1JUN A;  3FZM B;  5L3F B;  5LP6 E;  4U2Z A;  3NWI A;  1PP9 J;  3H1J G;  5LG4 A;  5AQV B;  4EED A;  2KOG A;  3RHW A;  3WUU A;  3O1H A;  3P4Q A;  4DV1 T;  4HFV A;  2FFD B;  1XMO T;  3C64 A;  3ZN1 B;  4PFO A;  3VHL A;  5F3J A;  4A97 A;  3RK3 B;  4R4M A;  4X65 T;  2POH A;  3G71 P;  1JOC A;  3CCM P;  1WRG A;  4FI5 A;  2K24 A;  3UTK A;  2WZI A;  4EXT A;  1KNZ A;  3H1L J;  4OHF A;  2D2S A;  3CK6 A;  3C9I A;  3C98 B;  3SWH A;  1B7T A;  1JMB A;  1XNR T;  2OYI A;  3D71 A;  1AFO A;  3Q1M A;  1NKZ B;  1K73 Q;  3PTR B;  3MP7 B;  5ABF A;  2A45 I;  1FZC B;  2LEH A;  4XFJ A;  1BE3 D;  5HCJ A;  4IHJ E;  4X66 T;  5B5E E;  3DP7 A;  3RGL A;  1YQ3 A;  5CB4 E;  3ZYL A;  1DEB A;  2MJZ A;  3B5N B;  3EDV A;  3AE2 A;  5EK3 A;  5KAF E;  1L0N J;  4DV5 T;  2E5T A;  5AVU B;  3UQ4 A;  4ILA A;  1ZR2 A;  2X68 A;  1FDO A;  4OYJ A;  4HFE A;  1MUU A;  4UR9 A;  4Y99 B;  4AKL A;  3L73 D;  3A8Y C;  3GW6 A;  2IUB A;  5DJT B;  3V6I A;  1NTK G;  3H1H D;  3SWY A;  1OED E;  1YHQ P;  2WQY C;  3E1R A;  2IBZ E;  4YY3 T;  4LF6 T;  2LE8 A;  4AQF A;  2JJL A;  2A9U A;  5E79 E;  3L71 E;  3CD6 P;  4HB1 A;  2XUE A;  3U1A A;  2V7L A;  3AEA C;  5HCM A;  2KXP B;  2OGU A;  3PU3 A;  3HE4 B;  2QA7 A;  2ODU A;  3KV9 A;  2L3L A;  4IDQ A;  3O6Q A;  1HF8 A;  3WUV A;  3IEE A;  5AQI B;  5H6R B;  3I56 P;  1SQP J;  3HKC E;  1O3X A;  3HD7 A;  2B87 B;  3TF5 A;  5IWA T;  1S5L X;  5KJ7 C;  3CL3 D;  1SQQ J;  4IDO A;  1NTZ E;  2VQF T;  5ABH A;  2IBZ G;  2EHO C;  4JBW F;  4DJG A;  4QH4 A;  4N78 E;  3L35 A;  2Y48 B;  4ANJ A;  3L71 G;  2XM1 A;  1E2A A;  4H9R C;  3KQG A;  5AQS B;  2Y0E A;  5AVW B;  2VL0 A;  4HWF A;  2QYW A;  2L5G B;  3GHG B;  3S4R A;  1D0Y A;  2E75 C;  5FL0 A;  2A06 E;  5AW6 B;  1S5L H;  2WDR A;  5FXW A;  2N1T C;  1LT9 B;  4TWF A;  2BCC E;  2FY8 A;  3V2Q A;  3FXD B;  4EAH A;  3CWB E;  2CPS A;  4KHZ F;  1NH4 A;  3MKD A;  4V1A v;  2AEM A;  4U33 A;  5CCH D;  4DID B;  1JNZ A;  5JDF A;  1KZU B;  2D0T A;  3A2A A;  1NTZ G;  2BKO A;  2RKL A;  3OVU A;  1ZEE A;  2HPL A;  2H3R A;  3IHR A;  4EYY R;  4U2Y A;  1EDJ A;  4CXW A;  2QM7 A;  3U1C A;  2A06 G;  3H32 B;  4LMJ A;  3W67 A;  2XND H;  4C46 A;  2UWJ E;  2W63 A;  4H63 V;  2IX7 C;  2BCC G;  5EFW B;  4PW8 A;  5DAB A;  4BXL A;  2JKV A;  4ZZC A;  3T97 A;  4B3R T;  3PJA A;  3K3N A;  3CWB G;  5KLV J;  3HE5 B;  3C4W A;  3RPU A;  1AJY A;  2UXB T;  4AI6 A;  2CHN A;  2Q9Q D;  2V26 A;  4HN9 A;  3CXH I;  3UU3 A;  1DH3 A;  2C9L Y;  3CVR A;  3C4Z A;  2W6B A;  4JYA T;  1KYO E;  2LOP A;  2M0B A;  2BVM A;  4ZNC A;  1XTG B;  2HPC B;  1VOM A;  3RQW A;  2LSG A;  3ZEF B;  1H7C A;  3CCQ P;  3AE5 C;  2W67 A;  4I50 E;  2Z4E A;  3A0B H;  3EWK A;  2E5L T;  4P0B A;  3ONX A;  4M1P A;  2O1K A;  3I9W A;  3ZSS A;  2QJK B;  1M62 A;  1VRB A;  3M9B A;  4YXD C;  2MAW A;  2OLT A;  3EAB A;  2CWY A;  4BJN A;  4NXN T;  1P84 I;  2KIK A;  4U7Y A;  1IFD A;  3IN6 A;  2W61 A;  1UUS A;  2C0S A;  2KLV A;  4HFD A;  4HKZ H;  4GT1 A;  5EZY E;  1Q2N A;  1K05 A;  4AUW A;  1UK5 A;  5APS A;  2Q9Q B;  1MMN A;  3RIU C;  1RQU A;  5AW8 B;  5TJH A;  1MFZ A;  5CHX A;  1GW4 A;  5JRC A;  3PRJ A;  2ITA A;  4ZEY A;  3CCR P;  2LHN A;  3M06 A;  4LLH A;  2WSC H;  4KMC A;  4UIG A;  2VRS A;  3AE7 A;  3SOL A;  4L76 A;  4PJ0 H;  2W6A A;  1JM0 A;  3I5C A;  4H9S E;  3MTU E;  3A5X A;  4JI2 T;  2HN2 A;  2MYS A;  5JR9 C;  2JQ9 A;  4HWD A;  1LTJ A;  4KUM B;  5HXE A;  1UX4 A;  4G63 A;  2KIN B;  1PZQ A;  1LWU B;  4I2L C;  2XQ8 A;  2KNC B;  2JMH A;  2BS4 A;  1KIL A;  3H1L E;  1VF5 C;  3Q5X A;  5FXZ A;  2L91 A;  3FWN A;  4I7Z B;  2KK7 A;  3FZL B;  1WYB A;  1HH0 A;  4ZS3 A;  4BAY B;  2JDI H;  1L4A D;  4WVZ A;  3E22 E;  4UXN B;  3EDU A;  1NYH A;  3D0T A;  3CIR A;  2PTF A;  4LF9 T;  3FB2 A;  1SS1 A;  3VP8 A;  1PP9 G;  3HUS C;  3CME P;  2YMK A;  3AEC C;  3RQU A;  1VCT A;  3I0O A;  3CI9 A;  2IBZ I;  2OYH C;  1J1E B;  1GDT A;  4QMA A;  4QX7 B;  2CA5 A;  4Q25 A;  2ZMA A;  2W00 A;  2V6X A;  4O4J E;  2BG9 C;  4K0U A;  2M5A B;  4PK4 A;  5AQP B;  1L2P A;  2K9J B;  2YNY A;  3H1L G;  3AB3 B;  2VVN A;  2X67 A;  1SP4 A;  2KSR A;  3ZKR A;  2RMZ A;  3EFG A;  2V1D B;  5FL1 A;  3HTK A;  3H1J J;  4B3M T;  3K3Q C;  1FZE A;  1UUR A;  3IAO A;  1YQ4 C;  3RIF A;  3LK4 2;  4L5G A;  2J1D G;  3KXD A;  5AVX B;  4AKR B;  4WYV A;  2OYI C;  2KT9 A;  3EQ2 A;  5BR8 T;  3L75 D;  3GA8 A;  3L74 J;  2LKG A;  2XU6 A;  2E8I A;  1HWT C;  3LBX B;  1SQV K;  1W5C E;  1HJB A;  4IDZ A;  4Z91 A;  1W09 A;  2YKS A;  5FY0 A;  3N4X A;  3UFG A;  5A1L A;  1L4A B;  3AEF A;  4LF5 T;  1YQ3 C;  1MV8 A;  2ZJS E;  3ZMT B;  5LNK A;  2IFM A;  3AE2 C;  1SQP E;  5CA0 E;  1SQB K;  3ZT6 A;  3UUM A;  1VQ9 P;  2JR8 A;  4O2B E;  5L2L A;  4W80 A;  2QGS A;  2FBW A;  5J2U E;  2PAJ A;  4WY4 A;  3ZJ2 A;  1MMA A;  1GMJ A;  1RHZ B;  2HOD B;  2YEV C;  3LDQ B;  1I94 T;  4U3F D;  1J5E T;  4TV8 E;  2WPV B;  3VMA A;  3EHZ A;  2XHE B;  4AQF C;  4CXX A;  4GIW A;  3FHN A;  4DV7 T;  1OIP A;  2WVR A;  4UV8 B;  5KJ7 D;  4FJO A;  3MGN A;  4BRY A;  2C5I T;  2EHO D;  2R3C A;  1SQV D;  1SQP G;  3H1K D;  3ANW B;  5L3E B;  2A45 H;  1BGY D;  3USS A;  2HYN A;  3CCV P;  3JC6 C;  1N36 T;  2N1G A;  1H88 A;  2PFV A;  1X9B A;  3PUG A;  4DUY T;  2UUA T;  3VMZ A;  3HKD E;  4B86 A;  2E75 D;  1EXI A;  1R5S A;  2ZM0 A;  4PFP A;  5JDH A;  3HD7 C;  3NTN A;  2N1T D;  3PTZ A;  3A7M A;  3CC4 P;  2WB5 A;  1M57 D;  3R2P A;  1JO5 A;  3HA4 A;  1SQV E;  2KSE A;  3Q5E A;  1KYO I;  1ZV4 X;  2X9X A;  2H7V C;  4HFB A;  2GA1 A;  3CQX C;  4CXY A;  3B4S A;  1PGQ A;  1N73 B;  1GQE A;  2AXT E;  1U4Q A;  2YIU C;  4PJJ A;  2LM2 A;  1SQB E;  5KLV E;  1J5W A;  3PP5 A;  2CHO A;  3A0H H;  1EDI A;  1VQ7 P;  4F8H A;  2LT3 A;  2WSE J;  3CML A;  1SLQ A;  4W7Z A;  3TLW A;  3M9Q A;  5BMV E;  2IAK A;  3L71 J;  4I1L A;  3CCJ P;  5AQG B;  3E7K A;  5K5G B;  2YDR A;  5KLI C;  5LYJ E;  1ZXG A;  3FBZ A;  4Z1M H;  2V7J A;  1FMW A;  1T98 A;  2XDJ A;  2EHO B;  1KOR A;  3SRZ A;  3M9H A;  2V5C A;  4U3C A;  2LSI A;  1Z8U A;  3KVA A;  3J7Y q;  1YKE B;  2E75 B;  5APQ A;  1SQB G;  5C8Y E;  4IIJ E;  5KLV G;  1GTW A;  2E9X A;  2N1T B;  3UUX B;  3KFW X;  3PUR A;  1HVV A;  4JLE A;  3Q5S A;  1RF1 B;  1KQS O;  1LTS C;  5KAI H;  3CX5 E;  2XV5 A;  4CI1 B;  3OAK A;  2KND A;  5HEO A;  2NW9 A;  3T1Y T;  4JI8 T;  1KB9 E;  2NRG A;  3W68 A;  1QLE D;  3CC2 P;  2XNX A;  1JNR A;  3QK6 A;  2H89 A;  3PJA J;  3CWB J;  3PDY A;  1BR0 A;  1JMM A;  2M3B A;  2ZXX A;  4YSY A;  2BDE A;  1YTZ I;  3NZQ A;  4DT0 A;  1N2D C;  3CQC B;  4JV5 T;  5AQH B;  3N9L A;  1GK6 A;  5LA6 E;  1ZR4 A;  2IFN A;  4CI3 B;  1SQX D;  3RX6 A;  1EZ3 A; 
#chains in the Genus database with same CATH homology
 1JY3 P;  3S4U A;  4BJM A;  4ZS2 A;  1G2C A;  2DNX A;  2YKQ A;  1L0L K;  2OA5 A;  1IJ6 A;  3MUD A;  3AA7 B;  2KYV A;  2YO2 A;  1RY3 A;  4ZI2 C;  3B8E B;  3OJA B;  2P7J A;  2E43 A;  3IFM A;  2X9W A;  4EOT A;  2R5D A;  2YU2 A;  3CLQ A;  4PJM A;  4G2A A;  2GM4 A;  2BZB A;  3TK1 A;  5JDN A;  5DQW A;  5KMG P;  2WPS A;  3Q2M A;  3OA7 A;  1T3J A;  4JEH B;  2K48 A;  2ZM8 A;  5APW A;  1FU1 A;  1LTJ C;  2WM9 A;  3F2E A;  2I1J A;  4AQG A;  3O1J A;  2CWO A;  3NBX X;  1KIL C;  3N2K E;  4GK5 E;  4PNI A;  2NTX A;  3KDS E;  2WMN A;  4DND A;  3L36 A;  1X79 B;  4OFZ A;  3A7O A;  2ZM2 A;  1YW0 A;  1CSB A;  2YU1 A;  2UXX B;  2VB6 A;  4AKI A;  2KWI B;  3ZCJ A;  5FXX A;  5APX A;  4X1Y E;  3CWZ B;  2PBI A;  1UX5 A;  1SHZ C;  3BAS A;  2FFD A;  4L0R A;  3HUS B;  2WMO A;  2CXF A;  2HPJ A;  3MIW A;  2DLR A;  4C7R A;  2OYH B;  4HH2 A;  2NPS A;  2WWU A;  5JDL A;  2XAQ B;  2WSE H;  4E7Z A;  4AKH A;  2IPP A;  3N9P A;  1HX8 A;  3E0Z A;  2W27 A;  3I9Y A;  1E1H B;  3GN5 A;  2OYI B;  2XAG B;  4O4I E;  3JC6 D;  2C0W A;  4O4H E;  3HR0 A;  1JY2 N;  1RF0 A;  3M0A A;  5E0O A;  3HD7 D;  2MBG A;  3K3O A;  5LHH B;  5LJN A;  2ES0 A;  1FIO A;  1ZN5 A;  2XAS B;  2K5B B;  4QXH B;  3N2O A;  3RH3 A;  2WSS V;  4I55 E;  3VP9 A;  5LCY A;  2WIT A;  2W62 A;  3VMX A;  5CJ4 A;  3L37 A;  2LSY A;  1FDM A;  1N7S A;  4W7Y A;  4ZKP A;  2IW5 B;  2MTQ A;  5AVT B;  1MND A;  3HD7 B;  2VAS A;  4O8S A;  2DHR A;  4ILU A;  5F8P A;  3E08 A;  2ZLY A;  4WBA A;  4MHC A;  2I59 A;  1RE4 A;  3KVB A;  1XTC C;  3EUH A;  4MLK A;  3PU8 A;  2WZ7 A;  4DMV A;  3SS1 A;  3VYI A;  4YHJ A;  2E9X C;  1Z56 A;  1IFJ A;  5APT A;  2Q7C A;  4PJL A;  5BU5 A;  4IFF A;  1MZ9 A;  2H43 A;  4KHX A;  2N9B A;  3RK2 C;  1NWM X;  4TZ4 C;  1SFC A;  1MNE A;  2H7O A;  4YJ2 E;  5AW5 B;  4MFR A;  1JY2 O;  4HKA A;  3PUQ A;  3HRN A;  3NZP A;  3A5T A;  2FYU K;  1LTG C;  3QC9 A;  2VKO A;  1H8A A;  3OBV E;  2J59 M;  2WT7 A;  3OKQ A;  3OYX A;  4IST A;  2IC9 A;  2Z6E A;  1URQ A;  3C50 A;  3U3I A;  4O4L E;  4GYS A;  5LXT E;  1HCI A;  5KDM C;  1FZA A;  3ZC0 A;  3VKG A;  2UXN B;  2O1J A;  1D1A A;  4ADZ A;  2GK9 A;  4XBF B;  4XAX B;  4XA4 A;  3P8C D;  2JMK A;  4HE8 A;  2L8K A;  5AW4 B;  4YLH A;  3SWF A;  1IJD B;  3P32 A;  1LVF A;  2NWB A;  1NO4 A;  1KIL D;  5FYM A;  5TAO A;  1HUC A;  1MIV A;  1EQ7 A;  2VL8 A;  1YKH B;  5LJM A;  4JF7 A;  1JY3 N;  4GIF A;  3RRW A;  5JRC B;  4EIW A;  4DVD A;  5CCG A;  3KPE A;  3ZYK A;  3L4F A;  3MJX A;  4TV9 E;  3AA1 B;  1KFN A;  3BRT B;  4IFM A;  3P7I A;  4HYT B;  2KP8 A;  5HAX A;  2CLY C;  2PG8 A;  2CEA A;  3V5U A;  1NKN A;  1LTJ B;  4H9N C;  4F6R C;  4CQI A;  1KIL B;  4AXP A;  2R5B A;  3V2N A;  3FBL A;  3ZYM A;  3ZCI A;  4AQR D;  4AKG A;  5APV A;  1IK9 A;  4NUU A;  3EVY A;  4EYU A;  3LW5 H;  2ODV A;  2NPS C;  2WWW A;  1NWQ A;  3BQL A;  4C7N A;  3BVH A;  3RRC A;  3HKE E;  4IE4 A;  3OYZ A;  4DBR A;  1GL2 A;  4UEL A;  2VWA A;  2X9Y A;  2FXM A;  3O8Z A;  1L4A A;  4M3L A;  2W0G A;  1JCC A;  4QWN B;  4C90 A;  4UF0 A;  5AW9 B;  2D0U A;  2Q5U A;  2P2U A;  3TSI A;  4PK5 A;  2V7K A;  2YK0 A;  1ZKE A;  1VDF A;  5AVV B;  1RF0 C;  2RA1 A;  2HOD A;  3J9X 1;  4I43 B;  1WLX A;  1YTZ T;  2HH7 A;  4MAL A;  5L3C B;  3ZMV B;  5FP3 A;  4J2C A;  3C4X A;  2D5U A;  2LSK A;  1GU4 A;  1S35 A;  5JH7 E;  3IBP A;  5AW0 B;  3UFE A;  2M8R A;  1CW5 A;  3KBT A;  3ESL A;  3DJB A;  4X20 E;  5L3G B;  3I1A A;  2GUS A;  3MXZ A;  4H9P C;  3GWH A;  1N7S C;  3CQG B;  1N73 A;  1ZHC A;  2V7I A;  3KV4 A;  1Y64 B;  3WMM 0;  2HG5 D;  3LK2 B;  2E9X D;  1HGV A;  1QL1 A;  2KSJ A;  3IF8 B;  5HXS A;  4IE0 A;  1RE4 C;  3RK2 D;  4QXC B;  3H37 A;  1VPC A;  4JYB A;  1WYC A;  2JPF A;  5DJQ C;  1IFM A;  4LC1 A;  1SQX K;  3MD0 A;  4KP3 C;  3B57 A;  2N1T A;  4ZI3 C;  1FZF A;  1RF1 A;  3NRX A;  1SFC C;  1GZL A;  1S9K D;  5LGU B;  2BAS A;  3LIE A;  4I4T E;  3CKD A;  2CCQ A;  3O1I A;  2PJQ A;  5AVR B;  4UVC B;  4EZH A;  1SA0 E;  3NXS A;  2E9X B;  5LGT B;  1U5P A;  3V4W A;  2WAU A;  2XAF B;  4WB4 A;  4A56 A;  1T3U A;  3W15 B;  2VK9 A;  3HKB E;  3RK2 B;  2LJL A;  1URQ C;  4HGA A;  5J2T E;  1J2J B;  5AVZ B;  1FJK A;  4U74 A;  4JYC A;  1CI6 B;  3KIN B;  1NU1 K;  3AVS A;  2Z5I A;  3N9Q A;  3PE0 A;  3O4X E;  2B1E A;  3VTP C;  1KQL A;  1RE3 A;  1FBM A;  2XQY A;  1PFI A;  3RYC E;  3RL0 C;  2JJ9 A;  2DI4 A;  1M1J A;  5AVY B;  3KDP B;  3M65 A;  3UT5 E;  1KFM A;  2KMF A;  5BU8 B;  4ZKU A;  5AVS B;  4UVB B;  1BR2 A;  3MAC A;  4UV9 B;  2GUV A;  1J1D C;  3KV5 A;  3LG7 A;  3ZLI A;  4U72 A;  3II6 A;  1CUN A;  3ETV A;  3UUL A;  5CCG C;  3LJC A;  3ZMU B;  2DWK A;  3N9N A;  4OYK A;  1D1C A;  5JDQ A;  3IR9 A;  3P7K A;  4E7S A;  1JNM A;  1FZB A;  5CMZ A;  3P8M C;  3N2G E;  3TNU A;  1JTH A;  4WBO A;  2WBL A;  4DO0 A;  1GU5 A;  1NTK K;  3RYI E;  5M4Y A;  4CZZ B;  5JR9 B;  2A3D A;  4IE5 A;  2NPS D;  1OXZ A;  4XE5 B;  2C0X A;  3VU7 H;  1AJ3 A;  4IGU A;  2X66 A;  3BQI A;  1IC2 A;  1YYC A;  3BRV B;  4QHO A;  3K8P C;  1BR1 A;  2CLY B;  2BVL A;  4ASK A;  3H3A A;  4IE6 A;  5JQG E;  1M7L A;  3RYF E;  2I1K A;  2OYH A;  1BR4 A;  4HTE A;  1GL2 C;  1MMD A;  1L4A C;  3KYQ A;  4LGD E;  4WW0 A;  3N7N A;  5HXH A;  3V2R A;  1V9D A;  1W2E A;  1FZC A;  1HTJ F;  5LGN B;  4YFS A;  4H63 H;  4GOU A;  5APU A;  3B5N A;  1S94 A;  1LTI C;  4WY4 C;  1FAV A;  4X1I E;  2NPS B;  1QL2 A;  1NTZ K;  2WPQ A;  3DTO A;  2KLQ A;  2P67 A;  3V5S A;  3N9O A;  3GN5 B;  1NTM K;  5FMN A;  4N3Y B;  2P1J A;  3NRY A;  1N7S D;  3BAT A;  5HYA A;  3HE4 A;  4IFD K;  3M0D A;  3ZN0 B;  5FY1 A;  1N86 A;  3ZMZ B;  4DZO A;  4P09 A;  4GKG A;  5LOV E;  4PAG A;  2MOZ A;  1N73 C;  3WI3 A;  2NP9 A;  3BQK A;  4DBQ A;  2XAJ B;  5AFU L;  4N78 D;  3HI2 A;  1T2K C;  2JRK A;  5LHG B;  1X9V A;  2E42 A;  2YIN A;  3GHG A;  1HG2 A;  1IFI A;  4GYR A;  1LT9 A;  3RYH E;  2P9B A;  1GK4 A;  4ZI3 D;  1HG5 A;  4N6J A;  4GK0 E;  1N7L A;  2DCF A;  1SFC D;  2NW8 A;  4X1K E;  1FOS E;  1N7S B;  4BA9 A;  2G0U A;  2CMR A;  4Z8X A;  2JEE A;  5KX5 E;  2SPC A;  3H6P A;  2KB7 P;  1RF1 C;  3AAE B;  3H32 A;  3V4Q A;  2H8P D;  3CX8 B;  2K9A A;  2HLO A;  2C9N Y;  1URQ D;  1WR6 A;  2KZ7 B;  3HE5 A;  1KK7 A;  1HS7 A;  4OH8 B;  5APY A;  2DWG A;  3ZJ1 A;  2R32 A;  4DOJ A;  1WRD A;  1QSD A;  3PUA A;  3V2P A;  5AW1 B;  2O01 H;  3VOP A;  4ZI7 E;  2C5J A;  3L3P A;  2HPC A;  1HGZ A;  4EB6 E;  1Z0P A;  5CCH A;  1ZV8 A;  1FMV A;  2IC6 A;  1SFC B;  4ZI2 D;  1G73 A;  3RL0 D;  4TN7 B;  4UVA B;  3F31 A;  1D0X A;  1CZQ A;  2Y8D A;  4TX5 A;  5GON E;  5AVQ B;  2RP4 A;  3NMD A;  5AW7 B;  2A72 A;  5IYZ E;  1RE3 C;  2QM8 A;  2WT7 B;  2M67 A;  5FY7 A;  2Y6X A;  2L9Q A;  1URQ B;  1M1J C;  2CXD A;  3G3Z A;  2NW7 A;  2Q9Q A;  5CCG D;  2V7M A;  2XTL A;  2J58 A;  5HXR A;  1GW3 A;  3C51 A;  3P8C E;  4EIJ A;  3RL0 B;  2WSF H;  2CPB A;  3HL6 A;  3R6N A;  1L0N K;  2WTY A;  2PP6 A;  1HBW A;  1J1D B;  3AA6 B;  1LTA C;  1LWU A;  1LRZ A;  5JDM A;  4PK6 A;  4JEU B;  3LK3 B;  1LTT C;  3AA0 B;  1US7 B;  1G1I A;  3ZMS B;  4I6M C;  4UEM A;  2FKW B;  1SVF A;  1SQP K;  1GL2 D;  3ZPO A;  1WT6 A;  5EK4 A;  2FFD C;  3N9M A;  1SQQ K;  1OWA A;  1MIW A;  3Q5W A;  3RK3 C;  2N9D A;  2VKH A;  2ZXE B;  1LKX A;  4QXB B;  3T8O A;  2YMY A;  3RC8 A;  4H9O C;  4WY4 D;  5ADX L;  3L09 A;  2ZFC A;  1JY2 P;  1X8Y A;  5CJ0 A;  3LBX A;  4XZC A;  3TKL B;  1FZC C;  3I0Q A;  3HTK B;  3WAK A;  2X9H A;  4H9Q C;  3B5N C;  4WBN E;  1QUU A;  1AQ5 A;  3LFM A;  2JQQ A;  2N2N A;  2LKM A;  4C7N B;  1D0Z A;  1JCD A;  5JVD E;  3V5B A;  3PUS A;  3UIA A;  3CPZ A;  4Y99 C;  1GL2 B;  2XKM A;  1NAF A;  3KV6 A;  4L9I A;  4UF0 B;  3N5L A;  5LBM A;  2Q3I A;  5AW2 B;  1JY3 O;  5KLV K;  4EZ4 A;  4ZHQ E;  1D1B A;  5FNV E;  3U78 A;  4WY4 B;  3ANW A;  3ETU A;  2CXL A;  3M0D C;  2Q9I A;  3CX6 B;  2A2F X;  1E5W A;  4O9B A;  1T2K D;  2XAH B;  3NFQ A;  5HWX A;  4AYC A;  3MZK B;  1MMG A;  3FXE B;  5IHY A;  1ZLL A;  5JDG A;  3U59 A;  4WNK A;  5KTB A;  2OAR A;  1LGH B;  1H89 A;  5CA1 E;  3GHG C;  1A02 F;  1LT9 C;  3RKO A;  1NHL A;  4PJN A;  3GMI A;  2HFE D;  2LSJ A;  5KJ7 A;  1HFA A;  5LHI B;  2LM9 A;  2EHO A;  1T8Z A;  1IJ5 A;  2CE7 A;  4P0A A;  2FYZ A;  4JUY A;  1GD2 E;  1A02 J;  1FOS F;  2XZR A;  3QUJ A;  1IAP A;  3RC3 A;  1IFN A;  5DQV A;  4ERR A;  1G1J A;  2H7H A;  5BVZ A;  4EOZ B;  1MIY A;  3AVR A;  5FXV A;  2LHR A;  1NOH A;  4OK0 A;  2A45 G;  2VKD A;  4QKN A;  4KBM B;  5L3D B;  2ACX A;  3O9X A;  4DMW A;  5CCH C;  1S9K E;  5EK2 A;  2CM0 A;  1IO4 A;  2NTY A;  5L3B B;  3AAI A;  2KWH A;  4B6X A;  3F57 A;  3VKH A;  1CI6 A;  1FJP A;  4NUV A;  3ZC1 A;  5LBQ B;  3KBU A;  3WAJ A;  3CX7 B;  2YKO A;  1LVK A;  3TYY A;  2YKP A;  4TUY E;  5JRE A;  3R84 B;  4HEA A;  2Q9Q C;  3OJA A;  3E1I A;  2WPR A;  1G2C B;  1FEW A;  3VMY A;  3LID A;  5ETW A;  2NOX A;  5HWY A;  1HTL C;  3Q9D A;  4CI2 B;  1YD8 G;  4YJ3 E;  2C5K T;  1IZN B;  1DX7 A;  1M1J B;  3MK7 C;  1FZG A;  4O2A E;  5AW3 B;  2Z5H A;  5H6Q B;  4RES B;  4ISS A;  2X0L B;  1LWU C;  4IE7 A;  2YO3 A;  1UCU A;  1X79 A;  3BK9 A;  3RK3 D;  4ZOL E;  2LOS A;  3AAA B;  4QX8 B;  1G8X A;  1J1E C;  5JR9 A;  3TNU B;  5HXC A;  1LTB C;  4C91 A;  1JTH B;  3VN0 A;  3A3Y B;  3M91 A;  3MA9 A;  4MBQ A;  3B13 A;  2X51 A;  3B5N D;  2VKJ A;  3HUS A;  5J1G A;  3UUN A;  1JUN A;  5L3F B;  5LP6 E;  5LG4 A;  2KOG A;  3O1H A;  4HFV A;  2FFD B;  3C64 A;  3ZN1 B;  4PFO A;  3VHL A;  5F3J A;  3RK3 B;  2POH A;  1JOC A;  1WRG A;  4FI5 A;  2K24 A;  3UTK A;  4EXT A;  1KNZ A;  4OHF A;  2D2S A;  3C9I A;  3C98 B;  3SWH A;  1B7T A;  2OYI A;  1AFO A;  1NKZ B;  3PTR B;  2A45 I;  1FZC B;  2LEH A;  4IHJ E;  3DP7 A;  5CB4 E;  3ZYL A;  1DEB A;  2MJZ A;  3B5N B;  3EDV A;  5EK3 A;  5AVU B;  1ZR2 A;  2X68 A;  4OYJ A;  1MUU A;  4Y99 B;  4AKL A;  3SWY A;  2LE8 A;  4AQF A;  2JJL A;  2XUE A;  3U1A A;  2V7L A;  2KXP B;  3PU3 A;  3HE4 B;  2QA7 A;  2ODU A;  3KV9 A;  2L3L A;  1HF8 A;  3IEE A;  5H6R B;  3HKC E;  1O3X A;  3HD7 A;  5KJ7 C;  3CL3 D;  2EHO C;  4N78 E;  3L35 A;  2Y48 B;  4ANJ A;  4H9R C;  3KQG A;  5AVW B;  2L5G B;  3GHG B;  1D0Y A;  5AW6 B;  5FXW A;  2N1T C;  1LT9 B;  3V2Q A;  3FXD B;  4EAH A;  2CPS A;  1NH4 A;  3MKD A;  4V1A v;  5CCH D;  5JDF A;  1KZU B;  2D0T A;  3A2A A;  1ZEE A;  2HPL A;  2H3R A;  3IHR A;  4EYY R;  4CXW A;  2QM7 A;  3U1C A;  3H32 B;  4C46 A;  2W63 A;  4H63 V;  2IX7 C;  4PW8 A;  5DAB A;  3T97 A;  3K3N A;  3HE5 B;  3C4W A;  3RPU A;  4AI6 A;  2Q9Q D;  2V26 A;  4HN9 A;  1DH3 A;  2C9L Y;  3CVR A;  3C4Z A;  2W6B A;  2LOP A;  2BVM A;  1XTG B;  2HPC B;  1VOM A;  2LSG A;  3ZEF B;  1H7C A;  4I50 E;  2Z4E A;  4P0B A;  3ONX A;  4M1P A;  2O1K A;  3I9W A;  1VRB A;  3M9B A;  2CWY A;  4BJN A;  1IFD A;  2W61 A;  2C0S A;  2KLV A;  4GT1 A;  5EZY E;  4AUW A;  2Q9Q B;  5APS A;  1MMN A;  5AW8 B;  1MFZ A;  5CHX A;  1GW4 A;  5JRC A;  2LHN A;  3M06 A;  4LLH A;  2WSC H;  4KMC A;  4UIG A;  2VRS A;  3SOL A;  2W6A A;  3I5C A;  4H9S E;  3MTU E;  3A5X A;  2MYS A;  5JR9 C;  1LTJ A;  4KUM B;  5HXE A;  1UX4 A;  4G63 A;  2KIN B;  1LWU B;  4I2L C;  2JMH A;  1KIL A;  3Q5X A;  5FXZ A;  1WYB A;  1HH0 A;  4ZS3 A;  4BAY B;  1L4A D;  3E22 E;  4UXN B;  3EDU A;  3D0T A;  3FB2 A;  3VP8 A;  3HUS C;  3I0O A;  3CI9 A;  2OYH C;  1J1E B;  1GDT A;  4QX7 B;  2CA5 A;  2ZMA A;  2W00 A;  4O4J E;  4K0U A;  4PK4 A;  2YNY A;  3AB3 B;  2X67 A;  1SP4 A;  3EFG A;  2V1D B;  3HTK A;  3K3Q C;  1FZE A;  3LK4 2;  4L5G A;  2J1D G;  5AVX B;  4AKR B;  2OYI C;  2KT9 A;  3EQ2 A;  3GA8 A;  2XU6 A;  2E8I A;  1HWT C;  3LBX B;  1SQV K;  1HJB A;  4IDZ A;  5FY0 A;  3N4X A;  5A1L A;  1L4A B;  1MV8 A;  3ZMT B;  5LNK A;  2IFM A;  5CA0 E;  1SQB K;  3UUM A;  4O2B E;  5L2L A;  4W80 A;  2QGS A;  5J2U E;  2PAJ A;  4WY4 A;  3ZJ2 A;  1MMA A;  2YEV C;  2HOD B;  4TV8 E;  2XHE B;  4AQF C;  4CXX A;  4GIW A;  3FHN A;  4UV8 B;  5KJ7 D;  4FJO A;  3MGN A;  2C5I T;  2EHO D;  2R3C A;  3ANW B;  5L3E B;  2A45 H;  2HYN A;  3JC6 C;  2N1G A;  1H88 A;  2PFV A;  3PUG A;  3VMZ A;  3HKD E;  4B86 A;  2ZM0 A;  5JDH A;  4PFP A;  3HD7 C;  3NTN A;  2N1T D;  3R2P A;  1JO5 A;  3HA4 A;  1ZV4 X;  2X9X A;  2H7V C;  3CQX C;  4CXY A;  1N73 B;  1U4Q A;  4PJJ A;  3PP5 A;  2LT3 A;  3CML A;  1SLQ A;  4W7Z A;  3M9Q A;  5BMV E;  2IAK A;  4I1L A;  5LYJ E;  3FBZ A;  2V7J A;  1FMW A;  1T98 A;  2XDJ A;  2EHO B;  3SRZ A;  3M9H A;  2LSI A;  3KVA A;  3J7Y q;  1YKE B;  5APQ A;  5C8Y E;  4IIJ E;  1GTW A;  2E9X A;  3UUX B;  2N1T B;  3KFW X;  3PUR A;  1HVV A;  4JLE A;  1RF1 B;  1LTS C;  2XV5 A;  4CI1 B;  3OAK A;  2KND A;  2NW9 A;  2XNX A;  3QK6 A;  3PDY A;  1BR0 A;  1JMM A;  2M3B A;  2BDE A;  1YTZ I;  3NZQ A;  1N2D C;  3CQC B;  3N9L A;  1GK6 A;  5LA6 E;  1ZR4 A;  2IFN A;  4CI3 B;  3RX6 A;  1EZ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...