2W62A

Saccharomyces cerevisiae gas2p in complex with laminaripentaose
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
461
structure length
436
Chain Sequence
b'SFEKTPAIKIVGNKFFDSESGEQFFIKGIAYQLQRSGAFETSYIDALADPKICLRDIPFLKMLGVNTLRVYAIDPTKSHDICMEALSAEGMYVLLDLSEPDISINRENPSWDVHIFERYKSVIDAMSSFPNLLGYFAGNEVTNDHTNTFASPFVKAAIRDAKEYISHSNHRKIPVGYSTNDDAMTRDNLARYFVCGDVKADFYGINMYEWCGYSTYGTSGYRERTKEFEGYPIPVFFSEFGCNLVRPRPFTEVSALYGNKMSSVWSGGLAYMYFEEENEYGVVKINDNDGVDILPDFKNLKKEFAKADPKGITEEEYLTESVECPHIAVGVWEANEKLPETPDRSKCACLDEILPCEIVPFGKYEEYFSYLCSKVDCSDILANGKTGEYGEFSDCSVEQKLSLQLSKLYCKIGANDRHCPLNDKNVYFNLESLQPC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLYCOLIPID-ANCHORED SURFACE PROTEIN 2
publication title Molecular Mechanisms of Yeast Cell Wall Glucan Remodeling.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 162
structure length 436
sequence length 461
ec nomenclature ec 2.4.1.-:
pdb deposition date 2008-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03198 Glyco_hydro_72 Glucanosyltransferase
A PF07983 X8 X8 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1040 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2w62A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2w62A01
5KEZA 1UH2A 4GZIA 3THCA 3AXIA 3RILA 4TX6A 4AZ7A 2EJ1A 1GHRA 3VD7A 1TR1A 4CU6A 4ML4A 2VRKA 2XVPA 3VD4A 4AZCB 4P8UA 5GNYA 3VGGA 3EYPA 1V0NA 2XVNA 1G1YA 3OGVA 2GK1B 3SCQA 2ZOXA 2J7EA 3UCQA 2OLHA 1TVNA 1WZKA 1WZMA 4NSBA 5EFDA 1ISXA 1XYZA 1US2A 1R87A 4D6CA 1JFHA 1MW1A 3HJEA 3WQVA 6CGTA 1UZ4A 3AMKA 4ATLA 2JEQA 1GOWA 2CESA 5EB8A 3BAXA 1DWAM 5FL1A 1W1VA 1H2JA 2ZWZA 2J62A 1XHGA 1VFFA 1HF6A 1V3JA 4J7RA 4W5UA 1BGGA 4U5KA 1Q4NX 3II1A 4IISA 4NRRA 4V28A 1UKSA 2Y8VA 5BXTA 5JBDA 2O9OA 3A4AA 4MNMA 2A3CA 3W37A 4EKJA 1MW0A 1HJSA 1CXLA 1QI4A 1GW1A 3W6LA 4FMVA 3VIFA 1S46A 4PN2A 2VRQA 4WK9A 1EO7A 3NIYA 2WBGA 5IXEA 1IZKA 3WH9A 5HBFA 2PBGA 3NDYA 4FLOA 3MO4A 2E0PA 1MFVA 1V6XA 3ARXA 2VCAA 3AHYA 1RD6A 4MNKA 2W66A 1VB9A 3FW6A 2CERA 2X2YA 3K8LA 1B30A 2QF8A 4N0RA 4PTMA 2G41A 1KR0A 1CXFA 2ZUTA 1CGYA 4W7UA 2OWXA 1W1TA 1VEOA 1WZAA 3PTQA 3WL1A 3FHQA 3WIJA 3AZTA 3NSMA 5E0FA 3WDRA 2ZICA 1JDAA 5E0CA 4U2YA 2FGLA 1NP0A 3WN6A 4FLSA 3VILA 1VBRA 1M03A 5CLTA 4ZE5A 2GSJA 1DTUA 2D1ZA 3GZAA 3WNKA 4KRUA 1OIMA 1ZU8A 3CO4A 4UOQA 3WELA 1KQZA 1M7XA 4QLJA 4MDOA 3O9NA 2DEPA 4BZYA 1XYFA 1JZ4A 3AFBA 5DMYA 3GXFA 4JZ5A 1UKQA 1E6ZA 2PI6A 1C7SA 1DWIM 1BPLB 4HMEA 3SUSA 1UR9A 3BMVA 1UZ1A 3WEMA 1E56A 2XFYA 3PZGA 4GI9A 1D3CA 4WIWA 5AY7A 4GO8A 4HU8A 1MW2A 4P7OA 4PMQA 3EDEA 1NWTA 3VX0A 2FHCA 3BC9A 2HISA 3G6MA 3CMGA 5M03A 1WDQA 1J0HA 3ZMRA 4LYRA 4BS0A 4R5EA 2WVTA 4IPLA 4HOWA 1TG7A 4BQ4A 1HP5A 4P7QA 9CGTA 4KMQA 1E6RA 3MU7A 3OGSA 4HU0A 4PMUA 1BAGA 4CD6A 3AIRA 3FY1A 2VOTA 3SCWA 3RPMA 1O6IA 2XWEA 4HMDA 1XH0A 2VVSA 4F9DA 1QI0A 2Y24A 2VX6A 1W1PA 1X6LA 4JIEA 3WL0A 5BXRA 4CD7A 1CDGA 2CIPA 3VU2A 2BV9A 1PBGA 2WMHA 1HKMA 1B31A 3W82A 2WC4A 1K6AA 2WCSA 3POHA 3BH4A 3BGAA 1EDGA 1QNQA 1V0MA 4EK7A 2E9LA 2F61A 1C8QA 3PZMA 3WDPP 3WDQA 2J74A 2ZUSA 1MQPA 4PTXA 1WDSA 1V3LA 2WCAA 4R27A 4WKHA 1UWQA 2VC9A 1LQ0A 5ABHA 3UEQA 1HKJA 1Q6FA 3ZJ6A 2QHAA 3DHPA 4AMCA 3W6MA 1E6NA 2XSAA 2ZXBA 2G4FA 2J7BA 3PN8A 3T08A 3GH7A 5E6ZA 1E40A 5GNXA 1KXQA 2ZUVA 1UKTA 3CUHA 4UOJA 3UG3A 2EPKX 3GH5A 2YA1A 1VF8A 4PRWA 2GDVA 1AVAA 1PX8A 3I3EA 3PZUA 1W9UA 1J01A 2CXGA 1V02A 3VMOA 1UD3A 2J25A 4HA1A 1UHVA 1CGWA 4PBGA 4CCEA 4MNJA 1W9PA 2AAAA 3G6LA 1NARA 5CZKA 2Q8XA 1R7AA 2WHJA 5JIWA 1TFVA 4CU8A 1QOXA 5CG0A 3WFLA 2YKKA 1DP0A 2DSUA 5ABEA 3GBEA 1E1FA 2GVYA 5DO8A 4C7FA 2WZEA 1B3XA 1BFNA 4AEEA 2W62A 4IPNB 3EMQA 1K9DA 3VDBA 2DSKA 1HJXA 1OWQA 2WKLA 3AZSA 1JI2A 1MYRA 4H7VA 4AZIA 3VX1A 4LXFA 3BCFA 1ESWA 1N82A 4HOXA 4H8UA 3MV01 2XJ7A 3GNOA 1CYGA 1GOOA 3WF0A 1ISVA 3OLEA 2E8ZA 4UQ9A 4AZ5A 3NSXA 4CKQA 3LPPA 2WLYA 2DT0A 1NOWA 3MANA 3O6AA 2NT0A 1GJUA 1PJ9A 4OOZA 1BLIA 3RM8A 2JFEX 1NOUA 1JZ5A 1AMYA 2CKRA 3W28A 2YLLA 4QCFA 2ZWYA 4U3AA 2D3NA 3ARVA 3WNLA 5DT5A 1FH7A 2OSXA 2OSWA 4CD4A 4CN4A 1CGXA 3CHEA 4AD2A 1E0VA 3BCDA 3SCRA 4PMNA 3VD9A 1CXKA 1NM9A 2AOSA 1EH9A 4BCEA 4DWSA 4AD0A 1ITXA 5C70A 1JDDA 1EQCA 1PIGA 3SCOA 4B3KA 3AS0A 4AIOA 1G5AA 2XIBA 2ZUNA 1EXPA 1O7AA 4ATWA 1BTCA 3OGRA 5TD4A 5I5RA 1UR1A 1E3ZA 3AQUA 1KB3A 4HOZA 4JFUA 4X0VA 1HNYA 3NSNA 2EPLX 1OD0A 3W29A 4MJ4A 2XM2A 2X8RA 4HPHA 4TTGA 3AISA 1NWSA 3WH7A 4GO9A 1V03A 1CXHA 3GDBA 5I24A 4ZFMA 3ECQA 1HN1A 3UERA 2DH2A 3MUY1 1W9BM 4CCCA 5A69A 2J7FA 3WFZA 4X0NA 1VJZA 4C7DA 3ZO9A 3KL5A 4P7NA 4IM4A 5I6SA 3D5HA 3WDHA 3FHAA 3VOCA 3U5YA 1RH9A 1UH3A 4AISA 3MMWA 1NP2A 4LYPA 1V02E 2RGLA 2VI0A 3IK2A 3PZ9A 4AZCA 1BYBA 3TONA 3WH6A 2WHMA 5IHRA 3ARUA 2GK1A 1ZS2A 4W7WA 1W32A 4NZCA 1W3KA 5A6JA 3FNDA 3VTRA 1PAMA 1CECA 4P8WA 3ZIZA 1UR2A 2G3MA 2A3EA 4RL3A 3OZPA 1CZ1A 3L2LA 3RO8A 3OA5A 2W63A 1LL4A 2J79A 1Q6CA 2XTKA 3TTOA 1KBKA 1E4MM 2VRJA 4CU7A 4K68A 1ZBCA 3TTYA 3CMJA 3SCNA 3K8KA 1SFSA 2VMFA 5D9PA 3CZJA 4PEEA 5A6SA 5C71A 1CXIA 1L0PA 1J0YA 1E0XA 1OCQA 1P6WA 5A94A 1EHNA 4GINA 3ARRA 3MUZ1 1J0JA 1B3WA 4XUYA 2W67A 3J7HA 4DWSB 1JD7A 5EBAA 1H09A 1GZJA 1WDRA 1JI1A 2XM1A 3NJ3A 4XX6A 4GIAA 1QI2A 1MFUA 1VENA 3VIJA 4HA3A 4DUXA 4LX4A 2OWWA 2O9RA 3CUJA 4AZGA 1H11A 3L2MA 3AIWA 1UYQA 3KL3A 2WANA 5LA0A 3MSDA 3MMDA 4Z2JA 1UQYA 3B9EA 2G3NA 3CUGA 4AZBA 2VX5A 3WUEA 1V3IA 5A1AA 1VJSA 1V6WA 1HKIA 3NCOA 2E40A 1TUXA 1CGTA 3WD4A 4J3SA 4U3CA 1QBBA 3WMBA 3EDFA 1OGBA 2PWEA 1MWOA 4Z2HA 2O9PA 3CZLA 4EANA 3WEOA 4WKFA 4BQ3A 1CLXA 1G0CA 2JE8A 1E4IA 3AIUA 4PMOA 2CBIA 3IAQA 1M04A 3AYRA 4MB3A 1BYAA 2DSWA 4W88A 1W2VA 4PTVA 4QLLA 1BHGA 1JYWA 3OLDA 4UQEA 4DWSC 2JALA 1QVBA 2GDUA 5IFPA 3ZOAA 3UESA 4AD3A 1JYVA 2YJQA 1QNPA 4JFVA 2V38A 4ACYA 1CENA 2Y5EA 4UFLA 2WHLA 1QW9A 2V3EA 5FIPA 2WSPA 1I1XA 3VIKA 3F5JA 5BXPA 1W9XA 2C7FA 1LL7A 2PWDA 1OINA 3VGEA 2E9MA 1JGIA 1JNEA 1HX0A 1FP8A 3PZVA 3RM4A 2J75A 4DM1A 1GOQA 4PMRA 2OSYA 2CHNA 1SR0A 2GUYA 2WYSA 2ZX9A 2FH8A 4WKAA 4Z2GA 2X0YA 5M17A 5HOSA 4CVUA 2XG9A 1A47A 2WNWA 4D6HA 3WMCA 2WMIB 2AMGA 3RCNA 1OGGA 5CJ5A 3EMCA 2WC7A 4U5IA 3CPUA 1H4PA 2FH6A 4F66A 1C92A 4V2XA 1TE1A 3D3AA 4DUWA 3DECA 4H41A 2WPGA 2J7DA 4UZUA 2A3BA 2G3IA 3AIQA 1UWTA 3GXIA 1UWSA 2BY1A 1CLVA 1EOKA 3VNZA 2E8YA 4D6IA 4OBSA 4JKLA 4ZEPA 4JHOA 4W89A 3TOPA 4B9YA 4UCFA 3MMUA 2ZX6A 4DUVA 1NWUA 1EDTA 2DIJA 1TCMA 3WDIA 4P8XA 4XZBA 1IT0A 1GCYA 2X1IA 4HZ7A 4D6JA 3M7SA 3ZJ7A 4RE4A 3KE0A 3WF2A 4MPKA 5D9MA 5CPTA 3ZJKA 1JZ3A 4FF5A 4YN5A 1ZJAA 3FAXA 3QHNA 2IXVA 2TAAA 3BAJA 2VTFA 3GH4A 1WE5A 2YDRA 1PEZA 2UWFA 4E4PA 3U7VA 5A2BA 1E6QM 1FA2A 3HU7A 1W3LA 1JYNA 4J3TA 4HZ8A 4TUFA 1IZJA 4HP5A 3SUVA 2BY3A 1J0KA 4YHEA 2DGAA 2FGZA 4Z2LA 1H49A 1GVIA 4PMZA 4MDPA 5IDIA 3TTSA 1B3VA 4J3UA 2X09A 4MAVA 3VGFA 1JZ8A 1VEMA 2XIIA 1H0GA 1XRVA 4GPNA 1W3JA 4OIFA 2O92A 4MB5A 2WMJA 4MAZA 4WSKA 2DSZA 2ZUMA 1TA3A 2D24A 3MUAA 2NW0A 1WPCA 3LMYA 2XFFA 4B16A 4EE9A 1Q6DA 1L8NA 5D9OA 4AC1X 4AY1A 1GOIA 2VO5A 2VZVA 4LGXA 1WNOA 1V6VA 1QHOA 1FHDA 5M3WA 3VM7A 3VMPA 3ARWA 2J7GA 1HXJA 1XSJA 4H8HA 4M8UA 1XC6A 4GKLA 4LQ1A 3VD5A 3MV11 1R8LA 2B31A 4WF7A 1GORA 2C8NA 1UQZA 1OT1A 1CPUA 3GTNA 4FLQA 4OBRA 3NUKA 3W24A 1JYXA 2YDQA 2VX7A 3OIHA 1EA9C 2BXZA 2FHBA 2GJRA 5IHSA 1QNOA 4CGTA 1XCWA 1BG4A 3SCPA 4AXNA 2D22A 2G3JA 2WHKA 5A2AA 5A6BD 1UD8A 1RP8A 2CBJA 2VZTA 2NT1A 3GXDA 1PZ3A 4XB3A 4LYQA 1PIFA 1E6PA 3BAWA 1QI3A 4MJ2A 1HJVA 2JF6A 1UG6A 3VKKA 3F4VA 1E70M 3IJ8A 1UD6A 3PHAA 5CLWA 3K4AA 2J7CA 1QNRA 4PTWA 5A3HA 4HMCA 2XVLA 2EXOA 3CH9A 3SIMA 3CGTA 1LJYA 4PCTA 1UOKA 2V3DA 2ZIDA 1MVYA 2W92A 4W86A 3WNMA 5A6BA 5HPOA 2XHYA 1QI5A 2VR5A 3CUIA 4S3JA 1WP6A 1E6SM 3L4XA 1I1WA 3GNRA 2G8ZA 2EEXA 4URIA 2EPOA 5LA2A 1UR4A 3CZGA 5A6AA 1E72M 1PX3A 2CNCA 1VFUA 3VPLA 3GNPA 1JL8A 3A4WA 1UH4A 4GZJA 4NI3A 1GQKA 1M01A 3S2CA 4AYSA 3QHMA 7A3HA 4JKKA 2ZX5A 5BRQA 3WNOA 1HJUA 2O9TA 4AWEA 1KWKA 2VZOA 1UD2A 2WZHA 1BYCA 2YLAA 1H1NA 2BHZA 1MW3A 3N13A 1TA3B 1BQCA 4GI6A 5DT7A 3GYCA 4FK9A 5FL0A 2IXUA 5LYRA 5I79A 5CGTA 1U33A 1LG1A 3ZR6A 1OM0A 4H8VA 1MQRA 2V3FA 1HJQA 4Y7EA 4CUCA 1B2YA 2JF7A 3TA9A 1OSEA 1E55A 1NH6A 3MS8A 1V08A 4DWSD 2YL8A 2PF0A 3WENA 2EQDA 1FFQA 5E9AA 1KFWA 1LWHA 3POCA 4F8XA 3L4TA 4U31A 2WXDM 4MNLA 3ZT7A 3WQ8A 2WMKA 3AMLA 1JAKA 5I23A 3DYOA 2JIWA 2WB5A 1KCLA 5BYWA 2DDXA 3EDDA 5DFAA 1UD5A 2WVVB 5FOOA 3L4WA 3AHVA 1ODUA 1K9TA 2PWFA 4BF7A 5A8QA 8CGTA 1E1EA 4D1IA 1E71M 1ISZA 3M07A 2WVSA 4TOQA 3RMEA 1V3MA 3PZIA 1KBBA 2JIEA 5E6YA 3N18A 2WZIA 3OLIA 4Z2IA 1R85A 1KQYA 2VR4A 1UD4A 2ZX7A 4X9YA 3AZRA 3RM9A 2VUYA 1MQQA 3BAIA 1PX4A 3ZT6A 3IJ9A 1EGZA 2UY5A 2Y2WA 4L4PA 3GXMA 3WBAA 1LL6A 1UUQA 1GQJA 1EDQA 3PZOA 2DH3A 1KXTA 3N17A 3PTMA 1ZBKA 2VCCA 2YA2A 2BVDA 3A4XA 3N9KA 1ZJBA 2UY2A 3T2PA 5A8PA 4CN6A 1K9FA 3AYSA 4ZXLA 4B9ZA 1YQ2A 1VAHA 3VM5A 3VO0A 3W4RA 1VFOA 5ABFB 3OG2A 3K8MA 4HZ6A 1KR1A 1B3YA 3T0DA 2WC3A 1D7FA 2WMGA 4TX8A 1HL9A 2Y8KA 4B3LA 3AIVA 1SMAA 4CD8A 5CPQA 4PCSA 2D20A 5HDRA 1XH2A 4EAMA 4P7RA 1ODZA 5AYIA 4RE2A 3KEHA 1JFXA 2XVKA 3VDCA 4PMXA 4TTUA 2WM0A 1W2PA 1HL8A 3BMWA 3AS3A 5ECUA 4A4AA 3WQ5A 2ZX8A 2Y4SA 4UNIA 5E70A 3FXYA 2CETA 3K1DA 1AQHA 2QPSA 4F9JA 1C93A 3DYPA 2J4GA 3WUGA 2F8QA 2D2OA 3VD3A 1CWYA 3UR8A 1C8XA 4GQQA 4E8CA 3TTQA 1E4NA 5IFTA 5A6MA 5A6LA 4HA4A 3SUTA 1QBAA 2GFTA 1F4AA 2J78A 2CCRA 2YL9A 3PZTA 3ARQA 2WMIA 1JD9A 2J7HA 2E3ZA 2XGIA 3QGVA 5CQ1A 4D6GA 2A3HA 3BLPX 5E09A 4AIEA 4BQ5A 3ARYA 4UFHA 4AD4A 1DWJM 4CCDA 4UOZA 1V6YA 3NDZA 3ZT5A 3DHUA 1LG2A 5ABGA 1XCXA 2DQXA 2PWHA 1EQPA 4M81A 3ZM8A 3T0AA 1K9EA 7CGTA 2ZXAA 3VMNA 3WQ6A 1B90A 4PUDA 1BG9A 4W87A 1XD1A 2VJXA 5A8NA 1KXHA 1W9DM 5HPCA 4ACZA 3VGDA 2XUCA 5DF0A 2J77A 1V0KA 2BXYA 2WWCA 5CSUA 4OKDA 2CKSA 3L4UA 4KH2A 1E15A 4C7GA 5A2CA 3AROA 2J8FA 2ZUWA 4M80A 2DSVA 2Z1KA 1KGWA 2V5CA 3TP4A 4PSPA 1QPKA 1JXJA 3S6TA 2DIEA 2XFRA 3K4DA 1NWRA 3VVGA 2VCBA 3EBVA 1C8YA 1OBAA 1E73M 3QR3A 2W5FA 1V3HA 1VEPA 3CLWA 2XYLA 1Z32X 1HIZA 1DWHM 4J28A 3U7BA 4QDMA 1H0IA 3T2OA 3WSUA 3WD2A 3F5KA 1A3HA 3OB8A 2BFGA 4S3KA 1KGXA 4WSJA 3L4VA 1HVXA 1CIUA 3WQ4A 1JXKA 1WDPA 1GONA 4GXPA 1VRXA 1DHKA 1Q6GA 2CEQA 1KXVA 3AS1A 4GQRA 2YOCA 3CBWA 3B9DA 1GNXA 3PTKA 1BGAA 4XV0A 1CTNA 3MUIA 5D9NA 3VNYA 4W84A 1W9VA 1GQIA 4JFTA 2V3GA 1NOFA 2F2HA 1JNDA 2YL6A 3UG5A 4CD5A 1E6XM 4TVDA 3LPGA 1HVQA 5I78A 2D0FA 4JFSA 1ZBVA 1JAEA 1GJWA 2CYGA 2VURA 1H41A 2EBNA 4E8DA 2XPKA 1MXDA 1FP9A 4AZ6A 4WJXA 1V6UA 5KZ6A 5GPRA 5A8MA 1XV8A 5BWFA 3VIGA 1XSKA 3WBEA 5DEZA 3I3DA 4Q7NA 3VDHA 2J8GA 1DEDA 1U30A 3RJYA 3RDKA 1QNSA 2ZE0A 3OLGA 4AZHA 1BSIA 3SEPA 1OD8A 2MANA 4WLCA 2EPNA 1BF2A 1R7OA 1UWRA 1EO5A 1JF6A 4ACZB 2FHFA 2PWGA 3DC0A 3MKKA 4M56A 2Z1SA 4UQBA 5C8BB 3W38A 4ZE4A 1CGUA 4QAWA 5FKYA 5CPSA 5BRPA 4GZEA 1HJWA 4UZSA 3WF4A 1DWFM 5JBFA 3VUPA 1G94A 4RE3A 2D3LA 2YIHA 1BVZA 4NRSA 5F7UA 3AMGA 1QW8A 6TAAA 1US3A 2XVGA 3GM8A 3CHDA 4D6DA 2ZXQA 5I77A 5A95A 4JL1A 3T2QA 3T09A 3WY1A 2EO7A 3W27A 4JHZA 1JG9A 1V0LA 3T0BA 1B1YA 2VQTA 4JL2A 2VNCA 2EPMX 4YHGA 3IJ7A 1HP4A 1KGUA 4W5ZA 4JCLA 1E3XA 4UQDA 3SURA 3WQWA 1RPKA 2YDSA 3AHTA 4CN1A 1E5NA 1V3KA 2WVUA 3SCTA 1GOMA 4P8VA 1C7TA 4E2OA 1GOKA 1OB0A 1D2KA 1NQ6A 1MXGA 2E9BA 4J3XA 4UFJA 3APGA 1JF5A 5A8OA 3WUBA 5D8WA 4FLRA 2WLZA 1FH8A 1R86A 3UETA 1H3GA 2HVMA 1Y7VA 3L4ZA 2UY3A 1W1YA 4BA0A 2BHUA 5BXSA 1B3ZA 1W91A 4PSRA 1OIFA 1QHPA 3WD1A 5I0DA 1UKOA 4J27A 2OYLA 2ESCA 1TZ7A 1SMDA 1UR0A 2GJXA 3CHFA 2WVVA 3SUUA 3K46A 2QLYA 6A3HA 3M46A 1E5JA 3KZSA 4D1JA 4A3HA 5BCAA 2BY2A 3WF3A 1ZL1A 4H2CA 3ALGA 5A6KA 2V5DA 1CBGA 1EOMA 4QLKA 3E1F1 4TVUA 4HTYA 3WF1A 5AYBA 1ISYA 4YPJA 3AXXA 3AI0A 1E43A 4AEFA 1C90A 1JIBA 3B8SA 3ARPA 4ZXOA 4QFUA 3HN3A 3WUFA 3ALFA 3WNNA 5D4YA 2PB1A 4Q22A 2DT1A 3AICA 5FD0A 5BROA 3VIOA 2D0HA 3ZR5A 3QOMA 4UFMA 2OYKA 2VVNA 3BAKA 4PYSA 3M6DA 4Z2KA 1FFRA 2W4XA 2VT0A 2XWDA 2D0GA 3PZQA 3QOKA 4DM2A 4ATDA 1FOBA 4A3YA 2VX4A 4KWUA 3CTTA 5HNNA 3IAPA 3L4YA 2PBOA 3CUFA 2X0HA 5EMYA 2QMKA 4U2ZA 2CITA 2NSXA 2W91A 4OZOA 1ZBWA 2CBVA 3BAYA 4D6FA 1H5VA 2QPUA 4NF7A 1J9YA 3RJXA 3AHXA 1TVPA 3SCSA 2ZUUA 5ABFA 2WAGA 3SCUA 5HXMA 1OT2A 4MTVA 1OGSA 3PBGA 3PZNA 5CXPA 1J0ZA 4H04A 2YBUA 5AC4A 1E9LA 3OZOA 3CZKA 1G9HA 3CZ8A 3W0KA 2UY4A 2CHOA 3UG4A 2PC8A 4JAWA 1UA3A 4MB1A 4W8AA 4KRTA 5I3DA 1C3FA 1JZ7A 4QP0A 3ZSTA 2WBKA 3A6OA 3GBDA 5D8ZA 1KWGA 1TMQA 1HKKA 3WDJA 5JUVA 1WB0A 4UFKA 1Q6EA 4UTFA 3AXHA 4J3WA 1XH1A 2RGMA 2A3AA 3SUWA 4TXEA 3N11A 2WCGA 4UQCA 3WEZA 4LPCA 2VQUA 1C91A 2GJXB 3BLKA 2BVYA 2YBTA 4AD1A 4UQAA 1UWIA 4M24A 4AIUA 3N1AA 3FAWA 3DYMA 1LLOA 2XSBA 3AMDA 3VGHA 2XGBA 4UFIA 3AOFA 1SYTA 2ZXDA 1IV8A 4IUGA 2CBUA 4BQ2A 5CSYA 1VFMA 4CVWA 3W25A 3WD0A 1YHTA 2BHYA 4PMVA 7TAAA 3N04A 2CPUA 2BNJA 1EIBA 4M1RA 3B9AA 3VIIA 4D6EA 5FCZA 3WMSA 1J11A 2OWCA 1GPFA 2BY0A 2QMJA 2E4TA 3ZJ8A 5EFFA 1UR8A 4HPGA 2W61A 1B9ZA 1AQMA 1VIWA 3VDAA 2VZSA 2OYMA 1LWJA 3BSGA 1FHLA 2WK2A 1KCKA 2YL5A 3UR7A 1BVNP 5M5DA 4OOUA 3JUGA 2IUZA 3LPOA 1HT6A 3NYDA 5LA1A 1M53A 3IANA 3LPFA 1JDCA 3A3HA 3QHOA 2BS9A 4J3VA 1EHAA 4JKMA 2X05A 3CZEA 1CNVA 1CEOA 1XD0A 4D72A 4PMYA 3CIVA 3U5UA 1VBUA 5GQBA 5AC5A 5I2UA 3WH5A 1GQLA 1UKPA 4JCMA 4D71A 3EDKA 3WNPA 1DWGM 1ISWA 1RP9A 3AMCA 2VL4A 2QV4A 1JZ6A 2JEPA 1J12A 4XZWA 4AW7A 2WSKA 8A3HA 1BYDA 3VIMA 3ARTA 2DT3A 2VZUA 4U33A 3VGBA 3WKZA 4PUEA 1FH9A 3A47A 1WO2A 3RIKA 1LF1A 2DT2A 4M82A 1B0IA 1GVYA 4MB4A 1WZLA 3ARSA 1WCGA 4MADA 3HMCA 2GJPA 3THDA 3MSGA 3ARZA 4M29A 5JBEA 2BVTA 4GI8A 1WKYA 1W3HA 1X1NA 4JFWA 3BSHA 3VIPA 4P7LA 3OBAA 3VIHA 2DPEA 3KWXA 3U57A 3EMZA 3N15A 3SCVA 2WKGA 4OJYA 1GUVA 3W81A 3O2LA 1JZ2A 1ECEA 2WW5A 2C0HA 5GNZA 4W7VA 4B15A 1XGZA 4L4OA 5CGMA 1ITCA 1UA7A 3ZQ9A 1F4HA 3AJ7A 3W26A 1CXEA 1XSIA 3WD3A 1G01A 1J10A 3F5LA 1J0IA 1UWUA 1PZ2A 1E4LA 4KGJA 4W8LA 4QCEA 4KGLA 3BXWA 1WAWA 4W85A 4W8BA 2J47A 1I75A 4UR9A 1PPIA 4V27A 2D23A 1CGVA 1X6NA 1QHZA 5JIPA 3AHZA 3I3BA 3AIBA 1GHSA 1U2YA 4OUEA 4N42A 4F79A 3VINA 3W53A 4W93A 2WMFA 4TVCA 3AIEA 1J18A 1ZB5A 1E0WA 3FN9A 4ZENA 4AD5A 3ZSSA 3WH8A 2WWDA 3CHCA 3KL0A 1AQ0A 3EDJA 2FDMA 3AS2A 2YA0A 4PMDA 3N12A
chains in the Genus database with same CATH superfamily
1H63A 4LT9A 3GC5A 4WJEA 4NXMT 4GZIA 5E0OA 4IIHA 3WQPA 2E6AA 1FXQA 3RILA 3M0XA 1YXRA 3FIGA 4U10A 2GGIA 2XVPA 3HA4A 4AZCB 1LCOA 4HNUA 4P8UA 4XBKA 3EYPA 2XVNA 1BXNA 3KVKA 4DI9A 1QCWA 1L6SA 3R8RA 3UCQA 1SSGA 4M19A 4L9YA 3HPXA 1TVNA 9XIAA 5GONE 4NSBA 3AB3B 5EFDA 1R3YA 2I6HA 2LRLA 4KHPT 1UROA 3OW1A 2MOZA 3WQVA 1A0EA 6CGTA 2DWGA 4ATLA 1Z9AA 2JEQA 1GOWA 1YE6A 3N4EA 2QQ6A 2EKCA 1W1VA 4INFA 2ZWZA 1B54A 2J62A 1VFFA 3U4FA 2UXDT 4YHJA 5LXEA 3QGAC 4S3EA 4B5XA 4IISA 3J7Yq 3EOLA 1KK7A 3PPGA 4HHLA 3NOEA 1U1JA 3LG3A 1H7NA 2VWSA 3MSYA 1T98A 3N9QA 4PK5A 3W37A 4EKJA 1XRFA 3UWZA 2LM9A 1UCWA 4DO0A 1VD6A 2VELA 4O50A 3VIFA 3G0XA 1S46A 3F2EA 3KVJA 5J0ZA 1EO7A 1OY0A 2XN0A 3QKZA 4HTBA 4K1GA 4L9XA 4HPXA 5EGRA 3ARXA 3AAEB 4P61A 4RW3A 1XBVA 2M6IA 1TB3A 3R5EA 4RZ4A 1H5YA 1UIOA 4PTMA 3A8YC 1K4GA 3UT0A 2VKDA 4P09A 5A8GA 1OFQA 3UNDA 1SE7A 1YKEB 4YTSA 4RLIA 4US5D 3NSMA 2YXOA 2ZICA 2WSRA 3KOWA 3W7CA 4F48A 4U2YA 4ZSUA 3P8IA 3IGHX 1JCXA 4B91A 4LS0A 4HK7A 3AE6A 3CV6A 1DTUA 3GZAA 4AQFA 2PRMA 5TF0A 3E5BA 4DR6T 1OIMA 3S9ZA 3MHUA 2LLYA 1HO4A 2E77A 2OOGA 4NT0A 4PL1A 1M7XA 1XUUA 3R0DA 4MDOA 3SGZA 1A5AA 3PB2A 4EIVA 3W7EA 5DJQC 4JZ5A 1UKQA 1E6ZA 3BLEA 4AHPA 4HMEA 1C7SA 1DWIM 1JVNA 1NWMX 3SUSA 4QAIA 2I9UA 4X65T 1UZ1A 4PUKA 3PJWA 2YYUA 2XFYA 4GI9A 3ITXA 3E0FA 3FVMA 4PMQA 4JY8A 3ZZ1A 1O94A 3VX0A 4IG2B 4MFEA 3BC9A 3PAJA 3G6MA 3EXTA 4KQNA 4JBRA 1WDQA 1SZFA 1U22A 3N3MA 3MVIA 4LUIA 3TXZA 1A3XA 1TG7A 5U4NA 3KVLA 1MI3A 9CGTA 3MU7A 3OGSA 1XPGA 3NQEA 4ZOCA 2QVNA 5LGTB 2WJFA 3FY1A 2VOTA 2IKIA 4HHPA 3O16A 3WJWA 3M6YA 1XH0A 2VVSA 2Y24A 2K5BB 3AAAB 1HG2A 2X7VA 4DBWA 4XKMA 5BXRA 5LBQB 4KS0A 4TNWA 3QM3A 3VU2A 2Z24A 2BV9A 1PBGA 3LDVA 4BJHA 3C3UA 1B31A 2WC4A 1K6AA 5D30A 3POHA 3BH4A 3UTKA 3WAJA 3T81A 1BF6A 1DIEA 1OX6A 5CAHA 4PCNA 1ZJHA 5FESA 3KRUA 3PZMA 4HCLA 1T0OA 3FZLB 3WDPP 3K3QC 1F3XA 2J74A 4PTXA 1WDSA 4BR1A 2Q9QB 1HG3A 1W1IE 1UWQA 4CNPA 3BICA 3UEQA 4KWOA 5HEGA 1Q6FA 1FQ0A 3TYCA 3M9YA 3C56A 1E6NA 4NIQA 2NQJA 2ZXBA 3KOYA 2HXTA 2G4FA 2J7BA 4IQEA 1TJ1A 2E5VA 4GK8A 3WQFA 5GNXA 1MNEA 4PB3A 1MRAA 1UKTA 3CUHA 4PB4A 4UOJA 3E2RA 3OPCA 2YA1A 3CV1A 2GDVA 3BSMA 3I3EA 1W9UA 1ZTVA 3RIFA 3NWIA 2CXGA 3WLQA 1V02A 4XZ9A 2QJGA 5G1TA 4EZ4A 3NQFA 2LSIA 4CCEA 4MNJA 3GTFA 5CZKA 2KLQA 5FYMA 4JI2T 5JIWA 6REQA 2CLLA 2VOMA 3DG7A 3WFLA 2FDSA 3RF9A 2BG9C 1LBMA 3F2CA 1E1FA 3AA0B 4C7FA 5BOOA 5KETA 2XAHB 4WSHA 4GJ1A 2W62A 2VWTA 2W0UA 1K9DA 1FKXA 4QIUA 5FY1A 4F2BA 2C18A 4IMCA 3O0FA 2NLIA 2RFGA 4S2CA 1EIXA 1ESWA 2PDLA 4QX8B 5JR9B 3MV01 3GNOA 4A8IA 2UUCT 3WF0A 3EAMA 3MKVA 1ISVA 3HI2A 2XQYA 2YDAA 1OQFA 3NSXA 3LPPA 2KSRA 1OHLA 4NX0A 2DT0A 5KX5E 3C0JA 3LRLA 2QCDB 1X9BA 5HEJA 2ZVRA 3NL3A 2PDUA 1BLIA 2FJBA 3RM8A 2JFEX 1NOUA 2H7OA 4AQFC 4CQ8A 4DR4T 1TPVA 2YLLA 2DP3A 2HH7A 3FJ4A 4M3PA 4QCFA 4CQBA 5AQJB 4FOUA 2ZWYA 1XMQT 3WNLA 1S2CA 3HG5A 4X1YE 2OSWA 2Y8DA 3J9X1 1KFKA 2IDOB 5CSSA 3TW7A 3CHEA 3BCDA 3JVAA 2WMOA 4K36A 3SCRA 1HG5A 3VD9A 3CX8B 3GU2A 3L5MA 3LSBA 3DFYA 1QMLA 2IKJA 4MSSA 5C70A 1JDDA 2PUZA 2P3ZA 2Y88A 4HYRA 3RK8A 4AXKA 1H7RA 4Q8WA 4HJWA 1BTCA 1UUSA 4A3RA 3DENA 3S1XA 3O1NA 4G7EB 4X0VA 2X9YA 3RIUA 3MCNA 3LOTA 2EPLX 3L0KA 3W29A 4C91A 1VBJA 4ZB0A 4FNSA 4YTNA 1YBQA 5I3HA 4GO9A 4UXDA 2PTZA 1CXHA 5I24A 2D9DA 2PJQA 2D0TA 1XYBA 2DH2A 4UVAB 3S2JA 5A69A 5J04A 3WFZA 2XQ8A 1NY1A 2WNZA 4X0NA 4O0ZA 2IPGA 2QCMA 1VYRA 3WDHA 3FHAA 1J4EA 1EP1A 4AISA 3VC5A 3V1HA 3WJXA 3E0ZA 4NZFA 4IX0A 3PZ9A 1JPMA 3RYCE 5DRIA 1QDSA 3C61A 4G5DA 1F61A 3ZN1B 2GK1A 4DF2A 1MNZA 1SVDA 4W7WA 1W32A 5JDQA 4GCXA 3HB9A 3C3NA 3EHZA 1CECA 3IVSA 4BI7A 4JI8T 3TV8A 4P8WA 4V15A 1OEDE 2A3EA 3OZPA 1CZ1A 4FALA 4BA9A 2Q3OA 2W63A 2FTYA 4JEQA 3QLLA 4XD5A 1Q6CA 1S3HA 5HWNA 2DZXA 2YZ5A 4DJFD 5D9PA 4PNIA 1Z7AA 1WOAA 2VYOA 1JRBA 2VEFA 1CXIA 2A3LA 2BKPA 5B80A 1F07A 1SA0E 1Z44A 1E0XA 5A94A 1P6WA 4LFCT 5FEZA 2NQZA 1J0JA 4YY3T 2CFFA 3J7HA 2GGEA 5MKGA 1JD7A 4NAEA 2PTXA 3VI2A 4K0KT 5EBAA 3NO5A 2PU0A 1W8SA 1MMGA 2J9YA 3QVQA 3LSVA 4ILCA 5DN1A 2HN1A 1XC4A 2YCLA 2OWWA 1MDRA 4EPKA 3OODA 4MUPA 1XIDA 2WANA 5FJRA 4PTDA 1BKSA 4O0KA 3ZCIA 3BUVA 2AXDS 3MMDA 5L47A 2NWBA 2XN2A 2UXXB 1N8FA 3B9EA 4AX7A 5L3CB 2J9ZA 3BK9A 3N14A 2VX5A 1AG1O 4A3UA 4K38A 4JNYA 2KZHA 1HKIA 2QJIA 1A0CA 2E40A 2FZ8A 3KBWA 4E4FA 5I09A 1M7JA 1O4UA 1LTDA 1FWSA 3QTPA 1ONWA 3T0CA 3TYDA 3M0MA 4Z17A 1QBBA 3WMBA 3WQOA 1OGBA 1WBJA 2Z29A 3F31A 3ERPA 3BV7A 3L23A 1IIHA 4I43B 3YPIA 1LLZA 1OF8A 3FA5A 2ASHA 3AE9A 3AIUA 3TX9A 4ZTXA 2CBIA 3AYRA 1HFAA 4HHMA 2ZZ3A 2PFHA 1BYAA 2C1GA 4JI0T 4W88A 4PTVA 3QPEA 4QLLA 3I7QA 3TLSA 4R7WA 4M6QA 3ENLA 4UQEA 2TPSA 1OYBA 3BZJA 5IFPA 3SY5A 1DBTA 5G1YA 2AL2A 3L09A 3TW9A 3UU6A 3P93A 4JFVA 3CPZA 5AQOB 2J88A 2WJEA 3VOIA 5I3IA 2XIJA 5CKSA 2CXLA 5FIPA 4ICNA 1ZKEA 4K6AA 1OG0A 1V93A 2VB6A 3UGVA 3RIUC 4EPEC 2A7RA 3MCMA 3KP1A 1OINA 4ZTYA 4O2AE 3F57A 3DAQA 3HGJA 4EOZB 2J75A 2VL0A 1E0UA 4TU1A 2VFGA 4LW7A 3A12A 5HJXA 4PMRA 2OSYA 3E49A 1SR0A 2GUYA 2FJUB 5HOSA 1O60A 3EWXA 4DPPA 2AMGA 2XY8B 4MF4A 2LE8A 1XLLA 2D69A 4RXGA 5AQGB 4UF0A 1H4PA 4OTKA 2K48A 4L7ZA 3TR9A 3RHGA 4G63A 3UGRA 1F7BA 3GKFA 3D3AA 4DUWA 1SO5A 3DECA 3RLGA 3VNDA 4DIDB 4IDNA 2P53A 3AIQA 1UWTA 3GXIA 4KCTA 1FHVA 3IEEA 4UBPC 2OLSA 4FNUA 5IRPA 3I0OA 3LI0A 3M43A 3T0TA 4NUWA 2ABAA 4NPPA 2OX4A 3QBUA 3PFMA 4UCFA 2BOGX 4LVBA 5HWXA 3LU2A 3QR0A 2F6KA 1FBAA 1NWUA 1EDTA 2DIJA 4P0AA 2IW0A 4RNHA 3PUDA 3LHYA 3NZRA 4HZ7A 2Z28A 1XLAA 1AJZA 1D1BA 3W7RA 3CTLA 1SFTA 3THQA 4REQB 2Z4GA 3CV7A 4F3HA 5F2GA 3KW3A 1NF0A 1CUNA 2KWIB 1N7KA 4PRRA 3IIXA 5JQ9A 3LM7A 3BQ5A 4LFBT 3QHNA 5EA9A 5HCMA 5HMEA 3CMFA 3GH4A 4BKNA 1RJRA 3NFUA 5F4XA 2X2GA 5A2BA 1E6QM 1JYNA 3JAFA 3UR2A 1K8XA 3UCDA 3SUVA 3W88A 4QSHA 2KAUC 5LIKX 4CNNA 4Z2LA 4TO8A 1H49A 1GVIA 5HMDA 3A9BA 4LNYA 4JTKA 4QXIA 2D5UA 3ZMUB 3BW4A 1B3VA 4J3UA 3CLMA 1JZ8A 1F8IA 1PKMA 2BASA 2WMJA 4WSKA 1WKDA 2DSZA 2ZUMA 4FX6M 1WPCA 3IGSA 2W9MA 3RPDA 2XFFA 3H7UA 5D9OA 1GOIA 6XIMA 1WNOA 3NQMA 2N2NA 4YS1A 1RVGA 1X1OA 3KTCA 3VMPA 2QCCA 5HWYA 3ARWA 2J7GA 1HXJA 4IQLA 4JR5A 3UYIA 3VD5A 4MG4A 2PTDA 5J5DA 2PDNA 3PUZF 4XZMX 4NZ1A 4LNCA 2C8NA 1UQZA 3PUSA 1OT1A 2F7FA 4Q32A 3CXOA 3W7KA 1RQEA 2RDXA 4JTUA 5DXXA 5IHSA 3BV4A 1TUFA 1QNOA 1O1ZA 1W0AA 1A5MC 4ZODA 2C91A 3SCPA 3V75A 2P0IA 4FAMA 1DE6A 3PUYF 3HQPA 1F9CA 1XYMA 4YNGA 2OV9A 1BWKA 4M7SA 1RP8A 2CBJA 3IARA 4XB3A 2O55A 4WEVX 5CA0E 4LYQA 1ICSA 1E6PA 3LXCA 4DBUA 1E70M 1O5XA 2X1SA 5A1LA 3S5SA 3PUWF 2OB3A 3PHAA 4YJ2E 1FWNA 2TMDA 2OCZA 4MKSA 5LMNT 3UULA 3AC0A 1IWPA 3CH9A 3CGTA 4XSLA 3V5CA 2ZIDA 3LQLA 3E0WA 2W92A 4DV2T 1Z41A 3N6HA 2XZ7A 1UB3A 5LNKA 5HPOA 3SFWA 2VR5A 1OEPA 3WQCA 2D73A 4N2YA 1XDPA 4KCVA 5LA2A 3IV8A 3ABRA 2G97A 1UR4A 5A6AA 2CNCA 1B4KA 3UPMA 3LX9A 3STPA 3VU7H 4XD6A 1XIHA 3S2CA 3PK7A 2MAWA 5LG3A 2HSAA 4IHCA 1HJUA 2O9TA 4B5WA 1IEIA 2BHZA 3G77A 2V7LA 4LUSB 3N13A 1TA3B 5FL0A 4KESA 2IXUA 4JIRA 5KMYA 3H2AA 4LRTA 5LYRA 5I79A 3W2UA 3FZHB 3WAKA 3UNTA 2LOPA 1OSEA 3MS8A 2PDWA 1V08A 1XG4A 4DWSD 4QH4A 3WENA 2H3BA 2EQDA 2Q71A 3ATYA 5E9AA 2V26A 3P14A 1Q6RA 2D2JA 3KV4A 3BW3A 2X30A 4B5SA 3ZT7A 1T96A 2HE5A 3BQKA 3AMLA 3FV9A 2PZNA 1KCLA 3BGGA 3EDDA 4IFKB 4G9PA 3RX2A 3L4WA 4NNCA 4JV5T 3DTOA 2PWFA 1DXFA 5A8QA 4Z1DA 3QW3A 4E2DA 1E71M 5JDMA 1OJXA 3W3OA 3TLUA 3M07A 2WVSA 4UTIA 1YNYA 4LS2A 2FFCA 3W15B 3PZIA 5LIXX 5E6YA 3N18A 2EJAA 4Z2IA 2NX3A 4WDUA 1KQYA 2VR4A 3E02A 1SZNA 5I3FA 1GKQA 4DRSA 5MF5A 3QNUA 3S1UA 3RM9A 3L66A 1MQQA 3BAIA 1LORA 1PX4A 2XASB 1E1CB 3IJ9A 3UZJA 2CLEA 3IK4A 4RK8A 3V0SA 2UY5A 3EOEA 4L4PA 2J66A 3GXMA 1EDQA 4HWIB 2Y48B 2DH3A 3OA3A 4S3AA 4V1XA 2GGJA 4Y96A 2UXBT 1F5ZA 2VCCA 3W2LA 4CXXA 2BVDA 1MZHA 2ANUA 1HS7A 3UR5A 3W70A 3O1JA 3AYSA 1CCWB 3URNA 3D46A 1VAHA 3U8GA 4ORIA 4HPNA 4NNBA 5HA7A 1VFOA 4S3DA 3UZZA 2HS8A 4PFPA 5LNRA 3M0HA 4ROQA 3VNMA 5I7GA 1UC4A 3K8MA 1GYNA 2X40A 3T0DA 2WC3A 1Z8UA 3U3IA 4B3RT 2P1FA 2JPFA 4B3LA 3AIVA 4CD8A 1DHPA 2V63A 2GSEA 2VGFA 2YXGA 5HDRA 4Q8MA 1B57A 3ZVHB 2QUNA 5AYIA 3W1RA 2GVEA 5CJNA 3W1XA 4JQ3A 4PMXA 1P5BA 3DEQA 2G0WA 1AH3A 3BMWA 4GK0E 5TNVA 4FA3A 3LTYA 3LHTA 2ZX8A 4UCGA 3MDWA 2Q8LA 3QR1A 5E70A 3FXYA 3TK7A 2CETA 3K1DA 2ZA2A 4YHHT 3WFAA 3RGLA 2QGSA 2QUUA 4PE8A 3REQB 4RKAA 1AH4A 3CPRA 5G2HA 3P4PA 1OZMA 3WUGA 3JC6D 2F8QA 2XH0A 1JPIA 1E9YB 1CWYA 4JDBA 4XK2A 1C8XA 1XBYA 3AU6A 4E8CA 3TTQA 4G7FA 2PDHA 2CMRA 4I5UA 2ZRZA 4H7CA 1E4NA 3T8OA 1QBAA 2TRSA 1NTHA 3M5ZA 4GCAA 2XAFB 5D38A 3U0HA 3OVGA 3FYPA 2XGIA 3QSTA 5DY2A 4RNFA 4C1KA 4B5TA 4O19A 1JCJA 1NDWA 4AIEA 3ARYA 4R88A 2VKZG 4F0HA 2TODA 4R9OA 1EC7A 3CVRA 1T99A 2O4MA 1KRBC 1DWJM 5I02A 4UOZA 1V6YA 3NQ6A 3DHUA 1LG2A 3NWRA 4HNNA 3BQ6A 1XCXA 2DQXA 3ITTA 4QQ3A 4FXRA 2DQWA 3WLSA 1K9EA 3E12A 4B5VA 3S1VA 2ZXAA 4RZ6A 3LZ3A 3TNBA 4QR6A 1Q7QA 2BOFX 2VJXA 5HPCA 4ACZA 2KT9A 2ZM2A 4MGGA 1YW1A 2E28A 3HQOA 2XUCA 3FX4A 5H1WA 1REQB 3EX2A 2WWCA 1RCXB 4DVOA 5I3GA 1MIYA 5LJMA 1PIIA 2NZLA 4DF1A 2VGBA 4M80A 2DSVA 5K9XA 1EJXC 4B4FA 5AKQA 1R46A 3MYPA 3V36A 3L65A 4JTSA 4LUJA 5F1VA 1JXJA 1KBLA 1IEVA 5L9FA 3GHTA 1N36T 1ZOYA 2DIEA 1FCQA 5LGUB 1DJGA 3GFYA 2XAJB 5FI8A 2ISDA 1MO0A 1S2WA 1LOQA 1TR9A 1WXJA 1BQGA 1EEXA 3V5OA 4TV5A 1Z32X 1Q85A 4HSNA 2HE8A 2DW6A 3G24A 3HGRA 2OXNA 2ICSA 3ES7A 4XD3A 4Z1YA 4WSJA 2V2CA 3SO7A 4I7VA 1JXKA 3LBXB 1WDPA 1GONA 1KTNA 4ZL1A 3O0KA 3OP2A 1PTAA 4IIGA 1M7KA 2PGRA 1BXBA 3UU4A 4LWWA 2VDHA 5K7JA 3RR4A 3N9MA 3BLDA 1EWDA 5AVHA 4GJJA 1YXYA 3CQ0A 4DNHA 4L9IA 5D9NA 3VNYA 5C9WA 4W84A 1W9VA 3RU8X 2YL6A 1JNDA 3PJAA 1E6XM 2NUXA 4TVDA 1A3WA 3IACA 2PDKA 5I78A 3ZR4A 3HMJG 1TWWA 2PGEA 2CYGA 3LSCA 4I90A 4E8DA 5F3JA 4H9OC 1QO2A 5REQA 4Q8OA 5KZ6A 3W72A 1K8CA 4C65A 1RA5A 3VIGA 5BMXA 3ID7A 1H50A 3MDUA 5DEZA 4Q7NA 3GVVA 3RRXA 3W75A 1DEDA 3KRSA 3QMTA 5EBUA 2FGBA 1U1HA 1QT1A 3OLGA 4AZHA 1BSIA 3GHUA 1GTEA 1OD8A 3RPTA 2LHRA 4P2VA 4WY0A 4OHFA 5LGXA 2PWGA 3VRBA 3TE9A 2A2IA 2VC7A 2LEHA 3V18A 3F2DA 5AB3A 4FXFA 1EGMA 1CGUA 1D7KA 2WS3A 3TIMA 3TLQA 4GOUA 1D1AA 1HJWA 4DBEA 3V5FA 5JBFA 1G94A 3VA8A 2Q6ZA 4AQGA 1QW8A 2XVGA 1XNQT 2VDIA 1SW7A 1XDLA 4GY7A 3D6NA 2CLKA 2EO7A 4ZFCA 1FWBC 3E5PA 2CWYA 1VLIA 2ALRA 3TJ4A 4XG1A 4EYYR 3JC6C 4O4JE 1AJ2A 4IUOA 1HP4A 1KM2A 4I5XA 1KGUA 1HCIA 3LFMA 2MTQA 5H2ZA 1PE1A 2XN1A 4DV5T 3CM4A 2ISVA 4QG8A 1JUKA 4MWAD 2A6NA 3KV6A 3SCTA 5LHHB 1C7TA 1OB0A 4DV0T 4C6MA 1UJPA 1MXGA 5LNUA 2E9BA 1NAL1 2W27A 1KBIA 1JF5A 3ANUA 3MHFA 3WUBA 5D8WA 2DZWA 4EWND 1HKVA 4XO7A 4XAYA 5F2LA 3TLWA 2UY3A 1RK6A 2BHUA 1P0DA 5DELA 2XQ4A 3CKDA 3BURA 2CLYC 2KZ7B 1W91A 4PSRA 4EPBC 1OIFA 3UWEA 3C52A 2GZXA 4JICA 3E0LA 3CQCB 2ESCA 3W1NA 1UR0A 3AA6B 3N29A 4IDZA 2KINB 4H9YA 1B3OA 1KF6A 1M1BA 1FJGT 3K46A 3R79A 3M46A 2LSKA 1R3TA 5FA5A 3CH0A 3ALGA 2CXDA 3C2OA 5AQIB 1EOMA 4ERAA 4QLKA 3E1F1 1VQTA 3AXXA 3SQMA 4F4RA 2CHRA 1E43A 5KMGP 3QQ0A 4AEFA 4YVVA 3WQEA 4KCWA 1MEWA 1I2QA 3ARPA 3UZ5A 3WUFA 4XBFB 1ICPA 3FSTA 2PPGA 1W5OA 1QPRA 3AICA 4G2DA 5C9UA 3O3RA 5BROA 4KIEA 4AWUA 4JI5T 3QOMA 2X1UA 4MJMA 4UFMA 1J6OA 2VT0A 5IBXA 1NQKA 3G18A 1XYCA 4IGSA 4A3YA 2VX4A 3CTTA 3CV2A 3L4YA 1MUMA 1K1DA 2X0HA 5EMYA 3UW6A 4FX8A 1A5OC 2CBVA 3GZ3A 1L6GA 3IIVA 1LBLA 4PODA 2WAGA 4C6KA 3FXGA 3UA4A 3UJRA 1FTXA 5HXMA 3S4UA 1OCJA 4QG9A 1OGSA 1PWLA 5CZSA 4H04A 4Q4SA 2YBUA 3CZKA 3DBNA 3AE1A 1G9HA 2UY4A 3L3PA 3QZEA 3IUDA 3G0SA 1GG1A 2PC8A 1FDYA 1UA3A 4X66T 1F3WA 3KBVA 4JEUB 4HPJA 4IHJE 3ZSTA 1HKKA 5JUVA 1WB0A 2RPAA 4UFKA 3AXHA 5T26A 1UP2A 4E3VA 3SUWA 4TXEA 3HPAA 1I4NA 5FJOA 3N11A 2WCGA 4UQCA 5E9XA 4GJIA 3I6RA 2GJXB 3KHJA 3F2BA 4JOMA 2BVYA 4I9AA 1Q4WA 2GJLA 1OF6A 1UWIA 4M24A 4AIUA 3FAWA 2B1EA 3IIPA 3DYMA 4A8RA 4H9TA 3PBVA 2BBFA 4YSXA 3CIWA 3P60A 1ZZMA 5IHYA 4LF2A 4IL4A 4CEUC 1VFMA 5ETWA 3W25A 3HOJA 3ZYZA 2CLIA 4QJ1A 3TKFA 4QXBB 7TAAA 3FXEB 2CPUA 4AVNA 5DCDA 1ZAHA 4HEAA 1GPFA 4RZBA 3WJSA 2QMJA 2BBJA 3ZJ8A 3PDYA 1YTDA 2PGWA 3G06A 1B9ZA 2G95A 1IBMT 2VFIA 3OBEA 4ZQPA 1J5WA 4LF8T 2VUNA 3PSVA 3NZQA 4WCJA 3BSGA 1FHLA 4R9XA 3MZ2A 4QG6A 1E51A 3EOSA 3ONXA 1PCKA 5CFBA 1MRQA 1YMYA 1AJ3A 5LB7B 5AQFB 2A2FX 3NXLA 1JDEA 3VNKA 3P50A 2BS9A 4J3VA 4HBKA 2QIIA 3QV6A 4GYSA 3M7WA 6REQB 1CEOA 3AEEA 3U2CA 2V0TA 3U5UA 3HR0A 2PDIA 3FZKB 1VBUA 4YL2A 3KFWX 3WH5A 1GQLA 1NEKA 4GZ7A 4CI2B 3EDKA 1EPXA 4XZHA 2DZUA 1RP9A 4DYKA 2JEPA 1J12A 3M4HA 3H26A 2E5BA 2C0SA 2OJPA 3BW2A 3QV9A 2DT3A 4U33A 2E2AA 1EC8A 1FH9A 3LHWA 3M0JA 1LF1A 2DT2A 5EMUA 4M82A 3NGFA 2QCNA 2VEMA 5BMWA 3OO2A 1WCGA 1ZP0A 4TUYE 2Z7GA 3QKEA 4C5YA 2WSSV 4H9UA 4KEZA 4EACA 2ZZ6A 5LIYX 1X1NA 3LN3A 5IBXC 4CNSA 4JIQA 3PV0F 3KXQA 4J1OA 5L6UA 3EMZA 3N15A 5H91A 4G1KA 4OJYA 4X60A 5CBIA 4P0BA 1ECEA 2WW5A 1H60A 3CS2A 3S8HA 4ZSTA 4JX6A 2VGGA 4RDZA 1EX5A 3CJPA 1XGZA 4H9ZA 4L4OA 4KI0F 4DN1A 2C15A 3UXAA 5HR6A 4X63A 2G4JA 4LAKA 1Q6QA 3F5LA 1J0IA 4KHZF 2YU1A 1RJQA 4PB5A 4UTWA 4E5TA 1PZ2A 5HAOA 4KGJA 1VFTA 4QCEA 4RUBA 1I75A 2OGYA 4UR9A 4G8TA 1PPIA 4GYRA 2NW9A 1PB0A 3BLLA 1QHZA 3B0PA 2Y0FA 3AHZA 1EJUC 3AIBA 3QGKC 4M6PA 4UR8A 2CA5A 3FA3A 5H6QB 4F79A 4XAXB 3UPBA 2HVNA 1F76A 1WQ5A 1I2OA 1J18A 2CW6A 5F4WA 3FB2A 4PMDA 4IREA 3N12A 4LBUA 2PZ0A 3GIQA 3KLLA 3AXIA 2FFIA 4MKVA 4TX6A 3SRFA 2NUWA 4X1KE 3PJAJ 2NQ5A 2EJ1A 1YTEA 3GDTA 3VD7A 3EX1A 2VRKA 3VD4A 5EZYE 1VRDA 5GNYA 1Z89A 3LCGA 5G1MA 1ZHCA 1B4EA 3OGVA 2GK1B 3EABA 3AEFA 4Q33A 1XM3A 4N6FA 1XLIA 1EZ2A 2J7EA 4N9DA 2BS4A 2OLHA 3HF3A 3EEGA 4GRSA 4KEUA 1E0TA 2CLFA 2ACQA 1OK4A 1XYZA 3TAOA 1JFHA 3TROA 3KVBA 1EBHA 2W0GA 2I5QA 1UZ4A 3RNDA 4IG2A 4GG9A 2B7OA 3H2OA 5EB8A 3RCMA 4M7TA 1XINA 2RJGA 1DWAM 3B57A 1XHGA 4KWSA 1HF6A 1V3JA 4W5UA 4PTNA 1BGGA 4OGZA 5ENLA 1UKSA 2Y5SA 5JBDA 2MBGA 2A3CA 2DZBA 4IJCA 3FDGA 1J2WA 2BDQA 3AEAA 3LM3A 4UVCB 2FVMA 3FK4A 2YCIX 1QI4A 1GW1A 2V30A 4FMVA 5CPLA 5AHNA 5MKGB 4X20E 4NAEB 3RHWA 3CEUA 7PTDA 3NIYA 3G2GA 3TZNA 4J40A 1Y65A 1TPWA 4B5UA 2XU2A 3NA8A 2PBGA 4FLOA 4JI4T 1MFVA 4DIAA 1VCFA 5AC6A 4DQWA 4DXKA 4ADSA 3CYJA 4MNKA 2YCLB 2YXXA 1B30A 3DGRA 1F6YA 2G41A 1GQEA 1KR0A 3MI6A 1KNPA 2Q9QA 3E3HA 4P5UA 1QUMA 2C0AA 1W1TA 1WZAA 1MNDA 3PTQA 1MEIA 4AKRB 3R12A 2XFWA 2E6DA 5E0CA 1TWIA 3BZGA 1SPQA 3WN6A 2NR4A 2J9XA 1VR6A 4GUGA 4WDXA 4ZQOA 1M03A 3L68A 2GSJA 4JQ2A 3FZMB 3C2EA 3C4ZA 1TCDA 2VGIA 4RPQA 3NVTA 1KQZA 2FTPA 2C16A 2AGTA 2OO6A 4GVIA 4QLJA 4WGXA 3VE7A 3K8PC 4MPQA 3ZMVB 1DKWA 3AFBA 1PSCA 3LA4A 3PG9A 2PI6A 5LXTE 3NQ8A 1XZYA 1TE6A 3TSMA 4UTWC 4JI6T 1KNZA 1JCMP 4WIWA 5AY7A 4ILAA 2AQVA 1QTWA 2AQWA 2ON3A 4XO6A 5G5IA 2PDGA 1Q8AA 3FDKA 2J24A 3K3OA 1IGWA 1J0HA 3ZMRA 4X64T 1OADA 4LYRA 3OKQA 3G1HA 4BS0A 3PUEA 4R5EA 3WO8A 2WVTA 4IPLA 1QOQA 3GC4A 4F2UA 4HE8A 3VKGA 1UMLA 2PLKA 1OFPA 1TWZA 3MJXA 4JN8A 1BAGA 4CD6A 1RQBA 1O6IA 1OX4A 2XDFA 3TOYA 1Q13A 4F9DA 4UTJA 4OK0A 4ZZCA 2VX6A 1BSLA 1W1PA 3OZYA 3DI0A 2K3WA 2AQOA 4CD7A 3BDKA 2X68A 4Q8NA 3OVPA 1SHZC 1YE4A 5D2WA 4DJED 4UF0B 5AHEA 3HV9A 3W82A 1AD4A 1UP0A 5D32A 4XBSA 1EDGA 1QNQA 4ZS3A 4QTGA 1EBGA 3SSZA 1S38A 2E9LA 1C8QA 1IXPA 2DVXA 4TV8E 2QJJA 1N8WA 1MQPA 2WCAA 1LQ0A 1HKJA 3DHPA 2BG9E 1NDVA 3NQBA 3KBMA 2XSAA 5HXCA 1QLBA 3GH7A 5E6ZA 1E40A 3UY8A 1Z6KA 2GDQA 2VFHA 2DVTA 1KXQA 2ZUVA 5HXEA 5J8LA 1VF8A 2X0SA 3W7JA 1VOMA 4DJDC 1G4PA 4OHQA 1AVAA 1EP2A 1EEPA 1PX8A 3PZUA 5BRBA 1EKOA 3GWQA 1HW6A 3L12A 1TREA 1KM5A 3VMOA 5C2XA 4CXYA 2J25A 4HA1A 1UHVA 3I7RA 3C2FA 4Y9MA 2BOEX 1FWIC 4ZO8A 4AH7A 2Q8XA 1R7AA 2CWNA 3GFXA 4NG3A 4CU8A 1QOXA 3ZCJA 4EEDA 5HCJA 4NYUA 3M3ZB 1DP0A 2DSUA 5HJLA 2GVYA 5DO8A 2WZEA 5IOBA 3TJIA 4AHOA 1BFNA 3QUJA 2PCQA 1QNVA 3ZN0B 2LSGA 3WBWA 3C2RA 2FPVA 2K9AA 3AZSA 4H7VA 4AZIA 3VX1A 4LXFA 2Q9QC 1N82A 1A5BA 4HOXA 1QK0A 2GPTA 1J5TA 4I7WA 4KBMB 3URAA 3OLEA 4UQ9A 4OBTA 3P74A 1ZPTA 4AZ5A 5HUPA 4A21A 2WLYA 1TPC1 3MANA 4OU1A 2ZZ1A 4UTKA 5AC7A 1W0BA 3NO3A 4E7ZA 4QROA 2R94A 4RV8A 1W3IA 2IAKA 4M51A 4GK5E 4UIOA 4HNCA 3PPFA 1SU5A 3AO0A 4IIDA 5DT5A 1TTPA 5J2TE 1G73A 4X2RA 5AQTB 1YXDA 1XMOT 4KFPA 1E0VA 2Y61A 1XLMA 3ONJA 1H7OA 4AX6A 3G3DA 2Z26A 3ABSA 3INPA 3QB5K 1CXKA 1NM9A 5IDZA 2NQ9A 1EH9A 4GH1A 1EQCA 4OV4A 3AS0A 1Q5MA 4GGHA 3CX7B 1G5AA 4WOZA 2ZUNA 3LZ5A 1VYSX 4FI4A 1O7AA 2BGQA 4J2PA 5GVJA 4ATWA 4AKHA 2ES0A 1UR1A 3N2CA 1K7XA 5M2FX 4JFUA 1AJ0A 1RK5A 1B9BA 5FF2A 1OD0A 3WYZA 4TTGA 2H6RA 4O12A 1Z0PA 3WH7A 1TWSA 3R58A 3TSDA 2PDFA 3GDBA 4ZFMA 1HN1A 1E9ZB 4KMCA 2OO0A 4CCCA 4LUTB 2J7FA 3O63A 2E9XD 4GNJA 1VJZA 3UU0A 3KL5A 4P7NA 1S35A 3T55A 5I6SA 3JS3A 2VFDA 3S5ZA 2NTXA 1V02E 3B04A 1EJTC 2E1DA 2JGYA 4AYGA 1DVJA 3IK2A 4IPJA 1A80A 3ARUA 1A5LC 4J2CA 1KM6A 5KSWA 4C6OA 3CT2A 3NQDA 1EYWA 1LM1A 1OFEA 1W3KA 4DWDA 5A6JA 5DCEA 3TLVA 1T41A 1TMHA 2WSYA 3R25A 3AUJA 4IP4A 1SW3A 3DX5A 2NWSA 4RDYA 4LMJA 4C6PA 3ZIZA 2QJHA 1UR2A 2AKZA 4RL3A 1LZOA 1SJDA 3KDOA 4C6NA 3LEPA 3RO8A 3OA5A 4NQ1A 1LL4A 1VKFA 2V69A 4B90A 3EA2A 3UPWA 5L3FB 3CMJA 5CA1E 1KRAC 1R38A 3CZJA 3ZC0A 4PEEA 5A6SA 3NZ1A 3RKOA 5C71A 3R43A 4Y9OA 4M6UA 1GQNA 1MMAA 4HWFA 4KX6A 3SM0A 5K4ZA 1L0PA 3QK6A 4MYXA 4DNDA 3UVIA 2ZYFA 3W7QA 2LOSA 3ARRA 3LGDA 1GEQA 3MUZ1 3LI1A 4NIRA 2JMHA 4DWSB 2CM0A 1H09A 3KDSE 4O1AA 2QA7A 4EAHA 1WDRA 1JI1A 4NI8A 2XM1A 2OEJA 1QI2A 2E7FA 4UVBB 3NVDA 3VIJA 4JTCA 2XAGB 4PH6A 3NRYA 3NQVA 1H11A 3L2MA 2N9DA 4LF5T 3AIWA 1UYQA 1YIXA 4IMEA 1CW2A 4YLWA 2YW3A 3TJLA 2GYIA 3UZYA 2V6AA 4Z2JA 2O7QA 4O15A 1UQYA 4Q4KA 2ZM0A 4Z8XA 4AAJA 1V6WA 2WBLA 3GY1A 1JQXA 1XIBA 3URQA 3STEA 4FR1A 2ISFA 4HTEA 3AUOA 4TN7B 1EF2A 3WD4A 2ZZ5A 1YPXA 3CB8A 4U3CA 2O7SA 1NAFA 3MT1A 2PWEA 2OKTA 1I2NA 3CZLA 4E4UA 3B9OA 3WEOA 2QEZA 4BQ3A 4O1BA 4ANJA 1XLBA 2NQHA 2OZ0A 4PMOA 2PDYA 4O8SA 2I14A 1M04A 3I0QA 1IWAA 4YU1A 5CC6A 2PODA 1RALA 4A8NA 2DSWA 1JDFA 1W2VA 4H83A 4J3ZA 3ONCA 1O5KA 3VOJA 3N19B 2JALA 3H2MA 1QVBA 2GDUA 3AWOA 4K7YA 4Z0SA 2C13A 5DY3A 4JPGA 4ACYA 1CENA 2BVWA 3GVWA 1VBGA 1SO3A 4KRZA 1TPFA 2V3EA 4DPQA 1I1XA 1BXCA 1BKHA 2WSQA 5EK4A 1TWDA 4AXPA 2PWUA 3NYZA 5K2ZA 4BWLA 1ZGDA 3UUMA 1HX0A 4K1WA 4ZOLE 1W56A 2TYSA 3PZVA 5GJMA 3RM4A 5C7VA 4R7OA 5JREA 3TQVA 4RDVA 1HX1B 3BL3A 1M5WA 4Q8TA 2XG9A 2JK2A 4D6HA 3B5MA 1W3TA 1FWEC 1XRTA 5D2YA 3RCNA 2JKPA 1VZWA 1J2BA 3GXNA 5U7SA 4U5IA 3CPUA 1S2VA 4L5GA 1C92A 4V2XA 1TE1A 1HNZT 3VC6A 3EA1A 1UIPA 4H41A 2WPGA 4UZUA 3QV7A 1M41A 3NQGA 2A3BA 1DV7A 4DY1A 4LRSA 5FF0A 1EOKA 3VNZA 1T6MA 4HCDA 4OVXA 1IBKT 3LRKA 1EZ3A 1NENA 3VHLA 5AFDA 3PUAA 4W89A 3GG0A 5BW6A 2ZFAA 1AFSA 3LNMA 1GCYA 2X1IA 1IXNA 2ISWA 4DZAA 1FWHC 2C1IA 2XINA 3TA6A 3HGSA 4TWHA 3P61A 3WF2A 3N2GE 2DZVA 5D9MA 2HV5A 2DU2A 1SSDA 3UJ2A 3KBJA 1JJKA 1JULA 2DJXA 2PP3A 4FF5A 2FB2A 4NXSA 2IXVA 2TAAA 3Q94A 3DZ1A 3OQ8A 1FUYA 2X16A 4R3UA 1PEZA 3UVAA 3U2EA 3M5VA 2UWFA 3E9AA 4K8GA 4LANA 3U7VA 4GLEA 3HU7A 3B13A 2BMBA 1NDZA 4YTMA 4KEVA 1RR2A 3W02A 2Y6ZA 2BY3A 1J0KA 5C2GA 4PK6A 3RX3A 5RUBA 4MDPA 1Z48A 2W79A 5SWUA 4MAVA 4ZCWA 4P1NA 1GT8A 1VEMA 2BG5A 4DBDA 5AQHB 4MAZA 3O07A 4JUYA 1S5VA 1TA3A 4ZO7A 2J13A 3LMYA 2XQAA 5CSRA 2CC0A 3W86A 3GUGA 4EE9A 2Z00A 1D9EA 1L8NA 3DHFA 4AY1A 2VO5A 3DHDA 2VZVA 3PNUA 1V6VA 1KKOA 1O68A 4LJ3A 4MFDA 3F4NA 1Z8AA 4E38A 1UR3M 4H8HA 3R4IA 4Q8QA 3T42A 1R8LA 4M1BA 1NFPA 4WF7A 1GORA 3PU3A 2V6YB 3GTNA 1CPUA 3FYOA 1JYXA 1DJHA 1YXCA 4XKYB 2FHBA 4UV8B 3HG2A 4KFNA 3Q2MA 1RD5A 2G3JA 1RCQA 3VE9A 1VFHA 4O52A 1UD8A 4FJOA 5BOEA 1ADOA 3GXDA 1SZRA 1PZ3A 5JH7E 5G4HC 2XH2A 4LMKA 1PIFA 3LHZA 4MJ2A 2FVKA 3KBUA 1UG6A 3RX6A 3VKDA 1UD6A 1ELSA 4O16A 2F38A 5CPMA 2FJDA 2Y70A 4BWLC 1V9DA 3STGA 4RW5A 3GTHA 2C79A 3KRBA 1O66A 3T1HT 1R3RA 2A21A 4PCTA 1W31A 1I60A 2V3DA 2DJLA 1XBZA 2OLTA 4W86A 4LBRA 3WNMA 4QE4A 3ANWB 5DQVA 2OZTA 3AEDA 4M5PA 2HHHT 4S3JA 4NHVA 3L4XA 3I7SA 1L6WA 2EEXA 3TCEA 4XQ6A 3B3DA 4DV7T 4FX7A 1E72M 2YU2A 1RY8A 2BXVA 2WM9A 4WYVA 3GNPA 3ABOA 3H21A 3G1SA 4LEQA 1KV8A 2XIQA 1L8PA 3G1VA 3H37A 4R53A 2VZOA 1UD2A 3RN6A 2HPLA 1H1NA 3GIPA 3E74A 1JCYA 1G69A 5LMUT 2Z25A 3ZVHA 1CHUA 5I3KA 5M1TA 4QQUA 4HFDA 3GNDA 5F2MA 5CGTA 2Y7GA 3LLDA 3MO7A 3RUBL 2V3FA 3RI5A 4Y7EA 3RMJA 1SQ7A 4DZHA 3TA9A 1E55A 3MJMA 1XLGA 1DU2A 3W22A 5FAGA 1FFQA 3KVMA 4UR7A 4F8XA 4MWAB 2WXDM 4A56A 2WMKA 5I23A 1JAKA 3DYOA 4KWWA 2Z7KA 3VABA 4V1YA 1PKNA 5AQVB 4PMJA 5FOOA 3VFLA 1ODUA 3NZGA 4HB7A 3OYXA 2ZLYA 4Q8UA 3VK5A 3WQGA 2GWNA 1H7PA 3KTSA 3CWHA 3H53A 3SSJA 1ZEEA 1ISZA 4O14A 1PYFA 2QNEA 3O05A 1IT8A 3RMEA 1V3MA 3UT5E 2WDRA 1TQXA 3DESA 3W84A 2VKOA 2WZIA 3OLIA 5C5YA 3EB4A 1XRSA 3NTYA 1R85A 1JPHA 2ZX7A 3XISA 3RG6A 1U5HA 3GWHA 3NM3A 2KMFA 2I16A 3W2JA 1K03A 1EGZA 2Y2WA 4A05A 1UUQA 1GQJA 4NXKA 1SGJA 3PTMA 4OECA 3QC9A 2YA2A 3S2NA 3A4XA 2Y7EA 1K02A 2UY2A 3H4GA 4QJ3B 3AVSA 3RLHA 4E7SA 3IRSA 4DF0A 3KFTA 4ZXLA 4AQLA 2NWRA 3W4RA 5LP6E 1PHQA 1M7OA 2QVHA 3SFKA 3OG2A 3SAZA 4EB6E 1E7PA 1KR1A 1QPNA 4IGHA 3GVGA 3TYBA 3WJYA 3N73A 5CPQA 4PCSA 4ZI3D 5BU9A 2NX1A 3R94A 1F3EA 3Q5EA 1D0YA 1SO6A 4RE2A 3CQHA 3SADA 1LQAA 1THFD 3W83A 4XAFA 4QDPA 4TTUA 2WM0A 1IEWA 1YDYA 1XDMA 4A4AA 1P6BA 5HMFA 2CLMA 2Y4SA 3U4AA 5J2UE 3KAOA 3GX9A 1B5TA 3BPWA 1AQHA 3RLFF 4HN4A 4LVAA 1Y01A 4F9JA 1YDVA 3IJDA 1RHCA 2J4GA 3LBXA 2D2OA 3VD3A 4LYKA 1PTGA 4JDYA 3STCA 1KM3A 3UR8A 5TBOA 1ALDA 1PKLA 3T40A 1DE5A 5IFTA 2YCJA 3SUTA 2YL9A 1QWGA 1FWGC 2WDVA 2PC4A 3PZTA 2BS2A 2EHHA 1SZGA 3ARQA 3EGJA 3D0CA 1OZQA 1JD9A 3GO2A 4BJMA 5E09A 3BLPX 1VRBA 4GKTA 2EHOD 1H62A 1F8MA 1GVFA 4EF9A 2Y7FA 1J5SA 1LVKA 4C6LA 4CCDA 1W09A 3VAVA 3LBMA 3NDZA 3ZT5A 5H8MA 2C1HA 2UUAT 3IPWA 3GU9A 3LK2B 1M6JA 5IWAT 3ZM8A 1KCXA 3T0AA 3IIZA 4Q4QA 3RF1A 1B90A 4DMWA 4KPLA 1H61A 4PUDA 4WRHA 4Z42C 1XD1A 1XLKA 1R6WA 1W9DM 5DXYA 2JBMA 4A98A 3I6TA 3P62A 3VGDA 2J77A 2G50A 2ZRXA 1W1ZA 2AGKA 1L6FA 2R6GF 1WUEA 4I7UA 2QDEA 1PUDA 3IBPA 2PDXA 1YX1A 1E15A 1K8YA 2Y85A 5FXWA 1LUCA 4GKKT 4BI6A 1TJRA 5ECVA 4LVDA 3TP4A 4PSPA 4Q6XA 2ZKMX 2XFRA 1YD8G 1NWRA 4Y6GA 2VCBA 3BOFA 3EBVA 3EZ4A 1ZLPA 1S5NA 4JEJA 3U2OA 1K7EA 2V8SV 2W5FA 3G8RA 4GACA 4PGLA 1V3HA 4WBNE 3LHVA 4QDMA 3WSUA 4NAFA 2ZVIA 1WXZA 4Q3MA 4S3KA 5EK3A 1KGXA 3RCYA 1HVXA 2E5CA 3GE7A 4AFYA 3PBMA 2Q3RA 2CLPA 3ABXA 3IS4A 4HFVA 4GXPA 4DR5T 1DHKA 1Q6GA 3GNXA 4Y2WA 5L4HA 3U48A 1KXVA 4GQRA 4L64A 1EA0A 5HXSA 4UTLA 3TQ0A 1D3HA 1CTNA 4UIGA 3GTXA 2Y5JA 3MXZA 3B4UA 4Q6JA 5A6TC 1GQIA 2V1DB 2VFFA 4CD5A 1UWAA 1HL2A 4FHAA 3W7PA 5LA6E 2D0FA 2Z6JA 2QDDA 3QY6A 1H41A 3GDLA 5T9CE 2A5HA 1MXDA 4HHHA 4AZ6A 2PU1A 3LRMA 4WJXA 1SM9A 3AWNA 3QZ6A 4EXTA 1XV8A 2GK9A 1OXZA 3IUHA 4RNJA 5BWFA 3CX6B 6TIMA 1P1MA 4C6EA 3VKHA 3NKZA 3UY7A 1ECQA 3NEVA 3FLUA 4EXQA 1I94T 4BEQA 3HO8A 1E1HB 1UWRA 2EGZA 3H4XA 4LAZA 3L67A 5JXQA 4ADZA 4ZE4A 3TR2A 4L0RA 5BRPA 4S3CA 3QW4B 3WF4A 3WLIA 2OZ8A 1DWFM 3P5YA 2H9AA 3VUPA 1V79A 2D3LA 1ZALA 2YIHA 1ONRA 4DO5A 5F7UA 3DG3A 3AMGA 3DFHA 1DQXA 3GM8A 2A9UA 3CHDA 5DMMA 3JADA 2CPTA 1QXLA 3ES8A 3Q9DA 2QGYA 2ZXQA 5I77A 4JL1A 3T2QA 3WBYA 4IE6A 2DUAA 3HA1A 4R33A 5DQPA 4JHZA 3P82A 2ODUA 2BZBA 2PEVA 3T0BA 2B7PA 2QKFA 2VQTA 4JL2A 2I5IA 3KLKA 2EPMX 4US5A 1V77A 2OQHA 2ALDA 3BE7A 3CAQA 3HTWA 3IJ7A 1PXGA 3SY8A 3FEQA 1E3XA 3GS6A 2VEGA 2YDSA 3AHTA 4CN1A 1F74A 3RH3A 1V3KA 1DXIA 2WVUA 2EG8A 4P8VA 4MY1A 1IHIA 5FJJA 1NQ6A 1J6PA 3UQNA 4KT2A 1HNXT 2NVAA 4J3XA 2WV8A 1A4LA 3KCLA 3APGA 3MVTA 2OVLA 3N2TA 1R86A 2ZC1A 1H3GA 4AKIA 3VKAA 3ZLIA 1Y7VA 1XGEA 4MZ8A 3LDQB 3SFEA 1LRQA 3K5XA 1UASA 3N34A 3R13A 3M44A 3TLTA 4ERGA 5BXSA 3KCOA 1QHPA 1RLDA 4TWDA 3WD1A 1KNWA 1R30A 3IIOA 1TZ7A 3IHRA 2GJXA 1BD0A 2WKJA 2WVVA 5KZEA 5AQSB 5LIWX 1GEHA 5I06A 4IIEA 3C8FA 4O8AA 4ZBCA 2BY2A 1FHUA 1ZL1A 3AEGA 2V5DA 4PUNA 1CBGA 3S0CA 3PR2A 1LOLA 4HTYA 2DV0A 1ISYA 4YPJA 4RJEA 3HKDE 2VEIA 3VOHA 3B8SA 1I45A 4K37A 4QFUA 5HXHA 1TYGA 3QXBA 4OFCA 1IGSA 4C6DA 4HSOA 5D4YA 4Q22A 3C50A 3W2MA 2QDHA 5B7YA 4HZMA 4QISA 1ZJIA 1YEYA 4WVXA 2W00A 4X61A 2W4XA 3PJUA 3MACA 2LM2A 3MBDA 3CWZB 2A1YA 3PZQA 4DLFA 4DUZT 4ATDA 1FOBA 1AK5A 5G2WA 4KWUA 4EVZA 1WV2A 3IAPA 4W9TA 2D0UA 3CUFA 4AMAA 4LSBA 1F3TA 5LXXA 4LF6T 4U2ZA 3N2OA 4D6FA 4AVOA 4JYDA 2QPUA 1U83A 5HWJA 1R2TA 5D2TA 1TVPA 4QEHA 3SCSA 5ABFA 2OOFA 3UUBA 2DL1A 3KOFA 4Z1BA 3RKGA 1RV8A 1OT2A 4MTVA 2XZ9A 3PBGA 4UB9A 4C6FA 2OGJA 1E9LA 1ADSA 3AXJA 3EUHA 3FA4A 4Y90A 1UMYA 2CHOA 2CXEA 3F7JA 1FRBA 4JAWA 3JRKA 3KRZA 4MB1A 3S9YA 4KRTA 5I3DA 1KNRA 1IF2A 4FR6A 2EPHA 3HPZA 1TMQA 3I9YA 2ODVA 1IT7A 3GU1A 3URBA 4Q4MA 2RGMA 1MIVA 4PRTA 1OX4B 3FFSA 2LSJA 5AQRB 4LPCA 2CU0A 4MHBA 2YBTA 3BTNA 3SGUA 5TAOA 5CPNA 3N1AA 3IRDA 1U1UA 2WQYA 1LLOA 1XFCA 4UFIA 3OU8A 1SYTA 2ZXDA 1IV8A 4JX5A 4IUGA 5AQPB 3R0UA 3QPZA 2HQAA 4HGAA 4JTIA 2GLKA 2O56A 4JQ4A 5LYJE 1QO5A 2BNJA 2VR2A 1EIBA 3BARA 5FCZA 4D6EA 3WMSA 4KKXA 4HFBA 3I4KA 3CQIA 3W1QA 3EOUA 3DUGA 4HPGA 2AKMA 3M5XA 1EF3A 2VZSA 2POZA 4XVDA 1A4MA 4ROPA 2OYMA 1R47A 2YL5A 1RLCL 1BVNP 3PWAA 3USZA 5M5DA 4OOUA 3JUGA 4L4MA 1WDWA 5HINA 3NYDA 5CC7A 4GC3A 1TSIA 4N78D 3QHOA 3L21A 4IT4A 3UQ4A 3A7MA 2X05A 1CNVA 3E2QA 5XINA 4O18A 4I0UA 3EKLA 2QCLA 3WK1A 2C19A 4PMYA 4ILBA 3BANA 5GQBA 2YX0A 1XBXA 2XSXA 3GQYA 1UKPA 1EP3A 1H1ZA 5L3EB 1QK2A 1DWGM 1MMNA 1PVNA 3FKRA 4CQIA 3DDMA 1G7UA 1VJIA 2VL4A 3L39A 3W23A 4AW7A 1X98A 3UUXB 2I57A 2BGNE 3C2YA 1JCNA 3C2VA 4GOAA 3VIMA 2QDGA 4QH1A 3WKZA 4Y8FA 3RIKA 4JTFA 1GVYA 4K8EA 1WZLA 3ARSA 4KW2A 1XP3A 2PDMA 2PLJA 3HMCA 3CL7A 1EL3A 3MSGA 4M29A 3CIXA 3CQGB 3RPUA 2ONEA 4GI8A 4HNLA 4ZB5A 2ZRWA 3BSHA 3PWGA 3B8WA 4GIWA 3RLUA 4UELA 3OBAA 3U6WA 3VIHA 2UUBT 2DPEA 3BLFA 3KWXA 4IF2A 3U57A 1S94A 4GH3A 4MM1A 1ZRQA 3UWYA 3H54A 2BVMA 2C0HA 3I4EA 3DFNA 1TV7A 4W7VA 4B15A 3TMLA 2DZPA 4WHBA 2Z1WA 1A5NC 4H1ZA 3AJ7A 1AA1B 3S5YA 3QEZA 1LT7A 2PMQA 1J10A 1VPYA 3BO9A 4HT3A 2PTYA 5LNVA 4DBQA 3DU0A 3UWVA 4KGLA 4NJKA 1WYCA 1WAWA 4DJFA 4W8BA 2J47A 3KBSA 4KF1A 2I5GA 2V7KA 2G3FA 4DYJA 2JQHA 1X6NA 1TV4A 4YYFA 4O57A 3I3BA 3H4WA 1KBJA 1GHSA 3BWWA 2I17A 4ICMA 3VINA 5AQKB 3W53A 4HVXA 2OT1A 1GVEA 5LHIB 1R3VA 2PG8A 3K1GA 3FN9A 4LCSA 3LLFA 3WH8A 4QGCA 1I2PA 3EDJA 2FDMA 2HK1A 5KEZA 4ZZ9A 1UH2A 3THCA 1V6TA 1JPDX 5I03A 4AZ7A 2DNXA 4GIEA 1X7FA 2FIQA 1GHRA 4ML4A 1D8CA 3W7OA 3VGGA 3GXPA 1BRLB 3VDGA 4B3ST 1ITQA 1NDYA 4NILA 5LGNB 3LCHA 3SCQA 2ZOXA 2CXFA 3PBYA 1UUMA 4FOKA 1WZKA 1WZMA 5AOUA 4NL1A 4LOCA 2E9XB 4I9JA 1US2A 3CT7A 2RDWA 4D6CA 1KLZA 4QRNA 3N2XA 3GR4A 5D09A 2CESA 3BAXA 3E0IA 4EWJA 3A5XA 5FL1A 4JTRA 1H2JA 4C6QA 1KM0A 3LCWA 2V67A 4TX9A 4EXAA 1Q4NX 3II1A 2JQKA 4V28A 4PJMA 3HURA 5BXTA 1QOPA 3A4AA 1CLKA 4MNMA 2X0LB 4IQJA 4XAPA 1MW0A 3FSUA 3OJGA 5AYYA 4E0CA 4PEKA 1CXLA 3E22E 4QDWA 2ZDRA 3ANYA 3DN5A 1POJA 3TLLA 4ML9A 4IH3A 2G5WA 3WH9A 1VC4A 2HMCA 3NDYA 2E0PA 1V6XA 2VCAA 1TPB1 3HQNA 3AHYA 1XX1A 3VZYA 1KD0A 2W66A 2HZGA 2V7JA 1VB9A 3KUMA 2CERA 3K8LA 2QF8A 3WI3A 5CB4E 1GKRA 3M0YA 1SR9A 1CXFA 2ZUTA 1CGYA 4W7UA 2LT3A 4GYFA 2OWXA 3TN6A 1UPPA 1VEOA 3T78A 4H63V 2VK9A 4PUWA 3O4XE 3WIJA 4H4IA 2J6XA 5E0FA 4GQGA 1JDAA 3SQSA 3WK2A 3KV9A 2FGLA 1NP0A 5HEHA 4FLSA 3B8IA 1UC5A 4ZO9A 3S2MA 3VILA 1VBRA 4Q4RA 4ZE5A 2V5LA 1C8VA 4HKAA 1KFLA 1X97A 1DJWA 2Z1VA 4KRUA 7REQA 3NEHA 1ZU8A 4AI6A 5AC8A 3VXGA 4K0UA 4BF5A 2L9QA 2DEPA 3QFWA 4BZYA 1JZ4A 5KZMA 5DMYA 3PANA 5F8PA 4O4VA 1QR7A 3PY2A 3UU8A 3WCZA 1UR9A 4EAYA 5L3BB 3WEMA 3PZGA 1D3CA 1OX5A 3W07A 4GO8A 2IQ0A 4C1NA 4HU8A 2AAMA 1MW2A 4P7OA 4DJFC 3UD6A 3EDEA 1NWTA 1IZNB 3ETVA 1HKWA 3PUVF 3MTWA 1SJBA 4D9PA 3DJBA 1YQ4A 4FS9A 3E2SA 4N02A 4HOWA 3P84A 4BQ4A 3FHNA 1E6RA 4HU0A 5AHMA 1L0VA 1PCWA 3AIRA 3LHUA 3SCWA 3CMLA 1OC5A 3GDKA 2XWEA 4YYCA 3G1FA 4HMDA 4UUIA 3G1DA 4YCPA 1B7TA 3WLOA 3LK6A 5AECA 4Y9AA 1ME8A 1X6LA 1VHNA 3WL0A 2ZM8A 5D2VA 2F6UA 4O1DA 4LTSA 4OWGA 2WMHA 2OQYA 5F5WA 2QS8A 1WKFA 3HM7A 2BODX 2WCSA 4WXYA 4LBSA 4JYAT 1UZHA 1SUXA 1V0MA 3C4UA 4EK7A 1S5TA 1TZZA 2I9EA 3WDQA 4H6QA 4ZOBA 4ZI2D 3SIZA 1VBHA 3Q5DA 4CQCA 4WKHA 3GDRA 3PAOA 3UXIA 4TV9E 2VC9A 5ABHA 3EWYA 4HCHA 5CEWA 3P80A 3LV6A 4MFRA 4ZHQE 3HJZA 5EYWA 1BTMA 4WR3A 3DXIA 3AE3A 4G6CA 2RHGA 2HWGA 2X9XA 4H6EA 1WYIA 2IUBA 4MUZA 3UG3A 1HGYA 3GH5A 1VP5A 2V2DA 1KLYA 3DERA 1FXPA 4NNAA 5HQEA 1NEYA 3W00A 4NJIA 3VOGA 5AQQB 1J01A 3CQKA 2RDUA 4TR9A 2Y8UA 2KXPB 3W2NA 1UD3A 3OPSA 1O3XA 1CGWA 1RA0A 3H23A 4PBGA 1SO4A 1M3UA 2V82A 4A22A 1NARA 1H1YA 3MC5A 3RIAA 5C2TA 5FJIA 1TFVA 2RAGA 1US7B 5ADXL 3OVUA 1KKRA 2NXGA 4LUTA 5CG0A 5AHFA 4TV6A 4QE1A 5DMLA 3R6NA 2YKKA 3GR7A 3LK3B 4UNKA