2CWYA

Crystal structure of conserved hypothetical protein, ttha0068 from thermus thermophilus hb8
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
94
structure length
94
Chain Sequence
MVPDWEEVLGLWRAGRYYEVHEVLEPYWLKATGEERRLLQGVILLAAALHQRRLGRPGLRNLRKAEARLEGLPCPLMGLDWRSLLQEARRRLGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein TTHA0068
publication title Crystal structure of conserved hypothetical protein, TTHA0068 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
total genus 33
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2005-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03745 DUF309 Domain of unknown function (DUF309)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.500 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2cwyA00
2CXDA 2CWYA
chains in the Genus database with same CATH superfamily
4DUYT 2HPJA 2L3LA 2Q9QD 3ZYMA 2Q9QA 3QOFA 5JR9C 2X51A 4X5TA 4QX8B 4A56A 3HKEE 3UU8A 3LK42 5LYJE 3L3PA 5FY0A 3ZMVB 3LBXB 4WW0A 2VKHA 3PUWF 1SA0E 3ABVA 2AXDS 4XBFB 5AQTB 1G8XA 4IE0A 4WBNE 3TLUA 5L3CB 1ZKEA 3N9LA 5HEJA 3B57A 5LBMA 4HWIB 3FBZA 2KSRA 4QH1A 3UT5E 2ZM6T 4EEBA 4ZHQE 2BG9B 4ZI2D 3AA6B 3NRXA 2KT9A 2V6YA 2WAUA 5LNKA 4CI3B 1X79A 2XQ7A 4DO0A 1CUNA 4ZI3D 4UR9A 2CBIA 5CGMA 3PUVF 3KDSE 5F8PA 2NOXA 4EZ4A 2XQAA 3MACA 3FZMB 4JI8T 5FYMA 2XASB 4YTMA 3FHNA 2KZ7B 2IC6A 3E08A 1I94T 3NVOA 4DV0T 3OVUA 3UUNA 2V6XA 1W09A 3QC9A 4AQFC 4OHFA 1BR2A 5J2TE 4UF0B 4IREA 5CB4E 3EAMA 5LA6E 5BMVE 2CRBA 5LMUT 1HNZT 3N9OA 3RQUA 2UXDT 3UU6A 1WFDA 4FI5A 3NRYA 3P8CD 4DR3T 3VR9A 2WM9A 2V5DA 5EZYE 4PK4A 3UULA 5ETWA 2CBJA 4LMKA 4JI5T 2WWVA 2Z6EA 3L09A 4AKGA 3EHZA 3AXJB 2PG8A 2K5BB 2YINA 2EHOC 2UUCT 3IEEA 2ODVA 4TV9E 4UELA 4JV5T 2JQKA 2BDEA 2JQHA 3PUYF 4F6RC 3JAEA 2L9QA 1T72A 3AE5A 5ADXL 2VL0A 4E7ZA 3OJAA 4HGAA 3AE7A 5ABHA 3L8RA 5AQGB 4EB6E 1BR4A 4LF6T 3T1YT 2J4GA 4LMJA 2NW7A 1XNRT 5DQWA 3QK6A 2LJLA 4QXCB 4AISA 5AQSB 4ILUA 3FBLA 2VWAA 4HFIA 5JDMA 5LGNB 3AE2A 5JRCA 1SHZC 3FZLB 1E1HB 5EK2A 5JH7E 1OEDC 2NW8A 3H3AA 2AE9A 4HN9A 1HTJF 2VL8A 3PUAA 1QUUA 3SFDA 3ZJ1A 1KFYA 4PJNA 4ISTA 4PNIA 3RKGA 4B6XA 4PK6A 2IMLA 2X0LB 1YQ3A 4GKJT 4IL4A 1T7SA 4DV4T 2DCFA 3VRBA 1MMDA 3HKBE 4UIGA 1XDPA 1HFAA 2BG9C 1MIYA 3J7Yq 1KNPA 4LMLA 2F4VT 2CA5A 5H6RB 1W9RA 3K8PC 5L4HA 3S4UA 3GN5A 2E2AA 1JNZA 2YN6A 4ERRA 2XUEA 2C0SA 1N34T 3KBTA 2Q9QB 5LGUB 5FVLA 3M3ZB 3CK6A 2HN2A 4BJNA 3VKHA 1XWMA 2CCQA 1WCRA 3O4XE 3QUJA 2K9AA 4GOUA 2KWHA 4JI3T 2BKPA 4YLHA 3GMIA 2E8IA 2YKSA 4QX7B 1T8BA 5LGTB 3ZKRA 4DV1T 4HWFA 5IYZE 3ZSTA 3RX6A 5LG4A 2J62A 4YHHT 1WLXA 5FXVA 2MPKA 3MZKB 2CXDA 4B3TT 1M7KA 4XZCA 5JTGA 3RGLA 5FP3A 3EUHA 3AE4A 4CQIA 4DV5T 2PTFA 3UQ4A 1FEWA 1LVKA 1HCIA 2LE8A 3SS1A 1YD8G 2IUBA 1KNZA 5KMGP 3L39A 3V5UA 3X1DA 2WSSV 2WDVA 2L8KA 4PJJA 3P7IA 2XAGB 4DR7T 3FZKB 4CI2B 2RP4A 4UXNB 3LJCA 4TZ4C 2RA1A 4QXHB 2HH7A 4ANJA 4MALA 4PFOA 2QYWA 2QGSA 4NPPA 2J47A 2K24A 3VR8A 1FMWA 2DLRA 1W0AA 1W0BA 2UXCT 3HA4A 3PURA 1NWMX 3E0ZA 3ZCIA 3JAFA 5L3DB 1ZP0A 1HNWT 4O4IE 2BBHA 2X9YA 4GKKT 1QLBA 3O1JA 5J1GA 3RIAA 3CX7B 4EV6A 4K0KT 1UGOA 4A5XA 2DWKA 2A3DA 4P09A 4TWHA 5LB7B 3CPZA 5C3JA 4UVBB 1ZHCA 2HPLA 3HKDE 4JI6T 5CA1E 2LRKA 3AEDA 5FL1A 4IE4A 3RC8A 3PJAA 1LRZA 3RLFF 5LJNA 2XM2A 5FXXA 4DBQA 1E7PA 4QHOA 4HTEA 5JVDE 3PUGA 2IHR1 3NKZA 3LG7A 2D0TA 5L3EB 2CHOA 1J1JA 5JRCB 3CX6B 4GYRA 2NTXA 4C90A 3ETUA 3ONJA 3RIUC 2ZMAA 2ES0A 3K3OA 3GWHA 4B3MT 3P50A 2C5KT 2Q9QC 3VU7H 4J2CA 4JEUB 2J1DG 2V8SV 5M4YA 1WRDA 4X65T 3OYZA 3R84B 3ZEFB 4U33A 3P4PA 1XZYA 5JREA 4DV6T 3AA1B 1BR0A 1OEDE 1LKXA 1U5PA 3TLVA 2JQQA 5L2LA 2LEHA 2UUAT 4DR6T 4ZI2C 3ZN0B 4ILCA 1MNEA 1H7CA 5JQGE 4EGWA 4DMVA 4HFEA 4YFSA 4JI1T 4ZI3C 3GN5B 4COFA 2VASA 4HEAA 2JPFA 2A9UA 4QXBB 3WI3A 2HN1A 5EK3A 3FZHB 3PDYA 1XMQT 2B1EA 2BG9E 5L4EA 1IAPA 1YKEB 2JMHA 3KV5A 4IT4A 2XZEA 2CE7A 4WBOA 1SE7A 2IIUA 4MHCA 2LSGA 3O1IA 2D9DA 3U78A 5AQMB 2N2NA 3ZSSA 5HXHA 5HXRA 5L47A 5FY1A 4DV2T 5L3FB 3BQIA 4KBMB 4YJ2E 4DMWA 4WZXA 4Z8XA 1D0XA 2LSIA 5DJQC 4ZZCA 1MIVA 4NXMT 5F3JA 4TWDA 3IBPA 4O4LE 2N1GA 4O8SA 3JADA 4TN7B 3UUMA 4X66T 3RPUA 4PFPA 4JI7T 3ZT5A 4UVCB 2XQ5A 1G73A 2W63A 2SPCA 2YDSA 4EYUA 2XAJB 2X9XA 1X9BA 3UQ7A 4U2ZA 5IWAT 4MBQA 1T98A 2QRXA 4AI6A 2YDRA 4U72A 4I43B 3I0QA 4ADZA 3N9QA 3W15B 4X62T 3ZCJA 2UXXB 4Z91A 5JDFA 3B5MA 4JBWF 4HWHA 3DP7A 2HHHT 2BVLA 5EK4A 4C91A 4DV7T 3F57A 4JI2T 2LHRA 2LOPA 3PUSA 4IDZA 3LDQB 2V7KA 5LOVE 2UXBT 5AFUL 4LF7T 4UEMA 3EVYA 4PK5A 3ZT7A 3ZMZB 2CEAA 2WBLA 3RYFE 2NW9A 3MK7C 1KK7A 2C5IT 1MMGA 4IHJE 3EDUA 1FMVA 1UUSA 3VRAA 1IBMT 3AEAA 3RYCE 4YT0A 3PUQA 3N2OA 1YKHB 4I50E 4JI0T 3SFEA 5L3GB 2ACZA 5LMNT 5H6QB 2V26A 4X1IE 1ZEEA 3TLWA 4AKIA 4LF8T 3HI2A 3LSVA 3OYXA 2Y6XA 4H9SE 3JC6D 4X64T 1UK5A 2K3WA 5JDNA 1XMOT 3VKGA 3ZYLA 3MKDA 4H63V 1LVFA 4O4JE 2OA5A 4BA9A 3N2GE 1HX1B 1WYCA 4LF4T 3N9PA 3MJXA 3PE0A 5LHHB 4QH4A 2X66A 4H9OC 2VQFT 4LF9T 5GONE 3ANWA 3RHWA 2MBGA 4U31A 4YTPA 3N9NA 4KHZF 2JQ9A 4NUUA 2FJEA 5HCMA 4IDQA 3G06A 1UURA 3C64A 1WR6A 3SWHA 2A72A 1MMAA 2WQYA 2JRKA 4ZS2A 5L3BB 1KEYA 3DJBA 5LP6E 4H9RC 3D0TA 4YTNA 2MYSA 4GIWA 2BBJA 5AQJB 1R8IA 5LG3A 3CX8B 3HKCE 2BZBA 4P1NA 1IJ6A 3NZPA 4DR1T 2W00A 2CWOA 5ABGA 1US7B 3J9X1 4JI4T 4ZXLA 2E9XA 2I59A 2XAQB 3KVBA 3Q5DA 4CN4A 1XDOA 2CMRA 5FKYA 4LF5T 1WYBA 3H3MA 2CXLA 3RYIE 4I55E 3ZYKA 2ZM8A 2CLYB 3BK9A 2XAHB 3U3IA 3ZMTB 2LHNA 3I9WA 3NWIA 4MFRA 5IUXA 2I6HA 2V6YB 2A2FX 2XQ6A 5AQPB 2XAFB 4GYSA 4TX5A 3FZFB 2JJ9A 5AQNB 4FJOA 2W67A 3LBXA 1HG5A 4H9PC 3WAJA 2WWUA 4L5GA 4AKLA 2K48A 3K3QC 4LFCT 2P9BA 5AQRB 3ETVA 3OPCA 3K1SA 2H3RA 2MTQA 4CZZB 3JCFA 2WP9A 2V7IA 4DR4T 3RQWA 1QSDA 4WYVA 4Z90A 3BQKA 2W0GA 4M1PA 2Y8DA 3N5LA 3RC3A 5JDHA 1JNRA 2ZLYA 4ZZBA 5ABFA 5JDQA 3RI5A 3H37A 3C4WA 2WZHA 5LJMA 4X1KE 4CN6A 2X67A 4DR2T 3LK3B 4G63A 4H9QC 1NEKA 1HS7A 2XY8B 4ZI7E 4NXNT 2X9HA 3NZQA 1XNQT 1M62A 3C98B 2LSKA 1N33T 2WY2A 5AQUB 5ABEA 1D1BA 3RKOA 2X9WA 2YEVC 2VVNA 2KXPB 3CQGB 3AEBA 3F31A 1HNXT 3AEEA 3Q2MA 2YU1A 4UVAB 1Z0PA 2X0HA 4ZOLE 2WMOA 3OKQA 1VCTA 5AQIB 3A8YC 4YXDA 3ZT6A 2D0UA 3RH3A 2N9DA 4HE8A 3AE6A 5HEOA 4OX9T 3IF8B 3GA8A 4DUZT 3AECA 1D1AA 3CQCB 3ZC1A 3RRCA 4JYAT 2NWBA 4KI0F 1O3XA 4V1Av 5AQKB 2Y48B 4OYKA 5FVKA 4YJ3E 4GK5E 3CMLA 3CKDA 1S94A 3F2EA 1GQEA 4X1YE 3AEGA 1UX5A 5FY7A 3AEFA 2VVSA 5FL0A 3ANWB 2M6BA 3ZJ2A 2LM9A 2CPTA 3AVRA 2IW5B 4AQYT 3T8OA 3T1HT 3Q9DA 3Q5WA 5AQQB 4EAHA 4IDOA 3C4XA 2CLYC 2IAKA 4TNWA 4ISSA 2LM2A 1V9DA 3N9MA 3KFWX 5AQOB 2G0UA 3B13A 1VOMA 2IDOB 5FMNA 2OLTA 4HWCA 2W66A 2VKOA 4O4HE 3CIRA 2V7JA 4N78D 2YU2A 3UUBA 2XSBA 4E7SA 5KXJA 2W2UA 2XJ7A 4IGUA 3AE9A 4KUMB 4JLEA 5A1LA 1L0VA 4EZHA 2WMNA 3PJAJ 1NENA 4JUYA 3I1AA 3Q5EA 4EOZB 3LK2B 4AXPA 3AA0B 2CHNA 4IDPA 3P4RA 5LHIB 3PU8A 5E0OA 2VURA 3KV4A 5JDLA 3QB5A 4I0UA 2LKGA 1KNRA 4L9IA 1Z8UA 2WDRA 5KDMC 3K3NA 3PU3A 4PJMA 2ZM0A 4L0RA 5TAOA 1N32T 4KX6A 1U4QA 4AIUA 2X68A 2ODUA 3CVRA 4IE7A 1FJGT 4B3ST 3IA3A 3EI0A 1HF8A 3LFMA 2WZIA 3UU4A 3AAEB 2DHRA 2B76A 3Q5XA 4DR5T 3UFEA 4PAGA 5HXCA 5ABFB 2H88A 4NUVA 4NIQA 4CI1B 3N2KE 3ONXA 4IE6A 4OK0A 2FJAA 4CN1A 2CM0A 4G2AA 4HWDA 2PBIA 4EXTA 5JR9A 2NTYA 1SUMB 3JC6C 3V5SA 4A97A 3FB2A 1HX8A 1KF6A 5FXWA 3RRWA 4I4TE 1YW0A 3RIFA 2KINB 2FJBA 2BS3A 2DNXA 3KV9A 2VK9A 2W4XA 5BR8T 2LSYA 3UTKA 2V1DB 4IE5A 1Y64B 2D5UA 5HEGA 5AQHB 3HL6A 3HR0A 4BAYB 2JMKA 4ILAA 2KNDA 4KP3C 4H63H 1J5WA 4CXXA 3FXEB 4AKRB 2MAWA 2CXFA 5CJ5A 3UUXB 5HXSA 2NR4A 4AKHA 3ZN1B 2KMFA 4MLKA 3AB3B 4IL9A 2BVMA 4AQFA 4QKNA 1B7TA 4YSXA 3TLTA 5DQVA 1OXZA 1IZNB 5IHYA 3EDVA 3AAAB 4UV9B 1J5ET 1HG2A 2QVAA 1MNDA 3P4WA 2E9XC 1E2AA 1UCUA 4ZS3A 2FBWA 4CXYA 1S35A 1ZV4X 3KBUA 3SRZA 3KVAA 4YHJA 3KINB 4DBRA 4B3RT 2UU9T 3PUXF 2EHOD 4OFZA 3MA9A 2EHOA 2I0MA 2WU2A 5J2UE 2VQET 1FIOA 3P4QA 4U74A 1VRBA 4DVDA 4IDNA 1NAFA 3CQXC 2XQYA 3P4SA 5HEHA 2V7MA 5AQFB 2KLQA 3QB5K 2ACXA 2E9XD 2QA7A 3VHLA 5HCJA 4O2BE 2YOEA 3OBVE 4A98A 4U7YA 2RPAA 3WAKA 5HXEA 4CXWA 4DV3T 3A5XA 1WR0A 4ILBA 2BKOA 5FNVE 5LBQB 1OEDA 4X20E 5F5WA 2WU5A 3QNUA 4KHPT 3O9XA 1IJ5A 5HWYA 2XQ9A 3PTRB 2DL1A 2LOSA 2ZM2A 2E5VA 1YQ4A 3AA7B 3A7MA 3UU3A 5AQLB 1ZOYA 3ESLA 2VKJA 4TNVA 3AE1A 1D0ZA 1BR1A 3IHRA 4ZEYA 2BKNA 2M6IA 4HFVA 1EZ3A 5DABA 2C5JA 2WDQA 3AAIA 2BG9A 4HFHA 3AE3A 3E22E 3PV0F 3SOLA 2IC9A 2GK9A 5CA0E 3ZC0A 2LRLA 3UU5A 3AVSA 1IBKT 2PJQA 4PJLA 3C4ZA 3O1HA 2XQ3A 4HFBA 4QWNB 4P0BA 4O2AE 5JR9B 3NBXX 4IIJE 3KV6A 3CWZB 3PUZF 4XAXB 4U2YA 2BS2A 4P0AA 1D1CA 2KWIB 2WS3A 2MOZA 4EEDA 4LFBT 1MMNA 3UFGA 3AE8A 4HKAA 4DIDB 2M67A 4WNKA 3ZMSB 2R6GF 4UF0A 4HFCA 1HR0T 2LT3A 3DTOA 1DU2A 1I6ZA 2JIWA 2XQ4A 3ZMUB 2NP9A 3TKLB 4HFDA 3TLSA 3RF1A 1Y01A 5C2TA 3ZPOA 2DI4A 2YDQA 1AJ3A 3RYHE 4YY3T 4LFAT 3I0OA 1CHUA 2DWGA 2H7VC 4OYJA 5C8YE 5LCYA 4Q25A 2W62A 4PW8A 2UXNB 3EABA 2XPKA 2XQ8A 4YSYA 1N36T 4AQGA 3AXJA 3I9YA 2V7LA 3C51A 3ZLIA 2XM1A 2D2SA 4F8HA 5CFBA 5HWXA 4YSZA 4BJMA 4TWFA 3MXZA 2W61A 4JEHB 2V5CA 2VKDA 2VB6A 1OWAA 2E5LT 5HAXA 5HYAA 1UX4A 5KX5E 4K0UA 4KMCA 4GK0E 2WCAA 4DNDA 2LLYA 4UV8B 4TV8E 2EHOB 4U3CA 1IBLT 4H9NC 3BQLA 2OV9A 4ASKA 2UUBT 1MIWA 4EYYR 2WB5A 2LSJA 2FJDA 3ONLC 4U7IA 1VCSA 2XTLA 5HEUA 3C50A 3R6NA 3OTOT 2FUPA 2LKHA 5JDGA 4QH5A 5LXTE 3M65A 2PFVA 4TUYE 5LHGB 2E9XB 1D0YA 1YXRA 4EIWA 3FXDB 5J0ZA 2XSAA 2H7OA 2CWYA 5AQVB 3RIUA 1OEDB 2YK0A 5FXZA 2BS4A 2X0YA 2XHEB 2H89A
chains in the Genus database with same CATH topology
4P09A 1WYBA 4BAYB 2HPJA 2L3LA 2Q9QD 2JMKA 3CPZA 2CXLA 4UVBB 3ZYMA 3RYIE 1ZHCA 2HPLA 2Q9QA 3HKDE 4I55E 5JR9C 3ZYKA 2X51A 5CA1E 2ZM8A 2KNDA 4KP3C 4QX8B 4A56A 3HKEE 3LK42 2CLYB 5LYJE 4IE4A 3BK9A 4H63H 2XAHB 3L3PA 5FY0A 3U3IA 3LBXB 3ZMTB 3ZMVB 3FXEB 4CXXA 3RC8A 4AKRB 2LHNA 3I9WA 4WW0A 2VKHA 4MFRA 1LRZA 2CXFA 3UUXB 1SA0E 2A2FX 5LJNA 5FXXA 4XBFB 1G8XA 5HXSA 4DBQA 4AKHA 4IE0A 3ZN1B 2XAFB 4GYSA 2KMFA 4TX5A 4WBNE 4QHOA 4MLKA 4HTEA 3AB3B 5JVDE 3PUGA 2BVMA 2JJ9A 4AQFA 4QKNA 1B7TA 1ZKEA 2D0TA 3LG7A 3N9LA 5L3CB 4FJOA 5L3EB 3LBXA 5DQVA 1OXZA 3B57A 1HG5A 4H9PC 5LBMA 1IZNB 3FBZA 3UT5E 5IHYA 3WAJA 5JRCB 2WWUA 3EDVA 4L5GA 4AKLA 3AAAB 3AA6B 3NRXA 2K48A 4ZI2D 4ZHQE 2KT9A 3K3QC 3CX6B 4GYRA 2NTXA 4UV9B 4C90A 2WAUA 3ETUA 2P9BA 5LNKA 1HG2A 4CI3B 1X79A 1MNDA 3ETVA 2ZMAA 4DO0A 1CUNA 2H3RA 2E9XC 2ES0A 3K3OA 2MTQA 4ZI3D 1UCUA 4CZZB 3GWHA 4ZS3A 4CXYA 1S35A 1ZV4X 2V7IA 2C5KT 3KBUA 3SRZA 1QSDA 3KDSE 2Q9QC 5F8PA 3BQKA 2NOXA 3VU7H 4J2CA 4JEUB 4EZ4A 2J1DG 5M4YA 3MACA 2W0GA 3KVAA 4M1PA 4YHJA 5FYMA 1WRDA 2XASB 2Y8DA 3FHNA 3KINB 3OYZA 2KZ7B 3R84B 3N5LA 3RC3A 2IC6A 3E08A 4DBRA 3ZEFB 5JDHA 2ZLYA 5JDQA 5JREA 3AA1B 1BR0A 2EHOD 4OFZA 3MA9A 1LKXA 3UUNA 1U5PA 3QC9A 2EHOA 4AQFC 4OHFA 3H37A 5J2UE 1BR2A 3C4WA 5J2TE 5LJMA 2JQQA 1FIOA 4UF0B 4X1KE 5CB4E 2X67A 4U74A 5L2LA 1VRBA 2LEHA 3LK3B 5LA6E 4G63A 4H9QC 5BMVE 1HS7A 3N9OA 4ZI2C 3ZN0B 4DVDA 4ZI7E 2X9HA 3NZQA 1NAFA 3CQXC 4FI5A 1MNEA 2XQYA 3C98B 3NRYA 1H7CA 2LSKA 3P8CD 5JQGE 4DMVA 2V7MA 4YFSA 2WM9A 4ZI3C 1D1BA 3RKOA 2X9WA 2KLQA 3GN5B 5EZYE 2YEVC 4PK4A 3UULA 2KXPB 2VASA 3CQGB 5ETWA 3F31A 4HEAA 2ACXA 2JPFA 2E9XD 2Z6EA 4QXBB 2QA7A 3L09A 3WI3A 3VHLA 4O2BE 5EK3A 3Q2MA 2YU1A 3OBVE 4AKGA 3PDYA 3WAKA 2B1EA 4UVAB 5HXEA 1Z0PA 1IAPA 4CXWA 1YKEB 3HR0A 4ZOLE 2JMHA 2PG8A 3KV5A 3A5XA 2K5BB 2YINA 2WMOA 2CE7A 3OKQA 2EHOC 4WBOA 5FNVE 5LBQB 3IEEA 2ODVA 4TV9E 4UELA 4X20E 4MHCA 2BDEA 2LSGA 3O1IA 4F6RC 2D0UA 3RH3A 2L9QA 2N9DA 4HE8A 3U78A 5ADXL 3O9XA 1IJ5A 4E7ZA 2N2NA 5HWYA 3OJAA 3IF8B 3GA8A 4HGAA 5HXRA 5HXHA 3PTRB 2LOSA 2ZM2A 1D1AA 3CQCB 3AA7B 5FY1A 3ZC1A 3RRCA 4EB6E 5L3FB 3BQIA 1BR4A 2NWBA 4KBMB 4YJ2E 1O3XA 4V1Av 4DMWA 2NW7A 4Z8XA 1D0XA 5DQWA 2LSIA 5DJQC 2Y48B 3ESLA 4OYKA 1MIVA 3QK6A 2VKJA 2LJLA 4QXCB 5F3JA 4YJ3E 4GK5E 4ILUA 3FBLA 3IBPA 4O4LE 2VWAA 1D0ZA 2N1GA 3CMLA 5JDMA 4O8SA 1BR1A 3IHRA 5LGNB 3CKDA 1S94A 3F2EA 4TN7B 4HFVA 1EZ3A 4X1YE 3UUMA 5JRCA 5DABA 2C5JA 1SHZC 3AAIA 3RPUA 1UX5A 5FY7A 4PFPA 3E22E 4UVCB 1E1HB 3SOLA 3ANWB 2IC9A 2GK9A 5CA0E 5EK2A 5JH7E 3ZC0A 1G73A 2W63A 2NW8A 2SPCA 4EYUA 3ZJ2A 3AVSA 2XAJB 3H3AA 2X9XA 2PJQA 2LM9A 4PJLA 3AVRA 3C4ZA 3O1HA 4MBQA 4HN9A 2IW5B 1T98A 4AI6A 1HTJF 2VL8A 4U72A 4I43B 3I0QA 4ADZA 3PUAA 3N9QA 3W15B 3ZCJA 3T8OA 2UXXB 4QWNB 4P0BA 5JDFA 1QUUA 3Q9DA 3Q5WA 3ZJ1A 4O2AE 4EAHA 3DP7A 5JR9B 3C4XA 4PJNA 4ISTA 2CLYC 3NBXX 2IAKA 4IIJE 4PNIA 3KV6A 4ISSA 4B6XA 4PK6A 2X0LB 1V9DA 3N9MA 2BVLA 3KFWX 3CWZB 4XAXB 2G0UA 3B13A 5EK4A 4C91A 4P0AA 1D1CA 2KWIB 2MOZA 1VOMA 3F57A 5FMNA 1MMNA 2LHRA 2LOPA 3PUSA 4HKAA 2M67A 2VKOA 4O4HE 4IDZA 4WNKA 3ZMSB 2V7JA 2V7KA 2DCFA 4N78D 1MMDA 2YU2A 4UF0A 3HKBE 2LT3A 3DTOA 4UIGA 5LOVE 1HFAA 5AFUL 4E7SA 1MIYA 4UEMA 3J7Yq 3EVYA 3ZMUB 2NP9A 3TKLB 2CA5A 4IGUA 4KUMB 4PK5A 4JLEA 3ZMZB 5A1LA 2CEAA 3ZPOA 2WBLA 5H6RB 3RYFE 4EZHA 2DI4A 2NW9A 1AJ3A 3RYHE 3K8PC 2WMNA 3I0OA 3S4UA 3GN5A 1KK7A 3MK7C 2C5IT 2DWGA 4ERRA 2XUEA 2C0SA 1MMGA 4IHJE 3KBTA 2Q9QB 5LGUB 3EDUA 1FMVA 4JUYA 2H7VC 4OYJA 5C8YE 3I1AA 5LCYA 2W62A 4BJNA 4PW8A 4EOZB 3LK2B 3RYCE 4AXPA 2UXNB 3AA0B 3VKHA 3PUQA 2CCQA 3N2OA 3O4XE 3QUJA 1YKHB 2K9AA 5LHIB 4GOUA 2KWHA 3PU8A 4AQGA 4I50E 5E0OA 3KV4A 3I9YA 4YLHA 2V7LA 3C51A 3GMIA 5JDLA 3ZLIA 5L3GB 2E8IA 4L9IA 4QX7B 5H6QB 5KDMC 5LGTB 3K3NA 3PU3A 2V26A 4PJMA 2D2SA 2ZM0A 4X1IE 1ZEEA 5IYZE 4AKIA 5HWXA 4L0RA 5TAOA 3RX6A 1U4QA 3HI2A 3OYXA 5LG4A 2Y6XA 2X68A 4H9SE 2ODUA 3CVRA 4IE7A 3JC6D 1WLXA 4BJMA 5FXVA 3MZKB 5JDNA 2CXDA 1HF8A 3LFMA 3MXZA 3VKGA 3ZYLA 2W61A 3MKDA 4JEHB 2VB6A 2VKDA 4H63V 1LVFA 4XZCA 5FP3A 1OWAA 3EUHA 4O4JE 2OA5A 3AAEB 4BA9A 5HAXA 4CQIA 3N2GE 2DHRA 1WYCA 3Q5XA 5HYAA 1UX4A 5KX5E 3UFEA 3N9PA 4PAGA 4K0UA 3MJXA 4KMCA 1FEWA 4GK0E 5HXCA 1LVKA 3PE0A 4DNDA 5LHHB 1HCIA 2LE8A 3SS1A 2X66A 4UV8B 1YD8G 4H9OC 1KNZA 4TV8E 5GONE 5KMGP 3ANWA 3V5UA 2EHOB 2MBGA 4NUVA 4CI1B 2WSSV 3N2KE 4H9NC 2L8KA 3BQLA 3N9NA 3ONXA 4PJJA 4ASKA 3P7IA 1MIWA 2XAGB 4IE6A 4EYYR 4OK0A 2LSJA 4CI2B 2RP4A 4UXNB 4NUUA 3LJCA 4TZ4C 2CM0A 4G2AA 2PBIA 4EXTA 2RA1A 2XTLA 4QXHB 2HH7A 4ANJA 4MALA 4PFOA 5JR9A 2NTYA 2QGSA 3C50A 3R6NA 2K24A 5JDGA 1FMWA 2DLRA 3C64A 3JC6C 3V5SA 3FB2A 1HX8A 1WR6A 3SWHA 2A72A 1MMAA 5LXTE 3M65A 2PFVA 2JRKA 4ZS2A 3HA4A 5L3BB 5FXWA 3DJBA 4TUYE 5LP6E 3PURA 3D0TA 4H9RC 3RRWA 5LHGB 1NWMX 4I4TE 2E9XB 2MYSA 3E0ZA 4GIWA 3ZCIA 1YW0A 1D0YA 3CX8B 3HKCE 2BZBA 2KINB 5L3DB 4EIWA 3FXDB 4O4IE 1IJ6A 3NZPA 2DNXA 3KV9A 2W00A 2CWOA 2H7OA 2VK9A 2CWYA 2X9YA 2LSYA 1US7B 3O1JA 3J9X1 3UTKA 2V1DB 2YK0A 4IE5A 5FXZA 2E9XA 2I59A 2XAQB 3KVBA 5J1GA 3CX7B 1Y64B 2D5UA 2CMRA 2XHEB 3HL6A 2DWKA 2A3DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CXD A;  2CWY A; 
#chains in the Genus database with same CATH topology
 4DUY T;  2HPJ A;  2L3L A;  2Q9Q D;  3ZYM A;  2Q9Q A;  3QOF A;  5JR9 C;  2X51 A;  4X5T A;  4QX8 B;  4A56 A;  3HKE E;  3UU8 A;  3LK4 2;  5LYJ E;  3L3P A;  5FY0 A;  3ZMV B;  3LBX B;  4WW0 A;  2VKH A;  3PUW F;  1SA0 E;  3ABV A;  2AXD S;  4XBF B;  5AQT B;  1G8X A;  4IE0 A;  4WBN E;  3TLU A;  5L3C B;  1ZKE A;  3N9L A;  5HEJ A;  3B57 A;  5LBM A;  4HWI B;  3FBZ A;  2KSR A;  4QH1 A;  3UT5 E;  2ZM6 T;  4EEB A;  4ZHQ E;  2BG9 B;  4ZI2 D;  3AA6 B;  3NRX A;  2KT9 A;  2V6Y A;  2WAU A;  5LNK A;  4CI3 B;  1X79 A;  2XQ7 A;  4DO0 A;  1CUN A;  4ZI3 D;  4UR9 A;  2CBI A;  5CGM A;  3PUV F;  3KDS E;  5F8P A;  2NOX A;  4EZ4 A;  2XQA A;  3MAC A;  3FZM B;  4JI8 T;  5FYM A;  2XAS B;  4YTM A;  3FHN A;  2KZ7 B;  2IC6 A;  3E08 A;  1I94 T;  3NVO A;  4DV0 T;  3OVU A;  3UUN A;  2V6X A;  1W09 A;  3QC9 A;  4AQF C;  4OHF A;  1BR2 A;  5J2T E;  4UF0 B;  4IRE A;  5CB4 E;  3EAM A;  5LA6 E;  5BMV E;  2CRB A;  5LMU T;  1HNZ T;  3N9O A;  3RQU A;  2UXD T;  3UU6 A;  1WFD A;  4FI5 A;  3NRY A;  3P8C D;  4DR3 T;  3VR9 A;  2WM9 A;  2V5D A;  5EZY E;  4PK4 A;  3UUL A;  5ETW A;  2CBJ A;  4LMK A;  4JI5 T;  2WWV A;  2Z6E A;  3L09 A;  4AKG A;  3EHZ A;  3AXJ B;  2PG8 A;  2K5B B;  2YIN A;  2EHO C;  2UUC T;  3IEE A;  2ODV A;  4TV9 E;  4UEL A;  4JV5 T;  2JQK A;  2BDE A;  2JQH A;  3PUY F;  4F6R C;  3JAE A;  2L9Q A;  1T72 A;  3AE5 A;  5ADX L;  2VL0 A;  4E7Z A;  3OJA A;  4HGA A;  3AE7 A;  5ABH A;  3L8R A;  5AQG B;  4EB6 E;  1BR4 A;  4LF6 T;  3T1Y T;  2J4G A;  4LMJ A;  2NW7 A;  1XNR T;  5DQW A;  3QK6 A;  2LJL A;  4QXC B;  4AIS A;  5AQS B;  4ILU A;  3FBL A;  2VWA A;  4HFI A;  5JDM A;  5LGN B;  3AE2 A;  5JRC A;  1SHZ C;  3FZL B;  1E1H B;  5EK2 A;  5JH7 E;  1OED C;  2NW8 A;  3H3A A;  2AE9 A;  4HN9 A;  1HTJ F;  2VL8 A;  3PUA A;  1QUU A;  3SFD A;  3ZJ1 A;  1KFY A;  4PJN A;  4IST A;  4PNI A;  3RKG A;  4B6X A;  4PK6 A;  2IML A;  2X0L B;  1YQ3 A;  4GKJ T;  4IL4 A;  1T7S A;  4DV4 T;  2DCF A;  3VRB A;  1MMD A;  3HKB E;  4UIG A;  1XDP A;  1HFA A;  2BG9 C;  1MIY A;  3J7Y q;  1KNP A;  4LML A;  2F4V T;  2CA5 A;  5H6R B;  1W9R A;  3K8P C;  5L4H A;  3S4U A;  3GN5 A;  2E2A A;  1JNZ A;  2YN6 A;  4ERR A;  2XUE A;  2C0S A;  1N34 T;  3KBT A;  2Q9Q B;  5LGU B;  5FVL A;  3M3Z B;  3CK6 A;  2HN2 A;  4BJN A;  3VKH A;  1XWM A;  2CCQ A;  1WCR A;  3O4X E;  3QUJ A;  2K9A A;  4GOU A;  2KWH A;  4JI3 T;  2BKP A;  4YLH A;  3GMI A;  2E8I A;  2YKS A;  4QX7 B;  1T8B A;  5LGT B;  3ZKR A;  4DV1 T;  4HWF A;  5IYZ E;  3ZST A;  3RX6 A;  5LG4 A;  2J62 A;  4YHH T;  1WLX A;  5FXV A;  2MPK A;  3MZK B;  2CXD A;  4B3T T;  1M7K A;  4XZC A;  5JTG A;  3RGL A;  5FP3 A;  3EUH A;  3AE4 A;  4CQI A;  4DV5 T;  2PTF A;  3UQ4 A;  1FEW A;  1LVK A;  1HCI A;  2LE8 A;  3SS1 A;  1YD8 G;  2IUB A;  1KNZ A;  5KMG P;  3L39 A;  3V5U A;  3X1D A;  2WSS V;  2WDV A;  2L8K A;  4PJJ A;  3P7I A;  2XAG B;  4DR7 T;  3FZK B;  4CI2 B;  2RP4 A;  4UXN B;  3LJC A;  4TZ4 C;  2RA1 A;  4QXH B;  2HH7 A;  4ANJ A;  4MAL A;  4PFO A;  2QYW A;  2QGS A;  4NPP A;  2J47 A;  2K24 A;  3VR8 A;  1FMW A;  2DLR A;  1W0A A;  1W0B A;  2UXC T;  3HA4 A;  3PUR A;  1NWM X;  3E0Z A;  3ZCI A;  3JAF A;  5L3D B;  1ZP0 A;  1HNW T;  4O4I E;  2BBH A;  2X9Y A;  4GKK T;  1QLB A;  3O1J A;  5J1G A;  3RIA A;  3CX7 B;  4EV6 A;  4K0K T;  1UGO A;  4A5X A;  2DWK A;  2A3D A;  4P09 A;  4TWH A;  5LB7 B;  3CPZ A;  5C3J A;  4UVB B;  1ZHC A;  2HPL A;  3HKD E;  4JI6 T;  5CA1 E;  2LRK A;  3AED A;  5FL1 A;  4IE4 A;  3RC8 A;  3PJA A;  1LRZ A;  3RLF F;  5LJN A;  2XM2 A;  5FXX A;  4DBQ A;  1E7P A;  4QHO A;  4HTE A;  5JVD E;  3PUG A;  2IHR 1;  3NKZ A;  3LG7 A;  2D0T A;  5L3E B;  2CHO A;  1J1J A;  5JRC B;  3CX6 B;  4GYR A;  2NTX A;  4C90 A;  3ETU A;  3ONJ A;  3RIU C;  2ZMA A;  2ES0 A;  3K3O A;  3GWH A;  4B3M T;  3P50 A;  2C5K T;  2Q9Q C;  3VU7 H;  4J2C A;  4JEU B;  2J1D G;  2V8S V;  5M4Y A;  1WRD A;  4X65 T;  3OYZ A;  3R84 B;  3ZEF B;  4U33 A;  3P4P A;  1XZY A;  5JRE A;  4DV6 T;  3AA1 B;  1BR0 A;  1OED E;  1LKX A;  1U5P A;  3TLV A;  2JQQ A;  5L2L A;  2LEH A;  2UUA T;  4DR6 T;  4ZI2 C;  3ZN0 B;  4ILC A;  1MNE A;  1H7C A;  5JQG E;  4EGW A;  4DMV A;  4HFE A;  4YFS A;  4JI1 T;  4ZI3 C;  3GN5 B;  4COF A;  2VAS A;  4HEA A;  2JPF A;  2A9U A;  4QXB B;  3WI3 A;  2HN1 A;  5EK3 A;  3FZH B;  3PDY A;  1XMQ T;  2B1E A;  2BG9 E;  5L4E A;  1IAP A;  1YKE B;  2JMH A;  3KV5 A;  4IT4 A;  2XZE A;  2CE7 A;  4WBO A;  1SE7 A;  2IIU A;  4MHC A;  2LSG A;  3O1I A;  2D9D A;  3U78 A;  5AQM B;  2N2N A;  3ZSS A;  5HXH A;  5HXR A;  5L47 A;  5FY1 A;  4DV2 T;  5L3F B;  3BQI A;  4KBM B;  4YJ2 E;  4DMW A;  4WZX A;  4Z8X A;  1D0X A;  2LSI A;  5DJQ C;  4ZZC A;  1MIV A;  4NXM T;  5F3J A;  4TWD A;  3IBP A;  4O4L E;  2N1G A;  4O8S A;  3JAD A;  4TN7 B;  3UUM A;  4X66 T;  3RPU A;  4PFP A;  4JI7 T;  3ZT5 A;  4UVC B;  2XQ5 A;  1G73 A;  2W63 A;  2SPC A;  2YDS A;  4EYU A;  2XAJ B;  2X9X A;  1X9B A;  3UQ7 A;  4U2Z A;  5IWA T;  4MBQ A;  1T98 A;  2QRX A;  4AI6 A;  2YDR A;  4U72 A;  4I43 B;  3I0Q A;  4ADZ A;  3N9Q A;  3W15 B;  4X62 T;  3ZCJ A;  2UXX B;  4Z91 A;  5JDF A;  3B5M A;  4JBW F;  4HWH A;  3DP7 A;  2HHH T;  2BVL A;  5EK4 A;  4C91 A;  4DV7 T;  3F57 A;  4JI2 T;  2LHR A;  2LOP A;  3PUS A;  4IDZ A;  3LDQ B;  2V7K A;  5LOV E;  2UXB T;  5AFU L;  4LF7 T;  4UEM A;  3EVY A;  4PK5 A;  3ZT7 A;  3ZMZ B;  2CEA A;  2WBL A;  3RYF E;  2NW9 A;  3MK7 C;  1KK7 A;  2C5I T;  1MMG A;  4IHJ E;  3EDU A;  1FMV A;  1UUS A;  3VRA A;  1IBM T;  3AEA A;  3RYC E;  4YT0 A;  3PUQ A;  3N2O A;  1YKH B;  4I50 E;  4JI0 T;  3SFE A;  5L3G B;  2ACZ A;  5LMN T;  5H6Q B;  2V26 A;  4X1I E;  1ZEE A;  3TLW A;  4AKI A;  4LF8 T;  3HI2 A;  3LSV A;  3OYX A;  2Y6X A;  4H9S E;  3JC6 D;  4X64 T;  1UK5 A;  2K3W A;  5JDN A;  1XMO T;  3VKG A;  3ZYL A;  3MKD A;  4H63 V;  1LVF A;  4O4J E;  2OA5 A;  4BA9 A;  3N2G E;  1HX1 B;  1WYC A;  4LF4 T;  3N9P A;  3MJX A;  3PE0 A;  5LHH B;  4QH4 A;  2X66 A;  4H9O C;  2VQF T;  4LF9 T;  5GON E;  3ANW A;  3RHW A;  2MBG A;  4U31 A;  4YTP A;  3N9N A;  4KHZ F;  2JQ9 A;  4NUU A;  2FJE A;  5HCM A;  4IDQ A;  3G06 A;  1UUR A;  3C64 A;  1WR6 A;  3SWH A;  2A72 A;  1MMA A;  2WQY A;  2JRK A;  4ZS2 A;  5L3B B;  1KEY A;  3DJB A;  5LP6 E;  4H9R C;  3D0T A;  4YTN A;  2MYS A;  4GIW A;  2BBJ A;  5AQJ B;  1R8I A;  5LG3 A;  3CX8 B;  3HKC E;  2BZB A;  4P1N A;  1IJ6 A;  3NZP A;  4DR1 T;  2W00 A;  2CWO A;  5ABG A;  1US7 B;  3J9X 1;  4JI4 T;  4ZXL A;  2E9X A;  2I59 A;  2XAQ B;  3KVB A;  3Q5D A;  4CN4 A;  1XDO A;  2CMR A;  5FKY A;  4LF5 T;  1WYB A;  3H3M A;  2CXL A;  3RYI E;  4I55 E;  3ZYK A;  2ZM8 A;  2CLY B;  3BK9 A;  2XAH B;  3U3I A;  3ZMT B;  2LHN A;  3I9W A;  3NWI A;  4MFR A;  5IUX A;  2I6H A;  2V6Y B;  2A2F X;  2XQ6 A;  5AQP B;  2XAF B;  4GYS A;  4TX5 A;  3FZF B;  2JJ9 A;  5AQN B;  4FJO A;  2W67 A;  3LBX A;  1HG5 A;  4H9P C;  3WAJ A;  2WWU A;  4L5G A;  4AKL A;  2K48 A;  3K3Q C;  4LFC T;  2P9B A;  5AQR B;  3ETV A;  3OPC A;  3K1S A;  2H3R A;  2MTQ A;  4CZZ B;  3JCF A;  2WP9 A;  2V7I A;  4DR4 T;  3RQW A;  1QSD A;  4WYV A;  4Z90 A;  3BQK A;  2W0G A;  4M1P A;  2Y8D A;  3N5L A;  3RC3 A;  5JDH A;  1JNR A;  2ZLY A;  4ZZB A;  5ABF A;  5JDQ A;  3RI5 A;  3H37 A;  3C4W A;  2WZH A;  5LJM A;  4X1K E;  4CN6 A;  2X67 A;  4DR2 T;  3LK3 B;  4G63 A;  4H9Q C;  1NEK A;  1HS7 A;  2XY8 B;  4ZI7 E;  4NXN T;  2X9H A;  3NZQ A;  1XNQ T;  1M62 A;  3C98 B;  2LSK A;  1N33 T;  2WY2 A;  5AQU B;  5ABE A;  1D1B A;  3RKO A;  2X9W A;  2YEV C;  2VVN A;  2KXP B;  3CQG B;  3AEB A;  3F31 A;  1HNX T;  3AEE A;  3Q2M A;  2YU1 A;  4UVA B;  1Z0P A;  2X0H A;  4ZOL E;  2WMO A;  3OKQ A;  1VCT A;  5AQI B;  3A8Y C;  4YXD A;  3ZT6 A;  2D0U A;  3RH3 A;  2N9D A;  4HE8 A;  3AE6 A;  5HEO A;  4OX9 T;  3IF8 B;  3GA8 A;  4DUZ T;  3AEC A;  1D1A A;  3CQC B;  3ZC1 A;  3RRC A;  4JYA T;  2NWB A;  4KI0 F;  1O3X A;  4V1A v;  5AQK B;  2Y48 B;  4OYK A;  5FVK A;  4YJ3 E;  4GK5 E;  3CML A;  3CKD A;  1S94 A;  3F2E A;  1GQE A;  4X1Y E;  3AEG A;  1UX5 A;  5FY7 A;  3AEF A;  2VVS A;  5FL0 A;  3ANW B;  2M6B A;  3ZJ2 A;  2LM9 A;  2CPT A;  3AVR A;  2IW5 B;  4AQY T;  3T8O A;  3T1H T;  3Q9D A;  3Q5W A;  5AQQ B;  4EAH A;  4IDO A;  3C4X A;  2CLY C;  2IAK A;  4TNW A;  4ISS A;  2LM2 A;  1V9D A;  3N9M A;  3KFW X;  5AQO B;  2G0U A;  3B13 A;  1VOM A;  2IDO B;  5FMN A;  2OLT A;  4HWC A;  2W66 A;  2VKO A;  4O4H E;  3CIR A;  2V7J A;  4N78 D;  2YU2 A;  3UUB A;  2XSB A;  4E7S A;  5KXJ A;  2W2U A;  2XJ7 A;  4IGU A;  3AE9 A;  4KUM B;  4JLE A;  5A1L A;  1L0V A;  4EZH A;  2WMN A;  3PJA J;  1NEN A;  4JUY A;  3I1A A;  3Q5E A;  4EOZ B;  3LK2 B;  4AXP A;  3AA0 B;  2CHN A;  4IDP A;  3P4R A;  5LHI B;  3PU8 A;  5E0O A;  2VUR A;  3KV4 A;  5JDL A;  3QB5 A;  4I0U A;  2LKG A;  1KNR A;  4L9I A;  1Z8U A;  2WDR A;  5KDM C;  3K3N A;  3PU3 A;  4PJM A;  2ZM0 A;  4L0R A;  5TAO A;  1N32 T;  4KX6 A;  1U4Q A;  4AIU A;  2X68 A;  2ODU A;  3CVR A;  4IE7 A;  1FJG T;  4B3S T;  3IA3 A;  3EI0 A;  1HF8 A;  3LFM A;  2WZI A;  3UU4 A;  3AAE B;  2DHR A;  2B76 A;  3Q5X A;  4DR5 T;  3UFE A;  4PAG A;  5HXC A;  5ABF B;  2H88 A;  4NUV A;  4NIQ A;  4CI1 B;  3N2K E;  3ONX A;  4IE6 A;  4OK0 A;  2FJA A;  4CN1 A;  2CM0 A;  4G2A A;  4HWD A;  2PBI A;  4EXT A;  5JR9 A;  2NTY A;  1SUM B;  3JC6 C;  3V5S A;  4A97 A;  3FB2 A;  1HX8 A;  1KF6 A;  5FXW A;  3RRW A;  4I4T E;  1YW0 A;  3RIF A;  2KIN B;  2FJB A;  2BS3 A;  2DNX A;  3KV9 A;  2VK9 A;  2W4X A;  5BR8 T;  2LSY A;  3UTK A;  2V1D B;  4IE5 A;  1Y64 B;  2D5U A;  5HEG A;  5AQH B;  3HL6 A;  3HR0 A;  4BAY B;  2JMK A;  4ILA A;  2KND A;  4KP3 C;  4H63 H;  1J5W A;  4CXX A;  3FXE B;  4AKR B;  2MAW A;  2CXF A;  5CJ5 A;  3UUX B;  5HXS A;  2NR4 A;  4AKH A;  3ZN1 B;  2KMF A;  4MLK A;  3AB3 B;  4IL9 A;  2BVM A;  4AQF A;  4QKN A;  1B7T A;  4YSX A;  3TLT A;  5DQV A;  1OXZ A;  1IZN B;  5IHY A;  3EDV A;  3AAA B;  4UV9 B;  1J5E T;  1HG2 A;  2QVA A;  1MND A;  3P4W A;  2E9X C;  1E2A A;  1UCU A;  4ZS3 A;  2FBW A;  4CXY A;  1S35 A;  1ZV4 X;  3KBU A;  3SRZ A;  3KVA A;  4YHJ A;  3KIN B;  4DBR A;  4B3R T;  2UU9 T;  3PUX F;  2EHO D;  4OFZ A;  3MA9 A;  2EHO A;  2I0M A;  2WU2 A;  5J2U E;  2VQE T;  1FIO A;  3P4Q A;  4U74 A;  1VRB A;  4DVD A;  4IDN A;  1NAF A;  3CQX C;  2XQY A;  3P4S A;  5HEH A;  2V7M A;  5AQF B;  2KLQ A;  3QB5 K;  2ACX A;  2E9X D;  2QA7 A;  3VHL A;  5HCJ A;  4O2B E;  2YOE A;  3OBV E;  4A98 A;  4U7Y A;  2RPA A;  3WAK A;  5HXE A;  4CXW A;  4DV3 T;  3A5X A;  1WR0 A;  4ILB A;  2BKO A;  5FNV E;  5LBQ B;  1OED A;  4X20 E;  5F5W A;  2WU5 A;  3QNU A;  4KHP T;  3O9X A;  1IJ5 A;  5HWY A;  2XQ9 A;  3PTR B;  2DL1 A;  2LOS A;  2ZM2 A;  2E5V A;  1YQ4 A;  3AA7 B;  3A7M A;  3UU3 A;  5AQL B;  1ZOY A;  3ESL A;  2VKJ A;  4TNV A;  3AE1 A;  1D0Z A;  1BR1 A;  3IHR A;  4ZEY A;  2BKN A;  2M6I A;  4HFV A;  1EZ3 A;  5DAB A;  2C5J A;  2WDQ A;  3AAI A;  2BG9 A;  4HFH A;  3AE3 A;  3E22 E;  3PV0 F;  3SOL A;  2IC9 A;  2GK9 A;  5CA0 E;  3ZC0 A;  2LRL A;  3UU5 A;  3AVS A;  1IBK T;  2PJQ A;  4PJL A;  3C4Z A;  3O1H A;  2XQ3 A;  4HFB A;  4QWN B;  4P0B A;  4O2A E;  5JR9 B;  3NBX X;  4IIJ E;  3KV6 A;  3CWZ B;  3PUZ F;  4XAX B;  4U2Y A;  2BS2 A;  4P0A A;  1D1C A;  2KWI B;  2WS3 A;  2MOZ A;  4EED A;  4LFB T;  1MMN A;  3UFG A;  3AE8 A;  4HKA A;  4DID B;  2M67 A;  4WNK A;  3ZMS B;  2R6G F;  4UF0 A;  4HFC A;  1HR0 T;  2LT3 A;  3DTO A;  1DU2 A;  1I6Z A;  2JIW A;  2XQ4 A;  3ZMU B;  2NP9 A;  3TKL B;  4HFD A;  3TLS A;  3RF1 A;  1Y01 A;  5C2T A;  3ZPO A;  2DI4 A;  2YDQ A;  1AJ3 A;  3RYH E;  4YY3 T;  4LFA T;  3I0O A;  1CHU A;  2DWG A;  2H7V C;  4OYJ A;  5C8Y E;  5LCY A;  4Q25 A;  2W62 A;  4PW8 A;  2UXN B;  3EAB A;  2XPK A;  2XQ8 A;  4YSY A;  1N36 T;  4AQG A;  3AXJ A;  3I9Y A;  2V7L A;  3C51 A;  3ZLI A;  2XM1 A;  2D2S A;  4F8H A;  5CFB A;  5HWX A;  4YSZ A;  4BJM A;  4TWF A;  3MXZ A;  2W61 A;  4JEH B;  2V5C A;  2VKD A;  2VB6 A;  1OWA A;  2E5L T;  5HAX A;  5HYA A;  1UX4 A;  5KX5 E;  4K0U A;  4KMC A;  4GK0 E;  2WCA A;  4DND A;  2LLY A;  4UV8 B;  4TV8 E;  2EHO B;  4U3C A;  1IBL T;  4H9N C;  3BQL A;  2OV9 A;  4ASK A;  2UUB T;  1MIW A;  4EYY R;  2WB5 A;  2LSJ A;  2FJD A;  3ONL C;  4U7I A;  1VCS A;  2XTL A;  5HEU A;  3C50 A;  3R6N A;  3OTO T;  2FUP A;  2LKH A;  5JDG A;  4QH5 A;  5LXT E;  3M65 A;  2PFV A;  4TUY E;  5LHG B;  2E9X B;  1D0Y A;  1YXR A;  4EIW A;  3FXD B;  5J0Z A;  2XSA A;  2H7O A;  2CWY A;  5AQV B;  3RIU A;  1OED B;  2YK0 A;  5FXZ A;  2BS4 A;  2X0Y A;  2XHE B;  2H89 A; 
#chains in the Genus database with same CATH homology
 4P09 A;  1WYB A;  4BAY B;  2HPJ A;  2L3L A;  2Q9Q D;  2JMK A;  3CPZ A;  2CXL A;  4UVB B;  3ZYM A;  3RYI E;  1ZHC A;  2HPL A;  2Q9Q A;  3HKD E;  4I55 E;  5JR9 C;  3ZYK A;  2X51 A;  5CA1 E;  2ZM8 A;  2KND A;  4KP3 C;  4QX8 B;  4A56 A;  3HKE E;  3LK4 2;  2CLY B;  5LYJ E;  4IE4 A;  3BK9 A;  4H63 H;  2XAH B;  3L3P A;  5FY0 A;  3U3I A;  3LBX B;  3ZMT B;  3ZMV B;  3FXE B;  4CXX A;  3RC8 A;  4AKR B;  2LHN A;  3I9W A;  4WW0 A;  2VKH A;  4MFR A;  1LRZ A;  2CXF A;  3UUX B;  1SA0 E;  2A2F X;  5LJN A;  5FXX A;  4XBF B;  1G8X A;  5HXS A;  4DBQ A;  4AKH A;  4IE0 A;  3ZN1 B;  2XAF B;  4GYS A;  2KMF A;  4TX5 A;  4WBN E;  4QHO A;  4MLK A;  4HTE A;  3AB3 B;  5JVD E;  3PUG A;  2BVM A;  2JJ9 A;  4AQF A;  4QKN A;  1B7T A;  1ZKE A;  2D0T A;  3LG7 A;  3N9L A;  5L3C B;  4FJO A;  5L3E B;  3LBX A;  5DQV A;  1OXZ A;  3B57 A;  1HG5 A;  4H9P C;  5LBM A;  1IZN B;  3FBZ A;  3UT5 E;  5IHY A;  3WAJ A;  5JRC B;  2WWU A;  3EDV A;  4L5G A;  4AKL A;  3AAA B;  3AA6 B;  3NRX A;  2K48 A;  4ZI2 D;  4ZHQ E;  2KT9 A;  3K3Q C;  3CX6 B;  4GYR A;  2NTX A;  4UV9 B;  4C90 A;  2WAU A;  3ETU A;  2P9B A;  5LNK A;  1HG2 A;  4CI3 B;  1X79 A;  1MND A;  3ETV A;  2ZMA A;  4DO0 A;  1CUN A;  2H3R A;  2E9X C;  2ES0 A;  3K3O A;  2MTQ A;  4ZI3 D;  1UCU A;  4CZZ B;  3GWH A;  4ZS3 A;  4CXY A;  1S35 A;  1ZV4 X;  2V7I A;  2C5K T;  3KBU A;  3SRZ A;  1QSD A;  3KDS E;  2Q9Q C;  5F8P A;  3BQK A;  2NOX A;  3VU7 H;  4J2C A;  4JEU B;  4EZ4 A;  2J1D G;  5M4Y A;  3MAC A;  2W0G A;  3KVA A;  4M1P A;  4YHJ A;  5FYM A;  1WRD A;  2XAS B;  2Y8D A;  3FHN A;  3KIN B;  3OYZ A;  2KZ7 B;  3R84 B;  3N5L A;  3RC3 A;  2IC6 A;  3E08 A;  4DBR A;  3ZEF B;  5JDH A;  2ZLY A;  5JDQ A;  5JRE A;  3AA1 B;  1BR0 A;  2EHO D;  4OFZ A;  3MA9 A;  1LKX A;  3UUN A;  1U5P A;  3QC9 A;  2EHO A;  4AQF C;  4OHF A;  3H37 A;  5J2U E;  1BR2 A;  3C4W A;  5J2T E;  5LJM A;  2JQQ A;  1FIO A;  4UF0 B;  4X1K E;  5CB4 E;  2X67 A;  4U74 A;  5L2L A;  1VRB A;  2LEH A;  3LK3 B;  5LA6 E;  4G63 A;  4H9Q C;  5BMV E;  1HS7 A;  3N9O A;  4ZI2 C;  3ZN0 B;  4DVD A;  4ZI7 E;  2X9H A;  3NZQ A;  1NAF A;  3CQX C;  4FI5 A;  1MNE A;  2XQY A;  3C98 B;  3NRY A;  1H7C A;  2LSK A;  3P8C D;  5JQG E;  4DMV A;  2V7M A;  4YFS A;  2WM9 A;  4ZI3 C;  1D1B A;  3RKO A;  2X9W A;  2KLQ A;  3GN5 B;  5EZY E;  2YEV C;  4PK4 A;  3UUL A;  2KXP B;  2VAS A;  3CQG B;  5ETW A;  3F31 A;  4HEA A;  2ACX A;  2JPF A;  2E9X D;  2Z6E A;  4QXB B;  2QA7 A;  3L09 A;  3WI3 A;  3VHL A;  4O2B E;  5EK3 A;  3Q2M A;  2YU1 A;  3OBV E;  4AKG A;  3PDY A;  3WAK A;  2B1E A;  4UVA B;  5HXE A;  1Z0P A;  1IAP A;  4CXW A;  1YKE B;  3HR0 A;  4ZOL E;  2JMH A;  2PG8 A;  3KV5 A;  3A5X A;  2K5B B;  2YIN A;  2WMO A;  2CE7 A;  3OKQ A;  2EHO C;  4WBO A;  5FNV E;  5LBQ B;  3IEE A;  2ODV A;  4TV9 E;  4UEL A;  4X20 E;  4MHC A;  2BDE A;  2LSG A;  3O1I A;  4F6R C;  2D0U A;  3RH3 A;  2L9Q A;  2N9D A;  4HE8 A;  3U78 A;  5ADX L;  3O9X A;  1IJ5 A;  4E7Z A;  2N2N A;  5HWY A;  3OJA A;  3IF8 B;  3GA8 A;  4HGA A;  5HXR A;  5HXH A;  3PTR B;  2LOS A;  2ZM2 A;  1D1A A;  3CQC B;  3AA7 B;  5FY1 A;  3ZC1 A;  3RRC A;  4EB6 E;  5L3F B;  3BQI A;  1BR4 A;  2NWB A;  4KBM B;  4YJ2 E;  1O3X A;  4V1A v;  4DMW A;  2NW7 A;  4Z8X A;  1D0X A;  5DQW A;  2LSI A;  5DJQ C;  2Y48 B;  3ESL A;  4OYK A;  1MIV A;  3QK6 A;  2VKJ A;  2LJL A;  4QXC B;  5F3J A;  4YJ3 E;  4GK5 E;  4ILU A;  3FBL A;  3IBP A;  4O4L E;  2VWA A;  1D0Z A;  2N1G A;  3CML A;  5JDM A;  4O8S A;  1BR1 A;  3IHR A;  5LGN B;  3CKD A;  1S94 A;  3F2E A;  4TN7 B;  4HFV A;  1EZ3 A;  4X1Y E;  3UUM A;  5JRC A;  5DAB A;  2C5J A;  1SHZ C;  3AAI A;  3RPU A;  1UX5 A;  5FY7 A;  4PFP A;  3E22 E;  4UVC B;  1E1H B;  3SOL A;  3ANW B;  2IC9 A;  2GK9 A;  5CA0 E;  5EK2 A;  5JH7 E;  3ZC0 A;  1G73 A;  2W63 A;  2NW8 A;  2SPC A;  4EYU A;  3ZJ2 A;  3AVS A;  2XAJ B;  3H3A A;  2X9X A;  2PJQ A;  2LM9 A;  4PJL A;  3AVR A;  3C4Z A;  3O1H A;  4MBQ A;  4HN9 A;  2IW5 B;  1T98 A;  4AI6 A;  1HTJ F;  2VL8 A;  4U72 A;  4I43 B;  3I0Q A;  4ADZ A;  3PUA A;  3N9Q A;  3W15 B;  3ZCJ A;  3T8O A;  2UXX B;  4QWN B;  4P0B A;  5JDF A;  1QUU A;  3Q9D A;  3Q5W A;  3ZJ1 A;  4O2A E;  4EAH A;  3DP7 A;  5JR9 B;  3C4X A;  4PJN A;  4IST A;  2CLY C;  3NBX X;  2IAK A;  4IIJ E;  4PNI A;  3KV6 A;  4ISS A;  4B6X A;  4PK6 A;  2X0L B;  1V9D A;  3N9M A;  2BVL A;  3KFW X;  3CWZ B;  4XAX B;  2G0U A;  3B13 A;  5EK4 A;  4C91 A;  4P0A A;  1D1C A;  2KWI B;  2MOZ A;  1VOM A;  3F57 A;  5FMN A;  1MMN A;  2LHR A;  2LOP A;  3PUS A;  4HKA A;  2M67 A;  2VKO A;  4O4H E;  4IDZ A;  4WNK A;  3ZMS B;  2V7J A;  2V7K A;  2DCF A;  4N78 D;  1MMD A;  2YU2 A;  4UF0 A;  3HKB E;  2LT3 A;  3DTO A;  4UIG A;  5LOV E;  1HFA A;  5AFU L;  4E7S A;  1MIY A;  4UEM A;  3J7Y q;  3EVY A;  3ZMU B;  2NP9 A;  3TKL B;  2CA5 A;  4IGU A;  4KUM B;  4PK5 A;  4JLE A;  3ZMZ B;  5A1L A;  2CEA A;  3ZPO A;  2WBL A;  5H6R B;  3RYF E;  4EZH A;  2DI4 A;  2NW9 A;  1AJ3 A;  3RYH E;  3K8P C;  2WMN A;  3I0O A;  3S4U A;  3GN5 A;  1KK7 A;  3MK7 C;  2C5I T;  2DWG A;  4ERR A;  2XUE A;  2C0S A;  1MMG A;  4IHJ E;  3KBT A;  2Q9Q B;  5LGU B;  3EDU A;  1FMV A;  4JUY A;  2H7V C;  4OYJ A;  5C8Y E;  3I1A A;  5LCY A;  2W62 A;  4BJN A;  4PW8 A;  4EOZ B;  3LK2 B;  3RYC E;  4AXP A;  2UXN B;  3AA0 B;  3VKH A;  3PUQ A;  2CCQ A;  3N2O A;  3O4X E;  3QUJ A;  1YKH B;  2K9A A;  5LHI B;  4GOU A;  2KWH A;  3PU8 A;  4AQG A;  4I50 E;  5E0O A;  3KV4 A;  3I9Y A;  4YLH A;  2V7L A;  3C51 A;  3GMI A;  5JDL A;  3ZLI A;  5L3G B;  2E8I A;  4L9I A;  4QX7 B;  5H6Q B;  5KDM C;  5LGT B;  3K3N A;  3PU3 A;  2V26 A;  4PJM A;  2D2S A;  2ZM0 A;  4X1I E;  1ZEE A;  5IYZ E;  4AKI A;  5HWX A;  4L0R A;  5TAO A;  3RX6 A;  1U4Q A;  3HI2 A;  3OYX A;  5LG4 A;  2Y6X A;  2X68 A;  4H9S E;  2ODU A;  3CVR A;  4IE7 A;  3JC6 D;  1WLX A;  4BJM A;  5FXV A;  3MZK B;  5JDN A;  2CXD A;  1HF8 A;  3LFM A;  3MXZ A;  3VKG A;  3ZYL A;  2W61 A;  3MKD A;  4JEH B;  2VB6 A;  2VKD A;  4H63 V;  1LVF A;  4XZC A;  5FP3 A;  1OWA A;  3EUH A;  4O4J E;  2OA5 A;  3AAE B;  4BA9 A;  5HAX A;  4CQI A;  3N2G E;  2DHR A;  1WYC A;  3Q5X A;  5HYA A;  1UX4 A;  5KX5 E;  3UFE A;  3N9P A;  4PAG A;  4K0U A;  3MJX A;  4KMC A;  1FEW A;  4GK0 E;  5HXC A;  1LVK A;  3PE0 A;  4DND A;  5LHH B;  1HCI A;  2LE8 A;  3SS1 A;  2X66 A;  4UV8 B;  1YD8 G;  4H9O C;  1KNZ A;  4TV8 E;  5GON E;  5KMG P;  3ANW A;  3V5U A;  2EHO B;  2MBG A;  4NUV A;  4CI1 B;  2WSS V;  3N2K E;  4H9N C;  2L8K A;  3BQL A;  3N9N A;  3ONX A;  4PJJ A;  4ASK A;  3P7I A;  1MIW A;  2XAG B;  4IE6 A;  4EYY R;  4OK0 A;  2LSJ A;  4CI2 B;  2RP4 A;  4UXN B;  4NUU A;  3LJC A;  4TZ4 C;  2CM0 A;  4G2A A;  2PBI A;  4EXT A;  2RA1 A;  2XTL A;  4QXH B;  2HH7 A;  4ANJ A;  4MAL A;  4PFO A;  5JR9 A;  2NTY A;  2QGS A;  3C50 A;  3R6N A;  2K24 A;  5JDG A;  1FMW A;  2DLR A;  3C64 A;  3JC6 C;  3V5S A;  3FB2 A;  1HX8 A;  1WR6 A;  3SWH A;  2A72 A;  1MMA A;  5LXT E;  3M65 A;  2PFV A;  2JRK A;  4ZS2 A;  3HA4 A;  5L3B B;  5FXW A;  3DJB A;  4TUY E;  5LP6 E;  3PUR A;  3D0T A;  4H9R C;  3RRW A;  5LHG B;  1NWM X;  4I4T E;  2E9X B;  2MYS A;  3E0Z A;  4GIW A;  3ZCI A;  1YW0 A;  1D0Y A;  3CX8 B;  3HKC E;  2BZB A;  2KIN B;  5L3D B;  4EIW A;  3FXD B;  4O4I E;  1IJ6 A;  3NZP A;  2DNX A;  3KV9 A;  2W00 A;  2CWO A;  2H7O A;  2VK9 A;  2CWY A;  2X9Y A;  2LSY A;  1US7 B;  3O1J A;  3J9X 1;  3UTK A;  2V1D B;  2YK0 A;  4IE5 A;  5FXZ A;  2E9X A;  2I59 A;  2XAQ B;  3KVB A;  5J1G A;  3CX7 B;  1Y64 B;  2D5U A;  2CMR A;  2XHE B;  3HL6 A;  2DWK A;  2A3D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...