3EVYA

Crystal structure of a fragment of a putative type i restriction enzyme r protein from bacteroides fragilis
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
83
structure length
83
Chain Sequence
MKPYEKLVERFNEMAAEFLSYFPTVKSVGNLESELDKRRFVILFRAMLRLRNEVKGYNEFDAEDLTIEEQRFADYQSKYLDMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a fragment of a putative type I restriction enzyme R protein from Bacteroides fragilis
rcsb
source organism Bacteroides fragilis nctc 9343
molecule tags Hydrolase
molecule keywords Putative type I restriction enzyme R protein
total genus 32
structure length 83
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.910 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3evyA00
3EVYA
chains in the Genus database with same CATH superfamily
5LG4A 3KV4A 3ANWA 2YOEA 5JDFA 4YLHA 3FZFB 2CBIA 3HKCE 3MACA 3O1IA 1FEWA 4TWDA 1S35A 2JQ9A 2LSYA 3N9MA 2DNXA 2XQ8A 3RC3A 3RIUC 5L2LA 3O1HA 3T1YT 1JNRA 2QVAA 4HWCA 3M65A 3ESLA 1XDPA 5AFUL 1HNXT 3VKGA 2E8IA 3C4ZA 4Z8XA 3PJAJ 5AQRB 4AISA 5L47A 2W63A 4LF6T 5KX5E 4N78D 3E0ZA 4MBQA 3MA9A 1QLBA 3T1HT 2X0HA 2J62A 4TV9E 4H9RC 3ZMUB 2IHR1 1S94A 3CQXC 2VASA 3VRBA 3PE0A 1WR0A 2BG9E 4TNWA 4JI2T 4YSZA 3AEFA 1Y64B 2Q9QA 5JR9C 1IJ6A 5LB7B 2JJ9A 3V5SA 2ZLYA 1QUUA 1YKEB 3LK2B 5H6QB 2Y8DA 1YW0A 5FVKA 4JBWF 2V5CA 4QH5A 5LNKA 4DV4T 4ZHQE 4OX9T 2NTYA 3PUXF 1HS7A 5C8YE 1XMOT 4AIUA 4DV1T 3U78A 4HEAA 3IBPA 3E22E 2LRKA 3AE4A 3K3OA 4QX8B 2Q9QB 3RI5A 4ISSA 2WDRA 2VQET 1XWMA 2KWIB 1OEDE 3AAAB 3ZMZB 2CMRA 3C98B 2BVMA 2PFVA 4HWIB 1UX4A 2CE7A 2XSAA 3TLSA 2LSIA 3AXJB 5AQLB 5JTGA 3AEDA 3I9WA 2J1DG 3FHNA 4B3RT 2LKGA 2D0TA 2J47A 3LBXB 3Q5DA 2MAWA 2DL1A 3OJAA 4WNKA 4KI0F 3ZJ1A 3KINB 4Z91A 5LXTE 4JI6T 1IJ5A 1SUMB 2LE8A 3K3QC 2WP9A 1E1HB 4YXDA 4LF9T 3NZPA 4TV8E 3VU7H 4TNVA 5LOVE 4MHCA 5HCJA 2NW9A 5AQQB 2OLTA 4HFBA 4UELA 3QUJA 4DR6T 3UFGA 4IDPA 4PK6A 3AEBA 4COFA 2Y48B 2E9XB 4P09A 4ZXLA 3UQ7A 4YTPA 1HF8A 3AE6A 2LEHA 3M3ZB 1J5WA 5AQIB 2UXXB 3JAEA 3RH3A 1IAPA 1SA0E 3RKGA 1BR2A 4O4HE 3ZC1A 3X1DA 4LFAT 3ZT5A 3J7Yq 1KF6A 3K3NA 3KV5A 3B5MA 2XQ3A 4UVCB 2ZMAA 3N2KE 2A2FX 3KFWX 4DV0T 4IDOA 2WMOA 4PAGA 1H7CA 2GK9A 2X9XA 5EK3A 2QGSA 4U74A 4UV8B 2H89A 5HEGA 5FNVE 4EB6E 3MZKB 4O2AE 5AQFB 5LP6E 2FJBA 3UU6A 4DNDA 2W00A 4IE4A 4X1IE 5CJ5A 2L8KA 2ODUA 5CGMA 3CIRA 4DUYT 4K0KT 2JQKA 2MOZA 4OK0A 2W62A 1MNEA 2DWGA 3ONJA 3PUGA 4HFHA 2XSBA 1UURA 2YDSA 2J4GA 2K9AA 4PW8A 3RIAA 3RYIE 3VRAA 2MPKA 4DR3T 4I50E 4I55E 3F57A 2IAKA 4L0RA 3HKBE 2DHRA 5IWAT 2KLQA 3OPCA 4ILCA 1BR1A 1L0VA 3SRZA 3OYXA 4JI7T 5H6RB 2HPLA 1W09A 5DJQC 3SFDA 3RHWA 3T8OA 4DMVA 3GMIA 4ZS3A 2HPJA 3OYZA 4U7YA 4ZS2A 2MTQA 5ABEA 2IMLA 1HTJF 3NVOA 1KEYA 3EABA 2HN2A 2WMNA 2BKPA 4UVBB 5M4YA 4GKJT 2PTFA 5HEUA 2BDEA 4DV7T 3AA0B 5LMUT 3FZKB 3IA3A 1ZHCA 3FZMB 3AEEA 3CQCB 5AQPB 1BR0A 4JLEA 3AAEB 2NR4A 3DTOA 2JQHA 1B7TA 3Q9DA 2BG9B 2X68A 3RLFF 5KDMC 1T7SA 2N2NA 4G63A 4HTEA 3CMLA 4PFPA 4V1Av 4WZXA 5JREA 1XMQT 4HWDA 4IDQA 3RC8A 4YJ3E 3NZQA 3KBUA 2YKSA 3K8PC 3UQ4A 2DWKA 2ZM6T 3CQGB 4JI4T 2BKNA 2KNDA 3PV0F 2CLYC 4KX6A 2BG9C 3B13A 2KT9A 3AEAA 4PNIA 5E0OA 5L3DB 2PBIA 2V6XA 4X65T 3V5UA 4YHHT 2V1DB 4LMLA 3MK7C 4H9SE 4PJNA 4HE8A 4FJOA 4NXNT 2Q9QD 2VKHA 2VB6A 2LSKA 3DP7A 3Q5WA 2ACZA 3BQIA 3Q5EA 4O4LE 4X20E 4EZHA 3F31A 3UUMA 4H9NC 2DLRA 2CWYA 5AQKB 1DU2A 3VHLA 3ZKRA 4A98A 2CCQA 4AQFC 3LBXA 4AXPA 3QOFA 3RKOA 5HXEA 2XAJB 3CPZA 2CLYB 3P4WA 4EYUA 2WQYA 4H9OC 1HX8A 4UF0B 5EK4A 5HEOA 4IE6A 3UFEA 2RA1A 4EXTA 3CKDA 4JEUB 2JMHA 3PUQA 5HXCA 4P0BA 2PJQA 3I0QA 3RRCA 1KNPA 2FJAA 3C4XA 2WS3A 4ZEYA 5J1GA 2QYWA 5LBMA 5J2UE 5BR8T 4X1YE 1KNRA 2D2SA 2I0MA 3RQUA 4BJMA 1MMNA 2V7KA 5AQHB 2X67A 2B1EA 4JV5T 1N33T 4WBNE 1AJ3A 1LVFA 4U7IA 2RPAA 4UF0A 2XQ9A 4UR9A 3EDVA 1YKHB 4ILUA 5JRCB 3MXZA 3N9LA 3RYCE 1SHZC 3ZSTA 4QXBB 4DIDB 3N9NA 2X9HA 3BQLA 2V6YA 4KP3C 1VCTA 1M62A 2G0UA 1NAFA 4C90A 2VKJA 3ZCIA 4EV6A 3FZHB 4BAYB 2X51A 4ISTA 3ZMTB 2IUBA 2VWAA 2WBLA 2IW5B 3KVAA 4JI8T 4P1NA 3A5XA 4TWHA 3OTOT 4JEHB 3UU3A 1NENA 5LGTB 2FJEA 5JH7E 5ADXL 2P9BA 1KK7A 5FKYA 4IGUA 2VURA 2M67A 2BVLA 2V7LA 3JC6D 3O1JA 5JVDE 3PUYF 3RX6A 2V6YB 1HNWT 4EIWA 4LF8T 2XHEB 3A8YC 2Y6XA 2HH7A 1W0AA 4QWNB 5L3EB 1XNQT 5AQVB 5FP3A 3AE7A 3K1SA 3P4PA 4H9PC 4X64T 2W2UA 2ODVA 1XDOA 1OXZA 4PK4A 3CX6B 4H63H 2H7VC 4O4JE 2H7OA 2X66A 3RIFA 3SOLA 4EEBA 4CI1B 2VVNA 2CA5A 2FJDA 5HYAA 5AQSB 4E7SA 1MMDA 4GYRA 3ZT6A 3DJBA 4DV5T 2UUCT 1LVKA 2KWHA 3NWIA 1MNDA 4PK5A 3AE5A 4QHOA 5JR9A 4AQFA 4ERRA 1WCRA 2ACXA 2CXFA 2WU5A 5FY7A 5BMVE 3PU3A 2M6IA 2MBGA 2UUAT 1G8XA 2BG9A 2XY8B 5FY1A 3HL6A 3MKDA 3NKZA 5L3GB 3FZLB 4AKIA 4CXXA 4JI5T 4CN4A 3JCFA 5HXHA 2UXNB 3B57A 3LK3B 2UXCT 2LM2A 3VR9A 1HG2A 3AECA 4I0UA 3RRWA 4E7ZA 5J2TE 4HWHA 2KSRA 3FBZA 2H88A 4ANJA 1OEDA 2K24A 1Z0PA 5JR9B 3LFMA 2BZBA 4HFIA 4UVAB 1D1AA 2YINA 3CX7B 4L5GA 4OFZA 5FY0A 5ABHA 1UCUA 3EHZA 4YJ2E 1IZNB 5HCMA 2X0YA 4MALA 4I43B 5JDLA 1ZV4X 4OYKA 2H3RA 4HGAA 2JMKA 5F3JA 2XQ6A 1IBMT 2OA5A 3PUVF 3UULA 4JI1T 2BS2A 1JNZA 2IDOB 4LFBT 1MMGA 4DBRA 2XM1A 1OEDB 4ASKA 4EOZB 1YD8G 4IE5A 3EVYA 4HFCA 5CB4E 2LHRA 4QX7B 5LMNT 2UXBT 1WR6A 3I0OA 2B76A 1UX5A 2CXDA 2XZEA 2BS3A 2C0SA 2VKOA 2W4XA 2D9DA 3N2OA 3QB5K 2WWVA 1U5PA 2ZM2A 3AE8A 4JI3T 2IC6A 4B3ST 3HKDE 5CA1E 1ZP0A 1E7PA 3UTKA 4HFDA 4KUMB 4ZI3D 3I9YA 4C91A 4DBQA 3J9X1 3H37A 5LJNA 2LRLA 5LYJE 3IF8B 3RPUA 4EGWA 2CBJA 2OV9A 3AE3A 1D1BA 5JRCA 3TLWA 2JIWA 1X79A 3RYFE 2KXPB 2A9UA 2UUBT 4YY3T 2N1GA 4KMCA 3QC9A 2JRKA 4QKNA 5LGNB 2F4VT 3P4RA 1YXRA 4JYAT 4O8SA 4GIWA 4YFSA 5CFBA 3P50A 4DMWA 4P0AA 2UXDT 4DV2T 1BR4A 4TWFA 4CQIA 2L9QA 2LT3A 1HCIA 2KMFA 4ZOLE 2YN6A 3H3MA 3IEEA 3P8CD 2K3WA 2JPFA 3BK9A 3L3PA 3P7IA 4X1KE 5AQJB 5DABA 3ZMVB 3AAIA 1I6ZA 2Q9QC 3GN5B 3L8RA 1E2AA 3HKEE 2VL0A 5L3CB 5JDMA 1O3XA 2AE9A 2ZM0A 3ABVA 4ILAA 3ETVA 2QRXA 4Q25A 5F5WA 4YSXA 4U3CA 3O9XA 4LMKA 4MLKA 2NOXA 1FMVA 1M7KA 4H63V 5LBQB 3ZPOA 4IL4A 2AXDS 4ILBA 4A56A 3AE1A 3ETUA 3OVUA 5GONE 2LOPA 1LKXA 4ZZCA 3N2GE 3F2EA 5FYMA 5IUXA 3TLUA 3PU8A 3EUHA 3QNUA 3GN5A 4O2BE 4AKGA 1NWMX 2LKHA 1WRDA 2LOSA 4QH1A 1Z8UA 2EHOD 4ZI7E 4M1PA 4QH4A 2N9DA 2BS4A 3ZMSB 2XAGB 3PTRB 2HN1A 3ZSSA 2VKDA 1CUNA 2WDVA 2Z6EA 4YSYA 2KINB 3ZN1B 4JUYA 4LMJA 4TUYE 4BJNA 3EI0A 4YTNA 2W61A 2K5BB 5KMGP 4YHJA 5LCYA 2LHNA 4GKKT 2CHOA 3ZN0B 4KHPT 3ONXA 1WYBA 4IDNA 4TN7B 3KVBA 4FI5A 4F8HA 1N32T 3AA7B 4QXCB 1UUSA 3BQKA 2CHNA 4ADZA 3N9QA 3C64A 5AQOB 5FXZA 3HR0A 2WSSV 2WB5A 3Q5XA 3PUWF 5AQUB 2ES0A 3AVSA 4PJLA 1MIVA 3R84B 5JDGA 3FB2A 3WAKA 1FJGT 4ZZBA 5EK2A 2E5VA 3FXDB 4U2ZA 5C2TA 3ZLIA 4B3TT 3ZCJA 3ZT7A 1GQEA 2E9XC 4DV3T 3RIUA 1KNZA 2JQQA 3TKLB 3ZC0A 5J0ZA 2C5KT 4A5XA 4LF5T 4CI2B 5L4HA 2E2AA 5TAOA 2CPTA 2D0UA 3UUNA 4AQYT 4YTMA 1IBLT 1MIWA 5LG3A 5IYZE 2XQ4A 3NRYA 4IDZA 2YEVC 5LJMA 4AKRB 5CA0E 2X9YA 2V26A 5AQGB 2RP4A 2CWOA 2XTLA 4HFVA 2XJ7A 5ETWA 4CZZB 2XQYA 4F6RC 4HWFA 5JDHA 2DCFA 3PUZF 3S4UA 4DR7T 3UU5A 4AKHA 1LRZA 4PJJA 1J1JA 4NIQA 2DI4A 3UT5E 2XASB 4B6XA 2XPKA 1X9BA 3GA8A 2A72A 1HFAA 4LF7T 3IHRA 3CX8B 5HWXA 4H9QC 3P4QA 5IHYA 5JDQA 1FIOA 2EHOB 1ZOYA 2C5IT 4CN1A 2LJLA 1FMWA 1D0XA 3KV9A 4EAHA 1T98A 5FXXA 4UIGA 4J2CA 5L3FB 4L9IA 3QK6A 5ABGA 3RQWA 2X0LB 4TZ4C 4IT4A 2WZHA 3HA4A 4NXMT 3CWZB 4IE0A 4MFRA 2A3DA 3JAFA 2W0GA 2WAUA 3UU4A 4X62T 3KBTA 4JI0T 2X9WA 4IIJE 1HR0T 3C51A 3PDYA 4U2YA 2KZ7B 1VCSA 5FXVA 4BA9A 3N9OA 3TLTA 2EHOC 3AA6B 3MJXA 5HXRA 5HWYA 2NWBA 1VRBA 3A7MA 3AB3B 2LLYA 3PUSA 2D5UA 3RYHE 2M6BA 3WAJA 5LA6E 1V9DA 1EZ3A 1CHUA 3R6NA 3SFEA 3TLVA 1WFDA 3SS1A 4NUVA 1MIYA 1J5ET 3ZEFB 4K0UA 2FUPA 3E08A 3H3AA 4DR4T 3JADA 5HXSA 3G06A 1N36T 3NRXA 1IBKT 3AA1B 1T72A 5A1LA 2LSJA 4ZI2C 5AQNB 4XBFB 3QB5A 4IREA 3O4XE 2IC9A 3HI2A 5FXWA 4EYYR 4DR2T 4UV9B 4HN9A 2WZIA 4IL9A 2VQFT 2E5LT 2LM9A 2YU2A 4IE7A 4ZI3C 1W0BA 2LSGA 2YK0A 3KV6A 4KBMB 1U4QA 2E9XD 2QA7A 3LDQB 4X5TA 1Y01A 4PFOA 1US7B 3N5LA 4U72A 4KHZF 3ZYKA 2WY2A 2V7JA 4IHJE 4DR1T 4UXNB 5AQTB 3W15B 3PJAA 3UU8A 2W67A 2UU9T 4LFCT 1T8BA 5JQGE 3GWHA 1HNZT 1D0ZA 3Q2MA 5KXJA 4CXWA 2ZM8A 3EAMA 5LHIB 4LF4T 1MMAA 2WU2A 4XZCA 3FBLA 2R6GF 3VR8A 3AEGA 3LJCA 1ZKEA 1WYCA 4TX5A 1W9RA 2BBJA 4G2AA 4XAXB 3RF1A 4EZ4A 4ZI2D 4OHFA 5DQWA 3U3IA 4CI3B 2CM0A 2WM9A 2XAFB 2XM2A 4HFEA 4OYJA 2NW7A 3CK6A 3P4SA 3ZJ2A 5ABFA 3ZYLA 2NTXA 3RGLA 1KFYA 2WCAA 2HHHT 2I6HA 2SPCA 5FMNA 1VOMA 4AI6A 2V7IA 1YQ4A 5F8PA 4GOUA 1WLXA 4PJMA 5FL0A 5C3JA 5HAXA 2VK9A 1HG5A 1XZYA 2WDQA 3SWHA 3LK42 5HEJA 3AXJA 5L4EA 4WYVA 3C4WA 3JC6C 5LHHB 1UK5A 1G73A 4GYSA 2V8SV 3UUBA 2MYSA 2XQ5A 2YDQA 1OWAA 2NW8A 3N9PA 3OKQA 5JDNA 1N34T 1OEDC 5DQVA 5ABFB 3AVRA 3I1AA 2EHOA 4NPPA 3AE9A 4O4IE 2YDRA 3OBVE 4HKAA 4QXHB 3UUXB 4AKLA 5LGUB 3VKHA 1ZEEA 2BBHA 2XQAA 1UGOA 2IIUA 2VL8A 3AE2A 4WBOA 3WI3A 4DV6T 5HEHA 4DUZT 4DR5T 2E9XA 2YU1A 3KDSE 5EZYE 3EDUA 2V7MA 5FVLA 2XQ7A 4NUUA 4UEMA 1QSDA 1R8IA 5L3BB 2I59A 4DVDA 5AQMB 2CEAA 3FXEB 3L09A 3ONLC 4CN6A 3PUAA 4B3MT 4Z90A 3LSVA 4CXYA 4EEDA 2BKOA 1D1CA 1HX1B 3ANWB 3CVRA 5FL1A 1XNRT 2XUEA 3ZYMA 3L39A 4U33A 1SE7A 1D0YA 4A97A 1NEKA 4X66T 3D0TA 4GK0E 2XAHB 2C5JA 2PG8A 2V5DA 4WW0A 4DO0A 3LG7A 2NP9A 2L3LA 3C50A 4U31A 4GK5E 2VVSA 2W66A 2WWUA 3PURA 4I4TE 1YQ3A 3NBXX 4AQGA 2CRBA 2FBWA 2XAQB 2K48A 4YT0A 5LHGB 2CXLA 1I94T
chains in the Genus database with same CATH topology
5LG4A 3KV4A 3ANWA 5JDFA 4YLHA 3HKCE 3MACA 3O1IA 1FEWA 1S35A 2LSYA 3N9MA 2DNXA 3RC3A 5L2LA 3O1HA 3M65A 3ESLA 5AFUL 3VKGA 2E8IA 3C4ZA 4Z8XA 2W63A 5KX5E 4N78D 3E0ZA 4MBQA 3MA9A 4TV9E 4H9RC 3ZMUB 1S94A 3CQXC 2VASA 3PE0A 5JR9C 1Y64B 2Q9QA 1IJ6A 2JJ9A 3V5SA 2ZLYA 1YKEB 1QUUA 3LK2B 5H6QB 2Y8DA 1YW0A 5LNKA 4ZHQE 2NTYA 1HS7A 5C8YE 3U78A 4HEAA 3IBPA 3E22E 3K3OA 4QX8B 2Q9QB 4ISSA 2KWIB 3AAAB 3ZMZB 2CMRA 3C98B 2BVMA 2PFVA 1UX4A 2CE7A 2LSIA 3I9WA 2J1DG 3FHNA 2D0TA 3LBXB 3OJAA 4WNKA 3ZJ1A 3KINB 5LXTE 1IJ5A 2LE8A 3K3QC 1E1HB 3NZPA 4TV8E 3VU7H 5LOVE 4MHCA 2NW9A 4UELA 3QUJA 4PK6A 2Y48B 2E9XB 4P09A 1HF8A 2LEHA 2UXXB 1IAPA 1SA0E 1BR2A 4O4HE 3ZC1A 3J7Yq 3K3NA 3KV5A 4UVCB 2ZMAA 3N2KE 2A2FX 3KFWX 2WMOA 4PAGA 1H7CA 2GK9A 2X9XA 5EK3A 2QGSA 4U74A 4UV8B 4EB6E 5L3GB 5FNVE 5LP6E 3MZKB 4O2AE 4DNDA 2W00A 4IE4A 4X1IE 2L8KA 2ODUA 2MOZA 4OK0A 5DJQC 2W62A 1MNEA 2DWGA 3PUGA 4O4LE 4PW8A 3RYIE 5HYAA 2K9AA 4I50E 4I55E 3F57A 2IAKA 4L0RA 3HKBE 2DHRA 2KLQA 1BR1A 3SRZA 3OYXA 5H6RB 2HPLA 4DMVA 3T8OA 3GMIA 4ZS3A 2HPJA 3OYZA 4ZS2A 2MTQA 1HTJF 5M4YA 4UVBB 2WMNA 2BDEA 3AA0B 1BR0A 1ZHCA 3CQCB 4JLEA 3AAEB 3DTOA 1B7TA 3Q9DA 2X68A 5KDMC 4G63A 2N2NA 4HTEA 4PFPA 3CMLA 4V1Av 5JREA 3RC8A 4YJ3E 3NZQA 3KBUA 3K8PC 2DWKA 3CQGB 2KNDA 2CLYC 3B13A 2KT9A 4PNIA 5E0OA 5L3DB 2PBIA 3V5UA 2V1DB 3MK7C 4H9SE 4PJNA 4HE8A 4FJOA 2Q9QD 2VKHA 2VB6A 2LSKA 3DP7A 3Q5WA 3BQIA 4X20E 4EZHA 3F31A 3UUMA 4H9NC 2DLRA 2CWYA 3VHLA 2CCQA 4AQFC 3LBXA 4AXPA 3RKOA 5HXEA 2XAJB 3CPZA 2CLYB 4EYUA 4H9OC 1HX8A 4UF0B 5EK4A 3UFEA 4IE6A 2RA1A 4EXTA 3CKDA 4JEUB 2JMHA 3PUQA 5HXCA 4P0BA 2PJQA 3I0QA 3RRCA 3C4XA 5J1GA 5LBMA 5J2UE 4X1YE 2D2SA 4BJMA 1MMNA 2V7KA 2X67A 2B1EA 1AJ3A 4WBNE 1LVFA 4UF0A 3EDVA 1YKHB 4ILUA 5JRCB 3MXZA 3N9LA 3RYCE 1SHZC 4QXBB 3N9NA 2X9HA 3BQLA 4KP3C 2G0UA 1NAFA 4C90A 2VKJA 3ZCIA 4BAYB 2X51A 4ISTA 3ZMTB 2VWAA 2WBLA 2IW5B 3KVAA 3A5XA 4JEHB 5LGTB 5JH7E 5ADXL 2P9BA 1KK7A 4IGUA 5JVDE 2M67A 2BVLA 2V7LA 3JC6D 3O1JA 3RX6A 4EIWA 2XHEB 2Y6XA 2HH7A 4QWNB 5FP3A 4H9PC 2ODVA 1OXZA 4PK4A 3CX6B 4H63H 2H7VC 4O4JE 2H7OA 2X66A 5JDQA 3SOLA 4CI1B 2CA5A 4E7SA 1MMDA 4GYRA 3DJBA 1LVKA 2KWHA 1MNDA 4PK5A 4QHOA 5JR9A 4AQFA 4ERRA 2CXFA 2ACXA 5FY7A 5BMVE 3PU3A 2MBGA 1G8XA 5FY1A 3HL6A 3MKDA 4AKIA 4CXXA 5HXHA 2UXNB 3B57A 3LK3B 1HG2A 3RRWA 5J2TE 4E7ZA 3FBZA 4ANJA 2K24A 1Z0PA 5JR9B 3LFMA 2BZBA 4UVAB 1D1AA 2YINA 3CX7B 4L5GA 4OFZA 5FY0A 1UCUA 4YJ2E 1IZNB 4MALA 4I43B 5JDLA 1ZV4X 4OYKA 2H3RA 4HGAA 2JMKA 5F3JA 2OA5A 3UULA 1MMGA 4DBRA 4EOZB 4ASKA 1YD8G 4IE5A 3EVYA 5CB4E 2LHRA 4QX7B 1WR6A 3I0OA 3RH3A 1UX5A 2CXDA 3N2OA 2C0SA 2VKOA 1U5PA 2ZM2A 2IC6A 3HKDE 5CA1E 3UTKA 4KUMB 4ZI3D 3I9YA 4C91A 4DBQA 3J9X1 3H37A 5LJNA 5LYJE 3IF8B 3RPUA 5JRCA 1D1BA 1X79A 3RYFE 2KXPB 2N1GA 4KMCA 3QC9A 2JRKA 4QKNA 4O8SA 4GIWA 4YFSA 4P0AA 4DMWA 1BR4A 4CQIA 2L9QA 2LT3A 1HCIA 2KMFA 4ZOLE 3IEEA 3P8CD 3BK9A 2JPFA 3L3PA 3P7IA 4X1KE 5DABA 3ZMVB 3AAIA 2Q9QC 3GN5B 3HKEE 5L3CB 5JDMA 1O3XA 2ZM0A 3ETVA 3O9XA 4MLKA 2NOXA 1FMVA 4H63V 3ZPOA 5LBQB 5L3EB 4A56A 3ETUA 5GONE 2LOPA 1LKXA 3N2GE 3F2EA 5FYMA 3PU8A 3EUHA 3GN5A 4O2BE 4AKGA 1NWMX 1WRDA 2LOSA 4ZI7E 2EHOD 4M1PA 2N9DA 3ZMSB 2XAGB 3PTRB 2VKDA 1CUNA 2Z6EA 2KINB 3ZN1B 4JUYA 4TUYE 4BJNA 5KMGP 2W61A 2K5BB 4YHJA 5LCYA 2LHNA 3ZN0B 3ONXA 1WYBA 4TN7B 3KVBA 4FI5A 3AA7B 4QXCB 3BQKA 4ADZA 3N9QA 3C64A 5FXZA 3HR0A 2WSSV 3Q5XA 2ES0A 3AVSA 4PJLA 1MIVA 3R84B 5JDGA 3FB2A 3WAKA 5EK2A 3FXDB 3ZLIA 3ZCJA 2E9XC 1KNZA 2JQQA 3TKLB 3ZC0A 2C5KT 4CI2B 5TAOA 2D0UA 3UUNA 1MIWA 5IYZE 3NRYA 5LJMA 4IDZA 2YEVC 4AKRB 5CA0E 2X9YA 2V26A 5ETWA 2RP4A 2CWOA 2XTLA 4HFVA 4CZZB 4F6RC 5JDHA 2XQYA 2DCFA 3S4UA 4AKHA 1LRZA 4PJJA 2DI4A 3UT5E 2XASB 4B6XA 3GA8A 2A72A 1HFAA 3IHRA 3CX8B 5HWXA 4H9QC 5IHYA 1FIOA 2EHOB 2C5IT 2LJLA 1FMWA 1D0XA 3KV9A 4EAHA 1T98A 5FXXA 4UIGA 4J2CA 5L3FB 4L9IA 3QK6A 2X0LB 4TZ4C 3HA4A 3CWZB 4IE0A 4MFRA 2A3DA 2W0GA 2WAUA 3KBTA 2X9WA 4IIJE 3C51A 3PDYA 2KZ7B 5FXVA 4BA9A 3N9OA 2EHOC 3AA6B 3MJXA 5HXRA 5HWYA 2NWBA 1VRBA 3AB3B 3PUSA 3RYHE 2D5UA 3WAJA 5LA6E 1V9DA 1EZ3A 3R6NA 3SS1A 4NUVA 1MIYA 3ZEFB 4K0UA 3E08A 3H3AA 5HXSA 3NRXA 3AA1B 5A1LA 2LSJA 4XBFB 3O4XE 2IC9A 3HI2A 5FXWA 4EYYR 4UV9B 4HN9A 2LM9A 2YU2A 4IE7A 4ZI3C 2LSGA 2YK0A 3KV6A 4KBMB 1U4QA 2E9XD 2QA7A 4PFOA 1US7B 3N5LA 4U72A 3ZYKA 2V7JA 4IHJE 4UXNB 3W15B 5JQGE 3GWHA 1D0ZA 3Q2MA 4CXWA 2ZM8A 5LHIB 1MMAA 4XZCA 3FBLA 3LJCA 1ZKEA 1WYCA 4TX5A 4XAXB 4EZ4A 4G2AA 4ZI2D 4OHFA 5DQWA 3U3IA 4CI3B 2CM0A 2WM9A 2XAFB 4OYJA 5LGNB 2NW7A 3ZJ2A 3ZYLA 2NTXA 2SPCA 5FMNA 1VOMA 4AI6A 2V7IA 5F8PA 4GOUA 1WLXA 4PJMA 5HAXA 2VK9A 1HG5A 3SWHA 3LK42 3C4WA 3JC6C 5LHHB 1G73A 4GYSA 5JDNA 2MYSA 3N9PA 1OWAA 2NW8A 3OKQA 5DQVA 3AVRA 3I1AA 2EHOA 4O4IE 3OBVE 4HKAA 4QXHB 3UUXB 4AKLA 5LGUB 3VKHA 1ZEEA 2VL8A 3WI3A 4WBOA 2E9XA 2YU1A 3KDSE 5EZYE 3EDUA 2V7MA 4ZI2C 4UEMA 4NUUA 5L3BB 1QSDA 2I59A 4DVDA 2CEAA 3FXEB 3L09A 3PUAA 4CXYA 1D1CA 3ANWB 3CVRA 2XUEA 3ZYMA 1D0YA 3D0TA 4GK0E 2XAHB 2C5JA 2PG8A 4WW0A 4DO0A 3LG7A 2NP9A 2L3LA 3C50A 4GK5E 2WWUA 3PURA 4I4TE 3NBXX 4AQGA 2XAQB 2K48A 5LHGB 2CXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EVY A; 
#chains in the Genus database with same CATH topology
 5LG4 A;  3KV4 A;  3ANW A;  2YOE A;  5JDF A;  4YLH A;  3FZF B;  2CBI A;  3HKC E;  3MAC A;  3O1I A;  1FEW A;  4TWD A;  1S35 A;  2JQ9 A;  2LSY A;  3N9M A;  2DNX A;  2XQ8 A;  3RC3 A;  3RIU C;  5L2L A;  3O1H A;  3T1Y T;  1JNR A;  2QVA A;  4HWC A;  3M65 A;  3ESL A;  1XDP A;  5AFU L;  1HNX T;  3VKG A;  2E8I A;  3C4Z A;  4Z8X A;  3PJA J;  5AQR B;  4AIS A;  5L47 A;  2W63 A;  4LF6 T;  5KX5 E;  4N78 D;  3E0Z A;  4MBQ A;  3MA9 A;  1QLB A;  3T1H T;  2X0H A;  2J62 A;  4TV9 E;  4H9R C;  3ZMU B;  2IHR 1;  1S94 A;  3CQX C;  2VAS A;  3VRB A;  3PE0 A;  1WR0 A;  2BG9 E;  4TNW A;  4JI2 T;  4YSZ A;  3AEF A;  1Y64 B;  2Q9Q A;  5JR9 C;  1IJ6 A;  5LB7 B;  2JJ9 A;  3V5S A;  2ZLY A;  1QUU A;  1YKE B;  3LK2 B;  5H6Q B;  2Y8D A;  1YW0 A;  5FVK A;  4JBW F;  2V5C A;  4QH5 A;  5LNK A;  4DV4 T;  4ZHQ E;  4OX9 T;  2NTY A;  3PUX F;  1HS7 A;  5C8Y E;  1XMO T;  4AIU A;  4DV1 T;  3U78 A;  4HEA A;  3IBP A;  3E22 E;  2LRK A;  3AE4 A;  3K3O A;  4QX8 B;  2Q9Q B;  3RI5 A;  4ISS A;  2WDR A;  2VQE T;  1XWM A;  2KWI B;  1OED E;  3AAA B;  3ZMZ B;  2CMR A;  3C98 B;  2BVM A;  2PFV A;  4HWI B;  1UX4 A;  2CE7 A;  2XSA A;  3TLS A;  2LSI A;  3AXJ B;  5AQL B;  5JTG A;  3AED A;  3I9W A;  2J1D G;  3FHN A;  4B3R T;  2LKG A;  2D0T A;  2J47 A;  3LBX B;  3Q5D A;  2MAW A;  2DL1 A;  3OJA A;  4WNK A;  4KI0 F;  3ZJ1 A;  3KIN B;  4Z91 A;  5LXT E;  4JI6 T;  1IJ5 A;  1SUM B;  2LE8 A;  3K3Q C;  2WP9 A;  1E1H B;  4YXD A;  4LF9 T;  3NZP A;  4TV8 E;  3VU7 H;  4TNV A;  5LOV E;  4MHC A;  5HCJ A;  2NW9 A;  5AQQ B;  2OLT A;  4HFB A;  4UEL A;  3QUJ A;  4DR6 T;  3UFG A;  4IDP A;  4PK6 A;  3AEB A;  4COF A;  2Y48 B;  2E9X B;  4P09 A;  4ZXL A;  3UQ7 A;  4YTP A;  1HF8 A;  3AE6 A;  2LEH A;  3M3Z B;  1J5W A;  5AQI B;  2UXX B;  3JAE A;  3RH3 A;  1IAP A;  1SA0 E;  3RKG A;  1BR2 A;  4O4H E;  3ZC1 A;  3X1D A;  4LFA T;  3ZT5 A;  3J7Y q;  1KF6 A;  3K3N A;  3KV5 A;  3B5M A;  2XQ3 A;  4UVC B;  2ZMA A;  3N2K E;  2A2F X;  3KFW X;  4DV0 T;  4IDO A;  2WMO A;  4PAG A;  1H7C A;  2GK9 A;  2X9X A;  5EK3 A;  2QGS A;  4U74 A;  4UV8 B;  2H89 A;  5HEG A;  5FNV E;  4EB6 E;  3MZK B;  4O2A E;  5AQF B;  5LP6 E;  2FJB A;  3UU6 A;  4DND A;  2W00 A;  4IE4 A;  4X1I E;  5CJ5 A;  2L8K A;  2ODU A;  5CGM A;  3CIR A;  4DUY T;  4K0K T;  2JQK A;  2MOZ A;  4OK0 A;  2W62 A;  1MNE A;  2DWG A;  3ONJ A;  3PUG A;  4HFH A;  2XSB A;  1UUR A;  2YDS A;  2J4G A;  2K9A A;  4PW8 A;  3RIA A;  3RYI E;  3VRA A;  2MPK A;  4DR3 T;  4I50 E;  4I55 E;  3F57 A;  2IAK A;  4L0R A;  3HKB E;  2DHR A;  5IWA T;  2KLQ A;  3OPC A;  4ILC A;  1BR1 A;  1L0V A;  3SRZ A;  3OYX A;  4JI7 T;  5H6R B;  2HPL A;  1W09 A;  5DJQ C;  3SFD A;  3RHW A;  3T8O A;  4DMV A;  3GMI A;  4ZS3 A;  2HPJ A;  3OYZ A;  4U7Y A;  4ZS2 A;  2MTQ A;  5ABE A;  2IML A;  1HTJ F;  3NVO A;  1KEY A;  3EAB A;  2HN2 A;  2WMN A;  2BKP A;  4UVB B;  5M4Y A;  4GKJ T;  2PTF A;  5HEU A;  2BDE A;  4DV7 T;  3AA0 B;  5LMU T;  3FZK B;  3IA3 A;  1ZHC A;  3FZM B;  3AEE A;  3CQC B;  5AQP B;  1BR0 A;  4JLE A;  3AAE B;  2NR4 A;  3DTO A;  2JQH A;  1B7T A;  3Q9D A;  2BG9 B;  2X68 A;  3RLF F;  5KDM C;  1T7S A;  2N2N A;  4G63 A;  4HTE A;  3CML A;  4PFP A;  4V1A v;  4WZX A;  5JRE A;  1XMQ T;  4HWD A;  4IDQ A;  3RC8 A;  4YJ3 E;  3NZQ A;  3KBU A;  2YKS A;  3K8P C;  3UQ4 A;  2DWK A;  2ZM6 T;  3CQG B;  4JI4 T;  2BKN A;  2KND A;  3PV0 F;  2CLY C;  4KX6 A;  2BG9 C;  3B13 A;  2KT9 A;  3AEA A;  4PNI A;  5E0O A;  5L3D B;  2PBI A;  2V6X A;  4X65 T;  3V5U A;  4YHH T;  2V1D B;  4LML A;  3MK7 C;  4H9S E;  4PJN A;  4HE8 A;  4FJO A;  4NXN T;  2Q9Q D;  2VKH A;  2VB6 A;  2LSK A;  3DP7 A;  3Q5W A;  2ACZ A;  3BQI A;  3Q5E A;  4O4L E;  4X20 E;  4EZH A;  3F31 A;  3UUM A;  4H9N C;  2DLR A;  2CWY A;  5AQK B;  1DU2 A;  3VHL A;  3ZKR A;  4A98 A;  2CCQ A;  4AQF C;  3LBX A;  4AXP A;  3QOF A;  3RKO A;  5HXE A;  2XAJ B;  3CPZ A;  2CLY B;  3P4W A;  4EYU A;  2WQY A;  4H9O C;  1HX8 A;  4UF0 B;  5EK4 A;  5HEO A;  4IE6 A;  3UFE A;  2RA1 A;  4EXT A;  3CKD A;  4JEU B;  2JMH A;  3PUQ A;  5HXC A;  4P0B A;  2PJQ A;  3I0Q A;  3RRC A;  1KNP A;  2FJA A;  3C4X A;  2WS3 A;  4ZEY A;  5J1G A;  2QYW A;  5LBM A;  5J2U E;  5BR8 T;  4X1Y E;  1KNR A;  2D2S A;  2I0M A;  3RQU A;  4BJM A;  1MMN A;  2V7K A;  5AQH B;  2X67 A;  2B1E A;  4JV5 T;  1N33 T;  4WBN E;  1AJ3 A;  1LVF A;  4U7I A;  2RPA A;  4UF0 A;  2XQ9 A;  4UR9 A;  3EDV A;  1YKH B;  4ILU A;  5JRC B;  3MXZ A;  3N9L A;  3RYC E;  1SHZ C;  3ZST A;  4QXB B;  4DID B;  3N9N A;  2X9H A;  3BQL A;  2V6Y A;  4KP3 C;  1VCT A;  1M62 A;  2G0U A;  1NAF A;  4C90 A;  2VKJ A;  3ZCI A;  4EV6 A;  3FZH B;  4BAY B;  2X51 A;  4IST A;  3ZMT B;  2IUB A;  2VWA A;  2WBL A;  2IW5 B;  3KVA A;  4JI8 T;  4P1N A;  3A5X A;  4TWH A;  3OTO T;  4JEH B;  3UU3 A;  1NEN A;  5LGT B;  2FJE A;  5JH7 E;  5ADX L;  2P9B A;  1KK7 A;  5FKY A;  4IGU A;  2VUR A;  2M67 A;  2BVL A;  2V7L A;  3JC6 D;  3O1J A;  5JVD E;  3PUY F;  3RX6 A;  2V6Y B;  1HNW T;  4EIW A;  4LF8 T;  2XHE B;  3A8Y C;  2Y6X A;  2HH7 A;  1W0A A;  4QWN B;  5L3E B;  1XNQ T;  5AQV B;  5FP3 A;  3AE7 A;  3K1S A;  3P4P A;  4H9P C;  4X64 T;  2W2U A;  2ODV A;  1XDO A;  1OXZ A;  4PK4 A;  3CX6 B;  4H63 H;  2H7V C;  4O4J E;  2H7O A;  2X66 A;  3RIF A;  3SOL A;  4EEB A;  4CI1 B;  2VVN A;  2CA5 A;  2FJD A;  5HYA A;  5AQS B;  4E7S A;  1MMD A;  4GYR A;  3ZT6 A;  3DJB A;  4DV5 T;  2UUC T;  1LVK A;  2KWH A;  3NWI A;  1MND A;  4PK5 A;  3AE5 A;  4QHO A;  5JR9 A;  4AQF A;  4ERR A;  1WCR A;  2ACX A;  2CXF A;  2WU5 A;  5FY7 A;  5BMV E;  3PU3 A;  2M6I A;  2MBG A;  2UUA T;  1G8X A;  2BG9 A;  2XY8 B;  5FY1 A;  3HL6 A;  3MKD A;  3NKZ A;  5L3G B;  3FZL B;  4AKI A;  4CXX A;  4JI5 T;  4CN4 A;  3JCF A;  5HXH A;  2UXN B;  3B57 A;  3LK3 B;  2UXC T;  2LM2 A;  3VR9 A;  1HG2 A;  3AEC A;  4I0U A;  3RRW A;  4E7Z A;  5J2T E;  4HWH A;  2KSR A;  3FBZ A;  2H88 A;  4ANJ A;  1OED A;  2K24 A;  1Z0P A;  5JR9 B;  3LFM A;  2BZB A;  4HFI A;  4UVA B;  1D1A A;  2YIN A;  3CX7 B;  4L5G A;  4OFZ A;  5FY0 A;  5ABH A;  1UCU A;  3EHZ A;  4YJ2 E;  1IZN B;  5HCM A;  2X0Y A;  4MAL A;  4I43 B;  5JDL A;  1ZV4 X;  4OYK A;  2H3R A;  4HGA A;  2JMK A;  5F3J A;  2XQ6 A;  1IBM T;  2OA5 A;  3PUV F;  3UUL A;  4JI1 T;  2BS2 A;  1JNZ A;  2IDO B;  4LFB T;  1MMG A;  4DBR A;  2XM1 A;  1OED B;  4ASK A;  4EOZ B;  1YD8 G;  4IE5 A;  3EVY A;  4HFC A;  5CB4 E;  2LHR A;  4QX7 B;  5LMN T;  2UXB T;  1WR6 A;  3I0O A;  2B76 A;  1UX5 A;  2CXD A;  2XZE A;  2BS3 A;  2C0S A;  2VKO A;  2W4X A;  2D9D A;  3N2O A;  3QB5 K;  2WWV A;  1U5P A;  2ZM2 A;  3AE8 A;  4JI3 T;  2IC6 A;  4B3S T;  3HKD E;  5CA1 E;  1ZP0 A;  1E7P A;  3UTK A;  4HFD A;  4KUM B;  4ZI3 D;  3I9Y A;  4C91 A;  4DBQ A;  3J9X 1;  3H37 A;  5LJN A;  2LRL A;  5LYJ E;  3IF8 B;  3RPU A;  4EGW A;  2CBJ A;  2OV9 A;  3AE3 A;  1D1B A;  5JRC A;  3TLW A;  2JIW A;  1X79 A;  3RYF E;  2KXP B;  2A9U A;  2UUB T;  4YY3 T;  2N1G A;  4KMC A;  3QC9 A;  2JRK A;  4QKN A;  5LGN B;  2F4V T;  3P4R A;  1YXR A;  4JYA T;  4O8S A;  4GIW A;  4YFS A;  5CFB A;  3P50 A;  4DMW A;  4P0A A;  2UXD T;  4DV2 T;  1BR4 A;  4TWF A;  4CQI A;  2L9Q A;  2LT3 A;  1HCI A;  2KMF A;  4ZOL E;  2YN6 A;  3H3M A;  3IEE A;  3P8C D;  2K3W A;  2JPF A;  3BK9 A;  3L3P A;  3P7I A;  4X1K E;  5AQJ B;  5DAB A;  3ZMV B;  3AAI A;  1I6Z A;  2Q9Q C;  3GN5 B;  3L8R A;  1E2A A;  3HKE E;  2VL0 A;  5L3C B;  5JDM A;  1O3X A;  2AE9 A;  2ZM0 A;  3ABV A;  4ILA A;  3ETV A;  2QRX A;  4Q25 A;  5F5W A;  4YSX A;  4U3C A;  3O9X A;  4LMK A;  4MLK A;  2NOX A;  1FMV A;  1M7K A;  4H63 V;  5LBQ B;  3ZPO A;  4IL4 A;  2AXD S;  4ILB A;  4A56 A;  3AE1 A;  3ETU A;  3OVU A;  5GON E;  2LOP A;  1LKX A;  4ZZC A;  3N2G E;  3F2E A;  5FYM A;  5IUX A;  3TLU A;  3PU8 A;  3EUH A;  3QNU A;  3GN5 A;  4O2B E;  4AKG A;  1NWM X;  2LKH A;  1WRD A;  2LOS A;  4QH1 A;  1Z8U A;  2EHO D;  4ZI7 E;  4M1P A;  4QH4 A;  2N9D A;  2BS4 A;  3ZMS B;  2XAG B;  3PTR B;  2HN1 A;  3ZSS A;  2VKD A;  1CUN A;  2WDV A;  2Z6E A;  4YSY A;  2KIN B;  3ZN1 B;  4JUY A;  4LMJ A;  4TUY E;  4BJN A;  3EI0 A;  4YTN A;  2W61 A;  2K5B B;  5KMG P;  4YHJ A;  5LCY A;  2LHN A;  4GKK T;  2CHO A;  3ZN0 B;  4KHP T;  3ONX A;  1WYB A;  4IDN A;  4TN7 B;  3KVB A;  4FI5 A;  4F8H A;  1N32 T;  3AA7 B;  4QXC B;  1UUS A;  3BQK A;  2CHN A;  4ADZ A;  3N9Q A;  3C64 A;  5AQO B;  5FXZ A;  3HR0 A;  2WSS V;  2WB5 A;  3Q5X A;  3PUW F;  5AQU B;  2ES0 A;  3AVS A;  4PJL A;  1MIV A;  3R84 B;  5JDG A;  3FB2 A;  3WAK A;  1FJG T;  4ZZB A;  5EK2 A;  2E5V A;  3FXD B;  4U2Z A;  5C2T A;  3ZLI A;  4B3T T;  3ZCJ A;  3ZT7 A;  1GQE A;  2E9X C;  4DV3 T;  3RIU A;  1KNZ A;  2JQQ A;  3TKL B;  3ZC0 A;  5J0Z A;  2C5K T;  4A5X A;  4LF5 T;  4CI2 B;  5L4H A;  2E2A A;  5TAO A;  2CPT A;  2D0U A;  3UUN A;  4AQY T;  4YTM A;  1IBL T;  1MIW A;  5LG3 A;  5IYZ E;  2XQ4 A;  3NRY A;  4IDZ A;  2YEV C;  5LJM A;  4AKR B;  5CA0 E;  2X9Y A;  2V26 A;  5AQG B;  2RP4 A;  2CWO A;  2XTL A;  4HFV A;  2XJ7 A;  5ETW A;  4CZZ B;  2XQY A;  4F6R C;  4HWF A;  5JDH A;  2DCF A;  3PUZ F;  3S4U A;  4DR7 T;  3UU5 A;  4AKH A;  1LRZ A;  4PJJ A;  1J1J A;  4NIQ A;  2DI4 A;  3UT5 E;  2XAS B;  4B6X A;  2XPK A;  1X9B A;  3GA8 A;  2A72 A;  1HFA A;  4LF7 T;  3IHR A;  3CX8 B;  5HWX A;  4H9Q C;  3P4Q A;  5IHY A;  5JDQ A;  1FIO A;  2EHO B;  1ZOY A;  2C5I T;  4CN1 A;  2LJL A;  1FMW A;  1D0X A;  3KV9 A;  4EAH A;  1T98 A;  5FXX A;  4UIG A;  4J2C A;  5L3F B;  4L9I A;  3QK6 A;  5ABG A;  3RQW A;  2X0L B;  4TZ4 C;  4IT4 A;  2WZH A;  3HA4 A;  4NXM T;  3CWZ B;  4IE0 A;  4MFR A;  2A3D A;  3JAF A;  2W0G A;  2WAU A;  3UU4 A;  4X62 T;  3KBT A;  4JI0 T;  2X9W A;  4IIJ E;  1HR0 T;  3C51 A;  3PDY A;  4U2Y A;  2KZ7 B;  1VCS A;  5FXV A;  4BA9 A;  3N9O A;  3TLT A;  2EHO C;  3AA6 B;  3MJX A;  5HXR A;  5HWY A;  2NWB A;  1VRB A;  3A7M A;  3AB3 B;  2LLY A;  3PUS A;  2D5U A;  3RYH E;  2M6B A;  3WAJ A;  5LA6 E;  1V9D A;  1EZ3 A;  1CHU A;  3R6N A;  3SFE A;  3TLV A;  1WFD A;  3SS1 A;  4NUV A;  1MIY A;  1J5E T;  3ZEF B;  4K0U A;  2FUP A;  3E08 A;  3H3A A;  4DR4 T;  3JAD A;  5HXS A;  3G06 A;  1N36 T;  3NRX A;  1IBK T;  3AA1 B;  1T72 A;  5A1L A;  2LSJ A;  4ZI2 C;  5AQN B;  4XBF B;  3QB5 A;  4IRE A;  3O4X E;  2IC9 A;  3HI2 A;  5FXW A;  4EYY R;  4DR2 T;  4UV9 B;  4HN9 A;  2WZI A;  4IL9 A;  2VQF T;  2E5L T;  2LM9 A;  2YU2 A;  4IE7 A;  4ZI3 C;  1W0B A;  2LSG A;  2YK0 A;  3KV6 A;  4KBM B;  1U4Q A;  2E9X D;  2QA7 A;  3LDQ B;  4X5T A;  1Y01 A;  4PFO A;  1US7 B;  3N5L A;  4U72 A;  4KHZ F;  3ZYK A;  2WY2 A;  2V7J A;  4IHJ E;  4DR1 T;  4UXN B;  5AQT B;  3W15 B;  3PJA A;  3UU8 A;  2W67 A;  2UU9 T;  4LFC T;  1T8B A;  5JQG E;  3GWH A;  1HNZ T;  1D0Z A;  3Q2M A;  5KXJ A;  4CXW A;  2ZM8 A;  3EAM A;  5LHI B;  4LF4 T;  1MMA A;  2WU2 A;  4XZC A;  3FBL A;  2R6G F;  3VR8 A;  3AEG A;  3LJC A;  1ZKE A;  1WYC A;  4TX5 A;  1W9R A;  2BBJ A;  4G2A A;  4XAX B;  3RF1 A;  4EZ4 A;  4ZI2 D;  4OHF A;  5DQW A;  3U3I A;  4CI3 B;  2CM0 A;  2WM9 A;  2XAF B;  2XM2 A;  4HFE A;  4OYJ A;  2NW7 A;  3CK6 A;  3P4S A;  3ZJ2 A;  5ABF A;  3ZYL A;  2NTX A;  3RGL A;  1KFY A;  2WCA A;  2HHH T;  2I6H A;  2SPC A;  5FMN A;  1VOM A;  4AI6 A;  2V7I A;  1YQ4 A;  5F8P A;  4GOU A;  1WLX A;  4PJM A;  5FL0 A;  5C3J A;  5HAX A;  2VK9 A;  1HG5 A;  1XZY A;  2WDQ A;  3SWH A;  3LK4 2;  5HEJ A;  3AXJ A;  5L4E A;  4WYV A;  3C4W A;  3JC6 C;  5LHH B;  1UK5 A;  1G73 A;  4GYS A;  2V8S V;  3UUB A;  2MYS A;  2XQ5 A;  2YDQ A;  1OWA A;  2NW8 A;  3N9P A;  3OKQ A;  5JDN A;  1N34 T;  1OED C;  5DQV A;  5ABF B;  3AVR A;  3I1A A;  2EHO A;  4NPP A;  3AE9 A;  4O4I E;  2YDR A;  3OBV E;  4HKA A;  4QXH B;  3UUX B;  4AKL A;  5LGU B;  3VKH A;  1ZEE A;  2BBH A;  2XQA A;  1UGO A;  2IIU A;  2VL8 A;  3AE2 A;  4WBO A;  3WI3 A;  4DV6 T;  5HEH A;  4DUZ T;  4DR5 T;  2E9X A;  2YU1 A;  3KDS E;  5EZY E;  3EDU A;  2V7M A;  5FVL A;  2XQ7 A;  4NUU A;  4UEM A;  1QSD A;  1R8I A;  5L3B B;  2I59 A;  4DVD A;  5AQM B;  2CEA A;  3FXE B;  3L09 A;  3ONL C;  4CN6 A;  3PUA A;  4B3M T;  4Z90 A;  3LSV A;  4CXY A;  4EED A;  2BKO A;  1D1C A;  1HX1 B;  3ANW B;  3CVR A;  5FL1 A;  1XNR T;  2XUE A;  3ZYM A;  3L39 A;  4U33 A;  1SE7 A;  1D0Y A;  4A97 A;  1NEK A;  4X66 T;  3D0T A;  4GK0 E;  2XAH B;  2C5J A;  2PG8 A;  2V5D A;  4WW0 A;  4DO0 A;  3LG7 A;  2NP9 A;  2L3L A;  3C50 A;  4U31 A;  4GK5 E;  2VVS A;  2W66 A;  2WWU A;  3PUR A;  4I4T E;  1YQ3 A;  3NBX X;  4AQG A;  2CRB A;  2FBW A;  2XAQ B;  2K48 A;  4YT0 A;  5LHG B;  2CXL A;  1I94 T; 
#chains in the Genus database with same CATH homology
 5LG4 A;  3KV4 A;  3ANW A;  5JDF A;  4YLH A;  3HKC E;  3MAC A;  3O1I A;  1FEW A;  1S35 A;  2LSY A;  3N9M A;  2DNX A;  3RC3 A;  5L2L A;  3O1H A;  3M65 A;  3ESL A;  5AFU L;  3VKG A;  2E8I A;  3C4Z A;  4Z8X A;  2W63 A;  5KX5 E;  4N78 D;  3E0Z A;  4MBQ A;  3MA9 A;  4TV9 E;  4H9R C;  3ZMU B;  1S94 A;  3CQX C;  2VAS A;  3PE0 A;  5JR9 C;  1Y64 B;  2Q9Q A;  1IJ6 A;  2JJ9 A;  3V5S A;  2ZLY A;  1YKE B;  1QUU A;  3LK2 B;  5H6Q B;  2Y8D A;  1YW0 A;  5LNK A;  4ZHQ E;  2NTY A;  1HS7 A;  5C8Y E;  3U78 A;  4HEA A;  3IBP A;  3E22 E;  3K3O A;  4QX8 B;  2Q9Q B;  4ISS A;  2KWI B;  3AAA B;  3ZMZ B;  2CMR A;  3C98 B;  2BVM A;  2PFV A;  1UX4 A;  2CE7 A;  2LSI A;  3I9W A;  2J1D G;  3FHN A;  2D0T A;  3LBX B;  3OJA A;  4WNK A;  3ZJ1 A;  3KIN B;  5LXT E;  1IJ5 A;  2LE8 A;  3K3Q C;  1E1H B;  3NZP A;  4TV8 E;  3VU7 H;  5LOV E;  4MHC A;  2NW9 A;  4UEL A;  3QUJ A;  4PK6 A;  2Y48 B;  2E9X B;  4P09 A;  1HF8 A;  2LEH A;  2UXX B;  1IAP A;  1SA0 E;  1BR2 A;  4O4H E;  3ZC1 A;  3J7Y q;  3K3N A;  3KV5 A;  4UVC B;  2ZMA A;  3N2K E;  2A2F X;  3KFW X;  2WMO A;  4PAG A;  1H7C A;  2GK9 A;  2X9X A;  5EK3 A;  2QGS A;  4U74 A;  4UV8 B;  4EB6 E;  5L3G B;  5FNV E;  5LP6 E;  3MZK B;  4O2A E;  4DND A;  2W00 A;  4IE4 A;  4X1I E;  2L8K A;  2ODU A;  2MOZ A;  4OK0 A;  5DJQ C;  2W62 A;  1MNE A;  2DWG A;  3PUG A;  4O4L E;  4PW8 A;  3RYI E;  5HYA A;  2K9A A;  4I50 E;  4I55 E;  3F57 A;  2IAK A;  4L0R A;  3HKB E;  2DHR A;  2KLQ A;  1BR1 A;  3SRZ A;  3OYX A;  5H6R B;  2HPL A;  4DMV A;  3T8O A;  3GMI A;  4ZS3 A;  2HPJ A;  3OYZ A;  4ZS2 A;  2MTQ A;  1HTJ F;  5M4Y A;  4UVB B;  2WMN A;  2BDE A;  3AA0 B;  1BR0 A;  1ZHC A;  3CQC B;  4JLE A;  3AAE B;  3DTO A;  1B7T A;  3Q9D A;  2X68 A;  5KDM C;  4G63 A;  2N2N A;  4HTE A;  4PFP A;  3CML A;  4V1A v;  5JRE A;  3RC8 A;  4YJ3 E;  3NZQ A;  3KBU A;  3K8P C;  2DWK A;  3CQG B;  2KND A;  2CLY C;  3B13 A;  2KT9 A;  4PNI A;  5E0O A;  5L3D B;  2PBI A;  3V5U A;  2V1D B;  3MK7 C;  4H9S E;  4PJN A;  4HE8 A;  4FJO A;  2Q9Q D;  2VKH A;  2VB6 A;  2LSK A;  3DP7 A;  3Q5W A;  3BQI A;  4X20 E;  4EZH A;  3F31 A;  3UUM A;  4H9N C;  2DLR A;  2CWY A;  3VHL A;  2CCQ A;  4AQF C;  3LBX A;  4AXP A;  3RKO A;  5HXE A;  2XAJ B;  3CPZ A;  2CLY B;  4EYU A;  4H9O C;  1HX8 A;  4UF0 B;  5EK4 A;  3UFE A;  4IE6 A;  2RA1 A;  4EXT A;  3CKD A;  4JEU B;  2JMH A;  3PUQ A;  5HXC A;  4P0B A;  2PJQ A;  3I0Q A;  3RRC A;  3C4X A;  5J1G A;  5LBM A;  5J2U E;  4X1Y E;  2D2S A;  4BJM A;  1MMN A;  2V7K A;  2X67 A;  2B1E A;  1AJ3 A;  4WBN E;  1LVF A;  4UF0 A;  3EDV A;  1YKH B;  4ILU A;  5JRC B;  3MXZ A;  3N9L A;  3RYC E;  1SHZ C;  4QXB B;  3N9N A;  2X9H A;  3BQL A;  4KP3 C;  2G0U A;  1NAF A;  4C90 A;  2VKJ A;  3ZCI A;  4BAY B;  2X51 A;  4IST A;  3ZMT B;  2VWA A;  2WBL A;  2IW5 B;  3KVA A;  3A5X A;  4JEH B;  5LGT B;  5JH7 E;  5ADX L;  2P9B A;  1KK7 A;  4IGU A;  5JVD E;  2M67 A;  2BVL A;  2V7L A;  3JC6 D;  3O1J A;  3RX6 A;  4EIW A;  2XHE B;  2Y6X A;  2HH7 A;  4QWN B;  5FP3 A;  4H9P C;  2ODV A;  1OXZ A;  4PK4 A;  3CX6 B;  4H63 H;  2H7V C;  4O4J E;  2H7O A;  2X66 A;  5JDQ A;  3SOL A;  4CI1 B;  2CA5 A;  4E7S A;  1MMD A;  4GYR A;  3DJB A;  1LVK A;  2KWH A;  1MND A;  4PK5 A;  4QHO A;  5JR9 A;  4AQF A;  4ERR A;  2CXF A;  2ACX A;  5FY7 A;  5BMV E;  3PU3 A;  2MBG A;  1G8X A;  5FY1 A;  3HL6 A;  3MKD A;  4AKI A;  4CXX A;  5HXH A;  2UXN B;  3B57 A;  3LK3 B;  1HG2 A;  3RRW A;  5J2T E;  4E7Z A;  3FBZ A;  4ANJ A;  2K24 A;  1Z0P A;  5JR9 B;  3LFM A;  2BZB A;  4UVA B;  1D1A A;  2YIN A;  3CX7 B;  4L5G A;  4OFZ A;  5FY0 A;  1UCU A;  4YJ2 E;  1IZN B;  4MAL A;  4I43 B;  5JDL A;  1ZV4 X;  4OYK A;  2H3R A;  4HGA A;  2JMK A;  5F3J A;  2OA5 A;  3UUL A;  1MMG A;  4DBR A;  4EOZ B;  4ASK A;  1YD8 G;  4IE5 A;  3EVY A;  5CB4 E;  2LHR A;  4QX7 B;  1WR6 A;  3I0O A;  3RH3 A;  1UX5 A;  2CXD A;  3N2O A;  2C0S A;  2VKO A;  1U5P A;  2ZM2 A;  2IC6 A;  3HKD E;  5CA1 E;  3UTK A;  4KUM B;  4ZI3 D;  3I9Y A;  4C91 A;  4DBQ A;  3J9X 1;  3H37 A;  5LJN A;  5LYJ E;  3IF8 B;  3RPU A;  5JRC A;  1D1B A;  1X79 A;  3RYF E;  2KXP B;  2N1G A;  4KMC A;  3QC9 A;  2JRK A;  4QKN A;  4O8S A;  4GIW A;  4YFS A;  4P0A A;  4DMW A;  1BR4 A;  4CQI A;  2L9Q A;  2LT3 A;  1HCI A;  2KMF A;  4ZOL E;  3IEE A;  3P8C D;  3BK9 A;  2JPF A;  3L3P A;  3P7I A;  4X1K E;  5DAB A;  3ZMV B;  3AAI A;  2Q9Q C;  3GN5 B;  3HKE E;  5L3C B;  5JDM A;  1O3X A;  2ZM0 A;  3ETV A;  3O9X A;  4MLK A;  2NOX A;  1FMV A;  4H63 V;  3ZPO A;  5LBQ B;  5L3E B;  4A56 A;  3ETU A;  5GON E;  2LOP A;  1LKX A;  3N2G E;  3F2E A;  5FYM A;  3PU8 A;  3EUH A;  3GN5 A;  4O2B E;  4AKG A;  1NWM X;  1WRD A;  2LOS A;  4ZI7 E;  2EHO D;  4M1P A;  2N9D A;  3ZMS B;  2XAG B;  3PTR B;  2VKD A;  1CUN A;  2Z6E A;  2KIN B;  3ZN1 B;  4JUY A;  4TUY E;  4BJN A;  5KMG P;  2W61 A;  2K5B B;  4YHJ A;  5LCY A;  2LHN A;  3ZN0 B;  3ONX A;  1WYB A;  4TN7 B;  3KVB A;  4FI5 A;  3AA7 B;  4QXC B;  3BQK A;  4ADZ A;  3N9Q A;  3C64 A;  5FXZ A;  3HR0 A;  2WSS V;  3Q5X A;  2ES0 A;  3AVS A;  4PJL A;  1MIV A;  3R84 B;  5JDG A;  3FB2 A;  3WAK A;  5EK2 A;  3FXD B;  3ZLI A;  3ZCJ A;  2E9X C;  1KNZ A;  2JQQ A;  3TKL B;  3ZC0 A;  2C5K T;  4CI2 B;  5TAO A;  2D0U A;  3UUN A;  1MIW A;  5IYZ E;  3NRY A;  5LJM A;  4IDZ A;  2YEV C;  4AKR B;  5CA0 E;  2X9Y A;  2V26 A;  5ETW A;  2RP4 A;  2CWO A;  2XTL A;  4HFV A;  4CZZ B;  4F6R C;  5JDH A;  2XQY A;  2DCF A;  3S4U A;  4AKH A;  1LRZ A;  4PJJ A;  2DI4 A;  3UT5 E;  2XAS B;  4B6X A;  3GA8 A;  2A72 A;  1HFA A;  3IHR A;  3CX8 B;  5HWX A;  4H9Q C;  5IHY A;  1FIO A;  2EHO B;  2C5I T;  2LJL A;  1FMW A;  1D0X A;  3KV9 A;  4EAH A;  1T98 A;  5FXX A;  4UIG A;  4J2C A;  5L3F B;  4L9I A;  3QK6 A;  2X0L B;  4TZ4 C;  3HA4 A;  3CWZ B;  4IE0 A;  4MFR A;  2A3D A;  2W0G A;  2WAU A;  3KBT A;  2X9W A;  4IIJ E;  3C51 A;  3PDY A;  2KZ7 B;  5FXV A;  4BA9 A;  3N9O A;  2EHO C;  3AA6 B;  3MJX A;  5HXR A;  5HWY A;  2NWB A;  1VRB A;  3AB3 B;  3PUS A;  3RYH E;  2D5U A;  3WAJ A;  5LA6 E;  1V9D A;  1EZ3 A;  3R6N A;  3SS1 A;  4NUV A;  1MIY A;  3ZEF B;  4K0U A;  3E08 A;  3H3A A;  5HXS A;  3NRX A;  3AA1 B;  5A1L A;  2LSJ A;  4XBF B;  3O4X E;  2IC9 A;  3HI2 A;  5FXW A;  4EYY R;  4UV9 B;  4HN9 A;  2LM9 A;  2YU2 A;  4IE7 A;  4ZI3 C;  2LSG A;  2YK0 A;  3KV6 A;  4KBM B;  1U4Q A;  2E9X D;  2QA7 A;  4PFO A;  1US7 B;  3N5L A;  4U72 A;  3ZYK A;  2V7J A;  4IHJ E;  4UXN B;  3W15 B;  5JQG E;  3GWH A;  1D0Z A;  3Q2M A;  4CXW A;  2ZM8 A;  5LHI B;  1MMA A;  4XZC A;  3FBL A;  3LJC A;  1ZKE A;  1WYC A;  4TX5 A;  4XAX B;  4EZ4 A;  4G2A A;  4ZI2 D;  4OHF A;  5DQW A;  3U3I A;  4CI3 B;  2CM0 A;  2WM9 A;  2XAF B;  4OYJ A;  5LGN B;  2NW7 A;  3ZJ2 A;  3ZYL A;  2NTX A;  2SPC A;  5FMN A;  1VOM A;  4AI6 A;  2V7I A;  5F8P A;  4GOU A;  1WLX A;  4PJM A;  5HAX A;  2VK9 A;  1HG5 A;  3SWH A;  3LK4 2;  3C4W A;  3JC6 C;  5LHH B;  1G73 A;  4GYS A;  5JDN A;  2MYS A;  3N9P A;  1OWA A;  2NW8 A;  3OKQ A;  5DQV A;  3AVR A;  3I1A A;  2EHO A;  4O4I E;  3OBV E;  4HKA A;  4QXH B;  3UUX B;  4AKL A;  5LGU B;  3VKH A;  1ZEE A;  2VL8 A;  3WI3 A;  4WBO A;  2E9X A;  2YU1 A;  3KDS E;  5EZY E;  3EDU A;  2V7M A;  4ZI2 C;  4UEM A;  4NUU A;  5L3B B;  1QSD A;  2I59 A;  4DVD A;  2CEA A;  3FXE B;  3L09 A;  3PUA A;  4CXY A;  1D1C A;  3ANW B;  3CVR A;  2XUE A;  3ZYM A;  1D0Y A;  3D0T A;  4GK0 E;  2XAH B;  2C5J A;  2PG8 A;  4WW0 A;  4DO0 A;  3LG7 A;  2NP9 A;  2L3L A;  3C50 A;  4GK5 E;  2WWU A;  3PUR A;  4I4T E;  3NBX X;  4AQG A;  2XAQ B;  2K48 A;  5LHG B;  2CXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...