1NAFA

Crystal structure of the human gga1 gat domain
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
129
structure length
124
Chain Sequence
DEEKSKMLARLLKSSHPEDLRAANKLIKEMVQEDQKRMEKISKRVNAIEEVNNNVKLLTEMVMSHSQGSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEILQANDNLTQVINLYKQLVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Structure of the GGA1-GAT Domain Reveals the Molecular Basis for ARF Binding and Membrane Association of GGAs
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein, membrane protein
molecule keywords ADP-ribosylation factor binding protein GGA1
total genus 37
structure length 124
sequence length 129
ec nomenclature
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03127 GAT GAT domain
A PF18308 GGA_N-GAT GGA N-GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1nafA01
1.20.58.160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1nafA02
4I2LC 5APVA 5AW3B 3HE5B 2WPRA 2Z5HA 4C46A 5AW0B 3M0AA 2KP8A 2WPQA 1FOSE 2VRSA 1GTWA 1H88A 3NFQA 2W6AA 4RESB 5CMZA 5APQA 1CZQA 1NWQA 3O8ZA 5AW9B 2H7HA 3V5BA 1HWTC 5APUA 5AVSB 2XZRA 4AYCA 5APWA 1OXZA 5AW2B 1HBWA 3MGNA 4JYBA 1MUUA 4HYTB 5APYA 5AVZB 2Q7CA 2P2UA 3NTNA 1JNMA 5AVXB 1FAVA 1S9KD 1G2CB 2XU6A 5APTA 2XV5A 1MV8A 2R32A 2P67A 2IPPA 3M9BA 3KDPB 3NMDA 4M3LA 1OWAA 4I6MC 2E43A 5AW4B 2YO2A 2ZFCA 5AW7B 1T2KD 3OAKA 3VMZA 5AW8B 2W27A 2BASA 5AVRB 3P7KA 3T97A 1H8AA 1S9KE 3VTPC 2WTYA 2ZXEB 5AVQB 2JJLA 5AVTB 1FOSF 5APSA 2C9LY 3KQGA 3A5TA 1O3XA 3I5CA 3M9HA 3TNUB 4AUWA 1NWMX 1A02J 1YD8G 2R3CA 1GD2E 3VMXA 3A2AA 3P8MC 3TK1A 2QM7A 3L36A 3L35A 5AW5B 3LIEA 3TYYA 2Q3IA 2E42A 3HE4A 2N9DA 1NAFA 3HTKA 5AVYB 5AW6B 2WT7B 2WT7A 3NXSA 3V4QA 5AVWB 1X8YA 1CI6A 4C7NA 1GZLA 1T2KC 3UIAA 1JUNA 4LC1A 4KHXA 3VYIA 5APXA 1CSBA 1WR6A 1DH3A 2QM8A 2P7JA 4AQRD 1HJBA 3M0DA 2YO3A 2R5BA 3TNUA 2YNYA 2WPSA 3VN0A 1MFZA 2WWWA 2C9NY 2Q5UA 1GK6A 1GU4A 4DZOA 4B86A 4GT1A 1IO4A 4GKGA 1CI6B 1X79A 4C7NB 1H89A 3SWFA 3A3YB 2Z5IA 1GK4A 3HE4B 3M91A 5AVUB 3HE5A 1J2JB 1KQLA 3V4WA 4JYCA 1GU5A 3A7OA 1WRDA 2R5DA 3VMYA 2N2NA 1HUCA 3LIDA 1SP4A 4XE5B 2N9BA 3L37A 5AVVB 3IR9A 5AW1B 3B8EB 3MD0A 4EOTA 1A02F 1SLQA 1YYCA 3M06A 3P32A
chains in the Genus database with same CATH superfamily
4H63H 4IFMA 1X0TA 2WCAA 1QEXA 3AXJB 2WPQA 4JV5T 2JKVA 1LKXA 4I4TE 2X68A 2B87A 3NFQA 4JI5T 1JMMA 2HLOA 4PV1D 1SVFA 3L71D 4QH5A 1NTKJ 2ZYAA 2WQYC 2NPSB 4TNWA 2NP9A 4WY4D 1KILC 5F5WA 2VL0A 2NRGA 3H1HE 3MGNA 4L0RA 2K9JB 3RK2C 1BR2A 2Q7CA 3AE2A 4DV0T 3ZCIA 1YKHB 1KILA 2WMNA 1XNQT 1Z8UA 4XA4A 5KLIC 2J4GA 3BRVB 5L3FB 3AE3A 5EK2A 1M1JC 3KV5A 5HXEA 2XQ7A 3B4SA 2QJYC 2IDOB 4WBOA 1PGQA 2ZFCA 2RA1A 4HGAA 3ZYKA 5AQTB 4DV6T 2E5TA 3H1ID 4K35A 4LMJA 5AVQB 3OW2O 3M9QA 3CC2P 5FY7A 2C9LY 3KQGA 1NTZD 3MACA 5LGUB 3CQXC 2ES0A 4ISTA 5KLVK 3GHGA 2J1DG 2D2CC 3VMXA 1BR1A 2FKWB 5FNVE 2FXMA 3CCLP 4ADZA 2WZIA 5ABGA 3L36A 3AEBA 5L3EB 1OVUA 2IYOA 4N78D 2D0UA 2P10A 3HE4A 3IFMA 5DJTB 3B5NC 4LC1A 4JI0T 4ILCA 1FJKA 1Q82Q 2YMYA 2UXCT 1G73A 2QM8A 5FY0A 5HEJA 1HJBA 1X22A 2YOEA 4LF8T 2R5BA 2YKSA 3ZJ2A 3LBXB 4DR7T 1RF1A 3ZT6A 2CCQA 1ZP0C 1RF1B 3PTZA 3P4WA 3OTOT 4EDFA 2ZYDA 4ZI3D 1NU1G 3N9PA 3JCUH 3LK3B 4C7NB 2ZM2A 3Q5WA 3KV9A 1BR0A 1URQC 3L72D 5CCHD 2WP9A 3RBZA 3ZEFB 1LTIC 3WUTA 2OYHA 1J2JB 3O1HA 1BE3D 1JCDA 1EDLA 2QEXP 4I7ZB 3TGUE 2QIWA 4XE5B 2W0GA 1NTKK 1EZVE 4EOTA 3D70A 3L8RA 4DCKA 2ZVOB 3P7IA 1AVYA 3MXZA 3L73G 1D7MA 5LHHB 4H63V 2E5LT 3AE4A 3CQCB 3FBLA 1KNPA 1VQ9P 3JADA 4U31A 3P50A 3FGAD 1G8XA 4ZEYA 3NRYA 3L72J 3IA3A 2IBZE 1IJ6A 1H0TB 4O8SA 3AECC 3PRJA 1FDMA 2RP4A 1HVVA 3S4UA 4IIJE 2LOSA 4CI1B 5CCHA 2BG9B 2J47A 3P4RA 4U72A 3DTOA 3ZCJA 3LFMA 1CW5A 3BASA 3I56P 2IIUA 2W63A 5AW8B 5C39A 3CC4P 3T97A 3VTPC 3CCMP 2XPKA 1VQ4P 3L70D 2CPSA 3CX5I 1L0LD 2L91A 1PIXA 4QXCB 3D0TA 3M9HA 1GD2E 4IREA 4GYSA 1SQQE 4Y99C 4AIUA 1M8OB 1FZAA 3TLUA 5JR9B 3VRAA 3W67A 5C3JA 1SQPG 1W0AA 3CX5D 4H9OC 5J0ZA 4V1Av 2XAFB 4KX6A 3M65A 2FBWC 1J1EB 1KILE 1SQVD 3TSIA 3GG2A 5FXXA 2FFDA 3ZMUB 1DIPA 3TGUG 3TNUA 4PK4A 3UT5E 3U3IA 1GK6A 1NTKD 4EOZB 3H6PA 5JRCB 2LHNA 4X1KE 2V4HA 1R5LA 1YQ4A 5KJ7A 2X9XA 2W61A 3X1DA 3AE1C 1DD3A 1JOCA 3CCVP 4EIJA 2A72A 4GODA 4HFIA 4PJNA 3UFGA 1QL1A 2RKLA 4PFOA 3AE8C 4IDOA 2CEAA 2K1AA 2NZ2A 4W7YA 4KT0J 3IR9A 1Q7YQ 5KTBA 3PUAA 1URQB 1GMJA 1D0XA 2K24A 3BCCJ 2QYWA 3QNUA 5H6RB 1JM0A 2E2AA 5CGMA 4CZZB 2JQHA 1SFCB 3AAAB 2KXPB 3T8OA 4OH8B 2AXCA 4RESB 3QB5A 3P8CD 1HGZA 1HR0T 2E75C 3KV6A 3RQWA 4AKHA 3QOFA 5KLVG 1JEKA 5EK3A 2V5DA 1Z56A 3CCRP 1YTZT 2IBZG 2YN6A 2P2UA 3MKDA 4LF4T 1AJ3A 1BCCJ 5AVXB 1KYOH 1S1CX 2A06G 3O1IA 3RGUA 2WWUA 3EFFK 3C4ZA 2XJ7A 2RN0A 3ZN0B 4X66T 2E43A 4EIWA 4I6MC 3I0OA 1JY2N 1LTBC 1BCCE 1P84D 2FJBA 5HEHA 3CWZB 1YW0A 5KAFE 4CXYA 1IBKT 3GF3A 2XTLA 4JLEA 1MMNA 5CJ5A 3KINB 3WUVA 2ACZA 3LJCA 3AAIA 1PZQA 2E74B 2GA1A 4PD4H 2WU2A 2SPCA 1L0LK 2JP3A 1HTJF 5JDGA 4ILAA 3H1LE 4H0LD 2L9QA 2E42A 5FVLA 5JDMA 2CHNA 4H9PC 2FYUG 2QVAA 5LGTB 3LDQB 4EYUA 4HFDA 3AE2C 2Y6XA 5BR8T 4R4LA 1U7JA 2WSEH 3L3PA 3JCUE 3T1YT 2P7JA 2DLRA 3PUQA 1VRBA 3OVUA 5F8PA 4MLKA 1N7SB 3H1JD 2O01J 3VN0A 2YDRA 1SQXE 1RY3A 3GMIA 4JUYA 1L4AA 1WMKA 2D2CB 4FI5A 4B86A 3Q3DA 3GA8A 1W2EA 4N3YB 2KMFA 2I0MA 4ZXLA 3SWFA 1L4AC 4H0LB 3ETVA 3O9XA 4OGQB 3HE5A 1LTJA 1OIPA 3N2GE 2CWOA 2XAQB 1WRDA 1OEDC 1LP1B 2V8SV 1M1JB 3AEBC 3FZFB 3C50A 3HKEE 4F8HA 5KLVE 2M5AB 4J2CA 2VURA 2O1KA 3M06A 3II6A 2HN1A 3B5NA 2YK0A 3RIUC 3AEGC 4YHJA 2D9DA 4P0BA 1AV1A 3KVAA 2O01H 2V7QJ 1JTHB 4KJMA 3KDSE 3AE8A 5LMUT 4YHHT 3WAKA 3IF8B 2RPAA 3ABVC 2I59A 3HKCE 5TISH 2QA7A 2HPJA 1N33T 3L74G 1BGYE 4JI6T 1FMWA 1ZR2A 2JQ9A 3HD7D 2KZ7B 3V2QA 5B66H 1HX1B 4OYKA 2KLQA 2Y48B 4I55E 5APTA 2CA5A 2XV5A 4WWIA 4DMVA 3NBXX 2OYIB 2NPSA 1JB0J 1S94A 1H8AA 1HG2A 2KS1A 2H7VC 4KHPT 2R6GF 5AQOB 2M3EA 2ODVA 1CHUA 3BQLA 3CVRA 2R3CA 4ILBA 1BE3J 4X62T 2QJKC 1FDIA 2WY2A 3A2AA 4U3FE 1EXIA 5LBMA 4LF6T 5CJ0A 1NAFA 3E1RA 3HTKA 3CXHE 2IC9A 2WMMA 2Z4EA 5AQGB 2ZVNB 1NAYA 3B71A 1XTCC 3P4PA 3JCFA 2XNDH 4IDQA 3G06A 3GHGB 2FYUE 3FXDB 2WSCH 3SS1A 1K8AQ 1LGHB 3RK3E 3QK6A 2BKPA 4CI2B 3ZDMA 2X0LB 3MK7C 3FX0A 4QMAA 4EYYQ 3QB5K 5ABHA 3B5MA 1GDTA 2DW3A 1KV4A 1CI6B 1E1HB 1RE4A 3A3YB 3R2PA 3H1KD 3AA6B 3RL0C 1EDIA 1EC5A 5HWXA 1IFPA 3NWIA 5FL0A 1SQBG 2LRKA 2W4XA 1N7SC 1PP9E 4WY4B 3ZC0A 1MIVA 4N6JA 3L73J 4GIWA 2WSFJ 2FUPA 2H89A 3JAEA 4M1PA 4WYVA 2Q9QD 3B8EB 3H1IJ 4BRYA 1U4QA 3KXDA 1WCRA 4XZCA 2XZEA 4LF7T 2KWIB 1PV3A 3Q2YA 5F3JA 5HCJA 3PP5A 5GTIH 3TLTA 1CZQA 3H1JJ 2X9HA 1KEYA 3RK2B 2QJPB 4PW8A 4H13C 5JVDE 3RIAA 1R8IA 1UIIA 4A56A 5ABFA 4E7ZA 4JI7T 5HEOA 3RRCA 5LG3A 4JYBA 3AE1A 2OV9A 3UULA 2LE8A 3NTNA 2MAWA 4HKZH 1R8EA 5KAFH 2PJQA 4WB4A 2E74C 1LRZA 3A8YC 3KFWX 4DR5T 3L71E 1LWUB 1EZ3A 2I1JA 1SQBK 2XHEB 5B66E 3AECA 4K3AA 3AEAA 4PNIA 3LK2B 2IFMA 3AE7C 2AEFA 2WTYA 2M3BA 2ZXEB 2J58A 3CWBE 3A5TA 2JQKA 2C5IT 4HWIB 2JWAA 3RK3D 1U57A 1IC2A 2E8IA 3BQKA 1NVOA 2OQQA 2Q3IA 2KT9A 2JEEA 5HXRA 5M4YA 3H32B 3CQGB 2WSFH 1S72P 5AVWB 4LGDE 5CBNA 3C4WA 3RL0g 2V7KA 3U59A 4U33A 1JCCA 3MIWA 2E9XA 4ZS3A 1BCCG 2JMHA 4ZI3C 4TLFA 1OW6A 2W67A 2ZT9D 3CXHH 2WM9A 2CXDA 1Q81Q 4COFA 1RQUA 3PU8A 5J2UE 1K04A 3ZJ1A 3EDUA 2WVRA 2ZM8A 2OLTA 3L71J 1MMAA 2LSYA 1X79A 2YKPA 2E75D 1VQLP 3B57A 1EZVG 3HE4B 1KNZA 2KI7B 2FFDC 4EEBA 1OEDE 4ZOLE 2UUCT 1IFIA 5KAIH 2C5KT 2XQ4A 4FJOA 2BCCG 4H44D 3Q5SA 4HKAA 2ZM6T 3L37A 2XAHB 3BCCG 2N1TD 2XAGB 1NHLA 2BDEA 4YTNA 1M57D 2B88A 3L4FA 2FJAA 2O01N 3RBXA 3SWHA 3ZT5A 3UU6A 3E1IA 3IF4A 1MKMA 5JDQA 3L70E 2JO1A 3J7Yq 3MA9A 1HFAA 3LG7A 4UV9B 5ABEA 1ZR4A 5TISE 3VR9A 5K5GB 4G2AA 1LWUA 3OJAB 1H88A 3L71G 3BCCE 2Q3EA 1N34T 5DJUB 3G71P 4P09A 1PPJE 1N73C 1RF0A 3V5BA 1HWTC 4JBZA 3TKLB 3L75J 2VQET 5LHGB 2XQ3A 5APWA 2XQ5A 5LXTE 1OXZA 4O2AE 2LJLA 2M8RA 1URQD 2KSRA 2H43A 3PUWF 1G2CB 3OA7A 4O4LE 3ZMSB 2R32A 3UUBA 3CMEP 3Q5DA 4YLHA 3V2NA 4IDPA 4QX7B 1T2KD 3EAMA 2OYIC 1XZYA 1GL2B 4EEDA 2WSSH 4L73A 2B1EA 4UB6E 2RMZA 1QGKB 4BA9A 2HN2A 3OKQA 2B9BA 3CKDA 2MKVA 5HCMA 2LSJA 1XDPA 1R5SA 3DJBA 3CCEP 1OFCX 1PP9D 2H88C 3RH3A 5E79E 2IFNA 4NUUA 5FY1A 4EXTA 1L0NG 2LLYA 2C0WA 3N7NA 1M62A 3CI9A 4HE8A 2XSBA 3OYZA 2RH0A 3IEEA 1CI6A 1WFDA 1YXRA 3L75E 4IHJE 2KLVA 2H7OA 1ZKEA 4CN6A 3H37A 5CB4E 3G3ZA 2NTXA 5C8YE 2OYHB 3AAEB 1YQ3A 5FP3A 2A45G 1NU1J 1VQNP 3FZLB 4TX5A 4WY4A 2YO3A 5AQJB 2BS2A 2IZ1A 1Y47A 3ZT7A 1DX7A 3N9NA 1FZBA 4AISA 2HH7A 1Q2NA 1OMIA 1KILD 1SQVE 3I9YA 3L72G 4PD4D 1IK9A 1BGYG 2LM2A 4H9NC 2V6YB 3WMM0 4YSYA 4U3FG 2H89C 1Y9BA 1NOHA 3CCJP 2POHA 1NKZB 1BSHA 3N2KE 3N2OA 1S4XA 3N9MA 1LT9C 1P84H 2OTLP 4EI2A 3PV0F 3PJSK 4JI1T 1A02F 2G3AA 3L73D 3FWNA 4D6TE 3D6YA 2DI4A 2Q9IA 3HTKB 5AW3B 2BBHA 2O1JA 5ETWA 5FXZA 1IFMA 2UXNB 2BG9A 3ESLA 4X5TA 5FVKA 3K5BA 1GL2A 3HR0A 5L3CB 1VCTA 1E7PA 5HXSA 1SQQD 2H88A 4BJNA 3IAOA 5J1GA 2YKQA 2YINA 1K73Q 2YDSA 5KJ7D 2YU1A 1JNMA 3PUXF 3QWOC 1YJNP 3RF1A 4YTPA 3UUXB 3FHNA 2P67A 3NVOA 2J59M 2WSCJ 2W27A 1WLXA 3K3QC 3L70G 3GW6A 3L75G 3FZKB 1ZN5A 1V9DA 5FYMA 1FDOA 1J5WA 4DV5T 1VOMA 1KB9D 3TDKA 3GHGC 3P8MC 1XMOT 4ERRA 1GQEA 2E9XC 1KB9H 1OW8A 5ABFB 4IE7A 2HPLA 2V5CA 1NENA 1OZHA 1L0NE 3B13A 1DEBA 4MN4C 3OPCA 4L76A 4PJJA 3RYFE 3NRXA 1HTLC 1CSBA 4HWCA 4UF0B 1PL5A 3S9OA 2N1TA 4L9IA 2MTQA 3H1LG 4NPDA 1MFZA 4KHZF 3HUSC 2C9NY 5L3BB 5DQVA 1IO4A 3N5LA 5KAIE 5M1BA 3N9OA 2Z5IA 5CFBA 3H1HG 1KK7A 4JEUB 5AVUB 4TN7B 4GYRA 2BEZF 1ZV8A 4YXDA 4KBMB 1NYHA 3AA0B 1IJDB 4CQIA 1NO4A 2WDVA 2M6IA 1S3JA 3LIDA 3VP8A 5AQSB 5AQQB 2FYUJ 1YITP 1LTGC 2P1JA 2W62A 2WQYA 2M67A 4ZS2A 3WU2E 4DR3T 2FYNB 4ASVA 4D6TG 1JY3P 5FKYA 2XQYA 3A0HH 1P84E 5AQRB 5L2LA 4ZI2D 1E2AA 1L0LJ 1RF0C 4W7ZA 1UX4A 1GW4A 2K5BB 3NZPA 3BVHA 4H44C 4HEAA 3ZSTA 2CPTA 4EGWA 4NPEA 2CBJA 3MUDC 4IE5A 5A1LA 5AQPB 1OEDA 4X64T 2W83C 4ZKPA 2HODB 1SQVJ 4K0UA 4DV7T 1JTHA 1LVKA 4O4HE 3KDPB 3EHZA 2LKHA 3OAKA 2AEMA 2NR4A 3HI2A 3D6ZA 2BASA 1YQ4C 4HTEA 3PHLA 4B3ST 5LYJE 5APSA 1VQ8P 1O3XA 3HUSB 4P0AA 1SQXD 5KLIB 1S5LE 1IFNA 1ZW0A 2X66A 1OVVA 2BBJA 5C2TA 3CPZA 2YMKA 3AEEC 5CHXA 2FYUD 3LIEA 3PJAA 4YXDC 1FZGA 2N9DA 1YHQP 2H7HA 3V4QA 4HB1A 2I6HA 2QG4A 1SQQK 3UU3A 2PRRA 3UUMA 3CL3D 3KV4A 2IMLA 2N9YB 5KLVJ 2PFXA 2DWKA 5GTHH 3AE5C 1M7LA 4ZI7E 2Q5UA 5J2TE 4AKGA 4PFPA 4NIQA 4IOIH 2E74D 3C9IA 1S2EA 1N32T 1ZHCA 1T7SA 2NOXA 4IL9A 2CRBA 1KN7A 5JDHA 4QXBB 2B76A 1NTZG 4DT0A 4JQ0D 2P58A 2JR8A 1NH4A 2XQ9A 2E5YA 3G4SP 4PAGA 2W66A 2WU5A 3FWLA 5TJHA 4I0UA 3ONLC 2JIWA 2XQ6A 3KYQA 2NW9A 1X79B 2WZ7A 3CPWO 3WUUA 1JY2P 2KB7P 3H1JE 3ZLIA 4OYJA 4C46A 1QL2A 4CI3B 3Q5PA 3EVYA 3L70J 2B87B 1ZRTD 3AA1B 1G1JA 3O8ZA 3H1HJ 5AW9B 2XQ8A 2V26A 4CXXA 3G6EP 1SFCC 4IL6X 5APUA 3FXEA 2OTJP 4HFHA 4HWFA 2IBZI 2UXDT 3L73E 2VKJA 1T3JA 1IBLT 2FXPA 3MHVA 3RL0D 4HFBA 2V1DB 4UV8B 4ASWA 3PTRB 2HPCA 1XMQT 1FZCA 5BMVE 1SQVK 1MMDA 1VQ6P 2WS3A 1ZMEC 4PV1C 4U7IA 1KFYA 1M1JA 3FZMB 1JY3N 1VL2A 3WAJA 5H2FE 4PV1B 5KDMC 4MBQA 1EZVI 2KSEA 2IYPA 4X1IE 3R6NA 1N7SD 4DVDA 3AE9A 4H9SE 1L0VA 2LRLA 1LTJC 1A02J 5AQVB 3UUNA 1LTTC 1NTME 2KK7A 1HS7A 3EFGA 3CCSP 2BZBA 2P9BA 1N2DC 3TF5A 4AKIA 5DABA 5HWYA 4U3FJ 1X8YA 3AEDC 3CWBG 4ANJA 2YDQA 1NTZJ 4JI8T 1ZXGA 2FYUK 2D5UA 1NU1K 1WRGA 1TU3F 1U7MA 3UU8A 1WR6A 4KP3C 3L74J 1HNWT 3PUVF 3PJAJ 2FYZA 3LW5J 3JSVC 3SWKA 1MNEA 4H9RC 3RRWA 3B5ND 4DV3T 2XUEA 4JEHB 1NKNA 1Y8AA 2IDBA 4LF9T 4LFAT 1K05A 3H1KG 2JMKA 1M90Q 4HWDA 4UIGA 4YTMA 2BKNA 5GTHE 2V6XA 3PU3A 4QH4A 4XBFB 2K3RA 2CE7A 2E5VA 3HD7C 4DUZT 1GU5A 2LXBA 2NPSD 2NW7A 5KXJA 4KMCA 2KYVA 2N2NA 3E0ZA 5DJQC 3AA7B 2PAJA 4TZ4C 5HXCA 3HD7A 3VR8A 3A0HE 1AA0A 3JAFA 5H6QB 3H1IG 1AQ5A 1XNRT 2X0YA 2HPCB 1HNZT 4TUYE 5L3DB 1IK7A 3HE5B 3SRZA 2AEJA 1UK5A 3G9RA 4PJMA 2E76B 2KP8A 2W00A 1GTWA 2W90A 2N1GA 5KJ7C 2E75B 2M0BA 3F31A 3JC6D 4P1NA 1BGYJ 2W6BA 3MZWB 2XZRA 4DV1T 4UEMA 4H44B 2KSJA 3JC6C 2N1TB 5AVZB 2CLYC 3E7KA 2Q9QB 3ANWA 4QWNB 2WB5A 2A45I 2BG9C 3GWHA 2KLUA 4GOUA 3W15B 1KTMA 2YXRB 3GN5B 3RQUA 3GN5A 1SFCD 1KMIZ 5LJNA 2E76D 1OWAA 2F4VT 3E08A 1ZLLA 2YO2A 2MOZA 5AW7B 4DR1T 1VF5D 1G1IA 3VMZA 2W6JH 3LK42 4AKLA 2PGDA 3VP9A 1NJIQ 1YIJP 5HEGA 2QSIA 3I55P 2HFED 2WDRA 4O4JE 2VK9A 4AUWA 1BE3G 2ZM0A 3C4XA 3Q1MA 4WNKA 2DCFA 2LSKA 2V7MA 4DR2T 5AQHB 3O6QB 3EI0A 4H0LC 3RLFF 2BCCJ 4TWDA 1JO5A 3PUZF 2G0UA 2VL8A 2WT7B 3NXSA 1JNRA 4BAYB 2KZJA 4LMKA 2IHR1 4X20E 3GMAA 2Y0EA 1BCCD 3VKGA 1FEWA 2KUBA 3VKHA 4GOEA 4IGUA 5FXWA 3A5XA 2O3JA 5CJ4A 3ZC1A 3M0DA 3VU7H 4UB8E 1HF8A 3I9WA 2OTKE 3CCUP 1WR0A 2GUVA 1VQPP 5JRCA 1ZEEA 1CUNA 4GT1A 1KQGB 4ISSA 1HF9A 1ZOYC 1HH0A 3N9LA 4YSXA 2V7QH 4JF7A 4U2ZA 2EHOD 3V4WA 1PPJG 4XAXB 4JYCA 2BCCD 1W9RA 3A7OA 1IBMT 2R5DA 3AEDA 4DNDA 2J5UA 2YEVC 1T8ZA 4B3MT 4I43B 2CMRA 5LBQB 5AW1B 3MD0A 1N7SA 4NXNT 3FBZA 1YYCA 1KD1Q 3P32A 5AFUL 5CCHC 1FZEA 1YTZI 2JWDA 2OA5A 1RF1C 3K3NA 1D1CA 1KILB 2LR2A 2OYOA 4L75A 4B3TT 1FOSE 2NPSC 4QX8B 2UUAT 1D1AA 1EDKA 1J5ET 2A06E 3T97B 2OARA 2UWJE 3H32A 1SQPD 4BRYB 1D0YA 1MIYA 2IZ0A 3H3AA 4N78E 3SFEC 1UCUA 4YT0A 1IJ5A 1B7TA 2Y9YA 3EQ2A 3RC8A 1W09A 3SFEA 1SQVG 2JJ9A 1KC8Q 5LHIB 4KI0F 1SQPJ 1FU1A 1N36T 2Y0DA 3EUHA 3RIUA 2Q1KA 2XU6A 5AQFB 2W8ZA 5GONE 2IPPA 3NMDA 1VQ7P 2LXCB 1KB9I 4OVNF 2VKOA 2E9XD 3P4QA 2X9WA 4ZI2C 1S9KE 4KUMB 1YKEB 4DO0A 1RE3A 5JREA 2XAJB 3OYXA 3CC7P 3E22E 1XTGB 1J1EC 3TNUB 1UUSA 1PP9G 3UU4A 3ITKA 1SA0E 2M6BA 2HODA 3I1AA 1PGJA 4DV4T 1RE4C 2H8PD 3Q5EA 4PK5A 4IFDK 5L8RJ 4W80A 4H9QC 4OGQD 4Z8XA 4WBAA 5JR9C 2EHOB 4AQGA 1S5LX 3UFEA 4C7NA 5IWAT 3AXJA 4U74A 2D0TA 2V6YA 1DH3A 4QXHB 4AI6A 3CD6P 1N8RQ 2EHOC 4YJ3E 2JQQA 4GIFA 2KNCA 1U5PA 4LLHA 5LGNB 2XM1A 3CIRA 1Z0PA 5KLVD 1BGYD 1NTMG 5L4HA 4A5XA 1H89A 1BDDA 4I7ZC 1NGMB 4UB8H 4D6TJ 4AXPA 3JC22 2IUBA 5CCGC 4IFFA 3CXHD 4ZKUA 3AE5A 4LFCT 4HJGH 1XWMA 1VCSA 4X1YE 4L74A 2B89A 1SHZC 4ASKA 3RYIE 3RHWA 3UU5A 3NKZA 2LKGA 3AE6A 1USDA 3A0BE 5IUXA 3V2PA 1NTZK 4I2LC 1L4AD 1AQTA 1YI2P 2ZLYA 5ADXL 1PFIA 3V5UA 4AQFC 1SQBJ 1VF5B 5HEUA 3RGLA 3NZQA 5KMGP 3RKOA 1UURA 4YTPC 4HFVA 2ZXXA 4F6RC 1SQQG 4MFRA 1QX8A 3U78A 3IBPA 1MFTA 2FYNC 4WVZA 1H7CA 5IYZE 1VQ5P 5CA1E 5AW2B 4U3CA 1N73B 3EWKA 1N73A 2A45H 5KKZC 5CCGD 4YXWH 3F57A 4HYTB 5TAOA 5LNKA 4UVAB 4EYYR 4OWFA 4A98A 1BR4A 1KZUB 2XNXA 5LOVE 2CBIA 2CHOA 3C64A 2KZIA 1MV8A 5JQGE 4JPZB 2R3SA 1RHZB 3FXEB 2WPVB 3USSA 4TWHA 4IT4A 2CXLA 2JJLA 1FOSF 4HWHA 1YJWP 4TV8E 2JPFA 1T6AA 3HD7B 1G2CA 2VKHA 4CPGA 3CX8B 2MPKA 2UU9T 1SQPK 1T8BA 3TYYA 2K37A 2KOGA 5AW6B 1T2KC 1GZLA 3AE9C 1JUNA 3K8PC 3ZMTB 4TWFA 1USEA 3CCQP 1DEEG 1GL2D 5LCYA 2Q9QA 3ANWB 3K3OA 4ZZCA 3O4XE 4YPCA 1EDJA 2YNYA 3R84B 1SQBE 5IHYA 2CK3H 2SPZA 3TLSA 1UIXA 3L74D 4GKKT 3H1HD 1SQQJ 2LSIA 2NTYA 3PUYF 3PUGA 1NU1D 2L8KA 2OGUA 3RK2D 3CX6B 4B6XA 3SWYA 4BJMA 1AVOA 1IAPA 3ZYMA 1IFJA 1MMGA 3TLWA 1W2BO 3WU2H 2KIKA 2ITAA 1IFDA 4NPFX 4C7RA 2N9BA 3HKBE 2C0SA 5L4EA 3L74E 1NTKE 2YIUC 4D6TD 2XDJA 3ONXA 3T1HT 5DQWA 4UVCB 1XDOA 4NUVA 1SQXJ 2Z5HA 2WSEJ 2PBIA 3MZKB 4R4MA 3SOLA 2ACXA 3O6QA 5CMZA 2Y8DA 2WZHA 1S35A 3A0BH 4DBRA 4X65T 4LF5T 4JYAT 3BRTB 4DOJA 1BSNA 4GK0E 4MALA 1JY3O 1FS0E 1J1DB 1NTMJ 4U2YA 4AYCA 5JH7E 2IX7C 5GTIE 3PE0A 4ZNCA 3C8VA 2K9YA 1QUUA 1YBKA 1EZVD 4JI3T 1RH5B 5HXHA 2V7IA 4B3RT 4Q25A 3GF7A 4GKJT 1WYCA 2XASB 2XM2A 2X67A 3SFDA 3RYCE 3L09A 3OJAA 4IL4A 2GUSA 1HG5A 3CWBJ 3F89A 3ZPOA 4EV6A 2A3DA 3BCCD 2FJEA 1LWUC 1KF6A 3KVBA 1YQ3C 3P7KA 4HH2A 4MHCA 1UX5A 2HR3A 2BVMA 1NEKA 2BG9E 2WDQA 5AVTB 3UTKA 3ZN1B 1SQXG 3VOPA 1SQBD 1EQ7A 2QE7H 1NWMX 1YD8G 2IAKA 1L0LG 2DHRA 4ZHQE 2AE9A 3DP7A 2HG5D 4IE4A 3RIFA 4DMWA 4EAHA 5JTGA 5CBOA 2KNCB 4AKRB 3Q5RA 2FJDA 5JDNA 1Q86Q 5E0OA 2MYSA 5AVYB 2DL1A 4OHFA 3H1KE 1OW7A 4C91A 1VQMP 3EDVA 1T98A 2E9XB 5APXA 1LT9B 2FY8A 1KORA 2WITA 3BATA 1EXJA 5LP6E 2NW8A 1K9MQ 2CM0A 4BWNA 1LP1A 1SUMB 2VB6A 2PTFA 2WAUA 1LTSC 1KQFB 3V5SA 3TGUD 1W0BA 1WT6A 4DZOA 3VMAA 4GKGA 1NTKG 3IN6A 3H1IE 3CMAP 1FMVA 1RE3C 1X9VA 1OEDB 3M91A 4GDOA 1KQLA 4UF0A 1IZNB 3UQ4A 4PD4I 1ZRTE 2KNDA 4LMLA 4Z1MH 4O2BE 2QJPC 2UXBT 2R44A 4PK6A 3SFDC 2YKOA 1N86A 4GOFA 5APVA 2JDIH 4NXMT 5AW0B 1AJYA 2VRSA 4A7PA 2BEQD 3Q2MA 3U1CA 2BCCE 1E5WA 2W6AA 1KYOI 2LHRA 3AE3C 3QC9A 2BS4A 3CK6A 3ZKRA 3WI3A 4HFCA 2LOPA 4UVBB 2PP6A 3KBUA 3M3ZB 3RK3B 1MUUA 2ZJSE 2KINB 1HNXT 4TV9E 2ZYGA 3MJXA 5H2FH 1KYOD 2IBZD 2DWGA 1S9KD 4WZXA 3C1LA 3V6IA 2A06D 3M9BA 3QH9A 2YXQB 2I8DA 1FC2C 5AW4B 3S1KA 1QVFO 1AFOA 2WBLA 2IW5B 4I50E 4DUYT 4DR6T 2N1TC 1ZOYA 1KYOE 2KWHA 2ODUA 2HYNA 4ILUA 5E79H 1GL2C 3L39A 1NTMK 2PFVA 5B5EE 3I5CA 1FJPA 1LNQA 1L2PA 2D2CD 3CX7B 1VDFA 4CN1A 5KKZB 2XQAA 4UB6H 3AB3B 1QVGO 2VASA 1NTZE 2M5AA 2K48A 3L35A 5AW5B 3AE7A 4C90A 1L0LE 4NPPA 4ZMDA 3RC3A 3GLMA 3S4RA 2C5JA 4OX9T 1NU1E 2DNXA 3ONJA 3UIAA 4PD4E 2CLYB 2Q9QC 3L72E 4YSZA 1VPCA 5FMNA 3VYIA 1JNZA 2JRKA 3BQIA 2K9JA 2XY8B 4CN4A 4AQRD 3KZIH 2IC6A 1QSDA 1HX8A 1J1JA 4YJ2E 2WWWA 3H1JG 1W5CE 4QH1A 2GK9A 2CXFA 3Q5XA 1QLBA 1SQXK 4WY4C 2GM4A 4YFSA 4U7JA 3L75D 1I94T 1BDCA 1KQSO 2VVSA 5AQIB 1GK4A 1FZCB 2CWYA 5EZYE 2VQFT 5LJMA 5AQKB 3RPUA 4OGQC 1RQVA 1DU2A 5L47A 4HFEA 1FZCC 4RO0A 1QLED 1HUCA 2QA4P 3PDYA 3A7MA 3UQ7A 3F2EA 3RK3C 4WW0A 3CX5H 5AVVB 2FFDB 5FL1A 1WYBA 1PGPA 1SLQA 1D0ZA 4HN9A 3B5NB 1N7LA 1HJ0A 4PJ0E 1FJGT 3PLNA 1L0NJ 4TT3H 4LFBT 1LJ2A 3U1AA 4UR9A 3KBTA 5AQLB 3K1SA 4Z91A 1SQPE 3TLVA 4Y28J 2HHHT 3R4YA 1Y64B 2ZMAA 3N4XA 3ETUA 3D71A 3LSVA 2UUBT 5LMNT 1L0ND 3H1LD 4I1LA 3AVSA 3N9QA 2D2SA 5AVSB 2MJZA 3H1KJ 3KHUA 1D1BA 1HBWA 2K9AA 3PURA 5JDFA 1VF5C 3FZHB 3H1LJ 3C51A 5APYA 2NWBA 2BS3A 3HKDE 3ABVA 1T72A 4BXLA 1FAVA 3I0QA 3VRBA 2QJYB 1PGOA 4RKUJ 4IDNA 3P8CE 4L5GA 4TNVA 2EHOA 2AXDS 2QRXA 3Q9DA 4M3LA 2CPBA 3EABA 2Y0CA 2AXTE 5AVRB 4IDZA 4EB6E 2KS1B 3RX6A 3AEEA 2K88A 2MBGA 5LG4A 2LEHA 2WSSV 2J62A 1J1DC 4U3FD 3KPEA 2OYHC 2Y9ZA 3V2RA 4RJTA 2XSAA 1T3UA 1MZ9A 4IE0A 4OFZA 4IL6H 2I1KA 1P84I 1SE7A 3TK1A 3M0DC 2QM7A 2OYIA 2A2FX 3P4SA 1OVRA 3J9X1 5B5EH 5EK4A 2WWVA 1LT1A 3MP7B 2LKMA 1VQKP 1JY2O 2WT7A 2H3RA 5EFWB 4JBWF 1HCIA 1H0TA 3QUJA 3AEFC 4KHXA 5AQNB 4PJLA 4AQFA 4E7SA 3CXHI 3ZYLA 2X0HA 1KB9E 1HGVA 3C98B 2QGSA 4DV2T 1GU4A 5L3GB 1YJ9P 3MTUE 5BVZA 4QKNA 1KFMA 3KZIE 4DIDB 2UXXB 1US7B 1PPJD 4IE6A 1SFCA 2YU2A 2YIUB 4Y99B 4A97A 5AQUB 1M1KQ 5FXVA 4O9BA 2XKMA 3VMYA 4CXWA 4U7YA 2X9YA 3LBXA 1E79H 4DJGA 4DBQA 5JR9A 1LTAC 3RL0B 4G63A 5LA6E 2K3WA 2G8YA 5JDLA 2L3LA 1FIOA 2WPRA 3PUSA 5BU8B 2VKDA 3M0AA 5APQA 1NWQA 2W2UA 1LT9A 2VWAA 2QJKB 4PJ0H 1VQOP 4K0KT 1Q90D 3ZSSA 1GW3A 3PH0A 1MNDA 3AVRA 1L0NK 2VVNA 4EZ4A 4OK0A 2BKOA 5CA0E 3ZMVB 2ZT9C 1MIWA 5HAXA 4O4IE 3RI5A 2LSGA 2Q6QA 3H25A 3MUDA 2BVLA 3CMLA 2FXOA 1FBMA 1FZFA 4GK5E 3HL6A 1KNRA 1S5LH 1M56D 1PP9J 2Z6EA 3ZMZB 2C0XA 1I6ZA 2WMOA 4JI4T 3VHLA 3RKGA 2LM9A 3HUSA 2ZAEB 3SSUA 2A9UA 2AXTH 4AQYT 3LW5H 3O1JA 2PG8A 1URQA 3AEAC 2V7JA 4DR4T 3BK9A 1ZP0A 4XFJA 3HRNA 5AQMB 5HYAA 2L5GB 1DD4A 1X9BA 1KFNA 4IL6E 4Z90A 3HA4A 1LTJB 4ZZBA 5LB7B 5CCGA 1M7KA 4UXNB 4H13D 2FBWA 2WPSA 3H3MA 3FB2A 4WBNE 1ZV4X 1NTMD 1L4AB 4EZHA 3RYHE 1OX3A 4UELA 5KX5E 3AEFA 1BE3E 1FE6A 3AE6C 4JI2T 3W68A 1LVFA 2V7LA 1UGOA 3CX5E 4YY3T 3AEGA 3TGUJ 1Y01A 2LT3A 4QHOA 3AE4C 5BU5A 1SP4A 2X51A 1JMBA 3F5HA 1SS1A 3FXDA 3OBVE 3IHRA 2ZT9B 4H13B 3CLQA 2E76C 3CWBD
chains in the Genus database with same CATH topology
1JY2P 4UVCB 2KB7P 4H63H 2KWIB 3ZLIA 4NUVA 4OYJA 4IFMA 2Z5HA 1QL2A 4C46A 5F3JA 3PP5A 2PBIA 2WPQA 4CI3B 3MZKB 3SOLA 1LKXA 2ACXA 4I4TE 2X68A 3EVYA 3NFQA 5CMZA 1CZQA 2Y8DA 1JMMA 1S35A 3AA1B 4DBRA 2X9HA 2HLOA 1G1JA 3O8ZA 1SVFA 5AW9B 3RK2B 4PW8A 4CXXA 2V26A 3BRTB 5JVDE 1SFCC 4DOJA 4GK0E 4MALA 4A56A 1JY3O 5APUA 1J1DB 2NPSB 4AYCA 4E7ZA 2IX7C 2NP9A 4WY4D 5JH7E 1KILC 3RRCA 3PE0A 3MGNA 4JYBA 4L0RA 3RK2C 2VKJA 1BR2A 1T3JA 2Q7CA 1QUUA 3ZCIA 1YKHB 3UULA 1KILA 3RL0D 2WMNA 2V7IA 5HXHA 2V1DB 4UV8B 2LE8A 3NTNA 4XA4A 3PTRB 2HPCA 3BRVB 5L3FB 1FZCA 1WYCA 1SQVK 1MMDA 2XASB 2PJQA 2X67A 4WB4A 5BMVE 1M1JC 3KV5A 1LRZA 3RYCE 5EK2A 3KFWX 5HXEA 1LWUB 3L09A 3OJAA 1EZ3A 2I1JA 4WBOA 1SQBK 2GUSA 1HG5A 2XHEB 3ZPOA 2ZFCA 2RA1A 4HGAA 2A3DA 1LWUC 3ZYKA 1M1JA 3KVBA 1JY3N 3P7KA 4HH2A 3LK2B 2IFMA 1UX5A 2BVMA 4MHCA 4PNIA 3WAJA 2WTYA 2M3BA 2ZXEB 5KDMC 5AVQB 5AVTB 4MBQA 3UTKA 3M9QA 3ZN1B 2J58A 4X1IE 3VOPA 3R6NA 5FY7A 1N7SD 2C9LY 3KQGA 3MACA 4DVDA 3A5TA 5LGUB 4H9SE 3CQXC 2ES0A 1LTJC 5KLVK 3GHGA 1EQ7A 1A02J 1NWMX 1YD8G 1LTTC 2C5IT 2IAKA 2DHRA 2J1DG 3UUNA 4ZHQE 1HS7A 3DP7A 2HG5D 3EFGA 3VMXA 1BR1A 2FKWB 3RK3D 4IE4A 5FNVE 1IC2A 2BZBA 4DMWA 2E8IA 2FXMA 4EAHA 4ADZA 3BQKA 2P9BA 1N2DC 3L36A 4AKRB 4AKIA 5JDNA 5L3EB 4N78D 2Q3IA 2D0UA 2KT9A 5DABA 3HE4A 2JEEA 2MYSA 5E0OA 5AVYB 5HXRA 5M4YA 3IFMA 5HWYA 3H32B 3CQGB 2WSFH 5AVWB 1X8YA 4LGDE 3C4WA 4OHFA 4ANJA 4C91A 3B5NC 2V7KA 4LC1A 2FYUK 3U59A 1T98A 2D5UA 1NU1K 1WRGA 3EDVA 1JCCA 3MIWA 2E9XB 1FJKA 2E9XA 5APXA 4ZS3A 1LT9B 1WR6A 4KP3C 2YMYA 2JMHA 4ZI3C 2WITA 3BATA 2QM8A 1G73A 5FY0A 5LP6E 2FYZA 1HJBA 2NW8A 2CM0A 2WM9A 2CXDA 1MNEA 2R5BA 4H9RC 3RRWA 3B5ND 3LBXB 2VB6A 2XUEA 2WAUA 3ZJ2A 4JEHB 1LTSC 3PU8A 3ZJ1A 5J2UE 1NKNA 3V5SA 3EDUA 1RF1A 1WT6A 4DZOA 1RF1B 2CCQA 2ZM8A 1MMAA 4ZI3D 2JMKA 2LSYA 4UIGA 4GKGA 3N9PA 3LK3B 1X79A 4C7NB 2YKPA 2ZM2A 1FMVA 1RE3C 3Q5WA 3KV9A 1X9VA 3B57A 1URQC 1BR0A 3HE4B 5CCHD 3PU3A 1KNZA 3M91A 3ZEFB 4XBFB 1LTIC 2OYHA 2FFDC 1J2JB 2CE7A 1KQLA 4UF0A 3HD7C 4ZOLE 3O1HA 1IZNB 1JCDA 1GU5A 1IFIA 5LJNA 2NPSD 2NW7A 2KNDA 2KYVA 2N2NA 4KMCA 3E0ZA 2C5KT 3AA7B 2PAJA 4FJOA 4O2BE 4TZ4C 5DJQC 5HXCA 3HD7A 4XE5B 4HKAA 3L37A 2W0GA 2XAHB 1NTKK 5H6QB 2N1TD 2XAGB 4EOTA 1NHLA 2BDEA 3VKHA 3L4FA 1AQ5A 3SWHA 4PK6A 3E1IA 5JDQA 3J7Yq 2YKOA 3MA9A 2HPCB 1N86A 1HFAA 3LG7A 3P7IA 4TUYE 5APVA 4UV9B 3MXZA 1ZR4A 5L3DB 3HE5B 5LHHB 4H63V 3SRZA 4PJMA 5AW0B 2KP8A 2W00A 4G2AA 1LWUA 2VRSA 3OJAB 1GTWA 1H88A 5KJ7C 2N1GA 3CQCB 3U1CA 2W6AA 1E5WA 3F31A 3FBLA 3Q2MA 3JC6D 2LHRA 4P09A 1G8XA 2W6BA 3QC9A 1N73C 1RF0A 3V5BA 1HWTC 3NRYA 3TKLB 2XZRA 1IJ6A 3WI3A 5LHGB 4UEMA 5APWA 5LXTE 1OXZA 4O2AE 4O8SA 2LOPA 2KSJA 4UVBB 2PP6A 2LJLA 3JC6C 3KBUA 1FDMA 2N1TB 3RK3B 1MUUA 5AVZB 2CLYC 2Q9QB 2RP4A 3ANWA 2M8RA 4ISTA 1URQD 2KINB 1HVVA 4QWNB 4TV9E 3S4UA 2A45I 3GWHA 3MJXA 4IIJE 2LOSA 2H43A 1S9KD 2DWGA 4GOUA 4CI1B 1G2CB 3OA7A 5CCHA 4O4LE 3W15B 3GN5B 3ZMSB 2R32A 3GN5A 1SFCD 4YLHA 3M9BA 3V2NA 3DTOA 4U72A 1OWAA 3LFMA 2WBLA 5AW4B 1ZLLA 2YO2A 3BASA 5AW7B 1T2KD 1AFOA 1CW5A 1G1IA 3VMZA 5AW8B 2W63A 3LK42 4I50E 2IW5B 2OYIC 2N1TC 1GL2B 3T97A 4AKLA 3VTPC 2B1EA 2KWHA 2ODUA 2HYNA 3VP9A 4ILUA 1GL2C 2CPSA 1NTMK 4BA9A 2PFVA 2HFED 4O4JE 2VK9A 3D0TA 3I5CA 3M9HA 4AUWA 3OKQA 1FJPA 2ZM0A 3CKDA 3C4XA 1GD2E 3CX7B 4GYSA 1VDFA 4Y99C 2LSJA 4WNKA 2DCFA 2LSKA 2V7MA 3DJBA 3AB3B 3RH3A 2VASA 1FZAA 5JR9B 2IFNA 4NUUA 2K48A 5FY1A 4EXTA 3L35A 2C0WA 3N7NA 5AW5B 3CI9A 1JO5A 4HE8A 4C90A 2G0UA 3RC3A 3OYZA 2VL8A 2C5JA 2WT7B 3NXSA 3IEEA 1CI6A 2DNXA 4BAYB 4H9OC 3UIAA 4IHJE 2CLYB 2Q9QC 4V1Av 4X20E 2XAFB 2KLVA 2H7OA 1ZKEA 3VKGA 3H37A 5CB4E 1FEWA 3G3ZA 2NTXA 1VPCA 3M65A 1J1EB 3VYIA 2OYHB 2JRKA 3BQIA 4IGUA 5FMNA 5FXWA 3AAEB 5FP3A 3ZCJA 3A5XA 2A45G 3TSIA 5FXXA 4AQRD 5CJ4A 2FFDA 3ZC1A 3M0DA 2IC6A 3ZMUB 1QSDA 4TX5A 4WY4A 2YO3A 1HF8A 1HX8A 3I9WA 3TNUA 4PK4A 3VU7H 4YJ2E 3UT5E 2WWWA 3U3IA 2GUVA 1DX7A 3N9NA 1GK6A 1FZBA 5JRCA 2GK9A 3H6PA 1CUNA 1ZEEA 2CXFA 4GT1A 2HH7A 1SQXK 4WY4C 2LHNA 3Q5XA 1KILD 4ISSA 4X1KE 3I9YA 5KJ7A 1HH0A 2GM4A 4YFSA 4QX7B 1IK9A 2X9XA 2W61A 1GK4A 5C8YE 3N9LA 4H9NC 1JOCA 1FZCB 2CWYA 5EZYE 4JF7A 4EIJA 3WMM0 3V4WA 2A72A 2EHOD 4PJNA 5LJMA 1QL1A 4JYCA 1NOHA 4XAXB 3RPUA 3A7OA 2POHA 2R5DA 4PFOA 1FZCC 4DNDA 1NKZB 2YEVC 3N2KE 1HUCA 3N2OA 3PDYA 2CEAA 1T8ZA 3N9MA 4I43B 4W7YA 2CMRA 3F2EA 5LBQB 3RK3C 1LT9C 5AVVB 2FFDB 3IR9A 5AW1B 4WW0A 1WYBA 3MD0A 1N7SA 5KTBA 1A02F 1URQB 3PUAA 3FBZA 1SLQA 1YYCA 1D0ZA 1D0XA 4HN9A 3B5NB 1N7LA 2K24A 3P32A 5AFUL 5CCHC 2DI4A 2Q9IA 5ADXL 5H6RB 1FZEA 3HTKB 1YTZI 3U1AA 5AW3B 2OA5A 3KBTA 4CZZB 1RF1C 1SFCB 3K3NA 1KILB 2O1JA 1D1CA 2KXPB 3AAAB 5ETWA 1FOSE 5FXZA 1IFMA 2NPSC 2UXNB 4QX8B 3T8OA 1D1AA 4OH8B 4RESB 1Y64B 2ZMAA 3N4XA 3ETUA 3ESLA 3P8CD 1GL2A 1HGZA 4I1LA 3AVSA 2OARA 3H32A 3HR0A 3N9QA 2D2SA 5L3CB 3KV6A 5AVSB 4AKHA 2MJZA 1D0YA 1MIYA 3H3AA 4N78E 5HXSA 1UCUA 1D1BA 1HBWA 1IJ5A 2K9AA 3PURA 5EK3A 1Z56A 1B7TA 5JDFA 4BJNA 3EQ2A 3C51A 1YTZT 2YKQA 5APYA 2NWBA 2YINA 5J1GA 3RC8A 2JJ9A 2P2UA 5KJ7D 2YU1A 3HKDE 5LHIB 3MKDA 1AJ3A 1JNMA 1FU1A 5AVXB 1FAVA 3I0QA 3O1IA 3EUHA 2XU6A 2WWUA 3FHNA 3UUXB 3C4ZA 3P8CE 3ZN0B 2P67A 4L5GA 5GONE 2J59M 2EHOA 2IPPA 2E43A 3Q9DA 3NMDA 4M3LA 4I6MC 4EIWA 2CPBA 2VKOA 1JY2N 1LTBC 3I0OA 2E9XD 2W27A 1WLXA 5AVRB 3K3QC 4IDZA 3CWZB 4EB6E 2X9WA 2MBGA 1S9KE 3RX6A 4ZI2C 2LEHA 5LG4A 4KUMB 1YW0A 2WSSV 4CXYA 2XTLA 4JLEA 1ZN5A 1MMNA 1YKEB 4DO0A 1RE3A 1V9DA 3KINB 5FYMA 5JREA 2XAJB 3OYXA 1J1DC 3E22E 3KPEA 1XTGB 1J1EC 3TNUB 2OYHC 3LJCA 3AAIA 3V2RA 1SA0E 2HODA 1T3UA 3I1AA 1MZ9A 1RE4C 1VOMA 2SPCA 4IE0A 1L0LK 2H8PD 4OFZA 1HTJF 2I1KA 3GHGC 3P8MC 3TK1A 3M0DC 2QM7A 2OYIA 4IFDK 2A2FX 4PK5A 3J9X1 5JDGA 4W80A 2L9QA 4H9QC 5EK4A 4ERRA 2E42A 5JDMA 2LKMA 4Z8XA 4WBAA 1JY2O 2E9XC 4H9PC 2EHOB 4AQGA 5JR9C 2WT7A 2H3RA 4IE7A 3UFEA 5LGTB 2HPLA 4C7NA 4EYUA 1HCIA 3B13A 1DEBA 2Y6XA 3QUJA 4KHXA 4PJJA 4U74A 3NRXA 3RYFE 2WSEH 1HTLC 2D0TA 4PJLA 1CSBA 3L3PA 1DH3A 4UF0B 4QXHB 4L9IA 2N1TA 4AQFA 4E7SA 4AI6A 2P7JA 2DLRA 3PUQA 1VRBA 5F8PA 3ZYLA 2MTQA 4MLKA 1N7SB 1HGVA 2EHOC 3C98B 4YJ3E 2JQQA 3VN0A 1MFZA 4GIFA 1RY3A 3HUSC 4LLHA 2C9NY 1U5PA 1L4AA 3GMIA 4JUYA 5LGNB 1GU4A 4FI5A 4B86A 5L3BB 5DQVA 1Z0PA 1W2EA 4N3YB 1IO4A 3GA8A 3N5LA 5L3GB 3MTUE 2KMFA 5BVZA 1H89A 4QKNA 3SWFA 1KFMA 1L4AC 3N9OA 2Z5IA 2UXXB 1US7B 1KK7A 4AXPA 3ETVA 4IE6A 3O9XA 4JEUB 5AVUB 3HE5A 1LTJA 4GYRA 1SFCA 5CCGC 4TN7B 1ZV8A 4IFFA 4ZKUA 2YU2A 4Y99B 3AA0B 1IJDB 3N2GE 4KBMB 1NO4A 4CQIA 5FXVA 2CWOA 4O9BA 2XAQB 1WRDA 2XKMA 3VMYA 4X1YE 4CXWA 3LIDA 2X9YA 3LBXA 1M1JB 3VP8A 1SHZC 4ASKA 3RYIE 3C50A 3HKEE 4DBQA 5JR9A 1LTAC 3RL0B 4G63A 4J2CA 2O1KA 1LTGC 2P1JA 3M06A 3II6A 5LA6E 2W62A 2YK0A 3B5NA 2M67A 4ZS2A 4YHJA 3V2PA 1NTZK 4I2LC 4P0BA 5JDLA 1L4AD 2L3LA 3KVAA 2O01H 1JY3P 1FIOA 2ZLYA 2XQYA 2WPRA 1PFIA 5BU8B 3PUSA 2VKDA 3V5UA 3M0AA 1JTHB 3KDSE 4AQFC 5L2LA 4ZI2D 1RF0C 3WAKA 5APQA 1NWQA 3IF8B 4W7ZA 1LT9A 3NZQA 2VWAA 5KMGP 1UX4A 3RKOA 1GW4A 2I59A 2K5BB 3NZPA 1GW3A 3HKCE 4HFVA 1MNDA 4F6RC 4MFRA 3BVHA 2QA7A 2HPJA 3AVRA 3U78A 3IBPA 4HEAA 1H7CA 5IYZE 1FMWA 5CA1E 5AW2B 1L0NK 1ZR2A 1N73B 4EZ4A 3HD7D 1N73A 2A45H 4OK0A 5CCGD 3F57A 2KZ7B 3V2QA 4HYTB 3ZMVB 5CA0E 4IE5A 5TAOA 4OYKA 5A1LA 2KLQA 2Y48B 1MIWA 4UVAB 5HAXA 4EYYR 4O4IE 5LNKA 1BR4A 1KZUB 2LSGA 4I55E 2XNXA 5LOVE 5JRCB 5APTA 4ZKPA 2HODB 2XV5A 2CA5A 1MV8A 3MUDA 3C64A 2BVLA 4K0UA 3CMLA 1JTHA 5JQGE 1LVKA 4O4HE 3KDPB 1FBMA 4DMVA 1FZFA 3NBXX 2OYIB 4GK5E 3HL6A 2NPSA 3OAKA 3FXEB 3HI2A 2BASA 1S94A 2Z6EA 1H8AA 2C0XA 1HG2A 2H7VC 3ZMZB 2WMOA 2CXLA 3VHLA 4HTEA 2JJLA 1FOSF 2ODVA 5LYJE 2LM9A 5APSA 3BQLA 4TV8E 3HUSA 2JPFA 1O3XA 3HUSB 3CVRA 4P0AA 2MOZA 2R3CA 1IFNA 3HD7B 2X66A 1G2CA 3LW5H 3O1JA 2VKHA 2PG8A 3A2AA 3CPZA 3CX8B 1URQA 2QGSA 1SQPK 5CHXA 2V7JA 5LBMA 3LIEA 3TYYA 5CJ0A 1FZGA 2N9DA 1NAFA 2KOGA 3HTKA 5AW6B 3BK9A 2H7HA 3V4QA 1T2KC 2IC9A 3HRNA 5HYAA 1GZLA 2L5GB 2Z4EA 1SQQK 1JUNA 3K8PC 3ZMTB 3UUMA 1KFNA 1XTCC 3CL3D 3HA4A 3KV4A 1LTJB 1GL2D 3GHGB 5LCYA 3FXDB 2WSCH 2DWKA 2Q9QA 3ANWB 3K3OA 3SS1A 5CCGA 1LGHB 3O4XE 4UXNB 1M7LA 3QK6A 4CI2B 2YNYA 2WPSA 3FB2A 2X0LB 4WBNE 4ZI7E 1ZV4X 2Q5UA 3MK7C 5J2TE 1L4AB 3R84B 5IHYA 4AKGA 4PFPA 3C9IA 4EZHA 3RYHE 4EOZB 5KX5E 4UELA 1GDTA 1CI6B 1E1HB 1RE4A 2LSIA 3A3YB 3R2PA 2NTYA 1ZHCA 3AA6B 2NOXA 3PUGA 3RL0C 2L8KA 1LVFA 2V7LA 5HWXA 5JDHA 4QXBB 3RK2D 3CX6B 4B6XA 3SWYA 2LT3A 1NH4A 4BJMA 1IAPA 3ZYMA 1IFJA 1MMGA 4QHOA 1N7SC 4WY4B 3ZC0A 1MIVA 4N6JA 5BU5A 1SP4A 2X51A 4PAGA 1IFDA 4GIWA 4C7RA 4M1PA 2N9BA 3HKBE 3OBVE 2C0SA 3IHRA 3E08A 2Q9QD 3B8EB 1U4QA 3KYQA 2NW9A 1X79B 3CLQA 2XDJA 3ONXA 2WZ7A 4QXCB 4XZCA 5DQWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I2L C;  5APV A;  5AW3 B;  3HE5 B;  2WPR A;  2Z5H A;  4C46 A;  5AW0 B;  3M0A A;  2KP8 A;  2WPQ A;  1FOS E;  2VRS A;  1GTW A;  1H88 A;  3NFQ A;  2W6A A;  4RES B;  5CMZ A;  5APQ A;  1CZQ A;  1NWQ A;  3O8Z A;  5AW9 B;  2H7H A;  3V5B A;  1HWT C;  5APU A;  5AVS B;  2XZR A;  4AYC A;  5APW A;  1OXZ A;  5AW2 B;  1HBW A;  3MGN A;  4JYB A;  1MUU A;  4HYT B;  5APY A;  5AVZ B;  2Q7C A;  2P2U A;  3NTN A;  1JNM A;  5AVX B;  1FAV A;  1S9K D;  1G2C B;  2XU6 A;  5APT A;  2XV5 A;  1MV8 A;  2R32 A;  2P67 A;  2IPP A;  3M9B A;  3KDP B;  3NMD A;  4M3L A;  1OWA A;  4I6M C;  2E43 A;  5AW4 B;  2YO2 A;  2ZFC A;  5AW7 B;  1T2K D;  3OAK A;  3VMZ A;  5AW8 B;  2W27 A;  2BAS A;  5AVR B;  3P7K A;  3T97 A;  1H8A A;  1S9K E;  3VTP C;  2WTY A;  2ZXE B;  5AVQ B;  2JJL A;  5AVT B;  1FOS F;  5APS A;  2C9L Y;  3KQG A;  3A5T A;  1O3X A;  3I5C A;  3M9H A;  3TNU B;  4AUW A;  1NWM X;  1A02 J;  1YD8 G;  2R3C A;  1GD2 E;  3VMX A;  3A2A A;  3P8M C;  3TK1 A;  2QM7 A;  3L36 A;  3L35 A;  5AW5 B;  3LIE A;  3TYY A;  2Q3I A;  2E42 A;  3HE4 A;  2N9D A;  1NAF A;  3HTK A;  5AVY B;  5AW6 B;  2WT7 B;  2WT7 A;  3NXS A;  3V4Q A;  5AVW B;  1X8Y A;  1CI6 A;  4C7N A;  1GZL A;  1T2K C;  3UIA A;  1JUN A;  4LC1 A;  4KHX A;  3VYI A;  5APX A;  1CSB A;  1WR6 A;  1DH3 A;  2QM8 A;  2P7J A;  4AQR D;  1HJB A;  3M0D A;  2YO3 A;  2R5B A;  3TNU A;  2YNY A;  2WPS A;  3VN0 A;  1MFZ A;  2WWW A;  2C9N Y;  2Q5U A;  1GK6 A;  1GU4 A;  4DZO A;  4B86 A;  4GT1 A;  1IO4 A;  4GKG A;  1CI6 B;  1X79 A;  4C7N B;  1H89 A;  3SWF A;  3A3Y B;  2Z5I A;  1GK4 A;  3HE4 B;  3M91 A;  5AVU B;  3HE5 A;  1J2J B;  1KQL A;  3V4W A;  4JYC A;  1GU5 A;  3A7O A;  1WRD A;  2R5D A;  3VMY A;  2N2N A;  1HUC A;  3LID A;  1SP4 A;  4XE5 B;  2N9B A;  3L37 A;  5AVV B;  3IR9 A;  5AW1 B;  3B8E B;  3MD0 A;  4EOT A;  1A02 F;  1SLQ A;  1YYC A;  3M06 A;  3P32 A; 
#chains in the Genus database with same CATH topology
 4H63 H;  4IFM A;  1X0T A;  2WCA A;  1QEX A;  3AXJ B;  2WPQ A;  4JV5 T;  2JKV A;  1LKX A;  4I4T E;  2X68 A;  2B87 A;  3NFQ A;  4JI5 T;  1JMM A;  2HLO A;  4PV1 D;  1SVF A;  3L71 D;  4QH5 A;  1NTK J;  2ZYA A;  2WQY C;  2NPS B;  4TNW A;  2NP9 A;  4WY4 D;  1KIL C;  5F5W A;  2VL0 A;  2NRG A;  3H1H E;  3MGN A;  4L0R A;  2K9J B;  3RK2 C;  1BR2 A;  2Q7C A;  3AE2 A;  4DV0 T;  3ZCI A;  1YKH B;  1KIL A;  2WMN A;  1XNQ T;  1Z8U A;  4XA4 A;  5KLI C;  2J4G A;  3BRV B;  5L3F B;  3AE3 A;  5EK2 A;  1M1J C;  3KV5 A;  5HXE A;  2XQ7 A;  3B4S A;  2QJY C;  2IDO B;  4WBO A;  1PGQ A;  2ZFC A;  2RA1 A;  4HGA A;  3ZYK A;  5AQT B;  4DV6 T;  2E5T A;  3H1I D;  4K35 A;  4LMJ A;  5AVQ B;  3OW2 O;  3M9Q A;  3CC2 P;  5FY7 A;  2C9L Y;  3KQG A;  1NTZ D;  3MAC A;  5LGU B;  3CQX C;  2ES0 A;  4IST A;  5KLV K;  3GHG A;  2J1D G;  2D2C C;  3VMX A;  1BR1 A;  2FKW B;  5FNV E;  2FXM A;  3CCL P;  4ADZ A;  2WZI A;  5ABG A;  3L36 A;  3AEB A;  5L3E B;  1OVU A;  2IYO A;  4N78 D;  2D0U A;  2P10 A;  3HE4 A;  3IFM A;  5DJT B;  3B5N C;  4LC1 A;  4JI0 T;  4ILC A;  1FJK A;  1Q82 Q;  2YMY A;  2UXC T;  1G73 A;  2QM8 A;  5FY0 A;  5HEJ A;  1HJB A;  1X22 A;  2YOE A;  4LF8 T;  2R5B A;  2YKS A;  3ZJ2 A;  3LBX B;  4DR7 T;  1RF1 A;  3ZT6 A;  2CCQ A;  1ZP0 C;  1RF1 B;  3PTZ A;  3P4W A;  3OTO T;  4EDF A;  2ZYD A;  4ZI3 D;  1NU1 G;  3N9P A;  3JCU H;  3LK3 B;  4C7N B;  2ZM2 A;  3Q5W A;  3KV9 A;  1BR0 A;  1URQ C;  3L72 D;  5CCH D;  2WP9 A;  3RBZ A;  3ZEF B;  1LTI C;  3WUT A;  2OYH A;  1J2J B;  3O1H A;  1BE3 D;  1JCD A;  1EDL A;  2QEX P;  4I7Z B;  3TGU E;  2QIW A;  4XE5 B;  2W0G A;  1NTK K;  1EZV E;  4EOT A;  3D70 A;  3L8R A;  4DCK A;  2ZVO B;  3P7I A;  1AVY A;  3MXZ A;  3L73 G;  1D7M A;  5LHH B;  4H63 V;  2E5L T;  3AE4 A;  3CQC B;  3FBL A;  1KNP A;  1VQ9 P;  3JAD A;  4U31 A;  3P50 A;  3FGA D;  1G8X A;  4ZEY A;  3NRY A;  3L72 J;  3IA3 A;  2IBZ E;  1IJ6 A;  1H0T B;  4O8S A;  3AEC C;  3PRJ A;  1FDM A;  2RP4 A;  1HVV A;  3S4U A;  4IIJ E;  2LOS A;  4CI1 B;  5CCH A;  2BG9 B;  2J47 A;  3P4R A;  4U72 A;  3DTO A;  3ZCJ A;  3LFM A;  1CW5 A;  3BAS A;  3I56 P;  2IIU A;  2W63 A;  5AW8 B;  5C39 A;  3CC4 P;  3T97 A;  3VTP C;  3CCM P;  2XPK A;  1VQ4 P;  3L70 D;  2CPS A;  3CX5 I;  1L0L D;  2L91 A;  1PIX A;  4QXC B;  3D0T A;  3M9H A;  1GD2 E;  4IRE A;  4GYS A;  1SQQ E;  4Y99 C;  4AIU A;  1M8O B;  1FZA A;  3TLU A;  5JR9 B;  3VRA A;  3W67 A;  5C3J A;  1SQP G;  1W0A A;  3CX5 D;  4H9O C;  5J0Z A;  4V1A v;  2XAF B;  4KX6 A;  3M65 A;  2FBW C;  1J1E B;  1KIL E;  1SQV D;  3TSI A;  3GG2 A;  5FXX A;  2FFD A;  3ZMU B;  1DIP A;  3TGU G;  3TNU A;  4PK4 A;  3UT5 E;  3U3I A;  1GK6 A;  1NTK D;  4EOZ B;  3H6P A;  5JRC B;  2LHN A;  4X1K E;  2V4H A;  1R5L A;  1YQ4 A;  5KJ7 A;  2X9X A;  2W61 A;  3X1D A;  3AE1 C;  1DD3 A;  1JOC A;  3CCV P;  4EIJ A;  2A72 A;  4GOD A;  4HFI A;  4PJN A;  3UFG A;  1QL1 A;  2RKL A;  4PFO A;  3AE8 C;  4IDO A;  2CEA A;  2K1A A;  2NZ2 A;  4W7Y A;  4KT0 J;  3IR9 A;  1Q7Y Q;  5KTB A;  3PUA A;  1URQ B;  1GMJ A;  1D0X A;  2K24 A;  3BCC J;  2QYW A;  3QNU A;  5H6R B;  1JM0 A;  2E2A A;  5CGM A;  4CZZ B;  2JQH A;  1SFC B;  3AAA B;  2KXP B;  3T8O A;  4OH8 B;  2AXC A;  4RES B;  3QB5 A;  3P8C D;  1HGZ A;  1HR0 T;  2E75 C;  3KV6 A;  3RQW A;  4AKH A;  3QOF A;  5KLV G;  1JEK A;  5EK3 A;  2V5D A;  1Z56 A;  3CCR P;  1YTZ T;  2IBZ G;  2YN6 A;  2P2U A;  3MKD A;  4LF4 T;  1AJ3 A;  1BCC J;  5AVX B;  1KYO H;  1S1C X;  2A06 G;  3O1I A;  3RGU A;  2WWU A;  3EFF K;  3C4Z A;  2XJ7 A;  2RN0 A;  3ZN0 B;  4X66 T;  2E43 A;  4EIW A;  4I6M C;  3I0O A;  1JY2 N;  1LTB C;  1BCC E;  1P84 D;  2FJB A;  5HEH A;  3CWZ B;  1YW0 A;  5KAF E;  4CXY A;  1IBK T;  3GF3 A;  2XTL A;  4JLE A;  1MMN A;  5CJ5 A;  3KIN B;  3WUV A;  2ACZ A;  3LJC A;  3AAI A;  1PZQ A;  2E74 B;  2GA1 A;  4PD4 H;  2WU2 A;  2SPC A;  1L0L K;  2JP3 A;  1HTJ F;  5JDG A;  4ILA A;  3H1L E;  4H0L D;  2L9Q A;  2E42 A;  5FVL A;  5JDM A;  2CHN A;  4H9P C;  2FYU G;  2QVA A;  5LGT B;  3LDQ B;  4EYU A;  4HFD A;  3AE2 C;  2Y6X A;  5BR8 T;  4R4L A;  1U7J A;  2WSE H;  3L3P A;  3JCU E;  3T1Y T;  2P7J A;  2DLR A;  3PUQ A;  1VRB A;  3OVU A;  5F8P A;  4MLK A;  1N7S B;  3H1J D;  2O01 J;  3VN0 A;  2YDR A;  1SQX E;  1RY3 A;  3GMI A;  4JUY A;  1L4A A;  1WMK A;  2D2C B;  4FI5 A;  4B86 A;  3Q3D A;  3GA8 A;  1W2E A;  4N3Y B;  2KMF A;  2I0M A;  4ZXL A;  3SWF A;  1L4A C;  4H0L B;  3ETV A;  3O9X A;  4OGQ B;  3HE5 A;  1LTJ A;  1OIP A;  3N2G E;  2CWO A;  2XAQ B;  1WRD A;  1OED C;  1LP1 B;  2V8S V;  1M1J B;  3AEB C;  3FZF B;  3C50 A;  3HKE E;  4F8H A;  5KLV E;  2M5A B;  4J2C A;  2VUR A;  2O1K A;  3M06 A;  3II6 A;  2HN1 A;  3B5N A;  2YK0 A;  3RIU C;  3AEG C;  4YHJ A;  2D9D A;  4P0B A;  1AV1 A;  3KVA A;  2O01 H;  2V7Q J;  1JTH B;  4KJM A;  3KDS E;  3AE8 A;  5LMU T;  4YHH T;  3WAK A;  3IF8 B;  2RPA A;  3ABV C;  2I59 A;  3HKC E;  5TIS H;  2QA7 A;  2HPJ A;  1N33 T;  3L74 G;  1BGY E;  4JI6 T;  1FMW A;  1ZR2 A;  2JQ9 A;  3HD7 D;  2KZ7 B;  3V2Q A;  5B66 H;  1HX1 B;  4OYK A;  2KLQ A;  2Y48 B;  4I55 E;  5APT A;  2CA5 A;  2XV5 A;  4WWI A;  4DMV A;  3NBX X;  2OYI B;  2NPS A;  1JB0 J;  1S94 A;  1H8A A;  1HG2 A;  2KS1 A;  2H7V C;  4KHP T;  2R6G F;  5AQO B;  2M3E A;  2ODV A;  1CHU A;  3BQL A;  3CVR A;  2R3C A;  4ILB A;  1BE3 J;  4X62 T;  2QJK C;  1FDI A;  2WY2 A;  3A2A A;  4U3F E;  1EXI A;  5LBM A;  4LF6 T;  5CJ0 A;  1NAF A;  3E1R A;  3HTK A;  3CXH E;  2IC9 A;  2WMM A;  2Z4E A;  5AQG B;  2ZVN B;  1NAY A;  3B71 A;  1XTC C;  3P4P A;  3JCF A;  2XND H;  4IDQ A;  3G06 A;  3GHG B;  2FYU E;  3FXD B;  2WSC H;  3SS1 A;  1K8A Q;  1LGH B;  3RK3 E;  3QK6 A;  2BKP A;  4CI2 B;  3ZDM A;  2X0L B;  3MK7 C;  3FX0 A;  4QMA A;  4EYY Q;  3QB5 K;  5ABH A;  3B5M A;  1GDT A;  2DW3 A;  1KV4 A;  1CI6 B;  1E1H B;  1RE4 A;  3A3Y B;  3R2P A;  3H1K D;  3AA6 B;  3RL0 C;  1EDI A;  1EC5 A;  5HWX A;  1IFP A;  3NWI A;  5FL0 A;  1SQB G;  2LRK A;  2W4X A;  1N7S C;  1PP9 E;  4WY4 B;  3ZC0 A;  1MIV A;  4N6J A;  3L73 J;  4GIW A;  2WSF J;  2FUP A;  2H89 A;  3JAE A;  4M1P A;  4WYV A;  2Q9Q D;  3B8E B;  3H1I J;  4BRY A;  1U4Q A;  3KXD A;  1WCR A;  4XZC A;  2XZE A;  4LF7 T;  2KWI B;  1PV3 A;  3Q2Y A;  5F3J A;  5HCJ A;  3PP5 A;  5GTI H;  3TLT A;  1CZQ A;  3H1J J;  2X9H A;  1KEY A;  3RK2 B;  2QJP B;  4PW8 A;  4H13 C;  5JVD E;  3RIA A;  1R8I A;  1UII A;  4A56 A;  5ABF A;  4E7Z A;  4JI7 T;  5HEO A;  3RRC A;  5LG3 A;  4JYB A;  3AE1 A;  2OV9 A;  3UUL A;  2LE8 A;  3NTN A;  2MAW A;  4HKZ H;  1R8E A;  5KAF H;  2PJQ A;  4WB4 A;  2E74 C;  1LRZ A;  3A8Y C;  3KFW X;  4DR5 T;  3L71 E;  1LWU B;  1EZ3 A;  2I1J A;  1SQB K;  2XHE B;  5B66 E;  3AEC A;  4K3A A;  3AEA A;  4PNI A;  3LK2 B;  2IFM A;  3AE7 C;  2AEF A;  2WTY A;  2M3B A;  2ZXE B;  2J58 A;  3CWB E;  3A5T A;  2JQK A;  2C5I T;  4HWI B;  2JWA A;  3RK3 D;  1U57 A;  1IC2 A;  2E8I A;  3BQK A;  1NVO A;  2OQQ A;  2Q3I A;  2KT9 A;  2JEE A;  5HXR A;  5M4Y A;  3H32 B;  3CQG B;  2WSF H;  1S72 P;  5AVW B;  4LGD E;  5CBN A;  3C4W A;  3RL0 g;  2V7K A;  3U59 A;  4U33 A;  1JCC A;  3MIW A;  2E9X A;  4ZS3 A;  1BCC G;  2JMH A;  4ZI3 C;  4TLF A;  1OW6 A;  2W67 A;  2ZT9 D;  3CXH H;  2WM9 A;  2CXD A;  1Q81 Q;  4COF A;  1RQU A;  3PU8 A;  5J2U E;  1K04 A;  3ZJ1 A;  3EDU A;  2WVR A;  2ZM8 A;  2OLT A;  3L71 J;  1MMA A;  2LSY A;  1X79 A;  2YKP A;  2E75 D;  1VQL P;  3B57 A;  1EZV G;  3HE4 B;  1KNZ A;  2KI7 B;  2FFD C;  4EEB A;  1OED E;  4ZOL E;  2UUC T;  1IFI A;  5KAI H;  2C5K T;  2XQ4 A;  4FJO A;  2BCC G;  4H44 D;  3Q5S A;  4HKA A;  2ZM6 T;  3L37 A;  2XAH B;  3BCC G;  2N1T D;  2XAG B;  1NHL A;  2BDE A;  4YTN A;  1M57 D;  2B88 A;  3L4F A;  2FJA A;  2O01 N;  3RBX A;  3SWH A;  3ZT5 A;  3UU6 A;  3E1I A;  3IF4 A;  1MKM A;  5JDQ A;  3L70 E;  2JO1 A;  3J7Y q;  3MA9 A;  1HFA A;  3LG7 A;  4UV9 B;  5ABE A;  1ZR4 A;  5TIS E;  3VR9 A;  5K5G B;  4G2A A;  1LWU A;  3OJA B;  1H88 A;  3L71 G;  3BCC E;  2Q3E A;  1N34 T;  5DJU B;  3G71 P;  4P09 A;  1PPJ E;  1N73 C;  1RF0 A;  3V5B A;  1HWT C;  4JBZ A;  3TKL B;  3L75 J;  2VQE T;  5LHG B;  2XQ3 A;  5APW A;  2XQ5 A;  5LXT E;  1OXZ A;  4O2A E;  2LJL A;  2M8R A;  1URQ D;  2KSR A;  2H43 A;  3PUW F;  1G2C B;  3OA7 A;  4O4L E;  3ZMS B;  2R32 A;  3UUB A;  3CME P;  3Q5D A;  4YLH A;  3V2N A;  4IDP A;  4QX7 B;  1T2K D;  3EAM A;  2OYI C;  1XZY A;  1GL2 B;  4EED A;  2WSS H;  4L73 A;  2B1E A;  4UB6 E;  2RMZ A;  1QGK B;  4BA9 A;  2HN2 A;  3OKQ A;  2B9B A;  3CKD A;  2MKV A;  5HCM A;  2LSJ A;  1XDP A;  1R5S A;  3DJB A;  3CCE P;  1OFC X;  1PP9 D;  2H88 C;  3RH3 A;  5E79 E;  2IFN A;  4NUU A;  5FY1 A;  4EXT A;  1L0N G;  2LLY A;  2C0W A;  3N7N A;  1M62 A;  3CI9 A;  4HE8 A;  2XSB A;  3OYZ A;  2RH0 A;  3IEE A;  1CI6 A;  1WFD A;  1YXR A;  3L75 E;  4IHJ E;  2KLV A;  2H7O A;  1ZKE A;  4CN6 A;  3H37 A;  5CB4 E;  3G3Z A;  2NTX A;  5C8Y E;  2OYH B;  3AAE B;  1YQ3 A;  5FP3 A;  2A45 G;  1NU1 J;  1VQN P;  3FZL B;  4TX5 A;  4WY4 A;  2YO3 A;  5AQJ B;  2BS2 A;  2IZ1 A;  1Y47 A;  3ZT7 A;  1DX7 A;  3N9N A;  1FZB A;  4AIS A;  2HH7 A;  1Q2N A;  1OMI A;  1KIL D;  1SQV E;  3I9Y A;  3L72 G;  4PD4 D;  1IK9 A;  1BGY G;  2LM2 A;  4H9N C;  2V6Y B;  3WMM 0;  4YSY A;  4U3F G;  2H89 C;  1Y9B A;  1NOH A;  3CCJ P;  2POH A;  1NKZ B;  1BSH A;  3N2K E;  3N2O A;  1S4X A;  3N9M A;  1LT9 C;  1P84 H;  2OTL P;  4EI2 A;  3PV0 F;  3PJS K;  4JI1 T;  1A02 F;  2G3A A;  3L73 D;  3FWN A;  4D6T E;  3D6Y A;  2DI4 A;  2Q9I A;  3HTK B;  5AW3 B;  2BBH A;  2O1J A;  5ETW A;  5FXZ A;  1IFM A;  2UXN B;  2BG9 A;  3ESL A;  4X5T A;  5FVK A;  3K5B A;  1GL2 A;  3HR0 A;  5L3C B;  1VCT A;  1E7P A;  5HXS A;  1SQQ D;  2H88 A;  4BJN A;  3IAO A;  5J1G A;  2YKQ A;  2YIN A;  1K73 Q;  2YDS A;  5KJ7 D;  2YU1 A;  1JNM A;  3PUX F;  3QWO C;  1YJN P;  3RF1 A;  4YTP A;  3UUX B;  3FHN A;  2P67 A;  3NVO A;  2J59 M;  2WSC J;  2W27 A;  1WLX A;  3K3Q C;  3L70 G;  3GW6 A;  3L75 G;  3FZK B;  1ZN5 A;  1V9D A;  5FYM A;  1FDO A;  1J5W A;  4DV5 T;  1VOM A;  1KB9 D;  3TDK A;  3GHG C;  3P8M C;  1XMO T;  4ERR A;  1GQE A;  2E9X C;  1KB9 H;  1OW8 A;  5ABF B;  4IE7 A;  2HPL A;  2V5C A;  1NEN A;  1OZH A;  1L0N E;  3B13 A;  1DEB A;  4MN4 C;  3OPC A;  4L76 A;  4PJJ A;  3RYF E;  3NRX A;  1HTL C;  1CSB A;  4HWC A;  4UF0 B;  1PL5 A;  3S9O A;  2N1T A;  4L9I A;  2MTQ A;  3H1L G;  4NPD A;  1MFZ A;  4KHZ F;  3HUS C;  2C9N Y;  5L3B B;  5DQV A;  1IO4 A;  3N5L A;  5KAI E;  5M1B A;  3N9O A;  2Z5I A;  5CFB A;  3H1H G;  1KK7 A;  4JEU B;  5AVU B;  4TN7 B;  4GYR A;  2BEZ F;  1ZV8 A;  4YXD A;  4KBM B;  1NYH A;  3AA0 B;  1IJD B;  4CQI A;  1NO4 A;  2WDV A;  2M6I A;  1S3J A;  3LID A;  3VP8 A;  5AQS B;  5AQQ B;  2FYU J;  1YIT P;  1LTG C;  2P1J A;  2W62 A;  2WQY A;  2M67 A;  4ZS2 A;  3WU2 E;  4DR3 T;  2FYN B;  4ASV A;  4D6T G;  1JY3 P;  5FKY A;  2XQY A;  3A0H H;  1P84 E;  5AQR B;  5L2L A;  4ZI2 D;  1E2A A;  1L0L J;  1RF0 C;  4W7Z A;  1UX4 A;  1GW4 A;  2K5B B;  3NZP A;  3BVH A;  4H44 C;  4HEA A;  3ZST A;  2CPT A;  4EGW A;  4NPE A;  2CBJ A;  3MUD C;  4IE5 A;  5A1L A;  5AQP B;  1OED A;  4X64 T;  2W83 C;  4ZKP A;  2HOD B;  1SQV J;  4K0U A;  4DV7 T;  1JTH A;  1LVK A;  4O4H E;  3KDP B;  3EHZ A;  2LKH A;  3OAK A;  2AEM A;  2NR4 A;  3HI2 A;  3D6Z A;  2BAS A;  1YQ4 C;  4HTE A;  3PHL A;  4B3S T;  5LYJ E;  5APS A;  1VQ8 P;  1O3X A;  3HUS B;  4P0A A;  1SQX D;  5KLI B;  1S5L E;  1IFN A;  1ZW0 A;  2X66 A;  1OVV A;  2BBJ A;  5C2T A;  3CPZ A;  2YMK A;  3AEE C;  5CHX A;  2FYU D;  3LIE A;  3PJA A;  4YXD C;  1FZG A;  2N9D A;  1YHQ P;  2H7H A;  3V4Q A;  4HB1 A;  2I6H A;  2QG4 A;  1SQQ K;  3UU3 A;  2PRR A;  3UUM A;  3CL3 D;  3KV4 A;  2IML A;  2N9Y B;  5KLV J;  2PFX A;  2DWK A;  5GTH H;  3AE5 C;  1M7L A;  4ZI7 E;  2Q5U A;  5J2T E;  4AKG A;  4PFP A;  4NIQ A;  4IOI H;  2E74 D;  3C9I A;  1S2E A;  1N32 T;  1ZHC A;  1T7S A;  2NOX A;  4IL9 A;  2CRB A;  1KN7 A;  5JDH A;  4QXB B;  2B76 A;  1NTZ G;  4DT0 A;  4JQ0 D;  2P58 A;  2JR8 A;  1NH4 A;  2XQ9 A;  2E5Y A;  3G4S P;  4PAG A;  2W66 A;  2WU5 A;  3FWL A;  5TJH A;  4I0U A;  3ONL C;  2JIW A;  2XQ6 A;  3KYQ A;  2NW9 A;  1X79 B;  2WZ7 A;  3CPW O;  3WUU A;  1JY2 P;  2KB7 P;  3H1J E;  3ZLI A;  4OYJ A;  4C46 A;  1QL2 A;  4CI3 B;  3Q5P A;  3EVY A;  3L70 J;  2B87 B;  1ZRT D;  3AA1 B;  1G1J A;  3O8Z A;  3H1H J;  5AW9 B;  2XQ8 A;  2V26 A;  4CXX A;  3G6E P;  1SFC C;  4IL6 X;  5APU A;  3FXE A;  2OTJ P;  4HFH A;  4HWF A;  2IBZ I;  2UXD T;  3L73 E;  2VKJ A;  1T3J A;  1IBL T;  2FXP A;  3MHV A;  3RL0 D;  4HFB A;  2V1D B;  4UV8 B;  4ASW A;  3PTR B;  2HPC A;  1XMQ T;  1FZC A;  5BMV E;  1SQV K;  1MMD A;  1VQ6 P;  2WS3 A;  1ZME C;  4PV1 C;  4U7I A;  1KFY A;  1M1J A;  3FZM B;  1JY3 N;  1VL2 A;  3WAJ A;  5H2F E;  4PV1 B;  5KDM C;  4MBQ A;  1EZV I;  2KSE A;  2IYP A;  4X1I E;  3R6N A;  1N7S D;  4DVD A;  3AE9 A;  4H9S E;  1L0V A;  2LRL A;  1LTJ C;  1A02 J;  5AQV B;  3UUN A;  1LTT C;  1NTM E;  2KK7 A;  1HS7 A;  3EFG A;  3CCS P;  2BZB A;  2P9B A;  1N2D C;  3TF5 A;  4AKI A;  5DAB A;  5HWY A;  4U3F J;  1X8Y A;  3AED C;  3CWB G;  4ANJ A;  2YDQ A;  1NTZ J;  4JI8 T;  1ZXG A;  2FYU K;  2D5U A;  1NU1 K;  1WRG A;  1TU3 F;  1U7M A;  3UU8 A;  1WR6 A;  4KP3 C;  3L74 J;  1HNW T;  3PUV F;  3PJA J;  2FYZ A;  3LW5 J;  3JSV C;  3SWK A;  1MNE A;  4H9R C;  3RRW A;  3B5N D;  4DV3 T;  2XUE A;  4JEH B;  1NKN A;  1Y8A A;  2IDB A;  4LF9 T;  4LFA T;  1K05 A;  3H1K G;  2JMK A;  1M90 Q;  4HWD A;  4UIG A;  4YTM A;  2BKN A;  5GTH E;  2V6X A;  3PU3 A;  4QH4 A;  4XBF B;  2K3R A;  2CE7 A;  2E5V A;  3HD7 C;  4DUZ T;  1GU5 A;  2LXB A;  2NPS D;  2NW7 A;  5KXJ A;  4KMC A;  2KYV A;  2N2N A;  3E0Z A;  5DJQ C;  3AA7 B;  2PAJ A;  4TZ4 C;  5HXC A;  3HD7 A;  3VR8 A;  3A0H E;  1AA0 A;  3JAF A;  5H6Q B;  3H1I G;  1AQ5 A;  1XNR T;  2X0Y A;  2HPC B;  1HNZ T;  4TUY E;  5L3D B;  1IK7 A;  3HE5 B;  3SRZ A;  2AEJ A;  1UK5 A;  3G9R A;  4PJM A;  2E76 B;  2KP8 A;  2W00 A;  1GTW A;  2W90 A;  2N1G A;  5KJ7 C;  2E75 B;  2M0B A;  3F31 A;  3JC6 D;  4P1N A;  1BGY J;  2W6B A;  3MZW B;  2XZR A;  4DV1 T;  4UEM A;  4H44 B;  2KSJ A;  3JC6 C;  2N1T B;  5AVZ B;  2CLY C;  3E7K A;  2Q9Q B;  3ANW A;  4QWN B;  2WB5 A;  2A45 I;  2BG9 C;  3GWH A;  2KLU A;  4GOU A;  3W15 B;  1KTM A;  2YXR B;  3GN5 B;  3RQU A;  3GN5 A;  1SFC D;  1KMI Z;  5LJN A;  2E76 D;  1OWA A;  2F4V T;  3E08 A;  1ZLL A;  2YO2 A;  2MOZ A;  5AW7 B;  4DR1 T;  1VF5 D;  1G1I A;  3VMZ A;  2W6J H;  3LK4 2;  4AKL A;  2PGD A;  3VP9 A;  1NJI Q;  1YIJ P;  5HEG A;  2QSI A;  3I55 P;  2HFE D;  2WDR A;  4O4J E;  2VK9 A;  4AUW A;  1BE3 G;  2ZM0 A;  3C4X A;  3Q1M A;  4WNK A;  2DCF A;  2LSK A;  2V7M A;  4DR2 T;  5AQH B;  3O6Q B;  3EI0 A;  4H0L C;  3RLF F;  2BCC J;  4TWD A;  1JO5 A;  3PUZ F;  2G0U A;  2VL8 A;  2WT7 B;  3NXS A;  1JNR A;  4BAY B;  2KZJ A;  4LMK A;  2IHR 1;  4X20 E;  3GMA A;  2Y0E A;  1BCC D;  3VKG A;  1FEW A;  2KUB A;  3VKH A;  4GOE A;  4IGU A;  5FXW A;  3A5X A;  2O3J A;  5CJ4 A;  3ZC1 A;  3M0D A;  3VU7 H;  4UB8 E;  1HF8 A;  3I9W A;  2OTK E;  3CCU P;  1WR0 A;  2GUV A;  1VQP P;  5JRC A;  1ZEE A;  1CUN A;  4GT1 A;  1KQG B;  4ISS A;  1HF9 A;  1ZOY C;  1HH0 A;  3N9L A;  4YSX A;  2V7Q H;  4JF7 A;  4U2Z A;  2EHO D;  3V4W A;  1PPJ G;  4XAX B;  4JYC A;  2BCC D;  1W9R A;  3A7O A;  1IBM T;  2R5D A;  3AED A;  4DND A;  2J5U A;  2YEV C;  1T8Z A;  4B3M T;  4I43 B;  2CMR A;  5LBQ B;  5AW1 B;  3MD0 A;  1N7S A;  4NXN T;  3FBZ A;  1YYC A;  1KD1 Q;  3P32 A;  5AFU L;  5CCH C;  1FZE A;  1YTZ I;  2JWD A;  2OA5 A;  1RF1 C;  3K3N A;  1D1C A;  1KIL B;  2LR2 A;  2OYO A;  4L75 A;  4B3T T;  1FOS E;  2NPS C;  4QX8 B;  2UUA T;  1D1A A;  1EDK A;  1J5E T;  2A06 E;  3T97 B;  2OAR A;  2UWJ E;  3H32 A;  1SQP D;  4BRY B;  1D0Y A;  1MIY A;  2IZ0 A;  3H3A A;  4N78 E;  3SFE C;  1UCU A;  4YT0 A;  1IJ5 A;  1B7T A;  2Y9Y A;  3EQ2 A;  3RC8 A;  1W09 A;  3SFE A;  1SQV G;  2JJ9 A;  1KC8 Q;  5LHI B;  4KI0 F;  1SQP J;  1FU1 A;  1N36 T;  2Y0D A;  3EUH A;  3RIU A;  2Q1K A;  2XU6 A;  5AQF B;  2W8Z A;  5GON E;  2IPP A;  3NMD A;  1VQ7 P;  2LXC B;  1KB9 I;  4OVN F;  2VKO A;  2E9X D;  3P4Q A;  2X9W A;  4ZI2 C;  1S9K E;  4KUM B;  1YKE B;  4DO0 A;  1RE3 A;  5JRE A;  2XAJ B;  3OYX A;  3CC7 P;  3E22 E;  1XTG B;  1J1E C;  3TNU B;  1UUS A;  1PP9 G;  3UU4 A;  3ITK A;  1SA0 E;  2M6B A;  2HOD A;  3I1A A;  1PGJ A;  4DV4 T;  1RE4 C;  2H8P D;  3Q5E A;  4PK5 A;  4IFD K;  5L8R J;  4W80 A;  4H9Q C;  4OGQ D;  4Z8X A;  4WBA A;  5JR9 C;  2EHO B;  4AQG A;  1S5L X;  3UFE A;  4C7N A;  5IWA T;  3AXJ A;  4U74 A;  2D0T A;  2V6Y A;  1DH3 A;  4QXH B;  4AI6 A;  3CD6 P;  1N8R Q;  2EHO C;  4YJ3 E;  2JQQ A;  4GIF A;  2KNC A;  1U5P A;  4LLH A;  5LGN B;  2XM1 A;  3CIR A;  1Z0P A;  5KLV D;  1BGY D;  1NTM G;  5L4H A;  4A5X A;  1H89 A;  1BDD A;  4I7Z C;  1NGM B;  4UB8 H;  4D6T J;  4AXP A;  3JC2 2;  2IUB A;  5CCG C;  4IFF A;  3CXH D;  4ZKU A;  3AE5 A;  4LFC T;  4HJG H;  1XWM A;  1VCS A;  4X1Y E;  4L74 A;  2B89 A;  1SHZ C;  4ASK A;  3RYI E;  3RHW A;  3UU5 A;  3NKZ A;  2LKG A;  3AE6 A;  1USD A;  3A0B E;  5IUX A;  3V2P A;  1NTZ K;  4I2L C;  1L4A D;  1AQT A;  1YI2 P;  2ZLY A;  5ADX L;  1PFI A;  3V5U A;  4AQF C;  1SQB J;  1VF5 B;  5HEU A;  3RGL A;  3NZQ A;  5KMG P;  3RKO A;  1UUR A;  4YTP C;  4HFV A;  2ZXX A;  4F6R C;  1SQQ G;  4MFR A;  1QX8 A;  3U78 A;  3IBP A;  1MFT A;  2FYN C;  4WVZ A;  1H7C A;  5IYZ E;  1VQ5 P;  5CA1 E;  5AW2 B;  4U3C A;  1N73 B;  3EWK A;  1N73 A;  2A45 H;  5KKZ C;  5CCG D;  4YXW H;  3F57 A;  4HYT B;  5TAO A;  5LNK A;  4UVA B;  4EYY R;  4OWF A;  4A98 A;  1BR4 A;  1KZU B;  2XNX A;  5LOV E;  2CBI A;  2CHO A;  3C64 A;  2KZI A;  1MV8 A;  5JQG E;  4JPZ B;  2R3S A;  1RHZ B;  3FXE B;  2WPV B;  3USS A;  4TWH A;  4IT4 A;  2CXL A;  2JJL A;  1FOS F;  4HWH A;  1YJW P;  4TV8 E;  2JPF A;  1T6A A;  3HD7 B;  1G2C A;  2VKH A;  4CPG A;  3CX8 B;  2MPK A;  2UU9 T;  1SQP K;  1T8B A;  3TYY A;  2K37 A;  2KOG A;  5AW6 B;  1T2K C;  1GZL A;  3AE9 C;  1JUN A;  3K8P C;  3ZMT B;  4TWF A;  1USE A;  3CCQ P;  1DEE G;  1GL2 D;  5LCY A;  2Q9Q A;  3ANW B;  3K3O A;  4ZZC A;  3O4X E;  4YPC A;  1EDJ A;  2YNY A;  3R84 B;  1SQB E;  5IHY A;  2CK3 H;  2SPZ A;  3TLS A;  1UIX A;  3L74 D;  4GKK T;  3H1H D;  1SQQ J;  2LSI A;  2NTY A;  3PUY F;  3PUG A;  1NU1 D;  2L8K A;  2OGU A;  3RK2 D;  3CX6 B;  4B6X A;  3SWY A;  4BJM A;  1AVO A;  1IAP A;  3ZYM A;  1IFJ A;  1MMG A;  3TLW A;  1W2B O;  3WU2 H;  2KIK A;  2ITA A;  1IFD A;  4NPF X;  4C7R A;  2N9B A;  3HKB E;  2C0S A;  5L4E A;  3L74 E;  1NTK E;  2YIU C;  4D6T D;  2XDJ A;  3ONX A;  3T1H T;  5DQW A;  4UVC B;  1XDO A;  4NUV A;  1SQX J;  2Z5H A;  2WSE J;  2PBI A;  3MZK B;  4R4M A;  3SOL A;  2ACX A;  3O6Q A;  5CMZ A;  2Y8D A;  2WZH A;  1S35 A;  3A0B H;  4DBR A;  4X65 T;  4LF5 T;  4JYA T;  3BRT B;  4DOJ A;  1BSN A;  4GK0 E;  4MAL A;  1JY3 O;  1FS0 E;  1J1D B;  1NTM J;  4U2Y A;  4AYC A;  5JH7 E;  2IX7 C;  5GTI E;  3PE0 A;  4ZNC A;  3C8V A;  2K9Y A;  1QUU A;  1YBK A;  1EZV D;  4JI3 T;  1RH5 B;  5HXH A;  2V7I A;  4B3R T;  4Q25 A;  3GF7 A;  4GKJ T;  1WYC A;  2XAS B;  2XM2 A;  2X67 A;  3SFD A;  3RYC E;  3L09 A;  3OJA A;  4IL4 A;  2GUS A;  1HG5 A;  3CWB J;  3F89 A;  3ZPO A;  4EV6 A;  2A3D A;  3BCC D;  2FJE A;  1LWU C;  1KF6 A;  3KVB A;  1YQ3 C;  3P7K A;  4HH2 A;  4MHC A;  1UX5 A;  2HR3 A;  2BVM A;  1NEK A;  2BG9 E;  2WDQ A;  5AVT B;  3UTK A;  3ZN1 B;  1SQX G;  3VOP A;  1SQB D;  1EQ7 A;  2QE7 H;  1NWM X;  1YD8 G;  2IAK A;  1L0L G;  2DHR A;  4ZHQ E;  2AE9 A;  3DP7 A;  2HG5 D;  4IE4 A;  3RIF A;  4DMW A;  4EAH A;  5JTG A;  5CBO A;  2KNC B;  4AKR B;  3Q5R A;  2FJD A;  5JDN A;  1Q86 Q;  5E0O A;  2MYS A;  5AVY B;  2DL1 A;  4OHF A;  3H1K E;  1OW7 A;  4C91 A;  1VQM P;  3EDV A;  1T98 A;  2E9X B;  5APX A;  1LT9 B;  2FY8 A;  1KOR A;  2WIT A;  3BAT A;  1EXJ A;  5LP6 E;  2NW8 A;  1K9M Q;  2CM0 A;  4BWN A;  1LP1 A;  1SUM B;  2VB6 A;  2PTF A;  2WAU A;  1LTS C;  1KQF B;  3V5S A;  3TGU D;  1W0B A;  1WT6 A;  4DZO A;  3VMA A;  4GKG A;  1NTK G;  3IN6 A;  3H1I E;  3CMA P;  1FMV A;  1RE3 C;  1X9V A;  1OED B;  3M91 A;  4GDO A;  1KQL A;  4UF0 A;  1IZN B;  3UQ4 A;  4PD4 I;  1ZRT E;  2KND A;  4LML A;  4Z1M H;  4O2B E;  2QJP C;  2UXB T;  2R44 A;  4PK6 A;  3SFD C;  2YKO A;  1N86 A;  4GOF A;  5APV A;  2JDI H;  4NXM T;  5AW0 B;  1AJY A;  2VRS A;  4A7P A;  2BEQ D;  3Q2M A;  3U1C A;  2BCC E;  1E5W A;  2W6A A;  1KYO I;  2LHR A;  3AE3 C;  3QC9 A;  2BS4 A;  3CK6 A;  3ZKR A;  3WI3 A;  4HFC A;  2LOP A;  4UVB B;  2PP6 A;  3KBU A;  3M3Z B;  3RK3 B;  1MUU A;  2ZJS E;  2KIN B;  1HNX T;  4TV9 E;  2ZYG A;  3MJX A;  5H2F H;  1KYO D;  2IBZ D;  2DWG A;  1S9K D;  4WZX A;  3C1L A;  3V6I A;  2A06 D;  3M9B A;  3QH9 A;  2YXQ B;  2I8D A;  1FC2 C;  5AW4 B;  3S1K A;  1QVF O;  1AFO A;  2WBL A;  2IW5 B;  4I50 E;  4DUY T;  4DR6 T;  2N1T C;  1ZOY A;  1KYO E;  2KWH A;  2ODU A;  2HYN A;  4ILU A;  5E79 H;  1GL2 C;  3L39 A;  1NTM K;  2PFV A;  5B5E E;  3I5C A;  1FJP A;  1LNQ A;  1L2P A;  2D2C D;  3CX7 B;  1VDF A;  4CN1 A;  5KKZ B;  2XQA A;  4UB6 H;  3AB3 B;  1QVG O;  2VAS A;  1NTZ E;  2M5A A;  2K48 A;  3L35 A;  5AW5 B;  3AE7 A;  4C90 A;  1L0L E;  4NPP A;  4ZMD A;  3RC3 A;  3GLM A;  3S4R A;  2C5J A;  4OX9 T;  1NU1 E;  2DNX A;  3ONJ A;  3UIA A;  4PD4 E;  2CLY B;  2Q9Q C;  3L72 E;  4YSZ A;  1VPC A;  5FMN A;  3VYI A;  1JNZ A;  2JRK A;  3BQI A;  2K9J A;  2XY8 B;  4CN4 A;  4AQR D;  3KZI H;  2IC6 A;  1QSD A;  1HX8 A;  1J1J A;  4YJ2 E;  2WWW A;  3H1J G;  1W5C E;  4QH1 A;  2GK9 A;  2CXF A;  3Q5X A;  1QLB A;  1SQX K;  4WY4 C;  2GM4 A;  4YFS A;  4U7J A;  3L75 D;  1I94 T;  1BDC A;  1KQS O;  2VVS A;  5AQI B;  1GK4 A;  1FZC B;  2CWY A;  5EZY E;  2VQF T;  5LJM A;  5AQK B;  3RPU A;  4OGQ C;  1RQV A;  1DU2 A;  5L47 A;  4HFE A;  1FZC C;  4RO0 A;  1QLE D;  1HUC A;  2QA4 P;  3PDY A;  3A7M A;  3UQ7 A;  3F2E A;  3RK3 C;  4WW0 A;  3CX5 H;  5AVV B;  2FFD B;  5FL1 A;  1WYB A;  1PGP A;  1SLQ A;  1D0Z A;  4HN9 A;  3B5N B;  1N7L A;  1HJ0 A;  4PJ0 E;  1FJG T;  3PLN A;  1L0N J;  4TT3 H;  4LFB T;  1LJ2 A;  3U1A A;  4UR9 A;  3KBT A;  5AQL B;  3K1S A;  4Z91 A;  1SQP E;  3TLV A;  4Y28 J;  2HHH T;  3R4Y A;  1Y64 B;  2ZMA A;  3N4X A;  3ETU A;  3D71 A;  3LSV A;  2UUB T;  5LMN T;  1L0N D;  3H1L D;  4I1L A;  3AVS A;  3N9Q A;  2D2S A;  5AVS B;  2MJZ A;  3H1K J;  3KHU A;  1D1B A;  1HBW A;  2K9A A;  3PUR A;  5JDF A;  1VF5 C;  3FZH B;  3H1L J;  3C51 A;  5APY A;  2NWB A;  2BS3 A;  3HKD E;  3ABV A;  1T72 A;  4BXL A;  1FAV A;  3I0Q A;  3VRB A;  2QJY B;  1PGO A;  4RKU J;  4IDN A;  3P8C E;  4L5G A;  4TNV A;  2EHO A;  2AXD S;  2QRX A;  3Q9D A;  4M3L A;  2CPB A;  3EAB A;  2Y0C A;  2AXT E;  5AVR B;  4IDZ A;  4EB6 E;  2KS1 B;  3RX6 A;  3AEE A;  2K88 A;  2MBG A;  5LG4 A;  2LEH A;  2WSS V;  2J62 A;  1J1D C;  4U3F D;  3KPE A;  2OYH C;  2Y9Z A;  3V2R A;  4RJT A;  2XSA A;  1T3U A;  1MZ9 A;  4IE0 A;  4OFZ A;  4IL6 H;  2I1K A;  1P84 I;  1SE7 A;  3TK1 A;  3M0D C;  2QM7 A;  2OYI A;  2A2F X;  3P4S A;  1OVR A;  3J9X 1;  5B5E H;  5EK4 A;  2WWV A;  1LT1 A;  3MP7 B;  2LKM A;  1VQK P;  1JY2 O;  2WT7 A;  2H3R A;  5EFW B;  4JBW F;  1HCI A;  1H0T A;  3QUJ A;  3AEF C;  4KHX A;  5AQN B;  4PJL A;  4AQF A;  4E7S A;  3CXH I;  3ZYL A;  2X0H A;  1KB9 E;  1HGV A;  3C98 B;  2QGS A;  4DV2 T;  1GU4 A;  5L3G B;  1YJ9 P;  3MTU E;  5BVZ A;  4QKN A;  1KFM A;  3KZI E;  4DID B;  2UXX B;  1US7 B;  1PPJ D;  4IE6 A;  1SFC A;  2YU2 A;  2YIU B;  4Y99 B;  4A97 A;  5AQU B;  1M1K Q;  5FXV A;  4O9B A;  2XKM A;  3VMY A;  4CXW A;  4U7Y A;  2X9Y A;  3LBX A;  1E79 H;  4DJG A;  4DBQ A;  5JR9 A;  1LTA C;  3RL0 B;  4G63 A;  5LA6 E;  2K3W A;  2G8Y A;  5JDL A;  2L3L A;  1FIO A;  2WPR A;  3PUS A;  5BU8 B;  2VKD A;  3M0A A;  5APQ A;  1NWQ A;  2W2U A;  1LT9 A;  2VWA A;  2QJK B;  4PJ0 H;  1VQO P;  4K0K T;  1Q90 D;  3ZSS A;  1GW3 A;  3PH0 A;  1MND A;  3AVR A;  1L0N K;  2VVN A;  4EZ4 A;  4OK0 A;  2BKO A;  5CA0 E;  3ZMV B;  2ZT9 C;  1MIW A;  5HAX A;  4O4I E;  3RI5 A;  2LSG A;  2Q6Q A;  3H25 A;  3MUD A;  2BVL A;  3CML A;  2FXO A;  1FBM A;  1FZF A;  4GK5 E;  3HL6 A;  1KNR A;  1S5L H;  1M56 D;  1PP9 J;  2Z6E A;  3ZMZ B;  2C0X A;  1I6Z A;  2WMO A;  4JI4 T;  3VHL A;  3RKG A;  2LM9 A;  3HUS A;  2ZAE B;  3SSU A;  2A9U A;  2AXT H;  4AQY T;  3LW5 H;  3O1J A;  2PG8 A;  1URQ A;  3AEA C;  2V7J A;  4DR4 T;  3BK9 A;  1ZP0 A;  4XFJ A;  3HRN A;  5AQM B;  5HYA A;  2L5G B;  1DD4 A;  1X9B A;  1KFN A;  4IL6 E;  4Z90 A;  3HA4 A;  1LTJ B;  4ZZB A;  5LB7 B;  5CCG A;  1M7K A;  4UXN B;  4H13 D;  2FBW A;  2WPS A;  3H3M A;  3FB2 A;  4WBN E;  1ZV4 X;  1NTM D;  1L4A B;  4EZH A;  3RYH E;  1OX3 A;  4UEL A;  5KX5 E;  3AEF A;  1BE3 E;  1FE6 A;  3AE6 C;  4JI2 T;  3W68 A;  1LVF A;  2V7L A;  1UGO A;  3CX5 E;  4YY3 T;  3AEG A;  3TGU J;  1Y01 A;  2LT3 A;  4QHO A;  3AE4 C;  5BU5 A;  1SP4 A;  2X51 A;  1JMB A;  3F5H A;  1SS1 A;  3FXD A;  3OBV E;  3IHR A;  2ZT9 B;  4H13 B;  3CLQ A;  2E76 C;  3CWB D; 
#chains in the Genus database with same CATH homology
 1JY2 P;  4UVC B;  2KB7 P;  4H63 H;  2KWI B;  3ZLI A;  4NUV A;  4OYJ A;  4IFM A;  2Z5H A;  1QL2 A;  4C46 A;  5F3J A;  3PP5 A;  2PBI A;  2WPQ A;  4CI3 B;  3MZK B;  3SOL A;  1LKX A;  2ACX A;  4I4T E;  2X68 A;  3EVY A;  3NFQ A;  5CMZ A;  1CZQ A;  2Y8D A;  1JMM A;  1S35 A;  3AA1 B;  4DBR A;  2X9H A;  2HLO A;  1G1J A;  3O8Z A;  1SVF A;  5AW9 B;  3RK2 B;  4PW8 A;  4CXX A;  2V26 A;  3BRT B;  5JVD E;  1SFC C;  4DOJ A;  4GK0 E;  4MAL A;  4A56 A;  1JY3 O;  5APU A;  1J1D B;  2NPS B;  4AYC A;  4E7Z A;  2IX7 C;  2NP9 A;  4WY4 D;  5JH7 E;  1KIL C;  3RRC A;  3PE0 A;  3MGN A;  4JYB A;  4L0R A;  3RK2 C;  2VKJ A;  1BR2 A;  1T3J A;  2Q7C A;  1QUU A;  3ZCI A;  1YKH B;  3UUL A;  1KIL A;  3RL0 D;  2WMN A;  2V7I A;  5HXH A;  2V1D B;  4UV8 B;  2LE8 A;  3NTN A;  4XA4 A;  3PTR B;  2HPC A;  3BRV B;  5L3F B;  1FZC A;  1WYC A;  1SQV K;  1MMD A;  2XAS B;  2PJQ A;  2X67 A;  4WB4 A;  5BMV E;  1M1J C;  3KV5 A;  1LRZ A;  3RYC E;  5EK2 A;  3KFW X;  5HXE A;  1LWU B;  3L09 A;  3OJA A;  1EZ3 A;  2I1J A;  4WBO A;  1SQB K;  2GUS A;  1HG5 A;  2XHE B;  3ZPO A;  2ZFC A;  2RA1 A;  4HGA A;  2A3D A;  1LWU C;  3ZYK A;  1M1J A;  3KVB A;  1JY3 N;  3P7K A;  4HH2 A;  3LK2 B;  2IFM A;  1UX5 A;  2BVM A;  4MHC A;  4PNI A;  3WAJ A;  2WTY A;  2M3B A;  2ZXE B;  5KDM C;  5AVQ B;  5AVT B;  4MBQ A;  3UTK A;  3M9Q A;  3ZN1 B;  2J58 A;  4X1I E;  3VOP A;  3R6N A;  5FY7 A;  1N7S D;  2C9L Y;  3KQG A;  3MAC A;  4DVD A;  3A5T A;  5LGU B;  4H9S E;  3CQX C;  2ES0 A;  1LTJ C;  5KLV K;  3GHG A;  1EQ7 A;  1A02 J;  1NWM X;  1YD8 G;  1LTT C;  2C5I T;  2IAK A;  2DHR A;  2J1D G;  3UUN A;  4ZHQ E;  1HS7 A;  3DP7 A;  2HG5 D;  3EFG A;  3VMX A;  1BR1 A;  2FKW B;  3RK3 D;  4IE4 A;  5FNV E;  1IC2 A;  2BZB A;  4DMW A;  2E8I A;  2FXM A;  4EAH A;  4ADZ A;  3BQK A;  2P9B A;  1N2D C;  3L36 A;  4AKR B;  4AKI A;  5JDN A;  5L3E B;  4N78 D;  2Q3I A;  2D0U A;  2KT9 A;  5DAB A;  3HE4 A;  2JEE A;  2MYS A;  5E0O A;  5AVY B;  5HXR A;  5M4Y A;  3IFM A;  5HWY A;  3H32 B;  3CQG B;  2WSF H;  5AVW B;  1X8Y A;  4LGD E;  3C4W A;  4OHF A;  4ANJ A;  4C91 A;  3B5N C;  2V7K A;  4LC1 A;  2FYU K;  3U59 A;  1T98 A;  2D5U A;  1NU1 K;  1WRG A;  3EDV A;  1JCC A;  3MIW A;  2E9X B;  1FJK A;  2E9X A;  5APX A;  4ZS3 A;  1LT9 B;  1WR6 A;  4KP3 C;  2YMY A;  2JMH A;  4ZI3 C;  2WIT A;  3BAT A;  2QM8 A;  1G73 A;  5FY0 A;  5LP6 E;  2FYZ A;  1HJB A;  2NW8 A;  2CM0 A;  2WM9 A;  2CXD A;  1MNE A;  2R5B A;  4H9R C;  3RRW A;  3B5N D;  3LBX B;  2VB6 A;  2XUE A;  2WAU A;  3ZJ2 A;  4JEH B;  1LTS C;  3PU8 A;  3ZJ1 A;  5J2U E;  1NKN A;  3V5S A;  3EDU A;  1RF1 A;  1WT6 A;  4DZO A;  1RF1 B;  2CCQ A;  2ZM8 A;  1MMA A;  4ZI3 D;  2JMK A;  2LSY A;  4UIG A;  4GKG A;  3N9P A;  3LK3 B;  1X79 A;  4C7N B;  2YKP A;  2ZM2 A;  1FMV A;  1RE3 C;  3Q5W A;  3KV9 A;  1X9V A;  3B57 A;  1URQ C;  1BR0 A;  3HE4 B;  5CCH D;  3PU3 A;  1KNZ A;  3M91 A;  3ZEF B;  4XBF B;  1LTI C;  2OYH A;  2FFD C;  1J2J B;  2CE7 A;  1KQL A;  4UF0 A;  3HD7 C;  4ZOL E;  3O1H A;  1IZN B;  1JCD A;  1GU5 A;  1IFI A;  5LJN A;  2NPS D;  2NW7 A;  2KND A;  2KYV A;  2N2N A;  4KMC A;  3E0Z A;  2C5K T;  3AA7 B;  2PAJ A;  4FJO A;  4O2B E;  4TZ4 C;  5DJQ C;  5HXC A;  3HD7 A;  4XE5 B;  4HKA A;  3L37 A;  2W0G A;  2XAH B;  1NTK K;  5H6Q B;  2N1T D;  2XAG B;  4EOT A;  1NHL A;  2BDE A;  3VKH A;  3L4F A;  1AQ5 A;  3SWH A;  4PK6 A;  3E1I A;  5JDQ A;  3J7Y q;  2YKO A;  3MA9 A;  2HPC B;  1N86 A;  1HFA A;  3LG7 A;  3P7I A;  4TUY E;  5APV A;  4UV9 B;  3MXZ A;  1ZR4 A;  5L3D B;  3HE5 B;  5LHH B;  4H63 V;  3SRZ A;  4PJM A;  5AW0 B;  2KP8 A;  2W00 A;  4G2A A;  1LWU A;  2VRS A;  3OJA B;  1GTW A;  1H88 A;  5KJ7 C;  2N1G A;  3CQC B;  3U1C A;  2W6A A;  1E5W A;  3F31 A;  3FBL A;  3Q2M A;  3JC6 D;  2LHR A;  4P09 A;  1G8X A;  2W6B A;  3QC9 A;  1N73 C;  1RF0 A;  3V5B A;  1HWT C;  3NRY A;  3TKL B;  2XZR A;  1IJ6 A;  3WI3 A;  5LHG B;  4UEM A;  5APW A;  5LXT E;  1OXZ A;  4O2A E;  4O8S A;  2LOP A;  2KSJ A;  4UVB B;  2PP6 A;  2LJL A;  3JC6 C;  3KBU A;  1FDM A;  2N1T B;  3RK3 B;  1MUU A;  5AVZ B;  2CLY C;  2Q9Q B;  2RP4 A;  3ANW A;  2M8R A;  4IST A;  1URQ D;  2KIN B;  1HVV A;  4QWN B;  4TV9 E;  3S4U A;  2A45 I;  3GWH A;  3MJX A;  4IIJ E;  2LOS A;  2H43 A;  1S9K D;  2DWG A;  4GOU A;  4CI1 B;  1G2C B;  3OA7 A;  5CCH A;  4O4L E;  3W15 B;  3GN5 B;  3ZMS B;  2R32 A;  3GN5 A;  1SFC D;  4YLH A;  3M9B A;  3V2N A;  3DTO A;  4U72 A;  1OWA A;  3LFM A;  2WBL A;  5AW4 B;  1ZLL A;  2YO2 A;  3BAS A;  5AW7 B;  1T2K D;  1AFO A;  1CW5 A;  1G1I A;  3VMZ A;  5AW8 B;  2W63 A;  3LK4 2;  4I50 E;  2IW5 B;  2OYI C;  2N1T C;  1GL2 B;  3T97 A;  4AKL A;  3VTP C;  2B1E A;  2KWH A;  2ODU A;  2HYN A;  3VP9 A;  4ILU A;  1GL2 C;  2CPS A;  1NTM K;  4BA9 A;  2PFV A;  2HFE D;  4O4J E;  2VK9 A;  3D0T A;  3I5C A;  3M9H A;  4AUW A;  3OKQ A;  1FJP A;  2ZM0 A;  3CKD A;  3C4X A;  1GD2 E;  3CX7 B;  4GYS A;  1VDF A;  4Y99 C;  2LSJ A;  4WNK A;  2DCF A;  2LSK A;  2V7M A;  3DJB A;  3AB3 B;  3RH3 A;  2VAS A;  1FZA A;  5JR9 B;  2IFN A;  4NUU A;  2K48 A;  5FY1 A;  4EXT A;  3L35 A;  2C0W A;  3N7N A;  5AW5 B;  3CI9 A;  1JO5 A;  4HE8 A;  4C90 A;  2G0U A;  3RC3 A;  3OYZ A;  2VL8 A;  2C5J A;  2WT7 B;  3NXS A;  3IEE A;  1CI6 A;  2DNX A;  4BAY B;  4H9O C;  3UIA A;  4IHJ E;  2CLY B;  2Q9Q C;  4V1A v;  4X20 E;  2XAF B;  2KLV A;  2H7O A;  1ZKE A;  3VKG A;  3H37 A;  5CB4 E;  1FEW A;  3G3Z A;  2NTX A;  1VPC A;  3M65 A;  1J1E B;  3VYI A;  2OYH B;  2JRK A;  3BQI A;  4IGU A;  5FMN A;  5FXW A;  3AAE B;  5FP3 A;  3ZCJ A;  3A5X A;  2A45 G;  3TSI A;  5FXX A;  4AQR D;  5CJ4 A;  2FFD A;  3ZC1 A;  3M0D A;  2IC6 A;  3ZMU B;  1QSD A;  4TX5 A;  4WY4 A;  2YO3 A;  1HF8 A;  1HX8 A;  3I9W A;  3TNU A;  4PK4 A;  3VU7 H;  4YJ2 E;  3UT5 E;  2WWW A;  3U3I A;  2GUV A;  1DX7 A;  3N9N A;  1GK6 A;  1FZB A;  5JRC A;  2GK9 A;  3H6P A;  1CUN A;  1ZEE A;  2CXF A;  4GT1 A;  2HH7 A;  1SQX K;  4WY4 C;  2LHN A;  3Q5X A;  1KIL D;  4ISS A;  4X1K E;  3I9Y A;  5KJ7 A;  1HH0 A;  2GM4 A;  4YFS A;  4QX7 B;  1IK9 A;  2X9X A;  2W61 A;  1GK4 A;  5C8Y E;  3N9L A;  4H9N C;  1JOC A;  1FZC B;  2CWY A;  5EZY E;  4JF7 A;  4EIJ A;  3WMM 0;  3V4W A;  2A72 A;  2EHO D;  4PJN A;  5LJM A;  1QL1 A;  4JYC A;  1NOH A;  4XAX B;  3RPU A;  3A7O A;  2POH A;  2R5D A;  4PFO A;  1FZC C;  4DND A;  1NKZ B;  2YEV C;  3N2K E;  1HUC A;  3N2O A;  3PDY A;  2CEA A;  1T8Z A;  3N9M A;  4I43 B;  4W7Y A;  2CMR A;  3F2E A;  5LBQ B;  3RK3 C;  1LT9 C;  5AVV B;  2FFD B;  3IR9 A;  5AW1 B;  4WW0 A;  1WYB A;  3MD0 A;  1N7S A;  5KTB A;  1A02 F;  1URQ B;  3PUA A;  3FBZ A;  1SLQ A;  1YYC A;  1D0Z A;  1D0X A;  4HN9 A;  3B5N B;  1N7L A;  2K24 A;  3P32 A;  5AFU L;  5CCH C;  2DI4 A;  2Q9I A;  5ADX L;  5H6R B;  1FZE A;  3HTK B;  1YTZ I;  3U1A A;  5AW3 B;  2OA5 A;  3KBT A;  4CZZ B;  1RF1 C;  1SFC B;  3K3N A;  1KIL B;  2O1J A;  1D1C A;  2KXP B;  3AAA B;  5ETW A;  1FOS E;  5FXZ A;  1IFM A;  2NPS C;  2UXN B;  4QX8 B;  3T8O A;  1D1A A;  4OH8 B;  4RES B;  1Y64 B;  2ZMA A;  3N4X A;  3ETU A;  3ESL A;  3P8C D;  1GL2 A;  1HGZ A;  4I1L A;  3AVS A;  2OAR A;  3H32 A;  3HR0 A;  3N9Q A;  2D2S A;  5L3C B;  3KV6 A;  5AVS B;  4AKH A;  2MJZ A;  1D0Y A;  1MIY A;  3H3A A;  4N78 E;  5HXS A;  1UCU A;  1D1B A;  1HBW A;  1IJ5 A;  2K9A A;  3PUR A;  5EK3 A;  1Z56 A;  1B7T A;  5JDF A;  4BJN A;  3EQ2 A;  3C51 A;  1YTZ T;  2YKQ A;  5APY A;  2NWB A;  2YIN A;  5J1G A;  3RC8 A;  2JJ9 A;  2P2U A;  5KJ7 D;  2YU1 A;  3HKD E;  5LHI B;  3MKD A;  1AJ3 A;  1JNM A;  1FU1 A;  5AVX B;  1FAV A;  3I0Q A;  3O1I A;  3EUH A;  2XU6 A;  2WWU A;  3FHN A;  3UUX B;  3C4Z A;  3P8C E;  3ZN0 B;  2P67 A;  4L5G A;  5GON E;  2J59 M;  2EHO A;  2IPP A;  2E43 A;  3Q9D A;  3NMD A;  4M3L A;  4I6M C;  4EIW A;  2CPB A;  2VKO A;  1JY2 N;  1LTB C;  3I0O A;  2E9X D;  2W27 A;  1WLX A;  5AVR B;  3K3Q C;  4IDZ A;  3CWZ B;  4EB6 E;  2X9W A;  2MBG A;  1S9K E;  3RX6 A;  4ZI2 C;  2LEH A;  5LG4 A;  4KUM B;  1YW0 A;  2WSS V;  4CXY A;  2XTL A;  4JLE A;  1ZN5 A;  1MMN A;  1YKE B;  4DO0 A;  1RE3 A;  1V9D A;  3KIN B;  5FYM A;  5JRE A;  2XAJ B;  3OYX A;  1J1D C;  3E22 E;  3KPE A;  1XTG B;  1J1E C;  3TNU B;  2OYH C;  3LJC A;  3AAI A;  3V2R A;  1SA0 E;  2HOD A;  1T3U A;  3I1A A;  1MZ9 A;  1RE4 C;  1VOM A;  2SPC A;  4IE0 A;  1L0L K;  2H8P D;  4OFZ A;  1HTJ F;  2I1K A;  3GHG C;  3P8M C;  3TK1 A;  3M0D C;  2QM7 A;  2OYI A;  4IFD K;  2A2F X;  4PK5 A;  3J9X 1;  5JDG A;  4W80 A;  2L9Q A;  4H9Q C;  5EK4 A;  4ERR A;  2E42 A;  5JDM A;  2LKM A;  4Z8X A;  4WBA A;  1JY2 O;  2E9X C;  4H9P C;  2EHO B;  4AQG A;  5JR9 C;  2WT7 A;  2H3R A;  4IE7 A;  3UFE A;  5LGT B;  2HPL A;  4C7N A;  4EYU A;  1HCI A;  3B13 A;  1DEB A;  2Y6X A;  3QUJ A;  4KHX A;  4PJJ A;  4U74 A;  3NRX A;  3RYF E;  2WSE H;  1HTL C;  2D0T A;  4PJL A;  1CSB A;  3L3P A;  1DH3 A;  4UF0 B;  4QXH B;  4L9I A;  2N1T A;  4AQF A;  4E7S A;  4AI6 A;  2P7J A;  2DLR A;  3PUQ A;  1VRB A;  5F8P A;  3ZYL A;  2MTQ A;  4MLK A;  1N7S B;  1HGV A;  2EHO C;  3C98 B;  4YJ3 E;  2JQQ A;  3VN0 A;  1MFZ A;  4GIF A;  1RY3 A;  3HUS C;  4LLH A;  2C9N Y;  1U5P A;  1L4A A;  3GMI A;  4JUY A;  5LGN B;  1GU4 A;  4FI5 A;  4B86 A;  5L3B B;  5DQV A;  1Z0P A;  1W2E A;  4N3Y B;  1IO4 A;  3GA8 A;  3N5L A;  5L3G B;  3MTU E;  2KMF A;  5BVZ A;  1H89 A;  4QKN A;  3SWF A;  1KFM A;  1L4A C;  3N9O A;  2Z5I A;  2UXX B;  1US7 B;  1KK7 A;  4AXP A;  3ETV A;  4IE6 A;  3O9X A;  4JEU B;  5AVU B;  3HE5 A;  1LTJ A;  4GYR A;  1SFC A;  5CCG C;  4TN7 B;  1ZV8 A;  4IFF A;  4ZKU A;  2YU2 A;  4Y99 B;  3AA0 B;  1IJD B;  3N2G E;  4KBM B;  1NO4 A;  4CQI A;  5FXV A;  2CWO A;  4O9B A;  2XAQ B;  1WRD A;  2XKM A;  3VMY A;  4X1Y E;  4CXW A;  3LID A;  2X9Y A;  3LBX A;  1M1J B;  3VP8 A;  1SHZ C;  4ASK A;  3RYI E;  3C50 A;  3HKE E;  4DBQ A;  5JR9 A;  1LTA C;  3RL0 B;  4G63 A;  4J2C A;  2O1K A;  1LTG C;  2P1J A;  3M06 A;  3II6 A;  5LA6 E;  2W62 A;  2YK0 A;  3B5N A;  2M67 A;  4ZS2 A;  4YHJ A;  3V2P A;  1NTZ K;  4I2L C;  4P0B A;  5JDL A;  1L4A D;  2L3L A;  3KVA A;  2O01 H;  1JY3 P;  1FIO A;  2ZLY A;  2XQY A;  2WPR A;  1PFI A;  5BU8 B;  3PUS A;  2VKD A;  3V5U A;  3M0A A;  1JTH B;  3KDS E;  4AQF C;  5L2L A;  4ZI2 D;  1RF0 C;  3WAK A;  5APQ A;  1NWQ A;  3IF8 B;  4W7Z A;  1LT9 A;  3NZQ A;  2VWA A;  5KMG P;  1UX4 A;  3RKO A;  1GW4 A;  2I59 A;  2K5B B;  3NZP A;  1GW3 A;  3HKC E;  4HFV A;  1MND A;  4F6R C;  4MFR A;  3BVH A;  2QA7 A;  2HPJ A;  3AVR A;  3U78 A;  3IBP A;  4HEA A;  1H7C A;  5IYZ E;  1FMW A;  5CA1 E;  5AW2 B;  1L0N K;  1ZR2 A;  1N73 B;  4EZ4 A;  3HD7 D;  1N73 A;  2A45 H;  4OK0 A;  5CCG D;  3F57 A;  2KZ7 B;  3V2Q A;  4HYT B;  3ZMV B;  5CA0 E;  4IE5 A;  5TAO A;  4OYK A;  5A1L A;  2KLQ A;  2Y48 B;  1MIW A;  4UVA B;  5HAX A;  4EYY R;  4O4I E;  5LNK A;  1BR4 A;  1KZU B;  2LSG A;  4I55 E;  2XNX A;  5LOV E;  5JRC B;  5APT A;  4ZKP A;  2HOD B;  2XV5 A;  2CA5 A;  1MV8 A;  3MUD A;  3C64 A;  2BVL A;  4K0U A;  3CML A;  1JTH A;  5JQG E;  1LVK A;  4O4H E;  3KDP B;  1FBM A;  4DMV A;  1FZF A;  3NBX X;  2OYI B;  4GK5 E;  3HL6 A;  2NPS A;  3OAK A;  3FXE B;  3HI2 A;  2BAS A;  1S94 A;  2Z6E A;  1H8A A;  2C0X A;  1HG2 A;  2H7V C;  3ZMZ B;  2WMO A;  2CXL A;  3VHL A;  4HTE A;  2JJL A;  1FOS F;  2ODV A;  5LYJ E;  2LM9 A;  5APS A;  3BQL A;  4TV8 E;  3HUS A;  2JPF A;  1O3X A;  3HUS B;  3CVR A;  4P0A A;  2MOZ A;  2R3C A;  1IFN A;  3HD7 B;  2X66 A;  1G2C A;  3LW5 H;  3O1J A;  2VKH A;  2PG8 A;  3A2A A;  3CPZ A;  3CX8 B;  1URQ A;  2QGS A;  1SQP K;  5CHX A;  2V7J A;  5LBM A;  3LIE A;  3TYY A;  5CJ0 A;  1FZG A;  2N9D A;  1NAF A;  2KOG A;  3HTK A;  5AW6 B;  3BK9 A;  2H7H A;  3V4Q A;  1T2K C;  2IC9 A;  3HRN A;  5HYA A;  1GZL A;  2L5G B;  2Z4E A;  1SQQ K;  1JUN A;  3K8P C;  3ZMT B;  3UUM A;  1KFN A;  1XTC C;  3CL3 D;  3HA4 A;  3KV4 A;  1LTJ B;  1GL2 D;  3GHG B;  5LCY A;  3FXD B;  2WSC H;  2DWK A;  2Q9Q A;  3ANW B;  3K3O A;  3SS1 A;  5CCG A;  1LGH B;  3O4X E;  4UXN B;  1M7L A;  3QK6 A;  4CI2 B;  2YNY A;  2WPS A;  3FB2 A;  2X0L B;  4WBN E;  4ZI7 E;  1ZV4 X;  2Q5U A;  3MK7 C;  5J2T E;  1L4A B;  3R84 B;  5IHY A;  4AKG A;  4PFP A;  3C9I A;  4EZH A;  3RYH E;  4EOZ B;  5KX5 E;  4UEL A;  1GDT A;  1CI6 B;  1E1H B;  1RE4 A;  2LSI A;  3A3Y B;  3R2P A;  2NTY A;  1ZHC A;  3AA6 B;  2NOX A;  3PUG A;  3RL0 C;  2L8K A;  1LVF A;  2V7L A;  5HWX A;  5JDH A;  4QXB B;  3RK2 D;  3CX6 B;  4B6X A;  3SWY A;  2LT3 A;  1NH4 A;  4BJM A;  1IAP A;  3ZYM A;  1IFJ A;  1MMG A;  4QHO A;  1N7S C;  4WY4 B;  3ZC0 A;  1MIV A;  4N6J A;  5BU5 A;  1SP4 A;  2X51 A;  4PAG A;  1IFD A;  4GIW A;  4C7R A;  4M1P A;  2N9B A;  3HKB E;  3OBV E;  2C0S A;  3IHR A;  3E08 A;  2Q9Q D;  3B8E B;  1U4Q A;  3KYQ A;  2NW9 A;  1X79 B;  3CLQ A;  2XDJ A;  3ONX A;  2WZ7 A;  4QXC B;  4XZC A;  5DQW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...