2W62A

Saccharomyces cerevisiae gas2p in complex with laminaripentaose
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
461
structure length
436
Chain Sequence
SFEKTPAIKIVGNKFFDSESGEQFFIKGIAYQLQRSGAFETSYIDALADPKICLRDIPFLKMLGVNTLRVYAIDPTKSHDICMEALSAEGMYVLLDLSEPDISINRENPSWDVHIFERYKSVIDAMSSFPNLLGYFAGNEVTNDHTNTFASPFVKAAIRDAKEYISHSNHRKIPVGYSTNDDAMTRDNLARYFVCGDVKADFYGINMYEWCGYSTYGTSGYRERTKEFEGYPIPVFFSEFGCNLVRPRPFTEVSALYGNKMSSVWSGGLAYMYFEEENEYGVVKINDNDGVDILPDFKNLKKEFAKADPKGITEEEYLTESVECPHIAVGVWEANEKLPETPDRSKCACLDEILPCEIVPFGKYEEYFSYLCSKVDCSDILANGKTGEYGEFSDCSVEQKLSLQLSKLYCKIGANDRHCPLNDKNVYFNLESLQPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords GLYCOLIPID-ANCHORED SURFACE PROTEIN 2
publication title Molecular Mechanisms of Yeast Cell Wall Glucan Remodeling.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 162
structure length 436
sequence length 461
ec nomenclature ec 2.4.1.-:
pdb deposition date 2008-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03198 Glyco_hydro_72 Glucanosyltransferase
A PF07983 X8 X8 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1040 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2w62A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2w62A01
3HU7A 4N42A 1W3JA 1GHSA 2WVUA 1KCKA 3AI0A 3MMWA 5FL0A 1CDGA 2DGAA 4HOWA 3L2LA 2V5CA 2WHKA 3UG3A 5HPCA 4HPHA 2YKKA 1SFSA 3ARRA 3B9AA 4PMXA 1UWRA 3ZJ7A 5FOOA 5HDRA 1U2YA 1JZ4A 3W81A 1J0IA 3D5HA 1E4IA 3N18A 1HKKA 3WH8A 1J01A 1GOKA 3RCNA 4PMQA 3PZNA 1ESWA 3BAYA 3AS3A 1ITCA 1QNOA 3MUY1 4W7WA 1G94A 1VFOA 1HKJA 4GQRA 1H4PA 3PZOA 3GNOA 4MB1A 4J3WA 5ABFA 3VGDA 4EAMA 3ARYA 1HXJA 5HOSA 1WZLA 2E8ZA 2OSYA 4IUGA 2WZEA 4U3CA 2A3HA 4CCCA 4JCMA 1V3LA 1AQHA 4UZSA 2CKRA 1E6SM 3A3HA 4ATLA 4E8DA 4OBSA 1UA7A 2O9RA 4HZ8A 3IK2A 2ZUMA 2E0PA 2PBOA 1KQYA 1BGAA 5JUVA 3FHAA 1V3KA 1JYNA 2UY5A 3AFBA 4MNLA 3VUPA 2XGIA 5A2BA 1CEOA 3AMKA 3B9DA 3IJ7A 4AZIA 5A6JA 1CGTA 1KXVA 3CO4A 3K1DA 4JFWA 3CUIA 4C7FA 5E9AA 1V6VA 4ACZA 1RPKA 2EBNA 3RJYA 2CCRA 4PMDA 3CZEA 1AQMA 1W32A 1HJVA 4TXEA 3VVGA 3GH4A 3AMDA 3OGSA 4AEFA 5ABHA 4D6EA 1JIBA 3THDA 1J0YA 3BGAA 3ZIZA 1L8NA 5IFTA 1V0LA 1WE5A 2J7DA 3WDIA 3K46A 1QBBA 4HPGA 3AXHA 3EDFA 1JL8A 2EPLX 1E43A 5AY7A 3GXFA 3VGEA 2EPOA 3PTKA 4D6JA 1M01A 1W91A 5E70A 4LYRA 2OYLA 1G5AA 1LWJA 2BY2A 2XG9A 1BPLB 2F61A 3WMSA 2ZUWA 4UQEA 4A3HA 2WZHA 4QLKA 5FL1A 3CUGA 4UQBA 2X1IA 1CGUA 4MJ2A 2VT0A 2OWCA 1DWGM 3M7SA 2YBUA 2W5FA 2W63A 1ECEA 1MXGA 1H0IA 3WNNA 5KEZA 1V0MA 1MFUA 4M29A 2CESA 2VX4A 1WNOA 3LPOA 3A47A 3WNPA 3GZAA 3VIFA 5A6SA 3AMLA 4FLOA 4IPNB 3WIJA 1LL6A 5FKYA 2G41A 1ISYA 3BLPX 2VZOA 2GJRA 4NRRA 2E4TA 1LJYA 4PMUA 5A94A 1CGYA 1NP2A 4KGJA 1LL4A 3WH9A 3SURA 4TVCA 3AQUA 3WEOA 3BSGA 1E5JA 1Q6GA 1QI3A 1UH3A 3QR3A 1GPFA 2D23A 1JAEA 4X0VA 2D22A 2J77A 2WHMA 3AISA 1NM9A 1HVQA 2QMKA 2E9LA 1GONA 1XV8A 3SUVA 1OD8A 3SUUA 6TAAA 2XGBA 4D6FA 1DP0A 2ZX5A 4ATDA 1EGZA 4MB3A 2WSPA 2FH8A 1EA9C 2CNCA 3WF2A 2QHAA 4UFHA 3L4WA 2PI6A 5HNNA 4ML4A 4LXFA 2YJQA 1KGWA 2VR5A 5LA0A 1GORA 3B8SA 3NIYA 1OGBA 3J7HA 1GQJA 2YDRA 4CCDA 2G3MA 3GXDA 2YDSA 2D3LA 3BMWA 4D6DA 2V5DA 1GVIA 1J18A 2W4XA 3W0KA 2PWFA 1GJUA 3K4DA 2WYSA 2VUYA 4M8UA 4H2CA 1D2KA 4KGLA 4ATWA 1LG1A 2ZX8A 2J7BA 4HMEA 2OWXA 4CU7A 5EBAA 4JFSA 3F5JA 3FW6A 2BHZA 3CBWA 1X6LA 3BAKA 1JD7A 4AMCA 1FFRA 2WC7A 1XYZA 1OGSA 4PMZA 3QHMA 3PN8A 1GZJA 3EMZA 2VURA 1CXEA 5C71A 4B16A 1HKMA 2WHJA 1H49A 3BLKA 3CHFA 4AIEA 4EE9A 3W26A 4BA0A 4JAWA 1UWTA 2VL4A 4TTUA 2ZICA 3WN6A 2CHNA 1UKSA 1WDQA 4D72A 4AEEA 4P7RA 3VIKA 1K9TA 1VENA 1E56A 1JZ8A 4GZIA 1XHGA 4EANA 3VD3A 2ZUUA 2JF6A 2FHCA 3AXIA 2FHBA 3CTTA 4F8XA 3CGTA 4AZ5A 1TA3A 3NCOA 1C90A 1J0KA 1UR9A 1G0CA 1CZ1A 4X9YA 1E4LA 1HF6A 3ARQA 1CGVA 3BC9A 1CXFA 3ZMRA 3WQ6A 4WLCA 4MB4A 4GIAA 2J7EA 1DEDA 4AIUA 5M03A 4H8VA 1FHDA 2WVSA 2WXDM 4Z2LA 2DSZA 4CD4A 1EHAA 2XPKA 1UR2A 1ZBWA 1B90A 1YQ2A 5I2UA 4YN5A 5GNZA 3BXWA 2WW5A 1JZ2A 1WKYA 4GI9A 4P7LA 2EPMX 2VR4A 3L4XA 2OSWA 5A8NA 2VZTA 3AHZA 2CERA 4DWSA 2WMGA 2BV9A 4HTYA 2FGLA 5A8PA 1CIUA 3SCSA 3ARSA 2VJXA 5A6BD 1TR1A 3SEPA 3UCQA 1ZU8A 4U31A 2DQXA 4EK7A 3AYRA 3RMEA 4H7VA 4H41A 1ZB5A 3VOCA 3VMPA 3EYPA 1E1EA 1H2JA 3OA5A 4J7RA 5AC4A 3E1F1 1M03A 4W7VA 4D6HA 2WNWA 3AHXA 2CKSA 2ZX7A 3WMBA 3M6DA 1LG2A 3WSUA 3WEMA 2E9BA 2VO5A 3I3BA 1QPKA 2ZXQA 3CHCA 3L4UA 4BCEA 4MDPA 2PB1A 1OIFA 4MNMA 1UWSA 1VEOA 1OIMA 3JUGA 1XC6A 2OYMA 1FHLA 1TE1A 3U5UA 4MB5A 1P6WA 2BNJA 1TFVA 5I5RA 1G1YA 3T2QA 3ARZA 1NARA 1ISWA 3WL1A 4B9ZA 1W9PA 1LLOA 1UYQA 2GUYA 2Y4SA 4DWSD 1BYCA 4GQQA 4HOXA 1US3A 1QI4A 2EPNA 1V02A 3PZTA 1TZ7A 2WVVA 2CHOA 4OIFA 3KEHA 3UEQA 1XCWA 4JHOA 3WL0A 1BYDA 5GNXA 2VRJA 2C7FA 4LYPA 3WQ5A 3IAPA 1C8XA 2C0HA 1CXHA 3ARWA 2WMIA 3VDAA 1JFXA 5FD0A 1QNSA 1J10A 2GK1B 3BCFA 2WWCA 4AISA 1HJUA 3MUAA 2YL9A 4JKMA 4GXPA 1PPIA 4P7QA 2VRQA 3OLGA 4DM2A 2VOTA 5I79A 4WF7A 1VEMA 3WQ8A 5CGTA 1Q6EA 3WH6A 1VAHA 3VILA 1V6YA 3U7VA 3PTQA 1JF5A 2BY3A 2WCSA 2FDMA 2J78A 3GDBA 4GKLA 1PIGA 4W85A 1UUQA 4N0RA 3FAXA 4DUXA 4ZENA 1U30A 3AZRA 3W6LA 4W93A 3WBEA 2ZE0A 4QLLA 3WF3A 1SMAA 4UR9A 4PUDA 1Y7VA 4QFUA 2VCAA 2ZOXA 2D20A 3RM4A 3KL0A 4QCEA 3GXMA 5I3DA 3ZR5A 1CNVA 3WNKA 5A2CA 1BAGA 1NWSA 2AAAA 3AOFA 2V3FA 1J9YA 1QI0A 3W37A 1UQYA 3OZPA 4KRTA 3VGGA 1UD6A 3THCA 2O9TA 2A3EA 4WIWA 3WDRA 4WKFA 4J3UA 3AS0A 2WANA 2G3NA 1HIZA 2DSUA 3SUTA 3WH7A 2PWGA 3VD7A 1BG4A 3TOPA 1WZAA 2XSAA 4UFMA 3MV11 3T2OA 1QBAA 1E40A 1CWYA 1NWTA 3BSHA 1DWJM 4BZYA 2YA0A 4CU8A 2CETA 4MTVA 2BHUA 4Z2JA 1Q6FA 1VF8A 3LPFA 2W66A 3EMCA 3A6OA 3T0AA 3ZJ8A 1UKOA 1HJQA 1KFWA 1EDGA 4WKHA 4CUCA 1E6NA 1VBRA 3PHAA 1PEZA 2WMFA 1EQCA 3NDYA 3WF1A 4BS0A 5A8OA 1X6NA 1JNDA 2XFFA 3GTNA 4BF7A 3CZJA 2XJ7A 3AIEA 3BCDA 4W8AA 3MUIA 4V2XA 2V3DA 4P8UA 2XSBA 3UG4A 1KXHA 2Y2WA 4UOZA 1CPUA 2CYGA 3ZM8A 3VGFA 4J3TA 3LMYA 4P8VA 3M46A 1TVPA 3VTRA 2HVMA 1KXTA 1OT1A 3VDHA 1IT0A 2DSWA 1MW2A 3AHVA 1QW9A 1CGWA 3N15A 5BXRA 3L4TA 4AD5A 4RE2A 1V3IA 1QNPA 3IAQA 2JALA 3MU7A 1QNRA 3ZJKA 3IJ8A 5DO8A 2IXVA 6A3HA 3PZIA 5LYRA 3W25A 3WD4A 4CCEA 1B2YA 5EFFA 3WNOA 1KWKA 5DT5A 3WQVA 1UD2A 3GNRA 3L4ZA 5ECUA 1W1TA 2ZWZA 2NSXA 4PTVA 3VD9A 1OBAA 5D9PA 4CN4A 3SCUA 5C70A 4JFTA 1R86A 4AZCA 2VQTA 4V27A 1FOBA 5DF0A 2RGLA 4JL2A 1BF2A 1QOXA 2HISA 1JDCA 1JF6A 1BFNA 1HNYA 1H1NA 3WUFA 2NT1A 5D8WA 1A3HA 1MFVA 3U57A 1LL7A 2WZIA 3DHPA 5F7UA 3DHUA 1RD6A 1JG9A 4CKQA 2Y5EA 1XH1A 1W3LA 1DHKA 1JD9A 1LQ0A 1MQPA 1BGGA 3WDJA 1GOIA 1BG9A 4C7GA 1PX3A 4E2OA 4W87A 1HL8A 2CBIA 3VGHA 1F4AA 4FK9A 1J0ZA 3TTOA 1K9FA 3CPUA 4PEEA 5I24A 1MXDA 1EXPA 2EO7A 4MADA 2YL8A 3VNYA 3FXYA 3VPLA 4AD2A 2GVYA 3NJ3A 3AMGA 5EB8A 2G3IA 4QLJA 6CGTA 2XYLA 1MWOA 5JIPA 3ZR6A 3QHNA 5BYWA 5I6SA 3W29A 1GOOA 2WB5A 4PSPA 3TTYA 4W5UA 3RIKA 5CZKA 1UQZA 5E0CA 1XH0A 4M80A 1UR0A 2CBJA 5A1AA 1C8YA 1EDTA 2G8ZA 3U7BA 4ZE5A 3NYDA 5BROA 3N13A 2PC8A 3F5LA 4NRSA 1NH6A 5TD4A 3SCWA 2VZSA 4CN6A 4M56A 2EPKX 4HMCA 2VC9A 1H41A 3HN3A 4YPJA 1E9LA 3I3DA 2D0GA 4PMNA 1E55A 3CLWA 2YBTA 4IISA 2D0FA 2BVTA 3DC0A 3N11A 2GDUA 1FA2A 4NI3A 4UCFA 4XX6A 4HA1A 4KWUA 3HMCA 1ZJBA 1CXKA 5M5DA 5ABFB 2EEXA 2CBVA 4J3VA 1LWHA 3OLEA 4UQ9A 1UWQA 1XD1A 2Z1KA 3GH5A 2PWHA 4D1JA 1BYAA 5FIPA 1E6RA 4AIOA 2V3EA 1W1VA 3ALFA 1B3VA 4M81A 4Y7EA 4JZ5A 3WEZA 4Z2HA 2EXOA 2W67A 1S46A 4L4PA 1U33A 2WBKA 2DH3A 4E4PA 3SCRA 3WD2A 1QHOA 3T09A 4GINA 4OOZA 1EO5A 3SCOA 1DWIM 4QP0A 1GUVA 4RE4A 2OYKA 1V6UA 1XCXA 1W9VA 1KB3A 1G01A 3W4RA 2Y8KA 1B3YA 3WMCA 2AMGA 2J7HA 2YDQA 3L2MA 3ZOAA 5CLWA 1ZBKA 4UZUA 2Y24A 2D0HA 7TAAA 1B31A 3VM7A 2FGZA 4ACZB 1I1WA 2ZXDA 4IM4A 4UOJA 3WF4A 2D3NA 1XH2A 1V08A 4BQ5A 2W91A 3KE0A 5A6BA 1QVBA 1V0NA 1OWQA 3ARUA 4OJYA 5A2AA 3L4VA 1L0PA 1HJSA 3GH7A 3QOKA 1SR0A 2BY1A 1E0WA 1ODUA 3VX1A 5BRPA 2J8FA 3EMQA 3DECA 4D71A 3AIBA 1XSKA 1C7TA 5JIWA 3FY1A 1Z32X 2DSKA 2XUCA 1UWIA 3WF0A 2V3GA 3WDPP 2WMJA 3N12A 1JAKA 4AYSA 5HPOA 2VX6A 4XZBA 9CGTA 1FH8A 2E8YA 2NT0A 3BAJA 3OGRA 3SUSA 1G9HA 1JDAA 1V0KA 1JZ7A 3O9NA 1NQ6A 1GQLA 2VTFA 1NOUA 5C8BB 2QLYA 1NWUA 4GO9A 1GQKA 3GM8A 5M3WA 1MQRA 4GI8A 3RILA 3CZLA 3VIJA 2DH2A 1D3CA 1GCYA 2GJXA 3W28A 4K68A 1B3WA 3VO0A 4PTMA 3AJ7A 4ZXOA 3AZSA 1WP6A 1KQZA 4LQ1A 3O6AA 4QDMA 3KL5A 1XYFA 1MW0A 2VZUA 4H8HA 1OGGA 1LF1A 3D3AA 1UG6A 1KBKA 3T08A 4X0NA 1H5VA 1GOMA 5D4YA 4CD8A 2UWFA 1M7XA 1TMQA 2XVLA 3VIIA 4AD1A 3MKKA 2J7FA 3CZGA 1OSEA 1QI5A 3PZMA 3AHTA 3VNZA 4AD4A 4EKJA 2WBGA 2J62A 3FN9A 2WHLA 3CMJA 4A4AA 3O2LA 2WLYA 3BAIA 2BVDA 3RJXA 3FNDA 1RP9A 3EDDA 4S3JA 1BSIA 3MANA 1HX0A 3AIRA 2GDVA 4U2YA 3F5KA 4FF5A 2IXUA 3S2CA 1KR1A 1E70M 3W6MA 3PZVA 3WDQA 2XFYA 1VFFA 5IHRA 2YL5A 2AOSA 3ZT6A 2Q8XA 4PMVA 3SCTA 2QV4A 2DIEA 1PX8A 3MUZ1 2DT2A 1B30A 1Q6CA 1W9XA 4TOQA 2VQUA 3POHA 1CYGA 3AIUA 1UKPA 2CIPA 2DT0A 4W7UA 2OWWA 1XRVA 3OG2A 1ODZA 4AZBA 4HU8A 3K8MA 4UFIA 3OLDA 7CGTA 2BXYA 2O9PA 1M53A 4JFVA 5A8QA 5GPRA 4PRWA 2WLZA 5LA1A 1JXKA 1CXLA 1EOMA 5IHSA 1C93A 3VKKA 2QPSA 1KXQA 3ZJ6A 3CZKA 1VIWA 1JYVA 3WUGA 1WZMA 3OBAA 3ARPA 2VX7A 3PTMA 1UR1A 4UOQA 1C92A 1AMYA 1CTNA 1KBBA 2VCBA 3AMCA 4A3YA 3KZSA 2J7CA 4W8LA 3GBDA 4PMRA 1O7AA 2X0HA 4BQ4A 3L4YA 3WY1A 1V02E 2Y8VA 1E71M 1E3ZA 1TA3B 4FLSA 1UKQA 2WKLA 2XIIA 5AYIA 4TX8A 1PBGA 5IDIA 1BQCA 4P8XA 3U5YA 3PZUA 3NSXA 4F66A 4D6CA 1KCLA 5HBFA 1W1YA 3WKZA 1MVYA 1UD4A 4TUFA 1K9EA 1J12A 2XWEA 1V03A 1EQPA 3MSDA 4KH2A 1IZKA 4MNKA 5ABEA 1E3XA 5GQBA 3GBEA 3MO4A 3RM8A 2JIWA 5DFAA 4PTXA 4AW7A 1C3FA 2BFGA 3CHEA 1R85A 3VIHA 2GFTA 2F2HA 4DWSB 2DSVA 2E9MA 4QAWA 2BY0A 1EOKA 1C7SA 3ARXA 2EJ1A 3UETA 3W38A 1E6PA 1WDRA 4FLQA 2VCCA 1W9DM 1WO2A 1E6ZA 3AROA 4LYQA 8A3HA 3IJ9A 4UFJA 2J8GA 4HOZA 1Q6DA 1VRXA 1HP4A 1EH9A 1ISXA 3A4XA 4M82A 4YHGA 3WENA 3IANA 1CLVA 2WCGA 2J7GA 4OKDA 4UQAA 3A4AA 2O9OA 3AS1A 1JNEA 2DT1A 2VVNA 2X8RA 1WDPA 3ARTA 3VMOA 2WAGA 1V6XA 1MW3A 5JBFA 2UY4A 1R7AA 4AXNA 1JDDA 4KMQA 1ITXA 2ZX9A 3CIVA 5CXPA 1OT2A 3CUHA 3RPMA 4PMYA 4PSRA 3VIGA 1UKTA 3AYSA 4PCTA 3I3EA 1K9DA 3WFZA 2W92A 1BVZA 5CPSA 5A8MA 3POCA 1PZ3A 2WCAA 2A3AA 3QGVA 4FMVA 1R7OA 4V28A 1JZ5A 4OUEA 2D24A 2WPGA 4Z2KA 4P7OA 3AZTA 2VNCA 2RGMA 3CUJA 2OSXA 3BH4A 3OZOA 4CVUA 2Z1SA 3OLIA 2CEQA 1E72M 2WVVB 3S6TA 3VIOA 1VJSA 4H8UA 4PCSA 4P8WA 4HA3A 1JXJA 4XUYA 5JBEA 4FLRA 3WD0A 3EDJA 1VJZA 2WMIB 4F79A 3MMDA 1BHGA 1QW8A 3W53A 1UD8A 2CPUA 1FH9A 3T0BA 3AIVA 5FCZA 3TTQA 2X09A 4W5ZA 3DYMA 1CECA 1XGZA 2E40A 1EO7A 4U5IA 4TX6A 4QCFA 3SCPA 3OB8A 3ZSSA 1D7FA 4PTWA 2ZX6A 3UR8A 1UWUA 1OD0A 1GQIA 1UH4A 2TAAA 4AD0A 1IZJA 4DUVA 5BCAA 3M07A 4GPNA 8CGTA 2ZUTA 3DYOA 5A3HA 1FP9A 3GNPA 5CSUA 1NWRA 4PUEA 5E6ZA 5CQ1A 3RDKA 3SCQA 3VM5A 4U2ZA 1UD5A 3K8LA 1NOFA 1DWHM 2JEQA 3HJEA 2MANA 1MYRA 4OZOA 1W3KA 4UTFA 1N82A 5A6AA 3DYPA 4AZHA 4UFKA 4MAZA 3MV01 1GVYA 4S3KA 4W84A 1JI1A 2O92A 3ARVA 4ACYA 2W62A 1HL9A 3AXXA 2NW0A 1VB9A 3VDBA 3OIHA 1VFUA 3NSMA 4NZCA 4XB3A 4AY1A 1V3MA 4WKAA 3TA9A 5A69A 2FH6A 2DT3A 2JIEA 3W27A 5CPQA 1NOWA 4NSBA 2DIJA 1JYWA 5A95A 5CG0A 2PF0A 1OM0A 1DTUA 1XD0A 1ISVA 3EDKA 5I23A 3FAWA 3VIMA 4RL3A 3WQ4A 1ZL1A 2FHFA 2UY2A 4B9YA 1DWAM 1JYXA 5M17A 3NUKA 3BAXA 2WWDA 1TVNA 5EMYA 4ZEPA 1I75A 5AC5A 5IFPA 1OINA 4J27A 1KWGA 1O6IA 1UR8A 1JGIA 3UG5A 5CSYA 3PBGA 1PAMA 3ZSTA 1WCGA 2X0YA 1TCMA 5DMYA 1WAWA 4MJ4A 5CGMA 1GOWA 4XV0A 3KWXA 1C8QA 2CXGA 3VINA 1F4HA 4AD3A 3WBAA 4W89A 3BAWA 4F9DA 2XM1A 1UH2A 1I1XA 1CENA 2DDXA 4M24A 4ZE4A 2WKGA 3N1AA 5D9MA 2A3CA 4BQ3A 1RP8A 1WDSA 1QHPA 1H09A 3AHYA 1KR0A 5AYBA 2GSJA 3MMUA 2V38A 2XHYA 2YLAA 1KGXA 4JFUA 2JF7A 3OGVA 1PIFA 2DPEA 4IPLA 3MS8A 3GYCA 3A4WA 3AIWA 1W9UA 3EBVA 3WUBA 5D9NA 4UFLA 5E0FA 4D1IA 2OLHA 1J0HA 2BXZA 1OB0A 3F4VA 1R87A 4L4OA 4PYSA 5ABGA 1B0IA 4C7DA 3EDEA 1QHZA 4RE3A 1B9ZA 4U5KA 3VU2A 4F9JA 1W1PA 5HXMA 4GZJA 2VRKA 1ZJAA 4BQ2A 1AVAA 4TVUA 1FFQA 2C8NA 5CLTA 1JZ3A 2XM2A 5KZ6A 4AZ7A 4AZCB 2JE8A 2ZUNA 3ZO9A 3GXIA 3ZQ9A 4CVWA 2VI0A 3PZGA 5DEZA 2WC4A 4LX4A 2YOCA 1HJXA 1BTCA 1E6XM 4TTGA 5GNYA 2GK1A 1J11A 3CUFA 3LPGA 3ZT7A 2BS9A 2J4GA 4ZXLA 1B3ZA 2BVYA 2X2YA 4PN2A 1AQ0A 1UZ4A 1YHTA 1K6AA 2ZUSA 1JZ6A 3APGA 1J0JA 2WMKA 2ZUVA 2BHYA 3WQWA 5E6YA 4LPCA 4R27A 3VDCA 1CBGA 4OBRA 1JI2A 4B15A 1PX4A 3K8KA 2G4FA 5LA2A 5BXTA 3ALGA 1X1NA 1V3JA 2XIBA 2XVPA 1M04A 2QF8A 1SMDA 3UERA 1HP5A 3WH5A 2ZXAA 3II1A 5A6KA 4GI6A 3PZQA 5JBDA 1A47A 1UR4A 3WD1A 4JL1A 4Q7NA 4OOUA 4J28A 4E8CA 3AICA 2ZXBA 1GW1A 1KGUA 2E3ZA 1HN1A 4JKLA 3TONA 2CBUA 1E0XA 1GNXA 2ZWYA 4HZ7A 1UOKA 4TVDA 1W2VA 1HVXA 4PMOA 4WK9A 2WC3A 3ECQA 1R8LA 1WZKA 5EFDA 1HJWA 1FH7A 4D6IA 2JEPA 2XWDA 2PWEA 1ZBVA 2J79A 3PZ9A 3SIMA 1BLIA 3VGBA 3WNLA 4GO8A 1UA3A 5IXEA 1JFHA 1E15A 4ZFMA 3VD4A 4J3SA 1XSJA 3BMVA 2GJPA 4CN1A 4PBGA 2VZVA 3UR7A 1CXIA 3NSNA 2PWDA 3AS2A 1RH9A 2EQDA 3K4AA 1MQQA 4B3LA 1W9BM 4CD7A 4HZ6A 3TP4A 4HU0A 3WD3A 1C91A 4U33A 1ZS2A 4KRUA 1V3HA 1CGXA 3ZT5A 2XVGA 1NP0A 3WFLA 1V6WA 5I77A 1TG7A 2YA2A 1VFMA 4XZWA 3N9KA 1TUXA 1UZ1A 4WJXA 2UY3A 1W3HA 2X05A 2IUZA 3WDHA 3WUEA 4JKKA 2A3BA 4CU6A 2YIHA 3CZ8A 3KL3A 4CD5A 2D2OA 4AZ6A 1PJ9A 2J47A 1E0VA 2XVKA 2PBGA 4DWSC 2J25A 2WMHA 4Z2IA 4URIA 5BWFA 1WB0A 2XTKA 3W24A 4AZGA 1GHRA 1E6QM 5BXSA 3UESA 3T2PA 3W82A 1WPCA 4H04A 4HP5A 2VMFA 4W8BA 7A3HA 1E1FA 2G3JA 1GJWA 3MSGA 1E4NA 5CJ5A 1VEPA 4HMDA 2WM0A 2WK2A 1E5NA 3WNMA 1H0GA 3CH9A 2XVNA 3T0DA 4CD6A 1E73M 1EIBA 1UD3A 2ESCA 3SCNA 5D9OA 1SYTA 1US2A 3N04A 3TTSA 4MAVA 4W86A 4WSKA 4UQCA 4CGTA 1DWFM 5I78A 4M1RA 3SCVA 4B3KA 4AC1X 1QI2A 2J74A 2JFEX 3G6LA 2DEPA 1OCQA 1QNQA 4GZEA 3CHDA 4MPKA 3RO8A 3B9EA 1H3GA 4JIEA 3RM9A 2D1ZA 4NF7A 4UNIA 2WSKA 5I0DA 5A6MA 4Z2GA 4MDOA 1FP8A 2CITA 4YHEA 4DUWA 4R5EA 3QOMA 2ZIDA 1PZ2A 2YL6A 1BVNP 4P7NA 2J75A 4UQDA 5E09A 1HKIA 4D6GA 3QHOA 4J3XA 2QMJA 3FHQA 1W2PA 5CPTA 3LPPA 5A6LA 5D8ZA 2VX5A 3VMNA 1VBUA 3AIQA 5BRQA 4JCLA 1E4MM 1B3XA 2F8QA 3VX0A 1MW1A 2XFRA 4LGXA 1ZBCA 3CMGA 2GJXB 4U3AA 3VD5A 4DM1A 3G6MA 3N17A 4W88A 4WSJA 3VIPA 5BXPA 1CLXA 4HA4A 1HT6A 2QPUA 3WELA 1B1YA 2YA1A 1UHVA 3SUWA 1IV8A 2W61A 1GOQA 4MNJA 2WVTA 1H11A 1BYBA 1EHNA 2VVSA 4JHZA 5DT7A 2YLLA 4Q22A 1Q4NX 4AWEA 1XSIA 2B31A 1EDQA 3NDZA 1ISZA
chains in the Genus database with same CATH superfamily
3HU7A 4N42A 4PTNA 1W3JA 4US5A 2DWGA 3AI0A 1AL8A 3GC5A 3MMWA 3QBUA 3UU3A 5FL0A 4HOWA 3L2LA 3UFYA 3UG3A 4HPHA 4IFRA 2BZNA 2HXTA 3LHUA 3ARRA 1O5KA 3Q45A 2PTWA 3FOKA 2WU5A 5C7VA 1OX4A 1JZ4A 3W81A 4UF0B 3ANWB 4Q4RA 3RLHA 3D5HA 1J01A 1UC4A 3JW7A 3ZWSA 1AJ2A 4GC4A 3H2AA 3F57A 4PMQA 3RHGA 1HTJF 3AS3A 2CLEA 2X0SA 1HKJA 2Y85A 1H4PA 4DF1A 4HK5A 3PZOA 2WWUA 4G2DA 5ABFA 4IPIA 5FJPA 1XYMA 4YTMA 5CZTA 2PD5A 2WZEA 1DXIA 2A3HA 5FF0A 1V3LA 1REQA 2ZC1A 4ZL1A 3CNYA 2CKRA 2X2GA 3CT7A 2W0GA 4MWAA 3WCZA 1KFLA 4ATLA 1W5QA 5LJNA 2E1DA 4DR3T 1G6CA 4HBKA 3AE4A 1P6CA 2PBOA 3S8HA 2VDIA 2VEMA 5JUVA 3FHAA 5B80A 3AB3B 4EV6A 5EA9A 5HXRA 2FJDA 4OX9T 3VUPA 1ZHCA 1EJUC 4GG9A 2DJXA 3B9DA 1UP3A 3IJ7A 4AKLA 4IP7A 5A6JA 2Z27A 2DZTA 1UZDA 1KXVA 3CO4A 1Q85A 3SY8A 3NNTA 5E9AA 1OCJA 1VHNA 3X1DA 1KM1A 1S3HA 4Q4PA 2WM1A 2CCRA 4A8RA 2V5LA 1W32A 4GY1A 3GH4A 2XTLA 3D47A 4LF8T 3G1XA 1JIBA 3THDA 3R13A 4S3CA 3MVTA 5BU6A 4NXNT 3PJXA 3P7IA 3FZHB 1M7PA 3GIPA 4DZIA 1XP3A 2NVAA 1QBBA 4HPGA 2YZRA 3AXHA 3UWUA 4JTHA 1OEDC 1TE6A 5L47A 5REQA 5AY7A 2R91A 4CI1B 2ZM0A 3PTKA 4LUJA 3OZYA 4PUKA 2LRKA 2E09A 4J1OA 4P5UA 2OYLA 1KLYA 3HMJG 1IEXA 2BY2A 4WOZA 2DNXA 5EK2A 3EOSA 2WZHA 1K6WA 1QK2A 4PTDA 1V79A 2X1IA 1R2TA 3FJLA 1DWGM 1XUZA 1MXGA 1ECEA 3GHTA 3UYCA 1V0MA 1F07A 2E67A 2CESA 4IL4A 1WNOA 3WNPA 5A6SA 2ISFA 4FLOA 5DBUA 2KT9A 4JLEA 2G41A 3Q5XA 3BLPX 2VZOA 3NOEA 4N02A 2V6AA 1PUDA 4PMUA 1NP2A 3DFSA 5JXQA 1XWYA 3BJTA 4PL1A 2FJBA 1LL4A 4ISTA 3LHVA 3GXNA 4IX2A 4ML9A 3VZXA 4YTTA 4TVCA 4TU1A 4LS0A 1A0DA 1E5JA 1Q6GA 4J5NA 1UH3A 4LJ3A 1GPFA 2V7MA 2V30A 4XUGA 2V81A 2WHMA 2XIQA 3F4WA 5FF2A 1HTIA 4GK0E 3PANA 3KVJA 1XV8A 4JICA 3SUVA 5HWJA 1WXZA 3ZVHB 3DUGA 4ZQRA 5F2GA 2XFWA 2CNCA 2JKEA 5JREA 1LVKA 3L4WA 1KRCC 5HNNA 4XD3A 1HL2A 2CWYA 3TCSA 4KWOA 1NF0A 1KGWA 4UC5A 4KI0F 2Z25A 4ICMA 3KDSE 1D0ZA 3NIYA 2YDRA 3B0PA 4GCXA 2YDSA 1AFSA 2P3EA 3LK2B 3I9YA 4PK5A 3F03K 3L0KA 1E1CB 4GD0A 3ZCJA 2IDOB 4PL2A 4M8UA 1ZKEA 3IVSA 4TZ4C 4KGLA 2W0UA 2WNZA 1OJXA 1EJXC 2E9XD 4CU7A 4TIMA 2WDRA 4JFSA 4KEZA 3NPVA 1CI1A 2DV0A 4IMFA 4AMCA 2V1DB 4PMZA 3RGTA 3KX6A 3PN8A 1NIUA 1PE1A 3ZYKA 2VURA 3LCFA 1CXEA 4RZ4A 5C71A 2XH0A 4JEUB 3NZRA 1IZNB 3BLKA 1UWTA 4DR5T 2P53A 2ZICA 2G50A 3FVMA 2CHNA 1WDQA 3VIKA 1Y5XA 3TYCA 1E56A 4H9UA 1JZ8A 3OYXA 1XHGA 4EANA 3VD3A 4ERAA 2ZUUA 2FHCA 1I9CB 1Q6LA 1YPIA 3PPHA 1SFJA 1VCTA 1UR9A 1XLFA 3UUXB 1G0CA 5CAKA 2VWSA 3EWDA 1E4LA 3SAZA 1RBAA 4LYKA 3BC9A 1CXFA 2VENA 3ZMRA 1H7XA 3L7RA 5HEUA 3WQ6A 3N4FA 4WLCA 1DEDA 3DX5A 2E6YA 4H8VA 4QH4A 1WRDA 7ODCA 1FHDA 4MG4A 2FZBA 3VRAA 1UR2A 5I2UA 3KBMA 1GVSA 2WW5A 3NKZA 1JZ2A 5JMUA 3M5VA 4J35A 2EPMX 2KNDA 1QO2A 2CERA 3L2IA 3P0WA 4YT0A 3UVAA 2BV9A 4XD5A 4WJEA 1TX2A 4WJ8A 2VGBA 3OBEA 1VCVA 1R9XA 4KQNA 4CNTA 2DQXA 4FIRA 3RMEA 4KBXA 4IHJE 1T5AA 3RIFA 5D30A 3CQKA 2PGEA 1A4MA 1RQEA 1Q6RA 1H2JA 3OA5A 1LZOA 3ZMVB 3J7Yq 1W8SA 3QMTA 4XSLA 2E5VA 3PU8A 3OG3A 2ZX7A 2WJFA 9XIMA 5DCEA 3CYVA 3THUA 3I3BA 1QPQA 2C0SA 1AODA 4IE4A 4AY8A 2IPWA 3ANVA 4AKRB 1OIMA 1SO6A 3U5UA 3BPWA 4MB5A 1HNXT 1P6WA 1CHUA 4H6KA 1YNYA 5I5RA 2QKFA 1DKWA 4Y9OA 3NQBA 1W8GA 3H4WA 1RJRA 1XGEA 2GUYA 3DN5A 4ICCX 4M7SA 4L6OA 1OZMA 2Q3RA 4GQQA 3GXTA 3ITXA 1TZ7A 4GLEA 1JEZA 3CUZA 3U3HA 1BYDA 1R5YA 1NU5A 2C7FA 4LYPA 2CLIA 2C0HA 1CXHA 3LXCA 5FD0A 3PJTA 4AXPA 4AISA 3BCFA 3UU8A 3H2NA 2I16A 3HQOA 2EHHA 2YL9A 2BGQA 4HNNA 3NRYA 4UV8B 4X60A 3M4HA 3EABA 2HSAA 3MB9A 2DU2A 1VQTA 3WH6A 3M0IA 1SSDA 1V6YA 5FF3A 1OG0A 1JF5A 2WCSA 3PJAJ 1PIGA 4W85A 4MLRA 4DUXA 4XD4A 3M47A 5D04C 4XO7A 2OQHA 3AZRA 3ZLFA 1Q5MA 1LROA 4A35A 4WZXA 2ZE0A 4TO8A 1F8IA 4UR9A 4PUDA 1LYXA 4QFUA 2YINA 2QGHA 2ZOXA 1PXGA 3QR0A 1O94A 3KL0A 4QCEA 3W01A 5C9ZA 4EYYR 1LOSA 4YFSA 3WNKA 3SQLA 5FY0A 1AK5A 4NJIA 1WV2A 2V3FA 1J5TA 3NL5A 4RDWA 3ZLGA 4PFOA 1R9YA 4ADSA 2W9MA 3W37A 3W85A 4K8EA 4CQ8A 3EWYA 1POJA 3DFOA 4B3MT 5EMLA 3WDRA 4H7CA 4J3UA 4S2BA 1K8CA 5LYJE 4LUSB 1UMYA 4V1YA 6REQA 4I9AA 1FCQA 4IIFA 3SUTA 2CWXA 2CCQA 5EU9A 1P48A 2XSAA 2GVEA 4UFMA 2RDTA 1PVNA 5L3BB 1EX1A 2TYSA 1DE5A 3NQVA 2X66A 2ZADA 3O9XA 2CETA 2A3DA 2UXCT 3R0UA 3TKLB 3MKVA 3R7MA 1W5NA 2ZTJA 3A6OA 3ES8A 3H22A 4ZO8A 4AWUA 4S38A 4TX9A 3TFXA 3ZJ8A 1U5HA 4FO4A 4HEAA 5D2TA 1E6NA 1G67A 3RR4A 2WMFA 5J04A 3LCHA 4OHFA 1FEWA 4H6QA 1XR2A 4Y9PA 3NDYA 3AJXA 3FK4A 4L9IA 4BS0A 1X6NA 2XFFA 1V77A 4Q4QA 2DUAA 4KFOA 2XJ7A 3AIEA 3BCDA 2LSGA 4MLKA 1XQLA 1KXHA 5HWMA 2DVXA 3VGFA 4C6PA 4JI6T 4P8VA 1XWMA 2HVMA 2GK9A 2EPHA 2AGTA 1CGWA 2MAWA 3RF1A 5BXRA 5HEGA 2YU2A 4UTMA 4HFHA 2JALA 3ZC0A 3MU7A 1QNRA 3ZJKA 5KZEA 3ZMZB 5DO8A 3NQDA 4W4QA 3WFAA 3PZIA 3NM1A 4LMJA 3R4IA 4IE6A 1B2YA 5EFFA 1OC7A 1AD1A 1JQVA 3WQVA 1AZ2A 4QRNA 1YBQA 2WJEA 4B5NA 3TXZA 1OEDA 5FJUA 5BZAA 1HFBA 4QS5A 4JQ1A 2MPKA 3L21A 4PR4A 4JFTA 4AZCA 1A3WA 3UBPC 3A64A 1W5OA 4K1WA 3P4PA 1EC7A 1QOXA 1XMOT 1H7RA 1KC7A 3MP4A 5AVNA 3WUFA 2NT1A 2AAMA 1LL7A 5F7UA 1FTXA 2V8ZA 4IQEA 3WK2A 4Q32A 3V0SA 7XIMA 1XH1A 1W3LA 1DHKA 1JD9A 3UZZA 1I2NA 4QE1A 4OWGA 1BGGA 5MHBA 3WDJA 2YW4A 5LKYA 3QYQA 1LUCA 1PX3A 4E2OA 3DKLA 4X62T 5G2HA 3LEPA 5LNWA 3OHIA 1I94T 1J0ZA 2QRXA 1Q7ZA 1LRQA 1EXPA 2YL8A 3M5XA 3QR1A 4GJJA 4HT3A 2GVYA 3GAKA 2G0WA 1R3WA 2NVDA 1J6PA 4A97A 2G5WA 1I4NA 4QLJA 3TYEA 3V5FA 5JIPA 1JJKA 3E2VA 3I4EA 3RR1A 3W29A 4AYGA 1JCNA 2WB5A 4DO5A 1PTAA 4K0KT 5E0CA 2C0AA 2YK0A 5A1AA 3NA8A 4S1FA 4N6FA 1YDVA 3H54A 1NH6A 2VZSA 1HG3A 4HMCA 1XIBA 2AMXA 2Y7EA 2AQWA 3HN3A 1E9LA 1OX4B 1TPC1 2QV5A 1F73A 3EX4A 2NQHA 3MSYA 3TOYA 2D0GA 4PMNA 1XDOA 3LUTA 3QLDA 5U7SA 2YBTA 3CAVA 2BVTA 3ABXA 3DC0A 4ZQCA 3N11A 2DFAA 3QKZA 1JDEA 3BJFA 4NI3A 1Q66A 3VR9A 1KA9F 2B81A 4UCFA 5EL1A 1CXKA 1VFTA 2E28A 5ABFB 3R6IA 2CBVA 3HTWA 1AJ0A 1VLWA 1I0DA 1ZHAA 2MYSA 4UQ9A 3GH5A 2Z1KA 3G0XA 2IQTA 1TO3A 1ME7A 4L9XA 4POCA 3UUBA 4AIOA 5HNTA 4NQ1A 1KM2A 4MWAB 1W1VA 3ALFA 5HMEA 1B3VA 4PODA 3JZUA 4M81A 5I00A 1KRBC 1F9CA 3SGUA 4X9SA 5A5WA 2LSIA 1SU5A 2EXOA 2W67A 3C2RA 4L4PA 1KBIA 1RY0A 2DH3A 3V5CA 3SCRA 2MBGA 1QHOA 3T09A 1EO5A 4KWSA 1DWIM 4Y9AA 3USBA 3UCCA 1HS7A 4PUJA 1XCXA 4BA9A 4F0SA 4AHOA 4KHPT 1ZAHA 3CB3A 3EGJA 3WMCA 1K8YA 4ILSA 3T8LA 1P0NA 2D0HA 2IW0A 3KVAA 4ASKA 3SZ8A 2ZA3A 1IIHA 5HCMA 1SSGA 1GGOA 4UOJA 2FYMA 3STPA 4JI1T 2JQKA 3VABA 4GOUA 1OWQA 5GONE 1BR2A 4OJYA 2WY2A 1S2WA 3PUZF 4XSMA 5EBUA 1HJSA 2D2JA 3QOKA 3UJRA 4ZHQE 1SR0A 4YS1A 4JEJA 3CC1A 4MVAA 4GHRA 1DVJA 3EMQA 2VD9A 3QFWA 3BG5A 4M6PA 4DB7A 3B57A 3F31A 5REQB 4AQFA 3P5YA 3WBYA 3IV3A 1IGSA 5JIWA 1Z32X 1UWIA 3PBUA 1UURA 5LP6E 3W1TA 2CW6A 1FH8A 5JR9C 2E8YA 2NT0A 2VEFA 5CCZA 1G9HA 3R2GA 4QEEA 2WNQA 1VHCA 1QLBA 1JZ7A 4L1XA 3D0CA 4DEFA 1L2QA 1G73A 4KEMA 5C8BB 2QLYA 1NWUA 4C65A 2XZ7A 3T9PA 4UXDA 2I59A 3GM8A 2PEVA 3ABZA 3VIJA 2DH2A 3HL6A 3S0CA 4WBOA 3S2NA 2PDIA 4I7VA 3ZR4A 3OHMB 3AE3A 5JTGA 3NPUA 4LQ1A 3O6AA 3KL5A 3IUHA 4G63A 4LW7A 3DJBA 1IAPA 1IJ6A 4H9PC 2P50A 1KBKA 2Q8ZA 1BTMA 4S3DA 1FWGC 4GUIA 1A5CA 5I3FA 2XVLA 2JKAA 3EPNA 2J7FA 3RMJA 1OSEA 1IEQA 4WR3A 1T40A 1QI5A 4YVXA 3O1IA 3PZMA 3VNZA 4JXCA 3SFDA 2J62A 4J4KA 4A29A 4DMVA 1K3UA 2JQXA 3VDGA 5HNUA 3NQ6A 1FWFC 1RP9A 3PY2A 1F7BA 3EDDA 4C6LA 4PFPA 1OFOA 3LB0A 1TVLA 5JDGA 3MANA 1HX0A 4A5XA 5AFDA 2BG9E 3CVRA 3F5KA 1JUBA 3DBPA 2I14A 3AVSA 1E70M 3LXBA 3W6MA 1IEIA 2XFYA 1VFFA 3ITGA 4H8NA 1V4YA 5CPMA 2Q8XA 3Q4DA 4COFA 3MUZ1 2X9HA 2LHNA 1OC5A 4I6KA 4HVXA 2CLYC 4TOQA 3POHA 5C55A 1EF3A 3AE1A 1XRVA 4AZBA 4DJEC 4GIWA 3N9SA 2XHEB 2VL0A 2K24A 1YX1A 2BXYA 1NJJA 3PAOA 4GYFA 5A8QA 4PRWA 2WLZA 1ADSA 1B5TA 3B97A 3VXGA 2H8XA 1EOMA 2XQ4A 3P50A 1TMHA 1RD5A 3CZKA 4FXRA 3TIMA 1Q45A 2C5KT 1DIOA 1WZMA 2X1TA 4CNPA 2VX7A 2DZWA 4UOQA 4DI8A 3DG7A 2Y62A 3WLRA 4NXMT 4NUWA 3IRSA 3KZSA 1CUNA 1J2BA 1O4UA 3NZGA 3HKBE 1OFRA 3O3RA 4PMRA 1O7AA 2X0HA 1P7TA 3L4YA 3C3UA 1V02E 4B3TT 3WY1A 4WQ6A 1KNRA 1FXPA 5C9WA 4I43B 1E3ZA 3QKEA 4ERRA 1UKQA 3DG6A 1DJZA 4HNOA 3W2JA 5AYIA 2HK0A 3RUBL 4IJCA 4TX8A 1WFDA 4WZHA 4P8XA 3U5YA 3PZUA 4HGAA 4PJMA 3NSXA 2ZM8A 4D6CA 3WKZA 1K9EA 3GNNA 1UW9A 5JRCA 1EQPA 3NXLA 1W0AA 3TYDA 3GBEA 3CV6A 2BVMA 1OCBA 4W9TA 2QCGA 3P6LA 4EWND 3HA1A 3RKOA 3N9QA 2BFGA 1TJPA 3VIHA 2QT3A 4KMCA 3AO0A 4QEHA 4NZ4A 2HZGA 3G1DA 3LBCA 4QAWA 5FEWA 5RUBA 3LGDA 1X9BA 1EOKA 3WQDA 2OEMA 2OX4A 4HCDA 4O1AA 1SR9A 3Q65A 2VCCA 5L3DB 4PUWA 3N2GE 2J8GA 4UTJA 3GHRA 4YHHT 3LQLA 4YHGA 1FMVA 3P74A 3J9X1 3D0TA 2J7GA 2FFCA 5LSMA 4UQAA 3PWGA 2Q6ZA 2VVNA 1JNEA 3I7RA 1WUEA 4M1BA 3W86A 3B8TA 3EVYA 1HQTA 5HEOA 4KMQA 4I5XA 3CIVA 4I5RA 5TNVA 3AYSA 4GZ7A 2BP1A 3UXAA 4HTBA 2P1FA 4PCTA 1K9DA 3MT1A 4X66T 2W92A 3BK0A 4IMCA 5CPSA 5A8MA 5LHFA 4KIRA 3QGVA 4V28A 3QPZA 3NEVA 3I65A 2GWNA 4AFYA 4Z2KA 2ZA1A 3MI3A 4P7OA 2HPJA 4IDZA 1H7WA 1O1ZA 1X98A 3BH4A 3MTWA 3OZOA 1T98A 5BR8T 3AXMA 1LT7A 1IGWA 4C6EA 4GBUA 3VIOA 1LOQA 1TV3A 4F2UA 5AECA 2HS6A 3P80A 4XUYA 1I2QA 2FLIA 1V9DA 1MIYA 3WD0A 3EDJA 1NF7A 5EMMA 3SFKA 4JTAA 3C0JA 3KVKA 3MMDA 5EK3A 4I4TE 4YTPA 3M6YA 2EG6A 4N9DA 4NZJA 3E22E 4CQAA 4IT1A 4A56A 4YJ5A 3LV5A 3WLMA 3T0BA 4AU0A 3TTQA 2X09A 3DYMA 3KV5A 2E40A 1KKRA 1EO7A 4U5IA 4K36A 4HSNA 3S1UA 1GKRA 3UR8A 3ZJ1A 5BMXA 1UH4A 1GQIA 2A79A 3RHWA 1JPIA 5BCAA 4ILBA 3M07A 4JQ3A 1TPWA 1FBAA 5CSUA 4PUEA 5FNVE 3RDKA 3SCQA 4E4UA 3TU9A 2V5JA 3B3DA 1UD5A 1S5NA 1RR2A 2JEQA 2MANA 1MYRA 1GEHA 5K9XA 4UTFA 4B3RT 3CPGA 4GUJA 3DG3A 3P5ZA 3MJMA 3AUOA 2NVCA 1ITUA 4I7WA 3KS6A 3M9YA 4UV9B 3RITA 1TJ2A 3STGA 3KW3A 1QK0A 1XLIA 3AXXA 3GDMA 1VB9A 3LCXA 5HQLA 1SVDA 4WEVX 4XB3A 3LHZA 4AY1A 1M7JA 2OT1A 3UXIA 5F2MA 3TA9A 5A69A 4DVOA 1DBTA 2ACZA 3NOYA 3UWVA 1NOWA 3M1ZA 6REQB 1J8VA 3FDKA 3MO7A 1R3VA 3P0XA 2DLRA 5CG0A 1VRDA 3TFCA 1OM0A 1KW1A 4C6FA 5FY1A 3E38A 4JN6A 1Y5WA 3EDKA 1H1ZA 1X96A 3FAWA 3WQ4A 4YSYA 5I3IA 1QT1A 4LS2A 2JGYA 3CX8B 4UMBA 5EMYA 1I75A 1O6IA 3LFMA 4JNMA 3W3OA 3W7DA 4UTTC 2RDUA 3TZNA 3HG2A 2K3WA 1DL3A 3RQWA 3KWXA 4IL2A 3ZFHA 3VINA 1F4HA 3WBAA 4W89A 3UU0A 3LYEA 4IREA 2BKPA 1K8XA 4M24A 3B8DA 2IPGA 3DIPA 3V0TA 4ADTA 4BQ3A 3Q94A 1H09A 3AHYA 4M1PA 4L56A 2GSJA 4G7FA 4QSHA 5DCDA 1F3TA 4L64A 4AY7A 1YDYA 2GOKA 2NQLA 1EJVC 4LAMA 4DO6A 2Z2UA 1W17A 4CLMA 3EX2A 4H9VA 1O1HA 4GJIA 3GYCA 2Y5SA 3MKCA 1G4EA 2CZ5A 3QPYA 2PDPA 1R38A 1L0VA 5G4EA 4MFRA 1R47A 3BARA 4LCRA 1TSIA 3WUBA 2C1GA 4CCZA 4F2TA 1CW2A 2OLHA 1OWAA 4PBEA 1OB0A 1W56A 2O7SA 1D8WA 1R87A 2XAFB 4L4OA 1QHZA 4U5KA 4I9TA 1YBQB 2WJZA 4F9JA 3O1JA 2R24A 1W1PA 4E8GA 1OEDB 4GZJA 2VRKA 2W6RA 4BQ2A 4PUUA 4J2CA 3ERPA 3MQTA 2W79A 4AH7A 3KBTA 5KTLA 3HJZA 1M1BA 3EWBX 3W7MA 3N29A 5AQKB 5AQLB 3BUVA 4AZCB 7TIMA 3LV6A 2ZUNA 3ZO9A 3GXIA 5JR9A 2PC4A 3C98B 4O4HE 4ZSUA 1IBMT 1QU4A 2WC4A 3WAJA 3C8NA 3UJEA 3CYJA 4RDVA 4DR1T 2GK1A 3ZT7A 3RPUA 1J11A 3CUFA 4NAEB 2DVTA 4ZXLA 5GJMA 3C2YA 2I5IA 1R30A 1B3ZA 3QZ6A 1AQ0A 3BTNA 3C61A 1K6AA 4NASA 3ZYZA 1X1ZA 4DYEA 3U6WA 3WQWA 3O0KA 3O1HA 3B4UA 4WGHA 3VDCA 1CBGA 3S46A 2XDFA 4IPPA 2NR4A 3K8KA 2X1SA 4JTDA 3ALGA 1X1NA 2XIBA 4C6IA 1YMYA 1HP5A 1LRNA 2ZXAA 5A6KA 1E0TA 3AE6A 4O2AE 1KGUA 1HN1A 3LM3A 1N8IA 4D9PA 2WPBA 2IIUA 8RUCA 3FXEB 2V68A 1GTHA 1UOKA 3TQKA 2QQ6A 2LM9A 3NURA 1HJWA 3AAEB 2E6AA 2XWDA 2PDYA 5CEWA 2CXEA 4TWHA 3WNLA 3RYCE 4J3SA 1IEWA 4KEUA 6ENLA 2PWDA 3DHFA 1TWDA 4HZ6A 3AEGA 1KNWA 3TP4A 2Q02A 1C91A 3EOEA 2B0MA 3VFLA 2AL2A 3EA1A 3HF3A 8TIMA 1CGXA 3G22A 4UTHA 3GNXA 1ML1A 5M4YA 1TUXA 3BVJA 7ENLA 4WJXA 3PJWA 4GNJA 5BOEA 3IV8A 5CKSA 3HPFA 4CD5A 1EJRC 1F3WA 3MW7A 4K37A 2PDHA 2Z1BA 3TN4A 1EZ3A 2XVKA 2PBGA 1H62A 4LSBA 3BQ6A 5LZLA 4YTQA 3T1HT 1O66A 1GKPA 2WZTA 1WB0A 2XTKA 5CGQA 3A5XA 4AZGA 1GHRA 2BBFA 3UESA 3T2PA 3W82A 1QW7A 2O7QA 5IBXC 2IC9A 2VMFA 4C6QA 2G3JA 5DXXA 3H7RA 3KWSA 4HMDA 1E5NA 3WNMA 2ACUA 1VPYA 3CH9A 2GGGA 4RXGA 2OOFA 5IRPA 5DCBA 3LGEA 1WR6A 2VFHA 2V7KA 1UD3A 2ESCA 1K1DA 3BLIA 4O0QA 5D9OA 2NSOA 2CZDA 4A2RA 2DP3A 1A5OC 2BZBA 5JDQA 4W86A 4H4IA 2PTXA 4JEHB 5I78A 2YN6A 1VFLA 2D5UA 2R14A 2X67A 4J40A 4X2PA 4B3KA 3B8VA 5HEJA 1QI2A 2J74A 3B8IA 3CASA 4DF0A 4YVPA 4GZEA 3CHDA 3L68A 3RM9A 4NF7A 1WCRA 1ZV4X 3CWHA 3L5AA 1QOPA 4DUWA 5HEHA 4KEVA 3GS6A 2RDWA 5CB4E 3QOMA 4FAMA 5J0ZA 2X1RA 4GKJT 3H26A 1OXZA 4Q8PA 4O0ZA 7REQA 4P7NA 4MLJA 2J75A 4UQDA 1TWZA 1L6FA 4XIAA 1RK5A 3BGGA 2ZRUA 3FHQA 3DAQA 4OQVA 5A6LA 4Q8TA 1DORA 5B7ZA 5I3JA 1Q4WA 1EPXA 1VBUA 3AIQA 1L6WA 5BRQA 4JCLA 1E4MM 5LHEA 4WYVA 2VC7A 4CNSA 2V6YA 1D3HA 1UIPA 3NPXA 2JKPA 5D05A 5AHNA 3IVTA 4C6KA 3N17A 3H37A 4HA4A 1HT6A 2QPUA 4ZMGA 4ILUA 4WW0A 3PUEA 4M0XA 2WV8A 2CA5A 3OTRA 4UVAB 4F4RA 3KCLA 1TJ0A 4LBRA 2WVTA 1H11A 5K2ZA 3QV9A 1QTWA 5AZ0A 2VVSA 3TR2A 4JHZA 4EXTA 2PWVA 2YLLA 3S83A 3WLQA 1KV5A 1N34T 4JBWF 4AWEA 2EKCA 5LHHB 5EZYE 1XBYA 4GIYA 3MPGA 2X30A 3TWAA 1KCKA 1UJPA 2DGAA 4QG9A 1S2CA 5HPCA 1XFCA 5D2XA 2GGJA 3TMQA 3VKHA 1SFSA 3B9AA 2VYOA 3G2GA 1O60A 4NILA 3A3WA 4DR6T 5HDRA 1WXYA 2HPIA 5FXXA 2OU4A 3MCOA 2HPLA 1J0IA 3NL2A 3HI2A 3KRUA 1VH7A 1GOKA 4H83A 3WH8A 1TJRA 1KEYA 4DV4T 3K3QC 1ITCA 5F3JA 5C2XA 4HMNA 3VOFA 4HE8A 3FYPA 1G94A 4MB1A 4J3WA 4O4WA 1FUYA 4NJHA 3JR2A 4JTTA 1A5LC 4QJ4B 4EAYA 2E8ZA 2OSYA 3ANYA 2PU1A 1Z7AA 1VCFA 4LMLA 2Y5JA 4AIBA 5HCJA 1AQHA 4JS3A 2HRWA 3AWOA 2ABAA 1UA7A 2O9RA 3KV9A 2QVNA 1ZQ5A 4HZ8A 4HNUA 2E0PA 1KQYA 2LLYA 1L8PA 1PKNA 3RYHE 3CV2A 4YJ3E 3I4KA 3RRCA 2PDMA 2OFJA 4OYJA 3TYZA 3H12A 2XGIA 3AMKA 3EKZA 1M9HA 5AHFA 4BKNA 4JTKA 1D1AA 1P7TB 5LXXA 3P62A 2IAKA 3DGBA 2YB1A 5HATA 4JFWA 3CUIA 1MNEA 2GZXA 2A4AA 3KM8A 4LEQA 1EP2A 4R7OA 5AFUL 4ADUA 1PWMA 4FX7A 1DOSA 1YXYA 2V63A 4H9ZA 1AQMA 1EEXA 3C4ZA 1HJVA 2GGEA 4JI0T 1BWVA 1K03A 2POTA 4TXEA 1NQKA 1XDPA 4AEFA 4NVTA 5ABHA 3SN4A 4OBTA 3ZIZA 4ZI2C 3R0DA 5JRCB 5IFTA 3HKCE 4DZAA 4IXXA 1TV8A 1M62A 5A8GA 3FJ6A 1WE5A 2J7DA 4MGGA 1J6OA 5CA1E 3K46A 2AE9A 3E2SA 3KDNA 4E3TA 1JL8A 4BI5A 3O16A 1E43A 4MWAD 1W54A 1DJYA 5LXTE 2EPOA 4D6JA 5G1TA 4IE5A 3B13A 1DJGA 5E70A 3C64A 4LYRA 1G5AA 3ZCIA 1LWJA 5DBTA 2VOMA 3RYSA 2F61A 3LA4A 3WMSA 2ZUWA 2E7FA 4UQEA 4PEKA 4QLKA 5FL1A 4C1KA 1CGUA 2VT0A 3URQA 3IEEA 2QUMA 1L6YA 2YBUA 2OEKA 1Z44A 3C86A 4MFEA 4M29A 5AQJB 1IXQA 3A47A 3W7LA 3AMLA 1OC6A 1ZJIA 4R85A 2QUUA 3BOFA 3S1GA 2GJRA 4F8HA 3TN5A 3FSTA 3KRZA 5KINA 4NRRA 4H9SE 2H7VC 4GXMA 3GWHA 1CGYA 4KGJA 2DVUA 4NZ5A 4DXXA 4OK0A 2Z2AA 3SIZA 3E74A 4O57A 3WH9A 3NZQA 1G7UA 5AKQA 4DR2T 3L0GA 1EZWA 3WEOA 4OT7A 1NDYA 1VYPX 4BI6A 2OOGA 4GGBA 2J77A 3W84A 4RLIA 3H2FA 4WY0B 1NM9A 4MM1A 1TPH1 5F4SA 2F84A 6TAAA 1IJ5A 1QCWA 2XGBA 3F2DA 3BDKA 4D6FA 2DQWA 4XTIA 1EGZA 4GYPC 2XISA 2D0TA 4UFHA 1N8FA 1OADA 2VEKA 3G5EA 4QXBB 5J8LA 2A3LA 3MI2A 4R88A 3EWWA 3RKGA 5BWAA 4EXAA 4XG1A 4XBFB 4CCDA 2D3LA 1WR0A 2V5DA 3LSCA 1GVIA 3DHDA 1IWBA 3RIUC 1EX5A 1EYEA 4P1NA 2CXFA 4I90A 4YVVA 2N1GA 4QG8A 3K4DA 2E68A 1NFBA 1RSCA 2VUYA 2LKHA 3TK7A 4LWWA 4F6RC 4Q4KA 1MMAA 3EB4A 1LG1A 4HCLA 4ATWA 4GMEA 3AUJA 4MY9A 2BXVA 1Z6KA 3MCMA 3K2GA 4B5WA 2NWBA 4JIRA 3FW6A 4KFNA 1KFEA 3EAMA 1X6LA 4FOJA 2ISVA 1X6UA 2WC7A 4DBEA 1RQHA 1RA5A 1NDVA 3NGFA 4E6MA 4E7SA 2KSRA 2R6GF 2XQ8A 3ITVA 4BHYA 3NGJA 4Q8OA 1S2TA 2PCQA 4EE9A 1YXCA 2PDGA 3T4WA 4B91A 3OPSA 4TTUA 4GNKB 1UKSA 4GK8A 4LU0A 4D72A 4AEEA 1FVPA 4UTWC 3PF3A 5L4HA 1K9TA 9XIAA 3QSRA 3T44A 2Y61A 2V7IA 3AXIA 3CGTA 3K3OA 4N4PA 4X9YA 4ZTYA 1Y64B 4CNNA 2DIKA 3TSMA 3R6NA 3C0QA 3W70A 3ONJA 4GIAA 5TBOA 2J7EA 2GQ3A 4AIUA 3W88A 3C2EA 1KV8A 1P5BA 4XVEA 3QH2A 1EJWC 4CD4A 3N6QA 2XPKA 1B90A 3UTKA 1YQ2A 4ZZ9A 2PGRA 3BXWA 1YNQA 1TR9A 4JI5T 1WKYA 4GI9A 3VZYA 5A8NA 4XZHA 1XICA 3AHZA 4AAJA 1VYSX 3V0UA 2J8TA 5A8PA 4CQ9A 1Y0EA 4QITA 3SCSA 3YPIA 4OGZA 3A22A 5A6BD 3SEPA 1FWSA 2HN2A 2VKDA 4U31A 1O3XA 4WHBA 3NFUA 2X9YA 3AYRA 4K38A 5IBXA 5I03A 4AWSA 2R8WA 4H7VA 1VLIA 4H41A 3UW6A 1TWSA 2LOPA 4UCGA 3KTCA 4I5UA 3GLCA 3LDQB 1LM1A 2XH4A 2IUBA 4J7RA 2OX1A 1VJIA 4NYUA 2C18A 5F1UA 2Q9QA 3NWRA 2CKSA 3OYZA 4E0CA 3RN6A 1A5BA 1TWIA 4MF4A 3P84A 3NVTA 3L4UA 4BCEA 3IHRA 3IUIA 3WG6A 1VEOA 3TLSA 3JUGA 3W74A 1R46A 1A49A 3E2QA 3P4WA 3I0OA 1JGMA 1V8EA 3RGLA 3EEZA 1TFVA 1X97A 4YHJA 3T2QA 1RY8A 3ARZA 4WCJA 5CJMA 3P8IA 3S4UA 3WL1A 1PHQA 3TJXA 1YW0A 1BYCA 2QCNA 4IDOA 1PKYA 3PBWA 4YCPA 2EPNA 2Z1WA 1SW7A 4IOTA 4RK8A 1TIMA 2CHOA 4JHOA 2P8BA 2A6LA 1JNRA 5JR9B 1ELSA 3BQKA 3WQ5A 1C8XA 3ARWA 4S39A 4WSHA 2GK1B 2YBVA 1YDNA 4KWVA 4B2DA 3B0UX 4P7QA 4V1Av 2ISSA 2C91A 4WF7A 3JC6C 3G77A 3R25A 3CQIA 3V5SA 4YXGA 2C1HA 2YCLA 4HWFA 2Z24A 4GKLA 1T8QA 1VPXA 2HMCA 5FXVA 1KRMA 2R1MA 3E9AA 3EZ4A 1LQAA 3R79A 5A1LA 4UR7A 1ONWA 1NDWA 1ZGDA 2B7OA 2DZPA 3PVFA 4O18A 3WBEA 4AQGA 4QLLA 1XLCA 1X7FA 3W2LA 1SMAA 3FDGA 1Y7VA 3RM4A 3R8HA 2P10A 3S47A 4WD0A 4AQYT 3N9MA 4P0BA 1HKVA 2OA5A 1CNVA 3OVQA 3W1UA 1NWSA 3A24A 1HW6A 2WDQA 1J9YA 2JQ9A 3S2LA 4QBXA 1UQYA 4D8LA 4DJDD 1XYBA 3VGGA 3THCA 2FVMA 2WBLA 1GK8A 2YW3A 4NKCA 2A3EA 1RK6A 2CPTA 4PC8A 1JRBA 4EF8A 3UA4A 2CLYB 1EC8A 2FJKA 5AVHA 3WH7A 1LBMA 3N9NA 2PWGA 5AQIB 2PDQA 3VD7A 4X2RA 2Y7GA 1LP6A 3LZ5A 2AL2B 4GX8A 3TJLA 1JCMP 1DWJM 2YA0A 3WJWA 3FA5A 3C2OA 5H6HA 2BS4A 4PCPA 3UU5A 2BHUA 4BK9A 3W15B 2W66A 3EMCA 4NNCA 3GA8A 3LSBA 4HKAA 3JAFA 3GR8A 2ZZ5A 1UKOA 1HJQA 4RNIA 4FSAA 1GOXA 2BKOA 2WS3A 4QWNB 2ZCGA 4CUCA 5JDHA 1VP5A 1Y5VA 3PHAA 1U83A 3H2OA 4LUYA 1H7NA 1FQ0A 4CNOA 1EQCA 1D0YA 3L3PA 1XW8A 5A8OA 1GZGA 2NX9A 4L1WA 3AA1B 4BF7A 3CZJA 4BI7A 3RX3A 4V2XA 4P8UA 4F2BA 3UG4A 4UOZA 1XX1A 3O07A 3H6OA 4HNLA 1WKDA 3L5MA 4LVBA 4J3TA 3IIVA 1JCXA 2XAHB 4KESA 1B4KA 1OT1A 4LBSA 2FUPA 2DSWA 1MW2A 3CT2A 4DBDA 3E96A 3N15A 2X16A 4I9JA 4EPDC 3QY8A 1ZUAX 4AD5A 2XIOA 1V3IA 1QNPA 2F2KA 2QCDB 2PF8A 5AC6A 4AKIA 3UPWA 4CCEA 4NP7A 1IWAA 1KWKA 2P88A 3CWOX 4LS1A 5T9CE 4PTVA 1ECQA 1E51A 4M7TA 4H9QC 3O6YX 5HXSA 3TA6A 2X68A 3FZFB 1RBLA 2GUBA 4LOCA 4JL2A 1NSJA 1HGYA 4MWAE 1JDCA 1BFNA 7REQB 1SA0E 4GUGA 1GYLA 1H1NA 3H7UA 4JTRA 4RZ6A 5FJOA 3LBXB 1MFVA 5D8WA 3U57A 2PDCA 3B03A 1KLZA 3DHPA 1EBHA 3DHUA 1JG9A 4R33A 2XU2A 2EG8A 2B7PA 3E3HA 3CV1A 3U2ZA 1KNZA 1J4EA 3APYA 1GG1A 5AYZA 3MKDA 1MQPA 4UMCA 1LKXA 1GOIA 4G7EA 1BG9A 4C7GA 4N2YA 2V6YB 1HL8A 3VGHA 2Z7GA 1MDLA 2UUBT 1F4AA 2QUVA 3V16A 3LNMA 2NV1A 1K9FA 4FR1A 3GW3A 2UV8G 1MXDA 2EO7A 4IZGA 5FEXA 1PSCA 5HMFA 3VNYA 2V2DA 3FXYA 3KHJA 2PMQA 3HG5A 3FBZA 2VGFA 3HV8A 2G3IA 5AQQB 5BMVE 1VIZA 1SO3A 4PSPA 4W5UA 2VC5A 4MY8A 1JCJA 1UQZA 4KCVA 1J5WA 4X65T 1WDWA 3NO1A 4DNHA 2G8ZA 3LHWA 2RDXA 3SGZA 3NYDA 5BROA 1MMDA 2PC8A 4FZIA 4NRSA 2V9DA 4TQTA 2E9XA 2QCLA 3GFYA 1IQ8A 4O52A 1XZYA 2Y0FA 2QEZA 5T8GA 4HFBA 3GMIA 3ZKRA 1X39A 1DXFA 2VFIA 3CLWA 3PBVA 1CB2A 1BWLA 4IISA 5DMNA 4DQWA 3OOQA 4ZOBA 3CEPA 2JQQA 4ZOEA 5FSDC 1WUFA 2IS7A 3GDKA 3ZYMA 2BVLA 1X79A 2J13A 2NX3A 3PUOA 4XX6A 3HMCA 3PG9A 1ZJBA 2EEXA 3SR7A 4J3VA 5FY7A 3CWZB 3GC4A 2PWHA 3RQUA 4WXYA 4D1JA 5FIPA 4ENLA 3TKFA 1MUCA 4BR1A 3JVAA 3S5ZA 2GVLA 3R5EA 4FA3A 2Y8UA 1VKFA 4R9OA 4Z2HA 2DCFA 3PB2A 1UBSA 2LLEA 3HO8A 2A9UA 4HSHA 2QDGA 4OOZA 3SW6A 3EX1A 2Y63A 4AHQA 2QGYA 4DNMA 4GA8A 1UCUA 3SWHA 1VCGA 1L6GA 1V6UA 1NVMA 3IJQA 4RCXA 5HUPA 4G1KA 3W4RA 2Y8KA 1XYCA 2AMGA 3N9RA 2YDQA 4YY3T 1FWDC 5HAXA 3ZOAA 3UZWA 5AQMB 3IIOA 1R3SA 2IQ0A 1RA0A 2UZ9A 2VEPA 4JOMA 1I1WA 4EIVA 5C0QA 2WNNA 4IM4A 2HV5A 3WF4A 4P09A 1XH2A 1V08A 4BQ5A 5HQEA 1KRAC 2W91A 2WJDA 4MYXA 1FWNA 1QVBA 1PKLA 2J9ZA 3A12A 3ARUA 3RPDA 9RUBA 4P61A 5FJJA 1ME8A 5A2AA 2QCEA 3HGSA 3RNDA 2HS8A 4REQA 2BWGA 1B3OA 1E0WA 3AE2A 3VX1A 1GQEA 1VFHA 3TMLA 4QHOA 1XNRT 2ABBA 3AIBA 2PODA 3TYBA 1JNZA 1C7TA 3U48A 8XIAA 1GT8A 2V7LA 4QAIA 4DV5T 4C5ZA 1N55A 3N12A 1JAKA 5FSEC 2NQ5A 5HPOA 1A5MC 3JRKA 3BAJA 5AHMA 5D37A 4Z1CA 3SUSA 1IBKT 4PGLA 1LBLA 2RPAA 3LU2A 1XMQT 2WM9A 1S38A 1J1JA 1V0KA 1JCYA 1UROA 4XBSA 3O9NA 4O13A 1XPGA 4Z17A 2HK1A 4ZB2A 3BQLA 1MQRA 3ABSA 3RILA 2V67A 3UYIA 1Y01A 5AQFB 2D2HA 3O15A 1GCYA 2YSWA 2D0UA 4ZO6A 4O17A 1B3WA 3WX7A 4XZLX 3M0LA 4PTMA 2WMNA 1FWAC 3W71A 1XYFA 4H8HA 1OGGA 1XIIA 3PV0F 1F8MA 1WX0A 5GVJA 4GBDA 3SJ3A 3T08A 5ADXL 1H5VA 4YMZA 3G8RA 2OLAA 2QULA 4LH8A 3BZGA 1EP1A 3O06A 3VIIA 4LALA 3GW0A 1GQNA 3GIQA 2B7QA 3CZGA 3W83A 3FN9A 4KHZF 2WHLA 1BVWA 4LF7T 2QCHA 1V51A 1NEYA 4C6JA 2WLYA 4KT2A 1AH0A 3FNDA 4AB4A 1K8ZA 5FMNA 1BSIA 5DY3A 3E5BA 4OVXA 3FX4A 4FF5A 4FOUA 4NG3A 1KR1A 4J9JA 4PA8A 3DFNA 1YTEA 2VGIA 3DC8A 1VS1A 2YL5A 2AOSA 1ADOA 1SO4A 3ZT6A 3MI6A 1LT8A 5C9UA 1B54A 4Q6JA 3RLUA 2DT2A 3HFYA 5CSRA 1W9XA 4KCTA 5KX5E 1EEPA 2IMLA 4HFIA 1XJBA 1UKPA 2CIPA 3IGUA 4MHBA 1BRLB 1Z8UA 2OWWA 2VDHA 4R3UA 3GR4A 3K8MA 3UXDA 1UX4A 3OLDA 1Q13A 7CGTA 2O0TA 3LD5A 1DHPA 1M53A 3ORWA 3QZAA 1TKKA 2YX0A 1JXKA 3VKKA 3DZ1A 2X41A 2HVOA 3WJSA 3N73A 1KXQA 4QQ3A 2XAQB 1VIWA 3T0TA 3R12A 2F6XA 1I2RA 4N9BA 1BWKA 3OBAA 4ZOCA 4KFPA 4ES4A 4XIMA 3IA3A 1AMYA 3PFRA 2VCBA 4GC3A 2J7CA 3OTOT 2WZMA 3GBDA 4KETA 1SFTA 3UY7A 4FNTA 3R1ZA 3PR2A 1AH3A 3UNDA 4IGUA 4UIOA 1YTDA 3UR2A 2XIIA 4UMAA 4YXDA 2J66A 2QJIA 5IDIA 3TAKA 1BQCA 4FF7A 1PWLA 4F66A 1Z0PA 1KCLA 3SOLA 1W1YA 2IC6A 2PGFA 3E5PA 1UD4A 1N33T 1VOMA 5AOUA 1EP3A 1SZFA 1SZNA 4KH2A 5ABEA 2RAGA 3RM8A 2JIWA 4MJMA 1XLKA 1Z9AA 3I6EA 2DZXA 1ZEEA 1R85A 4EOUA 1TPDA 3QQ0A 2F2HA 2EGZA 4DY1A 4ZTXA 2E9MA 2BY0A 2PCEA 3VKJA 2PURA 2EJ1A 4C1NA 3QC0A 5C9RA 2MOZA 5H8PA 2L9QA 3GDRA 5FVLA 1WDRA 5F4XA 5KMGP 5K7JA 2PFHA 2CFFA 1WO2A 3AROA 3H4XA 3OODA 4L5ZA 4LYQA 8A3HA 3IJ9A 2MTQA 1Q6DA 1VRXA 2BODX 1HP4A 1KFCA 2KWHA 3FS2A 4F3HA 3WENA 2WCGA 4GNVA 3MUCA 4OKDA 3E0ZA 5LIUX 1Q2RA 4JN7A 2FKPA 5JDMA 2PD9A 1DYSA 3ARTA 5CFBA 2Q9QB 4HZMA 1MNZA 1R7AA 4AXNA 2POZA 3E2RA 1ITXA 3AEEA 1EBGA 3QF0A 3ZMUB 3RPMA 4PSRA 1UUMA 4PULA 3BOLA 3REQA 1EGVA 4HYVA 2H9AA 3WFZA 4PUMA 4WUIA 2PDNA 2WCAA 1R7OA 1JZ5A 2Z2BA 3NBXX 3THAA 3ICJA 2NUWA 2WPGA 5HJYA 4EX4A 2RGMA 2V5KA 2FJEA 4JNYA 3BSMA 4AI6A 2Z1SA 1DJQA 3N3TA 3EDUA 1VJSA 3M16A 4P8WA 1JXJA 1W3IA 2HE8A 5IM51 4ZA0A 1U5PA 3NL6A 4Z08A 3TYAA 4R9XA 3GTXA 3W7PA 5IYZE 3C0SA 5B7YA 1QNVA 3TQVA 2CPUA 2QJJA 3T4CA 3AIVA 5FCZA 3IF8B 1ZENA 4W5ZA 1CECA 4JDYA 2YCLB 4TX6A 2Z6EA 2PA6A 1X7IA 4QCFA 1YEYA 1AQFA 1D1BA 2ZX6A 5BOFA 3QY6A 4JTCA 2TAAA 4I9MA 3H21A 4AD0A 3CH0A 1F3XA 3ITCA 2OB3A 1MXSA 8CGTA 5F5WA 3DYOA 2ZUTA 1Q6QA 1NWRA 1XLBA 5DABA 5E6ZA 3PUYF 2ODOA 3WJXA 3SRHA 4U2ZA 3GE7A 3QV6A 1IWPA 1W3KA 3LCIA 3GD6A 3HZ3A 1F6KA 5HQMA 1ONRA 1OEDE 1W1IE 4NJKA 2JMKA 1GVYA 4S3KA 4ACYA 3BL3A 3M0HA 2NW0A 3OIHA 3VOGA 5EK4A 2X7VA 2SPCA 3PUWF 1V3MA 2JMHA 3T42A 1XLMA 3W1XA 3W27A 4RJEA 1F74A 3TSDA 4NSBA 1SFLA 4FX6M 1JYWA 3VAVA 1EF2A 1UASA 2PF0A 3W7QA 4ASTA 2ZKMX 1XD0A 5F1VA 2QJHA 1ISVA 3VCRA 1B4EA 2XUEA 2J27A 4K8HA 5I23A 3UGRA 2ZRVA 3VIMA 3M0KA 3OA3A 3AEFA 4YTNA 1XINA 1ZL1A 2UY2A 4B9YA 5K3VA 1GKQA 1XRTA 1QOQA 2TMDA 5M17A 2WWDA 3GVQA 4ZEPA 4TMCA 3S3GA 2XN1A 4OFCA 5DQPA 1JGIA 4QH5A 3B40A 3PBGA 4C6OA 1FWJC 2HBXA 1S1PA 3OP2A 1GOWA 2J24A 3A23A 4GKKT 4OV4A 2L5HA 4DV0T 3K3NA 1GEQA 3BW4A 3RLFF 5CZSA 2G3FA 4F9DA 1NAL1 2EHOD 1ZFJA 2Z29A 4ADZA 2DDXA 4ZE4A 3HPZA 5D9MA 2A3CA 1WDSA 5I09A 4BWLA 1KR0A 4LFAT 5AYBA 1TMLA 4GABA 3NM3A 1FWCC 3TVAA 3OO2A 5L6UA 4UEMA 2JF7A 1LRTA 3OGVA 3CMLA 3TNBA 2DPEA 3F1QA 4IPLA 2ADAA 3R8RA 1PDZA 5E1QA 4Z8XA 4HYWA 4GY7A 3AIWA 2PLKA 3W22A 5BRBA 4H3DA 4LUTA 3EBVA 1AW2A 4UBPC 4HU4A 5E0FA 4JTQA 5FJIA 3B9OA 3UJ2A 1VZWA 1FY6A 1FWTA 4WBNE 2BXZA 4R53A 4I6VA 4JR5A 4H9YA 5ABGA 3STCA 1BXNA 2Y6XA 1KM5A 4MKNA 1YW1A 5AC7A 4RE3A 4ZVJA 1B9ZA 3VU2A 4DZ5A 3LZ3A 2V7JA 3WBWA 3UWZA 3V5UA 3U2OA 1ZJAA 1HFAA 1QATA 4MIMA 1JZ3A 4Q4SA 4CNUA 1H7CA 3GG0A 2JE8A 3JCFA 3KV6A 2H7OA 4GVGA 4HNTA 3HG4A 1RJPA 2VEIA 4CVWA 3PZGA 5DEZA 5T91A 3B04A 2VB6A 3KV4A 1E6XM 3DFYA 5GNYA 3T81A 3QMSA 4AWTA 2BOFX 3S1XA 2BS9A 1S3TC 3VC6A 4PN2A 4H00A 1K4HA 4Q8QA 1YHTA 2ZUSA 1J0JA 5TAOA 1XDJA 2BHYA 3N34A 5E6YA 4R27A 3KFTA 5D33A 2NTXA 4ZODA 5I3HA 2G4FA 5BXTA 3I6TA 1IE7C 4JEQA 2CLMA 2DZVA 2NUXA 2NW7A 4EACA 4M6UA 2UUCT 1MZHA 4QTGA 2Q71A 1DJXA 3MA9A 1FDYA 3PZQA 1CCWB 4FX8A 5JBDA 1A47A 3WD1A 4Q7NA 4E8CA 2XGZA 4M6QA 4FALA 3TONA 2CBUA 2M6IA 3T0CA 2C19A 1S2VA 4HZ7A 3G1HA 4TVDA 1W2VA 2WC3A 1R8LA 3W2MA 2XQ9A 5EFDA 2ON3A 4GUFA 3HV9A 3V7PA 5FESA 1FH7A 4D6IA 2JEPA 1ZBVA 2J79A 4X5TA 1NELA 1BLIA 3L0NA 3GZ3A 6XIAA 3CL6A 2M6BA 1UA3A 3LRLA 2E9XB 2BKNA 1JFHA 1E15A 3SN0A 3BMVA 4ONVA 4IIEA 2Z7KA 2VZVA 2CWNA 4ZI3D 2EQDA 4AQFC 2YKSA 3K1SA 3K4AA 4A3RA 2VWTA 1W9BM 2ZQ0A 3KTSA 4CD7A 4HU0A 3N2CA 4GQGA 3ZN1B 1W37A 5IDZA 3NTYA 1KBJA 1TG7A 3ZPOA 1VFMA 1GVOA 5K9DA 1C8VA 1UZ1A 2UY3A 2IUZA 4JKKA 3N2OA 4CU6A 1XUUA 1S5VA 3CZ8A 3GTHA 2FBWA 3EPOA 2ZZ7A 1PJ9A 1OX6A 3UFEA 1UC5A 1P1XA 3KS5A 3UQNA 4I7UA 2J88A 4RV3A 3K5XA 4DWSC 4R7WA 4RR4A 3VUSA 3I0QA 4QXCB 1AW1A 5C6MA 5F4WA 2QPXA 1XBZA 3M41A 2JRKA 4Q4OA 2X40A 5KSWA 2A0NA 3C2VA 4TUYE 4J2PA 3ETVA 2WSRA 4O8AA 3A4JA 7A3HA 1K7FA 3E08A 2IMRA 2VGGA 2LKGA 1E4NA 1A0CA 2WM0A 1RCXB 3BG9A 4QX4A 4M19A 3RAOA 3OVPA 1NEKA 5FA5A 2OZ3A 1QUMA 3WQPA 2XVNA 4KBMB 4PFHA 3KDOA 3LOTA 4GISA 5LIXX 4EXBA 3LM7A 3SCNA 4ZSTA 2OEJA 4Z91A 4LAUA 2VP8A 2RKXA 2DZUA 3IGSA 2RHGA 3FJ4A 4A8IA 4RNHA 4DJED 4IMAA 5HMSA 2ZRWA 2K48A 1DWFM 4M1RA 3SCVA 3AA7B 3UULA 3PSVA 3G6LA 2DEPA 2WO5A 1QNQA 2QAPA 1JRCA 4REQB 3H8AA 4MPKA 4O4VA 4JIEA 3BV7A 2PDUA 2XASB 5G5IA 3DI1A 3D46A 4Z2GA 3UT5E 5DY2A 2CITA 1F2JA 4YHEA 3QPEA 4NT0A 2ZIDA 2FVLA 1PZ2A 3GU2A 4ILCA 2YL6A 2YB4A 1ZP0A 2KZHA 1WQ5A 1HKIA 3QHOA 2REQB 4J3XA 3PBYA 3T7VA 1TZZA 5CPTA 3IGXA 3V5OA 1B57A 4LVGA 1Q2SA 1KFBA 3NQ2A 2OR2A 3EI0A 4JI4T 1P6BA 1XLDA 1W6TA 2OZ8A 2F8QA 1R2RA 4Q8VA 4A8LA 1OY0A 4LAZA 3VD5A 3IJDA 1QFEA 3B05A 3E12A 1IR1A 2FQIA 4HWDA 4WSJA 4DN1A 1CLXA 4XBKA 4ZOLE 3WELA 2FFIA 1BKHA 2V82A 1KM4A 3S4TA 3SUWA 1S2UA 4JX6A 4C6NA 2M67A 3PUVF 5J1GA 3QTGA 4RUBA 1M5WA 2PDKA 1EHNA 2NWRA 4ECLA 1XM3A 4UVCB 3PURA 1YRRA 4Q22A 1SW3A 4RNJA 1E9YB 5GJNA 3KBUA 3MYPA 1XSIA 4I8DA 2PGWA 3NG3A 2RA1A 2YXOA 4XBJA 1ISZA 3LRMA 1GHSA 2I7GA 3VKDA 3AEAA 2WHKA 2QCCA 3WJZA 2DL1A 3ES7A 4DBSA 4TV8E 2QJGA 1YPXA 3OU8A 3BLFA 2XIJA 3UWEA 1Q8AA 4DR4T 1U2YA 1FX6A 3T1GA 1YQ3A 1E4IA 3N18A 1VR6A 1KCZA 3RCNA 3V1PA 2PBIA 2JBMA 1FJGT 4OECA 1FMWA 1ESWA 1PTGA 4LVFA 3MUY1 4W7WA 3TTEA 3ZVHA 1VFOA 4KPLA 4GQRA 3GNOA 1TRDA 3VGDA 4HQVA 4Z0JA 4EAMA 4XAGA 5HOSA 1WZLA 1E7PA 3GHUA 4U3CA 3NQ7A 3QJAA 5K4XA 4CCCA 1XYLA 1MMFA 3AU2A 3AAAB 4FXJA 4FI5A 4E8DA 3CM4A 3NQFA 5JVLA 2PAJA 3IK2A 1XKJA 1H51A 1K77A 1BGAA 2VQET 2G4JA 4FEZA 4LF2A 3ITYA 4DI9A 4F40A 3C0LA 3AFBA 2P9BA 4MNLA 4S3BA 4DLMA 1A5NC 5A2BA 3KOFA 1CEOA 3PTRB 5DELA 3M64A 2V2CA 4GI4A 4AZIA 3GVWA 1CGTA 4BFAA 5LGZA 2HCVA 1ZPTA 2CLOA 3FA3A 1YNPA 1D3GA 1A80A 4CQCA 3CAKA 1RPKA 2EBNA 3BWWA 3RJYA 4PMDA 3CZEA 2FB2A 1SJBA 5T26A 2CLLA 2PDWA 3AMDA 3OGSA 2AQOA 4D6EA 1GVRA 3MXZA 3GXPA 3AA0B 2G95A 3ONBA 3BGAA 3V1HA 4AC7C 1GVFA 3WQGA 5DQWA 3UU4A 5C54A 1QSDA 4QG6A 4QROA 2CLFA 2BLEA 1WOBA 3LK3B 4K2SA 1GJPA 4NIRA 1XXXA 3DESA 1S35A 1SHZC 2FZNA 4CXWA 1M01A 1W91A 5L4EA 3QLLA 2FJUB 2ASHA 2XG9A 1BPLB 3MY9A 4C1NB 1OQFA 4IPJA 4JTSA 3CUGA 4H9OC 5CBBA 4UQBA 1AA1B 3QV8A 1OFAA 4X22A 2OELA 2HJPA 3V75A 2QUNA 1EA0A 2DW7A 3M43A 2W5FA 2W63A 4HFCA 3WNNA 1MFUA 1SPQA 4AX6A 3W00A 2VX4A 2IW5B 2DW6A 3RPTA 3SGGA 3GZAA 3VIFA 4O50A 4MHCA 2NX1A 4IPNB 3WIJA 5LOVE 1O12A 1ISYA 2YDAA 3O05A 4IG2A 4IIHA 2E4TA 2BOGX 1H50A 1ZCCA 3REQB 3W7CA 5JDFA 3GYEA 3HURA 2H9AB 1ZTVA 3QR3A 3G06A 1GYMA 2WSQA 4CZZB 4JHMA 4DO7A 5TF0A 3AISA 3W2KA 2I9UA 5AN7A 1HVQA 2QMKA 5DQVA 1KM0A 1OD8A 3EWZA 2K5BB 3GVGA 5LGTB 1DP0A 2WQPA 2HE5A 2YXGA 3PNUA 4MB3A 3H24A 2ACXA 1I2OA 2QHAA 3WF2A 3LTYA 2F7FA 3NQCA 4C6MA 4ML4A 4LXFA 4O1CA 4K39A 4CQBA 3AU6A 1E1HB 3LLFA 2KX9A 1REQB 3N6JA 1GORA 5BU9A 3E02A 1S5MA 3SRDA 3J7HA 4WXZA 3M3ZB 2GYIA 5JQ9A 4KKXA 3BMWA 3W7NA 4X63A 3KZPA 1J18A 2VKHA 3W0KA 2PWFA 1GJUA 2UXDT 1SM9A 2D73A 4OTKA 1MEIA 4H2CA 2VXNA 1MRQA 4XAXB 3GC2A 4UWMA 3NQEA 2YXXA 4MY1A 1OCNA 2J7BA 2QGSA 2OWXA 2FZ9A 4N78D 5EBAA 4O11A 2KWIB 4XTDA 3F5JA 3WLJA 4IFKA 3HGOA 2YGYA 1QMLA 3CBWA 2ISDA 1IF2A 4HN4A 1PZ1A 4DBQA 4L65A 3VOJA 5AHIA 1C29A 1GZJA 3NL3A 2IKGA 4LCSA 2ISWA 4QR6A 4YWSA 3CHFA 4RZ5A 4BA0A 1ZLPA 4DWDA 2VL4A 3KRBA 3NQGA 4L61A 3WN6A 4IGSA 4GZIA 4HK7A 3QNUA 4LAKA 4HPXA 4FNUA 1RJQA 2JF6A 2PS2A 1ZZMA 2FHBA 2ZTKA 3G18A 3CTTA 4AZ5A 1TV5A 4GE8A 1TA3A 3NCOA 2GOUA 2O55A 1CZ1A 4IGNA 3LJCA 4IMDA 1SJDA 4NUVA 1CGVA 2PG8A 5CPOA 2FGBA 4WX2A 5AHLA