2CWYA

Crystal structure of conserved hypothetical protein, ttha0068 from thermus thermophilus hb8
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
94
structure length
94
Chain Sequence
b'MVPDWEEVLGLWRAGRYYEVHEVLEPYWLKATGEERRLLQGVILLAAALHQRRLGRPGLRNLRKAEARLEGLPCPLMGLDWRSLLQEARRRLGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein TTHA0068
publication title Crystal structure of conserved hypothetical protein, TTHA0068 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
total genus 33
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2005-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03745 DUF309 Domain of unknown function (DUF309)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.500 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2cwyA00
2CXDA 2CWYA
chains in the Genus database with same CATH superfamily
3UQ7A 5CJ5A 4DUZT 2BKPA 4PK4A 2XJ7A 3FHNA 2FJEA 5ETWA 3RYCE 2DWGA 3B13A 4ILBA 2ZMAA 2KMFA 3B57A 4DNDA 2XZEA 4QX8B 3LDQB 2CHOA 2AE9A 2LOPA 5HEUA 4IREA 2DHRA 4HWCA 5L3FB 4DMVA 2NW9A 4LFAT 5C8YE 4IHJE 4DUYT 2BZBA 2UXXB 3U3IA 4OX9T 4TX5A 2NW7A 2LM2A 1EZ3A 1KNRA 4AKGA 4CN1A 3HKDE 4YSYA 2WM9A 4WYVA 3ONLC 2G0UA 3RPUA 2MAWA 3GN5B 3ABVA 3VR9A 1N32T 4DO0A 3ZT7A 5CGMA 2A3DA 1HG2A 2WBLA 3F57A 4CZZB 3E08A 2V7KA 4AKRB 4GKJT 3TLUA 1HNXT 2FUPA 2NTXA 5LMNT 2CXLA 1OEDA 4O4JE 3P4PA 3HKCE 2CWOA 4ZOLE 1Z0PA 4HTEA 3QNUA 4KP3C 4YTPA 4OYJA 2OV9A 4UXNB 1T72A 1WFDA 2CWYA 1ZHCA 4KX6A 3DP7A 2XSAA 2KT9A 4UV9B 2VK9A 2MBGA 1W0AA 3OJAA 2C5IT 3IEEA 3LK2B 2LHNA 3P4WA 3JADA 2BVLA 4GK0E 3W15B 2WCAA 2H7OA 2JRKA 3PUVF 3SRZA 3ESLA 3AE7A 1BR2A 5FXWA 2QVAA 3EUHA 5M4YA 2BBJA 3ZYLA 2W00A 2JMHA 2V26A 4O8SA 3ZMSB 2HPJA 4X1IE 2X0LB 1IJ5A 1OEDE 1N34T 4K0KT 3EI0A 2LHRA 3AECA 3C4XA 2X9HA 3AXJA 3AEFA 1MMGA 4DR7T 2JJ9A 4NXMT 3Q2MA 2KWIB 3C64A 3EDVA 4ISTA 2E5VA 5H6RB 5LXTE 4PK5A 3R84B 2LM9A 4DV2T 1NENA 2IAKA 4TZ4C 3IA3A 2GK9A 3VKHA 2ZM2A 5F5WA 1KEYA 5J1GA 2WWVA 3K3QC 3PE0A 3RLFF 1KNZA 2Y8DA 4QH5A 1NEKA 4IE4A 3CIRA 3RH3A 3VU7H 2D0UA 3AAAB 4DV7T 4WNKA 4IIJE 4H9RC 3V5UA 5LOVE 2N2NA 2XM2A 5HWXA 5IHYA 2SPCA 4CXWA 4IDNA 4WBNE 2E9XD 4AKHA 4AQFA 2H89A 4GOUA 2F4VT 5FKYA 4HFIA 3CPZA 5LNKA 2CCQA 3KFWX 2XQAA 4QXCB 1D0ZA 1YD8G 3RQUA 2CXDA 2CA5A 4UF0A 2CEAA 1NWMX 4YHJA 3DTOA 2LSKA 2X0HA 2VB6A 3QOFA 5JDFA 2UXBT 2H7VC 2XQ9A 5H6QB 2K48A 1XMOT 3AA1B 2XUEA 3FZLB 4L0RA 2ES0A 2VKOA 4DVDA 4HFCA 2ODVA 2V5DA 1SE7A 2LEHA 4A5XA 3I0QA 3PUSA 3PU3A 5HXCA 3GMIA 4LFBT 5FL1A 4Q25A 4KHZF 4CXXA 2LKHA 3FZKB 3AXJB 3O4XE 1FMVA 4MHCA 4DR4T 3VHLA 4ZI7E 1HS7A 2BG9A 3GA8A 4HWFA 1WRDA 5J0ZA 2NTYA 3AE3A 2XQ6A 5JDQA 1OEDC 3GWHA 3E22E 1HFAA 1UUSA 4ASKA 4HWHA 1US7B 4QKNA 4YSXA 4CN4A 3L09A 3RKOA 3H37A 3AE4A 2BS2A 2ZM0A 2JIWA 3Q9DA 4ZHQE 2EHOD 5IWAT 3AA6B 5JDMA 4LF8T 3H3AA 2B1EA 4JI8T 2QYWA 1MNDA 4ILUA 4NUUA 2WDQA 4U74A 1VOMA 4KUMB 1D1BA 3JC6D 5JR9A 4JI2T 4DR5T 3RHWA 2V1DB 2YEVC 2BS3A 3VKGA 3K8PC 1FEWA 3N9OA 2WU2A 5JH7E 2R6GF 3ZCJA 1U4QA 2BG9E 1SUMB 3T8OA 4JI5T 4TUYE 3OVUA 2XASB 4YHHT 4HE8A 4J2CA 1HF8A 1ZKEA 2CE7A 3AEEA 3UQ4A 5AQVB 2WMNA 3IBPA 5HEGA 2XQ4A 2FJDA 5FXVA 2VKDA 4UF0B 3I9WA 4WZXA 2I59A 5FY0A 3N9NA 4CXYA 3L8RA 4BJNA 5AQJB 5EZYE 4U33A 4U2YA 2WB5A 3J9X1 3WI3A 3VRBA 1BR0A 4EAHA 2LJLA 2BKOA 2W61A 5IUXA 3MZKB 3TLTA 3AEBA 3T1HT 4LMKA 2DWKA 2E9XA 5HXEA 2UUCT 5CA1E 4PW8A 3TLWA 2LSIA 3HKBE 4YFSA 3KV5A 4DIDB 3RYFE 4JI0T 3OYXA 2XQ5A 4KI0F 3CWZB 5LCYA 1MIWA 4PFPA 2XTLA 3C50A 4ILAA 5F8PA 4ZS2A 3AEAA 4AISA 3ETUA 1SA0E 4YJ2E 4AQFC 3LFMA 2J62A 4QWNB 3UUXB 4M1PA 3PUZF 4IDQA 4P0AA 2D9DA 3PV0F 4UIGA 2VVNA 4O2BE 4PK6A 2YDSA 5L3BB 4DV4T 5FXZA 2C5JA 3TKLB 2LE8A 5JR9B 4KBMB 3CX6B 4EEDA 3DJBA 5E0OA 2WS3A 2AXDS 3C51A 1FIOA 4ZI3D 2YU2A 4IDPA 2WZHA 3O9XA 2LRLA 2Q9QD 3HI2A 3FBZA 2QGSA 4ZI2D 4E7SA 1GQEA 2KSRA 4MLKA 4L9IA 5BR8T 4UVAB 2WU5A 1DU2A 2FJAA 2C5KT 3FZHB 5KMGP 3SFEA 4YLHA 2V6YA 2V7LA 4EGWA 1J1JA 3KV4A 3ZN0B 4MFRA 3Q5DA 4TN7B 2J47A 3FXDB 4HFEA 3EABA 1VCTA 2BG9C 2IHR1 5AQMB 2N9DA 2L8KA 2NP9A 2IC6A 4C91A 5AQHB 3RQWA 1YQ3A 4XAXB 1S94A 2W4XA 4QH4A 3NKZA 3N2GE 3IHRA 2V7JA 1WCRA 4OHFA 3NZPA 5HEJA 3CMLA 5AQNB 2E9XB 4U3CA 5LG4A 4TNVA 2BBHA 1JNZA 3EDUA 2J4GA 3N9PA 2B76A 2NW8A 5JR9C 2IW5B 4AI6A 2OA5A 4JLEA 5L4HA 3X1DA 2LSJA 2XQ8A 4IE6A 3A8YC 1VCSA 3KBUA 2ZLYA 5J2TE 4Z90A 3L39A 3N9MA 4LF4T 3WAJA 5LGTB 2X9XA 4YTNA 3UT5E 4ANJA 3CK6A 2WSSV 1N36T 4HKAA 4O4LE 3Q5XA 2MOZA 3UULA 5GONE 2X9YA 4H9SE 5TAOA 2DCFA 3S4UA 2X66A 2E2AA 4JI1T 2WQYA 3PDYA 3ZT6A 4X1YE 1UX5A 4YSZA 4TNWA 3QB5A 2VVSA 3UU4A 2XAFB 4ISSA 1E7PA 4NXNT 3SOLA 2KLQA 2A2FX 5DABA 2XAGB 4U7IA 5L3EB 3ZMZB 1E1HB 3AE2A 3HKEE 2MYSA 5HEHA 1VRBA 3NZQA 3EVYA 3LSVA 2E9XC 4Z91A 1UURA 5AQKB 3CX8B 1CHUA 3U78A 2XSBA 1B7TA 3N2OA 2CM0A 2KNDA 4A98A 5IYZE 3RYIE 3KVAA 4CN6A 4G63A 4H9QC 4A97A 2ACZA 2X9WA 2W2UA 4IL4A 5JQGE 3F2EA 2CLYB 2CBJA 1O3XA 3AEDA 5KX5E 3HL6A 3AE5A 2XQYA 2D5UA 2Q9QA 4P09A 2JPFA 1OEDB 4B3RT 1WLXA 3ZMUB 2VKHA 4WBOA 5JDLA 1IZNB 3SFDA 3P50A 2XAJB 2MPKA 4LMJA 3I1AA 4JI7T 3SS1A 3PJAJ 4HGAA 5L3GB 3RKGA 2YDQA 3RX6A 4LF5T 3ZCIA 3UFGA 1X79A 2MTQA 2IC9A 2DL1A 2M67A 3TLVA 4V1Av 1WR0A 2V5CA 3MKDA 4QXBB 3LJCA 4ZXLA 2J1DG 4PAGA 3P4SA 5KXJA 4B3TT 2HN1A 2V7IA 3JCFA 4MBQA 3ONJA 4DV1T 1FJGT 4EB6E 4CI3B 3JAFA 4CQIA 3O1IA 3QK6A 4E7ZA 4UVBB 3UFEA 1OWAA 5EK4A 1D0XA 4FI5A 4PNIA 2UXCT 2CLYC 3HA4A 3JC6C 5AQIB 4KHPT 4MALA 3AVSA 4HFHA 3F31A 3AE9A 3AE1A 3PU8A 3FB2A 4O4HE 4OFZA 2A72A 1WYBA 4TV9E 5LJNA 2X68A 4HFDA 4CI2B 1W9RA 3RIFA 5L47A 2HPLA 3UTKA 3I9YA 1YKHB 5LB7B 1QLBA 5HEOA 2K5BB 1IBLT 3VRAA 4X62T 3CQXC 2XQ3A 2WMOA 4UVCB 5FL0A 3ZC1A 4AIUA 1E2AA 4UV8B 3I0OA 4B3MT 3CQGB 4IDZA 3G06A 4HEAA 2XPKA 1ZP0A 2XAHB 3NRYA 4QXHB 2ACXA 1QSDA 1XZYA 4DR2T 3CVRA 5JTGA 2K9AA 2LSYA 5FY1A 4I55E 2X67A 5DQVA 2D0TA 3PUYF 5C2TA 3ZYKA 3K3NA 4IL9A 2Q9QB 2ZM8A 2BS4A 4JUYA 5FVLA 3ZLIA 3UUMA 1UX4A 4JEHB 5HCJA 1IAPA 4UEMA 4DR6T 2UUBT 4PJNA 1G73A 4UR9A 2KINB 1IBKT 2LT3A 2PFVA 4LMLA 1OXZA 4LF6T 4ZS3A 3ZJ1A 2W62A 5L4EA 4AQYT 2HN2A 4O2AE 2VKJA 1T7SA 2E8IA 3FBLA 1XNRT 2QA7A 2E5LT 2LKGA 5L2LA 3PUWF 4BA9A 1HNZT 2Y6XA 3KBTA 2P9BA 2XAQB 2VQFT 4H9NC 2RA1A 2WAUA 5AQUB 2JMKA 1MIYA 2JQ9A 3KV6A 4C90A 2CMRA 2L3LA 2FBWA 4ADZA 3VR8A 4YT0A 3HR0A 2WDRA 5LGUB 4EXTA 1YQ4A 4HFVA 3ZEFB 3RIUA 4GK5E 2Q9QC 2BG9B 2IIUA 2CHNA 4LF7T 4EV6A 3EHZA 3B5MA 3LG7A 2V8SV 4ZI2C 4X1KE 5J2UE 3TLSA 4H63V 4O4IE 5BMVE 1U5PA 5LHHB 2V7MA 3PUQA 3N5LA 5LMUT 5HAXA 4IE0A 2UU9T 2RP4A 4DBRA 2Z6EA 4ILCA 3ZJ2A 4U72A 2ODUA 4DMWA 4B6XA 2WY2A 5JDHA 4HN9A 2W0GA 3ZN1B 4I4TE 5FVKA 5LHGB 2D2SA 4TV8E 5FMNA 4HFBA 5ADXL 2XY8B 3UUBA 4N78D 3K3OA 5HXHA 4QH1A 1S35A 3IF8B 4PFOA 3ZSTA 2BDEA 2NOXA 1SHZC 3P4RA 2VWAA 3NRXA 3PUXF 2PG8A 4OYKA 3AVRA 4JI3T 5JDGA 4ERRA 4JV5T 3Q5WA 1BR1A 3AE6A 4UELA 3A5XA 4YXDA 2Y48B 4DBQA 4U7YA 5FXXA 2EHOA 5HWYA 2CRBA 1UCUA 5JVDE 5AQQB 1L0VA 4PJLA 1KFYA 4I0UA 1YKEB 1D0YA 3D0TA 2FJBA 3PUGA 4ZZCA 5A1LA 3AB3B 4I50E 2IDOB 5CFBA 1XMQT 1IJ6A 2JQQA 2QRXA 3ZMTB 5AQOB 1H7CA 2X0YA 1J5ET 3FZMB 1LRZA 4DV5T 3LBXA 3L3PA 4P0BA 3MACA 2LSGA 3ANWA 2YDRA 4IE5A 1Z8UA 3PJAA 2XM1A 4AQGA 4JBWF 3OKQA 2IUBA 5HXRA 3M3ZB 3AE8A 4B3ST 1HTJF 1YW0A 4DV0T 3MK7C 2WP9A 3ZMVB 4EOZB 1M7KA 3RF1A 3QB5K 1WR6A 2KWHA 5LG3A 1MIVA 2KZ7B 1CUNA 2YU1A 5L3CB 4I43B 2BKNA 1KF6A 2PJQA 5AQGB 4EYUA 2YKSA 1ZEEA 4H9PC 4F6RC 3BQLA 1MMAA 1T8BA 5JRCA 4U2ZA 4FJOA 2BVMA 2JQHA 3P4QA 1HX8A 3PURA 2H88A 4TWHA 1HNWT 5FY7A 2LOSA 4X20E 4H63H 1MNEA 2V6YB 4DV3T 1QUUA 2WZIA 3NVOA 4GIWA 5F3JA 5ABFA 5JDNA 3OYZA 4EEBA 2K24A 3ZC0A 2JQKA 3RIUC 3MXZA 4F8HA 3OPCA 2EHOB 1UGOA 5HXSA 5HYAA 3RI5A 2ZM6T 3AA7B 1MMNA 1HCIA 4TWFA 4IGUA 4KMCA 5AFUL 1LVKA 1MMDA 1XNQT 2XHEB 1FMWA 4A56A 4XZCA 1LKXA 2UUAT 3M65A 5ABEA 2DI4A 4AKLA 1XDPA 3E0ZA 4GYSA 3SWHA 2M6BA 4K0UA 4COFA 3UU8A 2UXNB 3UU3A 4YTMA 2XQ7A 5LBMA 1T98A 5LA6E 4IDOA 2X51A 3LBXB 3KV9A 3ANWB 5ABHA 4H9OC 2V6XA 4X65T 1KNPA 4JI4T 1HG5A 5CB4E 3FZFB 4JEUB 3PTRB 2H3RA 3LK42 3ZT5A 5LP6E 3ZKRA 1KK7A 5AQSB 4X64T 2W67A 1W0BA 4EYYR 5AQPB 3MA9A 3UU5A 2EHOC 3O1JA 5LHIB 2VURA 3Q5EA 4PJMA 3KDSE 5CA0E 4ZZBA 2RPAA 3KVBA 4Z8XA 1JNRA 5JRCB 3LK3B 2I0MA 3ZPOA 5FYMA 4BAYB 4NPPA 1YXRA 2YK0A 4YY3T 5AQFB 1R8IA 3R6NA 2WDVA 2L9QA 2LLYA 5ABFB 1XDOA 2VQET 3C98B 3OTOT 2M6IA 4QX7B 2A9UA 1X9BA 1V9DA 1XWMA 3OBVE 2HHHT 3KINB 3AEGA 5ABGA 4GYRA 2HH7A 4EIWA 3BQIA 4G2AA 3MJXA 1WYCA 4JI6T 1M62A 5JREA 3C4WA 2DNXA 4EZHA 4JYAT 2W63A 1ZV4X 3RIAA 4IE7A 4IT4A 1N33T 5EK2A 3NBXX 2VASA 5FP3A 3UUNA 3N9LA 4DV6T 4GKKT 4U31A 5L3DB 2PTFA 4QHOA 2NR4A 4BJMA 3RC3A 4XBFB 3O1HA 5AQRB 5C3JA 4OK0A 4TWDA 3FXEB 2NWBA 5EK3A 3EAMA 4DR1T 3PUAA 1BR4A 3UU6A 2CBIA 3AA0B 5AQLB 1NAFA 5DQWA 3AAIA 2VL0A 3QUJA 5HCMA 2CXFA 1HX1B 3C4ZA 3CQCB 2I6HA 2VL8A 3V5SA 1W09A 2WWUA 3H3MA 5FNVE 2IMLA 1D1CA 3RC8A 3N2KE 4WW0A 3A7MA 3ETVA 4PJJA 3GN5A 3N9QA 4NUVA 3WAKA 4X5TA 3K1SA 5LYJE 2YINA 3BK9A 4LFCT 2UXDT 4LF9T 1G8XA 2YOEA 1Y01A 4CI1B 4ZI3C 3J7Yq 5LJMA 1I6ZA 3BQKA 3AAEB 2W66A 4NIQA 1D1AA 5LGNB 2DLRA 2CPTA 4HWDA 3T1YT 1ZOYA 1Y64B 2OLTA 3NWIA 3RRCA 1J5WA 3QC9A 3CKDA 4P1NA 3ZSSA 1HR0T 2KXPB 4X66T 1I94T 4EZ4A 3RRWA 4L5GA 1IBMT 5DJQC 4AXPA 3P7IA 3RYHE 4ZEYA 3P8CD 3ZYMA 4YJ3E 1AJ3A 3JAEA 2LRKA 5KDMC 5AQTB 1LVFA 3ONXA 1UK5A 4DR3T 3RGLA 2PBIA 4AKIA 2YN6A 2N1GA 3CX7B 2K3WA 4HWIB 5LBQB 2C0SA
chains in the Genus database with same CATH topology
3RX6A 3VKGA 3K8PC 3ZCIA 1FEWA 1MIVA 1X79A 2KZ7B 1CUNA 3N9OA 4PK4A 5JH7E 2YU1A 3ZCJA 2MTQA 3FHNA 2IC9A 5ETWA 1U4QA 2M67A 4I43B 3RYCE 5L3CB 2DWGA 3B13A 3T8OA 4V1Av 2PJQA 3MKDA 4EYUA 4TUYE 4QXBB 1ZEEA 4H9PC 3LJCA 4F6RC 2J1DG 4PAGA 3BQLA 1MMAA 2XASB 2ZMAA 2KMFA 3B57A 4HE8A 4DNDA 4J2CA 1HF8A 4QX8B 1ZKEA 2V7IA 5JRCA 2CE7A 4FJOA 2WMNA 2BVMA 3IBPA 4MBQA 2LOPA 5FXVA 1HX8A 3PURA 2VKDA 4EB6E 4UF0B 3I9WA 2DHRA 4CI3B 5L3FB 4CQIA 3O1IA 3QK6A 2NW9A 4DMVA 4E7ZA 2I59A 4UVBB 5C8YE 4IHJE 3N9NA 5FY0A 4CXYA 2BZBA 3UFEA 2UXXB 5FY7A 2LOSA 3U3IA 1OWAA 4TX5A 5EK4A 4BJNA 2NW7A 1D0XA 5EZYE 4X20E 4H63H 1MNEA 4FI5A 1EZ3A 4PNIA 3J9X1 3WI3A 1QUUA 2CLYC 3HA4A 4GIWA 5F3JA 5JDNA 3OYZA 3JC6C 1BR0A 4EAHA 4AKGA 3HKDE 4MALA 2K24A 3AVSA 2WM9A 3ZC0A 3MXZA 2LJLA 3F31A 2EHOB 5HXSA 3PU8A 2W61A 3FB2A 4O4HE 3MZKB 4OFZA 2A72A 5HYAA 1WYBA 2G0UA 3AA7B 1MMNA 4TV9E 5LJNA 2DWKA 2E9XA 1HCIA 3RPUA 5HXEA 2X68A 3GN5B 4IGUA 5CA1E 4CI2B 4KMCA 5AFUL 1LVKA 1MMDA 4DO0A 4PW8A 2HPLA 2XHEB 3UTKA 1FMWA 2LSIA 3I9YA 1YKHB 2K5BB 2A3DA 1HG2A 4A56A 3HKBE 4YFSA 2WBLA 3F57A 3KV5A 4XZCA 4CZZB 1LKXA 3E08A 2V7KA 4AKRB 3CQXC 3RYFE 3M65A 3OYXA 2DI4A 2WMOA 3CWZB 5LCYA 4AKLA 1MIWA 4PFPA 4UVCB 2NTXA 2XTLA 3ZC1A 2CXLA 3C50A 4UV8B 4O4JE 3E0ZA 3I0OA 4GYSA 4ZS2A 3CQGB 5F8PA 3SWHA 4IDZA 4K0UA 3ETUA 4HEAA 1SA0E 2UXNB 4YJ2E 3HKCE 2XAHB 3NRYA 4QXHB 2ACXA 1QSDA 3LFMA 4AQFC 4QWNB 3UUXB 3CVRA 2CWOA 4M1PA 4ZOLE 5LBMA 1T98A 5LA6E 1Z0PA 2X51A 4HTEA 3LBXB 2K9AA 2LSYA 3KV9A 5FY1A 4P0AA 4I55E 4KP3C 3ANWB 4H9OC 4OYJA 2X67A 5DQVA 2D0TA 4UIGA 4UXNB 3ZYKA 3K3NA 2Q9QB 4O2BE 4PK6A 2ZM8A 2CWYA 1ZHCA 5L3BB 4JUYA 3DP7A 2KT9A 3ZLIA 5FXZA 3UUMA 4UV9B 1HG5A 1UX4A 2C5JA 2VK9A 5CB4E 2MBGA 4JEUB 3TKLB 3OJAA 2C5IT 3PTRB 3IEEA 2H3RA 4JEHB 2LE8A 1IAPA 3LK2B 5JR9B 2LHNA 4KBMB 4UEMA 3CX6B 3DJBA 5E0OA 2BVLA 4GK0E 3W15B 3C51A 1FIOA 4ZI3D 3LK42 2YU2A 4PJNA 2H7OA 3O9XA 2JRKA 1G73A 3SRZA 2KINB 5LP6E 1KK7A 3ESLA 2Q9QD 1BR2A 3HI2A 3FBZA 2LT3A 2QGSA 2PFVA 5FXWA 4ZI2D 4EYYR 3EUHA 5M4YA 1OXZA 4E7SA 4MLKA 4ZS3A 3ZJ1A 2W62A 4L9IA 2W00A 3MA9A 4UVAB 3ZYLA 2EHOC 2JMHA 3O1JA 5LHIB 2V26A 4O8SA 4PJMA 3ZMSB 3KDSE 4O2AE 5CA0E 2C5KT 2VKJA 2HPJA 4X1IE 5KMGP 2X0LB 2E8IA 3FBLA 4YLHA 1IJ5A 2QA7A 3KVBA 2LHRA 2V7LA 4Z8XA 5L2LA 5JRCB 3KV4A 3LK3B 3ZN0B 4MFRA 3C4XA 2X9HA 4TN7B 3ZPOA 3FXDB 1MMGA 4BA9A 5FYMA 2Y6XA 3KBTA 2JJ9A 2P9BA 2XAQB 3Q2MA 4BAYB 4H9NC 2KWIB 2RA1A 2WAUA 2YK0A 2JMKA 1MIYA 2N9DA 3C64A 3EDVA 3R6NA 2L8KA 4ISTA 5H6RB 2NP9A 2C0SA 2IC6A 3KV6A 5LXTE 4PK5A 4C91A 3R84B 2L9QA 2LM9A 4C90A 2CMRA 2L3LA 4XAXB 4ADZA 1S94A 3C98B 3HR0A 5LGUB 4EXTA 4QX7B 3N2GE 2IAKA 1V9DA 3IHRA 4HFVA 4TZ4C 3OBVE 3ZEFB 2V7JA 2GK9A 3VKHA 2ZM2A 4GK5E 4OHFA 3NZPA 5J1GA 3KINB 2Q9QC 3K3QC 3CMLA 3PE0A 4GYRA 2HH7A 4EIWA 3BQIA 3LG7A 4ZI2C 1KNZA 2Y8DA 2E9XB 4G2AA 3MJXA 4X1KE 5LG4A 1WYCA 4IE4A 5J2UE 3EDUA 3N9PA 3RH3A 2NW8A 4H63V 3VU7H 2D0UA 4O4IE 2IW5B 5BMVE 5JR9C 1U5PA 3AAAB 4AI6A 2OA5A 5JREA 4WNKA 3C4WA 2DNXA 5LHHB 2V7MA 4JLEA 4EZHA 3PUQA 2W63A 4IIJE 3N5LA 1ZV4X 5HAXA 4IE0A 4IE7A 2LSJA 4IE6A 4H9RC 5EK2A 3NBXX 2VASA 5LOVE 3V5UA 3KBUA 2N2NA 2ZLYA 2RP4A 5J2TE 5HWXA 3N9MA 5FP3A 5IHYA 2SPCA 2Z6EA 4CXWA 4DBRA 4WBNE 2E9XD 3ZJ2A 4U72A 3UUNA 3WAJA 4AKHA 2ODUA 3N9LA 5LGTB 2X9XA 4DMWA 4B6XA 4AQFA 3UT5E 5JDHA 4GOUA 4HN9A 4ANJA 2WSSV 2W0GA 5L3DB 3ZN1B 4QHOA 4HKAA 3CPZA 5LNKA 4I4TE 4O4LE 3Q5XA 4BJMA 5LHGB 3RC3A 2MOZA 2CCQA 3KFWX 2D2SA 5GONE 3UULA 4TV8E 4XBFB 2X9YA 3O1HA 4H9SE 5FMNA 4QXCB 5ADXL 5TAOA 4OK0A 1D0ZA 1YD8G 2DCFA 4N78D 3FXEB 2NWBA 3S4UA 2X66A 5EK3A 3K3OA 2CXDA 2CA5A 5HXHA 4UF0A 3PUAA 1S35A 2CEAA 3IF8B 3PDYA 1NWMX 4PFOA 4YHJA 3DTOA 1BR4A 2LSKA 1UX5A 2VB6A 4X1YE 2BDEA 2NOXA 3AA0B 5JDFA 1NAFA 1SHZC 2H7VC 2VWAA 5DQWA 3AAIA 3NRXA 3QUJA 2XAFB 5H6QB 2CXFA 2K48A 3AA1B 4ISSA 2PG8A 4OYKA 3C4ZA 2XUEA 3AVRA 2KLQA 4L0RA 3SOLA 2A2FX 3CQCB 5DABA 2XAGB 2VL8A 3V5SA 5JDGA 2WWUA 4ERRA 5L3EB 3Q5WA 1BR1A 2ES0A 2VKOA 5FNVE 4DVDA 4UELA 3A5XA 2ODVA 3ZMZB 1E1HB 2Y48B 3HKEE 4DBQA 2MYSA 1D1CA 2LEHA 5FXXA 2EHOA 5HWYA 3RC8A 3N2KE 3I0QA 4WW0A 1VRBA 3PUSA 3NZQA 3EVYA 3PU3A 1UCUA 5JVDE 2E9XC 5HXCA 3ETVA 4PJJA 3GMIA 3GN5A 4PJLA 3CX8B 3N9QA 4NUVA 3WAKA 3U78A 5LYJE 4CXXA 1B7TA 2YINA 3N2OA 3BK9A 1YKEB 1D0YA 3D0TA 2CM0A 2KNDA 3PUGA 3O4XE 5A1LA 1FMVA 1G8XA 5IYZE 3AB3B 3RYIE 4CI1B 4ZI3C 3J7Yq 4MHCA 5LJMA 4I50E 3BQKA 3VHLA 4ZI7E 1HS7A 3AAEB 3KVAA 1IJ6A 2JQQA 3GA8A 1D1AA 5LGNB 1WRDA 3ZMTB 4G63A 2NTYA 2DLRA 4H9QC 1H7CA 5JDQA 3GWHA 3E22E 1HFAA 2X9WA 4ASKA 1US7B 4QKNA 5JQGE 3F2EA 2CLYB 3L09A 1O3XA 3RKOA 1Y64B 3RRCA 1LRZA 3H37A 5KX5E 3QC9A 3HL6A 3LBXA 2ZM0A 3L3PA 3CKDA 4P0BA 2XQYA 3MACA 2LSGA 2KXPB 3ANWA 3Q9DA 4ZHQE 2D5UA 2EHOD 4EZ4A 4IE5A 3RRWA 4L5GA 2Q9QA 3AA6B 5DJQC 5JDMA 4P09A 4AQGA 4AXPA 3P7IA 3H3AA 2JPFA 3RYHE 2B1EA 1MNDA 3P8CD 4ILUA 1WLXA 4NUUA 3ZMUB 2VKHA 3OKQA 5HXRA 3ZYMA 4YJ3E 1AJ3A 4U74A 1VOMA 4KUMB 1D1BA 5KDMC 1HTJF 4WBOA 5JDLA 1IZNB 1LVFA 3JC6D 3ONXA 5JR9A 1YW0A 3MK7C 2PBIA 2XAJB 3ZMVB 4AKIA 4EOZB 2N1GA 3I1AA 3CX7B 2V1DB 3SS1A 2YEVC 4HGAA 5LBQB 5L3GB 1WR6A 2KWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CXD A;  2CWY A; 
#chains in the Genus database with same CATH topology
 3UQ7 A;  5CJ5 A;  4DUZ T;  2BKP A;  4PK4 A;  2XJ7 A;  3FHN A;  2FJE A;  5ETW A;  3RYC E;  2DWG A;  3B13 A;  4ILB A;  2ZMA A;  2KMF A;  3B57 A;  4DND A;  2XZE A;  4QX8 B;  3LDQ B;  2CHO A;  2AE9 A;  2LOP A;  5HEU A;  4IRE A;  2DHR A;  4HWC A;  5L3F B;  4DMV A;  2NW9 A;  4LFA T;  5C8Y E;  4IHJ E;  4DUY T;  2BZB A;  2UXX B;  3U3I A;  4OX9 T;  4TX5 A;  2NW7 A;  2LM2 A;  1EZ3 A;  1KNR A;  4AKG A;  4CN1 A;  3HKD E;  4YSY A;  2WM9 A;  4WYV A;  3ONL C;  2G0U A;  3RPU A;  2MAW A;  3GN5 B;  3ABV A;  3VR9 A;  1N32 T;  4DO0 A;  3ZT7 A;  5CGM A;  2A3D A;  1HG2 A;  2WBL A;  3F57 A;  4CZZ B;  3E08 A;  2V7K A;  4AKR B;  4GKJ T;  3TLU A;  1HNX T;  2FUP A;  2NTX A;  5LMN T;  2CXL A;  1OED A;  4O4J E;  3P4P A;  3HKC E;  2CWO A;  4ZOL E;  1Z0P A;  4HTE A;  3QNU A;  4KP3 C;  4YTP A;  4OYJ A;  2OV9 A;  4UXN B;  1T72 A;  1WFD A;  2CWY A;  1ZHC A;  4KX6 A;  3DP7 A;  2XSA A;  2KT9 A;  4UV9 B;  2VK9 A;  2MBG A;  1W0A A;  3OJA A;  2C5I T;  3IEE A;  3LK2 B;  2LHN A;  3P4W A;  3JAD A;  2BVL A;  4GK0 E;  3W15 B;  2WCA A;  2H7O A;  2JRK A;  3PUV F;  3SRZ A;  3ESL A;  3AE7 A;  1BR2 A;  5FXW A;  2QVA A;  3EUH A;  5M4Y A;  2BBJ A;  3ZYL A;  2W00 A;  2JMH A;  2V26 A;  4O8S A;  3ZMS B;  2HPJ A;  4X1I E;  2X0L B;  1IJ5 A;  1OED E;  1N34 T;  4K0K T;  3EI0 A;  2LHR A;  3AEC A;  3C4X A;  2X9H A;  3AXJ A;  3AEF A;  1MMG A;  4DR7 T;  2JJ9 A;  4NXM T;  3Q2M A;  2KWI B;  3C64 A;  3EDV A;  4IST A;  2E5V A;  5H6R B;  5LXT E;  4PK5 A;  3R84 B;  2LM9 A;  4DV2 T;  1NEN A;  2IAK A;  4TZ4 C;  3IA3 A;  2GK9 A;  3VKH A;  2ZM2 A;  5F5W A;  1KEY A;  5J1G A;  2WWV A;  3K3Q C;  3PE0 A;  3RLF F;  1KNZ A;  2Y8D A;  4QH5 A;  1NEK A;  4IE4 A;  3CIR A;  3RH3 A;  3VU7 H;  2D0U A;  3AAA B;  4DV7 T;  4WNK A;  4IIJ E;  4H9R C;  3V5U A;  5LOV E;  2N2N A;  2XM2 A;  5HWX A;  5IHY A;  2SPC A;  4CXW A;  4IDN A;  4WBN E;  2E9X D;  4AKH A;  4AQF A;  2H89 A;  4GOU A;  2F4V T;  5FKY A;  4HFI A;  3CPZ A;  5LNK A;  2CCQ A;  3KFW X;  2XQA A;  4QXC B;  1D0Z A;  1YD8 G;  3RQU A;  2CXD A;  2CA5 A;  4UF0 A;  2CEA A;  1NWM X;  4YHJ A;  3DTO A;  2LSK A;  2X0H A;  2VB6 A;  3QOF A;  5JDF A;  2UXB T;  2H7V C;  2XQ9 A;  5H6Q B;  2K48 A;  1XMO T;  3AA1 B;  2XUE A;  3FZL B;  4L0R A;  2ES0 A;  2VKO A;  4DVD A;  4HFC A;  2ODV A;  2V5D A;  1SE7 A;  2LEH A;  4A5X A;  3I0Q A;  3PUS A;  3PU3 A;  5HXC A;  3GMI A;  4LFB T;  5FL1 A;  4Q25 A;  4KHZ F;  4CXX A;  2LKH A;  3FZK B;  3AXJ B;  3O4X E;  1FMV A;  4MHC A;  4DR4 T;  3VHL A;  4ZI7 E;  1HS7 A;  2BG9 A;  3GA8 A;  4HWF A;  1WRD A;  5J0Z A;  2NTY A;  3AE3 A;  2XQ6 A;  5JDQ A;  1OED C;  3GWH A;  3E22 E;  1HFA A;  1UUS A;  4ASK A;  4HWH A;  1US7 B;  4QKN A;  4YSX A;  4CN4 A;  3L09 A;  3RKO A;  3H37 A;  3AE4 A;  2BS2 A;  2ZM0 A;  2JIW A;  3Q9D A;  4ZHQ E;  2EHO D;  5IWA T;  3AA6 B;  5JDM A;  4LF8 T;  3H3A A;  2B1E A;  4JI8 T;  2QYW A;  1MND A;  4ILU A;  4NUU A;  2WDQ A;  4U74 A;  1VOM A;  4KUM B;  1D1B A;  3JC6 D;  5JR9 A;  4JI2 T;  4DR5 T;  3RHW A;  2V1D B;  2YEV C;  2BS3 A;  3VKG A;  3K8P C;  1FEW A;  3N9O A;  2WU2 A;  5JH7 E;  2R6G F;  3ZCJ A;  1U4Q A;  2BG9 E;  1SUM B;  3T8O A;  4JI5 T;  4TUY E;  3OVU A;  2XAS B;  4YHH T;  4HE8 A;  4J2C A;  1HF8 A;  1ZKE A;  2CE7 A;  3AEE A;  3UQ4 A;  5AQV B;  2WMN A;  3IBP A;  5HEG A;  2XQ4 A;  2FJD A;  5FXV A;  2VKD A;  4UF0 B;  3I9W A;  4WZX A;  2I59 A;  5FY0 A;  3N9N A;  4CXY A;  3L8R A;  4BJN A;  5AQJ B;  5EZY E;  4U33 A;  4U2Y A;  2WB5 A;  3J9X 1;  3WI3 A;  3VRB A;  1BR0 A;  4EAH A;  2LJL A;  2BKO A;  2W61 A;  5IUX A;  3MZK B;  3TLT A;  3AEB A;  3T1H T;  4LMK A;  2DWK A;  2E9X A;  5HXE A;  2UUC T;  5CA1 E;  4PW8 A;  3TLW A;  2LSI A;  3HKB E;  4YFS A;  3KV5 A;  4DID B;  3RYF E;  4JI0 T;  3OYX A;  2XQ5 A;  4KI0 F;  3CWZ B;  5LCY A;  1MIW A;  4PFP A;  2XTL A;  3C50 A;  4ILA A;  5F8P A;  4ZS2 A;  3AEA A;  4AIS A;  3ETU A;  1SA0 E;  4YJ2 E;  4AQF C;  3LFM A;  2J62 A;  4QWN B;  3UUX B;  4M1P A;  3PUZ F;  4IDQ A;  4P0A A;  2D9D A;  3PV0 F;  4UIG A;  2VVN A;  4O2B E;  4PK6 A;  2YDS A;  5L3B B;  4DV4 T;  5FXZ A;  2C5J A;  3TKL B;  2LE8 A;  5JR9 B;  4KBM B;  3CX6 B;  4EED A;  3DJB A;  5E0O A;  2WS3 A;  2AXD S;  3C51 A;  1FIO A;  4ZI3 D;  2YU2 A;  4IDP A;  2WZH A;  3O9X A;  2LRL A;  2Q9Q D;  3HI2 A;  3FBZ A;  2QGS A;  4ZI2 D;  4E7S A;  1GQE A;  2KSR A;  4MLK A;  4L9I A;  5BR8 T;  4UVA B;  2WU5 A;  1DU2 A;  2FJA A;  2C5K T;  3FZH B;  5KMG P;  3SFE A;  4YLH A;  2V6Y A;  2V7L A;  4EGW A;  1J1J A;  3KV4 A;  3ZN0 B;  4MFR A;  3Q5D A;  4TN7 B;  2J47 A;  3FXD B;  4HFE A;  3EAB A;  1VCT A;  2BG9 C;  2IHR 1;  5AQM B;  2N9D A;  2L8K A;  2NP9 A;  2IC6 A;  4C91 A;  5AQH B;  3RQW A;  1YQ3 A;  4XAX B;  1S94 A;  2W4X A;  4QH4 A;  3NKZ A;  3N2G E;  3IHR A;  2V7J A;  1WCR A;  4OHF A;  3NZP A;  5HEJ A;  3CML A;  5AQN B;  2E9X B;  4U3C A;  5LG4 A;  4TNV A;  2BBH A;  1JNZ A;  3EDU A;  2J4G A;  3N9P A;  2B76 A;  2NW8 A;  5JR9 C;  2IW5 B;  4AI6 A;  2OA5 A;  4JLE A;  5L4H A;  3X1D A;  2LSJ A;  2XQ8 A;  4IE6 A;  3A8Y C;  1VCS A;  3KBU A;  2ZLY A;  5J2T E;  4Z90 A;  3L39 A;  3N9M A;  4LF4 T;  3WAJ A;  5LGT B;  2X9X A;  4YTN A;  3UT5 E;  4ANJ A;  3CK6 A;  2WSS V;  1N36 T;  4HKA A;  4O4L E;  3Q5X A;  2MOZ A;  3UUL A;  5GON E;  2X9Y A;  4H9S E;  5TAO A;  2DCF A;  3S4U A;  2X66 A;  2E2A A;  4JI1 T;  2WQY A;  3PDY A;  3ZT6 A;  4X1Y E;  1UX5 A;  4YSZ A;  4TNW A;  3QB5 A;  2VVS A;  3UU4 A;  2XAF B;  4ISS A;  1E7P A;  4NXN T;  3SOL A;  2KLQ A;  2A2F X;  5DAB A;  2XAG B;  4U7I A;  5L3E B;  3ZMZ B;  1E1H B;  3AE2 A;  3HKE E;  2MYS A;  5HEH A;  1VRB A;  3NZQ A;  3EVY A;  3LSV A;  2E9X C;  4Z91 A;  1UUR A;  5AQK B;  3CX8 B;  1CHU A;  3U78 A;  2XSB A;  1B7T A;  3N2O A;  2CM0 A;  2KND A;  4A98 A;  5IYZ E;  3RYI E;  3KVA A;  4CN6 A;  4G63 A;  4H9Q C;  4A97 A;  2ACZ A;  2X9W A;  2W2U A;  4IL4 A;  5JQG E;  3F2E A;  2CLY B;  2CBJ A;  1O3X A;  3AED A;  5KX5 E;  3HL6 A;  3AE5 A;  2XQY A;  2D5U A;  2Q9Q A;  4P09 A;  2JPF A;  1OED B;  4B3R T;  1WLX A;  3ZMU B;  2VKH A;  4WBO A;  5JDL A;  1IZN B;  3SFD A;  3P50 A;  2XAJ B;  2MPK A;  4LMJ A;  3I1A A;  4JI7 T;  3SS1 A;  3PJA J;  4HGA A;  5L3G B;  3RKG A;  2YDQ A;  3RX6 A;  4LF5 T;  3ZCI A;  3UFG A;  1X79 A;  2MTQ A;  2IC9 A;  2DL1 A;  2M67 A;  3TLV A;  4V1A v;  1WR0 A;  2V5C A;  3MKD A;  4QXB B;  3LJC A;  4ZXL A;  2J1D G;  4PAG A;  3P4S A;  5KXJ A;  4B3T T;  2HN1 A;  2V7I A;  3JCF A;  4MBQ A;  3ONJ A;  4DV1 T;  1FJG T;  4EB6 E;  4CI3 B;  3JAF A;  4CQI A;  3O1I A;  3QK6 A;  4E7Z A;  4UVB B;  3UFE A;  1OWA A;  5EK4 A;  1D0X A;  4FI5 A;  4PNI A;  2UXC T;  2CLY C;  3HA4 A;  3JC6 C;  5AQI B;  4KHP T;  4MAL A;  3AVS A;  4HFH A;  3F31 A;  3AE9 A;  3AE1 A;  3PU8 A;  3FB2 A;  4O4H E;  4OFZ A;  2A72 A;  1WYB A;  4TV9 E;  5LJN A;  2X68 A;  4HFD A;  4CI2 B;  1W9R A;  3RIF A;  5L47 A;  2HPL A;  3UTK A;  3I9Y A;  1YKH B;  5LB7 B;  1QLB A;  5HEO A;  2K5B B;  1IBL T;  3VRA A;  4X62 T;  3CQX C;  2XQ3 A;  2WMO A;  4UVC B;  5FL0 A;  3ZC1 A;  4AIU A;  1E2A A;  4UV8 B;  3I0O A;  4B3M T;  3CQG B;  4IDZ A;  3G06 A;  4HEA A;  2XPK A;  1ZP0 A;  2XAH B;  3NRY A;  4QXH B;  2ACX A;  1QSD A;  1XZY A;  4DR2 T;  3CVR A;  5JTG A;  2K9A A;  2LSY A;  5FY1 A;  4I55 E;  2X67 A;  5DQV A;  2D0T A;  3PUY F;  5C2T A;  3ZYK A;  3K3N A;  4IL9 A;  2Q9Q B;  2ZM8 A;  2BS4 A;  4JUY A;  5FVL A;  3ZLI A;  3UUM A;  1UX4 A;  4JEH B;  5HCJ A;  1IAP A;  4UEM A;  4DR6 T;  2UUB T;  4PJN A;  1G73 A;  4UR9 A;  2KIN B;  1IBK T;  2LT3 A;  2PFV A;  4LML A;  1OXZ A;  4LF6 T;  4ZS3 A;  3ZJ1 A;  2W62 A;  5L4E A;  4AQY T;  2HN2 A;  4O2A E;  2VKJ A;  1T7S A;  2E8I A;  3FBL A;  1XNR T;  2QA7 A;  2E5L T;  2LKG A;  5L2L A;  3PUW F;  4BA9 A;  1HNZ T;  2Y6X A;  3KBT A;  2P9B A;  2XAQ B;  2VQF T;  4H9N C;  2RA1 A;  2WAU A;  5AQU B;  2JMK A;  1MIY A;  2JQ9 A;  3KV6 A;  4C90 A;  2CMR A;  2L3L A;  2FBW A;  4ADZ A;  3VR8 A;  4YT0 A;  3HR0 A;  2WDR A;  5LGU B;  4EXT A;  1YQ4 A;  4HFV A;  3ZEF B;  3RIU A;  4GK5 E;  2Q9Q C;  2BG9 B;  2IIU A;  2CHN A;  4LF7 T;  4EV6 A;  3EHZ A;  3B5M A;  3LG7 A;  2V8S V;  4ZI2 C;  4X1K E;  5J2U E;  3TLS A;  4H63 V;  4O4I E;  5BMV E;  1U5P A;  5LHH B;  2V7M A;  3PUQ A;  3N5L A;  5LMU T;  5HAX A;  4IE0 A;  2UU9 T;  2RP4 A;  4DBR A;  2Z6E A;  4ILC A;  3ZJ2 A;  4U72 A;  2ODU A;  4DMW A;  4B6X A;  2WY2 A;  5JDH A;  4HN9 A;  2W0G A;  3ZN1 B;  4I4T E;  5FVK A;  5LHG B;  2D2S A;  4TV8 E;  5FMN A;  4HFB A;  5ADX L;  2XY8 B;  3UUB A;  4N78 D;  3K3O A;  5HXH A;  4QH1 A;  1S35 A;  3IF8 B;  4PFO A;  3ZST A;  2BDE A;  2NOX A;  1SHZ C;  3P4R A;  2VWA A;  3NRX A;  3PUX F;  2PG8 A;  4OYK A;  3AVR A;  4JI3 T;  5JDG A;  4ERR A;  4JV5 T;  3Q5W A;  1BR1 A;  3AE6 A;  4UEL A;  3A5X A;  4YXD A;  2Y48 B;  4DBQ A;  4U7Y A;  5FXX A;  2EHO A;  5HWY A;  2CRB A;  1UCU A;  5JVD E;  5AQQ B;  1L0V A;  4PJL A;  1KFY A;  4I0U A;  1YKE B;  1D0Y A;  3D0T A;  2FJB A;  3PUG A;  4ZZC A;  5A1L A;  3AB3 B;  4I50 E;  2IDO B;  5CFB A;  1XMQ T;  1IJ6 A;  2JQQ A;  2QRX A;  3ZMT B;  5AQO B;  1H7C A;  2X0Y A;  1J5E T;  3FZM B;  1LRZ A;  4DV5 T;  3LBX A;  3L3P A;  4P0B A;  3MAC A;  2LSG A;  3ANW A;  2YDR A;  4IE5 A;  1Z8U A;  3PJA A;  2XM1 A;  4AQG A;  4JBW F;  3OKQ A;  2IUB A;  5HXR A;  3M3Z B;  3AE8 A;  4B3S T;  1HTJ F;  1YW0 A;  4DV0 T;  3MK7 C;  2WP9 A;  3ZMV B;  4EOZ B;  1M7K A;  3RF1 A;  3QB5 K;  1WR6 A;  2KWH A;  5LG3 A;  1MIV A;  2KZ7 B;  1CUN A;  2YU1 A;  5L3C B;  4I43 B;  2BKN A;  1KF6 A;  2PJQ A;  5AQG B;  4EYU A;  2YKS A;  1ZEE A;  4H9P C;  4F6R C;  3BQL A;  1MMA A;  1T8B A;  5JRC A;  4U2Z A;  4FJO A;  2BVM A;  2JQH A;  3P4Q A;  1HX8 A;  3PUR A;  2H88 A;  4TWH A;  1HNW T;  5FY7 A;  2LOS A;  4X20 E;  4H63 H;  1MNE A;  2V6Y B;  4DV3 T;  1QUU A;  2WZI A;  3NVO A;  4GIW A;  5F3J A;  5ABF A;  5JDN A;  3OYZ A;  4EEB A;  2K24 A;  3ZC0 A;  2JQK A;  3RIU C;  3MXZ A;  4F8H A;  3OPC A;  2EHO B;  1UGO A;  5HXS A;  5HYA A;  3RI5 A;  2ZM6 T;  3AA7 B;  1MMN A;  1HCI A;  4TWF A;  4IGU A;  4KMC A;  5AFU L;  1LVK A;  1MMD A;  1XNQ T;  2XHE B;  1FMW A;  4A56 A;  4XZC A;  1LKX A;  2UUA T;  3M65 A;  5ABE A;  2DI4 A;  4AKL A;  1XDP A;  3E0Z A;  4GYS A;  3SWH A;  2M6B A;  4K0U A;  4COF A;  3UU8 A;  2UXN B;  3UU3 A;  4YTM A;  2XQ7 A;  5LBM A;  1T98 A;  5LA6 E;  4IDO A;  2X51 A;  3LBX B;  3KV9 A;  3ANW B;  5ABH A;  4H9O C;  2V6X A;  4X65 T;  1KNP A;  4JI4 T;  1HG5 A;  5CB4 E;  3FZF B;  4JEU B;  3PTR B;  2H3R A;  3LK4 2;  3ZT5 A;  5LP6 E;  3ZKR A;  1KK7 A;  5AQS B;  4X64 T;  2W67 A;  1W0B A;  4EYY R;  5AQP B;  3MA9 A;  3UU5 A;  2EHO C;  3O1J A;  5LHI B;  2VUR A;  3Q5E A;  4PJM A;  3KDS E;  5CA0 E;  4ZZB A;  2RPA A;  3KVB A;  4Z8X A;  1JNR A;  5JRC B;  3LK3 B;  2I0M A;  3ZPO A;  5FYM A;  4BAY B;  4NPP A;  1YXR A;  2YK0 A;  4YY3 T;  5AQF B;  1R8I A;  3R6N A;  2WDV A;  2L9Q A;  2LLY A;  5ABF B;  1XDO A;  2VQE T;  3C98 B;  3OTO T;  2M6I A;  4QX7 B;  2A9U A;  1X9B A;  1V9D A;  1XWM A;  3OBV E;  2HHH T;  3KIN B;  3AEG A;  5ABG A;  4GYR A;  2HH7 A;  4EIW A;  3BQI A;  4G2A A;  3MJX A;  1WYC A;  4JI6 T;  1M62 A;  5JRE A;  3C4W A;  2DNX A;  4EZH A;  4JYA T;  2W63 A;  1ZV4 X;  3RIA A;  4IE7 A;  4IT4 A;  1N33 T;  5EK2 A;  3NBX X;  2VAS A;  5FP3 A;  3UUN A;  3N9L A;  4DV6 T;  4GKK T;  4U31 A;  5L3D B;  2PTF A;  4QHO A;  2NR4 A;  4BJM A;  3RC3 A;  4XBF B;  3O1H A;  5AQR B;  5C3J A;  4OK0 A;  4TWD A;  3FXE B;  2NWB A;  5EK3 A;  3EAM A;  4DR1 T;  3PUA A;  1BR4 A;  3UU6 A;  2CBI A;  3AA0 B;  5AQL B;  1NAF A;  5DQW A;  3AAI A;  2VL0 A;  3QUJ A;  5HCM A;  2CXF A;  1HX1 B;  3C4Z A;  3CQC B;  2I6H A;  2VL8 A;  3V5S A;  1W09 A;  2WWU A;  3H3M A;  5FNV E;  2IML A;  1D1C A;  3RC8 A;  3N2K E;  4WW0 A;  3A7M A;  3ETV A;  4PJJ A;  3GN5 A;  3N9Q A;  4NUV A;  3WAK A;  4X5T A;  3K1S A;  5LYJ E;  2YIN A;  3BK9 A;  4LFC T;  2UXD T;  4LF9 T;  1G8X A;  2YOE A;  1Y01 A;  4CI1 B;  4ZI3 C;  3J7Y q;  5LJM A;  1I6Z A;  3BQK A;  3AAE B;  2W66 A;  4NIQ A;  1D1A A;  5LGN B;  2DLR A;  2CPT A;  4HWD A;  3T1Y T;  1ZOY A;  1Y64 B;  2OLT A;  3NWI A;  3RRC A;  1J5W A;  3QC9 A;  3CKD A;  4P1N A;  3ZSS A;  1HR0 T;  2KXP B;  4X66 T;  1I94 T;  4EZ4 A;  3RRW A;  4L5G A;  1IBM T;  5DJQ C;  4AXP A;  3P7I A;  3RYH E;  4ZEY A;  3P8C D;  3ZYM A;  4YJ3 E;  1AJ3 A;  3JAE A;  2LRK A;  5KDM C;  5AQT B;  1LVF A;  3ONX A;  1UK5 A;  4DR3 T;  3RGL A;  2PBI A;  4AKI A;  2YN6 A;  2N1G A;  3CX7 B;  2K3W A;  4HWI B;  5LBQ B;  2C0S A; 
#chains in the Genus database with same CATH homology
 3RX6 A;  3VKG A;  3K8P C;  3ZCI A;  1FEW A;  1MIV A;  1X79 A;  2KZ7 B;  1CUN A;  3N9O A;  4PK4 A;  5JH7 E;  2YU1 A;  3ZCJ A;  2MTQ A;  3FHN A;  2IC9 A;  5ETW A;  1U4Q A;  2M67 A;  4I43 B;  3RYC E;  5L3C B;  2DWG A;  3B13 A;  3T8O A;  4V1A v;  2PJQ A;  3MKD A;  4EYU A;  4TUY E;  4QXB B;  1ZEE A;  4H9P C;  3LJC A;  4F6R C;  2J1D G;  4PAG A;  3BQL A;  1MMA A;  2XAS B;  2ZMA A;  2KMF A;  3B57 A;  4HE8 A;  4DND A;  4J2C A;  1HF8 A;  4QX8 B;  1ZKE A;  2V7I A;  5JRC A;  2CE7 A;  4FJO A;  2WMN A;  2BVM A;  3IBP A;  4MBQ A;  2LOP A;  5FXV A;  1HX8 A;  3PUR A;  2VKD A;  4EB6 E;  4UF0 B;  3I9W A;  2DHR A;  4CI3 B;  5L3F B;  4CQI A;  3O1I A;  3QK6 A;  2NW9 A;  4DMV A;  4E7Z A;  2I59 A;  4UVB B;  5C8Y E;  4IHJ E;  3N9N A;  5FY0 A;  4CXY A;  2BZB A;  3UFE A;  2UXX B;  5FY7 A;  2LOS A;  3U3I A;  1OWA A;  4TX5 A;  5EK4 A;  4BJN A;  2NW7 A;  1D0X A;  5EZY E;  4X20 E;  4H63 H;  1MNE A;  4FI5 A;  1EZ3 A;  4PNI A;  3J9X 1;  3WI3 A;  1QUU A;  2CLY C;  3HA4 A;  4GIW A;  5F3J A;  5JDN A;  3OYZ A;  3JC6 C;  1BR0 A;  4EAH A;  4AKG A;  3HKD E;  4MAL A;  2K24 A;  3AVS A;  2WM9 A;  3ZC0 A;  3MXZ A;  2LJL A;  3F31 A;  2EHO B;  5HXS A;  3PU8 A;  2W61 A;  3FB2 A;  4O4H E;  3MZK B;  4OFZ A;  2A72 A;  5HYA A;  1WYB A;  2G0U A;  3AA7 B;  1MMN A;  4TV9 E;  5LJN A;  2DWK A;  2E9X A;  1HCI A;  3RPU A;  5HXE A;  2X68 A;  3GN5 B;  4IGU A;  5CA1 E;  4CI2 B;  4KMC A;  5AFU L;  1LVK A;  1MMD A;  4DO0 A;  4PW8 A;  2HPL A;  2XHE B;  3UTK A;  1FMW A;  2LSI A;  3I9Y A;  1YKH B;  2K5B B;  2A3D A;  1HG2 A;  4A56 A;  3HKB E;  4YFS A;  2WBL A;  3F57 A;  3KV5 A;  4XZC A;  4CZZ B;  1LKX A;  3E08 A;  2V7K A;  4AKR B;  3CQX C;  3RYF E;  3M65 A;  3OYX A;  2DI4 A;  2WMO A;  3CWZ B;  5LCY A;  4AKL A;  1MIW A;  4PFP A;  4UVC B;  2NTX A;  2XTL A;  3ZC1 A;  2CXL A;  3C50 A;  4UV8 B;  4O4J E;  3E0Z A;  3I0O A;  4GYS A;  4ZS2 A;  3CQG B;  5F8P A;  3SWH A;  4IDZ A;  4K0U A;  3ETU A;  4HEA A;  1SA0 E;  2UXN B;  4YJ2 E;  3HKC E;  2XAH B;  3NRY A;  4QXH B;  2ACX A;  1QSD A;  3LFM A;  4AQF C;  4QWN B;  3UUX B;  3CVR A;  2CWO A;  4M1P A;  4ZOL E;  5LBM A;  1T98 A;  5LA6 E;  1Z0P A;  2X51 A;  4HTE A;  3LBX B;  2K9A A;  2LSY A;  3KV9 A;  5FY1 A;  4P0A A;  4I55 E;  4KP3 C;  3ANW B;  4H9O C;  4OYJ A;  2X67 A;  5DQV A;  2D0T A;  4UIG A;  4UXN B;  3ZYK A;  3K3N A;  2Q9Q B;  4O2B E;  4PK6 A;  2ZM8 A;  2CWY A;  1ZHC A;  5L3B B;  4JUY A;  3DP7 A;  2KT9 A;  3ZLI A;  5FXZ A;  3UUM A;  4UV9 B;  1HG5 A;  1UX4 A;  2C5J A;  2VK9 A;  5CB4 E;  2MBG A;  4JEU B;  3TKL B;  3OJA A;  2C5I T;  3PTR B;  3IEE A;  2H3R A;  4JEH B;  2LE8 A;  1IAP A;  3LK2 B;  5JR9 B;  2LHN A;  4KBM B;  4UEM A;  3CX6 B;  3DJB A;  5E0O A;  2BVL A;  4GK0 E;  3W15 B;  3C51 A;  1FIO A;  4ZI3 D;  3LK4 2;  2YU2 A;  4PJN A;  2H7O A;  3O9X A;  2JRK A;  1G73 A;  3SRZ A;  2KIN B;  5LP6 E;  1KK7 A;  3ESL A;  2Q9Q D;  1BR2 A;  3HI2 A;  3FBZ A;  2LT3 A;  2QGS A;  2PFV A;  5FXW A;  4ZI2 D;  4EYY R;  3EUH A;  5M4Y A;  1OXZ A;  4E7S A;  4MLK A;  4ZS3 A;  3ZJ1 A;  2W62 A;  4L9I A;  2W00 A;  3MA9 A;  4UVA B;  3ZYL A;  2EHO C;  2JMH A;  3O1J A;  5LHI B;  2V26 A;  4O8S A;  4PJM A;  3ZMS B;  3KDS E;  4O2A E;  5CA0 E;  2C5K T;  2VKJ A;  2HPJ A;  4X1I E;  5KMG P;  2X0L B;  2E8I A;  3FBL A;  4YLH A;  1IJ5 A;  2QA7 A;  3KVB A;  2LHR A;  2V7L A;  4Z8X A;  5L2L A;  5JRC B;  3KV4 A;  3LK3 B;  3ZN0 B;  4MFR A;  3C4X A;  2X9H A;  4TN7 B;  3ZPO A;  3FXD B;  1MMG A;  4BA9 A;  5FYM A;  2Y6X A;  3KBT A;  2JJ9 A;  2P9B A;  2XAQ B;  3Q2M A;  4BAY B;  4H9N C;  2KWI B;  2RA1 A;  2WAU A;  2YK0 A;  2JMK A;  1MIY A;  2N9D A;  3C64 A;  3EDV A;  3R6N A;  2L8K A;  4IST A;  5H6R B;  2NP9 A;  2C0S A;  2IC6 A;  3KV6 A;  5LXT E;  4PK5 A;  4C91 A;  3R84 B;  2L9Q A;  2LM9 A;  4C90 A;  2CMR A;  2L3L A;  4XAX B;  4ADZ A;  1S94 A;  3C98 B;  3HR0 A;  5LGU B;  4EXT A;  4QX7 B;  3N2G E;  2IAK A;  1V9D A;  3IHR A;  4HFV A;  4TZ4 C;  3OBV E;  3ZEF B;  2V7J A;  2GK9 A;  3VKH A;  2ZM2 A;  4GK5 E;  4OHF A;  3NZP A;  5J1G A;  3KIN B;  2Q9Q C;  3K3Q C;  3CML A;  3PE0 A;  4GYR A;  2HH7 A;  4EIW A;  3BQI A;  3LG7 A;  4ZI2 C;  1KNZ A;  2Y8D A;  2E9X B;  4G2A A;  3MJX A;  4X1K E;  5LG4 A;  1WYC A;  4IE4 A;  5J2U E;  3EDU A;  3N9P A;  3RH3 A;  2NW8 A;  4H63 V;  3VU7 H;  2D0U A;  4O4I E;  2IW5 B;  5BMV E;  5JR9 C;  1U5P A;  3AAA B;  4AI6 A;  2OA5 A;  5JRE A;  4WNK A;  3C4W A;  2DNX A;  5LHH B;  2V7M A;  4JLE A;  4EZH A;  3PUQ A;  2W63 A;  4IIJ E;  3N5L A;  1ZV4 X;  5HAX A;  4IE0 A;  4IE7 A;  2LSJ A;  4IE6 A;  4H9R C;  5EK2 A;  3NBX X;  2VAS A;  5LOV E;  3V5U A;  3KBU A;  2N2N A;  2ZLY A;  2RP4 A;  5J2T E;  5HWX A;  3N9M A;  5FP3 A;  5IHY A;  2SPC A;  2Z6E A;  4CXW A;  4DBR A;  4WBN E;  2E9X D;  3ZJ2 A;  4U72 A;  3UUN A;  3WAJ A;  4AKH A;  2ODU A;  3N9L A;  5LGT B;  2X9X A;  4DMW A;  4B6X A;  4AQF A;  3UT5 E;  5JDH A;  4GOU A;  4HN9 A;  4ANJ A;  2WSS V;  2W0G A;  5L3D B;  3ZN1 B;  4QHO A;  4HKA A;  3CPZ A;  5LNK A;  4I4T E;  4O4L E;  3Q5X A;  4BJM A;  5LHG B;  3RC3 A;  2MOZ A;  2CCQ A;  3KFW X;  2D2S A;  5GON E;  3UUL A;  4TV8 E;  4XBF B;  2X9Y A;  3O1H A;  4H9S E;  5FMN A;  4QXC B;  5ADX L;  5TAO A;  4OK0 A;  1D0Z A;  1YD8 G;  2DCF A;  4N78 D;  3FXE B;  2NWB A;  3S4U A;  2X66 A;  5EK3 A;  3K3O A;  2CXD A;  2CA5 A;  5HXH A;  4UF0 A;  3PUA A;  1S35 A;  2CEA A;  3IF8 B;  3PDY A;  1NWM X;  4PFO A;  4YHJ A;  3DTO A;  1BR4 A;  2LSK A;  1UX5 A;  2VB6 A;  4X1Y E;  2BDE A;  2NOX A;  3AA0 B;  5JDF A;  1NAF A;  1SHZ C;  2H7V C;  2VWA A;  5DQW A;  3AAI A;  3NRX A;  3QUJ A;  2XAF B;  5H6Q B;  2CXF A;  2K48 A;  3AA1 B;  4ISS A;  2PG8 A;  4OYK A;  3C4Z A;  2XUE A;  3AVR A;  2KLQ A;  4L0R A;  3SOL A;  2A2F X;  3CQC B;  5DAB A;  2XAG B;  2VL8 A;  3V5S A;  5JDG A;  2WWU A;  4ERR A;  5L3E B;  3Q5W A;  1BR1 A;  2ES0 A;  2VKO A;  5FNV E;  4DVD A;  4UEL A;  3A5X A;  2ODV A;  3ZMZ B;  1E1H B;  2Y48 B;  3HKE E;  4DBQ A;  2MYS A;  1D1C A;  2LEH A;  5FXX A;  2EHO A;  5HWY A;  3RC8 A;  3N2K E;  3I0Q A;  4WW0 A;  1VRB A;  3PUS A;  3NZQ A;  3EVY A;  3PU3 A;  1UCU A;  5JVD E;  2E9X C;  5HXC A;  3ETV A;  4PJJ A;  3GMI A;  3GN5 A;  4PJL A;  3CX8 B;  3N9Q A;  4NUV A;  3WAK A;  3U78 A;  5LYJ E;  4CXX A;  1B7T A;  2YIN A;  3N2O A;  3BK9 A;  1YKE B;  1D0Y A;  3D0T A;  2CM0 A;  2KND A;  3PUG A;  3O4X E;  5A1L A;  1FMV A;  1G8X A;  5IYZ E;  3AB3 B;  3RYI E;  4CI1 B;  4ZI3 C;  3J7Y q;  4MHC A;  5LJM A;  4I50 E;  3BQK A;  3VHL A;  4ZI7 E;  1HS7 A;  3AAE B;  3KVA A;  1IJ6 A;  2JQQ A;  3GA8 A;  1D1A A;  5LGN B;  1WRD A;  3ZMT B;  4G63 A;  2NTY A;  2DLR A;  4H9Q C;  1H7C A;  5JDQ A;  3GWH A;  3E22 E;  1HFA A;  2X9W A;  4ASK A;  1US7 B;  4QKN A;  5JQG E;  3F2E A;  2CLY B;  3L09 A;  1O3X A;  3RKO A;  1Y64 B;  3RRC A;  1LRZ A;  3H37 A;  5KX5 E;  3QC9 A;  3HL6 A;  3LBX A;  2ZM0 A;  3L3P A;  3CKD A;  4P0B A;  2XQY A;  3MAC A;  2LSG A;  2KXP B;  3ANW A;  3Q9D A;  4ZHQ E;  2D5U A;  2EHO D;  4EZ4 A;  4IE5 A;  3RRW A;  4L5G A;  2Q9Q A;  3AA6 B;  5DJQ C;  5JDM A;  4P09 A;  4AQG A;  4AXP A;  3P7I A;  3H3A A;  2JPF A;  3RYH E;  2B1E A;  1MND A;  3P8C D;  4ILU A;  1WLX A;  4NUU A;  3ZMU B;  2VKH A;  3OKQ A;  5HXR A;  3ZYM A;  4YJ3 E;  1AJ3 A;  4U74 A;  1VOM A;  4KUM B;  1D1B A;  5KDM C;  1HTJ F;  4WBO A;  5JDL A;  1IZN B;  1LVF A;  3JC6 D;  3ONX A;  5JR9 A;  1YW0 A;  3MK7 C;  2PBI A;  2XAJ B;  3ZMV B;  4AKI A;  4EOZ B;  2N1G A;  3I1A A;  3CX7 B;  2V1D B;  3SS1 A;  2YEV C;  4HGA A;  5LBQ B;  5L3G B;  1WR6 A;  2KWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...