3EVYA

Crystal structure of a fragment of a putative type i restriction enzyme r protein from bacteroides fragilis
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
83
structure length
83
Chain Sequence
MKPYEKLVERFNEMAAEFLSYFPTVKSVGNLESELDKRRFVILFRAMLRLRNEVKGYNEFDAEDLTIEEQRFADYQSKYLDMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Putative type I restriction enzyme R protein
publication title Crystal structure of a fragment of a putative type I restriction enzyme R protein from Bacteroides fragilis
rcsb
source organism Bacteroides fragilis nctc 9343
total genus 32
structure length 83
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.910 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3evyA00
3EVYA
chains in the Genus database with same CATH superfamily
3RF1A 1WR6A 2Z6EA 5ABEA 5DABA 4O4JE 2ZM8A 4IE4A 2PFVA 2K24A 2VASA 2OV9A 2X51A 3ZSSA 4E7ZA 3I9WA 3A8YC 4PFOA 3K8PC 4A5XA 4G63A 4ZOLE 3K3NA 4QWNB 4EEDA 4HN9A 3RC3A 3AE4A 1XDOA 3Q9DA 3KBTA 2W2UA 4GOUA 5HCMA 3N2KE 1HX8A 2V6YA 4HWIB 2BKNA 4LF4T 2XQ4A 2CA5A 2WMNA 4IDOA 4ZI7E 2RP4A 2H89A 2PBIA 3N9LA 3ZJ1A 3KV9A 3MXZA 2VL0A 3OBVE 2V7LA 4IREA 4PFPA 3OYXA 4K0KT 2V7IA 4DV7T 3ZC1A 3UULA 4DUYT 3EDVA 3GN5A 5AQPB 3RYCE 2CHNA 5FY7A 1JNZA 3AE1A 5AQGB 2W4XA 3AAAB 2FJEA 4JYAT 4ISSA 4CN6A 2WAUA 2XTLA 3PDYA 4JI8T 1YKHB 3M3ZB 2J62A 4H9NC 2JMHA 2ES0A 1XDPA 2CWYA 2RPAA 3JAEA 3RYFE 4U33A 1OEDA 2XPKA 3ETUA 2VL8A 2ZMAA 2YOEA 3UUBA 2KSRA 3DP7A 4DVDA 4ILCA 4EAHA 3RYIE 4JI0T 4DNDA 3PE0A 4TWDA 2W67A 3NKZA 2D5UA 2VK9A 5LMNT 3I0OA 3P8CD 1N34T 2CE7A 2QRXA 2NP9A 5ADXL 3QB5K 5IHYA 1UURA 3ZMUB 1OEDC 4XAXB 3AE3A 1VOMA 5FP3A 1B7TA 5FY0A 4U7YA 5HEUA 2LSKA 3QK6A 5GONE 1OXZA 5L3GB 2EHOD 3AAIA 3GA8A 2H7VC 1MMGA 2BZBA 1LRZA 5JDFA 4HWCA 5J0ZA 4NIQA 3ZMTB 4KUMB 3EVYA 2LSGA 5LOVE 2LLYA 5LHHB 4YY3T 5LXTE 1Z0PA 2VKOA 1HS7A 5AQOB 3B13A 1T8BA 3T8OA 4AQFA 4I50E 5FVKA 5FYMA 4DV1T 2CPTA 2BG9B 4PK4A 4ZS3A 2LM2A 3CIRA 3K3OA 4KHZF 4M1PA 3CWZB 3P4RA 1VCSA 2WY2A 4AKGA 2KWIB 1KNRA 4ZHQE 4YJ3E 4P0AA 1UX5A 2CXDA 3ZYMA 4YSYA 2CHOA 3UFEA 4AQFC 4N78D 1QSDA 5JVDE 5J1GA 5JR9A 5HXHA 3UQ4A 4TX5A 1IBMT 1MNEA 4JI6T 3ANWA 1UCUA 3HKDE 3PUWF 2DCFA 1LVKA 4BJMA 2KWHA 2H7OA 2CWOA 3FZKB 5LYJE 2LOPA 5AQTB 5JR9C 4GK0E 3RIUA 2XUEA 3K1SA 3MK7C 4GK5E 4U74A 5LJMA 5C8YE 1D1AA 3B57A 4NUVA 5HWXA 2LHNA 3UFGA 4WBOA 2V6XA 3V5SA 5L4EA 2D0UA 3ZMSB 2BS3A 2VQET 4DBQA 1W09A 4YJ2E 3ONXA 3FXDB 2JRKA 2YK0A 2LKHA 2ACXA 2WWUA 4MLKA 4PJJA 2XAJB 4UV9B 3P4WA 1O3XA 3VU7H 4ZI2C 4C90A 5HEGA 3P50A 3RIUC 4HFCA 2D0TA 4DR1T 3WAJA 5EK3A 3N5LA 3LFMA 3ZJ2A 2J47A 3H3MA 3H37A 1WFDA 2L3LA 5FVLA 3SFEA 3AXJB 3PUQA 2BS2A 3P4PA 1Y64B 1VRBA 3RQUA 2B76A 2C5IT 3LK3B 4IE0A 2NTYA 3ZCJA 3HKEE 3TLVA 4COFA 4IDNA 3UQ7A 1HR0T 4CXWA 2V6YB 3IF8B 2HHHT 5ABFA 4HWFA 4DV2T 4OX9T 3RRWA 2QVAA 2W00A 5M4YA 4Z91A 2LHRA 1UUSA 3C4WA 2HH7A 3NWIA 5LBQB 1L0VA 3K3QC 3GN5B 4LFAT 4DV4T 1N32T 3QB5A 5FXZA 4IE5A 4LMKA 4L0RA 5FXWA 4H9SE 1HNXT 4LF7T 2D9DA 1JNRA 3PUGA 2LM9A 2LKGA 5HXRA 4HE8A 3EI0A 1G73A 4I55E 2AXDS 4U72A 3P4SA 5CFBA 1HCIA 4EV6A 5LHGB 1ZV4X 3H3AA 1NEKA 4YSZA 3V5UA 3QC9A 2EHOB 4NPPA 1J5ET 3MJXA 1XMQT 4FJOA 3VR8A 4KI0F 3KV6A 3ZKRA 4H9PC 2DLRA 3WAKA 3OJAA 2LT3A 3QNUA 1IZNB 4JBWF 2XZEA 2Q9QB 3ZPOA 4UIGA 2MOZA 3W15B 2X68A 1FIOA 1UK5A 4H9QC 1IBKT 5AQQB 3AE6A 5FXVA 1N36T 5J2TE 5L3DB 4J2CA 4U2YA 2ZM0A 4X64T 4YXDA 2QA7A 3T1YT 1WLXA 1N33T 4ZI3D 4OHFA 3WI3A 1I6ZA 1US7B 3ZT7A 4ADZA 2DNXA 2ZM6T 4NXNT 4AIUA 3CKDA 4HFBA 4Z90A 4DBRA 2KINB 3F57A 2D2SA 5HXSA 2IUBA 3UU5A 5L2LA 2A9UA 4TV9E 4ILAA 4ERRA 2VKJA 1AJ3A 3MACA 2UU9T 3OVUA 3KINB 3JC6C 4HFIA 4UVCB 4MHCA 3SFDA 5JTGA 1XWMA 4EB6E 5JDHA 5ABHA 3RYHE 2WB5A 2BVMA 2ZM2A 5HEJA 5LG3A 1J1JA 4LF5T 3B5MA 5JQGE 2X9WA 5E0OA 4QX7B 1KFYA 4AI6A 2OLTA 2N1GA 3CX6B 4EYUA 1T7SA 3AE8A 4A56A 4LF6T 3Q5EA 2CRBA 4B6XA 3ZN0B 3VR9A 3KVAA 4JI4T 4GYSA 1SA0E 5DQVA 3BQLA 2WM9A 2VURA 4LFBT 3C51A 4LFCT 4YTMA 4LMJA 2XQ5A 3CQXC 4AQYT 5FXXA 5JDLA 3IHRA 4CN4A 1BR4A 2KNDA 4PJLA 4QX8B 2JQHA 4NXMT 1EZ3A 5JREA 2X9XA 3CVRA 5L3CB 3AE5A 4IE7A 2E9XA 4O8SA 2UXCT 3AE7A 4EIWA 2LE8A 1ZEEA 3ABVA 4E7SA 1YKEB 1E1HB 5LG4A 5IUXA 3BQIA 2CLYB 5ABFB 3NZPA 4X66T 5L3FB 4IHJE 3UU8A 4P0BA 5AQHB 1HX1B 3O9XA 4UF0B 2CBJA 2LEHA 2E9XC 3UU3A 2JQKA 2Y48B 4EEBA 4JUYA 2MBGA 4AKRB 4F8HA 1IBLT 5LGTB 3MKDA 2NOXA 1KNZA 4IT4A 4A98A 5F8PA 1UGOA 4P09A 4CXYA 2WU5A 3UU6A 2WZIA 4TV8E 3I1AA 3FZHB 3ZYKA 5JRCA 4LMLA 2CCQA 4DR7T 2HPLA 1ZOYA 2Q9QD 4X1KE 5ABGA 2IHR1 5AQKB 2JPFA 4L5GA 2V7KA 3AECA 1T98A 4QH1A 4EYYR 2XAGB 4GKJT 1XZYA 3PTRB 2BDEA 2UXBT 3VKHA 5IWAT 3LBXB 2CBIA 5AQVB 5L3EB 5HCJA 2VKDA 4O2BE 2X0HA 4JI5T 3N9QA 4GIWA 3UU4A 3AA1B 2X9YA 3E08A 3GWHA 3HKCE 3X1DA 3QUJA 5LNKA 2W66A 1WR0A 2K5BB 4ILUA 3C4ZA 3N9MA 4JV5T 1KNPA 2L8KA 2NTXA 3VHLA 3PUAA 2VVSA 3G06A 3LK42 2V1DB 3RX6A 5HXCA 3D0TA 3PUXF 1WYCA 4AXPA 1NWMX 2UXNB 2QYWA 4EOZB 3FB2A 3LG7A 2W61A 3TLSA 3AAEB 4KX6A 4AQGA 4DV0T 1NAFA 3ONLC 5C2TA 2YINA 5AQUB 4H63H 1R8IA 3ONJA 5JDNA 3N9PA 1MIWA 3FBLA 4DIDB 3LSVA 1CUNA 2DWGA 2V8SV 3RIFA 4I43B 4UEMA 4JEUB 4IGUA 2XAHB 5BR8T 5AQFB 4XBFB 2CXFA 5FKYA 5IYZE 3L09A 3C64A 5C3JA 3EABA 1YD8G 2WSSV 4PW8A 4DR6T 2PTFA 2H3RA 5HXEA 3GMIA 4WW0A 5CA0E 3O1IA 3PV0F 4TNVA 4NUUA 5LGUB 2RA1A 1WRDA 5FL0A 5L3BB 4CZZB 4BJNA 4OYJA 3RKGA 2VQFT 2JMKA 3QOFA 3MZKB 2CMRA 3E22E 3LJCA 4V1Av 4K0UA 2YDSA 5CGMA 1IJ6A 3NZQA 3AA0B 4I4TE 5HEOA 2VVNA 2E5VA 2G0UA 1MMDA 2JQQA 5KX5E 3JCFA 2E8IA 5KDMC 3A7MA 2LOSA 1VCTA 3ZMVB 4A97A 1OEDB 1D0ZA 1MIVA 3I9YA 5CJ5A 3HKBE 2CM0A 3L39A 4JI3T 3N9NA 2C0SA 3FHNA 3RPUA 2IDOB 5LP6E 4KHPT 3AVRA 3ZT5A 2JIWA 2BG9A 3FXEB 2M6IA 2M6BA 4EZ4A 3AEBA 5F3JA 1YQ3A 4DV5T 4WYVA 2NW7A 1D1BA 2XSAA 3ZMZB 1ZHCA 2AE9A 4YHJA 4HWDA 1H7CA 4KMCA 4I0UA 4H63V 4PJMA 3NVOA 4Q25A 2BG9C 4G2AA 1Z8UA 3LDQB 2XQYA 4TZ4C 5LB7B 4PNIA 4EGWA 4UELA 4C91A 1IAPA 2X0YA 3KBUA 2ZLYA 2XASB 3IBPA 1LVFA 2WMOA 2YEVC 2A2FX 3KV5A 3ZCIA 3ETVA 2K3WA 5JRCB 2VWAA 2XHEB 4DR4T 2VKHA 4QXHB 4O2AE 3ZN1B 2DHRA 3BQKA 2CEAA 5LHIB 3EHZA 1IJ5A 4O4LE 3PU3A 5H6QB 4CQIA 2WDVA 4IL4A 2IC9A 4JLEA 2WS3A 2XY8B 4DUZT 1W0AA 2GK9A 4HTEA 2A3DA 2YN6A 4DV6T 2FJBA 2XAQB 4IDZA 4CN1A 4DR5T 4X1YE 1Y01A 2V7JA 1MMNA 3TLUA 4F6RC 5JR9B 2P9BA 3PUZF 3NBXX 4GYRA 2YU2A 5FL1A 4IDPA 5AFUL 3L8RA 5DJQC 2Y8DA 2BS4A 5JDGA 3JC6D 2E2AA 3ANWB 3CQCB 3AVSA 5AQNB 3AXJA 2YU1A 4ASKA 3PURA 3KV4A 1KF6A 2B1EA 3U3IA 4OK0A 3M65A 4IDQA 4X20E 4U3CA 3R84B 4HFHA 1E2AA 1FMWA 3AEGA 1W9RA 4ZZCA 2DI4A 2LSYA 2UUBT 1S94A 3J7Yq 2V26A 4TUYE 1DU2A 5H6RB 3F2EA 1HNWT 4BAYB 2N2NA 4WBNE 3AE2A 1UX4A 3FBZA 5HWYA 1XNRT 1D0YA 3ZC0A 2WZHA 4MALA 3VRAA 2MTQA 1OEDE 4OYKA 5LBMA 3C50A 2XQ6A 1I94T 4AISA 4ZZBA 2N9DA 3KVBA 2XSBA 1HF8A 2C5JA 2DWKA 2WQYA 3N9OA 5LA6E 2W63A 3TLTA 3AA7B 4DMWA 2K48A 1G8XA 5JDQA 3CPZA 2NWBA 2L9QA 5EK2A 4UR9A 2SPCA 4YTPA 5JH7E 4PK5A 2I59A 3UTKA 2XQ9A 2FJAA 2I0MA 3EUHA 4JEHB 5DQWA 4TWFA 3CX7B 3RRCA 2QGSA 4X1IE 4B3MT 3UUNA 1J5WA 2IIUA 3AB3B 3SWHA 2IW5B 4HGAA 3JADA 4O4IE 2V5DA 3S4UA 3VRBA 2KZ7B 2HN1A 2A72A 1W0BA 1M7KA 1CHUA 3N2OA 3AEDA 4HFEA 5FY1A 3CMLA 2EHOA 2ODUA 3AEFA 2NW9A 5AQIB 2FUPA 4B3ST 4UVBB 3A5XA 3U78A 5AQMB 3HA4A 4O4HE 2MAWA 2XAFB 4YTNA 2WDQA 4TNWA 2E9XD 1HG2A 2Q9QA 5LCYA 1LKXA 4KBMB 1YQ4A 4WZXA 1HNZT 1M62A 4UV8B 1MNDA 2EHOC 4L9IA 3UUMA 4HFVA 1KEYA 3HR0A 4U7IA 2CXLA 3FZMB 3JAFA 1E7PA 4FI5A 2E5LT 2UUCT 4H9OC 2Q9QC 4EXTA 3RH3A 4PAGA 1XMOT 4GKKT 2M67A 3DTOA 4DMVA 3PJAJ 5JDMA 2F4VT 3ZLIA 1FMVA 2MPKA 2H88A 3CQGB 2V7MA 4JI2T 3Q5XA 1V9DA 2XQAA 2PJQA 5BMVE 4H9RC 3F31A 4ISTA 3HL6A 4DV3T 1SHZC 4HKAA 2UXDT 3Q5WA 2VB6A 1U5PA 4PK6A 3EDUA 4CI2B 4ZXLA 2IC6A 1HG5A 4Z8XA 3C4XA 4AKHA 2KMFA 3CK6A 4YSXA 3E0ZA 1NENA 2DL1A 2WDRA 1QUUA 4MFRA 3NRXA 1BR0A 2J4GA 4QHOA 5LMUT 4HEAA 4B3RT 2R6GF 4IE6A 3O4XE 3OYZA 2XJ7A 4X62T 4QH5A 1X9BA 4HWHA 1SE7A 3ESLA 2XQ7A 3AEEA 2BKOA 4MBQA 1BR2A 4TN7B 2WWVA 1T72A 2W0GA 3UUXB 2J1DG 2YKSA 4ZI2D 3AEAA 1GQEA 2W62A 4XZCA 3PJAA 5HYAA 5TAOA 2BVLA 4UXNB 1HFAA 4X5TA 4HFDA 5L47A 2LRKA 3OPCA 3PUYF 3O1JA 4ZEYA 1ZP0A 5KMGP 3DJBA 2XQ8A 1SUMB 3R6NA 5A1LA 4QXBB 3HI2A 4PJNA 4ZS2A 3FZLB 2IMLA 3P4QA 3RC8A 3ZSTA 5EK4A 1MIYA 2KXPB 3RHWA 3LK2B 1XNQT 2JQ9A 4U31A 2X66A 4JI7T 3KFWX 3RLFF 5AQRB 1FJGT 2OA5A 2LRLA 3FZFB 4YFSA 2FJDA 2BBHA 2KLQA 4CI3B 1D1CA 3OKQA 2I6HA 2JJ9A 2XM1A 3AA6B 3UT5E 3I0QA 1S35A 2WBLA 3Q5DA 4UF0A 1OWAA 2KT9A 4EZHA 3ZT6A 2BG9E 3RGLA 2PG8A 4OFZA 5AQSB 2Y6XA 4IL9A 1MMAA 4BA9A 1X79A 1U4QA 4AKIA 2CLYC 4CXXA 5HEHA 5F5WA 4DR3T 4JI1T 4YHHT 1D0XA 3EAMA 2E9XB 3J9X1 2XQ3A 3PU8A 4YT0A 3TLWA 3SS1A 2XM2A 1KK7A 3OTOT 3CX8B 3ZEFB 3KDSE 1ZKEA 2C5KT 2V5CA 4IIJE 2NR4A 3N2GE 3Q2MA 5KXJA 3LBXA 2X0LB 4KP3C 1WYBA 4U2ZA 2BBJA 5L4HA 4QXCB 4CI1B 1YXRA 2NW8A 2UXXB 4YLHA 2HN2A 4UVAB 3RKOA 2HPJA 1BR1A 5LJNA 1HTJF 4B3TT 2LSIA 3O1HA 2X67A 4ILBA 3PUVF 2WU2A 2BKPA 4DR2T 2ACZA 5ETWA 1WCRA 3RQWA 2UUAT 5EZYE 4QH4A 4ZI3C 3PUSA 4X65T 3IEEA 2LSJA 3NRYA 2X9HA 1FEWA 2IAKA 2YDQA 3L3PA 3MA9A 3P7IA 4TWHA 3BK9A 5J2UE 2FBWA 4WNKA 5CB4E 4AKLA 5HAXA 3C98B 3IA3A 5AQJB 3SOLA 3VKGA 3SRZA 3RI5A 4QKNA 4LF8T 5CA1E 5LGNB 5FNVE 3RIAA 2LJLA 1QLBA 3TKLB 4P1NA 3ZYLA 2MYSA 3AE9A 2YDRA 1YW0A 4ANJA 4LF9T 2ODVA 5AQLB 4DO0A 5FMNA 2WCAA 3T1HT 2K9AA 2WP9A
chains in the Genus database with same CATH topology
2NW9A 4L0RA 1WR6A 5FXWA 4H9SE 1WYCA 2Z6EA 4UVBB 3A5XA 3U78A 4AXPA 3PUGA 2LM9A 5DABA 1NWMX 4O4JE 2ZM8A 5HXRA 4IE4A 2PFVA 3HA4A 4HE8A 2UXNB 2K24A 2VASA 4O4HE 1G73A 2X51A 4I55E 4EOZB 3I9WA 4E7ZA 3FB2A 2XAFB 4PFOA 3K8PC 3LG7A 2E9XD 1HG2A 2Q9QA 2W61A 4U72A 4G63A 5LCYA 1HCIA 1LKXA 4KBMB 5LHGB 3AAEB 4AQGA 1NAFA 2YINA 4UV8B 1ZV4X 4ZOLE 1MNDA 3H3AA 4H63H 2EHOC 3K3NA 3V5UA 4QWNB 3QC9A 4HN9A 4L9IA 3RC3A 2EHOB 3UUMA 4HFVA 3MJXA 5JDNA 3N9PA 1MIWA 4FJOA 3Q9DA 3KBTA 3FBLA 4GOUA 3KV6A 3HR0A 1CUNA 3N2KE 1HX8A 2CXLA 2DWGA 4H9PC 2DLRA 3WAKA 4FI5A 4I43B 4UEMA 3OJAA 2CA5A 4H9OC 2LT3A 2WMNA 2Q9QC 1IZNB 4ZI7E 4EXTA 2RP4A 4JEUB 3RH3A 2Q9QB 3ZPOA 4PAGA 4IGUA 2XAHB 2PBIA 2M67A 4XBFB 2CXFA 3N9LA 4UIGA 3ZJ1A 3KV9A 3DTOA 3MXZA 2MOZA 4DMVA 5IYZE 3L09A 3OBVE 3C64A 3W15B 2X68A 1FIOA 2V7LA 5JDMA 4H9QC 1YD8G 4PFPA 3ZLIA 3OYXA 1FMVA 2WSSV 5FXVA 2V7IA 3CQGB 4PW8A 5J2TE 3ZC1A 2V7MA 3UULA 5L3DB 4J2CA 3EDVA 2ZM0A 2H3RA 3GN5A 3Q5XA 3RYCE 5FY7A 1V9DA 2QA7A 1WLXA 5HXEA 3GMIA 4ZI3D 2PJQA 4OHFA 5BMVE 4H9RC 4WW0A 5CA0E 3O1IA 3F31A 4NUUA 3WI3A 4ISTA 3HL6A 3AAAB 5LGUB 2RA1A 1SHZC 4ISSA 1WRDA 2WAUA 2XTLA 1US7B 5L3BB 4HKAA 3PDYA 4CZZB 1YKHB 4ADZA 2DNXA 3Q5WA 2VB6A 1U5PA 4H9NC 4PK6A 3EDUA 4BJNA 2JMHA 4CI2B 2ES0A 2CWYA 2IC6A 1HG5A 3CKDA 4Z8XA 3C4XA 3RYFE 4OYJA 4AKHA 2KMFA 3ETUA 4DBRA 3E0ZA 2VL8A 2KINB 2JMKA 2D2SA 2ZMAA 3F57A 3DP7A 4DVDA 4EAHA 3MZKB 2CMRA 3E22E 3RYIE 5HXSA 3LJCA 1QUUA 4MFRA 3NRXA 4K0UA 4V1Av 1BR0A 4DNDA 3PE0A 5L2LA 4QHOA 4TV9E 1IJ6A 3NZQA 3AA0B 4I4TE 2D5UA 4HEAA 2VK9A 3I0OA 4ERRA 2VKJA 3P8CD 4IE6A 3O4XE 3OYZA 1AJ3A 2G0UA 2CE7A 3MACA 1MMDA 2NP9A 5ADXL 3KINB 5IHYA 2JQQA 3JC6C 5KX5E 5KDMC 2E8IA 3ESLA 2LOSA 3ZMUB 4UVCB 4XAXB 4MHCA 1VOMA 3ZMVB 1D0ZA 1MIVA 5FP3A 1B7TA 4MBQA 1BR2A 5FY0A 4TN7B 3I9YA 3HKBE 2LSKA 2CM0A 4EB6E 2W0GA 5JDHA 3QK6A 3RYHE 3UUXB 3N9NA 2C0SA 3FHNA 3RPUA 5GONE 5LP6E 3AVRA 1OXZA 2J1DG 4ZI2D 2BVMA 3FXEB 5L3GB 2ZM2A 2EHOD 4EZ4A 3AAIA 3GA8A 5F3JA 2H7VC 2W62A 1MMGA 2NW7A 4XZCA 5JQGE 2X9WA 2BZBA 1D1BA 1LRZA 5HYAA 5TAOA 2BVLA 4UXNB 5E0OA 3ZMZB 1HFAA 5JDFA 4QX7B 4AI6A 3ZMTB 1ZHCA 2N1GA 4KUMB 3EVYA 2LSGA 5LOVE 5LHHB 4YHJA 1H7CA 3CX6B 1Z0PA 4KMCA 2VKOA 3O1JA 4EYUA 5LXTE 1HS7A 5KMGP 3B13A 4A56A 4H63V 3DJBA 4PJMA 3T8OA 3R6NA 5A1LA 4QXBB 4AQFA 3HI2A 4G2AA 4I50E 4PJNA 5FYMA 4ZS2A 4B6XA 4PK4A 2XQYA 4TZ4C 3RC8A 4ZS3A 4PNIA 5EK4A 1MIYA 3K3OA 2KXPB 4UELA 3LK2B 3ZN0B 4C91A 1IAPA 2X66A 3KBUA 2ZLYA 3KVAA 2XASB 3KFWX 3IBPA 4M1PA 1LVFA 2WMOA 2YEVC 3CWZB 2A2FX 4GYSA 3KV5A 4AKGA 1SA0E 3ZCIA 2KWIB 5DQVA 3BQLA 2OA5A 3ETVA 4ZHQE 2WM9A 4YJ3E 4P0AA 5JRCB 1UX5A 4YFSA 2CXDA 2VWAA 2XHEB 3C51A 3ZYMA 2VKHA 4QXHB 4O2AE 3UFEA 3ZN1B 4AQFC 2DHRA 4N78D 1QSDA 3BQKA 2KLQA 2CEAA 4CI3B 5LHIB 3CQXC 1D1CA 5JVDE 1IJ5A 3OKQA 5J1GA 4O4LE 5FXXA 5JDLA 5JR9A 5HXHA 3PU3A 2JJ9A 3IHRA 3AA6B 1BR4A 3UT5E 3I0QA 2KNDA 1S35A 4PJLA 2WBLA 4QX8B 4TX5A 5H6QB 1EZ3A 4UF0A 4CQIA 5JREA 1OWAA 2X9XA 1MNEA 3CVRA 2IC9A 4JLEA 5L3CB 2GK9A 4HTEA 2KT9A 4EZHA 3ANWA 4IE7A 2E9XA 4O8SA 2A3DA 1UCUA 3HKDE 2XAQB 2PG8A 4OFZA 4IDZA 2DCFA 1LVKA 2Y6XA 4X1YE 2KWHA 2LE8A 4BJMA 1ZEEA 4EIWA 4E7SA 2H7OA 1MMAA 1YKEB 4BA9A 1X79A 1U4QA 2CWOA 2V7JA 1E1HB 1MMNA 5LG4A 5LYJE 2CLYC 4AKIA 2LOPA 5JR9C 3BQIA 4GK0E 2CLYB 4F6RC 3NZPA 5JR9B 5L3FB 4CXXA 2P9BA 2XUEA 3MK7C 3NBXX 4IHJE 4GYRA 2YU2A 4GK5E 4P0BA 4U74A 5AFUL 4UF0B 5DJQC 5LJMA 3O9XA 5C8YE 2Y8DA 1D1AA 3B57A 4NUVA 5HWXA 2LHNA 2LEHA 2E9XC 5JDGA 4WBOA 3JC6D 2Y48B 3V5SA 2D0UA 3ZMSB 3ANWB 1D0XA 2E9XB 4JUYA 3J9X1 2MBGA 3CQCB 4AKRB 3AVSA 4DBQA 3PU8A 2YU1A 4YJ2E 5LGTB 3ONXA 4ASKA 3FXDB 3PURA 3MKDA 3KV4A 2JRKA 2YK0A 3SS1A 2B1EA 3U3IA 2NOXA 1KK7A 4OK0A 3M65A 3CX8B 2ACXA 3ZEFB 2WWUA 3KDSE 4MLKA 2XAJB 4PJJA 4X20E 4UV9B 1KNZA 5F8PA 1ZKEA 1O3XA 3R84B 3VU7H 4P09A 4ZI2C 2C5KT 4C90A 1FMWA 4CXYA 2DI4A 2D0TA 4IIJE 4TV8E 2LSYA 3I1AA 3N2GE 3Q2MA 3ZYKA 1S94A 3LBXA 2X0LB 4KP3C 3WAJA 3J7Yq 5EK3A 3N5LA 3LFMA 5JRCA 2V26A 2CCQA 4TUYE 3ZJ2A 5H6RB 3F2EA 3H37A 2HPLA 4BAYB 1WYBA 2N2NA 4WBNE 2Q9QD 2L3LA 1UX4A 3FBZA 5HWYA 4X1KE 1D0YA 3ZC0A 4MALA 2MTQA 4QXCB 4CI1B 2NW8A 4OYKA 5LBMA 2UXXB 4YLHA 2JPFA 3PUQA 4UVAB 3C50A 4L5GA 2V7KA 1Y64B 3RKOA 2HPJA 1T98A 1BR1A 1VRBA 4EYYR 2N9DA 5LJNA 2C5IT 2XAGB 1HTJF 3KVBA 3LK3B 4IE0A 3PTRB 2BDEA 1HF8A 2C5JA 2DWKA 2LSIA 3N9OA 3VKHA 3O1HA 2X67A 2NTYA 2W63A 3LBXB 5LA6E 3ZCJA 4DMWA 3AA7B 5ETWA 3HKEE 5EZYE 2K48A 4ZI3C 3PUSA 5L3EB 1G8XA 5JDQA 4CXWA 3IEEA 3CPZA 2VKDA 2NWBA 2LSJA 3NRYA 2L9QA 2X9HA 1FEWA 4O2BE 5EK2A 2IAKA 3IF8B 3L3PA 3MA9A 3P7IA 2SPCA 3N9QA 3BK9A 4GIWA 3AA1B 2X9YA 5JH7E 4PK5A 5J2UE 3E08A 2I59A 3GWHA 3HKCE 3UTKA 3RRWA 4WNKA 2W00A 5CB4E 5M4YA 3EUHA 4AKLA 3QUJA 5HAXA 3C98B 5LNKA 2LHRA 4JEHB 5DQWA 3CX7B 3RRCA 2K5BB 3SOLA 2QGSA 3C4WA 4ILUA 3VKGA 3C4ZA 2HH7A 3N9MA 3SRZA 4X1IE 3UUNA 4QKNA 3AB3B 3SWHA 5CA1E 5LGNB 5FNVE 5LBQB 2IW5B 4HGAA 2LJLA 3TKLB 4O4IE 3S4UA 3K3QC 2KZ7B 2L8KA 3ZYLA 2NTXA 3VHLA 2MYSA 2A72A 3GN5B 5FY1A 3N2OA 1YW0A 4ANJA 2ODVA 3CMLA 3PUAA 3LK42 2EHOA 2ODUA 5FXZA 4DO0A 2V1DB 5FMNA 2K9AA 3RX6A 5HXCA 4IE5A 3D0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EVY A; 
#chains in the Genus database with same CATH topology
 3RF1 A;  1WR6 A;  2Z6E A;  5ABE A;  5DAB A;  4O4J E;  2ZM8 A;  4IE4 A;  2PFV A;  2K24 A;  2VAS A;  2OV9 A;  2X51 A;  3ZSS A;  4E7Z A;  3I9W A;  3A8Y C;  4PFO A;  3K8P C;  4A5X A;  4G63 A;  4ZOL E;  3K3N A;  4QWN B;  4EED A;  4HN9 A;  3RC3 A;  3AE4 A;  1XDO A;  3Q9D A;  3KBT A;  2W2U A;  4GOU A;  5HCM A;  3N2K E;  1HX8 A;  2V6Y A;  4HWI B;  2BKN A;  4LF4 T;  2XQ4 A;  2CA5 A;  2WMN A;  4IDO A;  4ZI7 E;  2RP4 A;  2H89 A;  2PBI A;  3N9L A;  3ZJ1 A;  3KV9 A;  3MXZ A;  2VL0 A;  3OBV E;  2V7L A;  4IRE A;  4PFP A;  3OYX A;  4K0K T;  2V7I A;  4DV7 T;  3ZC1 A;  3UUL A;  4DUY T;  3EDV A;  3GN5 A;  5AQP B;  3RYC E;  2CHN A;  5FY7 A;  1JNZ A;  3AE1 A;  5AQG B;  2W4X A;  3AAA B;  2FJE A;  4JYA T;  4ISS A;  4CN6 A;  2WAU A;  2XTL A;  3PDY A;  4JI8 T;  1YKH B;  3M3Z B;  2J62 A;  4H9N C;  2JMH A;  2ES0 A;  1XDP A;  2CWY A;  2RPA A;  3JAE A;  3RYF E;  4U33 A;  1OED A;  2XPK A;  3ETU A;  2VL8 A;  2ZMA A;  2YOE A;  3UUB A;  2KSR A;  3DP7 A;  4DVD A;  4ILC A;  4EAH A;  3RYI E;  4JI0 T;  4DND A;  3PE0 A;  4TWD A;  2W67 A;  3NKZ A;  2D5U A;  2VK9 A;  5LMN T;  3I0O A;  3P8C D;  1N34 T;  2CE7 A;  2QRX A;  2NP9 A;  5ADX L;  3QB5 K;  5IHY A;  1UUR A;  3ZMU B;  1OED C;  4XAX B;  3AE3 A;  1VOM A;  5FP3 A;  1B7T A;  5FY0 A;  4U7Y A;  5HEU A;  2LSK A;  3QK6 A;  5GON E;  1OXZ A;  5L3G B;  2EHO D;  3AAI A;  3GA8 A;  2H7V C;  1MMG A;  2BZB A;  1LRZ A;  5JDF A;  4HWC A;  5J0Z A;  4NIQ A;  3ZMT B;  4KUM B;  3EVY A;  2LSG A;  5LOV E;  2LLY A;  5LHH B;  4YY3 T;  5LXT E;  1Z0P A;  2VKO A;  1HS7 A;  5AQO B;  3B13 A;  1T8B A;  3T8O A;  4AQF A;  4I50 E;  5FVK A;  5FYM A;  4DV1 T;  2CPT A;  2BG9 B;  4PK4 A;  4ZS3 A;  2LM2 A;  3CIR A;  3K3O A;  4KHZ F;  4M1P A;  3CWZ B;  3P4R A;  1VCS A;  2WY2 A;  4AKG A;  2KWI B;  1KNR A;  4ZHQ E;  4YJ3 E;  4P0A A;  1UX5 A;  2CXD A;  3ZYM A;  4YSY A;  2CHO A;  3UFE A;  4AQF C;  4N78 D;  1QSD A;  5JVD E;  5J1G A;  5JR9 A;  5HXH A;  3UQ4 A;  4TX5 A;  1IBM T;  1MNE A;  4JI6 T;  3ANW A;  1UCU A;  3HKD E;  3PUW F;  2DCF A;  1LVK A;  4BJM A;  2KWH A;  2H7O A;  2CWO A;  3FZK B;  5LYJ E;  2LOP A;  5AQT B;  5JR9 C;  4GK0 E;  3RIU A;  2XUE A;  3K1S A;  3MK7 C;  4GK5 E;  4U74 A;  5LJM A;  5C8Y E;  1D1A A;  3B57 A;  4NUV A;  5HWX A;  2LHN A;  3UFG A;  4WBO A;  2V6X A;  3V5S A;  5L4E A;  2D0U A;  3ZMS B;  2BS3 A;  2VQE T;  4DBQ A;  1W09 A;  4YJ2 E;  3ONX A;  3FXD B;  2JRK A;  2YK0 A;  2LKH A;  2ACX A;  2WWU A;  4MLK A;  4PJJ A;  2XAJ B;  4UV9 B;  3P4W A;  1O3X A;  3VU7 H;  4ZI2 C;  4C90 A;  5HEG A;  3P50 A;  3RIU C;  4HFC A;  2D0T A;  4DR1 T;  3WAJ A;  5EK3 A;  3N5L A;  3LFM A;  3ZJ2 A;  2J47 A;  3H3M A;  3H37 A;  1WFD A;  2L3L A;  5FVL A;  3SFE A;  3AXJ B;  3PUQ A;  2BS2 A;  3P4P A;  1Y64 B;  1VRB A;  3RQU A;  2B76 A;  2C5I T;  3LK3 B;  4IE0 A;  2NTY A;  3ZCJ A;  3HKE E;  3TLV A;  4COF A;  4IDN A;  3UQ7 A;  1HR0 T;  4CXW A;  2V6Y B;  3IF8 B;  2HHH T;  5ABF A;  4HWF A;  4DV2 T;  4OX9 T;  3RRW A;  2QVA A;  2W00 A;  5M4Y A;  4Z91 A;  2LHR A;  1UUS A;  3C4W A;  2HH7 A;  3NWI A;  5LBQ B;  1L0V A;  3K3Q C;  3GN5 B;  4LFA T;  4DV4 T;  1N32 T;  3QB5 A;  5FXZ A;  4IE5 A;  4LMK A;  4L0R A;  5FXW A;  4H9S E;  1HNX T;  4LF7 T;  2D9D A;  1JNR A;  3PUG A;  2LM9 A;  2LKG A;  5HXR A;  4HE8 A;  3EI0 A;  1G73 A;  4I55 E;  2AXD S;  4U72 A;  3P4S A;  5CFB A;  1HCI A;  4EV6 A;  5LHG B;  1ZV4 X;  3H3A A;  1NEK A;  4YSZ A;  3V5U A;  3QC9 A;  2EHO B;  4NPP A;  1J5E T;  3MJX A;  1XMQ T;  4FJO A;  3VR8 A;  4KI0 F;  3KV6 A;  3ZKR A;  4H9P C;  2DLR A;  3WAK A;  3OJA A;  2LT3 A;  3QNU A;  1IZN B;  4JBW F;  2XZE A;  2Q9Q B;  3ZPO A;  4UIG A;  2MOZ A;  3W15 B;  2X68 A;  1FIO A;  1UK5 A;  4H9Q C;  1IBK T;  5AQQ B;  3AE6 A;  5FXV A;  1N36 T;  5J2T E;  5L3D B;  4J2C A;  4U2Y A;  2ZM0 A;  4X64 T;  4YXD A;  2QA7 A;  3T1Y T;  1WLX A;  1N33 T;  4ZI3 D;  4OHF A;  3WI3 A;  1I6Z A;  1US7 B;  3ZT7 A;  4ADZ A;  2DNX A;  2ZM6 T;  4NXN T;  4AIU A;  3CKD A;  4HFB A;  4Z90 A;  4DBR A;  2KIN B;  3F57 A;  2D2S A;  5HXS A;  2IUB A;  3UU5 A;  5L2L A;  2A9U A;  4TV9 E;  4ILA A;  4ERR A;  2VKJ A;  1AJ3 A;  3MAC A;  2UU9 T;  3OVU A;  3KIN B;  3JC6 C;  4HFI A;  4UVC B;  4MHC A;  3SFD A;  5JTG A;  1XWM A;  4EB6 E;  5JDH A;  5ABH A;  3RYH E;  2WB5 A;  2BVM A;  2ZM2 A;  5HEJ A;  5LG3 A;  1J1J A;  4LF5 T;  3B5M A;  5JQG E;  2X9W A;  5E0O A;  4QX7 B;  1KFY A;  4AI6 A;  2OLT A;  2N1G A;  3CX6 B;  4EYU A;  1T7S A;  3AE8 A;  4A56 A;  4LF6 T;  3Q5E A;  2CRB A;  4B6X A;  3ZN0 B;  3VR9 A;  3KVA A;  4JI4 T;  4GYS A;  1SA0 E;  5DQV A;  3BQL A;  2WM9 A;  2VUR A;  4LFB T;  3C51 A;  4LFC T;  4YTM A;  4LMJ A;  2XQ5 A;  3CQX C;  4AQY T;  5FXX A;  5JDL A;  3IHR A;  4CN4 A;  1BR4 A;  2KND A;  4PJL A;  4QX8 B;  2JQH A;  4NXM T;  1EZ3 A;  5JRE A;  2X9X A;  3CVR A;  5L3C B;  3AE5 A;  4IE7 A;  2E9X A;  4O8S A;  2UXC T;  3AE7 A;  4EIW A;  2LE8 A;  1ZEE A;  3ABV A;  4E7S A;  1YKE B;  1E1H B;  5LG4 A;  5IUX A;  3BQI A;  2CLY B;  5ABF B;  3NZP A;  4X66 T;  5L3F B;  4IHJ E;  3UU8 A;  4P0B A;  5AQH B;  1HX1 B;  3O9X A;  4UF0 B;  2CBJ A;  2LEH A;  2E9X C;  3UU3 A;  2JQK A;  2Y48 B;  4EEB A;  4JUY A;  2MBG A;  4AKR B;  4F8H A;  1IBL T;  5LGT B;  3MKD A;  2NOX A;  1KNZ A;  4IT4 A;  4A98 A;  5F8P A;  1UGO A;  4P09 A;  4CXY A;  2WU5 A;  3UU6 A;  2WZI A;  4TV8 E;  3I1A A;  3FZH B;  3ZYK A;  5JRC A;  4LML A;  2CCQ A;  4DR7 T;  2HPL A;  1ZOY A;  2Q9Q D;  4X1K E;  5ABG A;  2IHR 1;  5AQK B;  2JPF A;  4L5G A;  2V7K A;  3AEC A;  1T98 A;  4QH1 A;  4EYY R;  2XAG B;  4GKJ T;  1XZY A;  3PTR B;  2BDE A;  2UXB T;  3VKH A;  5IWA T;  3LBX B;  2CBI A;  5AQV B;  5L3E B;  5HCJ A;  2VKD A;  4O2B E;  2X0H A;  4JI5 T;  3N9Q A;  4GIW A;  3UU4 A;  3AA1 B;  2X9Y A;  3E08 A;  3GWH A;  3HKC E;  3X1D A;  3QUJ A;  5LNK A;  2W66 A;  1WR0 A;  2K5B B;  4ILU A;  3C4Z A;  3N9M A;  4JV5 T;  1KNP A;  2L8K A;  2NTX A;  3VHL A;  3PUA A;  2VVS A;  3G06 A;  3LK4 2;  2V1D B;  3RX6 A;  5HXC A;  3D0T A;  3PUX F;  1WYC A;  4AXP A;  1NWM X;  2UXN B;  2QYW A;  4EOZ B;  3FB2 A;  3LG7 A;  2W61 A;  3TLS A;  3AAE B;  4KX6 A;  4AQG A;  4DV0 T;  1NAF A;  3ONL C;  5C2T A;  2YIN A;  5AQU B;  4H63 H;  1R8I A;  3ONJ A;  5JDN A;  3N9P A;  1MIW A;  3FBL A;  4DID B;  3LSV A;  1CUN A;  2DWG A;  2V8S V;  3RIF A;  4I43 B;  4UEM A;  4JEU B;  4IGU A;  2XAH B;  5BR8 T;  5AQF B;  4XBF B;  2CXF A;  5FKY A;  5IYZ E;  3L09 A;  3C64 A;  5C3J A;  3EAB A;  1YD8 G;  2WSS V;  4PW8 A;  4DR6 T;  2PTF A;  2H3R A;  5HXE A;  3GMI A;  4WW0 A;  5CA0 E;  3O1I A;  3PV0 F;  4TNV A;  4NUU A;  5LGU B;  2RA1 A;  1WRD A;  5FL0 A;  5L3B B;  4CZZ B;  4BJN A;  4OYJ A;  3RKG A;  2VQF T;  2JMK A;  3QOF A;  3MZK B;  2CMR A;  3E22 E;  3LJC A;  4V1A v;  4K0U A;  2YDS A;  5CGM A;  1IJ6 A;  3NZQ A;  3AA0 B;  4I4T E;  5HEO A;  2VVN A;  2E5V A;  2G0U A;  1MMD A;  2JQQ A;  5KX5 E;  3JCF A;  2E8I A;  5KDM C;  3A7M A;  2LOS A;  1VCT A;  3ZMV B;  4A97 A;  1OED B;  1D0Z A;  1MIV A;  3I9Y A;  5CJ5 A;  3HKB E;  2CM0 A;  3L39 A;  4JI3 T;  3N9N A;  2C0S A;  3FHN A;  3RPU A;  2IDO B;  5LP6 E;  4KHP T;  3AVR A;  3ZT5 A;  2JIW A;  2BG9 A;  3FXE B;  2M6I A;  2M6B A;  4EZ4 A;  3AEB A;  5F3J A;  1YQ3 A;  4DV5 T;  4WYV A;  2NW7 A;  1D1B A;  2XSA A;  3ZMZ B;  1ZHC A;  2AE9 A;  4YHJ A;  4HWD A;  1H7C A;  4KMC A;  4I0U A;  4H63 V;  4PJM A;  3NVO A;  4Q25 A;  2BG9 C;  4G2A A;  1Z8U A;  3LDQ B;  2XQY A;  4TZ4 C;  5LB7 B;  4PNI A;  4EGW A;  4UEL A;  4C91 A;  1IAP A;  2X0Y A;  3KBU A;  2ZLY A;  2XAS B;  3IBP A;  1LVF A;  2WMO A;  2YEV C;  2A2F X;  3KV5 A;  3ZCI A;  3ETV A;  2K3W A;  5JRC B;  2VWA A;  2XHE B;  4DR4 T;  2VKH A;  4QXH B;  4O2A E;  3ZN1 B;  2DHR A;  3BQK A;  2CEA A;  5LHI B;  3EHZ A;  1IJ5 A;  4O4L E;  3PU3 A;  5H6Q B;  4CQI A;  2WDV A;  4IL4 A;  2IC9 A;  4JLE A;  2WS3 A;  2XY8 B;  4DUZ T;  1W0A A;  2GK9 A;  4HTE A;  2A3D A;  2YN6 A;  4DV6 T;  2FJB A;  2XAQ B;  4IDZ A;  4CN1 A;  4DR5 T;  4X1Y E;  1Y01 A;  2V7J A;  1MMN A;  3TLU A;  4F6R C;  5JR9 B;  2P9B A;  3PUZ F;  3NBX X;  4GYR A;  2YU2 A;  5FL1 A;  4IDP A;  5AFU L;  3L8R A;  5DJQ C;  2Y8D A;  2BS4 A;  5JDG A;  3JC6 D;  2E2A A;  3ANW B;  3CQC B;  3AVS A;  5AQN B;  3AXJ A;  2YU1 A;  4ASK A;  3PUR A;  3KV4 A;  1KF6 A;  2B1E A;  3U3I A;  4OK0 A;  3M65 A;  4IDQ A;  4X20 E;  4U3C A;  3R84 B;  4HFH A;  1E2A A;  1FMW A;  3AEG A;  1W9R A;  4ZZC A;  2DI4 A;  2LSY A;  2UUB T;  1S94 A;  3J7Y q;  2V26 A;  4TUY E;  1DU2 A;  5H6R B;  3F2E A;  1HNW T;  4BAY B;  2N2N A;  4WBN E;  3AE2 A;  1UX4 A;  3FBZ A;  5HWY A;  1XNR T;  1D0Y A;  3ZC0 A;  2WZH A;  4MAL A;  3VRA A;  2MTQ A;  1OED E;  4OYK A;  5LBM A;  3C50 A;  2XQ6 A;  1I94 T;  4AIS A;  4ZZB A;  2N9D A;  3KVB A;  2XSB A;  1HF8 A;  2C5J A;  2DWK A;  2WQY A;  3N9O A;  5LA6 E;  2W63 A;  3TLT A;  3AA7 B;  4DMW A;  2K48 A;  1G8X A;  5JDQ A;  3CPZ A;  2NWB A;  2L9Q A;  5EK2 A;  4UR9 A;  2SPC A;  4YTP A;  5JH7 E;  4PK5 A;  2I59 A;  3UTK A;  2XQ9 A;  2FJA A;  2I0M A;  3EUH A;  4JEH B;  5DQW A;  4TWF A;  3CX7 B;  3RRC A;  2QGS A;  4X1I E;  4B3M T;  3UUN A;  1J5W A;  2IIU A;  3AB3 B;  3SWH A;  2IW5 B;  4HGA A;  3JAD A;  4O4I E;  2V5D A;  3S4U A;  3VRB A;  2KZ7 B;  2HN1 A;  2A72 A;  1W0B A;  1M7K A;  1CHU A;  3N2O A;  3AED A;  4HFE A;  5FY1 A;  3CML A;  2EHO A;  2ODU A;  3AEF A;  2NW9 A;  5AQI B;  2FUP A;  4B3S T;  4UVB B;  3A5X A;  3U78 A;  5AQM B;  3HA4 A;  4O4H E;  2MAW A;  2XAF B;  4YTN A;  2WDQ A;  4TNW A;  2E9X D;  1HG2 A;  2Q9Q A;  5LCY A;  1LKX A;  4KBM B;  1YQ4 A;  4WZX A;  1HNZ T;  1M62 A;  4UV8 B;  1MND A;  2EHO C;  4L9I A;  3UUM A;  4HFV A;  1KEY A;  3HR0 A;  4U7I A;  2CXL A;  3FZM B;  3JAF A;  1E7P A;  4FI5 A;  2E5L T;  2UUC T;  4H9O C;  2Q9Q C;  4EXT A;  3RH3 A;  4PAG A;  1XMO T;  4GKK T;  2M67 A;  3DTO A;  4DMV A;  3PJA J;  5JDM A;  2F4V T;  3ZLI A;  1FMV A;  2MPK A;  2H88 A;  3CQG B;  2V7M A;  4JI2 T;  3Q5X A;  1V9D A;  2XQA A;  2PJQ A;  5BMV E;  4H9R C;  3F31 A;  4IST A;  3HL6 A;  4DV3 T;  1SHZ C;  4HKA A;  2UXD T;  3Q5W A;  2VB6 A;  1U5P A;  4PK6 A;  3EDU A;  4CI2 B;  4ZXL A;  2IC6 A;  1HG5 A;  4Z8X A;  3C4X A;  4AKH A;  2KMF A;  3CK6 A;  4YSX A;  3E0Z A;  1NEN A;  2DL1 A;  2WDR A;  1QUU A;  4MFR A;  3NRX A;  1BR0 A;  2J4G A;  4QHO A;  5LMU T;  4HEA A;  4B3R T;  2R6G F;  4IE6 A;  3O4X E;  3OYZ A;  2XJ7 A;  4X62 T;  4QH5 A;  1X9B A;  4HWH A;  1SE7 A;  3ESL A;  2XQ7 A;  3AEE A;  2BKO A;  4MBQ A;  1BR2 A;  4TN7 B;  2WWV A;  1T72 A;  2W0G A;  3UUX B;  2J1D G;  2YKS A;  4ZI2 D;  3AEA A;  1GQE A;  2W62 A;  4XZC A;  3PJA A;  5HYA A;  5TAO A;  2BVL A;  4UXN B;  1HFA A;  4X5T A;  4HFD A;  5L47 A;  2LRK A;  3OPC A;  3PUY F;  3O1J A;  4ZEY A;  1ZP0 A;  5KMG P;  3DJB A;  2XQ8 A;  1SUM B;  3R6N A;  5A1L A;  4QXB B;  3HI2 A;  4PJN A;  4ZS2 A;  3FZL B;  2IML A;  3P4Q A;  3RC8 A;  3ZST A;  5EK4 A;  1MIY A;  2KXP B;  3RHW A;  3LK2 B;  1XNQ T;  2JQ9 A;  4U31 A;  2X66 A;  4JI7 T;  3KFW X;  3RLF F;  5AQR B;  1FJG T;  2OA5 A;  2LRL A;  3FZF B;  4YFS A;  2FJD A;  2BBH A;  2KLQ A;  4CI3 B;  1D1C A;  3OKQ A;  2I6H A;  2JJ9 A;  2XM1 A;  3AA6 B;  3UT5 E;  3I0Q A;  1S35 A;  2WBL A;  3Q5D A;  4UF0 A;  1OWA A;  2KT9 A;  4EZH A;  3ZT6 A;  2BG9 E;  3RGL A;  2PG8 A;  4OFZ A;  5AQS B;  2Y6X A;  4IL9 A;  1MMA A;  4BA9 A;  1X79 A;  1U4Q A;  4AKI A;  2CLY C;  4CXX A;  5HEH A;  5F5W A;  4DR3 T;  4JI1 T;  4YHH T;  1D0X A;  3EAM A;  2E9X B;  3J9X 1;  2XQ3 A;  3PU8 A;  4YT0 A;  3TLW A;  3SS1 A;  2XM2 A;  1KK7 A;  3OTO T;  3CX8 B;  3ZEF B;  3KDS E;  1ZKE A;  2C5K T;  2V5C A;  4IIJ E;  2NR4 A;  3N2G E;  3Q2M A;  5KXJ A;  3LBX A;  2X0L B;  4KP3 C;  1WYB A;  4U2Z A;  2BBJ A;  5L4H A;  4QXC B;  4CI1 B;  1YXR A;  2NW8 A;  2UXX B;  4YLH A;  2HN2 A;  4UVA B;  3RKO A;  2HPJ A;  1BR1 A;  5LJN A;  1HTJ F;  4B3T T;  2LSI A;  3O1H A;  2X67 A;  4ILB A;  3PUV F;  2WU2 A;  2BKP A;  4DR2 T;  2ACZ A;  5ETW A;  1WCR A;  3RQW A;  2UUA T;  5EZY E;  4QH4 A;  4ZI3 C;  3PUS A;  4X65 T;  3IEE A;  2LSJ A;  3NRY A;  2X9H A;  1FEW A;  2IAK A;  2YDQ A;  3L3P A;  3MA9 A;  3P7I A;  4TWH A;  3BK9 A;  5J2U E;  2FBW A;  4WNK A;  5CB4 E;  4AKL A;  5HAX A;  3C98 B;  3IA3 A;  5AQJ B;  3SOL A;  3VKG A;  3SRZ A;  3RI5 A;  4QKN A;  4LF8 T;  5CA1 E;  5LGN B;  5FNV E;  3RIA A;  2LJL A;  1QLB A;  3TKL B;  4P1N A;  3ZYL A;  2MYS A;  3AE9 A;  2YDR A;  1YW0 A;  4ANJ A;  4LF9 T;  2ODV A;  5AQL B;  4DO0 A;  5FMN A;  2WCA A;  3T1H T;  2K9A A;  2WP9 A; 
#chains in the Genus database with same CATH homology
 2NW9 A;  4L0R A;  1WR6 A;  5FXW A;  4H9S E;  1WYC A;  2Z6E A;  4UVB B;  3A5X A;  3U78 A;  4AXP A;  3PUG A;  2LM9 A;  5DAB A;  1NWM X;  4O4J E;  2ZM8 A;  5HXR A;  4IE4 A;  2PFV A;  3HA4 A;  4HE8 A;  2UXN B;  2K24 A;  2VAS A;  4O4H E;  1G73 A;  2X51 A;  4I55 E;  4EOZ B;  3I9W A;  4E7Z A;  3FB2 A;  2XAF B;  4PFO A;  3K8P C;  3LG7 A;  2E9X D;  1HG2 A;  2Q9Q A;  2W61 A;  4U72 A;  4G63 A;  5LCY A;  1HCI A;  1LKX A;  4KBM B;  5LHG B;  3AAE B;  4AQG A;  1NAF A;  2YIN A;  4UV8 B;  1ZV4 X;  4ZOL E;  1MND A;  3H3A A;  4H63 H;  2EHO C;  3K3N A;  3V5U A;  4QWN B;  3QC9 A;  4HN9 A;  4L9I A;  3RC3 A;  2EHO B;  3UUM A;  4HFV A;  3MJX A;  5JDN A;  3N9P A;  1MIW A;  4FJO A;  3Q9D A;  3KBT A;  3FBL A;  4GOU A;  3KV6 A;  3HR0 A;  1CUN A;  3N2K E;  1HX8 A;  2CXL A;  2DWG A;  4H9P C;  2DLR A;  3WAK A;  4FI5 A;  4I43 B;  4UEM A;  3OJA A;  2CA5 A;  4H9O C;  2LT3 A;  2WMN A;  2Q9Q C;  1IZN B;  4ZI7 E;  4EXT A;  2RP4 A;  4JEU B;  3RH3 A;  2Q9Q B;  3ZPO A;  4PAG A;  4IGU A;  2XAH B;  2PBI A;  2M67 A;  4XBF B;  2CXF A;  3N9L A;  4UIG A;  3ZJ1 A;  3KV9 A;  3DTO A;  3MXZ A;  2MOZ A;  4DMV A;  5IYZ E;  3L09 A;  3OBV E;  3C64 A;  3W15 B;  2X68 A;  1FIO A;  2V7L A;  5JDM A;  4H9Q C;  1YD8 G;  4PFP A;  3ZLI A;  3OYX A;  1FMV A;  2WSS V;  5FXV A;  2V7I A;  3CQG B;  4PW8 A;  5J2T E;  3ZC1 A;  2V7M A;  3UUL A;  5L3D B;  4J2C A;  3EDV A;  2ZM0 A;  2H3R A;  3GN5 A;  3Q5X A;  3RYC E;  5FY7 A;  1V9D A;  2QA7 A;  1WLX A;  5HXE A;  3GMI A;  4ZI3 D;  2PJQ A;  4OHF A;  5BMV E;  4H9R C;  4WW0 A;  5CA0 E;  3O1I A;  3F31 A;  4NUU A;  3WI3 A;  4IST A;  3HL6 A;  3AAA B;  5LGU B;  2RA1 A;  1SHZ C;  4ISS A;  1WRD A;  2WAU A;  2XTL A;  1US7 B;  5L3B B;  4HKA A;  3PDY A;  4CZZ B;  1YKH B;  4ADZ A;  2DNX A;  3Q5W A;  2VB6 A;  1U5P A;  4H9N C;  4PK6 A;  3EDU A;  4BJN A;  2JMH A;  4CI2 B;  2ES0 A;  2CWY A;  2IC6 A;  1HG5 A;  3CKD A;  4Z8X A;  3C4X A;  3RYF E;  4OYJ A;  4AKH A;  2KMF A;  3ETU A;  4DBR A;  3E0Z A;  2VL8 A;  2KIN B;  2JMK A;  2D2S A;  2ZMA A;  3F57 A;  3DP7 A;  4DVD A;  4EAH A;  3MZK B;  2CMR A;  3E22 E;  3RYI E;  5HXS A;  3LJC A;  1QUU A;  4MFR A;  3NRX A;  4K0U A;  4V1A v;  1BR0 A;  4DND A;  3PE0 A;  5L2L A;  4QHO A;  4TV9 E;  1IJ6 A;  3NZQ A;  3AA0 B;  4I4T E;  2D5U A;  4HEA A;  2VK9 A;  3I0O A;  4ERR A;  2VKJ A;  3P8C D;  4IE6 A;  3O4X E;  3OYZ A;  1AJ3 A;  2G0U A;  2CE7 A;  3MAC A;  1MMD A;  2NP9 A;  5ADX L;  3KIN B;  5IHY A;  2JQQ A;  3JC6 C;  5KX5 E;  5KDM C;  2E8I A;  3ESL A;  2LOS A;  3ZMU B;  4UVC B;  4XAX B;  4MHC A;  1VOM A;  3ZMV B;  1D0Z A;  1MIV A;  5FP3 A;  1B7T A;  4MBQ A;  1BR2 A;  5FY0 A;  4TN7 B;  3I9Y A;  3HKB E;  2LSK A;  2CM0 A;  4EB6 E;  2W0G A;  5JDH A;  3QK6 A;  3RYH E;  3UUX B;  3N9N A;  2C0S A;  3FHN A;  3RPU A;  5GON E;  5LP6 E;  3AVR A;  1OXZ A;  2J1D G;  4ZI2 D;  2BVM A;  3FXE B;  5L3G B;  2ZM2 A;  2EHO D;  4EZ4 A;  3AAI A;  3GA8 A;  5F3J A;  2H7V C;  2W62 A;  1MMG A;  2NW7 A;  4XZC A;  5JQG E;  2X9W A;  2BZB A;  1D1B A;  1LRZ A;  5HYA A;  5TAO A;  2BVL A;  4UXN B;  5E0O A;  3ZMZ B;  1HFA A;  5JDF A;  4QX7 B;  4AI6 A;  3ZMT B;  1ZHC A;  2N1G A;  4KUM B;  3EVY A;  2LSG A;  5LOV E;  5LHH B;  4YHJ A;  1H7C A;  3CX6 B;  1Z0P A;  4KMC A;  2VKO A;  3O1J A;  4EYU A;  5LXT E;  1HS7 A;  5KMG P;  3B13 A;  4A56 A;  4H63 V;  3DJB A;  4PJM A;  3T8O A;  3R6N A;  5A1L A;  4QXB B;  4AQF A;  3HI2 A;  4G2A A;  4I50 E;  4PJN A;  5FYM A;  4ZS2 A;  4B6X A;  4PK4 A;  2XQY A;  4TZ4 C;  3RC8 A;  4ZS3 A;  4PNI A;  5EK4 A;  1MIY A;  3K3O A;  2KXP B;  4UEL A;  3LK2 B;  3ZN0 B;  4C91 A;  1IAP A;  2X66 A;  3KBU A;  2ZLY A;  3KVA A;  2XAS B;  3KFW X;  3IBP A;  4M1P A;  1LVF A;  2WMO A;  2YEV C;  3CWZ B;  2A2F X;  4GYS A;  3KV5 A;  4AKG A;  1SA0 E;  3ZCI A;  2KWI B;  5DQV A;  3BQL A;  2OA5 A;  3ETV A;  4ZHQ E;  2WM9 A;  4YJ3 E;  4P0A A;  5JRC B;  1UX5 A;  4YFS A;  2CXD A;  2VWA A;  2XHE B;  3C51 A;  3ZYM A;  2VKH A;  4QXH B;  4O2A E;  3UFE A;  3ZN1 B;  4AQF C;  2DHR A;  4N78 D;  1QSD A;  3BQK A;  2KLQ A;  2CEA A;  4CI3 B;  5LHI B;  3CQX C;  1D1C A;  5JVD E;  1IJ5 A;  3OKQ A;  5J1G A;  4O4L E;  5FXX A;  5JDL A;  5JR9 A;  5HXH A;  3PU3 A;  2JJ9 A;  3IHR A;  3AA6 B;  1BR4 A;  3UT5 E;  3I0Q A;  2KND A;  1S35 A;  4PJL A;  2WBL A;  4QX8 B;  4TX5 A;  5H6Q B;  1EZ3 A;  4UF0 A;  4CQI A;  5JRE A;  1OWA A;  2X9X A;  1MNE A;  3CVR A;  2IC9 A;  4JLE A;  5L3C B;  2GK9 A;  4HTE A;  2KT9 A;  4EZH A;  3ANW A;  4IE7 A;  2E9X A;  4O8S A;  2A3D A;  1UCU A;  3HKD E;  2XAQ B;  2PG8 A;  4OFZ A;  4IDZ A;  2DCF A;  1LVK A;  2Y6X A;  4X1Y E;  2KWH A;  2LE8 A;  4BJM A;  1ZEE A;  4EIW A;  4E7S A;  2H7O A;  1MMA A;  1YKE B;  4BA9 A;  1X79 A;  1U4Q A;  2CWO A;  2V7J A;  1E1H B;  1MMN A;  5LG4 A;  5LYJ E;  2CLY C;  4AKI A;  2LOP A;  5JR9 C;  3BQI A;  4GK0 E;  2CLY B;  4F6R C;  3NZP A;  5JR9 B;  5L3F B;  4CXX A;  2P9B A;  2XUE A;  3MK7 C;  3NBX X;  4IHJ E;  4GYR A;  2YU2 A;  4GK5 E;  4P0B A;  4U74 A;  5AFU L;  4UF0 B;  5DJQ C;  5LJM A;  3O9X A;  5C8Y E;  2Y8D A;  1D1A A;  3B57 A;  4NUV A;  5HWX A;  2LHN A;  2LEH A;  2E9X C;  5JDG A;  4WBO A;  3JC6 D;  2Y48 B;  3V5S A;  2D0U A;  3ZMS B;  3ANW B;  1D0X A;  2E9X B;  4JUY A;  3J9X 1;  2MBG A;  3CQC B;  4AKR B;  3AVS A;  4DBQ A;  3PU8 A;  2YU1 A;  4YJ2 E;  5LGT B;  3ONX A;  4ASK A;  3FXD B;  3PUR A;  3MKD A;  3KV4 A;  2JRK A;  2YK0 A;  3SS1 A;  2B1E A;  3U3I A;  2NOX A;  1KK7 A;  4OK0 A;  3M65 A;  3CX8 B;  2ACX A;  3ZEF B;  2WWU A;  3KDS E;  4MLK A;  2XAJ B;  4PJJ A;  4X20 E;  4UV9 B;  1KNZ A;  5F8P A;  1ZKE A;  1O3X A;  3R84 B;  3VU7 H;  4P09 A;  4ZI2 C;  2C5K T;  4C90 A;  1FMW A;  4CXY A;  2DI4 A;  2D0T A;  4IIJ E;  4TV8 E;  2LSY A;  3I1A A;  3N2G E;  3Q2M A;  3ZYK A;  1S94 A;  3LBX A;  2X0L B;  4KP3 C;  3WAJ A;  3J7Y q;  5EK3 A;  3N5L A;  3LFM A;  5JRC A;  2V26 A;  2CCQ A;  4TUY E;  3ZJ2 A;  5H6R B;  3F2E A;  3H37 A;  2HPL A;  4BAY B;  1WYB A;  2N2N A;  4WBN E;  2Q9Q D;  2L3L A;  1UX4 A;  3FBZ A;  5HWY A;  4X1K E;  1D0Y A;  3ZC0 A;  4MAL A;  2MTQ A;  4QXC B;  4CI1 B;  2NW8 A;  4OYK A;  5LBM A;  2UXX B;  4YLH A;  2JPF A;  3PUQ A;  4UVA B;  3C50 A;  4L5G A;  2V7K A;  1Y64 B;  3RKO A;  2HPJ A;  1T98 A;  1BR1 A;  1VRB A;  4EYY R;  2N9D A;  5LJN A;  2C5I T;  2XAG B;  1HTJ F;  3KVB A;  3LK3 B;  4IE0 A;  3PTR B;  2BDE A;  1HF8 A;  2C5J A;  2DWK A;  2LSI A;  3N9O A;  3VKH A;  3O1H A;  2X67 A;  2NTY A;  2W63 A;  3LBX B;  5LA6 E;  3ZCJ A;  4DMW A;  3AA7 B;  5ETW A;  3HKE E;  5EZY E;  2K48 A;  4ZI3 C;  3PUS A;  5L3E B;  1G8X A;  5JDQ A;  4CXW A;  3IEE A;  3CPZ A;  2VKD A;  2NWB A;  2LSJ A;  3NRY A;  2L9Q A;  2X9H A;  1FEW A;  4O2B E;  5EK2 A;  2IAK A;  3IF8 B;  3L3P A;  3MA9 A;  3P7I A;  2SPC A;  3N9Q A;  3BK9 A;  4GIW A;  3AA1 B;  2X9Y A;  5JH7 E;  4PK5 A;  5J2U E;  3E08 A;  2I59 A;  3GWH A;  3HKC E;  3UTK A;  3RRW A;  4WNK A;  2W00 A;  5CB4 E;  5M4Y A;  3EUH A;  4AKL A;  3QUJ A;  5HAX A;  3C98 B;  5LNK A;  2LHR A;  4JEH B;  5DQW A;  3CX7 B;  3RRC A;  2K5B B;  3SOL A;  2QGS A;  3C4W A;  4ILU A;  3VKG A;  3C4Z A;  2HH7 A;  3N9M A;  3SRZ A;  4X1I E;  3UUN A;  4QKN A;  3AB3 B;  3SWH A;  5CA1 E;  5LGN B;  5FNV E;  5LBQ B;  2IW5 B;  4HGA A;  2LJL A;  3TKL B;  4O4I E;  3S4U A;  3K3Q C;  2KZ7 B;  2L8K A;  3ZYL A;  2NTX A;  3VHL A;  2MYS A;  2A72 A;  3GN5 B;  5FY1 A;  3N2O A;  1YW0 A;  4ANJ A;  2ODV A;  3CML A;  3PUA A;  3LK4 2;  2EHO A;  2ODU A;  5FXZ A;  4DO0 A;  2V1D B;  5FMN A;  2K9A A;  3RX6 A;  5HXC A;  4IE5 A;  3D0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...