3EVYA

Crystal structure of a fragment of a putative type i restriction enzyme r protein from bacteroides fragilis
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
83
structure length
83
Chain Sequence
b'MKPYEKLVERFNEMAAEFLSYFPTVKSVGNLESELDKRRFVILFRAMLRLRNEVKGYNEFDAEDLTIEEQRFADYQSKYLDMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative type I restriction enzyme R protein
molecule tags Hydrolase
source organism Bacteroides fragilis nctc 9343
publication title Crystal structure of a fragment of a putative type I restriction enzyme R protein from Bacteroides fragilis
rcsb
total genus 32
structure length 83
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.910 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3evyA00
3EVYA
chains in the Genus database with same CATH superfamily
2ACZA 3LSVA 1ZHCA 2Q9QB 2WMNA 2BDEA 2YDSA 4H9OC 3AE7A 4HFEA 4ILCA 4GKKT 2LOPA 3UTKA 5FP3A 4DR7T 4U2ZA 5LJNA 3I1AA 3L8RA 2NW8A 4LMLA 4A98A 3OKQA 2YU1A 2DLRA 4OHFA 4F6RC 5JQGE 5LXTE 3C51A 2HHHT 2XZEA 3FHNA 5F5WA 4DBRA 3UU4A 4YSYA 5ABFA 1HFAA 2XQ4A 2XAQB 2SPCA 4IE7A 5LA6E 2YKSA 3AXJA 2LKGA 5LG3A 2IW5B 2HN2A 3RF1A 3RQWA 3LJCA 1IJ6A 1J5WA 4DR1T 4TWFA 2OLTA 5FKYA 3ZN1B 4X1KE 2WBLA 1BR1A 4JYAT 2MPKA 5JDGA 2PG8A 2VVNA 2X9XA 3JAFA 4XBFB 2H3RA 2W66A 1YQ3A 3LG7A 3SOLA 4HFVA 2KZ7B 2W67A 3BQLA 1D1BA 2ZM6T 4TX5A 1ZP0A 3AXJB 3UU6A 4COFA 3O4XE 1IAPA 2CXLA 3EVYA 5L3EB 2C5JA 4IGUA 3PDYA 3AEFA 2VWAA 3EABA 2WM9A 2YN6A 5AQKB 5HEJA 4QHOA 2WSSV 2YU2A 1FMVA 2NWBA 3AE5A 3CK6A 1OEDE 2LSKA 2D0TA 4X20E 2A72A 4TWHA 5CB4E 4AIUA 2BG9C 3WI3A 3SWHA 1XMOT 4X1IE 4H63V 2VK9A 4J2CA 4DR6T 4KMCA 3PV0F 2DWGA 2NTXA 2QGSA 2CBJA 4UV9B 3F31A 5FMNA 4DV3T 3ETVA 2OV9A 4TZ4C 1IBMT 3A8YC 3Q9DA 4IDZA 3X1DA 3MK7C 3EDVA 3Q5WA 3LDQB 4H9QC 4X66T 1N36T 3SFEA 3PURA 3FZHB 3RC8A 2LSIA 3O1JA 5AQLB 2J62A 2W2UA 2XAFB 3QB5A 2V26A 5HCMA 2VL8A 4BJNA 4AKRB 3LFMA 3UUBA 3ZSTA 3IA3A 3VR9A 4AQFA 2FJBA 3IHRA 3Q5XA 2K5BB 5LB7B 4IL4A 5LYJE 1YD8G 4JLEA 1YW0A 5LOVE 1Y64B 3LK42 4JI6T 4ZS2A 3ZMZB 2XUEA 5JR9C 3F2EA 3EHZA 2DNXA 1XDPA 3O9XA 5L3CB 2X9HA 2QYWA 1HNXT 3PUSA 3LBXB 2N2NA 2WDRA 3RYCE 4GYSA 2W4XA 4NPPA 5KXJA 4EB6E 3M65A 4V1Av 5H6QB 4DUZT 2YEVC 2MYSA 4QX8B 3G06A 2VASA 5L3BB 4YLHA 2H89A 2X67A 3PUGA 4XZCA 3RC3A 2WDQA 4U74A 5LMNT 3QOFA 5FVKA 3OYXA 2BS4A 5GONE 5HEHA 2BKNA 5HXCA 3GA8A 4IREA 2JQ9A 2KNDA 3V5UA 2Q9QD 1W0BA 2IDOB 1WCRA 2V7JA 5EK3A 4AISA 3Q2MA 2PTFA 4PJLA 3N9MA 4WBNE 5CGMA 4DR5T 3T8OA 4HWFA 4EEBA 2LM2A 2KT9A 3N9NA 4U3CA 2FJEA 4ZI3D 3CKDA 3DJBA 4UV8B 4UR9A 3CX7B 3LK2B 3RQUA 1FIOA 2KWHA 1YQ4A 5DABA 4CI2B 2LKHA 2LSYA 3ANWB 3ZYMA 3EI0A 4EAHA 4EZ4A 4ILAA 1HX8A 5L47A 3HR0A 5FL1A 3NKZA 1T72A 3CWZB 1LRZA 3KVAA 4PNIA 5HXSA 5J2UE 1FEWA 2V7IA 4IDNA 4IE0A 3QC9A 3IEEA 4OK0A 1U5PA 5FYMA 1Z0PA 1M62A 5LCYA 4HFIA 5J0ZA 3ANWA 2B76A 5HEOA 3RYFE 1JNZA 4U33A 2H7VC 3KFWX 3BK9A 3NZPA 4MLKA 2FUPA 3KV5A 5L3DB 4PAGA 5LGUB 1WFDA 2CHNA 4UIGA 3AA6B 1HG5A 4NUVA 2Q9QA 2J4GA 3ZT5A 2MOZA 3CVRA 2WQYA 1VCSA 1E1HB 2C0SA 1SUMB 3PUAA 1J1JA 2Z6EA 3FB2A 4DBQA 2A3DA 3Q5DA 4JEUB 4O4JE 4TNVA 2A9UA 4KHZF 2BG9B 2BKOA 5FL0A 3WAKA 4EV6A 2IIUA 3B5MA 2YOEA 4MBQA 3AB3B 2VL0A 1SHZC 5J1GA 3AE6A 3QK6A 4KUMB 4KI0F 4U31A 1OEDB 2WP9A 3AE1A 2WY2A 3NRXA 3UFGA 3ZMVB 2V7LA 3AE2A 2LJLA 5LHIB 3FZMB 1KEYA 3O1IA 5JVDE 4EEDA 2E9XB 4ZI2C 3JADA 1N33T 2QRXA 4KHPT 4PK6A 2KSRA 3KV4A 1I94T 2XSAA 5JRCA 1BR4A 2JRKA 2ZM2A 3OYZA 3P7IA 5HYAA 2J1DG 3J9X1 1SE7A 4HWIB 4O2AE 3CX6B 3FBZA 4OYKA 3GMIA 3UQ4A 5E0OA 4A56A 3VR8A 1WLXA 2Y48B 4HWCA 4DR3T 2WZHA 2W0GA 2LRLA 3L09A 3OTOT 5JRCB 4QXCB 4P09A 2RPAA 3RKGA 2XM1A 2LM9A 3ZMSB 5BMVE 4IE6A 3H3MA 5C8YE 3HKCE 3EUHA 2M6BA 2XM2A 3UU3A 4JI3T 4U7IA 3R84B 1FMWA 5AQOB 4LFBT 1QLBA 1XZYA 5ABEA 4QXBB 2Y6XA 1LVKA 4AQFC 2CA5A 2JQKA 2CPTA 3MZKB 2LRKA 2DHRA 4FI5A 4HN9A 4PFPA 4U72A 4X1YE 4P1NA 1X79A 4GK5E 4WBOA 1WRDA 1T7SA 3FXDB 1SA0E 3KBUA 5AQGB 3OBVE 4K0KT 1KNZA 4TN7B 4YHHT 2NW9A 2NR4A 1HX1B 1QSDA 4IT4A 2QVAA 4K0UA 3ZSSA 4DV0T 2M67A 4IL9A 1D0XA 2ES0A 4DNDA 4QWNB 4UVAB 2ZM0A 3UFEA 2JPFA 3N2KE 5FXWA 2IUBA 2ODVA 5ETWA 2BG9A 3BQKA 2WWUA 3K3NA 1W0AA 3QNUA 4CXYA 2D9DA 1UX5A 2XQ9A 4HWDA 1ZV4X 1AJ3A 5LBMA 3TLUA 2CWYA 4HGAA 3EAMA 3Q5EA 5AQIB 1VOMA 5LBQB 3W15B 1QUUA 2VKHA 1MMAA 2L3LA 2UXNB 2V1DB 2E9XA 3I9YA 4GOUA 1X9BA 1ZOYA 3CQCB 4NUUA 2LEHA 3DP7A 3NZQA 2W61A 3PUWF 1G8XA 4Q25A 2VQET 2D2SA 1MIWA 3ZT6A 3K1SA 4AI6A 3J7Yq 3I0OA 3OPCA 2X51A 5CJ5A 4I55E 2LSJA 3ZMUB 3AVRA 3ZCJA 1US7B 5F8PA 4TV9E 5LJMA 3RH3A 5HXEA 3AE9A 3AEEA 2V7KA 4YHJA 3RYIE 4GKJT 3VKGA 3ONLC 4WNKA 2KWIB 3ZYLA 2XAGB 2NP9A 5TAOA 3B13A 3CMLA 3UUMA 3WAJA 4G2AA 4JI8T 1CHUA 4DR4T 5LG4A 4GIWA 2UUAT 2KLQA 3AE3A 3GWHA 1BR0A 4YJ3E 1Y01A 3PUQA 3AAEB 2X9WA 4B3MT 2V7MA 3HKDE 3RRWA 4KBMB 3IBPA 2MBGA 1MIYA 3T1YT 1JNRA 4F8HA 1EZ3A 1VCTA 2CLYB 2VB6A 4ILUA 5AQUB 2UXBT 4LF5T 2CHOA 5AQVB 2E9XD 5AQFB 4P0BA 3LBXA 1I6ZA 5IHYA 5EZYE 3CQXC 4ILBA 1M7KA 3VHLA 3ONJA 5FXVA 2X0YA 4YT0A 5AQTB 1MMGA 4GK0E 4LFCT 2KINB 2LHRA 3RHWA 2DI4A 4C90A 1XNQT 2FBWA 2XAHB 3RLFF 3TLSA 2A2FX 3N9OA 4A97A 2JJ9A 4AQYT 4LMKA 5JDHA 3QUJA 4DV1T 3HKBE 3C4ZA 2OA5A 1ZEEA 5IYZE 3L3PA 1L0VA 1W09A 4UVCB 4I0UA 2I0MA 4IDQA 3FZKB 2L8KA 3N9LA 1HNWT 3BQIA 5ADXL 2DL1A 2WMOA 3F57A 2UXXB 3K3OA 4H63H 3V5SA 4UEMA 2LT3A 3JAEA 4ZI7E 4Z91A 5L3FB 3RRCA 3P8CD 4X65T 2ZMAA 3I0QA 5BR8T 1WR6A 2E2AA 4ZZCA 2WCAA 4ZEYA 4IE4A 2K48A 2XQYA 2EHOB 4CN4A 2AXDS 2WAUA 3C50A 4JEHB 3RIUC 1E2AA 2UXDT 3A5XA 2BVMA 4P0AA 4QH1A 4HKAA 2W00A 5L4EA 4PK4A 5HXRA 1IBKT 4C91A 4X5TA 4ASKA 4TUYE 5FXZA 2V6YB 4IHJE 4O2BE 3ETUA 3E22E 2IMLA 4EZHA 3FXEB 2HPJA 2X0HA 3U78A 3P4SA 2J47A 4DIDB 5JH7E 4HFCA 4CXWA 3C64A 4YSZA 3VRBA 3NWIA 2JMKA 3RIFA 1UUSA 5C3JA 5HEUA 4DVDA 5JTGA 2ACXA 4YXDA 5CA1E 3CPZA 2CM0A 3RI5A 1YKEB 2NTYA 2CXDA 1NEKA 5FY7A 4DV2T 2V6YA 2ZM8A 2K24A 4I50E 1U4QA 2N9DA 4WYVA 1D0ZA 3ZC0A 3P4QA 3AA0B 2WU2A 2GK9A 4KX6A 4PJMA 4DO0A 3P4WA 5HXHA 4LF9T 1LVFA 2H88A 2YDRA 3PJAA 4IDPA 5DQVA 3K8PC 4EYYR 4H9NC 4EGWA 1UURA 3ZYKA 3N9QA 5FY0A 2KXPB 2WDVA 3ZPOA 2PJQA 5EK2A 4DV7T 3ONXA 1DU2A 2EHOD 4B3RT 3EDUA 4I4TE 3SFDA 5JREA 3PU3A 4HWHA 2CEAA 5LNKA 2CLYC 4QXHB 5AQQB 2XQ8A 3ABVA 2X0LB 2CMRA 3DTOA 3CQGB 5AFUL 4HEAA 4TV8E 3NVOA 3RGLA 4MFRA 2MAWA 2RP4A 2LSGA 2UUCT 4LF8T 3UT5E 4FJOA 5ABHA 2E8IA 3D0TA 1KK7A 3CIRA 4AKIA 2ZLYA 3AE4A 4NXNT 2CCQA 5JDFA 4B3TT 2CRBA 4ERRA 3A7MA 4ZXLA 4QX7B 3NBXX 5F3JA 3AEGA 3PU8A 2MTQA 2XAJB 4L9IA 5AQNB 5FY1A 3RIUA 3KV6A 5ABFB 5AQMB 2H7OA 5AQRB 4H9RC 2BZBA 3UUXB 4I43B 4YFSA 5LMUT 2BS3A 4ISTA 1IZNB 1S94A 4UVBB 2YDQA 2PBIA 4G63A 4U7YA 5IWAT 1E7PA 2BBJA 4QH5A 1H7CA 4TWDA 4DR2T 2DCFA 3ZT7A 4CQIA 4E7SA 4B3ST 3HKEE 2CWOA 4UELA 2IAKA 1T98A 3CX8B 2Y8DA 2V6XA 3O1HA 4YTMA 4JI2T 3PUVF 1VRBA 3AA1B 4UF0A 4ZHQE 4AKHA 4DUYT 4CXXA 1N34T 2V5DA 2XY8B 3P4PA 2E5VA 2V5CA 2VVSA 2BG9E 1MIVA 4M1PA 2WWVA 2ODUA 4EOZB 4YSXA 1HNZT 2DWKA 4PJJA 5AQSB 3UU8A 2P9BA 4CZZB 4CN1A 5L2LA 3T1HT 3QB5K 3TKLB 4QKNA 4HFDA 2IHR1 4Z8XA 2VQFT 2F4VT 3KINB 4AKGA 2D5UA 5L3GB 4UF0B 1XMQT 2XJ7A 2JQQA 1HR0T 3VKHA 5LGTB 4E7ZA 3C98B 4ISSA 1UCUA 4ZOLE 4ZZBA 4LFAT 1WYCA 1MMNA 3I9WA 1KNRA 1UK5A 2I6HA 2VURA 4IDOA 3PTRB 4YTNA 5C2TA 2JQHA 3ESLA 5LHHB 1N32T 2XQ3A 3SRZA 1MNEA 4ZI3C 4AXPA 4YJ2E 3HA4A 4CI3B 3AVSA 3VU7H 4JI7T 2VKDA 1MMDA 1UGOA 2VKJA 4O4HE 2BVLA 3RX6A 4CN6A 4YTPA 5IUXA 1V9DA 3JC6D 4L0RA 4OFZA 4PJNA 3RKOA 3LK3B 3PUXF 3OJAA 3MXZA 4UXNB 3GN5A 2WU5A 1HG2A 2KMFA 3AAAB 3PUZF 1HCIA 4H9SE 4HE8A 3TLTA 4PW8A 4NXMT 1J5ET 2LE8A 2CBIA 2UXCT 5JDMA 4O4IE 5H6RB 1YXRA 3H37A 1KNPA 1CUNA 2I59A 4X64T 4HTEA 5M4YA 4NIQA 1WR0A 2HN1A 4BAYB 3GN5B 1FJGT 2E9XC 2HH7A 2N1GA 4HFHA 5HWYA 4YY3T 4JI4T 4OX9T 4O8SA 2X68A 4JI5T 3R6NA 3P50A 3H3AA 2CXFA 1MNDA 2W62A 3AE8A 1T8BA 2LHNA 1D1AA 1XWMA 2NOXA 2XASB 3IF8B 3N5LA 4IIJE 3ZN0B 4LMJA 3MJXA 2C5IT 4JBWF 5AQHB 5EK4A 2E5LT 3NRYA 1LKXA 3ZLIA 5HWXA 4DMWA 5JR9B 2FJDA 2W63A 5KMGP 3AAIA 1XDOA 2HPLA 3PUYF 1WYBA 2Q9QC 2VKOA 3MACA 4AQGA 1NAFA 3E0ZA 2AE9A 5LHGB 4DV6T 4XAXB 2JIWA 3KVBA 3N2OA 4JI0T 4PFOA 2FJAA 2PFVA 3JCFA 2WB5A 1O3XA 2K9AA 2NW7A 5A1LA 4LF6T 4WZXA 3UUNA 4Z90A 3JC6C 5HEGA 2XQ6A 2YK0A 3KDSE 3HL6A 3ZJ1A 5JDLA 4CI1B 2XQ7A 3C4XA 3N2GE 4EIWA 2QA7A 3N9PA 2XPKA 4GYRA 4JUYA 1B7TA 5L4HA 4AKLA 4BA9A 1IBLT 5AQPB 1XNRT 1KFYA 5HCJA 3C4WA 3HI2A 1W9RA 2K3WA 3AEDA 5FXXA 4MHCA 3U3IA 3FZFB 4BJMA 3MKDA 3L39A 3AA7B 3RYHE 4DMVA 5CA0E 3ZKRA 4OYJA 3ZJ2A 3UULA 3ZMTB 2X66A 4ADZA 4EXTA 4QH4A 1OEDC 2EHOA 5JDQA 2YINA 3FZLB 5KX5E 4HFBA 2WS3A 3TLWA 3AEAA 3PJAJ 2D0UA 4EYUA 4LF7T 5FVLA 4JV5T 2XQ5A 1OXZA 1KF6A 4U2YA 3P4RA 4L5GA 2C5KT 4O4LE 5DJQC 5JDNA 2R6GF 4MALA 4WW0A 4B6XA 2RA1A 4KP3C 4LF4T 1UX4A 2WZIA 4ANJA 5KDMC 1IJ5A 2BS2A 4DV5T 4ZS3A 3K3QC 5LP6E 3AEBA 3PE0A 2UUBT 4IE5A 1OEDA 2EHOC 2XHEB 2V8SV 3FBLA 1S35A 1D1CA 3UU5A 1R8IA 2XTLA 3B57A 3KV9A 3M3ZB 3RPUA 3ZC1A 2BBHA 1HF8A 1NWMX 2IC6A 2XQAA 5JR9A 3TLVA 5CFBA 1YKHB 3E08A 3ZEFB 5FNVE 1NENA 2X9YA 2B1EA 2JMHA 3SS1A 4ZI2D 5LGNB 1HS7A 1ZKEA 2LLYA 2XSBA 4H9PC 3ZCIA 2CE7A 2IC9A 4A5XA 1GQEA 3S4UA 3RIAA 3MA9A 1OWAA 2G0UA 1HTJF 4N78D 2LOSA 4PK5A 5AQJB 5HAXA 1Z8UA 2BKPA 3VRAA 4X62T 3AECA 3UQ7A 5ABGA 4JI1T 4TNWA 5DQWA 4DV4T 1BR2A 1D0YA 2L9QA 2M6IA 5J2TE 2UU9T 1G73A 3OVUA 3KBTA
chains in the Genus database with same CATH topology
1ZHCA 2Q9QB 2WMNA 2BDEA 4H9OC 2LOPA 3UTKA 5FP3A 5LJNA 3I1AA 2NW8A 3OKQA 2YU1A 2DLRA 4OHFA 4F6RC 5JQGE 5LXTE 3C51A 3FHNA 4DBRA 1HFAA 2XAQB 2SPCA 4IE7A 5LA6E 2IW5B 3LJCA 1IJ6A 3ZN1B 4X1KE 2WBLA 1BR1A 4XBFB 5JDGA 2PG8A 2X9XA 2H3RA 3SOLA 3LG7A 4HFVA 2KZ7B 3BQLA 1D1BA 4TX5A 3O4XE 1IAPA 2CXLA 3EVYA 5L3EB 2C5JA 4IGUA 3PDYA 2VWAA 2WM9A 4QHOA 2WSSV 2YU2A 1FMVA 2NWBA 2LSKA 2D0TA 4X20E 2A72A 5CB4E 3WI3A 3SWHA 4X1IE 4H63V 2VK9A 4J2CA 4KMCA 2DWGA 2NTXA 2QGSA 4UV9B 3F31A 5FMNA 3ETVA 4TZ4C 3Q9DA 4IDZA 3MK7C 3EDVA 3Q5WA 4H9QC 3PURA 3RC8A 2LSIA 3O1JA 2XAFB 2V26A 2VL8A 4BJNA 4AKRB 3LFMA 4AQFA 5LYJE 3IHRA 3Q5XA 2K5BB 1YD8G 4JLEA 1YW0A 5LOVE 1Y64B 3LK42 4ZS2A 3ZMZB 2XUEA 5JR9C 3F2EA 2DNXA 3O9XA 5L3CB 2X9HA 3PUSA 3LBXB 2N2NA 3RYCE 4GYSA 4EB6E 3M65A 4V1Av 5H6QB 2YEVC 2MYSA 4QX8B 5L3BB 2VASA 4YLHA 2X67A 3PUGA 4XZCA 3RC3A 4U74A 3OYXA 5GONE 5HXCA 3GA8A 2KNDA 3V5UA 2Q9QD 2V7JA 5EK3A 3Q2MA 4PJLA 3N9MA 4WBNE 3T8OA 2KT9A 3N9NA 4ZI3D 3CKDA 3DJBA 4UV8B 3CX7B 3LK2B 1FIOA 2KWHA 5DABA 4CI2B 4EAHA 2LSYA 3ANWB 3ZYMA 4EZ4A 1HX8A 3HR0A 3CWZB 1LRZA 3KVAA 4PNIA 5HXSA 5J2UE 1FEWA 2V7IA 4IE0A 3QC9A 3IEEA 4OK0A 1U5PA 5FYMA 1Z0PA 5LCYA 3ANWA 3RYFE 2H7VC 3KFWX 3BK9A 3NZPA 4MLKA 3KV5A 5L3DB 4PAGA 5LGUB 4UIGA 3AA6B 1HG5A 4NUVA 2Q9QA 2MOZA 3CVRA 1E1HB 2C0SA 3PUAA 2Z6EA 3FB2A 4DBQA 2A3DA 4JEUB 4O4JE 3WAKA 4MBQA 3AB3B 1SHZC 5J1GA 3QK6A 4KUMB 3ZMVB 3NRXA 2V7LA 5LHIB 2LJLA 3O1IA 5JVDE 2E9XB 4ZI2C 4PK6A 5JRCA 3KV4A 1BR4A 2JRKA 2ZM2A 3OYZA 3P7IA 5HYAA 2J1DG 3J9X1 4A56A 4OYKA 4O2AE 3CX6B 3FBZA 3GMIA 5E0OA 1WLXA 2Y48B 2W0GA 3L09A 5JRCB 4QXCB 4P09A 5BMVE 2LM9A 3ZMSB 4IE6A 5C8YE 3HKCE 3EUHA 3R84B 1FMWA 4QXBB 2Y6XA 1LVKA 4AQFC 2CA5A 3MZKB 4HN9A 4FI5A 4PFPA 2DHRA 4U72A 4X1YE 1X79A 4GK5E 4WBOA 1WRDA 3FXDB 1SA0E 3KBUA 3OBVE 1KNZA 4TN7B 2NW9A 1QSDA 4K0UA 2M67A 1D0XA 2ES0A 4QWNB 4UVAB 2ZM0A 3UFEA 2JPFA 3N2KE 5FXWA 2ODVA 5ETWA 3BQKA 2WWUA 3K3NA 4CXYA 1UX5A 1ZV4X 1AJ3A 5LBMA 2CWYA 4HGAA 1VOMA 5LBQB 3W15B 1QUUA 2VKHA 1MMAA 2L3LA 2UXNB 2V1DB 2E9XA 3I9YA 4GOUA 3CQCB 3SRZA 4NUUA 3U78A 2LEHA 3DP7A 3NZQA 2W61A 1G8XA 2D2SA 1MIWA 4AI6A 3J7Yq 3I0OA 2X51A 4I55E 2LSJA 3ZMUB 3AVRA 3ZCJA 1US7B 5F8PA 4TV9E 5LJMA 3RH3A 5HXEA 3RYIE 2V7KA 4YHJA 3VKGA 4WNKA 2KWIB 3ZYLA 2XAGB 2NP9A 5TAOA 3B13A 3CMLA 3UUMA 3WAJA 4G2AA 5LG4A 4GIWA 2KLQA 1BR0A 3GWHA 4YJ3E 3PUQA 3AAEB 2X9WA 2V7MA 3HKDE 3RRWA 4KBMB 3IBPA 2MBGA 1MIYA 1EZ3A 2CLYB 2VB6A 4ILUA 2E9XD 4P0BA 3LBXA 5IHYA 5EZYE 3CQXC 3VHLA 5FXVA 1MMGA 4GK0E 2KINB 2LHRA 4C90A 2DI4A 2XAHB 2A2FX 3N9OA 2JJ9A 5JDHA 3QUJA 3HKBE 3C4ZA 2OA5A 1ZEEA 5IYZE 3L3PA 4UVCB 3N9LA 2L8KA 3BQIA 5ADXL 2WMOA 3F57A 3V5SA 2UXXB 3K3OA 4H63H 4ZI7E 4UEMA 2LT3A 5L3FB 3RRCA 3P8CD 2ZMAA 3I0QA 1WR6A 4IE4A 2K48A 2XQYA 2EHOB 2WAUA 3C50A 4JEHB 3A5XA 2BVMA 4P0AA 4HKAA 2W00A 4PK4A 5HXRA 4C91A 4ASKA 4TUYE 5FXZA 4IHJE 4O2BE 3ETUA 3E22E 4EZHA 5JH7E 3FXEB 2HPJA 4CXWA 3C64A 2JMKA 4DVDA 2ACXA 5CA1E 3CPZA 2CM0A 1YKEB 2NTYA 2CXDA 5FY7A 2ZM8A 2K24A 4I50E 1U4QA 2N9DA 1D0ZA 3ZC0A 4DO0A 3AA0B 5HXHA 2GK9A 4PJMA 1LVFA 5DQVA 3K8PC 4EYYR 4H9NC 3ZYKA 3N9QA 5FY0A 2KXPB 3ZPOA 5EK2A 2PJQA 3ONXA 2EHOD 3EDUA 4I4TE 5JREA 3PU3A 2CEAA 5LNKA 2CLYC 4QXHB 3DTOA 2X0LB 2CMRA 3CQGB 5AFUL 4HEAA 4TV8E 4MFRA 2RP4A 2LSGA 3UT5E 4FJOA 2E8IA 3D0TA 1KK7A 4AKIA 2ZLYA 2CCQA 5JDFA 4ERRA 4QX7B 3NBXX 5F3JA 3PU8A 2MTQA 2XAJB 4L9IA 5FY1A 3KV6A 2H7OA 4H9RC 2BZBA 3UUXB 4I43B 4YFSA 4ISTA 1IZNB 1S94A 4UVBB 2PBIA 4G63A 1H7CA 2DCFA 4CQIA 4E7SA 3HKEE 2CWOA 4UELA 2IAKA 1T98A 3CX8B 2Y8DA 3O1HA 1VRBA 3AA1B 4UF0A 4ZHQE 4CXXA 1MIVA 4M1PA 2ODUA 4EOZB 2DWKA 4PJJA 2P9BA 4CZZB 5L2LA 3TKLB 4QKNA 4Z8XA 4AKGA 3KINB 2D5UA 5L3GB 4UF0B 2JQQA 3VKHA 5LGTB 4E7ZA 3C98B 4ISSA 1UCUA 4ZOLE 1WYCA 1MMNA 3I9WA 3PTRB 3ESLA 5LHHB 1MNEA 4ZI3C 4AXPA 4YJ2E 3HA4A 4CI3B 3AVSA 3VU7H 2VKDA 1MMDA 2VKJA 4O4HE 3RX6A 2BVLA 1V9DA 3JC6D 4L0RA 4OFZA 4PJNA 3RKOA 3LK3B 3OJAA 3MXZA 4UXNB 3GN5A 1HG2A 2KMFA 3AAAB 4HE8A 1HCIA 4H9SE 4PW8A 2LE8A 5JDMA 4O4IE 5H6RB 3H37A 1CUNA 2I59A 4HTEA 5M4YA 4BAYB 3GN5B 2E9XC 2HH7A 2N1GA 5HWYA 4O8SA 2X68A 3R6NA 3H3AA 2CXFA 1MNDA 2W62A 3IF8B 3N5LA 2LHNA 1D1AA 4IIJE 2NOXA 2XASB 4AKHA 3ZN0B 3MJXA 2C5IT 5EK4A 3NRYA 1LKXA 3ZLIA 5HWXA 4DMWA 5JR9B 2W63A 5KMGP 3AAIA 4AQGA 2HPLA 1WYBA 2Q9QC 2VKOA 3MACA 1NAFA 3E0ZA 5LHGB 4XAXB 3KVBA 3N2OA 4PFOA 2PFVA 1O3XA 2K9AA 2NW7A 5A1LA 3UUNA 3JC6C 2YK0A 3KDSE 3HL6A 3ZJ1A 5JDLA 4CI1B 3C4XA 3N2GE 4EIWA 2QA7A 3N9PA 4GYRA 4JUYA 4AKLA 1B7TA 4BA9A 3C4WA 3HI2A 5FXXA 4MHCA 3U3IA 4BJMA 3MKDA 3AA7B 3RYHE 4DMVA 5CA0E 4ADZA 4OYJA 3ZJ2A 3UULA 3ZMTB 2X66A 4EXTA 2EHOA 5JDQA 2YINA 5KX5E 2D0UA 4EYUA 1OXZA 4L5GA 2C5KT 4O4LE 5DJQC 5JDNA 4MALA 4WW0A 4B6XA 2RA1A 4KP3C 1UX4A 4ANJA 5KDMC 1IJ5A 4ZS3A 3K3QC 5LP6E 3PE0A 4IE5A 2EHOC 2XHEB 3FBLA 1S35A 1D1CA 2XTLA 3B57A 3KV9A 3ZC1A 3RPUA 4DNDA 2IC6A 1HF8A 1NWMX 5JR9A 1YKHB 3E08A 3ZEFB 5FNVE 4ZI2D 2X9YA 2B1EA 2JMHA 3SS1A 5LGNB 1HS7A 1ZKEA 4H9PC 3ZCIA 2CE7A 2IC9A 3S4UA 3MA9A 1OWAA 2G0UA 1HTJF 4N78D 2LOSA 4PK5A 5HAXA 5DQWA 1BR2A 1D0YA 2L9QA 5J2TE 1G73A 3KBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EVY A; 
#chains in the Genus database with same CATH topology
 2ACZ A;  3LSV A;  1ZHC A;  2Q9Q B;  2WMN A;  2BDE A;  2YDS A;  4H9O C;  3AE7 A;  4HFE A;  4ILC A;  4GKK T;  2LOP A;  3UTK A;  5FP3 A;  4DR7 T;  4U2Z A;  5LJN A;  3I1A A;  3L8R A;  2NW8 A;  4LML A;  4A98 A;  3OKQ A;  2YU1 A;  2DLR A;  4OHF A;  4F6R C;  5JQG E;  5LXT E;  3C51 A;  2HHH T;  2XZE A;  3FHN A;  5F5W A;  4DBR A;  3UU4 A;  4YSY A;  5ABF A;  1HFA A;  2XQ4 A;  2XAQ B;  2SPC A;  4IE7 A;  5LA6 E;  2YKS A;  3AXJ A;  2LKG A;  5LG3 A;  2IW5 B;  2HN2 A;  3RF1 A;  3RQW A;  3LJC A;  1IJ6 A;  1J5W A;  4DR1 T;  4TWF A;  2OLT A;  5FKY A;  3ZN1 B;  4X1K E;  2WBL A;  1BR1 A;  4JYA T;  2MPK A;  5JDG A;  2PG8 A;  2VVN A;  2X9X A;  3JAF A;  4XBF B;  2H3R A;  2W66 A;  1YQ3 A;  3LG7 A;  3SOL A;  4HFV A;  2KZ7 B;  2W67 A;  3BQL A;  1D1B A;  2ZM6 T;  4TX5 A;  1ZP0 A;  3AXJ B;  3UU6 A;  4COF A;  3O4X E;  1IAP A;  2CXL A;  3EVY A;  5L3E B;  2C5J A;  4IGU A;  3PDY A;  3AEF A;  2VWA A;  3EAB A;  2WM9 A;  2YN6 A;  5AQK B;  5HEJ A;  4QHO A;  2WSS V;  2YU2 A;  1FMV A;  2NWB A;  3AE5 A;  3CK6 A;  1OED E;  2LSK A;  2D0T A;  4X20 E;  2A72 A;  4TWH A;  5CB4 E;  4AIU A;  2BG9 C;  3WI3 A;  3SWH A;  1XMO T;  4X1I E;  4H63 V;  2VK9 A;  4J2C A;  4DR6 T;  4KMC A;  3PV0 F;  2DWG A;  2NTX A;  2QGS A;  2CBJ A;  4UV9 B;  3F31 A;  5FMN A;  4DV3 T;  3ETV A;  2OV9 A;  4TZ4 C;  1IBM T;  3A8Y C;  3Q9D A;  4IDZ A;  3X1D A;  3MK7 C;  3EDV A;  3Q5W A;  3LDQ B;  4H9Q C;  4X66 T;  1N36 T;  3SFE A;  3PUR A;  3FZH B;  3RC8 A;  2LSI A;  3O1J A;  5AQL B;  2J62 A;  2W2U A;  2XAF B;  3QB5 A;  2V26 A;  5HCM A;  2VL8 A;  4BJN A;  4AKR B;  3LFM A;  3UUB A;  3ZST A;  3IA3 A;  3VR9 A;  4AQF A;  2FJB A;  3IHR A;  3Q5X A;  2K5B B;  5LB7 B;  4IL4 A;  5LYJ E;  1YD8 G;  4JLE A;  1YW0 A;  5LOV E;  1Y64 B;  3LK4 2;  4JI6 T;  4ZS2 A;  3ZMZ B;  2XUE A;  5JR9 C;  3F2E A;  3EHZ A;  2DNX A;  1XDP A;  3O9X A;  5L3C B;  2X9H A;  2QYW A;  1HNX T;  3PUS A;  3LBX B;  2N2N A;  2WDR A;  3RYC E;  4GYS A;  2W4X A;  4NPP A;  5KXJ A;  4EB6 E;  3M65 A;  4V1A v;  5H6Q B;  4DUZ T;  2YEV C;  2MYS A;  4QX8 B;  3G06 A;  2VAS A;  5L3B B;  4YLH A;  2H89 A;  2X67 A;  3PUG A;  4XZC A;  3RC3 A;  2WDQ A;  4U74 A;  5LMN T;  3QOF A;  5FVK A;  3OYX A;  2BS4 A;  5GON E;  5HEH A;  2BKN A;  5HXC A;  3GA8 A;  4IRE A;  2JQ9 A;  2KND A;  3V5U A;  2Q9Q D;  1W0B A;  2IDO B;  1WCR A;  2V7J A;  5EK3 A;  4AIS A;  3Q2M A;  2PTF A;  4PJL A;  3N9M A;  4WBN E;  5CGM A;  4DR5 T;  3T8O A;  4HWF A;  4EEB A;  2LM2 A;  2KT9 A;  3N9N A;  4U3C A;  2FJE A;  4ZI3 D;  3CKD A;  3DJB A;  4UV8 B;  4UR9 A;  3CX7 B;  3LK2 B;  3RQU A;  1FIO A;  2KWH A;  1YQ4 A;  5DAB A;  4CI2 B;  2LKH A;  2LSY A;  3ANW B;  3ZYM A;  3EI0 A;  4EAH A;  4EZ4 A;  4ILA A;  1HX8 A;  5L47 A;  3HR0 A;  5FL1 A;  3NKZ A;  1T72 A;  3CWZ B;  1LRZ A;  3KVA A;  4PNI A;  5HXS A;  5J2U E;  1FEW A;  2V7I A;  4IDN A;  4IE0 A;  3QC9 A;  3IEE A;  4OK0 A;  1U5P A;  5FYM A;  1Z0P A;  1M62 A;  5LCY A;  4HFI A;  5J0Z A;  3ANW A;  2B76 A;  5HEO A;  3RYF E;  1JNZ A;  4U33 A;  2H7V C;  3KFW X;  3BK9 A;  3NZP A;  4MLK A;  2FUP A;  3KV5 A;  5L3D B;  4PAG A;  5LGU B;  1WFD A;  2CHN A;  4UIG A;  3AA6 B;  1HG5 A;  4NUV A;  2Q9Q A;  2J4G A;  3ZT5 A;  2MOZ A;  3CVR A;  2WQY A;  1VCS A;  1E1H B;  2C0S A;  1SUM B;  3PUA A;  1J1J A;  2Z6E A;  3FB2 A;  4DBQ A;  2A3D A;  3Q5D A;  4JEU B;  4O4J E;  4TNV A;  2A9U A;  4KHZ F;  2BG9 B;  2BKO A;  5FL0 A;  3WAK A;  4EV6 A;  2IIU A;  3B5M A;  2YOE A;  4MBQ A;  3AB3 B;  2VL0 A;  1SHZ C;  5J1G A;  3AE6 A;  3QK6 A;  4KUM B;  4KI0 F;  4U31 A;  1OED B;  2WP9 A;  3AE1 A;  2WY2 A;  3NRX A;  3UFG A;  3ZMV B;  2V7L A;  3AE2 A;  2LJL A;  5LHI B;  3FZM B;  1KEY A;  3O1I A;  5JVD E;  4EED A;  2E9X B;  4ZI2 C;  3JAD A;  1N33 T;  2QRX A;  4KHP T;  4PK6 A;  2KSR A;  3KV4 A;  1I94 T;  2XSA A;  5JRC A;  1BR4 A;  2JRK A;  2ZM2 A;  3OYZ A;  3P7I A;  5HYA A;  2J1D G;  3J9X 1;  1SE7 A;  4HWI B;  4O2A E;  3CX6 B;  3FBZ A;  4OYK A;  3GMI A;  3UQ4 A;  5E0O A;  4A56 A;  3VR8 A;  1WLX A;  2Y48 B;  4HWC A;  4DR3 T;  2WZH A;  2W0G A;  2LRL A;  3L09 A;  3OTO T;  5JRC B;  4QXC B;  4P09 A;  2RPA A;  3RKG A;  2XM1 A;  2LM9 A;  3ZMS B;  5BMV E;  4IE6 A;  3H3M A;  5C8Y E;  3HKC E;  3EUH A;  2M6B A;  2XM2 A;  3UU3 A;  4JI3 T;  4U7I A;  3R84 B;  1FMW A;  5AQO B;  4LFB T;  1QLB A;  1XZY A;  5ABE A;  4QXB B;  2Y6X A;  1LVK A;  4AQF C;  2CA5 A;  2JQK A;  2CPT A;  3MZK B;  2LRK A;  2DHR A;  4FI5 A;  4HN9 A;  4PFP A;  4U72 A;  4X1Y E;  4P1N A;  1X79 A;  4GK5 E;  4WBO A;  1WRD A;  1T7S A;  3FXD B;  1SA0 E;  3KBU A;  5AQG B;  3OBV E;  4K0K T;  1KNZ A;  4TN7 B;  4YHH T;  2NW9 A;  2NR4 A;  1HX1 B;  1QSD A;  4IT4 A;  2QVA A;  4K0U A;  3ZSS A;  4DV0 T;  2M67 A;  4IL9 A;  1D0X A;  2ES0 A;  4DND A;  4QWN B;  4UVA B;  2ZM0 A;  3UFE A;  2JPF A;  3N2K E;  5FXW A;  2IUB A;  2ODV A;  5ETW A;  2BG9 A;  3BQK A;  2WWU A;  3K3N A;  1W0A A;  3QNU A;  4CXY A;  2D9D A;  1UX5 A;  2XQ9 A;  4HWD A;  1ZV4 X;  1AJ3 A;  5LBM A;  3TLU A;  2CWY A;  4HGA A;  3EAM A;  3Q5E A;  5AQI B;  1VOM A;  5LBQ B;  3W15 B;  1QUU A;  2VKH A;  1MMA A;  2L3L A;  2UXN B;  2V1D B;  2E9X A;  3I9Y A;  4GOU A;  1X9B A;  1ZOY A;  3CQC B;  4NUU A;  2LEH A;  3DP7 A;  3NZQ A;  2W61 A;  3PUW F;  1G8X A;  4Q25 A;  2VQE T;  2D2S A;  1MIW A;  3ZT6 A;  3K1S A;  4AI6 A;  3J7Y q;  3I0O A;  3OPC A;  2X51 A;  5CJ5 A;  4I55 E;  2LSJ A;  3ZMU B;  3AVR A;  3ZCJ A;  1US7 B;  5F8P A;  4TV9 E;  5LJM A;  3RH3 A;  5HXE A;  3AE9 A;  3AEE A;  2V7K A;  4YHJ A;  3RYI E;  4GKJ T;  3VKG A;  3ONL C;  4WNK A;  2KWI B;  3ZYL A;  2XAG B;  2NP9 A;  5TAO A;  3B13 A;  3CML A;  3UUM A;  3WAJ A;  4G2A A;  4JI8 T;  1CHU A;  4DR4 T;  5LG4 A;  4GIW A;  2UUA T;  2KLQ A;  3AE3 A;  3GWH A;  1BR0 A;  4YJ3 E;  1Y01 A;  3PUQ A;  3AAE B;  2X9W A;  4B3M T;  2V7M A;  3HKD E;  3RRW A;  4KBM B;  3IBP A;  2MBG A;  1MIY A;  3T1Y T;  1JNR A;  4F8H A;  1EZ3 A;  1VCT A;  2CLY B;  2VB6 A;  4ILU A;  5AQU B;  2UXB T;  4LF5 T;  2CHO A;  5AQV B;  2E9X D;  5AQF B;  4P0B A;  3LBX A;  1I6Z A;  5IHY A;  5EZY E;  3CQX C;  4ILB A;  1M7K A;  3VHL A;  3ONJ A;  5FXV A;  2X0Y A;  4YT0 A;  5AQT B;  1MMG A;  4GK0 E;  4LFC T;  2KIN B;  2LHR A;  3RHW A;  2DI4 A;  4C90 A;  1XNQ T;  2FBW A;  2XAH B;  3RLF F;  3TLS A;  2A2F X;  3N9O A;  4A97 A;  2JJ9 A;  4AQY T;  4LMK A;  5JDH A;  3QUJ A;  4DV1 T;  3HKB E;  3C4Z A;  2OA5 A;  1ZEE A;  5IYZ E;  3L3P A;  1L0V A;  1W09 A;  4UVC B;  4I0U A;  2I0M A;  4IDQ A;  3FZK B;  2L8K A;  3N9L A;  1HNW T;  3BQI A;  5ADX L;  2DL1 A;  2WMO A;  3F57 A;  2UXX B;  3K3O A;  4H63 H;  3V5S A;  4UEM A;  2LT3 A;  3JAE A;  4ZI7 E;  4Z91 A;  5L3F B;  3RRC A;  3P8C D;  4X65 T;  2ZMA A;  3I0Q A;  5BR8 T;  1WR6 A;  2E2A A;  4ZZC A;  2WCA A;  4ZEY A;  4IE4 A;  2K48 A;  2XQY A;  2EHO B;  4CN4 A;  2AXD S;  2WAU A;  3C50 A;  4JEH B;  3RIU C;  1E2A A;  2UXD T;  3A5X A;  2BVM A;  4P0A A;  4QH1 A;  4HKA A;  2W00 A;  5L4E A;  4PK4 A;  5HXR A;  1IBK T;  4C91 A;  4X5T A;  4ASK A;  4TUY E;  5FXZ A;  2V6Y B;  4IHJ E;  4O2B E;  3ETU A;  3E22 E;  2IML A;  4EZH A;  3FXE B;  2HPJ A;  2X0H A;  3U78 A;  3P4S A;  2J47 A;  4DID B;  5JH7 E;  4HFC A;  4CXW A;  3C64 A;  4YSZ A;  3VRB A;  3NWI A;  2JMK A;  3RIF A;  1UUS A;  5C3J A;  5HEU A;  4DVD A;  5JTG A;  2ACX A;  4YXD A;  5CA1 E;  3CPZ A;  2CM0 A;  3RI5 A;  1YKE B;  2NTY A;  2CXD A;  1NEK A;  5FY7 A;  4DV2 T;  2V6Y A;  2ZM8 A;  2K24 A;  4I50 E;  1U4Q A;  2N9D A;  4WYV A;  1D0Z A;  3ZC0 A;  3P4Q A;  3AA0 B;  2WU2 A;  2GK9 A;  4KX6 A;  4PJM A;  4DO0 A;  3P4W A;  5HXH A;  4LF9 T;  1LVF A;  2H88 A;  2YDR A;  3PJA A;  4IDP A;  5DQV A;  3K8P C;  4EYY R;  4H9N C;  4EGW A;  1UUR A;  3ZYK A;  3N9Q A;  5FY0 A;  2KXP B;  2WDV A;  3ZPO A;  2PJQ A;  5EK2 A;  4DV7 T;  3ONX A;  1DU2 A;  2EHO D;  4B3R T;  3EDU A;  4I4T E;  3SFD A;  5JRE A;  3PU3 A;  4HWH A;  2CEA A;  5LNK A;  2CLY C;  4QXH B;  5AQQ B;  2XQ8 A;  3ABV A;  2X0L B;  2CMR A;  3DTO A;  3CQG B;  5AFU L;  4HEA A;  4TV8 E;  3NVO A;  3RGL A;  4MFR A;  2MAW A;  2RP4 A;  2LSG A;  2UUC T;  4LF8 T;  3UT5 E;  4FJO A;  5ABH A;  2E8I A;  3D0T A;  1KK7 A;  3CIR A;  4AKI A;  2ZLY A;  3AE4 A;  4NXN T;  2CCQ A;  5JDF A;  4B3T T;  2CRB A;  4ERR A;  3A7M A;  4ZXL A;  4QX7 B;  3NBX X;  5F3J A;  3AEG A;  3PU8 A;  2MTQ A;  2XAJ B;  4L9I A;  5AQN B;  5FY1 A;  3RIU A;  3KV6 A;  5ABF B;  5AQM B;  2H7O A;  5AQR B;  4H9R C;  2BZB A;  3UUX B;  4I43 B;  4YFS A;  5LMU T;  2BS3 A;  4IST A;  1IZN B;  1S94 A;  4UVB B;  2YDQ A;  2PBI A;  4G63 A;  4U7Y A;  5IWA T;  1E7P A;  2BBJ A;  4QH5 A;  1H7C A;  4TWD A;  4DR2 T;  2DCF A;  3ZT7 A;  4CQI A;  4E7S A;  4B3S T;  3HKE E;  2CWO A;  4UEL A;  2IAK A;  1T98 A;  3CX8 B;  2Y8D A;  2V6X A;  3O1H A;  4YTM A;  4JI2 T;  3PUV F;  1VRB A;  3AA1 B;  4UF0 A;  4ZHQ E;  4AKH A;  4DUY T;  4CXX A;  1N34 T;  2V5D A;  2XY8 B;  3P4P A;  2E5V A;  2V5C A;  2VVS A;  2BG9 E;  1MIV A;  4M1P A;  2WWV A;  2ODU A;  4EOZ B;  4YSX A;  1HNZ T;  2DWK A;  4PJJ A;  5AQS B;  3UU8 A;  2P9B A;  4CZZ B;  4CN1 A;  5L2L A;  3T1H T;  3QB5 K;  3TKL B;  4QKN A;  4HFD A;  2IHR 1;  4Z8X A;  2VQF T;  2F4V T;  3KIN B;  4AKG A;  2D5U A;  5L3G B;  4UF0 B;  1XMQ T;  2XJ7 A;  2JQQ A;  1HR0 T;  3VKH A;  5LGT B;  4E7Z A;  3C98 B;  4ISS A;  1UCU A;  4ZOL E;  4ZZB A;  4LFA T;  1WYC A;  1MMN A;  3I9W A;  1KNR A;  1UK5 A;  2I6H A;  2VUR A;  4IDO A;  3PTR B;  4YTN A;  5C2T A;  2JQH A;  3ESL A;  5LHH B;  1N32 T;  2XQ3 A;  3SRZ A;  1MNE A;  4ZI3 C;  4AXP A;  4YJ2 E;  3HA4 A;  4CI3 B;  3AVS A;  3VU7 H;  4JI7 T;  2VKD A;  1MMD A;  1UGO A;  2VKJ A;  4O4H E;  2BVL A;  3RX6 A;  4CN6 A;  4YTP A;  5IUX A;  1V9D A;  3JC6 D;  4L0R A;  4OFZ A;  4PJN A;  3RKO A;  3LK3 B;  3PUX F;  3OJA A;  3MXZ A;  4UXN B;  3GN5 A;  2WU5 A;  1HG2 A;  2KMF A;  3AAA B;  3PUZ F;  1HCI A;  4H9S E;  4HE8 A;  3TLT A;  4PW8 A;  4NXM T;  1J5E T;  2LE8 A;  2CBI A;  2UXC T;  5JDM A;  4O4I E;  5H6R B;  1YXR A;  3H37 A;  1KNP A;  1CUN A;  2I59 A;  4X64 T;  4HTE A;  5M4Y A;  4NIQ A;  1WR0 A;  2HN1 A;  4BAY B;  3GN5 B;  1FJG T;  2E9X C;  2HH7 A;  2N1G A;  4HFH A;  5HWY A;  4YY3 T;  4JI4 T;  4OX9 T;  4O8S A;  2X68 A;  4JI5 T;  3R6N A;  3P50 A;  3H3A A;  2CXF A;  1MND A;  2W62 A;  3AE8 A;  1T8B A;  2LHN A;  1D1A A;  1XWM A;  2NOX A;  2XAS B;  3IF8 B;  3N5L A;  4IIJ E;  3ZN0 B;  4LMJ A;  3MJX A;  2C5I T;  4JBW F;  5AQH B;  5EK4 A;  2E5L T;  3NRY A;  1LKX A;  3ZLI A;  5HWX A;  4DMW A;  5JR9 B;  2FJD A;  2W63 A;  5KMG P;  3AAI A;  1XDO A;  2HPL A;  3PUY F;  1WYB A;  2Q9Q C;  2VKO A;  3MAC A;  4AQG A;  1NAF A;  3E0Z A;  2AE9 A;  5LHG B;  4DV6 T;  4XAX B;  2JIW A;  3KVB A;  3N2O A;  4JI0 T;  4PFO A;  2FJA A;  2PFV A;  3JCF A;  2WB5 A;  1O3X A;  2K9A A;  2NW7 A;  5A1L A;  4LF6 T;  4WZX A;  3UUN A;  4Z90 A;  3JC6 C;  5HEG A;  2XQ6 A;  2YK0 A;  3KDS E;  3HL6 A;  3ZJ1 A;  5JDL A;  4CI1 B;  2XQ7 A;  3C4X A;  3N2G E;  4EIW A;  2QA7 A;  3N9P A;  2XPK A;  4GYR A;  4JUY A;  1B7T A;  5L4H A;  4AKL A;  4BA9 A;  1IBL T;  5AQP B;  1XNR T;  1KFY A;  5HCJ A;  3C4W A;  3HI2 A;  1W9R A;  2K3W A;  3AED A;  5FXX A;  4MHC A;  3U3I A;  3FZF B;  4BJM A;  3MKD A;  3L39 A;  3AA7 B;  3RYH E;  4DMV A;  5CA0 E;  3ZKR A;  4OYJ A;  3ZJ2 A;  3UUL A;  3ZMT B;  2X66 A;  4ADZ A;  4EXT A;  4QH4 A;  1OED C;  2EHO A;  5JDQ A;  2YIN A;  3FZL B;  5KX5 E;  4HFB A;  2WS3 A;  3TLW A;  3AEA A;  3PJA J;  2D0U A;  4EYU A;  4LF7 T;  5FVL A;  4JV5 T;  2XQ5 A;  1OXZ A;  1KF6 A;  4U2Y A;  3P4R A;  4L5G A;  2C5K T;  4O4L E;  5DJQ C;  5JDN A;  2R6G F;  4MAL A;  4WW0 A;  4B6X A;  2RA1 A;  4KP3 C;  4LF4 T;  1UX4 A;  2WZI A;  4ANJ A;  5KDM C;  1IJ5 A;  2BS2 A;  4DV5 T;  4ZS3 A;  3K3Q C;  5LP6 E;  3AEB A;  3PE0 A;  2UUB T;  4IE5 A;  1OED A;  2EHO C;  2XHE B;  2V8S V;  3FBL A;  1S35 A;  1D1C A;  3UU5 A;  1R8I A;  2XTL A;  3B57 A;  3KV9 A;  3M3Z B;  3RPU A;  3ZC1 A;  2BBH A;  1HF8 A;  1NWM X;  2IC6 A;  2XQA A;  5JR9 A;  3TLV A;  5CFB A;  1YKH B;  3E08 A;  3ZEF B;  5FNV E;  1NEN A;  2X9Y A;  2B1E A;  2JMH A;  3SS1 A;  4ZI2 D;  5LGN B;  1HS7 A;  1ZKE A;  2LLY A;  2XSB A;  4H9P C;  3ZCI A;  2CE7 A;  2IC9 A;  4A5X A;  1GQE A;  3S4U A;  3RIA A;  3MA9 A;  1OWA A;  2G0U A;  1HTJ F;  4N78 D;  2LOS A;  4PK5 A;  5AQJ B;  5HAX A;  1Z8U A;  2BKP A;  3VRA A;  4X62 T;  3AEC A;  3UQ7 A;  5ABG A;  4JI1 T;  4TNW A;  5DQW A;  4DV4 T;  1BR2 A;  1D0Y A;  2L9Q A;  2M6I A;  5J2T E;  2UU9 T;  1G73 A;  3OVU A;  3KBT A; 
#chains in the Genus database with same CATH homology
 1ZHC A;  2Q9Q B;  2WMN A;  2BDE A;  4H9O C;  2LOP A;  3UTK A;  5FP3 A;  5LJN A;  3I1A A;  2NW8 A;  3OKQ A;  2YU1 A;  2DLR A;  4OHF A;  4F6R C;  5JQG E;  5LXT E;  3C51 A;  3FHN A;  4DBR A;  1HFA A;  2XAQ B;  2SPC A;  4IE7 A;  5LA6 E;  2IW5 B;  3LJC A;  1IJ6 A;  3ZN1 B;  4X1K E;  2WBL A;  1BR1 A;  4XBF B;  5JDG A;  2PG8 A;  2X9X A;  2H3R A;  3SOL A;  3LG7 A;  4HFV A;  2KZ7 B;  3BQL A;  1D1B A;  4TX5 A;  3O4X E;  1IAP A;  2CXL A;  3EVY A;  5L3E B;  2C5J A;  4IGU A;  3PDY A;  2VWA A;  2WM9 A;  4QHO A;  2WSS V;  2YU2 A;  1FMV A;  2NWB A;  2LSK A;  2D0T A;  4X20 E;  2A72 A;  5CB4 E;  3WI3 A;  3SWH A;  4X1I E;  4H63 V;  2VK9 A;  4J2C A;  4KMC A;  2DWG A;  2NTX A;  2QGS A;  4UV9 B;  3F31 A;  5FMN A;  3ETV A;  4TZ4 C;  3Q9D A;  4IDZ A;  3MK7 C;  3EDV A;  3Q5W A;  4H9Q C;  3PUR A;  3RC8 A;  2LSI A;  3O1J A;  2XAF B;  2V26 A;  2VL8 A;  4BJN A;  4AKR B;  3LFM A;  4AQF A;  5LYJ E;  3IHR A;  3Q5X A;  2K5B B;  1YD8 G;  4JLE A;  1YW0 A;  5LOV E;  1Y64 B;  3LK4 2;  4ZS2 A;  3ZMZ B;  2XUE A;  5JR9 C;  3F2E A;  2DNX A;  3O9X A;  5L3C B;  2X9H A;  3PUS A;  3LBX B;  2N2N A;  3RYC E;  4GYS A;  4EB6 E;  3M65 A;  4V1A v;  5H6Q B;  2YEV C;  2MYS A;  4QX8 B;  5L3B B;  2VAS A;  4YLH A;  2X67 A;  3PUG A;  4XZC A;  3RC3 A;  4U74 A;  3OYX A;  5GON E;  5HXC A;  3GA8 A;  2KND A;  3V5U A;  2Q9Q D;  2V7J A;  5EK3 A;  3Q2M A;  4PJL A;  3N9M A;  4WBN E;  3T8O A;  2KT9 A;  3N9N A;  4ZI3 D;  3CKD A;  3DJB A;  4UV8 B;  3CX7 B;  3LK2 B;  1FIO A;  2KWH A;  5DAB A;  4CI2 B;  4EAH A;  2LSY A;  3ANW B;  3ZYM A;  4EZ4 A;  1HX8 A;  3HR0 A;  3CWZ B;  1LRZ A;  3KVA A;  4PNI A;  5HXS A;  5J2U E;  1FEW A;  2V7I A;  4IE0 A;  3QC9 A;  3IEE A;  4OK0 A;  1U5P A;  5FYM A;  1Z0P A;  5LCY A;  3ANW A;  3RYF E;  2H7V C;  3KFW X;  3BK9 A;  3NZP A;  4MLK A;  3KV5 A;  5L3D B;  4PAG A;  5LGU B;  4UIG A;  3AA6 B;  1HG5 A;  4NUV A;  2Q9Q A;  2MOZ A;  3CVR A;  1E1H B;  2C0S A;  3PUA A;  2Z6E A;  3FB2 A;  4DBQ A;  2A3D A;  4JEU B;  4O4J E;  3WAK A;  4MBQ A;  3AB3 B;  1SHZ C;  5J1G A;  3QK6 A;  4KUM B;  3ZMV B;  3NRX A;  2V7L A;  5LHI B;  2LJL A;  3O1I A;  5JVD E;  2E9X B;  4ZI2 C;  4PK6 A;  5JRC A;  3KV4 A;  1BR4 A;  2JRK A;  2ZM2 A;  3OYZ A;  3P7I A;  5HYA A;  2J1D G;  3J9X 1;  4A56 A;  4OYK A;  4O2A E;  3CX6 B;  3FBZ A;  3GMI A;  5E0O A;  1WLX A;  2Y48 B;  2W0G A;  3L09 A;  5JRC B;  4QXC B;  4P09 A;  5BMV E;  2LM9 A;  3ZMS B;  4IE6 A;  5C8Y E;  3HKC E;  3EUH A;  3R84 B;  1FMW A;  4QXB B;  2Y6X A;  1LVK A;  4AQF C;  2CA5 A;  3MZK B;  4HN9 A;  4FI5 A;  4PFP A;  2DHR A;  4U72 A;  4X1Y E;  1X79 A;  4GK5 E;  4WBO A;  1WRD A;  3FXD B;  1SA0 E;  3KBU A;  3OBV E;  1KNZ A;  4TN7 B;  2NW9 A;  1QSD A;  4K0U A;  2M67 A;  1D0X A;  2ES0 A;  4QWN B;  4UVA B;  2ZM0 A;  3UFE A;  2JPF A;  3N2K E;  5FXW A;  2ODV A;  5ETW A;  3BQK A;  2WWU A;  3K3N A;  4CXY A;  1UX5 A;  1ZV4 X;  1AJ3 A;  5LBM A;  2CWY A;  4HGA A;  1VOM A;  5LBQ B;  3W15 B;  1QUU A;  2VKH A;  1MMA A;  2L3L A;  2UXN B;  2V1D B;  2E9X A;  3I9Y A;  4GOU A;  3CQC B;  3SRZ A;  4NUU A;  3U78 A;  2LEH A;  3DP7 A;  3NZQ A;  2W61 A;  1G8X A;  2D2S A;  1MIW A;  4AI6 A;  3J7Y q;  3I0O A;  2X51 A;  4I55 E;  2LSJ A;  3ZMU B;  3AVR A;  3ZCJ A;  1US7 B;  5F8P A;  4TV9 E;  5LJM A;  3RH3 A;  5HXE A;  3RYI E;  2V7K A;  4YHJ A;  3VKG A;  4WNK A;  2KWI B;  3ZYL A;  2XAG B;  2NP9 A;  5TAO A;  3B13 A;  3CML A;  3UUM A;  3WAJ A;  4G2A A;  5LG4 A;  4GIW A;  2KLQ A;  1BR0 A;  3GWH A;  4YJ3 E;  3PUQ A;  3AAE B;  2X9W A;  2V7M A;  3HKD E;  3RRW A;  4KBM B;  3IBP A;  2MBG A;  1MIY A;  1EZ3 A;  2CLY B;  2VB6 A;  4ILU A;  2E9X D;  4P0B A;  3LBX A;  5IHY A;  5EZY E;  3CQX C;  3VHL A;  5FXV A;  1MMG A;  4GK0 E;  2KIN B;  2LHR A;  4C90 A;  2DI4 A;  2XAH B;  2A2F X;  3N9O A;  2JJ9 A;  5JDH A;  3QUJ A;  3HKB E;  3C4Z A;  2OA5 A;  1ZEE A;  5IYZ E;  3L3P A;  4UVC B;  3N9L A;  2L8K A;  3BQI A;  5ADX L;  2WMO A;  3F57 A;  3V5S A;  2UXX B;  3K3O A;  4H63 H;  4ZI7 E;  4UEM A;  2LT3 A;  5L3F B;  3RRC A;  3P8C D;  2ZMA A;  3I0Q A;  1WR6 A;  4IE4 A;  2K48 A;  2XQY A;  2EHO B;  2WAU A;  3C50 A;  4JEH B;  3A5X A;  2BVM A;  4P0A A;  4HKA A;  2W00 A;  4PK4 A;  5HXR A;  4C91 A;  4ASK A;  4TUY E;  5FXZ A;  4IHJ E;  4O2B E;  3ETU A;  3E22 E;  4EZH A;  5JH7 E;  3FXE B;  2HPJ A;  4CXW A;  3C64 A;  2JMK A;  4DVD A;  2ACX A;  5CA1 E;  3CPZ A;  2CM0 A;  1YKE B;  2NTY A;  2CXD A;  5FY7 A;  2ZM8 A;  2K24 A;  4I50 E;  1U4Q A;  2N9D A;  1D0Z A;  3ZC0 A;  4DO0 A;  3AA0 B;  5HXH A;  2GK9 A;  4PJM A;  1LVF A;  5DQV A;  3K8P C;  4EYY R;  4H9N C;  3ZYK A;  3N9Q A;  5FY0 A;  2KXP B;  3ZPO A;  5EK2 A;  2PJQ A;  3ONX A;  2EHO D;  3EDU A;  4I4T E;  5JRE A;  3PU3 A;  2CEA A;  5LNK A;  2CLY C;  4QXH B;  3DTO A;  2X0L B;  2CMR A;  3CQG B;  5AFU L;  4HEA A;  4TV8 E;  4MFR A;  2RP4 A;  2LSG A;  3UT5 E;  4FJO A;  2E8I A;  3D0T A;  1KK7 A;  4AKI A;  2ZLY A;  2CCQ A;  5JDF A;  4ERR A;  4QX7 B;  3NBX X;  5F3J A;  3PU8 A;  2MTQ A;  2XAJ B;  4L9I A;  5FY1 A;  3KV6 A;  2H7O A;  4H9R C;  2BZB A;  3UUX B;  4I43 B;  4YFS A;  4IST A;  1IZN B;  1S94 A;  4UVB B;  2PBI A;  4G63 A;  1H7C A;  2DCF A;  4CQI A;  4E7S A;  3HKE E;  2CWO A;  4UEL A;  2IAK A;  1T98 A;  3CX8 B;  2Y8D A;  3O1H A;  1VRB A;  3AA1 B;  4UF0 A;  4ZHQ E;  4CXX A;  1MIV A;  4M1P A;  2ODU A;  4EOZ B;  2DWK A;  4PJJ A;  2P9B A;  4CZZ B;  5L2L A;  3TKL B;  4QKN A;  4Z8X A;  4AKG A;  3KIN B;  2D5U A;  5L3G B;  4UF0 B;  2JQQ A;  3VKH A;  5LGT B;  4E7Z A;  3C98 B;  4ISS A;  1UCU A;  4ZOL E;  1WYC A;  1MMN A;  3I9W A;  3PTR B;  3ESL A;  5LHH B;  1MNE A;  4ZI3 C;  4AXP A;  4YJ2 E;  3HA4 A;  4CI3 B;  3AVS A;  3VU7 H;  2VKD A;  1MMD A;  2VKJ A;  4O4H E;  3RX6 A;  2BVL A;  1V9D A;  3JC6 D;  4L0R A;  4OFZ A;  4PJN A;  3RKO A;  3LK3 B;  3OJA A;  3MXZ A;  4UXN B;  3GN5 A;  1HG2 A;  2KMF A;  3AAA B;  4HE8 A;  1HCI A;  4H9S E;  4PW8 A;  2LE8 A;  5JDM A;  4O4I E;  5H6R B;  3H37 A;  1CUN A;  2I59 A;  4HTE A;  5M4Y A;  4BAY B;  3GN5 B;  2E9X C;  2HH7 A;  2N1G A;  5HWY A;  4O8S A;  2X68 A;  3R6N A;  3H3A A;  2CXF A;  1MND A;  2W62 A;  3IF8 B;  3N5L A;  2LHN A;  1D1A A;  4IIJ E;  2NOX A;  2XAS B;  4AKH A;  3ZN0 B;  3MJX A;  2C5I T;  5EK4 A;  3NRY A;  1LKX A;  3ZLI A;  5HWX A;  4DMW A;  5JR9 B;  2W63 A;  5KMG P;  3AAI A;  4AQG A;  2HPL A;  1WYB A;  2Q9Q C;  2VKO A;  3MAC A;  1NAF A;  3E0Z A;  5LHG B;  4XAX B;  3KVB A;  3N2O A;  4PFO A;  2PFV A;  1O3X A;  2K9A A;  2NW7 A;  5A1L A;  3UUN A;  3JC6 C;  2YK0 A;  3KDS E;  3HL6 A;  3ZJ1 A;  5JDL A;  4CI1 B;  3C4X A;  3N2G E;  4EIW A;  2QA7 A;  3N9P A;  4GYR A;  4JUY A;  4AKL A;  1B7T A;  4BA9 A;  3C4W A;  3HI2 A;  5FXX A;  4MHC A;  3U3I A;  4BJM A;  3MKD A;  3AA7 B;  3RYH E;  4DMV A;  5CA0 E;  4ADZ A;  4OYJ A;  3ZJ2 A;  3UUL A;  3ZMT B;  2X66 A;  4EXT A;  2EHO A;  5JDQ A;  2YIN A;  5KX5 E;  2D0U A;  4EYU A;  1OXZ A;  4L5G A;  2C5K T;  4O4L E;  5DJQ C;  5JDN A;  4MAL A;  4WW0 A;  4B6X A;  2RA1 A;  4KP3 C;  1UX4 A;  4ANJ A;  5KDM C;  1IJ5 A;  4ZS3 A;  3K3Q C;  5LP6 E;  3PE0 A;  4IE5 A;  2EHO C;  2XHE B;  3FBL A;  1S35 A;  1D1C A;  2XTL A;  3B57 A;  3KV9 A;  3ZC1 A;  3RPU A;  4DND A;  2IC6 A;  1HF8 A;  1NWM X;  5JR9 A;  1YKH B;  3E08 A;  3ZEF B;  5FNV E;  4ZI2 D;  2X9Y A;  2B1E A;  2JMH A;  3SS1 A;  5LGN B;  1HS7 A;  1ZKE A;  4H9P C;  3ZCI A;  2CE7 A;  2IC9 A;  3S4U A;  3MA9 A;  1OWA A;  2G0U A;  1HTJ F;  4N78 D;  2LOS A;  4PK5 A;  5HAX A;  5DQW A;  1BR2 A;  1D0Y A;  2L9Q A;  5J2T E;  1G73 A;  3KBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...