2CWYA

Crystal structure of conserved hypothetical protein, ttha0068 from thermus thermophilus hb8
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
94
structure length
94
Chain Sequence
MVPDWEEVLGLWRAGRYYEVHEVLEPYWLKATGEERRLLQGVILLAAALHQRRLGRPGLRNLRKAEARLEGLPCPLMGLDWRSLLQEARRRLGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein TTHA0068
publication title Crystal structure of conserved hypothetical protein, TTHA0068 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
total genus 33
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2005-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03745 DUF309 Domain of unknown function (DUF309)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.500 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2cwyA00
2CWYA 2CXDA
chains in the Genus database with same CATH superfamily
1S35A 3WI3A 2LKHA 3P4QA 3I1AA 4HWHA 4YTMA 2X0YA 2N2NA 2NR4A 4X62T 5AQUB 3N9LA 4KX6A 3EAMA 3PUWF 4X5TA 2N1GA 4PJLA 4YSYA 4ERRA 3ZSSA 2KSRA 1XMQT 3V5SA 3N9PA 4DR1T 4PW8A 4TUYE 1VRBA 3HKEE 1KFYA 4AQYT 4ILUA 3ZLIA 2XUEA 1E7PA 3QK6A 1FJGT 1MMDA 4QH5A 3UUBA 1J5WA 2LSYA 1MMAA 2I0MA 2UXDT 4BA9A 2FJBA 2VKHA 2X9XA 5FY1A 2C5KT 2UUAT 2FJEA 2Q9QD 5EZYE 4LMJA 2YDSA 1X9BA 1YKEB 5IUXA 3N2KE 3PUXF 4P0AA 5AQSB 3AE6A 4ZI3C 4PJMA 1CUNA 4QKNA 3NVOA 3ZC0A 2LRLA 4GOUA 4JEUB 3GN5B 4ZI2D 4NIQA 2M6IA 3A5XA 1XDPA 3NZPA 2UXCT 1WR0A 1BR0A 3PTRB 1Z0PA 2ZM8A 2F4VT 3V5UA 3ONLC 2YOEA 2QA7A 1D1CA 4KP3C 4UVBB 4X1YE 4H9OC 4TWHA 2C0SA 4PFPA 2I6HA 4LFAT 2WMNA 4AXPA 1XNQT 1ZV4X 1D1BA 3AXJB 4TNVA 4OYJA 1Y64B 4CQIA 5IYZE 4WBNE 2E2AA 3ZSTA 4UV9B 5JR9C 3F57A 3I0OA 1HX8A 5J0ZA 3UQ4A 2DWGA 4OK0A 5J2TE 2WB5A 4BAYB 1UK5A 2LM2A 2XQ8A 3IHRA 1KNZA 3PUYF 1WRDA 4QH4A 3JADA 3GWHA 2UU9T 3FB2A 4LF6T 5ABEA 4JLEA 4LF9T 3AA0B 2LEHA 2PBIA 1AJ3A 4CXWA 3MKDA 1HG5A 5CA1E 1VOMA 3M3ZB 3D0TA 5L4HA 1N36T 2WMOA 3CX7B 4YTNA 5HEGA 1QLBA 2LOSA 4JI0T 4PFOA 2X9WA 1S94A 1MNDA 3RYFE 4ISSA 3BQLA 1OWAA 3TLTA 1IJ6A 5JRCB 5C2TA 3BQIA 2ACZA 2JMHA 5ABFA 5JR9B 2V6YA 2PTFA 1LKXA 4EYUA 2KXPB 2IW5B 2Y6XA 3ZMSB 1XWMA 3T1HT 4EEBA 2ODUA 2AXDS 4GK5E 3RQUA 4MLKA 5LJMA 1IJ5A 5DABA 1IZNB 4Z8XA 2DCFA 5LA6E 4DUYT 3DTOA 4XZCA 2VVNA 3OBVE 4CI2B 5LYJE 4TNWA 4NPPA 2X66A 3L39A 4ZOLE 2YDQA 3IA3A 4PK5A 3EDVA 5HXRA 2OA5A 2PJQA 2W61A 4AKRB 3KV4A 4I55E 4X64T 3FXDB 2NP9A 2JQ9A 3N2GE 1KK7A 2EHOC 2Q9QA 3IBPA 2W62A 2YN6A 5FXXA 2BG9C 3KV6A 3SS1A 5HCMA 3RQWA 2FJAA 4ILAA 2JQQA 5J1GA 5F3JA 2K5BB 4B3MT 2IC6A 4ZI3D 2UUBT 1N32T 5H6QB 4UF0A 1MIVA 3AEBA 3ZMVB 4B3ST 4QH1A 1WR6A 3AE7A 4DBRA 5LHHB 4I0UA 3P4PA 4HFCA 4DVDA 3HKBE 5L3DB 4F8HA 4P09A 1FMWA 2LSJA 2VK9A 1MIWA 3FBZA 1E2AA 2UUCT 2IMLA 4EEDA 4CI3B 3VHLA 4A97A 2X67A 4X1KE 4BJMA 2H3RA 4JI6T 5LP6E 2KNDA 2VL8A 3WAKA 3ZT5A 1T8BA 4DIDB 3G06A 1HR0T 1UURA 4QXCB 1O3XA 4HFHA 5JREA 1BR4A 1G73A 4UIGA 2EHOB 2RP4A 2KT9A 3L3PA 2Q9QC 2BG9B 1VCTA 3QB5A 2N9DA 1IBKT 2YK0A 2XQ3A 4DV2T 4JUYA 4ZXLA 2WSSV 3AA1B 1YKHB 2JIWA 1SA0E 4IE4A 5ADXL 3N9MA 4ZZBA 4H63V 3S4UA 4ZI7E 2D2SA 4ZS3A 3BK9A 2J1DG 4HWIB 4U31A 2WCAA 2V1DB 5CB4E 1T72A 2CBIA 3ZYMA 4EYYR 4JI7T 5AQGB 5CGMA 2VKOA 3FBLA 3NBXX 4IE6A 4LF5T 2FBWA 5AQLB 4NUVA 2W0GA 2K3WA 4G2AA 5FXWA 4H9NC 1UUSA 4KHPT 3Q2MA 3JAEA 4YTPA 4DV4T 2K9AA 3SRZA 2Q9QB 3PUVF 4IL4A 4U33A 3CQCB 3J7Yq 1UCUA 3AE5A 4DR7T 2AE9A 4DNDA 4JI1T 1T98A 2LHRA 1MMNA 2LRKA 5HXCA 4PK4A 1HNXT 4X20E 4O4JE 5JH7E 4UF0B 2XQ6A 3AB3B 5FP3A 5DJQC 4JBWF 2V8SV 4K0KT 2H88A 4OX9T 2CEAA 4ILCA 3GN5A 2BKOA 2DNXA 1FIOA 4EV6A 2XJ7A 2XM2A 1YXRA 3QNUA 3OVUA 3LFMA 1HF8A 4ILBA 2XQ5A 5BMVE 2IIUA 2L8KA 3ZN0B 3ZYKA 4IGUA 2X51A 3TLSA 2KLQA 3NZQA 4EXTA 1D0XA 3L09A 3ZT6A 5JVDE 4B3TT 2ZMAA 3LK42 3L8RA 1OEDA 2LKGA 4B6XA 3AXJA 2NWBA 3RKOA 3AAAB 3I9WA 2XZEA 2X9HA 4ASKA 2BS4A 4IE5A 1KNPA 3B57A 5DQWA 3Q5XA 2M67A 5FVLA 2VKDA 4CI1B 2VKJA 4KHZF 3ABVA 3A7MA 4EZ4A 5L3FB 4EOZB 4YSXA 3OPCA 1G8XA 3AE4A 4QWNB 4AKIA 4J2CA 4MALA 4TWFA 2H7OA 4FJOA 3JAFA 3MZKB 2JQHA 3Q5WA 4WZXA 4X65T 2ZM2A 1B7TA 3ZPOA 5LMUT 3AE3A 3RYHE 3ANWB 5LG4A 2C5JA 3CK6A 2CXFA 2FUPA 4LFBT 3W15B 2WWUA 4YJ2E 2W4XA 2VVSA 4LF4T 3H37A 1JNZA 1MNEA 3UU6A 3VRBA 3K3QC 2QVAA 2A9UA 3SFEA 4YY3T 3CKDA 3E22E 5AQFB 2J62A 1NAFA 2HHHT 5LG3A 1SE7A 1OEDC 3KVAA 3AEFA 2JJ9A 2LT3A 3P4RA 4TX5A 1NENA 1KEYA 1WYCA 3UFEA 5L2LA 4X1IE 5GONE 5JRCA 4F6RC 5JR9A 4KUMB 5H6RB 1YQ4A 4LF8T 4IIJE 3FZMB 1NWMX 5HEOA 1U4QA 4O4HE 2WZIA 3C50A 2V7JA 4NXNT 4IREA 1L0VA 2WZHA 2B1EA 2XAJB 2XSAA 4HTEA 2RPAA 4G63A 3H3MA 5IHYA 2K24A 3F31A 4CN1A 3P4SA 1BR2A 4O4IE 2D0UA 5HEUA 4EAHA 2L3LA 3FZKB 2PG8A 4TV8E 4WBOA 3ZMZB 4AQFA 3E0ZA 3AE2A 1OEDB 4P1NA 3O4XE 4A5XA 3C4XA 3MXZA 3RH3A 1BR1A 1EZ3A 4E7ZA 3RIFA 5CFBA 3ZMTB 3Q5EA 3PUQA 3QOFA 4C90A 4JV5T 2KZ7B 5L3GB 2IUBA 2MTQA 4HKAA 4KBMB 3AEAA 3PU3A 2VQET 4IE0A 3MJXA 4QXBB 4IE7A 3PJAJ 3C64A 5BR8T 3OYZA 2BKPA 3HKCE 3OKQA 3RLFF 3RX6A 5FYMA 1D0ZA 4IL9A 3TKLB 2X68A 2XAFB 3LBXB 4H9SE 4IDPA 1LVKA 2I59A 2CXDA 4IDNA 3AVSA 3A8YC 3MK7C 4P0BA 4AQFC 2H89A 4O2BE 2V5DA 2EHOA 2BG9A 2JPFA 4U3CA 3EUHA 3AAEB 4ZHQE 1XNRT 2GK9A 2BS3A 4IDZA 1HG2A 4HFBA 5C3JA 2XQYA 3UTKA 2A2FX 2XQ9A 5EK4A 1ZKEA 2VASA 4UEMA 5AQJB 2H7VC 2J47A 2D9DA 1D0YA 4DBQA 2CPTA 4O4LE 5ETWA 2KWHA 5AQKB 5JTGA 4AKHA 4COFA 5LB7B 3QB5K 5E0OA 3B5MA 2NOXA 3OTOT 4GIWA 3F2EA 1MMGA 3UUMA 2SPCA 4DMVA 5AQTB 4OYKA 3U78A 4PAGA 3ZC1A 3AEDA 4A98A 4DR3T 3P4WA 2CHNA 3TLVA 4I43B 4IT4A 5L47A 2CBJA 4BJNA 4C91A 2JMKA 3AE9A 4LMLA 2X9YA 1CHUA 3CMLA 1SUMB 4UVCB 4JI3T 1J1JA 3ZN1B 4PJNA 1FMVA 2HPLA 4OHFA 2V26A 1E1HB 2ES0A 1ZEEA 5DQVA 3UT5E 3RRCA 4K0UA 4V1Av 2X0LB 5LGUB 5L3BB 2BBJA 3UU5A 4OFZA 4UELA 5KMGP 4YHHT 5KDMC 2WWVA 4XAXB 2BVLA 3KV5A 3K1SA 3PUSA 4TV9E 2WY2A 3ZEFB 4H63H 3PURA 2V6XA 2B76A 5JDQA 4ZS2A 1VCSA 2G0UA 3ZYLA 1YW0A 3PJAA 2V7LA 1W9RA 2ACXA 5KXJA 4PK6A 2V7MA 2LM9A 4YHJA 2XQ7A 2NTXA 2DI4A 3RIUA 1IBMT 1KNRA 3TLUA 2FJDA 4H9RC 3RGLA 2Z6EA 3ZCIA 3ZJ2A 4U7YA 4U72A 4EZHA 3PUZF 2CXLA 2MBGA 3JC6D 4QX8B 5A1LA 3T8OA 3N9OA 3KBUA 3ANWA 5JDHA 4CXXA 3KVBA 4DV3T 4JYAT 2IC9A 1IBLT 4QHOA 2V7KA 2E8IA 3RYCE 5FMNA 3R6NA 2LOPA 4HN9A 2W67A 4E7SA 4DR4T 1ZP0A 2E9XC 3C51A 4DMWA 1QSDA 4UR9A 1U5PA 1HNZT 2CE7A 3FZHB 1UX5A 1Y01A 2KINB 3HA4A 1T7SA 2PFVA 3RIUC 4L9IA 2XQAA 3OYXA 3O1HA 3RIAA 5HYAA 3ZJ1A 4TWDA 1WLXA 5JDLA 5LXTE 2MPKA 2VWAA 4H9QC 5JQGE 2CCQA 2E5VA 2MOZA 5AQMB 1W0BA 3RHWA 2OLTA 3VRAA 5LJNA 2W63A 5FNVE 5HWYA 3ONXA 4YXDA 2MAWA 4AI6A 5CJ5A 5C8YE 4LFCT 2XAQB 2BDEA 5LHGB 2XASB 3UFGA 1LRZA 4NUUA 2WDVA 2KMFA 3FZFB 5HXSA 2E9XB 3LSVA 2CRBA 3ZMUB 2RA1A 4YLHA 1OXZA 3VKGA 5FXVA 4ZZCA 4MHCA 2M6BA 4HE8A 5AQIB 3N2OA 3CVRA 4KMCA 1M62A 2CA5A 4ADZA 2V5CA 4A56A 3GMIA 4GYRA 2WDQA 2Y48B 2LLYA 2D0TA 3RRWA 4ISTA 5LMNT 3P8CD 5HCJA 3OJAA 5IWAT 2NW7A 4LF7T 3N9QA 4HWFA 4Z90A 3JCFA 5F8PA 3CPZA 3I9YA 2XY8B 2YEVC 4NXMT 3LBXA 3EABA 1HS7A 4YSZA 3LG7A 2VL0A 2W2UA 3SWHA 2VB6A 2XSBA 3GA8A 3HR0A 4DV5T 4O8SA 4YT0A 3AAIA 3FHNA 4JI5T 3IF8B 2HPJA 2D5UA 3BQKA 4UV8B 2WDRA 4GK0E 5LBMA 3Q5DA 4H9PC 3AEEA 2L9QA 4HEAA 1WFDA 4HWDA 2XQ4A 3MA9A 2WU5A 1V9DA 2C5IT 4WYVA 4YJ3E 1DU2A 3PU8A 4HWCA 4QXHB 3UU3A 3UQ7A 5ABHA 3NWIA 1I6ZA 4TN7B 4DR6T 2XTLA 2KWIB 4UVAB 2QYWA 2WU2A 3AA7B 3QC9A 3EVYA 3RC3A 3RF1A 1KF6A 1WCRA 4JI2T 4HFVA 3AA6B 2E9XD 2CHOA 4EGWA 2P9BA 4HGAA 4PNIA 5EK2A 3R84B 2ZLYA 5AQHB 2NW9A 4HFEA 2WQYA 3LK2B 2A72A 3CQGB 4X66T 4HFIA 2DLRA 3CX8B 2JRKA 3QUJA 3H3AA 4CZZB 4U2YA 3JC6C 3CX6B 2HN1A 5F5WA 2WM9A 4FI5A 3J9X1 4DV0T 1HNWT 3CWZB 3LDQB 2E5LT 2VURA 3PE0A 1NEKA 2X0HA 4AQGA 5JDGA 2IAKA 5HXEA 3T1YT 5HWXA 4HFDA 4QX7B 1HCIA 3FXEB 1UGOA 3LJCA 5FL1A 4DUZT 3VR9A 1YD8G 5KX5E 1W0AA 5LGNB 3I0QA 5LGTB 2DHRA 1R8IA 2WP9A 3O1IA 2BZBA 2LHNA 1UX4A 2LSIA 3HKDE 2UXNB 3O9XA 2YU2A 3VU7H 1GQEA 3RC8A 5HAXA 3KBTA 4GYSA 4MFRA 2CWYA 5L3CB 4ZEYA 2CMRA 5LHIB 1N33T 2XPKA 1WYBA 1ZOYA 2W00A 5FY0A 1OEDE 3LK3B 5AQVB 1Z8UA 2YU1A 3FZLB 5JDNA 2BVMA 4JI4T 1LVFA 4Q25A 1XZYA 3C98B 3ESLA 2IHR1 3UUXB 3UU4A 2DWKA 2LSGA 2R6GF 3AECA 2ZM6T 4L5GA 2VQFT 5HEJA 3NKZA 5L3EB 3EDUA 2CWOA 4DO0A 2UXXB 5AQRB 5M4YA 2MYSA 2DL1A 2CM0A 3TLWA 2ODVA 4KI0F 5FVKA 1M7KA 5LBQB 2CLYC 3IEEA 4UXNB 1FEWA 3U3IA 5HXHA 5TAOA 2NTYA 5FKYA 3DJBA 2ZM0A 4MBQA 2W66A 4IHJE 4I50E 3SFDA 3K3OA 5LCYA 1H7CA 1XDOA 1SHZC 3M65A 2V7IA 3C4ZA 1HX1B 4DV6T 5CA0E 2BS2A 1W09A 4DV7T 3K8PC 3RI5A 3Q9DA 2J4GA 3ETUA 3AE1A 4TZ4C 4I4TE 5FXZA 3PUGA 5EK3A 5LOVE 1X79A 3HI2A 1QUUA 4CN6A 3UU8A 4WNKA 3B13A 3UULA 3KV9A 1HTJF 3O1JA 2E9XA 5AQOB 4U2ZA 4GKKT 3N5LA 3ZT7A 3EHZA 2CLYB 4IDOA 3E08A 4DR5T 4WW0A 1N34T 2LSKA 1ZHCA 3AE8A 4IDQA 5ABFB 2V6YB 4CXYA 4LMKA 5AFUL 1JNRA 4M1PA 3VKHA 4JI8T 2XHEB 3ZKRA 3CQXC 4ZI2C 2A3DA 2WS3A 3EI0A 3RPUA 2OV9A 3X1DA 1US7B 4GKJT 2QRXA 5FL0A 4XBFB 4B3RT 4L0RA 1MIYA 2BBHA 3C4WA 2WAUA 5L4EA 5J2UE 5ABGA 2NW8A 3P50A 4PJJA 3NRXA 2K48A 3SOLA 1I94T 2WBLA 2JQKA 2XAGB 3DP7A 3NRYA 4N78D 2YDRA 2Y8DA 4U7IA 4AIUA 3PDYA 3RYIE 5JDFA 4YFSA 1D1AA 1YQ3A 3HL6A 2BKNA 5AQQB 3K3NA 3VR8A 3RKGA 3WAJA 3N9NA 5LNKA 4Z91A 3AVRA 1J5ET 1XMOT 3CIRA 2BG9E 4ANJA 3ZCJA 1HFAA 3KDSE 4O2AE 4JEHB 2YKSA 5JDMA 4U74A 4AISA 4AKLA 4EIWA 3ONJA 3PV0F 4CN4A 3KFWX 3PUAA 2HN2A 4DV1T 2LE8A 2IDOB 4AKGA 2UXBT 3UUNA 2XAHB 4DR2T 2HH7A 5AQNB 5HEHA 2EHOD 5AQPB 1IAPA 3KINB 3AEGA 4EB6E 3ETVA 3P7IA 2LJLA 5FY7A 3MACA 2QGSA 2YINA 2XM1A
chains in the Genus database with same CATH topology
1S35A 4HGAA 4PNIA 3WI3A 5EK2A 2VKOA 3F2EA 3I1AA 3FBLA 3R84B 1MMGA 3UUMA 2SPCA 2ZLYA 2N2NA 4DMVA 3NBXX 4IE6A 2NW9A 4OYKA 4NUVA 2W0GA 3U78A 3N9LA 3LK2B 4G2AA 4PAGA 2A72A 3CQGB 5FXWA 2DLRA 3CX8B 2JRKA 4H9NC 3ZC1A 3QUJA 3Q2MA 2N1GA 3H3AA 4PJLA 4CZZB 3JC6C 2K9AA 3CX6B 3SRZA 2WM9A 4I43B 4FI5A 3J9X1 4ERRA 4BJNA 4C91A 2JMKA 3CWZB 2Q9QB 3V5SA 3N9PA 3CQCB 3J7Yq 4PW8A 4TUYE 2X9YA 3PE0A 1UCUA 1VRBA 3HKEE 3CMLA 4AQGA 4ILUA 3ZLIA 2XUEA 4DNDA 1T98A 5JDGA 2IAKA 2LHRA 4UVCB 5HXEA 3QK6A 1MMNA 3ZN1B 5HWXA 4PJNA 5HXCA 1FMVA 1MMDA 4PK4A 4X20E 4O4JE 5JH7E 2LSYA 4UF0B 4QX7B 1MMAA 3AB3B 1HCIA 5FP3A 5DJQC 2HPLA 4OHFA 2V26A 1E1HB 2ES0A 3FXEB 1ZEEA 5DQVA 2VKHA 3LJCA 3UT5E 4BA9A 2X9XA 3RRCA 5FY1A 2C5KT 2Q9QD 5EZYE 4K0UA 4V1Av 1YD8G 5KX5E 2X0LB 2CEAA 5L3BB 5LGUB 5LGNB 3I0QA 1YKEB 4OFZA 4UELA 5LGTB 3N2KE 4P0AA 5KMGP 2DHRA 4ZI3C 5KDMC 3GN5A 4PJMA 4XAXB 1CUNA 2BVLA 4QKNA 3KV5A 3O1IA 3PUSA 2DNXA 1FIOA 2BZBA 2LHNA 4TV9E 3ZEFB 3ZC0A 4H63H 1UX4A 2LSIA 3PURA 5JDQA 3HKDE 4ZS2A 2UXNB 2G0UA 3O9XA 3ZYLA 2YU2A 3LFMA 3VU7H 1HF8A 1YW0A 4GOUA 4JEUB 2V7LA 5BMVE 3RC8A 3GN5B 5HAXA 4ZI2D 3ZYKA 2L8KA 3ZN0B 4IGUA 3A5XA 3KBTA 2ACXA 4PK6A 2V7MA 2LM9A 2X51A 3NZPA 4YHJA 1BR0A 2KLQA 4GYSA 3PTRB 2NTXA 2DI4A 4MFRA 1Z0PA 2CWYA 2ZM8A 3NZQA 4EXTA 5L3CB 3V5UA 1D0XA 3L09A 2CMRA 5LHIB 1WYBA 5JVDE 2QA7A 1D1CA 2W00A 2ZMAA 3LK42 4KP3C 4B6XA 4UVBB 4H9RC 5FY0A 2NWBA 4X1YE 3RKOA 3LK3B 3AAAB 2Z6EA 3ZCIA 3ZJ2A 4H9OC 4U72A 3I9WA 2YU1A 2X9HA 4ASKA 2C0SA 4EZHA 4IE5A 4PFPA 5JDNA 2BVMA 2CXLA 3B57A 5DQWA 3Q5XA 1LVFA 2M67A 2VKDA 3JC6D 2MBGA 4CI1B 2WMNA 2VKJA 3C98B 3ESLA 4AXPA 3UUXB 4QX8B 2DWKA 4EZ4A 2LSGA 5L3FB 4EOZB 1ZV4X 5A1LA 3T8OA 1D1BA 4L5GA 3N9OA 1G8XA 3KBUA 3ANWA 5L3EB 5JDHA 4QWNB 4CXXA 3EDUA 3KVBA 4OYJA 2CWOA 1Y64B 2IC9A 4CQIA 4DO0A 4AKIA 4J2CA 2UXXB 4MALA 5IYZE 2H7OA 5M4YA 4FJOA 2MYSA 4WBNE 3MZKB 3Q5WA 2CM0A 4UV9B 2ZM2A 5JR9C 4QHOA 3F57A 3I0OA 1B7TA 2V7KA 2E8IA 2ODVA 3RYCE 1HX8A 5FMNA 3ZPOA 3RYHE 2DWGA 3ANWB 3R6NA 5LG4A 5LBQB 4OK0A 5J2TE 2C5JA 2CLYC 3IEEA 4BAYB 2CXFA 2LOPA 4UXNB 4HN9A 1FEWA 4E7SA 3U3IA 2E9XC 3C51A 4DMWA 1QSDA 5HXHA 3W15B 2WWUA 2NTYA 5TAOA 1U5PA 4YJ2E 3DJBA 2ZM0A 2CE7A 3IHRA 1UX5A 4MBQA 3H37A 1KNZA 2KINB 4IHJE 4I50E 1WRDA 1MNEA 3HA4A 3K3OA 5LCYA 3K3QC 1H7CA 3GWHA 3FB2A 2PFVA 1SHZC 3M65A 2V7IA 3C4ZA 4L9IA 4JLEA 3CKDA 3E22E 3AA0B 2LEHA 3OYXA 2PBIA 5CA0E 1NAFA 3O1HA 4CXWA 1AJ3A 3KVAA 5HYAA 3ZJ1A 3K8PC 2JJ9A 2LT3A 3MKDA 4TX5A 1HG5A 5CA1E 1VOMA 1WLXA 5JDLA 3D0TA 3Q9DA 3UFEA 1WYCA 5L2LA 5LXTE 4X1IE 3ETUA 5GONE 5JRCA 2WMOA 4TZ4C 3CX7B 4I4TE 5FXZA 3PUGA 4F6RC 2LOSA 5JR9A 2VWAA 4H9QC 5EK3A 4KUMB 5JQGE 2CCQA 5H6RB 5LOVE 2MOZA 4PFOA 1X79A 2X9WA 3HI2A 1QUUA 5LJNA 2W63A 5FNVE 5HWYA 3ONXA 4IIJE 1NWMX 1S94A 1MNDA 4WNKA 3B13A 1U4QA 3KV9A 3UULA 4AI6A 3RYFE 4O4HE 1HTJF 3C50A 2V7JA 3O1JA 2E9XA 4ISSA 3BQLA 1OWAA 5C8YE 1IJ6A 5JRCB 3BQIA 2XAQB 2JMHA 2BDEA 3N5LA 5JR9B 5LHGB 2XASB 1LKXA 1LRZA 4EYUA 2KXPB 2B1EA 2XAJB 2IW5B 2Y6XA 3ZMSB 4NUUA 4HTEA 2KMFA 2CLYB 3E08A 2ODUA 4WW0A 4GK5E 2LSKA 4G63A 5HXSA 2E9XB 4MLKA 1ZHCA 1IJ5A 5LJMA 5DABA 1IZNB 4Z8XA 5IHYA 3ZMUB 2RA1A 4YLHA 2K24A 2DCFA 1OXZA 3F31A 5LA6E 4CXYA 3VKGA 5AFUL 4M1PA 1BR2A 5FXVA 4O4IE 2D0UA 3DTOA 4MHCA 4HE8A 3VKHA 4XZCA 4EAHA 2L3LA 2PG8A 3N2OA 3CVRA 3OBVE 4TV8E 4WBOA 3ZMZB 4AQFA 2XHEB 3E0ZA 4KMCA 2CA5A 4CI2B 5LYJE 3CQXC 4ZI2C 4ADZA 2A3DA 3O4XE 4A56A 3GMIA 2X66A 3C4XA 3MXZA 4GYRA 4ZOLE 3RPUA 3RH3A 1BR1A 2Y48B 4PK5A 2D0TA 3RRWA 4ISTA 3P8CD 1US7B 3EDVA 5HXRA 1EZ3A 2OA5A 2PJQA 3OJAA 4E7ZA 2W61A 2NW7A 4AKRB 3KV4A 3ZMTB 4I55E 4XBFB 3FXDB 1MIYA 3N9QA 4L0RA 3PUQA 3C4WA 2WAUA 4C90A 2NP9A 2KZ7B 5F8PA 3N2GE 1KK7A 5J2UE 3CPZA 5L3GB 4HKAA 2MTQA 2EHOC 4KBMB 2Q9QA 2NW8A 3I9YA 2W62A 3IBPA 4PJJA 5FXXA 3PU3A 3KV6A 2YEVC 3NRXA 2K48A 4IE0A 3SS1A 3MJXA 3SOLA 2WBLA 2XAGB 4QXBB 2JQQA 3LBXA 3DP7A 4IE7A 3NRYA 3C64A 5J1GA 1HS7A 4N78D 5F3JA 3OYZA 2K5BB 2IC6A 3LG7A 3HKCE 4ZI3D 3OKQA 5H6QB 4UF0A 3SWHA 2Y8DA 3RX6A 1MIVA 5FYMA 2VB6A 3GA8A 3HR0A 1D0ZA 3PDYA 4O8SA 3ZMVB 3TKLB 3RYIE 1WR6A 2X68A 2XAFB 5JDFA 4YFSA 3AAIA 4DBRA 1D1AA 3LBXB 5LHHB 3FHNA 4H9SE 3IF8B 3HL6A 4DVDA 3HKBE 3K3NA 1LVKA 2I59A 2CXDA 5L3DB 2HPJA 4P09A 3AVSA 1FMWA 2LSJA 2D5UA 2VK9A 1MIWA 3FBZA 3MK7C 3WAJA 4P0BA 3BQKA 4UV8B 4AQFC 3N9NA 5LNKA 3VHLA 4CI3B 4O2BE 2X67A 3AVRA 4GK0E 2EHOA 4X1KE 5LBMA 4BJMA 2H3RA 5LP6E 4H9PC 2JPFA 2L9QA 2KNDA 4ANJA 2VL8A 3ZCJA 1HFAA 3EUHA 3KDSE 3WAKA 4O2AE 3AAEB 4JEHB 4HEAA 4QXCB 1O3XA 3MA9A 5JREA 1BR4A 1G73A 4ZHQE 5JDMA 1V9DA 2GK9A 4UIGA 2C5IT 4IDZA 2EHOB 2RP4A 2KT9A 4YJ3E 3L3PA 1HG2A 4U74A 2Q9QC 3PU8A 2XQYA 4QXHB 3UTKA 2A2FX 2N9DA 2YK0A 4TN7B 4JUYA 4AKLA 4EIWA 5EK4A 2XTLA 1ZKEA 2VASA 2WSSV 2KWIB 3AA1B 4UVAB 1YKHB 4UEMA 1SA0E 3KFWX 3PUAA 4IE4A 5ADXL 3N9MA 2H7VC 3AA7B 4H63V 2LE8A 3S4UA 4ZI7E 3QC9A 2D2SA 1D0YA 4ZS3A 4DBQA 3EVYA 3BK9A 3RC3A 2J1DG 4AKGA 3UUNA 2XAHB 4O4LE 5ETWA 2HH7A 2KWHA 2V1DB 2EHOD 4HFVA 5CB4E 1IAPA 4AKHA 3KINB 4EB6E 3ETVA 3P7IA 2LJLA 5E0OA 5FY7A 3ZYMA 3MACA 2QGSA 3AA6B 2E9XD 4EYYR 2NOXA 2YINA 2P9BA 4GIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CWY A;  2CXD A; 
#chains in the Genus database with same CATH topology
 1S35 A;  3WI3 A;  2LKH A;  3P4Q A;  3I1A A;  4HWH A;  4YTM A;  2X0Y A;  2N2N A;  2NR4 A;  4X62 T;  5AQU B;  3N9L A;  4KX6 A;  3EAM A;  3PUW F;  4X5T A;  2N1G A;  4PJL A;  4YSY A;  4ERR A;  3ZSS A;  2KSR A;  1XMQ T;  3V5S A;  3N9P A;  4DR1 T;  4PW8 A;  4TUY E;  1VRB A;  3HKE E;  1KFY A;  4AQY T;  4ILU A;  3ZLI A;  2XUE A;  1E7P A;  3QK6 A;  1FJG T;  1MMD A;  4QH5 A;  3UUB A;  1J5W A;  2LSY A;  1MMA A;  2I0M A;  2UXD T;  4BA9 A;  2FJB A;  2VKH A;  2X9X A;  5FY1 A;  2C5K T;  2UUA T;  2FJE A;  2Q9Q D;  5EZY E;  4LMJ A;  2YDS A;  1X9B A;  1YKE B;  5IUX A;  3N2K E;  3PUX F;  4P0A A;  5AQS B;  3AE6 A;  4ZI3 C;  4PJM A;  1CUN A;  4QKN A;  3NVO A;  3ZC0 A;  2LRL A;  4GOU A;  4JEU B;  3GN5 B;  4ZI2 D;  4NIQ A;  2M6I A;  3A5X A;  1XDP A;  3NZP A;  2UXC T;  1WR0 A;  1BR0 A;  3PTR B;  1Z0P A;  2ZM8 A;  2F4V T;  3V5U A;  3ONL C;  2YOE A;  2QA7 A;  1D1C A;  4KP3 C;  4UVB B;  4X1Y E;  4H9O C;  4TWH A;  2C0S A;  4PFP A;  2I6H A;  4LFA T;  2WMN A;  4AXP A;  1XNQ T;  1ZV4 X;  1D1B A;  3AXJ B;  4TNV A;  4OYJ A;  1Y64 B;  4CQI A;  5IYZ E;  4WBN E;  2E2A A;  3ZST A;  4UV9 B;  5JR9 C;  3F57 A;  3I0O A;  1HX8 A;  5J0Z A;  3UQ4 A;  2DWG A;  4OK0 A;  5J2T E;  2WB5 A;  4BAY B;  1UK5 A;  2LM2 A;  2XQ8 A;  3IHR A;  1KNZ A;  3PUY F;  1WRD A;  4QH4 A;  3JAD A;  3GWH A;  2UU9 T;  3FB2 A;  4LF6 T;  5ABE A;  4JLE A;  4LF9 T;  3AA0 B;  2LEH A;  2PBI A;  1AJ3 A;  4CXW A;  3MKD A;  1HG5 A;  5CA1 E;  1VOM A;  3M3Z B;  3D0T A;  5L4H A;  1N36 T;  2WMO A;  3CX7 B;  4YTN A;  5HEG A;  1QLB A;  2LOS A;  4JI0 T;  4PFO A;  2X9W A;  1S94 A;  1MND A;  3RYF E;  4ISS A;  3BQL A;  1OWA A;  3TLT A;  1IJ6 A;  5JRC B;  5C2T A;  3BQI A;  2ACZ A;  2JMH A;  5ABF A;  5JR9 B;  2V6Y A;  2PTF A;  1LKX A;  4EYU A;  2KXP B;  2IW5 B;  2Y6X A;  3ZMS B;  1XWM A;  3T1H T;  4EEB A;  2ODU A;  2AXD S;  4GK5 E;  3RQU A;  4MLK A;  5LJM A;  1IJ5 A;  5DAB A;  1IZN B;  4Z8X A;  2DCF A;  5LA6 E;  4DUY T;  3DTO A;  4XZC A;  2VVN A;  3OBV E;  4CI2 B;  5LYJ E;  4TNW A;  4NPP A;  2X66 A;  3L39 A;  4ZOL E;  2YDQ A;  3IA3 A;  4PK5 A;  3EDV A;  5HXR A;  2OA5 A;  2PJQ A;  2W61 A;  4AKR B;  3KV4 A;  4I55 E;  4X64 T;  3FXD B;  2NP9 A;  2JQ9 A;  3N2G E;  1KK7 A;  2EHO C;  2Q9Q A;  3IBP A;  2W62 A;  2YN6 A;  5FXX A;  2BG9 C;  3KV6 A;  3SS1 A;  5HCM A;  3RQW A;  2FJA A;  4ILA A;  2JQQ A;  5J1G A;  5F3J A;  2K5B B;  4B3M T;  2IC6 A;  4ZI3 D;  2UUB T;  1N32 T;  5H6Q B;  4UF0 A;  1MIV A;  3AEB A;  3ZMV B;  4B3S T;  4QH1 A;  1WR6 A;  3AE7 A;  4DBR A;  5LHH B;  4I0U A;  3P4P A;  4HFC A;  4DVD A;  3HKB E;  5L3D B;  4F8H A;  4P09 A;  1FMW A;  2LSJ A;  2VK9 A;  1MIW A;  3FBZ A;  1E2A A;  2UUC T;  2IML A;  4EED A;  4CI3 B;  3VHL A;  4A97 A;  2X67 A;  4X1K E;  4BJM A;  2H3R A;  4JI6 T;  5LP6 E;  2KND A;  2VL8 A;  3WAK A;  3ZT5 A;  1T8B A;  4DID B;  3G06 A;  1HR0 T;  1UUR A;  4QXC B;  1O3X A;  4HFH A;  5JRE A;  1BR4 A;  1G73 A;  4UIG A;  2EHO B;  2RP4 A;  2KT9 A;  3L3P A;  2Q9Q C;  2BG9 B;  1VCT A;  3QB5 A;  2N9D A;  1IBK T;  2YK0 A;  2XQ3 A;  4DV2 T;  4JUY A;  4ZXL A;  2WSS V;  3AA1 B;  1YKH B;  2JIW A;  1SA0 E;  4IE4 A;  5ADX L;  3N9M A;  4ZZB A;  4H63 V;  3S4U A;  4ZI7 E;  2D2S A;  4ZS3 A;  3BK9 A;  2J1D G;  4HWI B;  4U31 A;  2WCA A;  2V1D B;  5CB4 E;  1T72 A;  2CBI A;  3ZYM A;  4EYY R;  4JI7 T;  5AQG B;  5CGM A;  2VKO A;  3FBL A;  3NBX X;  4IE6 A;  4LF5 T;  2FBW A;  5AQL B;  4NUV A;  2W0G A;  2K3W A;  4G2A A;  5FXW A;  4H9N C;  1UUS A;  4KHP T;  3Q2M A;  3JAE A;  4YTP A;  4DV4 T;  2K9A A;  3SRZ A;  2Q9Q B;  3PUV F;  4IL4 A;  4U33 A;  3CQC B;  3J7Y q;  1UCU A;  3AE5 A;  4DR7 T;  2AE9 A;  4DND A;  4JI1 T;  1T98 A;  2LHR A;  1MMN A;  2LRK A;  5HXC A;  4PK4 A;  1HNX T;  4X20 E;  4O4J E;  5JH7 E;  4UF0 B;  2XQ6 A;  3AB3 B;  5FP3 A;  5DJQ C;  4JBW F;  2V8S V;  4K0K T;  2H88 A;  4OX9 T;  2CEA A;  4ILC A;  3GN5 A;  2BKO A;  2DNX A;  1FIO A;  4EV6 A;  2XJ7 A;  2XM2 A;  1YXR A;  3QNU A;  3OVU A;  3LFM A;  1HF8 A;  4ILB A;  2XQ5 A;  5BMV E;  2IIU A;  2L8K A;  3ZN0 B;  3ZYK A;  4IGU A;  2X51 A;  3TLS A;  2KLQ A;  3NZQ A;  4EXT A;  1D0X A;  3L09 A;  3ZT6 A;  5JVD E;  4B3T T;  2ZMA A;  3LK4 2;  3L8R A;  1OED A;  2LKG A;  4B6X A;  3AXJ A;  2NWB A;  3RKO A;  3AAA B;  3I9W A;  2XZE A;  2X9H A;  4ASK A;  2BS4 A;  4IE5 A;  1KNP A;  3B57 A;  5DQW A;  3Q5X A;  2M67 A;  5FVL A;  2VKD A;  4CI1 B;  2VKJ A;  4KHZ F;  3ABV A;  3A7M A;  4EZ4 A;  5L3F B;  4EOZ B;  4YSX A;  3OPC A;  1G8X A;  3AE4 A;  4QWN B;  4AKI A;  4J2C A;  4MAL A;  4TWF A;  2H7O A;  4FJO A;  3JAF A;  3MZK B;  2JQH A;  3Q5W A;  4WZX A;  4X65 T;  2ZM2 A;  1B7T A;  3ZPO A;  5LMU T;  3AE3 A;  3RYH E;  3ANW B;  5LG4 A;  2C5J A;  3CK6 A;  2CXF A;  2FUP A;  4LFB T;  3W15 B;  2WWU A;  4YJ2 E;  2W4X A;  2VVS A;  4LF4 T;  3H37 A;  1JNZ A;  1MNE A;  3UU6 A;  3VRB A;  3K3Q C;  2QVA A;  2A9U A;  3SFE A;  4YY3 T;  3CKD A;  3E22 E;  5AQF B;  2J62 A;  1NAF A;  2HHH T;  5LG3 A;  1SE7 A;  1OED C;  3KVA A;  3AEF A;  2JJ9 A;  2LT3 A;  3P4R A;  4TX5 A;  1NEN A;  1KEY A;  1WYC A;  3UFE A;  5L2L A;  4X1I E;  5GON E;  5JRC A;  4F6R C;  5JR9 A;  4KUM B;  5H6R B;  1YQ4 A;  4LF8 T;  4IIJ E;  3FZM B;  1NWM X;  5HEO A;  1U4Q A;  4O4H E;  2WZI A;  3C50 A;  2V7J A;  4NXN T;  4IRE A;  1L0V A;  2WZH A;  2B1E A;  2XAJ B;  2XSA A;  4HTE A;  2RPA A;  4G63 A;  3H3M A;  5IHY A;  2K24 A;  3F31 A;  4CN1 A;  3P4S A;  1BR2 A;  4O4I E;  2D0U A;  5HEU A;  4EAH A;  2L3L A;  3FZK B;  2PG8 A;  4TV8 E;  4WBO A;  3ZMZ B;  4AQF A;  3E0Z A;  3AE2 A;  1OED B;  4P1N A;  3O4X E;  4A5X A;  3C4X A;  3MXZ A;  3RH3 A;  1BR1 A;  1EZ3 A;  4E7Z A;  3RIF A;  5CFB A;  3ZMT B;  3Q5E A;  3PUQ A;  3QOF A;  4C90 A;  4JV5 T;  2KZ7 B;  5L3G B;  2IUB A;  2MTQ A;  4HKA A;  4KBM B;  3AEA A;  3PU3 A;  2VQE T;  4IE0 A;  3MJX A;  4QXB B;  4IE7 A;  3PJA J;  3C64 A;  5BR8 T;  3OYZ A;  2BKP A;  3HKC E;  3OKQ A;  3RLF F;  3RX6 A;  5FYM A;  1D0Z A;  4IL9 A;  3TKL B;  2X68 A;  2XAF B;  3LBX B;  4H9S E;  4IDP A;  1LVK A;  2I59 A;  2CXD A;  4IDN A;  3AVS A;  3A8Y C;  3MK7 C;  4P0B A;  4AQF C;  2H89 A;  4O2B E;  2V5D A;  2EHO A;  2BG9 A;  2JPF A;  4U3C A;  3EUH A;  3AAE B;  4ZHQ E;  1XNR T;  2GK9 A;  2BS3 A;  4IDZ A;  1HG2 A;  4HFB A;  5C3J A;  2XQY A;  3UTK A;  2A2F X;  2XQ9 A;  5EK4 A;  1ZKE A;  2VAS A;  4UEM A;  5AQJ B;  2H7V C;  2J47 A;  2D9D A;  1D0Y A;  4DBQ A;  2CPT A;  4O4L E;  5ETW A;  2KWH A;  5AQK B;  5JTG A;  4AKH A;  4COF A;  5LB7 B;  3QB5 K;  5E0O A;  3B5M A;  2NOX A;  3OTO T;  4GIW A;  3F2E A;  1MMG A;  3UUM A;  2SPC A;  4DMV A;  5AQT B;  4OYK A;  3U78 A;  4PAG A;  3ZC1 A;  3AED A;  4A98 A;  4DR3 T;  3P4W A;  2CHN A;  3TLV A;  4I43 B;  4IT4 A;  5L47 A;  2CBJ A;  4BJN A;  4C91 A;  2JMK A;  3AE9 A;  4LML A;  2X9Y A;  1CHU A;  3CML A;  1SUM B;  4UVC B;  4JI3 T;  1J1J A;  3ZN1 B;  4PJN A;  1FMV A;  2HPL A;  4OHF A;  2V26 A;  1E1H B;  2ES0 A;  1ZEE A;  5DQV A;  3UT5 E;  3RRC A;  4K0U A;  4V1A v;  2X0L B;  5LGU B;  5L3B B;  2BBJ A;  3UU5 A;  4OFZ A;  4UEL A;  5KMG P;  4YHH T;  5KDM C;  2WWV A;  4XAX B;  2BVL A;  3KV5 A;  3K1S A;  3PUS A;  4TV9 E;  2WY2 A;  3ZEF B;  4H63 H;  3PUR A;  2V6X A;  2B76 A;  5JDQ A;  4ZS2 A;  1VCS A;  2G0U A;  3ZYL A;  1YW0 A;  3PJA A;  2V7L A;  1W9R A;  2ACX A;  5KXJ A;  4PK6 A;  2V7M A;  2LM9 A;  4YHJ A;  2XQ7 A;  2NTX A;  2DI4 A;  3RIU A;  1IBM T;  1KNR A;  3TLU A;  2FJD A;  4H9R C;  3RGL A;  2Z6E A;  3ZCI A;  3ZJ2 A;  4U7Y A;  4U72 A;  4EZH A;  3PUZ F;  2CXL A;  2MBG A;  3JC6 D;  4QX8 B;  5A1L A;  3T8O A;  3N9O A;  3KBU A;  3ANW A;  5JDH A;  4CXX A;  3KVB A;  4DV3 T;  4JYA T;  2IC9 A;  1IBL T;  4QHO A;  2V7K A;  2E8I A;  3RYC E;  5FMN A;  3R6N A;  2LOP A;  4HN9 A;  2W67 A;  4E7S A;  4DR4 T;  1ZP0 A;  2E9X C;  3C51 A;  4DMW A;  1QSD A;  4UR9 A;  1U5P A;  1HNZ T;  2CE7 A;  3FZH B;  1UX5 A;  1Y01 A;  2KIN B;  3HA4 A;  1T7S A;  2PFV A;  3RIU C;  4L9I A;  2XQA A;  3OYX A;  3O1H A;  3RIA A;  5HYA A;  3ZJ1 A;  4TWD A;  1WLX A;  5JDL A;  5LXT E;  2MPK A;  2VWA A;  4H9Q C;  5JQG E;  2CCQ A;  2E5V A;  2MOZ A;  5AQM B;  1W0B A;  3RHW A;  2OLT A;  3VRA A;  5LJN A;  2W63 A;  5FNV E;  5HWY A;  3ONX A;  4YXD A;  2MAW A;  4AI6 A;  5CJ5 A;  5C8Y E;  4LFC T;  2XAQ B;  2BDE A;  5LHG B;  2XAS B;  3UFG A;  1LRZ A;  4NUU A;  2WDV A;  2KMF A;  3FZF B;  5HXS A;  2E9X B;  3LSV A;  2CRB A;  3ZMU B;  2RA1 A;  4YLH A;  1OXZ A;  3VKG A;  5FXV A;  4ZZC A;  4MHC A;  2M6B A;  4HE8 A;  5AQI B;  3N2O A;  3CVR A;  4KMC A;  1M62 A;  2CA5 A;  4ADZ A;  2V5C A;  4A56 A;  3GMI A;  4GYR A;  2WDQ A;  2Y48 B;  2LLY A;  2D0T A;  3RRW A;  4IST A;  5LMN T;  3P8C D;  5HCJ A;  3OJA A;  5IWA T;  2NW7 A;  4LF7 T;  3N9Q A;  4HWF A;  4Z90 A;  3JCF A;  5F8P A;  3CPZ A;  3I9Y A;  2XY8 B;  2YEV C;  4NXM T;  3LBX A;  3EAB A;  1HS7 A;  4YSZ A;  3LG7 A;  2VL0 A;  2W2U A;  3SWH A;  2VB6 A;  2XSB A;  3GA8 A;  3HR0 A;  4DV5 T;  4O8S A;  4YT0 A;  3AAI A;  3FHN A;  4JI5 T;  3IF8 B;  2HPJ A;  2D5U A;  3BQK A;  4UV8 B;  2WDR A;  4GK0 E;  5LBM A;  3Q5D A;  4H9P C;  3AEE A;  2L9Q A;  4HEA A;  1WFD A;  4HWD A;  2XQ4 A;  3MA9 A;  2WU5 A;  1V9D A;  2C5I T;  4WYV A;  4YJ3 E;  1DU2 A;  3PU8 A;  4HWC A;  4QXH B;  3UU3 A;  3UQ7 A;  5ABH A;  3NWI A;  1I6Z A;  4TN7 B;  4DR6 T;  2XTL A;  2KWI B;  4UVA B;  2QYW A;  2WU2 A;  3AA7 B;  3QC9 A;  3EVY A;  3RC3 A;  3RF1 A;  1KF6 A;  1WCR A;  4JI2 T;  4HFV A;  3AA6 B;  2E9X D;  2CHO A;  4EGW A;  2P9B A;  4HGA A;  4PNI A;  5EK2 A;  3R84 B;  2ZLY A;  5AQH B;  2NW9 A;  4HFE A;  2WQY A;  3LK2 B;  2A72 A;  3CQG B;  4X66 T;  4HFI A;  2DLR A;  3CX8 B;  2JRK A;  3QUJ A;  3H3A A;  4CZZ B;  4U2Y A;  3JC6 C;  3CX6 B;  2HN1 A;  5F5W A;  2WM9 A;  4FI5 A;  3J9X 1;  4DV0 T;  1HNW T;  3CWZ B;  3LDQ B;  2E5L T;  2VUR A;  3PE0 A;  1NEK A;  2X0H A;  4AQG A;  5JDG A;  2IAK A;  5HXE A;  3T1Y T;  5HWX A;  4HFD A;  4QX7 B;  1HCI A;  3FXE B;  1UGO A;  3LJC A;  5FL1 A;  4DUZ T;  3VR9 A;  1YD8 G;  5KX5 E;  1W0A A;  5LGN B;  3I0Q A;  5LGT B;  2DHR A;  1R8I A;  2WP9 A;  3O1I A;  2BZB A;  2LHN A;  1UX4 A;  2LSI A;  3HKD E;  2UXN B;  3O9X A;  2YU2 A;  3VU7 H;  1GQE A;  3RC8 A;  5HAX A;  3KBT A;  4GYS A;  4MFR A;  2CWY A;  5L3C B;  4ZEY A;  2CMR A;  5LHI B;  1N33 T;  2XPK A;  1WYB A;  1ZOY A;  2W00 A;  5FY0 A;  1OED E;  3LK3 B;  5AQV B;  1Z8U A;  2YU1 A;  3FZL B;  5JDN A;  2BVM A;  4JI4 T;  1LVF A;  4Q25 A;  1XZY A;  3C98 B;  3ESL A;  2IHR 1;  3UUX B;  3UU4 A;  2DWK A;  2LSG A;  2R6G F;  3AEC A;  2ZM6 T;  4L5G A;  2VQF T;  5HEJ A;  3NKZ A;  5L3E B;  3EDU A;  2CWO A;  4DO0 A;  2UXX B;  5AQR B;  5M4Y A;  2MYS A;  2DL1 A;  2CM0 A;  3TLW A;  2ODV A;  4KI0 F;  5FVK A;  1M7K A;  5LBQ B;  2CLY C;  3IEE A;  4UXN B;  1FEW A;  3U3I A;  5HXH A;  5TAO A;  2NTY A;  5FKY A;  3DJB A;  2ZM0 A;  4MBQ A;  2W66 A;  4IHJ E;  4I50 E;  3SFD A;  3K3O A;  5LCY A;  1H7C A;  1XDO A;  1SHZ C;  3M65 A;  2V7I A;  3C4Z A;  1HX1 B;  4DV6 T;  5CA0 E;  2BS2 A;  1W09 A;  4DV7 T;  3K8P C;  3RI5 A;  3Q9D A;  2J4G A;  3ETU A;  3AE1 A;  4TZ4 C;  4I4T E;  5FXZ A;  3PUG A;  5EK3 A;  5LOV E;  1X79 A;  3HI2 A;  1QUU A;  4CN6 A;  3UU8 A;  4WNK A;  3B13 A;  3UUL A;  3KV9 A;  1HTJ F;  3O1J A;  2E9X A;  5AQO B;  4U2Z A;  4GKK T;  3N5L A;  3ZT7 A;  3EHZ A;  2CLY B;  4IDO A;  3E08 A;  4DR5 T;  4WW0 A;  1N34 T;  2LSK A;  1ZHC A;  3AE8 A;  4IDQ A;  5ABF B;  2V6Y B;  4CXY A;  4LMK A;  5AFU L;  1JNR A;  4M1P A;  3VKH A;  4JI8 T;  2XHE B;  3ZKR A;  3CQX C;  4ZI2 C;  2A3D A;  2WS3 A;  3EI0 A;  3RPU A;  2OV9 A;  3X1D A;  1US7 B;  4GKJ T;  2QRX A;  5FL0 A;  4XBF B;  4B3R T;  4L0R A;  1MIY A;  2BBH A;  3C4W A;  2WAU A;  5L4E A;  5J2U E;  5ABG A;  2NW8 A;  3P50 A;  4PJJ A;  3NRX A;  2K48 A;  3SOL A;  1I94 T;  2WBL A;  2JQK A;  2XAG B;  3DP7 A;  3NRY A;  4N78 D;  2YDR A;  2Y8D A;  4U7I A;  4AIU A;  3PDY A;  3RYI E;  5JDF A;  4YFS A;  1D1A A;  1YQ3 A;  3HL6 A;  2BKN A;  5AQQ B;  3K3N A;  3VR8 A;  3RKG A;  3WAJ A;  3N9N A;  5LNK A;  4Z91 A;  3AVR A;  1J5E T;  1XMO T;  3CIR A;  2BG9 E;  4ANJ A;  3ZCJ A;  1HFA A;  3KDS E;  4O2A E;  4JEH B;  2YKS A;  5JDM A;  4U74 A;  4AIS A;  4AKL A;  4EIW A;  3ONJ A;  3PV0 F;  4CN4 A;  3KFW X;  3PUA A;  2HN2 A;  4DV1 T;  2LE8 A;  2IDO B;  4AKG A;  2UXB T;  3UUN A;  2XAH B;  4DR2 T;  2HH7 A;  5AQN B;  5HEH A;  2EHO D;  5AQP B;  1IAP A;  3KIN B;  3AEG A;  4EB6 E;  3ETV A;  3P7I A;  2LJL A;  5FY7 A;  3MAC A;  2QGS A;  2YIN A;  2XM1 A; 
#chains in the Genus database with same CATH homology
 1S35 A;  4HGA A;  4PNI A;  3WI3 A;  5EK2 A;  2VKO A;  3F2E A;  3I1A A;  3FBL A;  3R84 B;  1MMG A;  3UUM A;  2SPC A;  2ZLY A;  2N2N A;  4DMV A;  3NBX X;  4IE6 A;  2NW9 A;  4OYK A;  4NUV A;  2W0G A;  3U78 A;  3N9L A;  3LK2 B;  4G2A A;  4PAG A;  2A72 A;  3CQG B;  5FXW A;  2DLR A;  3CX8 B;  2JRK A;  4H9N C;  3ZC1 A;  3QUJ A;  3Q2M A;  2N1G A;  3H3A A;  4PJL A;  4CZZ B;  3JC6 C;  2K9A A;  3CX6 B;  3SRZ A;  2WM9 A;  4I43 B;  4FI5 A;  3J9X 1;  4ERR A;  4BJN A;  4C91 A;  2JMK A;  3CWZ B;  2Q9Q B;  3V5S A;  3N9P A;  3CQC B;  3J7Y q;  4PW8 A;  4TUY E;  2X9Y A;  3PE0 A;  1UCU A;  1VRB A;  3HKE E;  3CML A;  4AQG A;  4ILU A;  3ZLI A;  2XUE A;  4DND A;  1T98 A;  5JDG A;  2IAK A;  2LHR A;  4UVC B;  5HXE A;  3QK6 A;  1MMN A;  3ZN1 B;  5HWX A;  4PJN A;  5HXC A;  1FMV A;  1MMD A;  4PK4 A;  4X20 E;  4O4J E;  5JH7 E;  2LSY A;  4UF0 B;  4QX7 B;  1MMA A;  3AB3 B;  1HCI A;  5FP3 A;  5DJQ C;  2HPL A;  4OHF A;  2V26 A;  1E1H B;  2ES0 A;  3FXE B;  1ZEE A;  5DQV A;  2VKH A;  3LJC A;  3UT5 E;  4BA9 A;  2X9X A;  3RRC A;  5FY1 A;  2C5K T;  2Q9Q D;  5EZY E;  4K0U A;  4V1A v;  1YD8 G;  5KX5 E;  2X0L B;  2CEA A;  5L3B B;  5LGU B;  5LGN B;  3I0Q A;  1YKE B;  4OFZ A;  4UEL A;  5LGT B;  3N2K E;  4P0A A;  5KMG P;  2DHR A;  4ZI3 C;  5KDM C;  3GN5 A;  4PJM A;  4XAX B;  1CUN A;  2BVL A;  4QKN A;  3KV5 A;  3O1I A;  3PUS A;  2DNX A;  1FIO A;  2BZB A;  2LHN A;  4TV9 E;  3ZEF B;  3ZC0 A;  4H63 H;  1UX4 A;  2LSI A;  3PUR A;  5JDQ A;  3HKD E;  4ZS2 A;  2UXN B;  2G0U A;  3O9X A;  3ZYL A;  2YU2 A;  3LFM A;  3VU7 H;  1HF8 A;  1YW0 A;  4GOU A;  4JEU B;  2V7L A;  5BMV E;  3RC8 A;  3GN5 B;  5HAX A;  4ZI2 D;  3ZYK A;  2L8K A;  3ZN0 B;  4IGU A;  3A5X A;  3KBT A;  2ACX A;  4PK6 A;  2V7M A;  2LM9 A;  2X51 A;  3NZP A;  4YHJ A;  1BR0 A;  2KLQ A;  4GYS A;  3PTR B;  2NTX A;  2DI4 A;  4MFR A;  1Z0P A;  2CWY A;  2ZM8 A;  3NZQ A;  4EXT A;  5L3C B;  3V5U A;  1D0X A;  3L09 A;  2CMR A;  5LHI B;  1WYB A;  5JVD E;  2QA7 A;  1D1C A;  2W00 A;  2ZMA A;  3LK4 2;  4KP3 C;  4B6X A;  4UVB B;  4H9R C;  5FY0 A;  2NWB A;  4X1Y E;  3RKO A;  3LK3 B;  3AAA B;  2Z6E A;  3ZCI A;  3ZJ2 A;  4H9O C;  4U72 A;  3I9W A;  2YU1 A;  2X9H A;  4ASK A;  2C0S A;  4EZH A;  4IE5 A;  4PFP A;  5JDN A;  2BVM A;  2CXL A;  3B57 A;  5DQW A;  3Q5X A;  1LVF A;  2M67 A;  2VKD A;  3JC6 D;  2MBG A;  4CI1 B;  2WMN A;  2VKJ A;  3C98 B;  3ESL A;  4AXP A;  3UUX B;  4QX8 B;  2DWK A;  4EZ4 A;  2LSG A;  5L3F B;  4EOZ B;  1ZV4 X;  5A1L A;  3T8O A;  1D1B A;  4L5G A;  3N9O A;  1G8X A;  3KBU A;  3ANW A;  5L3E B;  5JDH A;  4QWN B;  4CXX A;  3EDU A;  3KVB A;  4OYJ A;  2CWO A;  1Y64 B;  2IC9 A;  4CQI A;  4DO0 A;  4AKI A;  4J2C A;  2UXX B;  4MAL A;  5IYZ E;  2H7O A;  5M4Y A;  4FJO A;  2MYS A;  4WBN E;  3MZK B;  3Q5W A;  2CM0 A;  4UV9 B;  2ZM2 A;  5JR9 C;  4QHO A;  3F57 A;  3I0O A;  1B7T A;  2V7K A;  2E8I A;  2ODV A;  3RYC E;  1HX8 A;  5FMN A;  3ZPO A;  3RYH E;  2DWG A;  3ANW B;  3R6N A;  5LG4 A;  5LBQ B;  4OK0 A;  5J2T E;  2C5J A;  2CLY C;  3IEE A;  4BAY B;  2CXF A;  2LOP A;  4UXN B;  4HN9 A;  1FEW A;  4E7S A;  3U3I A;  2E9X C;  3C51 A;  4DMW A;  1QSD A;  5HXH A;  3W15 B;  2WWU A;  2NTY A;  5TAO A;  1U5P A;  4YJ2 E;  3DJB A;  2ZM0 A;  2CE7 A;  3IHR A;  1UX5 A;  4MBQ A;  3H37 A;  1KNZ A;  2KIN B;  4IHJ E;  4I50 E;  1WRD A;  1MNE A;  3HA4 A;  3K3O A;  5LCY A;  3K3Q C;  1H7C A;  3GWH A;  3FB2 A;  2PFV A;  1SHZ C;  3M65 A;  2V7I A;  3C4Z A;  4L9I A;  4JLE A;  3CKD A;  3E22 E;  3AA0 B;  2LEH A;  3OYX A;  2PBI A;  5CA0 E;  1NAF A;  3O1H A;  4CXW A;  1AJ3 A;  3KVA A;  5HYA A;  3ZJ1 A;  3K8P C;  2JJ9 A;  2LT3 A;  3MKD A;  4TX5 A;  1HG5 A;  5CA1 E;  1VOM A;  1WLX A;  5JDL A;  3D0T A;  3Q9D A;  3UFE A;  1WYC A;  5L2L A;  5LXT E;  4X1I E;  3ETU A;  5GON E;  5JRC A;  2WMO A;  4TZ4 C;  3CX7 B;  4I4T E;  5FXZ A;  3PUG A;  4F6R C;  2LOS A;  5JR9 A;  2VWA A;  4H9Q C;  5EK3 A;  4KUM B;  5JQG E;  2CCQ A;  5H6R B;  5LOV E;  2MOZ A;  4PFO A;  1X79 A;  2X9W A;  3HI2 A;  1QUU A;  5LJN A;  2W63 A;  5FNV E;  5HWY A;  3ONX A;  4IIJ E;  1NWM X;  1S94 A;  1MND A;  4WNK A;  3B13 A;  1U4Q A;  3KV9 A;  3UUL A;  4AI6 A;  3RYF E;  4O4H E;  1HTJ F;  3C50 A;  2V7J A;  3O1J A;  2E9X A;  4ISS A;  3BQL A;  1OWA A;  5C8Y E;  1IJ6 A;  5JRC B;  3BQI A;  2XAQ B;  2JMH A;  2BDE A;  3N5L A;  5JR9 B;  5LHG B;  2XAS B;  1LKX A;  1LRZ A;  4EYU A;  2KXP B;  2B1E A;  2XAJ B;  2IW5 B;  2Y6X A;  3ZMS B;  4NUU A;  4HTE A;  2KMF A;  2CLY B;  3E08 A;  2ODU A;  4WW0 A;  4GK5 E;  2LSK A;  4G63 A;  5HXS A;  2E9X B;  4MLK A;  1ZHC A;  1IJ5 A;  5LJM A;  5DAB A;  1IZN B;  4Z8X A;  5IHY A;  3ZMU B;  2RA1 A;  4YLH A;  2K24 A;  2DCF A;  1OXZ A;  3F31 A;  5LA6 E;  4CXY A;  3VKG A;  5AFU L;  4M1P A;  1BR2 A;  5FXV A;  4O4I E;  2D0U A;  3DTO A;  4MHC A;  4HE8 A;  3VKH A;  4XZC A;  4EAH A;  2L3L A;  2PG8 A;  3N2O A;  3CVR A;  3OBV E;  4TV8 E;  4WBO A;  3ZMZ B;  4AQF A;  2XHE B;  3E0Z A;  4KMC A;  2CA5 A;  4CI2 B;  5LYJ E;  3CQX C;  4ZI2 C;  4ADZ A;  2A3D A;  3O4X E;  4A56 A;  3GMI A;  2X66 A;  3C4X A;  3MXZ A;  4GYR A;  4ZOL E;  3RPU A;  3RH3 A;  1BR1 A;  2Y48 B;  4PK5 A;  2D0T A;  3RRW A;  4IST A;  3P8C D;  1US7 B;  3EDV A;  5HXR A;  1EZ3 A;  2OA5 A;  2PJQ A;  3OJA A;  4E7Z A;  2W61 A;  2NW7 A;  4AKR B;  3KV4 A;  3ZMT B;  4I55 E;  4XBF B;  3FXD B;  1MIY A;  3N9Q A;  4L0R A;  3PUQ A;  3C4W A;  2WAU A;  4C90 A;  2NP9 A;  2KZ7 B;  5F8P A;  3N2G E;  1KK7 A;  5J2U E;  3CPZ A;  5L3G B;  4HKA A;  2MTQ A;  2EHO C;  4KBM B;  2Q9Q A;  2NW8 A;  3I9Y A;  2W62 A;  3IBP A;  4PJJ A;  5FXX A;  3PU3 A;  3KV6 A;  2YEV C;  3NRX A;  2K48 A;  4IE0 A;  3SS1 A;  3MJX A;  3SOL A;  2WBL A;  2XAG B;  4QXB B;  2JQQ A;  3LBX A;  3DP7 A;  4IE7 A;  3NRY A;  3C64 A;  5J1G A;  1HS7 A;  4N78 D;  5F3J A;  3OYZ A;  2K5B B;  2IC6 A;  3LG7 A;  3HKC E;  4ZI3 D;  3OKQ A;  5H6Q B;  4UF0 A;  3SWH A;  2Y8D A;  3RX6 A;  1MIV A;  5FYM A;  2VB6 A;  3GA8 A;  3HR0 A;  1D0Z A;  3PDY A;  4O8S A;  3ZMV B;  3TKL B;  3RYI E;  1WR6 A;  2X68 A;  2XAF B;  5JDF A;  4YFS A;  3AAI A;  4DBR A;  1D1A A;  3LBX B;  5LHH B;  3FHN A;  4H9S E;  3IF8 B;  3HL6 A;  4DVD A;  3HKB E;  3K3N A;  1LVK A;  2I59 A;  2CXD A;  5L3D B;  2HPJ A;  4P09 A;  3AVS A;  1FMW A;  2LSJ A;  2D5U A;  2VK9 A;  1MIW A;  3FBZ A;  3MK7 C;  3WAJ A;  4P0B A;  3BQK A;  4UV8 B;  4AQF C;  3N9N A;  5LNK A;  3VHL A;  4CI3 B;  4O2B E;  2X67 A;  3AVR A;  4GK0 E;  2EHO A;  4X1K E;  5LBM A;  4BJM A;  2H3R A;  5LP6 E;  4H9P C;  2JPF A;  2L9Q A;  2KND A;  4ANJ A;  2VL8 A;  3ZCJ A;  1HFA A;  3EUH A;  3KDS E;  3WAK A;  4O2A E;  3AAE B;  4JEH B;  4HEA A;  4QXC B;  1O3X A;  3MA9 A;  5JRE A;  1BR4 A;  1G73 A;  4ZHQ E;  5JDM A;  1V9D A;  2GK9 A;  4UIG A;  2C5I T;  4IDZ A;  2EHO B;  2RP4 A;  2KT9 A;  4YJ3 E;  3L3P A;  1HG2 A;  4U74 A;  2Q9Q C;  3PU8 A;  2XQY A;  4QXH B;  3UTK A;  2A2F X;  2N9D A;  2YK0 A;  4TN7 B;  4JUY A;  4AKL A;  4EIW A;  5EK4 A;  2XTL A;  1ZKE A;  2VAS A;  2WSS V;  2KWI B;  3AA1 B;  4UVA B;  1YKH B;  4UEM A;  1SA0 E;  3KFW X;  3PUA A;  4IE4 A;  5ADX L;  3N9M A;  2H7V C;  3AA7 B;  4H63 V;  2LE8 A;  3S4U A;  4ZI7 E;  3QC9 A;  2D2S A;  1D0Y A;  4ZS3 A;  4DBQ A;  3EVY A;  3BK9 A;  3RC3 A;  2J1D G;  4AKG A;  3UUN A;  2XAH B;  4O4L E;  5ETW A;  2HH7 A;  2KWH A;  2V1D B;  2EHO D;  4HFV A;  5CB4 E;  1IAP A;  4AKH A;  3KIN B;  4EB6 E;  3ETV A;  3P7I A;  2LJL A;  5E0O A;  5FY7 A;  3ZYM A;  3MAC A;  2QGS A;  3AA6 B;  2E9X D;  4EYY R;  2NOX A;  2YIN A;  2P9B A;  4GIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...