2CWYA

Crystal structure of conserved hypothetical protein, ttha0068 from thermus thermophilus hb8
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
94
structure length
94
Chain Sequence
MVPDWEEVLGLWRAGRYYEVHEVLEPYWLKATGEERRLLQGVILLAAALHQRRLGRPGLRNLRKAEARLEGLPCPLMGLDWRSLLQEARRRLGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein TTHA0068
publication title Crystal structure of conserved hypothetical protein, TTHA0068 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
total genus 33
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2005-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03745 DUF309 Domain of unknown function (DUF309)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.500 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2cwyA00
2CXDA 2CWYA
chains in the Genus database with same CATH superfamily
1G73A 2J4GA 4Z91A 2D9DA 3UU6A 5H6QB 3O4XE 3ONLC 2VQET 3P4SA 5DABA 2E9XA 3RIAA 5AQVB 3Q5EA 4QHOA 3OYZA 2VK9A 2LSIA 4IT4A 1HNWT 2UUAT 1UGOA 4EV6A 3ZPOA 3L8RA 3AVSA 4X65T 4AI6A 3T8OA 1HG2A 4ZZBA 2A72A 3UU3A 3ZMUB 3RGLA 3OVUA 3AE2A 3M3ZB 3WI3A 4EAHA 3SOLA 5FY7A 3P4PA 3R84B 3MACA 4B3TT 4JI5T 3F31A 2UXNB 5ETWA 4YFSA 2WBLA 3CQCB 4UEMA 2D0TA 5FNVE 4NPPA 2YDQA 4DUZT 1FEWA 4ZHQE 4K0UA 1HTJF 4CQIA 3EHZA 3L39A 4CN1A 5LJNA 5HEHA 4LFBT 5FL1A 3PV0F 1ZV4X 1Y64B 2ZM2A 2WSSV 2NWBA 3NKZA 4COFA 2MPKA 3PJAA 3AVRA 4IDOA 4GIWA 3ZN1B 4IE5A 1VCSA 3AEAA 4ILBA 3PE0A 3H3MA 3RYIE 3MJXA 5LJMA 4HWHA 4JI7T 4ZEYA 3E0ZA 1T98A 4F6RC 1YQ3A 2WDRA 3M65A 2LLYA 4DV4T 3P8CD 2RPAA 2XASB 2LHNA 4EYYR 3PU3A 3GN5B 1J5ET 1FJGT 4CZZB 3AE9A 1E1HB 4JV5T 2ODVA 1SHZC 4YY3T 3ONJA 3N2GE 3JADA 2IAKA 4I43B 4OYJA 5LA6E 4BJNA 2LEHA 2UUBT 2B76A 1US7B 4ISSA 5AQFB 3GN5A 1GQEA 3N2OA 5GONE 4DNDA 2K9AA 3I1AA 3MKDA 4DR2T 5LGNB 2LM9A 3UUMA 3ZT5A 3FB2A 3C98B 1T8BA 2WQYA 1X9BA 2FJAA 3VR9A 4AKHA 5AQHB 1QLBA 1N34T 1D1CA 2CE7A 4DV7T 2YDSA 2J47A 2IMLA 4L9IA 4X64T 3ESLA 4I4TE 2V26A 2PJQA 3SRZA 4LMLA 4MBQA 3LBXB 2JMKA 2Q9QC 4DV6T 3ZKRA 4LF6T 1V9DA 5F5WA 4XZCA 3U78A 3KFWX 5AQPB 4UV8B 4I50E 4WBNE 3UUBA 2NOXA 2X0HA 4LF8T 3CVRA 3LBXA 2BDEA 1FIOA 4BA9A 3LSVA 2JQQA 3UU4A 2WY2A 3RH3A 2DWGA 4JI1T 5F8PA 2XUEA 1XDOA 3NBXX 4ZI2D 2X68A 4TV9E 5FY0A 4JI8T 2E9XD 3PUWF 1D1AA 3IEEA 1WYBA 5JRCB 3FZFB 2NTXA 4DV3T 4LF9T 4IDQA 4JI2T 4EB6E 5KX5E 4O2BE 2IDOB 4DR5T 2YEVC 2XQ7A 3FXEB 4NXNT 4H9QC 5JRCA 2FBWA 4GYSA 1W0BA 4EYUA 1CHUA 4U2YA 1YD8G 5HWYA 3LDQB 5J1GA 2LHRA 5TAOA 3AE3A 3HKCE 4CI2B 4X66T 3ZYLA 2WU2A 4GKKT 2CXFA 2XY8B 2V7IA 4HFHA 3UULA 3ZSTA 3JCFA 3V5SA 1LRZA 2J1DG 3ZC1A 3ZMTB 4KHPT 4ZI3C 4H9NC 2HHHT 2VKJA 4I0UA 4B3ST 2X67A 1YKHB 4OK0A 5LCYA 2W00A 4HGAA 2Y8DA 3C4XA 2YU1A 2VASA 4UF0B 3RPUA 2BZBA 3C4WA 2DI4A 4YSXA 2IUBA 4YTNA 3AEBA 1NAFA 5LMNT 4KI0F 5ABEA 2C5JA 3UTKA 4UF0A 5C2TA 4HFEA 5LYJE 4LFAT 3IBPA 1HF8A 2BKNA 3BQKA 1EZ3A 4IREA 5AQIB 3C51A 3HL6A 1SE7A 4QH4A 1UX5A 2H88A 3MXZA 1R8IA 4ISTA 2X66A 4TX5A 4PAGA 4IE4A 3BQLA 4A97A 4PFPA 4LF7T 4ZOLE 2SPCA 2K24A 5AQMB 3AA6B 5AQQB 1B7TA 1IJ6A 4U3CA 2MAWA 5CA1E 3Q2MA 4DO0A 2WWUA 2NW8A 1LVFA 2BS4A 4AKLA 2E8IA 2D5UA 5F3JA 2BG9C 5LOVE 1OEDC 2H89A 4EGWA 3BQIA 1WLXA 4KX6A 4HWDA 2OV9A 2WWVA 3OKQA 3PUXF 2NW7A 5JTGA 3VRBA 2M6IA 4UR9A 4WBOA 1SA0E 1LKXA 2V7JA 2KINB 4O4LE 3TLTA 2YDRA 4LF4T 3CQXC 5AQJB 3SFEA 1N36T 4KHZF 4NIQA 4J2CA 4EOZB 4YTPA 2KWIB 3K1SA 4JI6T 2JMHA 3HKDE 4FI5A 5KXJA 3EVYA 5JVDE 3ZSSA 3EDVA 3QOFA 3RKOA 5HXEA 3AA1B 3ETUA 5LB7B 2KXPB 5AQSB 5EK2A 2W62A 4FJOA 3T1HT 2JQKA 3UU5A 2VKHA 4H9SE 5L3DB 4P0AA 2XPKA 2C5KT 2JQ9A 2D0UA 5HXCA 4AXPA 2ZMAA 1KNPA 4IE6A 1HS7A 4IIJE 4IDNA 1WR6A 3CMLA 2KNDA 3EDUA 3AE7A 2LRLA 2M67A 1N32T 3ZLIA 4LF5T 4U7YA 1WYCA 1N33T 1S94A 5IYZE 1T7SA 4ILCA 3NVOA 3CQGB 4AKIA 1YW0A 2V5CA 4UIGA 2V5DA 2HPJA 3D0TA 2RA1A 2WDQA 4E7SA 4PK4A 3JC6D 5J0ZA 3MK7C 3AA7B 3UFGA 1MNDA 4IL9A 1OXZA 4GKJT 3VR8A 3L09A 4DMWA 2MTQA 1ZEEA 3NRYA 4KMCA 4M1PA 4AISA 3PDYA 2LSGA 1M7KA 3N9QA 4H9PC 1CUNA 3ZMZB 5HXSA 3AEDA 4MALA 3PUVF 5L3BB 2IW5B 4QH1A 4DR1T 5AFUL 3Q5WA 3PTRB 2J62A 5A1LA 2CBIA 4UELA 4YXDA 3NZPA 3FXDB 5L47A 4HWIB 2CCQA 4LMKA 1NEKA 4G2AA 3U3IA 4A5XA 3R6NA 2W2UA 1J5WA 1D1BA 3MZKB 4KBMB 3WAKA 2VVSA 4X1YE 4IDZA 2W61A 4ILUA 3KV6A 4DV2T 4EEDA 5JREA 2A2FX 2XSBA 2XAJB 3B5MA 5AQKB 3EI0A 1IJ5A 2X0YA 3AEEA 3N2KE 4YTMA 3UFEA 5JDHA 3FBZA 2LOSA 2KZ7B 5FVLA 2VKOA 1IBMT 2UXCT 2BKOA 2LKHA 4H9RC 2BG9B 3IF8B 4O4IE 2XQ3A 1UUSA 1OEDB 4AIUA 2LSJA 2EHOD 5HEOA 2PBIA 5CA0E 4PJMA 5AQNB 1U5PA 3PUYF 2CHOA 3I9WA 5L3FB 2BG9A 4YSZA 2V6XA 1W9RA 3AECA 2D2SA 3RQUA 1OEDA 4YSYA 4ANJA 4X62T 4UV9B 2X51A 4CI3B 4HFCA 1IBLT 2ODUA 3WAJA 2IC9A 1UCUA 3HKBE 5CB4E 5LHGB 1Z0PA 2W66A 3FZHB 5H6RB 2FUPA 3HI2A 3CX8B 1IAPA 1OWAA 4BAYB 2Q9QD 4IE7A 3T1YT 1DU2A 5KMGP 3N9OA 5EZYE 4JI3T 3GA8A 4HWFA 4DVDA 5JQGE 2WCAA 4H63H 4P09A 2XQAA 1W0AA 1Y01A 3AEFA 3K3NA 2E5VA 3CWZB 3UQ4A 4KUMB 3UUXB 1HG5A 3CX6B 2FJEA 3P4RA 3N5LA 1UURA 4H9OC 4EEBA 5FMNA 5FP3A 4ERRA 3X1DA 2VQFT 5FL0A 1HX8A 1WCRA 5HCMA 2DNXA 5AQLB 4P0BA 5FXXA 5JDGA 5HEUA 1WR0A 4KP3C 3RIFA 4DV0T 2OLTA 4YLHA 2H7OA 5FY1A 2UUCT 2X0LB 5IWAT 3C4ZA 4GK5E 4HN9A 3ABVA 2WU5A 4TNVA 2ACZA 1ZKEA 2QVAA 2XQYA 2MYSA 1BR2A 4X20E 2KSRA 2XM2A 3N9PA 3UQ7A 4U74A 3IA3A 3ZT7A 4Q25A 3ZMSB 2WDVA 4PW8A 1T72A 4CXWA 3O1IA 1XNRT 3ZMVB 5FKYA 2V8SV 4AKGA 1HFAA 2L3LA 3DJBA 1BR4A 1O3XA 4B3RT 5AQGB 3QNUA 2WZIA 2E5LT 4F8HA 2QYWA 1MIWA 4EZ4A 1ZOYA 4PFOA 4QXCB 1VOMA 2I59A 4ILAA 3KV9A 3TLSA 3B13A 2VVNA 4OHFA 4TWFA 3Q9DA 3AE5A 3UT5E 4HWCA 4O4JE 2I6HA 5L3GB 1KEYA 4PJNA 1KFYA 2HH7A 4NUVA 2FJDA 2WZHA 2X9XA 3Q5XA 5HCJA 2XAGB 1M62A 4OX9T 1KK7A 3HR0A 2MBGA 4HFBA 3ZT6A 3L3PA 3CK6A 2VWAA 3ZCIA 4EXTA 5JDLA 3AAIA 3N9MA 4ADZA 3AE4A 2XSAA 4CXXA 4ZI7E 3RC8A 3K8PC 5HAXA 5M4YA 4X1KE 3QUJA 4HE8A 1MIVA 3V5UA 1NENA 4IGUA 2P9BA 3RI5A 4Z8XA 1Z8UA 1I94T 3LFMA 5LG4A 4JBWF 5L3CB 3W15B 3ZN0B 4AQFC 4N78D 2LSKA 2Y6XA 4DR6T 1I6ZA 3CPZA 2DWKA 4ZXLA 1YQ4A 2VURA 2LT3A 3H37A 4QH5A 2N1GA 3HA4A 3J9X1 3A5XA 3Q5DA 1L0VA 3ZJ2A 3SFDA 5EK3A 3KVBA 3O1JA 5HEGA 4O8SA 2W63A 2VB6A 2YK0A 2BBHA 3CIRA 4IL4A 3GMIA 2IC6A 2CRBA 2LSYA 4XBFB 4HFIA 3ZCJA 5LGUB 3QK6A 1MNEA 2QRXA 5JDMA 3RYCE 2ES0A 4L5GA 5JDNA 2V1DB 5AQRB 1D0XA 2WP9A 3K3QC 4DBRA 2ACXA 4YJ2E 2LE8A 2W0GA 4OYKA 1X79A 3RLFF 3AE6A 3ZJ1A 1E7PA 5HXHA 2NTYA 4AQGA 2X9WA 5LGTB 4DMVA 4A56A 3J7Yq 4LMJA 2CM0A 5C3JA 4TZ4C 1D0ZA 2JIWA 4CN6A 1QSDA 1BR0A 5LHHB 4PNIA 2JPFA 2LOPA 3MA9A 2XTLA 5AQOB 2CWOA 4UVAB 3PU8A 2HN2A 2CXDA 4PJJA 3TKLB 3VKHA 2Y48B 1XDPA 3PUAA 5KDMC 1XZYA 2KMFA 3VKGA 2KWHA 5FYMA 5ABFB 2UXXB 4JI0T 3JC6C 1YKEB 3AE8A 5HYAA 3A7MA 3LK2B 2E2AA 2YINA 2UU9T 1FMVA 4U31A 2L8KA 1JNRA 3OYXA 2M6BA 2DHRA 2DLRA 4UVCB 3AA0B 3OPCA 5ABFA 2CXLA 4JYAT 4UVBB 1XMOT 3ZEFB 1VCTA 3TLWA 2NW9A 2NR4A 3S4UA 4JLEA 4G63A 3HKEE 3PUZF 2XQ4A 4AQYT 3EUHA 4MLKA 4TV8E 5JH7E 5L3EB 4YHJA 2V7KA 3FZKB 4E7ZA 4YJ3E 4LFCT 2WAUA 4QWNB 3H3AA 2BBJA 5CJ5A 3F57A 4HKAA 4B6XA 3QB5A 2YU2A 2PG8A 3RX6A 1MMGA 3C50A 4MHCA 2CLYC 3RRCA 4CI1B 2ZM6T 1MMAA 1FMWA 3JAEA 3G06A 4U72A 5FXZA 4TWHA 2C5IT 4QX7B 2N2NA 2XJ7A 3RIUA 2XQ6A 4ZS2A 2IIUA 1WRDA 1W09A 2OA5A 5LG3A 5ABHA 1AJ3A 5LBMA 2L9QA 4QXHB 1LVKA 2IHR1 2BVMA 3PURA 4C91A 1KNZA 3ANWB 4TN7B 1J1JA 2V6YB 2X9YA 4WZXA 2XQ8A 2ZM0A 3PJAJ 3B57A 2FJBA 1HNXT 2XQ9A 4TUYE 4U7IA 5L4EA 5JR9C 3ANWA 4DR3T 2ZLYA 1HX1B 2V6YA 4P1NA 3JAFA 1XWMA 3A8YC 5C8YE 5J2UE 3RHWA 1MMNA 3P4WA 5HXRA 5LBQB 2YOEA 2EHOC 3FBLA 4XAXB 5FVKA 2VL0A 2A3DA 2BS3A 4IHJE 5IHYA 5LNKA 1ZP0A 2RP4A 5L4HA 5BR8T 4AQFA 3F2EA 2XAQB 2X9HA 4NXMT 3C64A 5JDFA 4O2AE 3E22E 1QUUA 4CXYA 3NRXA 2W67A 2R6GF 2AXDS 2XQ5A 4JEUB 2WS3A 3RKGA 3FZLB 3PUSA 4K0KT 2CPTA 2A9UA 3AAEB 3E08A 4C90A 2VKDA 1MMDA 1UX4A 3O1HA 2JRKA 2KT9A 2JJ9A 4EIWA 2V7MA 5LXTE 3ETVA 3RC3A 4ZI2C 2UXBT 4DR7T 2BVLA 2H3RA 2E9XC 3VU7H 4QKNA 5CGMA 2CMRA 1HNZT 2CA5A 3QC9A 3I9YA 2WB5A 3P7IA 4TWDA 3K3OA 3PUGA 1HR0T 3P50A 2CWYA 4L0RA 5HEJA 1IZNB 1U4QA 4JUYA 3P4QA 1IBKT 2V7LA 2LRKA 2VL8A 4QX8B 4V1Av 3KVAA 3I0QA 5L2LA 1KF6A 3ZC0A 2G0UA 1UK5A 4BJMA 3OBVE 1XMQT 3KINB 1VRBA 3RRWA 4EZHA 1KNRA 5LMUT 3GWHA 2UXDT 3IHRA 3O9XA 4HFDA 2BKPA 2GK9A 3NZQA 3AE1A 3ZYKA 3NWIA 3OJAA 5EK4A 4PJLA 2HPLA 2WMNA 3AEGA 4ZI3D 4IDPA 4QXBB 5JDQA 3N9LA 2C0SA 2LJLA 4U33A 2XZEA 2XAFB 4DIDB 2DCFA 4WNKA 4X1IE 3RIUC 3SWHA 5FXWA 3KBUA 4PK5A 3DP7A 3KV4A 4X5TA 3VHLA 3LK3B 4ZS3A 3BK9A 2XAHB 2QA7A 4GK0E 3DTOA 3UU8A 4YHHT 4UXNB 2CHNA 4Z90A 3OTOT 3AXJB 2HN1A 2CLYB 5LHIB 1HCIA 3FHNA 2DL1A 5AQTB 4DV5T 1G8XA 3N9NA 2WM9A 4DR4T 5IUXA 2K5BB 4H63V 2XHEB 4PK6A 5HWXA 4HFVA 4GYRA 3AXJA 5J2TE 4I55E 3I0OA 2PFVA 1SUMB 3ONXA 4MFRA 4ZZCA 2LM2A 5LP6E 5FXVA 1D0YA 2I0MA 3RYHE 2YKSA 4JI4T 2MOZA 1H7CA 2K3WA 4HTEA 4AKRB 4YT0A 3UUNA 5DQVA 3TLUA 2Z6EA 5CFBA 4CN4A 4B3MT 1JNZA 3CKDA 3FZMB 4DBQA 3TLVA 5JR9B 2F4VT 3RF1A 4JEHB 4DV1T 3SS1A 2WMOA 4ASKA 2EHOB 4O4HE 3KDSE 1MIYA 2JQHA 3QB5K 4HEAA 5JR9A 2BG9E 4WW0A 3EAMA 2PTFA 1YXRA 2CBJA 3AB3B 3CX7B 1OEDE 3RQWA 2H7VC 4NUUA 2EHOA 4OFZA 1ZHCA 3RYFE 2YN6A 4WYVA 3KV5A 2XM1A 5DJQC 1XNQT 1E2AA 4GOUA 4A98A 2CEAA 5BMVE 5DQWA 1WFDA 3VRAA 1NWMX 2Q9QB 2QGSA 4U2ZA 3ZYMA 1BR1A 2AE9A 5E0OA 2BS2A 2K48A 2ZM8A 4IE0A 2B1EA 3AAAB 5ABGA 5ADXL 3LJCA 2N9DA 3LK42 3EABA 3KBTA 3PUQA 2W4XA 2KLQA 5AQUB 4DUYT 1S35A 2LKGA 2E9XB 2Q9QA 4TNWA 3LG7A 2NP9A
chains in the Genus database with same CATH topology
1G73A 1AJ3A 4PFPA 4ZOLE 2SPCA 1HX8A 5H6QB 2K24A 2DNXA 4P0BA 2L9QA 4QXHB 5FXXA 5LBMA 5JDGA 3AA6B 1LVKA 2BVMA 3O4XE 3PURA 4KP3C 4C91A 3ANWB 1B7TA 1IJ6A 4TN7B 1KNZA 5DABA 2E9XA 5CA1E 3Q2MA 4YLHA 2X9YA 4DO0A 2H7OA 2WWUA 5FP3A 2NW8A 5FY1A 2ZM0A 4QHOA 3OYZA 2VK9A 3B57A 1LVFA 4AKLA 2LSIA 2E8IA 2D5UA 2X0LB 4TUYE 3C4ZA 5F3JA 4GK5E 5JR9C 3ANWA 4HN9A 2ZLYA 5LOVE 3BQIA 3ZPOA 1WLXA 1ZKEA 2XQYA 5C8YE 2MYSA 3AVSA 5J2UE 1MMNA 4AI6A 5HXRA 5LBQB 1BR2A 3T8OA 4X20E 2EHOC 1HG2A 3FBLA 2A72A 3OKQA 2NW7A 3N9PA 3ZMUB 4XAXB 4U74A 2A3DA 3ZMSB 4PW8A 4WBOA 3WI3A 4EAHA 1SA0E 1LKXA 4IHJE 4CXWA 3O1IA 3SOLA 2V7JA 3ZMVB 5IHYA 5LNKA 2KINB 4O4LE 2RP4A 5FY7A 1HFAA 4AKGA 2L3LA 3R84B 3DJBA 3CQXC 1BR4A 1O3XA 3F2EA 4AQFA 2XAQB 3MACA 2X9HA 3C64A 5JDFA 4O2AE 3E22E 3F31A 2UXNB 1QUUA 5ETWA 4YFSA 4J2CA 2WBLA 4CXYA 3NRXA 4EOZB 3CQCB 2KWIB 1MIWA 4UEMA 4EZ4A 2JMHA 3HKDE 4PFOA 4QXCB 1VOMA 2D0TA 4JEUB 5FNVE 4FI5A 2I59A 1FEWA 4ZHQE 4K0UA 3PUSA 1HTJF 3KV9A 3EVYA 4CQIA 5JVDE 3AAEB 3E08A 3B13A 3EDVA 4C90A 2VKDA 5LJNA 1MMDA 1UX4A 3O1HA 4OHFA 3RKOA 3Q9DA 5HXEA 3UT5E 3AA1B 2JRKA 2KT9A 2JJ9A 1ZV4X 1Y64B 4EIWA 2ZM2A 2V7MA 2WSSV 4O4JE 5L3GB 5LXTE 3ETUA 3ETVA 4PJNA 3RC3A 4ZI2C 2HH7A 2NWBA 2KXPB 4NUVA 2BVLA 5EK2A 2H3RA 2E9XC 3VU7H 2W62A 2X9XA 4QKNA 3AVRA 2CMRA 3Q5XA 2CA5A 4FJOA 2XAGB 3QC9A 4GIWA 2VKHA 3I9YA 3ZN1B 4H9SE 3P7IA 4IE5A 3PE0A 5L3DB 3K3OA 4P0AA 1KK7A 3HR0A 2C5KT 3RYIE 3MJXA 5LJMA 2MBGA 3E0ZA 1T98A 3L3PA 3PUGA 4F6RC 2D0UA 3M65A 5HXCA 2VWAA 4AXPA 3P8CD 3ZCIA 2XASB 2ZMAA 4EXTA 5JDLA 4IE6A 1HS7A 2CWYA 2LHNA 3AAIA 3N9MA 4IIJE 3PU3A 4L0RA 3GN5B 4ADZA 4CXXA 4EYYR 4ZI7E 3RC8A 1WR6A 3CMLA 3K8PC 1IZNB 5HAXA 5M4YA 4X1KE 4CZZB 1E1HB 3QUJA 2ODVA 4HE8A 2KNDA 3EDUA 1SHZC 1U4QA 4JUYA 3N2GE 1MIVA 3V5UA 2IAKA 2M67A 4OYJA 4I43B 5LA6E 4BJNA 3ZLIA 4IGUA 2P9BA 2V7LA 2LEHA 1WYCA 2VL8A 4QX8B 4Z8XA 4V1Av 3KVAA 1S94A 3I0QA 1US7B 5IYZE 5L2LA 3LFMA 4ISSA 3CQGB 5LG4A 3ZC0A 4AKIA 3GN5A 5L3CB 3N2OA 5GONE 2G0UA 3W15B 1YW0A 3ZN0B 4DNDA 4AQFC 4BJMA 2K9AA 4UIGA 3OBVE 3I1AA 4N78D 3KINB 1VRBA 3RRWA 2LSKA 3MKDA 4EZHA 5LGNB 2Y6XA 2LM9A 2HPJA 3GWHA 3D0TA 3CPZA 2RA1A 2DWKA 3IHRA 3UUMA 3O9XA 3FB2A 3C98B 2LT3A 4E7SA 3H37A 4PK4A 2N1GA 3HA4A 3JC6D 3J9X1 4AKHA 3A5XA 2GK9A 3NZQA 3ZJ2A 3MK7C 3AA7B 3ZYKA 1D1CA 5EK3A 2CE7A 3KVBA 3O1JA 3OJAA 5EK4A 4O8SA 1MNDA 4PJLA 2W63A 2WMNA 2HPLA 1OXZA 2VB6A 4L9IA 4ZI3D 2YK0A 4QXBB 5JDQA 3L09A 3GMIA 2C0SA 3N9LA 3ESLA 4I4TE 2LJLA 4DMWA 2MTQA 1ZEEA 3NRYA 2V26A 2PJQA 2IC6A 2LSYA 4KMCA 3SRZA 4XBFB 3ZCJA 5LGUB 2XAFB 4M1PA 4MBQA 3LBXB 3PDYA 2JMKA 2Q9QC 3QK6A 2LSGA 1V9DA 1MNEA 2DCFA 4WNKA 4X1IE 4XZCA 3RYCE 2ES0A 3N9QA 3SWHA 3KFWX 1CUNA 4H9PC 5FXWA 3U78A 4L5GA 3KBUA 4PK5A 3DP7A 3ZMZB 5JDNA 4UV8B 2V1DB 4I50E 3KV4A 4WBNE 5HXSA 1D0XA 3LK3B 3VHLA 4DBRA 3K3QC 2ACXA 4MALA 5L3BB 4ZS3A 3BK9A 2XAHB 4YJ2E 2LE8A 2W0GA 4OYKA 2QA7A 4GK0E 2IW5B 2NOXA 5AFUL 1X79A 3CVRA 3Q5WA 3PTRB 3DTOA 3LBXA 2BDEA 4UXNB 3ZJ1A 1FIOA 4BA9A 5A1LA 2JQQA 4UELA 3RH3A 5HXHA 2CLYB 2DWGA 3NZPA 5F8PA 3FXDB 2XUEA 5LHIB 2NTYA 2CCQA 2X9WA 4AQGA 1HCIA 3FHNA 3NBXX 4ZI2D 5LGTB 4G2AA 4DMVA 4A56A 3J7Yq 2X68A 1G8XA 3N9NA 3U3IA 4TV9E 2WM9A 5FY0A 3R6NA 2E9XD 2K5BB 1D1AA 2CM0A 4H63V 2XHEB 3IEEA 1D1BA 4PK6A 4TZ4C 1D0ZA 5HWXA 4HFVA 3MZKB 4GYRA 1QSDA 4KBMB 5J2TE 4I55E 1WYBA 3I0OA 1BR0A 5JRCB 5LHHB 4PNIA 2JPFA 3WAKA 2LOPA 3MA9A 4ERRA 4X1YE 2PFVA 2XTLA 4IDZA 3ONXA 2W61A 2CWOA 4ILUA 4MFRA 4UVAB 3KV6A 2NTXA 3PU8A 5JREA 5LP6E 5FXVA 1D0YA 2CXDA 4PJJA 4EB6E 3TKLB 5KX5E 3RYHE 4O2BE 3VKHA 2A2FX 2MOZA 2Y48B 2YEVC 2XAJB 1H7CA 4HTEA 4AKRB 3FXEB 4H9QC 3PUAA 3UUNA 5JRCA 5DQVA 5KDMC 1IJ5A 2Z6EA 2KMFA 4GYSA 3VKGA 3N2KE 4EYUA 3UFEA 1YD8G 5JDHA 3FBZA 2KWHA 2LOSA 2KZ7B 5FYMA 5HWYA 2VKOA 5J1GA 2LHRA 2UXXB 3CKDA 4DBQA 5TAOA 3HKCE 4CI2B 3ZYLA 4H9RC 5JR9B 3JC6C 3IF8B 1YKEB 4O4IE 5HYAA 4JEHB 2CXFA 2V7IA 3UULA 3LK2B 2YINA 2LSJA 1FMVA 2EHOD 3SS1A 2L8KA 3V5SA 1LRZA 2PBIA 3OYXA 4PJMA 5CA0E 2DHRA 2DLRA 2WMOA 3AA0B 2EHOB 2J1DG 4UVCB 3ZC1A 4ASKA 4O4HE 1U5PA 3ZMTB 2CXLA 4ZI3C 4H9NC 2VKJA 3KDSE 1MIYA 4UVBB 4HEAA 3I9WA 3ZEFB 5L3FB 2NW9A 5JR9A 2X67A 3S4UA 1YKHB 4G63A 4JLEA 4OK0A 3HKEE 5LCYA 4WW0A 2D2SA 2W00A 3EUHA 4MLKA 3AB3B 4ANJA 4HGAA 3CX7B 2Y8DA 3C4XA 4TV8E 5JH7E 5L3EB 4UV9B 4YHJA 2X51A 2V7KA 2H7VC 2YU1A 4NUUA 4CI3B 4E7ZA 2ODUA 4YJ3E 2EHOA 2VASA 4UF0B 3RPUA 2WAUA 2BZBA 3C4WA 3WAJA 2IC9A 1UCUA 4OFZA 3HKBE 1ZHCA 5CB4E 3RYFE 2DI4A 5LHGB 4QWNB 1Z0PA 3KV5A 3H3AA 5DJQC 3F57A 5H6RB 4HKAA 4GOUA 3HI2A 3CX8B 1IAPA 1OWAA 4B6XA 4BAYB 2CEAA 2Q9QD 4IE7A 2YU2A 5KMGP 2PG8A 1NAFA 3N9OA 5DQWA 5EZYE 3GA8A 3RX6A 5BMVE 1NWMX 1MMGA 4DVDA 2Q9QB 2QGSA 3C50A 3ZYMA 4MHCA 5JQGE 2C5JA 2CLYC 1BR1A 3RRCA 3UTKA 4UF0A 4CI1B 4H63H 4P09A 5LYJE 1MMAA 3IBPA 1FMWA 5E0OA 2K48A 1HF8A 2ZM8A 3BQKA 4U72A 4IE0A 3K3NA 2B1EA 3AAAB 1EZ3A 5JDMA 5ADXL 3LJCA 2N9DA 3LK42 3CWZB 3C51A 3HL6A 5FXZA 4KUMB 3KBTA 3UUXB 3PUQA 1HG5A 2KLQA 1S35A 3CX6B 1UX5A 2C5IT 3MXZA 2E9XB 2Q9QA 4QX7B 4ISTA 2N2NA 2X66A 3N5LA 4ZS2A 4H9OC 3LG7A 1WRDA 4TX5A 4PAGA 5FMNA 4IE4A 2OA5A 3BQLA 2NP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CXD A;  2CWY A; 
#chains in the Genus database with same CATH topology
 1G73 A;  2J4G A;  4Z91 A;  2D9D A;  3UU6 A;  5H6Q B;  3O4X E;  3ONL C;  2VQE T;  3P4S A;  5DAB A;  2E9X A;  3RIA A;  5AQV B;  3Q5E A;  4QHO A;  3OYZ A;  2VK9 A;  2LSI A;  4IT4 A;  1HNW T;  2UUA T;  1UGO A;  4EV6 A;  3ZPO A;  3L8R A;  3AVS A;  4X65 T;  4AI6 A;  3T8O A;  1HG2 A;  4ZZB A;  2A72 A;  3UU3 A;  3ZMU B;  3RGL A;  3OVU A;  3AE2 A;  3M3Z B;  3WI3 A;  4EAH A;  3SOL A;  5FY7 A;  3P4P A;  3R84 B;  3MAC A;  4B3T T;  4JI5 T;  3F31 A;  2UXN B;  5ETW A;  4YFS A;  2WBL A;  3CQC B;  4UEM A;  2D0T A;  5FNV E;  4NPP A;  2YDQ A;  4DUZ T;  1FEW A;  4ZHQ E;  4K0U A;  1HTJ F;  4CQI A;  3EHZ A;  3L39 A;  4CN1 A;  5LJN A;  5HEH A;  4LFB T;  5FL1 A;  3PV0 F;  1ZV4 X;  1Y64 B;  2ZM2 A;  2WSS V;  2NWB A;  3NKZ A;  4COF A;  2MPK A;  3PJA A;  3AVR A;  4IDO A;  4GIW A;  3ZN1 B;  4IE5 A;  1VCS A;  3AEA A;  4ILB A;  3PE0 A;  3H3M A;  3RYI E;  3MJX A;  5LJM A;  4HWH A;  4JI7 T;  4ZEY A;  3E0Z A;  1T98 A;  4F6R C;  1YQ3 A;  2WDR A;  3M65 A;  2LLY A;  4DV4 T;  3P8C D;  2RPA A;  2XAS B;  2LHN A;  4EYY R;  3PU3 A;  3GN5 B;  1J5E T;  1FJG T;  4CZZ B;  3AE9 A;  1E1H B;  4JV5 T;  2ODV A;  1SHZ C;  4YY3 T;  3ONJ A;  3N2G E;  3JAD A;  2IAK A;  4I43 B;  4OYJ A;  5LA6 E;  4BJN A;  2LEH A;  2UUB T;  2B76 A;  1US7 B;  4ISS A;  5AQF B;  3GN5 A;  1GQE A;  3N2O A;  5GON E;  4DND A;  2K9A A;  3I1A A;  3MKD A;  4DR2 T;  5LGN B;  2LM9 A;  3UUM A;  3ZT5 A;  3FB2 A;  3C98 B;  1T8B A;  2WQY A;  1X9B A;  2FJA A;  3VR9 A;  4AKH A;  5AQH B;  1QLB A;  1N34 T;  1D1C A;  2CE7 A;  4DV7 T;  2YDS A;  2J47 A;  2IML A;  4L9I A;  4X64 T;  3ESL A;  4I4T E;  2V26 A;  2PJQ A;  3SRZ A;  4LML A;  4MBQ A;  3LBX B;  2JMK A;  2Q9Q C;  4DV6 T;  3ZKR A;  4LF6 T;  1V9D A;  5F5W A;  4XZC A;  3U78 A;  3KFW X;  5AQP B;  4UV8 B;  4I50 E;  4WBN E;  3UUB A;  2NOX A;  2X0H A;  4LF8 T;  3CVR A;  3LBX A;  2BDE A;  1FIO A;  4BA9 A;  3LSV A;  2JQQ A;  3UU4 A;  2WY2 A;  3RH3 A;  2DWG A;  4JI1 T;  5F8P A;  2XUE A;  1XDO A;  3NBX X;  4ZI2 D;  2X68 A;  4TV9 E;  5FY0 A;  4JI8 T;  2E9X D;  3PUW F;  1D1A A;  3IEE A;  1WYB A;  5JRC B;  3FZF B;  2NTX A;  4DV3 T;  4LF9 T;  4IDQ A;  4JI2 T;  4EB6 E;  5KX5 E;  4O2B E;  2IDO B;  4DR5 T;  2YEV C;  2XQ7 A;  3FXE B;  4NXN T;  4H9Q C;  5JRC A;  2FBW A;  4GYS A;  1W0B A;  4EYU A;  1CHU A;  4U2Y A;  1YD8 G;  5HWY A;  3LDQ B;  5J1G A;  2LHR A;  5TAO A;  3AE3 A;  3HKC E;  4CI2 B;  4X66 T;  3ZYL A;  2WU2 A;  4GKK T;  2CXF A;  2XY8 B;  2V7I A;  4HFH A;  3UUL A;  3ZST A;  3JCF A;  3V5S A;  1LRZ A;  2J1D G;  3ZC1 A;  3ZMT B;  4KHP T;  4ZI3 C;  4H9N C;  2HHH T;  2VKJ A;  4I0U A;  4B3S T;  2X67 A;  1YKH B;  4OK0 A;  5LCY A;  2W00 A;  4HGA A;  2Y8D A;  3C4X A;  2YU1 A;  2VAS A;  4UF0 B;  3RPU A;  2BZB A;  3C4W A;  2DI4 A;  4YSX A;  2IUB A;  4YTN A;  3AEB A;  1NAF A;  5LMN T;  4KI0 F;  5ABE A;  2C5J A;  3UTK A;  4UF0 A;  5C2T A;  4HFE A;  5LYJ E;  4LFA T;  3IBP A;  1HF8 A;  2BKN A;  3BQK A;  1EZ3 A;  4IRE A;  5AQI B;  3C51 A;  3HL6 A;  1SE7 A;  4QH4 A;  1UX5 A;  2H88 A;  3MXZ A;  1R8I A;  4IST A;  2X66 A;  4TX5 A;  4PAG A;  4IE4 A;  3BQL A;  4A97 A;  4PFP A;  4LF7 T;  4ZOL E;  2SPC A;  2K24 A;  5AQM B;  3AA6 B;  5AQQ B;  1B7T A;  1IJ6 A;  4U3C A;  2MAW A;  5CA1 E;  3Q2M A;  4DO0 A;  2WWU A;  2NW8 A;  1LVF A;  2BS4 A;  4AKL A;  2E8I A;  2D5U A;  5F3J A;  2BG9 C;  5LOV E;  1OED C;  2H89 A;  4EGW A;  3BQI A;  1WLX A;  4KX6 A;  4HWD A;  2OV9 A;  2WWV A;  3OKQ A;  3PUX F;  2NW7 A;  5JTG A;  3VRB A;  2M6I A;  4UR9 A;  4WBO A;  1SA0 E;  1LKX A;  2V7J A;  2KIN B;  4O4L E;  3TLT A;  2YDR A;  4LF4 T;  3CQX C;  5AQJ B;  3SFE A;  1N36 T;  4KHZ F;  4NIQ A;  4J2C A;  4EOZ B;  4YTP A;  2KWI B;  3K1S A;  4JI6 T;  2JMH A;  3HKD E;  4FI5 A;  5KXJ A;  3EVY A;  5JVD E;  3ZSS A;  3EDV A;  3QOF A;  3RKO A;  5HXE A;  3AA1 B;  3ETU A;  5LB7 B;  2KXP B;  5AQS B;  5EK2 A;  2W62 A;  4FJO A;  3T1H T;  2JQK A;  3UU5 A;  2VKH A;  4H9S E;  5L3D B;  4P0A A;  2XPK A;  2C5K T;  2JQ9 A;  2D0U A;  5HXC A;  4AXP A;  2ZMA A;  1KNP A;  4IE6 A;  1HS7 A;  4IIJ E;  4IDN A;  1WR6 A;  3CML A;  2KND A;  3EDU A;  3AE7 A;  2LRL A;  2M67 A;  1N32 T;  3ZLI A;  4LF5 T;  4U7Y A;  1WYC A;  1N33 T;  1S94 A;  5IYZ E;  1T7S A;  4ILC A;  3NVO A;  3CQG B;  4AKI A;  1YW0 A;  2V5C A;  4UIG A;  2V5D A;  2HPJ A;  3D0T A;  2RA1 A;  2WDQ A;  4E7S A;  4PK4 A;  3JC6 D;  5J0Z A;  3MK7 C;  3AA7 B;  3UFG A;  1MND A;  4IL9 A;  1OXZ A;  4GKJ T;  3VR8 A;  3L09 A;  4DMW A;  2MTQ A;  1ZEE A;  3NRY A;  4KMC A;  4M1P A;  4AIS A;  3PDY A;  2LSG A;  1M7K A;  3N9Q A;  4H9P C;  1CUN A;  3ZMZ B;  5HXS A;  3AED A;  4MAL A;  3PUV F;  5L3B B;  2IW5 B;  4QH1 A;  4DR1 T;  5AFU L;  3Q5W A;  3PTR B;  2J62 A;  5A1L A;  2CBI A;  4UEL A;  4YXD A;  3NZP A;  3FXD B;  5L47 A;  4HWI B;  2CCQ A;  4LMK A;  1NEK A;  4G2A A;  3U3I A;  4A5X A;  3R6N A;  2W2U A;  1J5W A;  1D1B A;  3MZK B;  4KBM B;  3WAK A;  2VVS A;  4X1Y E;  4IDZ A;  2W61 A;  4ILU A;  3KV6 A;  4DV2 T;  4EED A;  5JRE A;  2A2F X;  2XSB A;  2XAJ B;  3B5M A;  5AQK B;  3EI0 A;  1IJ5 A;  2X0Y A;  3AEE A;  3N2K E;  4YTM A;  3UFE A;  5JDH A;  3FBZ A;  2LOS A;  2KZ7 B;  5FVL A;  2VKO A;  1IBM T;  2UXC T;  2BKO A;  2LKH A;  4H9R C;  2BG9 B;  3IF8 B;  4O4I E;  2XQ3 A;  1UUS A;  1OED B;  4AIU A;  2LSJ A;  2EHO D;  5HEO A;  2PBI A;  5CA0 E;  4PJM A;  5AQN B;  1U5P A;  3PUY F;  2CHO A;  3I9W A;  5L3F B;  2BG9 A;  4YSZ A;  2V6X A;  1W9R A;  3AEC A;  2D2S A;  3RQU A;  1OED A;  4YSY A;  4ANJ A;  4X62 T;  4UV9 B;  2X51 A;  4CI3 B;  4HFC A;  1IBL T;  2ODU A;  3WAJ A;  2IC9 A;  1UCU A;  3HKB E;  5CB4 E;  5LHG B;  1Z0P A;  2W66 A;  3FZH B;  5H6R B;  2FUP A;  3HI2 A;  3CX8 B;  1IAP A;  1OWA A;  4BAY B;  2Q9Q D;  4IE7 A;  3T1Y T;  1DU2 A;  5KMG P;  3N9O A;  5EZY E;  4JI3 T;  3GA8 A;  4HWF A;  4DVD A;  5JQG E;  2WCA A;  4H63 H;  4P09 A;  2XQA A;  1W0A A;  1Y01 A;  3AEF A;  3K3N A;  2E5V A;  3CWZ B;  3UQ4 A;  4KUM B;  3UUX B;  1HG5 A;  3CX6 B;  2FJE A;  3P4R A;  3N5L A;  1UUR A;  4H9O C;  4EEB A;  5FMN A;  5FP3 A;  4ERR A;  3X1D A;  2VQF T;  5FL0 A;  1HX8 A;  1WCR A;  5HCM A;  2DNX A;  5AQL B;  4P0B A;  5FXX A;  5JDG A;  5HEU A;  1WR0 A;  4KP3 C;  3RIF A;  4DV0 T;  2OLT A;  4YLH A;  2H7O A;  5FY1 A;  2UUC T;  2X0L B;  5IWA T;  3C4Z A;  4GK5 E;  4HN9 A;  3ABV A;  2WU5 A;  4TNV A;  2ACZ A;  1ZKE A;  2QVA A;  2XQY A;  2MYS A;  1BR2 A;  4X20 E;  2KSR A;  2XM2 A;  3N9P A;  3UQ7 A;  4U74 A;  3IA3 A;  3ZT7 A;  4Q25 A;  3ZMS B;  2WDV A;  4PW8 A;  1T72 A;  4CXW A;  3O1I A;  1XNR T;  3ZMV B;  5FKY A;  2V8S V;  4AKG A;  1HFA A;  2L3L A;  3DJB A;  1BR4 A;  1O3X A;  4B3R T;  5AQG B;  3QNU A;  2WZI A;  2E5L T;  4F8H A;  2QYW A;  1MIW A;  4EZ4 A;  1ZOY A;  4PFO A;  4QXC B;  1VOM A;  2I59 A;  4ILA A;  3KV9 A;  3TLS A;  3B13 A;  2VVN A;  4OHF A;  4TWF A;  3Q9D A;  3AE5 A;  3UT5 E;  4HWC A;  4O4J E;  2I6H A;  5L3G B;  1KEY A;  4PJN A;  1KFY A;  2HH7 A;  4NUV A;  2FJD A;  2WZH A;  2X9X A;  3Q5X A;  5HCJ A;  2XAG B;  1M62 A;  4OX9 T;  1KK7 A;  3HR0 A;  2MBG A;  4HFB A;  3ZT6 A;  3L3P A;  3CK6 A;  2VWA A;  3ZCI A;  4EXT A;  5JDL A;  3AAI A;  3N9M A;  4ADZ A;  3AE4 A;  2XSA A;  4CXX A;  4ZI7 E;  3RC8 A;  3K8P C;  5HAX A;  5M4Y A;  4X1K E;  3QUJ A;  4HE8 A;  1MIV A;  3V5U A;  1NEN A;  4IGU A;  2P9B A;  3RI5 A;  4Z8X A;  1Z8U A;  1I94 T;  3LFM A;  5LG4 A;  4JBW F;  5L3C B;  3W15 B;  3ZN0 B;  4AQF C;  4N78 D;  2LSK A;  2Y6X A;  4DR6 T;  1I6Z A;  3CPZ A;  2DWK A;  4ZXL A;  1YQ4 A;  2VUR A;  2LT3 A;  3H37 A;  4QH5 A;  2N1G A;  3HA4 A;  3J9X 1;  3A5X A;  3Q5D A;  1L0V A;  3ZJ2 A;  3SFD A;  5EK3 A;  3KVB A;  3O1J A;  5HEG A;  4O8S A;  2W63 A;  2VB6 A;  2YK0 A;  2BBH A;  3CIR A;  4IL4 A;  3GMI A;  2IC6 A;  2CRB A;  2LSY A;  4XBF B;  4HFI A;  3ZCJ A;  5LGU B;  3QK6 A;  1MNE A;  2QRX A;  5JDM A;  3RYC E;  2ES0 A;  4L5G A;  5JDN A;  2V1D B;  5AQR B;  1D0X A;  2WP9 A;  3K3Q C;  4DBR A;  2ACX A;  4YJ2 E;  2LE8 A;  2W0G A;  4OYK A;  1X79 A;  3RLF F;  3AE6 A;  3ZJ1 A;  1E7P A;  5HXH A;  2NTY A;  4AQG A;  2X9W A;  5LGT B;  4DMV A;  4A56 A;  3J7Y q;  4LMJ A;  2CM0 A;  5C3J A;  4TZ4 C;  1D0Z A;  2JIW A;  4CN6 A;  1QSD A;  1BR0 A;  5LHH B;  4PNI A;  2JPF A;  2LOP A;  3MA9 A;  2XTL A;  5AQO B;  2CWO A;  4UVA B;  3PU8 A;  2HN2 A;  2CXD A;  4PJJ A;  3TKL B;  3VKH A;  2Y48 B;  1XDP A;  3PUA A;  5KDM C;  1XZY A;  2KMF A;  3VKG A;  2KWH A;  5FYM A;  5ABF B;  2UXX B;  4JI0 T;  3JC6 C;  1YKE B;  3AE8 A;  5HYA A;  3A7M A;  3LK2 B;  2E2A A;  2YIN A;  2UU9 T;  1FMV A;  4U31 A;  2L8K A;  1JNR A;  3OYX A;  2M6B A;  2DHR A;  2DLR A;  4UVC B;  3AA0 B;  3OPC A;  5ABF A;  2CXL A;  4JYA T;  4UVB B;  1XMO T;  3ZEF B;  1VCT A;  3TLW A;  2NW9 A;  2NR4 A;  3S4U A;  4JLE A;  4G63 A;  3HKE E;  3PUZ F;  2XQ4 A;  4AQY T;  3EUH A;  4MLK A;  4TV8 E;  5JH7 E;  5L3E B;  4YHJ A;  2V7K A;  3FZK B;  4E7Z A;  4YJ3 E;  4LFC T;  2WAU A;  4QWN B;  3H3A A;  2BBJ A;  5CJ5 A;  3F57 A;  4HKA A;  4B6X A;  3QB5 A;  2YU2 A;  2PG8 A;  3RX6 A;  1MMG A;  3C50 A;  4MHC A;  2CLY C;  3RRC A;  4CI1 B;  2ZM6 T;  1MMA A;  1FMW A;  3JAE A;  3G06 A;  4U72 A;  5FXZ A;  4TWH A;  2C5I T;  4QX7 B;  2N2N A;  2XJ7 A;  3RIU A;  2XQ6 A;  4ZS2 A;  2IIU A;  1WRD A;  1W09 A;  2OA5 A;  5LG3 A;  5ABH A;  1AJ3 A;  5LBM A;  2L9Q A;  4QXH B;  1LVK A;  2IHR 1;  2BVM A;  3PUR A;  4C91 A;  1KNZ A;  3ANW B;  4TN7 B;  1J1J A;  2V6Y B;  2X9Y A;  4WZX A;  2XQ8 A;  2ZM0 A;  3PJA J;  3B57 A;  2FJB A;  1HNX T;  2XQ9 A;  4TUY E;  4U7I A;  5L4E A;  5JR9 C;  3ANW A;  4DR3 T;  2ZLY A;  1HX1 B;  2V6Y A;  4P1N A;  3JAF A;  1XWM A;  3A8Y C;  5C8Y E;  5J2U E;  3RHW A;  1MMN A;  3P4W A;  5HXR A;  5LBQ B;  2YOE A;  2EHO C;  3FBL A;  4XAX B;  5FVK A;  2VL0 A;  2A3D A;  2BS3 A;  4IHJ E;  5IHY A;  5LNK A;  1ZP0 A;  2RP4 A;  5L4H A;  5BR8 T;  4AQF A;  3F2E A;  2XAQ B;  2X9H A;  4NXM T;  3C64 A;  5JDF A;  4O2A E;  3E22 E;  1QUU A;  4CXY A;  3NRX A;  2W67 A;  2R6G F;  2AXD S;  2XQ5 A;  4JEU B;  2WS3 A;  3RKG A;  3FZL B;  3PUS A;  4K0K T;  2CPT A;  2A9U A;  3AAE B;  3E08 A;  4C90 A;  2VKD A;  1MMD A;  1UX4 A;  3O1H A;  2JRK A;  2KT9 A;  2JJ9 A;  4EIW A;  2V7M A;  5LXT E;  3ETV A;  3RC3 A;  4ZI2 C;  2UXB T;  4DR7 T;  2BVL A;  2H3R A;  2E9X C;  3VU7 H;  4QKN A;  5CGM A;  2CMR A;  1HNZ T;  2CA5 A;  3QC9 A;  3I9Y A;  2WB5 A;  3P7I A;  4TWD A;  3K3O A;  3PUG A;  1HR0 T;  3P50 A;  2CWY A;  4L0R A;  5HEJ A;  1IZN B;  1U4Q A;  4JUY A;  3P4Q A;  1IBK T;  2V7L A;  2LRK A;  2VL8 A;  4QX8 B;  4V1A v;  3KVA A;  3I0Q A;  5L2L A;  1KF6 A;  3ZC0 A;  2G0U A;  1UK5 A;  4BJM A;  3OBV E;  1XMQ T;  3KIN B;  1VRB A;  3RRW A;  4EZH A;  1KNR A;  5LMU T;  3GWH A;  2UXD T;  3IHR A;  3O9X A;  4HFD A;  2BKP A;  2GK9 A;  3NZQ A;  3AE1 A;  3ZYK A;  3NWI A;  3OJA A;  5EK4 A;  4PJL A;  2HPL A;  2WMN A;  3AEG A;  4ZI3 D;  4IDP A;  4QXB B;  5JDQ A;  3N9L A;  2C0S A;  2LJL A;  4U33 A;  2XZE A;  2XAF B;  4DID B;  2DCF A;  4WNK A;  4X1I E;  3RIU C;  3SWH A;  5FXW A;  3KBU A;  4PK5 A;  3DP7 A;  3KV4 A;  4X5T A;  3VHL A;  3LK3 B;  4ZS3 A;  3BK9 A;  2XAH B;  2QA7 A;  4GK0 E;  3DTO A;  3UU8 A;  4YHH T;  4UXN B;  2CHN A;  4Z90 A;  3OTO T;  3AXJ B;  2HN1 A;  2CLY B;  5LHI B;  1HCI A;  3FHN A;  2DL1 A;  5AQT B;  4DV5 T;  1G8X A;  3N9N A;  2WM9 A;  4DR4 T;  5IUX A;  2K5B B;  4H63 V;  2XHE B;  4PK6 A;  5HWX A;  4HFV A;  4GYR A;  3AXJ A;  5J2T E;  4I55 E;  3I0O A;  2PFV A;  1SUM B;  3ONX A;  4MFR A;  4ZZC A;  2LM2 A;  5LP6 E;  5FXV A;  1D0Y A;  2I0M A;  3RYH E;  2YKS A;  4JI4 T;  2MOZ A;  1H7C A;  2K3W A;  4HTE A;  4AKR B;  4YT0 A;  3UUN A;  5DQV A;  3TLU A;  2Z6E A;  5CFB A;  4CN4 A;  4B3M T;  1JNZ A;  3CKD A;  3FZM B;  4DBQ A;  3TLV A;  5JR9 B;  2F4V T;  3RF1 A;  4JEH B;  4DV1 T;  3SS1 A;  2WMO A;  4ASK A;  2EHO B;  4O4H E;  3KDS E;  1MIY A;  2JQH A;  3QB5 K;  4HEA A;  5JR9 A;  2BG9 E;  4WW0 A;  3EAM A;  2PTF A;  1YXR A;  2CBJ A;  3AB3 B;  3CX7 B;  1OED E;  3RQW A;  2H7V C;  4NUU A;  2EHO A;  4OFZ A;  1ZHC A;  3RYF E;  2YN6 A;  4WYV A;  3KV5 A;  2XM1 A;  5DJQ C;  1XNQ T;  1E2A A;  4GOU A;  4A98 A;  2CEA A;  5BMV E;  5DQW A;  1WFD A;  3VRA A;  1NWM X;  2Q9Q B;  2QGS A;  4U2Z A;  3ZYM A;  1BR1 A;  2AE9 A;  5E0O A;  2BS2 A;  2K48 A;  2ZM8 A;  4IE0 A;  2B1E A;  3AAA B;  5ABG A;  5ADX L;  3LJC A;  2N9D A;  3LK4 2;  3EAB A;  3KBT A;  3PUQ A;  2W4X A;  2KLQ A;  5AQU B;  4DUY T;  1S35 A;  2LKG A;  2E9X B;  2Q9Q A;  4TNW A;  3LG7 A;  2NP9 A; 
#chains in the Genus database with same CATH homology
 1G73 A;  1AJ3 A;  4PFP A;  4ZOL E;  2SPC A;  1HX8 A;  5H6Q B;  2K24 A;  2DNX A;  4P0B A;  2L9Q A;  4QXH B;  5FXX A;  5LBM A;  5JDG A;  3AA6 B;  1LVK A;  2BVM A;  3O4X E;  3PUR A;  4KP3 C;  4C91 A;  3ANW B;  1B7T A;  1IJ6 A;  4TN7 B;  1KNZ A;  5DAB A;  2E9X A;  5CA1 E;  3Q2M A;  4YLH A;  2X9Y A;  4DO0 A;  2H7O A;  2WWU A;  5FP3 A;  2NW8 A;  5FY1 A;  2ZM0 A;  4QHO A;  3OYZ A;  2VK9 A;  3B57 A;  1LVF A;  4AKL A;  2LSI A;  2E8I A;  2D5U A;  2X0L B;  4TUY E;  3C4Z A;  5F3J A;  4GK5 E;  5JR9 C;  3ANW A;  4HN9 A;  2ZLY A;  5LOV E;  3BQI A;  3ZPO A;  1WLX A;  1ZKE A;  2XQY A;  5C8Y E;  2MYS A;  3AVS A;  5J2U E;  1MMN A;  4AI6 A;  5HXR A;  5LBQ B;  1BR2 A;  3T8O A;  4X20 E;  2EHO C;  1HG2 A;  3FBL A;  2A72 A;  3OKQ A;  2NW7 A;  3N9P A;  3ZMU B;  4XAX B;  4U74 A;  2A3D A;  3ZMS B;  4PW8 A;  4WBO A;  3WI3 A;  4EAH A;  1SA0 E;  1LKX A;  4IHJ E;  4CXW A;  3O1I A;  3SOL A;  2V7J A;  3ZMV B;  5IHY A;  5LNK A;  2KIN B;  4O4L E;  2RP4 A;  5FY7 A;  1HFA A;  4AKG A;  2L3L A;  3R84 B;  3DJB A;  3CQX C;  1BR4 A;  1O3X A;  3F2E A;  4AQF A;  2XAQ B;  3MAC A;  2X9H A;  3C64 A;  5JDF A;  4O2A E;  3E22 E;  3F31 A;  2UXN B;  1QUU A;  5ETW A;  4YFS A;  4J2C A;  2WBL A;  4CXY A;  3NRX A;  4EOZ B;  3CQC B;  2KWI B;  1MIW A;  4UEM A;  4EZ4 A;  2JMH A;  3HKD E;  4PFO A;  4QXC B;  1VOM A;  2D0T A;  4JEU B;  5FNV E;  4FI5 A;  2I59 A;  1FEW A;  4ZHQ E;  4K0U A;  3PUS A;  1HTJ F;  3KV9 A;  3EVY A;  4CQI A;  5JVD E;  3AAE B;  3E08 A;  3B13 A;  3EDV A;  4C90 A;  2VKD A;  5LJN A;  1MMD A;  1UX4 A;  3O1H A;  4OHF A;  3RKO A;  3Q9D A;  5HXE A;  3UT5 E;  3AA1 B;  2JRK A;  2KT9 A;  2JJ9 A;  1ZV4 X;  1Y64 B;  4EIW A;  2ZM2 A;  2V7M A;  2WSS V;  4O4J E;  5L3G B;  5LXT E;  3ETU A;  3ETV A;  4PJN A;  3RC3 A;  4ZI2 C;  2HH7 A;  2NWB A;  2KXP B;  4NUV A;  2BVL A;  5EK2 A;  2H3R A;  2E9X C;  3VU7 H;  2W62 A;  2X9X A;  4QKN A;  3AVR A;  2CMR A;  3Q5X A;  2CA5 A;  4FJO A;  2XAG B;  3QC9 A;  4GIW A;  2VKH A;  3I9Y A;  3ZN1 B;  4H9S E;  3P7I A;  4IE5 A;  3PE0 A;  5L3D B;  3K3O A;  4P0A A;  1KK7 A;  3HR0 A;  2C5K T;  3RYI E;  3MJX A;  5LJM A;  2MBG A;  3E0Z A;  1T98 A;  3L3P A;  3PUG A;  4F6R C;  2D0U A;  3M65 A;  5HXC A;  2VWA A;  4AXP A;  3P8C D;  3ZCI A;  2XAS B;  2ZMA A;  4EXT A;  5JDL A;  4IE6 A;  1HS7 A;  2CWY A;  2LHN A;  3AAI A;  3N9M A;  4IIJ E;  3PU3 A;  4L0R A;  3GN5 B;  4ADZ A;  4CXX A;  4EYY R;  4ZI7 E;  3RC8 A;  1WR6 A;  3CML A;  3K8P C;  1IZN B;  5HAX A;  5M4Y A;  4X1K E;  4CZZ B;  1E1H B;  3QUJ A;  2ODV A;  4HE8 A;  2KND A;  3EDU A;  1SHZ C;  1U4Q A;  4JUY A;  3N2G E;  1MIV A;  3V5U A;  2IAK A;  2M67 A;  4OYJ A;  4I43 B;  5LA6 E;  4BJN A;  3ZLI A;  4IGU A;  2P9B A;  2V7L A;  2LEH A;  1WYC A;  2VL8 A;  4QX8 B;  4Z8X A;  4V1A v;  3KVA A;  1S94 A;  3I0Q A;  1US7 B;  5IYZ E;  5L2L A;  3LFM A;  4ISS A;  3CQG B;  5LG4 A;  3ZC0 A;  4AKI A;  3GN5 A;  5L3C B;  3N2O A;  5GON E;  2G0U A;  3W15 B;  1YW0 A;  3ZN0 B;  4DND A;  4AQF C;  4BJM A;  2K9A A;  4UIG A;  3OBV E;  3I1A A;  4N78 D;  3KIN B;  1VRB A;  3RRW A;  2LSK A;  3MKD A;  4EZH A;  5LGN B;  2Y6X A;  2LM9 A;  2HPJ A;  3GWH A;  3D0T A;  3CPZ A;  2RA1 A;  2DWK A;  3IHR A;  3UUM A;  3O9X A;  3FB2 A;  3C98 B;  2LT3 A;  4E7S A;  3H37 A;  4PK4 A;  2N1G A;  3HA4 A;  3JC6 D;  3J9X 1;  4AKH A;  3A5X A;  2GK9 A;  3NZQ A;  3ZJ2 A;  3MK7 C;  3AA7 B;  3ZYK A;  1D1C A;  5EK3 A;  2CE7 A;  3KVB A;  3O1J A;  3OJA A;  5EK4 A;  4O8S A;  1MND A;  4PJL A;  2W63 A;  2WMN A;  2HPL A;  1OXZ A;  2VB6 A;  4L9I A;  4ZI3 D;  2YK0 A;  4QXB B;  5JDQ A;  3L09 A;  3GMI A;  2C0S A;  3N9L A;  3ESL A;  4I4T E;  2LJL A;  4DMW A;  2MTQ A;  1ZEE A;  3NRY A;  2V26 A;  2PJQ A;  2IC6 A;  2LSY A;  4KMC A;  3SRZ A;  4XBF B;  3ZCJ A;  5LGU B;  2XAF B;  4M1P A;  4MBQ A;  3LBX B;  3PDY A;  2JMK A;  2Q9Q C;  3QK6 A;  2LSG A;  1V9D A;  1MNE A;  2DCF A;  4WNK A;  4X1I E;  4XZC A;  3RYC E;  2ES0 A;  3N9Q A;  3SWH A;  3KFW X;  1CUN A;  4H9P C;  5FXW A;  3U78 A;  4L5G A;  3KBU A;  4PK5 A;  3DP7 A;  3ZMZ B;  5JDN A;  4UV8 B;  2V1D B;  4I50 E;  3KV4 A;  4WBN E;  5HXS A;  1D0X A;  3LK3 B;  3VHL A;  4DBR A;  3K3Q C;  2ACX A;  4MAL A;  5L3B B;  4ZS3 A;  3BK9 A;  2XAH B;  4YJ2 E;  2LE8 A;  2W0G A;  4OYK A;  2QA7 A;  4GK0 E;  2IW5 B;  2NOX A;  5AFU L;  1X79 A;  3CVR A;  3Q5W A;  3PTR B;  3DTO A;  3LBX A;  2BDE A;  4UXN B;  3ZJ1 A;  1FIO A;  4BA9 A;  5A1L A;  2JQQ A;  4UEL A;  3RH3 A;  5HXH A;  2CLY B;  2DWG A;  3NZP A;  5F8P A;  3FXD B;  2XUE A;  5LHI B;  2NTY A;  2CCQ A;  2X9W A;  4AQG A;  1HCI A;  3FHN A;  3NBX X;  4ZI2 D;  5LGT B;  4G2A A;  4DMV A;  4A56 A;  3J7Y q;  2X68 A;  1G8X A;  3N9N A;  3U3I A;  4TV9 E;  2WM9 A;  5FY0 A;  3R6N A;  2E9X D;  2K5B B;  1D1A A;  2CM0 A;  4H63 V;  2XHE B;  3IEE A;  1D1B A;  4PK6 A;  4TZ4 C;  1D0Z A;  5HWX A;  4HFV A;  3MZK B;  4GYR A;  1QSD A;  4KBM B;  5J2T E;  4I55 E;  1WYB A;  3I0O A;  1BR0 A;  5JRC B;  5LHH B;  4PNI A;  2JPF A;  3WAK A;  2LOP A;  3MA9 A;  4ERR A;  4X1Y E;  2PFV A;  2XTL A;  4IDZ A;  3ONX A;  2W61 A;  2CWO A;  4ILU A;  4MFR A;  4UVA B;  3KV6 A;  2NTX A;  3PU8 A;  5JRE A;  5LP6 E;  5FXV A;  1D0Y A;  2CXD A;  4PJJ A;  4EB6 E;  3TKL B;  5KX5 E;  3RYH E;  4O2B E;  3VKH A;  2A2F X;  2MOZ A;  2Y48 B;  2YEV C;  2XAJ B;  1H7C A;  4HTE A;  4AKR B;  3FXE B;  4H9Q C;  3PUA A;  3UUN A;  5JRC A;  5DQV A;  5KDM C;  1IJ5 A;  2Z6E A;  2KMF A;  4GYS A;  3VKG A;  3N2K E;  4EYU A;  3UFE A;  1YD8 G;  5JDH A;  3FBZ A;  2KWH A;  2LOS A;  2KZ7 B;  5FYM A;  5HWY A;  2VKO A;  5J1G A;  2LHR A;  2UXX B;  3CKD A;  4DBQ A;  5TAO A;  3HKC E;  4CI2 B;  3ZYL A;  4H9R C;  5JR9 B;  3JC6 C;  3IF8 B;  1YKE B;  4O4I E;  5HYA A;  4JEH B;  2CXF A;  2V7I A;  3UUL A;  3LK2 B;  2YIN A;  2LSJ A;  1FMV A;  2EHO D;  3SS1 A;  2L8K A;  3V5S A;  1LRZ A;  2PBI A;  3OYX A;  4PJM A;  5CA0 E;  2DHR A;  2DLR A;  2WMO A;  3AA0 B;  2EHO B;  2J1D G;  4UVC B;  3ZC1 A;  4ASK A;  4O4H E;  1U5P A;  3ZMT B;  2CXL A;  4ZI3 C;  4H9N C;  2VKJ A;  3KDS E;  1MIY A;  4UVB B;  4HEA A;  3I9W A;  3ZEF B;  5L3F B;  2NW9 A;  5JR9 A;  2X67 A;  3S4U A;  1YKH B;  4G63 A;  4JLE A;  4OK0 A;  3HKE E;  5LCY A;  4WW0 A;  2D2S A;  2W00 A;  3EUH A;  4MLK A;  3AB3 B;  4ANJ A;  4HGA A;  3CX7 B;  2Y8D A;  3C4X A;  4TV8 E;  5JH7 E;  5L3E B;  4UV9 B;  4YHJ A;  2X51 A;  2V7K A;  2H7V C;  2YU1 A;  4NUU A;  4CI3 B;  4E7Z A;  2ODU A;  4YJ3 E;  2EHO A;  2VAS A;  4UF0 B;  3RPU A;  2WAU A;  2BZB A;  3C4W A;  3WAJ A;  2IC9 A;  1UCU A;  4OFZ A;  3HKB E;  1ZHC A;  5CB4 E;  3RYF E;  2DI4 A;  5LHG B;  4QWN B;  1Z0P A;  3KV5 A;  3H3A A;  5DJQ C;  3F57 A;  5H6R B;  4HKA A;  4GOU A;  3HI2 A;  3CX8 B;  1IAP A;  1OWA A;  4B6X A;  4BAY B;  2CEA A;  2Q9Q D;  4IE7 A;  2YU2 A;  5KMG P;  2PG8 A;  1NAF A;  3N9O A;  5DQW A;  5EZY E;  3GA8 A;  3RX6 A;  5BMV E;  1NWM X;  1MMG A;  4DVD A;  2Q9Q B;  2QGS A;  3C50 A;  3ZYM A;  4MHC A;  5JQG E;  2C5J A;  2CLY C;  1BR1 A;  3RRC A;  3UTK A;  4UF0 A;  4CI1 B;  4H63 H;  4P09 A;  5LYJ E;  1MMA A;  3IBP A;  1FMW A;  5E0O A;  2K48 A;  1HF8 A;  2ZM8 A;  3BQK A;  4U72 A;  4IE0 A;  3K3N A;  2B1E A;  3AAA B;  1EZ3 A;  5JDM A;  5ADX L;  3LJC A;  2N9D A;  3LK4 2;  3CWZ B;  3C51 A;  3HL6 A;  5FXZ A;  4KUM B;  3KBT A;  3UUX B;  3PUQ A;  1HG5 A;  2KLQ A;  1S35 A;  3CX6 B;  1UX5 A;  2C5I T;  3MXZ A;  2E9X B;  2Q9Q A;  4QX7 B;  4IST A;  2N2N A;  2X66 A;  3N5L A;  4ZS2 A;  4H9O C;  3LG7 A;  1WRD A;  4TX5 A;  4PAG A;  5FMN A;  4IE4 A;  2OA5 A;  3BQL A;  2NP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...