2W62A

Saccharomyces cerevisiae gas2p in complex with laminaripentaose
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
461
structure length
436
Chain Sequence
SFEKTPAIKIVGNKFFDSESGEQFFIKGIAYQLQRSGAFETSYIDALADPKICLRDIPFLKMLGVNTLRVYAIDPTKSHDICMEALSAEGMYVLLDLSEPDISINRENPSWDVHIFERYKSVIDAMSSFPNLLGYFAGNEVTNDHTNTFASPFVKAAIRDAKEYISHSNHRKIPVGYSTNDDAMTRDNLARYFVCGDVKADFYGINMYEWCGYSTYGTSGYRERTKEFEGYPIPVFFSEFGCNLVRPRPFTEVSALYGNKMSSVWSGGLAYMYFEEENEYGVVKINDNDGVDILPDFKNLKKEFAKADPKGITEEEYLTESVECPHIAVGVWEANEKLPETPDRSKCACLDEILPCEIVPFGKYEEYFSYLCSKVDCSDILANGKTGEYGEFSDCSVEQKLSLQLSKLYCKIGANDRHCPLNDKNVYFNLESLQPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Mechanisms of Yeast Cell Wall Glucan Remodeling.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords GLYCOLIPID-ANCHORED SURFACE PROTEIN 2
total genus 162
structure length 436
sequence length 461
ec nomenclature ec 2.4.1.-:
pdb deposition date 2008-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03198 Glyco_hydro_72 Glucanosyltransferase
A PF07983 X8 X8 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1040 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2w62A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2w62A01
3GXDA 5BXPA 3F4VA 1PZ2A 4ZEPA 2E9MA 4W7WA 5BRQA 3MKKA 4NSBA 2X05A 2GDUA 4LGXA 1JFXA 1HIZA 1UA7A 2J25A 3W0KA 2XUCA 4UTFA 1BVNP 4DM2A 3OB8A 3F5JA 1XHGA 2WM0A 3NSNA 2EO7A 2QLYA 4JFUA 4YHEA 3W29A 4PBGA 3BMVA 5A95A 4ZXOA 4M24A 2G3JA 1BYCA 2XGIA 5CGMA 4LXFA 1IT0A 1AMYA 1WO2A 4Z2IA 2G3IA 3NJ3A 3BAJA 1GHSA 1JYXA 3CUGA 1JDAA 1NQ6A 4AWEA 1V3MA 2JEQA 3WH9A 1SFSA 2XG9A 2A3AA 3EDEA 3VMPA 3RDKA 1PEZA 1TG7A 1XRVA 1PPIA 2VVNA 4AY1A 5FKYA 3WF0A 1ITXA 1QW8A 1UD8A 2WC4A 2XWEA 4D6IA 5DT7A 3T09A 4KH2A 1CPUA 4XX6A 3VGEA 3OA5A 2D20A 1BG4A 3ARVA 2PWFA 3ZT7A 1W3KA 1TVNA 5EFFA 4DUWA 1VFFA 4CCDA 2WWCA 2CCRA 2YDQA 3L4UA 4HOXA 1SMAA 3T2PA 2Y2WA 4UCFA 5JBDA 4RE2A 1J0KA 1MW2A 2YL5A 4TVDA 3DC0A 1GOMA 3VTRA 3AI0A 4AD3A 4J3XA 3RM4A 1KXVA 4E4PA 1RH9A 4RL3A 3AS3A 5A8QA 3VIGA 2YDRA 1OB0A 1KCKA 1NWTA 7TAAA 3SCQA 2FH6A 3FNDA 3MUAA 4N0RA 1UQYA 2E4TA 4AC1X 2X0HA 4HP5A 2RGMA 1VAHA 1KXHA 1O7AA 1E0WA 1JZ2A 3SIMA 4EANA 2E0PA 4AZCA 4FLQA 3CZLA 2CETA 5EFDA 2WVUA 3E1F1 1SR0A 5E70A 2OYMA 4F8XA 5DEZA 4PTMA 4CN6A 2J7EA 2C8NA 5A6MA 3ZOAA 1N82A 4Z2HA 5C8BB 2PWEA 3B9DA 1J0YA 8A3HA 1QHZA 2UY4A 4JCMA 2OYLA 2J79A 2D3LA 1Q4NX 4F79A 2J78A 5CLWA 3WIJA 3F5LA 3VDCA 3BSHA 3VGHA 4D6EA 1V03A 5DFAA 4NRSA 3AZSA 4GZJA 3VUPA 1JDCA 2WMHA 1UR4A 4UNIA 1UWIA 2VCAA 5BWFA 3BAKA 2VX6A 3ZM8A 2IXVA 1KWGA 4HMCA 4MPKA 4OOUA 4CGTA 3M6DA 2X0YA 1XYFA 2QPUA 3AIWA 3CBWA 4QP0A 1EXPA 3NCOA 5D9NA 3SCRA 1B2YA 1HF6A 1V6XA 5HXMA 2CIPA 5IFTA 4W88A 4FF5A 1HKJA 2FHFA 4BQ5A 3TTOA 4WIWA 4UQBA 3N12A 5A6SA 2X8RA 2ZX6A 2DGAA 3WKZA 1GOIA 3WQVA 2G3NA 3EDFA 2J7FA 1CXIA 3WQWA 4MAZA 1C93A 2D1ZA 1LF1A 3PZGA 1E40A 4PTXA 1QHOA 1E0XA 3RCNA 2DT0A 4LYQA 1QI0A 1PX8A 3NIYA 1DEDA 2WCSA 3BAWA 5A8PA 3SCOA 3CZGA 4B16A 3N13A 3WBEA 2XSBA 4A4AA 1B3ZA 3EDKA 4PMOA 4AW7A 5ABHA 2WKGA 4CU8A 1J18A 1Q6CA 1H3GA 2ZX8A 2UY3A 4GI8A 5A6AA 5HOSA 4H8VA 3VIJA 2O9RA 5A2CA 2PF0A 1KXTA 1O6IA 3AIQA 3MANA 3NSXA 3W4RA 3VGFA 5FOOA 1RPKA 5HBFA 1KXQA 1QW9A 4W85A 5A8OA 1WP6A 4PCSA 1UH2A 1B31A 1H41A 3ZQ9A 4H7VA 1G01A 1QOXA 1UA3A 4HZ6A 1JL8A 3TA9A 3U5UA 2ZUNA 3ZSSA 4D6CA 4NI3A 1XC6A 1ZBWA 3SCPA 1VB9A 4WSJA 1WZMA 4OIFA 3AHTA 1BFNA 4JCLA 3ZO9A 4V27A 3N1AA 4QLJA 3TONA 1JZ4A 1M7XA 1R8LA 4GIAA 2F61A 4W89A 3OG2A 3W37A 2GUYA 2BNJA 4XZBA 3BAYA 1VFMA 4ACYA 3NSMA 5AC4A 1J11A 2BHZA 4AIOA 4GINA 1JI2A 4YN5A 1ZJAA 4M56A 1NARA 3EBVA 5FD0A 3GTNA 2CBJA 3VDHA 4D6HA 3GNOA 3LMYA 1K9FA 1VIWA 2W66A 3BH4A 1EDGA 1KCLA 4HTYA 1F4HA 1E6QM 2EPMX 3WF4A 2ZE0A 3SCUA 2PB1A 4QLKA 3OIHA 2ZX5A 2XFRA 3LPOA 1C7TA 3PZTA 2ZUMA 5KEZA 3FXYA 4ZE5A 1JDDA 1XSIA 1TA3B 1KGUA 1JIBA 2YL8A 5ABGA 1GQLA 1OT2A 4CD4A 4PUEA 4ATDA 2GJRA 4RE4A 4KRTA 4C7DA 1VEPA 3KL5A 1V6UA 1B90A 1ECEA 1MW1A 2WZIA 1Q6GA 1J0ZA 1ZS2A 1OIFA 1UG6A 2WB5A 1CNVA 1E73M 4PCTA 3W26A 1EH9A 3A47A 1W1PA 3I3EA 2BY2A 3PHAA 2VR5A 5I0DA 5E09A 3M07A 4IUGA 1QNQA 4CD5A 2WCAA 2NT0A 3CZJA 3RO8A 3ARTA 4M81A 4W8AA 3LPFA 3U57A 2J75A 3WNKA 1UUQA 3SCNA 1CZ1A 2WPGA 2CHNA 4RE3A 3HN3A 3BAIA 1UQZA 4D6GA 3RJXA 3APGA 4U31A 5GNZA 3VPLA 1AQ0A 4H41A 4WJXA 1E6SM 1UZ1A 3L4YA 4OZOA 2WBKA 4FLSA 2CPUA 2OSYA 4UFIA 3ZT5A 1B0IA 2YA1A 1VFUA 1E6NA 3VM7A 2VT0A 2X1IA 3NDYA 1MYRA 3UG4A 1V02E 1C90A 3WDJA 5A6JA 3PBGA 2BY3A 3VD7A 1EA9C 4C7GA 2DIJA 2ZXQA 1B9ZA 1J10A 2XVLA 3OLEA 1K6AA 1MQQA 1SYTA 4JL1A 2RGLA 3WDQA 1E1FA 5CQ1A 1E4LA 1J0HA 2VCCA 2DIEA 3VOCA 2AOSA 4QDMA 4OUEA 4JHOA 1H49A 1UZ4A 5A8MA 3BLKA 3DYMA 3VIFA 5FL0A 4AIEA 3B9AA 1TUXA 3PZMA 1WDSA 5AYBA 2D2OA 2QHAA 4ZENA 2QF8A 3K46A 3D5HA 1A47A 1HVXA 1FHLA 4FLRA 3VILA 4AZBA 4MJ2A 2UWFA 1LG2A 2DQXA 1KBBA 4BQ2A 3PZQA 2J7GA 1M01A 4NF7A 1V6YA 1B3VA 5CPTA 3W81A 2CBVA 2JF6A 1PX3A 3WUFA 3ZJKA 2A3CA 1MWOA 4AEEA 4MTVA 1ISWA 3WBAA 1EOMA 3UCQA 4OOZA 5JUVA 2TAAA 1CGYA 1GNXA 2D0FA 1PAMA 2J74A 2VX5A 4HPHA 1MXDA 2WW5A 4HOWA 5BXTA 4PYSA 4HA3A 2YBUA 1V0LA 4TVCA 4UFKA 1QNPA 3KWXA 4JFTA 2VNCA 4P7OA 2Y8VA 4AZCB 3WFZA 1W9BM 2OWXA 1MW0A 1NWSA 1R86A 4L4PA 4UFMA 2UY2A 2Z1KA 3WN6A 2V5DA 2VMFA 3K1DA 1U2YA 3WMSA 1LG1A 4HMEA 5E6YA 4B15A 1ISZA 1KGWA 1NP2A 2PWHA 1G1YA 1BF2A 1RP8A 4MB4A 1B3YA 1B30A 3EDDA 4PSPA 1W1TA 1D7FA 4W7VA 3VKKA 1BYAA 3MMDA 3N17A 1OBAA 1K9DA 2O9TA 3MUZ1 3AS0A 1HJUA 2D22A 4BCEA 4W93A 2G8ZA 1MFUA 2BY1A 4ZE4A 3LPGA 4W84A 3VINA 1UKSA 1U33A 1NOUA 3PZOA 4U33A 4UQ9A 4LX4A 2J77A 3GYCA 1CGXA 1H5VA 5HNNA 1D3CA 1C92A 2WCGA 4GZEA 1DWAM 2BVTA 2E9BA 2D3NA 1JF5A 3WUBA 3RM8A 5EBAA 2WHKA 3ARYA 2VQUA 3GH5A 1WNOA 4UOJA 4U2YA 1Q6FA 3ZT6A 5A6LA 3VMOA 1FFRA 1DWGM 3WD4A 4B9ZA 3CZKA 4AXNA 2W92A 3VM5A 4MADA 4IISA 1V6WA 1CXEA 1UWUA 4P8XA 5KZ6A 2VZOA 1EO5A 3WF2A 1Y7VA 4QCFA 1R7AA 1EHAA 2ZXBA 5IHSA 1XH1A 3QR3A 2WMJA 4MDOA 3RPMA 4C7FA 4P7QA 4UR9A 4M82A 3RM9A 4D71A 1HJQA 1US2A 3AOFA 4J3SA 4P7RA 1QNRA 1PZ3A 1QI3A 4EKJA 1QI5A 4PMUA 3VIMA 3AHVA 1HJXA 2E40A 1UWRA 1EDQA 1OINA 3PTQA 1QI2A 3MV11 1CGVA 2VCBA 4TTUA 4AYSA 1W9UA 3WQ4A 2C7FA 1V3JA 4PEEA 2YDSA 4P8UA 4D6DA 3GZAA 1QVBA 2XYLA 1HP5A 3PZNA 4MB5A 1EDTA 1FP9A 4PSRA 4HPGA 5GNXA 1H09A 4PTWA 4MJ4A 4WSKA 1GQJA 3CUJA 1XH2A 4CU7A 1E9LA 3RMEA 4WKHA 4HU0A 3WFLA 3WH5A 2VZTA 3A3HA 5CSYA 4W8LA 1M03A 2WYSA 1GOKA 5EB8A 3L4WA 3S2CA 1VBUA 1CENA 1LQ0A 2GJPA 3ZR5A 3VDAA 2WLYA 2A3BA 3UR8A 3WD3A 1UWQA 4CKQA 3GXIA 2WHMA 3QOKA 2WMIB 4ZXLA 1D2KA 3VX1A 3VDBA 3RILA 1WCGA 4J27A 3PZVA 3WD1A 2FHCA 3SEPA 3CIVA 3IAPA 2VRKA 3L2LA 3WNNA 3KZSA 3MUIA 2EPOA 3VX0A 2EPKX 2PWDA 3VIIA 5A1AA 3T2OA 3AICA 1E71M 2CKSA 2XM1A 3FHQA 3AROA 1JZ6A 3IAQA 4PRWA 1C3FA 1MXGA 2V5CA 4ZFMA 4F9JA 3ARPA 3KL3A 1JF6A 5TD4A 4D1JA 2A3EA 4WLCA 4OBRA 2NSXA 2CXGA 1E3ZA 2ZICA 3GDBA 4Z2LA 4YPJA 3M7SA 2V3DA 4URIA 3PZUA 1LWJA 1JXKA 2G3MA 5F7UA 1ISXA 3A6OA 3NYDA 4UZSA 4YHGA 2W91A 2VTFA 2BXYA 4KRUA 1UKTA 3N9KA 2YA0A 3UETA 3AMGA 1W2PA 3WENA 2C0HA 7A3HA 6A3HA 3ALFA 3POCA 1HNYA 4FMVA 3FW6A 4PMYA 4PTVA 1V02A 2EXOA 3ARQA 3WDHA 3MV01 2ZUUA 1DWFM 3WNMA 4TX6A 1E56A 4AEFA 4TVUA 2VZSA 2DDXA 3AHXA 1WPCA 1UHVA 4J3TA 2W62A 3W27A 1DP0A 1C8QA 2YBTA 1BVZA 3GBDA 2XHYA 3EMQA 4EK7A 4E8DA 2O9OA 3ZR6A 2AAAA 1M04A 2X2YA 2YOCA 2D23A 3OZOA 2CHOA 2V3EA 1TCMA 4CVWA 1W2VA 2WBGA 1MW3A 3I3DA 1U30A 4KGJA 3AMCA 4M29A 1L8NA 2ZXDA 2DSVA 2QV4A 5FIPA 1CWYA 1HT6A 2Q8XA 3BSGA 3N11A 5DF0A 1EHNA 3VU2A 5A3HA 3WQ6A 4U2ZA 1DWIM 1VENA 4JKMA 2CEQA 2CITA 1NWRA 2BVDA 1C8YA 5ABFB 2PI6A 1HXJA 3AMDA 3EDJA 2DSKA 1UWTA 1FFQA 1EQCA 1W9PA 1QI4A 2IXUA 2MANA 1MQPA 5CGTA 2JFEX 1XSJA 3W6LA 1US3A 5A69A 2CKRA 3BAXA 4CU6A 3U7BA 3WNPA 1KFWA 9CGTA 3CTTA 3CHFA 5D9MA 2X09A 3BCDA 4QLLA 1B3XA 2E9LA 4UOQA 4GZIA 4B9YA 2YLAA 3MSDA 1VRXA 5FL1A 3AZRA 3UEQA 1UD4A 1BHGA 4GXPA 1J12A 2NW0A 5I23A 1JYVA 5IXEA 1EQPA 2V3FA 2DSWA 5A6KA 1HVQA 1Z32X 1I1XA 1IZJA 4FK9A 1HKKA 4IPLA 4MDPA 1GHRA 3RJYA 3VMNA 2VO5A 5D8WA 3FY1A 1TFVA 1X6LA 1E1EA 2OLHA 5D8ZA 2ZWYA 1BGGA 5GNYA 5LYRA 4N42A 1EOKA 4WKAA 1B3WA 1XD0A 3ZJ7A 2HVMA 4Y7EA 5AY7A 1VFOA 3WMBA 3LPPA 1JAKA 3O2LA 1LLOA 1V0KA 4UQAA 3VIHA 2J8FA 2WC7A 2DT1A 2D0HA 3T0AA 2ZUWA 3HU7A 3S6TA 1GVIA 1E4MM 1CXHA 5A6BA 2F2HA 2YA2A 1FP8A 3AXXA 1JZ5A 1EO7A 2Z1SA 1OT1A 1J01A 1UD6A 3DHPA 3VO0A 3UESA 4S3KA 1GQIA 2O9PA 3AIRA 3W38A 3T08A 4PMDA 1AVAA 1V0MA 3NDZA 2PWGA 1UH3A 4AD1A 1ZU8A 5ABEA 4BS0A 2ZOXA 3W53A 3AQUA 3CHEA 2CBIA 1QBAA 1VEMA 1ZJBA 2GJXA 2VX4A 5CG0A 2JALA 3QHOA 2XIBA 1GORA 3SUWA 3WQ8A 2WSKA 3O9NA 3CMGA 3BC9A 5LA0A 1JFHA 1IZKA 3WF3A 1K9EA 1OGGA 2FHBA 1JXJA 2WANA 5IFPA 2ZWZA 3K4AA 2VRJA 4IM4A 3IJ9A 5BXSA 1PX4A 1E6RA 1W9XA 1JZ3A 3WEOA 2BFGA 1H2JA 2J7BA 4JKLA 1CXKA 1QNOA 2XVPA 3PTKA 4CD6A 4F9DA 1VJZA 2XVKA 1W3HA 1UR0A 3UG5A 3B8SA 1V3IA 5BXRA 1KWKA 3WNOA 3L2MA 2HISA 1JD9A 2JF7A 1QNSA 2QPSA 1J0IA 3K8MA 4U5KA 3RIKA 3W25A 1ESWA 3AISA 5CXPA 2YL9A 1XCXA 1E6XM 1XV8A 4F66A 1G94A 1KQZA 4CN4A 1YQ2A 1J9YA 3GXMA 4CCCA 2F8QA 3CH9A 1FH8A 3K4DA 1E3XA 3CGTA 4HU8A 1XH0A 1LWHA 5I5RA 1BPLB 3OLDA 4UQCA 4TUFA 2WVSA 2GJXB 2XIIA 1BLIA 3OZPA 3WMCA 3W24A 5I6SA 1A3HA 2GDVA 1ZL1A 4GKLA 3CLWA 1WKYA 1W1YA 2OWCA 4HA4A 3A4XA 2XGBA 4KGLA 3G6LA 2Y5EA 3BGAA 3VVGA 3KEHA 2EBNA 4M8UA 4PMQA 3TTSA 1JNDA 1NH6A 2VUYA 1JG9A 3WDPP 4PN2A 4J28A 4PUDA 1KR0A 1ODUA 4HZ8A 2J7CA 4J7RA 2VL4A 2WNWA 3N04A 4X9YA 1WZLA 2EJ1A 5I79A 4HOZA 1V3HA 4CVUA 5JIPA 1JD7A 4OJYA 1CECA 3W82A 1WAWA 3ZIZA 2VZUA 1UH4A 2ZXAA 5A2AA 3PN8A 4UFHA 1GOOA 1Q6EA 3OGSA 1TZ7A 1HP4A 3WEZA 3OBAA 3L4TA 2G41A 2WWDA 3G6MA 2WHJA 1DWJM 3N15A 1ITCA 1PBGA 5GQBA 2FGZA 1E55A 2PBOA 3GXFA 2DT2A 3WNLA 3A4AA 1WDQA 4MB3A 2VC9A 1WZKA 3MUY1 1HKMA 4AISA 4A3HA 3GH7A 2XTKA 1W9DM 3WH8A 2DPEA 1I1WA 1W91A 1JYNA 3EMZA 2NT1A 4X0NA 1ZBCA 3AIBA 4AZ5A 4W5ZA 2WXDM 4JFVA 1DTUA 3WDIA 2JEPA 2WMGA 3ARRA 1R85A 4MNLA 5I3DA 1E72M 3IK2A 3TOPA 4K68A 4UFLA 3ZJ8A 2E3ZA 2EEXA 3MMUA 2XFYA 1TA3A 4H8HA 4BA0A 4AD2A 3SUUA 1I75A 3J7HA 2VR4A 2BHYA 4IPNB 2D0GA 2WVVB 1UYQA 1E70M 2V38A 4ACZA 1GOQA 4PMXA 3L4XA 1MFVA 4H8UA 3F5KA 2V3GA 3FAXA 3WF1A 4AZHA 1AQHA 1E4IA 4A3YA 4LPCA 3AXIA 1WB0A 3HJEA 4MNJA 3WUGA 6TAAA 3GH4A 4P7NA 4ACZB 2E8ZA 3WQ5A 4JIEA 1ISYA 1JGIA 1BG9A 3WY1A 1L0PA 5ECUA 1MVYA 4JKKA 1GZJA 3MO4A 2JE8A 3MS8A 2E8YA 4AD4A 1IV8A 1WDPA 2EQDA 1KGXA 3D3AA 3AXHA 3OGVA 1UD5A 3SCTA 2WC3A 5E0FA 4P8VA 4Z2GA 4KMQA 5AC5A 2YIHA 3VIOA 1DWHM 1M53A 1W3LA 3AIVA 2DH3A 5HPOA 1VJSA 3AS2A 4HA1A 1GPFA 1V3LA 2WVTA 5GPRA 4W5UA 4B3LA 4U3AA 4P8WA 4DWSD 4D6FA 1LJYA 2VURA 1E5JA 4GO8A 4XUYA 3VNYA 2DSUA 3CZ8A 2OSXA 3VD5A 1WDRA 2WVVA 1TE1A 5E9AA 1BGAA 2OWWA 1PJ9A 1OD0A 1JZ7A 3U7VA 2QMJA 2CYGA 1VBRA 4H04A 4GPNA 1XD1A 2EPNA 2B31A 2Y8KA 3K8LA 2YL6A 3FN9A 2CERA 1HL8A 1HJSA 3BCFA 4AIUA 1ZBVA 4U3CA 2ESCA 2OSWA 1EIBA 5M5DA 3WH6A 2ZIDA 1E15A 4TX8A 5JBFA 3VD9A 3AYSA 3NUKA 1JYWA 1GUVA 2J8GA 2XFFA 1X1NA 3ALGA 2BHUA 1W3JA 4J3UA 2Y4SA 2J4GA 4TTGA 3SUVA 1UD2A 5DO8A 4HMDA 1GVYA 2WLZA 3AHYA 4PMZA 5BYWA 1WZAA 3CHCA 3TTQA 4X0VA 2BS9A 3JUGA 1G5AA 1GONA 1W32A 3ARZA 5D4YA 3GNRA 2CNCA 3ARXA 6CGTA 4CCEA 3O6AA 4AMCA 3AYRA 1HJWA 3GM8A 4GQRA 2WMFA 5CSUA 1XSKA 4DM1A 2J7DA 2GSJA 4JFSA 2WHLA 2BXZA 3QOMA 4OBSA 1JAEA 2YJQA 3U5YA 2CBUA 2XM2A 4UFJA 3FHAA 3VGGA 1XGZA 1CGTA 5C71A 4EAMA 2Y24A 4MNKA 4QFUA 4UZUA 4LYPA 1H11A 3WD2A 2JIWA 3SCWA 1W9VA 1LL6A 3ZSTA 1H1NA 4CD8A 2XVGA 1CGUA 1KB3A 4W8BA 2BVYA 2XPKA 3UERA 5E0CA 1GJUA 4R27A 1R7OA 2ZX7A 3WELA 3M46A 1FH9A 2ZX9A 2WK2A 4M80A 4TXEA 2YLLA 4GI6A 1UD3A 5A8NA 3N18A 1W1VA 2PBGA 2VQTA 4H2CA 1PIGA 1E0VA 3PTMA 5DT5A 4AD5A 2PC8A 1HL9A 5BRPA 1UR9A 1G9HA 1JNEA 3ARSA 2OYKA 1UKQA 1HX0A 3T2QA 4CN1A 5DMYA 3VD4A 2ZUSA 1E6ZA 1FH7A 4J3WA 1HKIA 3QHMA 3A4WA 2BV9A 2VI0A 1NOFA 1XYZA 1QBBA 1DHKA 5M03A 1BYDA 1OWQA 4W87A 3ARUA 1CIUA 1V0NA 1Q6DA 4DWSC 2DSZA 4D1IA 4GI9A 3WDRA 1JI1A 5A94A 2UY5A 1R87A 4PMRA 4CUCA 1UR8A 3CUFA 1BSIA 3MSGA 5JBEA 1LL4A 4DUXA 2CESA 3GBEA 1C7SA 1TVPA 5CLTA 1HN1A 2XWDA 7CGTA 3WD0A 3TP4A 1BQCA 2W63A 2XJ7A 2DH2A 5A2BA 2J47A 5IHRA 3DECA 2VZVA 4UQEA 4Q7NA 1FA2A 4OKDA 5I2UA 1CGWA 1ZB5A 4GO9A 5AYIA 5CZKA 3MU7A 3L4ZA 2O92A 3THDA 1KR1A 3PZ9A 1RD6A 1GJWA 1H0IA 3W6MA 3VGDA 1CLVA 2EPLX 3K8KA 5I77A 1OGSA 4S3JA 1HJVA 1TMQA 3AIUA 4JAWA 3WH7A 3SURA 1GOWA 1V08A 4DWSB 1X6NA 2VVSA 5JIWA 2BY0A 3AFBA 4NZCA 1QHPA 5D9OA 2ZUVA 3II1A 1OSEA 3AJ7A 1V3KA 1CLXA 2ZUTA 4TOQA 4J3VA 3SUSA 2VX7A 4UQDA 1E5NA 1BTCA 3DYOA 4MB1A 3THCA 4HZ7A 4E8CA 3OLGA 4CD7A 4LYRA 1QPKA 3SCVA 1BAGA 1GQKA 4L4OA 1S46A 3W28A 3ZMRA 1ZBKA 2AMGA 2WZHA 5CPSA 3CPUA 1G0CA 2W4XA 3OLIA 2WMKA 4BQ4A 1UKPA 3T0DA 1MQRA 2WMIA 4QCEA 2FH8A 2XSAA 3IANA 4AZGA 4UOZA 1F4AA 3TTYA 1UR2A 4W7UA 5C70A 1NM9A 4AZ6A 1CXLA 4ATLA 3VGBA 2XVNA 3T0BA 5FCZA 4Q22A 1WE5A 1GW1A 3PZIA 4JZ5A 5ABFA 1E4NA 5LA1A 1RP9A 1XCWA 3VNZA 3DYPA 3BLPX 4B3KA 4XZWA 4BF7A 1FHDA 1KQYA 1NWUA 5I78A 3KE0A 3IJ7A 1E6PA 3EYPA 4LQ1A 4JFWA 3AIEA 5HPCA 1SMDA 2JIEA 3BMWA 3VD3A 1OGBA 1UOKA 2DT3A 5I24A 5CPQA 4ML4A 4QAWA 2VRQA 4GQQA 4NRRA 2IUZA 2W67A 2GK1A 1B1YA 4Z2KA 3CZEA 4EE9A 3B9EA 1P6WA 3L4VA 1BYBA 1KBKA 1J0JA 1PIFA 4W86A 1VEOA 1LL7A 2QMKA 8CGTA 4V2XA 1TR1A 1UWSA 5D9PA 3CUIA 5LA2A 1H0GA 1CTNA 4ATWA 3IJ8A 1CYGA 1VF8A 2GK1B 2FGLA 3AS1A 3AZTA 4M1RA 4KWUA 4D72A 4R5EA 4JHZA 5HDRA 3WUEA 3CHDA 2W5FA 3WL1A 1C8XA 1OM0A 5M17A 5A6BD 3AHZA 1C91A 1EGZA 2VJXA 3AMLA 4WF7A 1YHTA 1AQMA 4AZIA 1OIMA 3UR7A 3WL0A 2D24A 5EMYA 4XV0A 1CXFA 4FLOA 2W61A 5M3WA 3QHNA 3KL0A 4WK9A 4BZYA 2YKKA 1JZ8A 3GNPA 3ZJ6A 4D6JA 1NP0A 3EMCA 3FAWA 1UR1A 2G4FA 4P7LA 2J7HA 1CDGA 2FDMA 2WAGA 3ARWA 4WKFA 4U5IA 2A3HA 3DHUA 5BCAA 3MMWA 3ECQA 2WSPA 3QGVA 3HMCA 1E43A 4DWSA 2J62A 5E6ZA 1UKOA 2GVYA 4PMVA 1CBGA 3VIPA 4Z2JA 3OGRA 2VOTA 3SUTA 1OD8A 3UG3A 3CUHA 1H4PA 5BROA 2WZEA 1FOBA 2WKLA 1ISVA 3CMJA 3I3BA 4E2OA 3WEMA 2GFTA 4AD0A 2DEPA 3AMKA 3WSUA 4JL2A 4PMNA 1K9TA 1OCQA 4DUVA 4V28A 3BXWA 1CEOA 3POHA 1ODZA 4XB3A 1NOWA 3CO4A 5IDIA 3SCSA 4MAVA 1GCYA 4MNMA 4BQ3A 3VIKA 4AZ7A 1V6VA 5CJ5A
chains in the Genus database with same CATH superfamily
2TSYA 4B6XA 4ZEPA 4NYYA 2E9MA 2ODOA 4W7WA 5BRQA 2WSYA 4FS9A 4NSBA 4W4QA 2R82A 1HIZA 3W0KA 3UJEA 4GYRA 2LM2A 2DZXA 3LNMA 4PH6A 4XTDA 4A6GA 2EO7A 3P80A 3UVIA 5A95A 1TQJA 2J8TA 3FLUA 4H9OC 3VOFA 5CGMA 3LBOA 4LXFA 4AFYA 3O63A 1OEDA 2E2AA 1Q6RA 3NJ3A 3TLSA 5A6TC 4TWHA 3BAJA 1JYXA 2F6UA 3CUGA 3TXZA 3B3DA 2ADAA 1D0XA 2OA5A 4BAYB 4LUSB 4KERA 3S2NA 4WDTA 2Y5SA 3A64A 3BV4A 3UGVA 3LXCA 2XG9A 3OOQA 1TJ0A 3E2RA 3VMPA 4NJKA 3MQTA 3RDKA 2AQVA 2TPSA 3GTFA 5C2XA 1D1AA 1Q85A 3WAJA 1ITXA 2PDGA 1QW8A 2L9QA 4D6IA 1CPUA 3VGEA 4K0UA 1BG4A 3ARVA 3RIUC 3BG3A 1W3KA 2CZEA 4PTDA 4OECA 5EFFA 3L4UA 4Z0SA 1SMAA 2Y2WA 1OHLA 2DJXA 5FYMA 2Y61A 1MO0A 3N9RA 3QKEA 2QJHA 2X68A 3LXBA 4BWLA 3N2BA 2NZLA 2WWVA 4LUTB 2PDPA 4IFKB 3ID7A 4JQ3A 3SADA 4A22A 5AQRB 3SSZA 2R1PA 1OX4B 4R9OA 4UNLA 3ZCIA 1RH9A 1X7FA 3AS3A 5G5IA 4ZL1A 5ETWA 1OB0A 4EXQA 3KRZA 4H6QA 1KCKA 1NWTA 3HQPA 3QQWA 5AZ0A 4WSHA 4Z1AA 4RZBA 3M5XA 1KFCA 3R5EA 4EANA 3P62A 5T9CE 3B5MA 5I07A 1JGMA 2M67A 5E70A 2OYMA 4F8XA 4GYFA 5DEZA 2JRKA 2J7EA 3LERA 5DBTA 3ZOAA 5C8BB 3PPGA 3S5SA 5U7SA 2A4AA 3B9DA 1D1CA 1QHZA 4JCMA 1Q4NX 1AK5A 4AHPA 2XQ3A 4YWSA 5AOUA 4XBSA 3QQ0A 1ZAIA 2ZDRA 2ZA2A 4K8HA 2EKCA 5HINA 3VFCA 3VUPA 4O1AA 3STCA 1UR4A 1MRQA 4AKRB 5TF0A 2IC6A 3UXKA 1JPKA 3HTWA 3VA8A 3MZKB 1RLCL 4JTUA 1IEWA 1KWGA 4GXWA 4HMCA 4N2YA 4R53A 4DIDB 1DJXA 2X1RA 3DG7A 4CGTA 3AEGA 1XYFA 3GK0A 2QPUA 3WLIA 3R8RA 3GFXA 4XZCA 4MKSA 1A5NC 1EXPA 3WLOA 3FSUA 3SCRA 2GVLA 3QH2A 1OC6A 1OQFA 3H3AA 1AG1O 1SHZC 5IFTA 4HGXA 4IGNA 3C4WA 4QJ1A 3TTOA 1R38A 3N12A 4LVBA 5A6SA 4K1WA 4ROPA 2MUCA 1GOIA 1DOSA 3GVQA 3WQVA 1GTHA 3E0WA 4H6RA 1FWAC 3CB8A 2NWSA 1E0XA 2UXXB 3RCNA 3B57A 4LYQA 4UCGA 1ADOA 1B5TA 1DEDA 1GG1A 4KETA 2QDHA 3SCOA 3ME3A 2FPVA 3OVQA 3EX6A 1N8WA 5FJIA 4UV8B 4M6PA 4DEFA 1HS7A 2BZBA 1Q6CA 2XZ7A 5DQPA 1S3HA 5CZ0A 5A6AA 5HOSA 2B0MA 1LQAA 1Z7AA 2O9RA 4DV7T 5ADXL 1O6IA 1BR1A 3LLXA 4TV8E 1XLLA 4FNQA 4O4LE 5CA0E 1RPKA 2AKMA 4O19A 3MSYA 4W85A 4GRSA 4KKXA 4Y9AA 1SM9A 4QEEA 1SSGA 2PMQA 4JI3T 3QXBA 3UU0A 4HZ6A 5H6QB 4H8NA 5LHIB 1JL8A 3TA9A 4D6CA 3NRXA 2CLKA 3ZWSA 1I94T 3PS7A 3WLKX 4WSJA 3FHNA 3R58A 1DQWA 3LN3A 3W22A 4QLJA 2YCLB 2V5BA 3BQIA 3GFZA 1E2AA 4GIAA 3M16A 4HHPA 1WA3A 1XIDA 1VFMA 4OYKA 1I2PA 4LVDA 1VYPX 4ACYA 3NSMA 2JKEA 4D2JA 5FD0A 3GTNA 4ZVJA 2FVMA 1XNQT 1UB3A 5F2IA 3GNOA 3LMYA 1K9FA 3ZLIA 4LF2A 4ILAA 4GOUA 3KTSA 4HTYA 3KBTA 2EPMX 1WRDA 4C6NA 5HR7A 4JTRA 1HW6A 5AYXA 1BR4A 4Q4OA 3CUXA 3IIVA 3GAYA 4AU0A 3FXDB 3Q5EA 4H63V 1KBJA 1T41A 3FGCA 1RJRA 4B5TA 3OU8A 4NAEB 1AL7A 4ZE5A 1QPQA 1XSIA 4I4TE 2E77A 1SJCA 3E0VA 2Y7DA 5ABGA 1RALA 3CAKA 4TV5A 4RE4A 2GUUA 3VCRA 2Y62A 4H7CA 2FFCA 1MW1A 1JEZA 4Y8EA 1J0ZA 2CLOA 2WB5A 3WQCA 1CNVA 1VYSX 1KM2A 3W26A 4IJBA 2A0NA 3BZJA 1W1PA 1AFSA 2PTDA 4MLKA 1S3TC 1P5BA 4REQA 3M07A 4YWIA 1NAL1 1QNQA 4CD5A 2NT0A 4RZ5A 5FJJA 3RO8A 2CZVA 3K13A 1CZ1A 4I8DA 2E67A 2NVCA 4QQUA 4HPJA 4Q3MA 5GNZA 1SQ7A 5JH2A 5LXXA 1AQ0A 2BB0A 2P1FA 4WJXA 5AQQB 4Y9PA 2CPUA 2FQIA 3RYSA 4UFIA 1W0AA 4ZQNA 4HKAA 2POZA 2UUBT 1XPYA 4KFPA 3LD5A 4J4KA 4JX5A 1WKFA 3NDYA 4X9SA 1DIOA 3UG4A 1V02E 2QULA 5A6JA 4LFBT 3USZA 1EA9C 4C7GA 3PJAJ 2XVLA 5AQFB 4HTBA 1E1FA 4KFNA 2J88A 3NA8A 3UFEA 1E4LA 1I2NA 2AOSA 1RLDA 4DXVA 2P50A 4EV6A 4B5WA 1XUUA 3DEQA 2HE8A 3M5YA 1DBTA 3QN3A 1R8IA 2OOGA 1IJ6A 3CASA 5G1YA 4UR8A 1WDSA 5AYBA 1K4GA 4Z1DA 3DXIA 3CQXC 3VK5A 4FLRA 1W9RA 1S2WA 3KHDA 3DG6A 4EEDA 1BVWA 3TQVA 3MBDA 3UWEA 4Z08A 3B40A 4A05A 3W81A 2CBVA 4F2BA 3WUFA 3MVTA 4H1ZA 3TN3A 2XAGB 5DCEA 2DZSA 3VHLA 3MHFA 3MJXA 4MTVA 4KCUA 3NWIA 1EOMA 5EA9A 7XIMA 4OOZA 2TAAA 3BK9A 1RAKA 8RUCA 4CNSA 4BFAA 3PUDA 3APTA 3ITOA 2J74A 2Y0FA 1MXDA 5L4EA 4US5D 4PYSA 4WOZA 4TVCA 4JFTA 2QGYA 3E0FA 3BVJA 4X1KE 4NZJA 3NVOA 4K7VA 4OBTA 1LVFA 2Z1KA 3RLUA 4IQEA 2VMFA 3WMSA 4DNHA 2B7QA 1UASA 4PJJA 4Q8OA 1PZ1A 3G24A 4Q8UA 1LG1A 4HMEA 4WOQA 5E6YA 2PWHA 3BOXA 1RP8A 1B3YA 1B30A 3KXQA 1ZJHA 3EDDA 4X2RA 1W1TA 3N17A 1KK7A 2V30A 3CS2A 3IPWA 4ERGA 2D22A 3GMIA 3LRKA 1MFUA 1JR1A 1GG0A 2P3ZA 4ZE4A 2DNXA 2V2DA 4J3ZA 1U33A 5IDZA 4C6MA 1NOUA 3PZOA 4UQ9A 2J77A 3HV8A 5JVLA 3TQ0A 1D3CA 4GZEA 2VL8A 1HGWA 2E9BA 2Z2UA 2GL5A 5D2XA 2D3NA 5EBAA 1BXNA 4ENLA 4DJDC 1Q6FA 1FFRA 4IP7A 2Q8ZA 5G4EA 4GH1A 4ASTA 4AXNA 3VM5A 1HUVA 1OEDB 2C5IT 3WF2A 4IF2A 2DZAA 1R7AA 4PRRA 4MDOA 3RPMA 3B0XA 3OTRA 4LFCT 4UR9A 4RDVA 4FHAA 3T55A 4J3SA 4A3UA 1U4QA 3TYAA 3EWBX 5LIKX 1YKWA 2FZMA 2HROA 4PMUA 4RCXA 5HQLA 3AHVA 3V7PA 2QCFA 2TMDA 5HEGA 1UWRA 1F6PA 4RDYA 3HGSA 5JH7E 3TLTA 3MMTA 4YMZA 1FCUA 4PEEA 1EF2A 3RYHE 3B8VA 2R9RA 5JH1A 1Y0EA 1FWDC 3GZAA 1OFOA 2YZ5A 3NQAA 5D2WA 4MB5A 4PSRA 5HWNA 1RCXB 4HPGA 5GNXA 5U4NA 4MJ4A 4BI7A 2VB6A 4PK5A 4EWJA 1GQJA 3A8YC 3BZGA 4NZ5A 1XH2A 5HUOA 1H7WA 1R2SA 1TKKA 4WKHA 4HU0A 3WFLA 4W8LA 4NASA 4H9YA 4H9UA 4ZB0A 1TV3A 1CENA 4IX2A 2GJPA 2WLYA 4JIHA 2V6XA 5HEJA 4YSXA 2WMIB 3VX1A 5I03A 4GNJA 2X1SA 4YJ5A 4X3ZA 2ZM2A 3TR9A 3PZVA 4WVXA 1EJTC 3L2LA 3OW1A 4O52A 4LBRA 2IS7A 4H9ZA 2ONEA 3EKZA 3MUIA 4BEQA 3LK6A 3S1GA 1E71M 2C3ZA 4QEHA 2XM1A 4C1NA 2XH0A 3IAQA 2O4QA 3T40A 2VEGA 5J0ZA 4UTTA 4F9JA 5TD4A 1ITQA 1EB3A 2NSXA 2CXGA 3THAA 3ES7A 3BMXA 3H7RA 3T05A 4XO7A 3P84A 1R3TA 2V3DA 3H24A 2XH7A 1G7VA 3LCGA 1BWKA 1BWVA 5H8UA 1MMAA 1UP3A 3T7VA 2DHRA 2LM9A 2ATSA 5FF3A 2OB3A 4UZSA 2V7IA 4EVZA 2SPCA 3NL2A 4HHHA 1LRTA 2BGNE 3RF9A 1UKTA 4IIJE 3EWYA 3TAKA 4WJEA 4GWEA 3AMGA 3W1UA 4MHCA 4I0UA 4XZMX 3I7SA 4IMDA 2PFHA 4JBWF 3WENA 5KZEA 5HA7A 1ONWA 3ALFA 3POCA 3G1RA 5SWUA 2ACZA 1MNDA 3FW6A 2FFIA 4PMYA 2EXOA 1D3GA 1LZOA 3ARQA 4H3DA 4S1FA 4YLHA 2VFEA 1DWFM 5T9BG 5AC7A 4AEFA 1EJWC 3LLDA 5DQVA 4LAOA 2ZRVA 2VZSA 2DDXA 4IT4A 3TJ4A 5T26A 3WJYA 1DP0A 5HNRA 1C8QA 2PUZA 2HJPA 2PDBA 2D0TA 1M9HA 3GU1A 5CJMA 4E8DA 4GK0E 1MNEA 2X2YA 3PJXA 3UZXA 1NTHA 3LNPA 1EC9A 2CHOA 5I3GA 1J5WA 5HQMA 3BDKA 4JI4T 1IWBA 2V82A 2BX7A 4M29A 1L8NA 4L80A 1PIIA 1DXFA 4FNTA 3P8IA 4O16A 1XLDA 3N11A 4IG2B 4LH8A 3VU2A 5DRIA 5A3HA 1QK2A 3WQ6A 3IJIA 5FEWA 4DMWA 3BQ5A 4JTHA 4L65A 3YPIA 4JKMA 1YXDA 3C98B 2CITA 1MI3A 4OU1A 1C8YA 1GJPA 1HXJA 1EEXA 1KM0A 2PCEA 2MYSA 2PRHA 4KBMB 1FFQA 2DUZA 1UK5A 2ABAA 1I9CB 1QPNA 2IXUA 1NIUA 2E6YA 2JFEX 1XSJA 4DUOA 5A69A 2CKRA 3F7JA 4JNYA 3IK4A 5KTLA 3WNPA 3RQWA 2BG5A 1SW7A 9CGTA 3CTTA 3CHFA 1TV5A 5D9MA 2X09A 3H22A 3BCDA 3PUAA 1LBLA 1I2QA 2WJFA 2YLAA 2E7FA 4R34A 2E25A 1LLWA 3AZRA 1UD4A 5FEXA 1XG3A 4M1BA 5M2FX 4RV8A 1TWWA 1FXPA 2Q8LA 1PHWA 5A6KA 4DBSA 1E1HB 1K02A 4UMCA 2A1YA 4OK0A 3LI1A 1HKKA 1FWIC 3GDTA 4DXKA 1YNYA 1T72A 1JRBA 2OLHA 3ANWB 2D73A 4IL4A 1D9EA 2RDXA 4B2DA 4I5XA 3C52A 2HVMA 3LBCA 2FYMA 2OO6A 3LPPA 2PD9A 2CXEA 2Z24A 1V9DA 5A5WA 1NFGA 2WC7A 2CWOA 2D0HA 3IGXA 1G4TA 3S6TA 4BJMA 4WEVX 4GLEA 5J04A 2F2HA 1EJVC 1FP8A 3KTCA 2VGGA 2Z1SA 3TKFA 3DHPA 3VO0A 1YKEB 3UESA 4O2AE 1GQIA 2O9PA 2GVJA 3T08A 5REQA 3H12A 3E08A 1AVAA 3KUMA 2PEVA 2XQ5A 1FDZA 4AKLA 2OLSA 4GJ1A 1E51A 3AQUA 4ZI2C 1VEMA 1TELA 2P8CA 5CG0A 2JALA 2VQET 4AQFA 4I9JA 5LYJE 4OV9A 5JDNA 3O9NA 4BEUA 1OFBA 5LA0A 2WPBA 3H8AA 1OGGA 2FHBA 2WANA 1XIEA 4ONVA 2ZWZA 3K4AA 4IJCA 2V63A 5CC7A 5CG7A 1PX4A 4O14A 1W9XA 3ORWA 3Q37A 3ITLA 3EWDA 3GW0A 1KCXA 1WX0A 1SFJA 2G4JA 3QQ1A 3M0VA 4GBDA 3MC5A 1TTPA 3B8SA 3HJZA 3WNOA 3U2CA 4O11A 3REQB 5L3EB 2HISA 3DBNA 1O1ZA 3ITTA 4MSSA 4GY0A 2BVMA 3U3HA 1ESWA 3AISA 1UCWA 3RR1A 2YL9A 3WJSA 3RIAA 5TNVA 1VBHA 1JPIA 1G94A 4YCPA 1YQ2A 3W7RA 4LB4A 3I1AA 2EHOA 1E3XA 4NX5A 3TW6A 3DC8A 1TVLA 5I5RA 1BPLB 2Q9QA 3AEFA 4OVXA 4MYAA 3WMCA 3W24A 2Z1BA 5I6SA 4LSBA 5C9WA 3KINB 1QO2A 1ZL1A 3F2CA 1W1YA 5LMNT 4EZHA 5I7GA 2AQOA 4HA4A 4V1YA 4UTWC 3W7LA 2F4VT 8XIMA 3VVGA 2EBNA 4M8UA 3A9IA 4JV5T 3WDPP 4LF4T 4DF2A 4JOMA 4J28A 2QVHA 2IQTA 5DJQC 3AUJA 1VRDA 5JTGA 6XIAA 1YXRA 3FJNA 3AJXA 2VGFA 1PXGA 4WGHA 4HOZA 3GSMA 3X1DA 4GOAA 6XIMA 5HEUA 3CTLA 3BW2A 3IUDA 1AH4A 4OJYA 4S3AA 1UP0A 4HFEA 1WAWA 3THUA 5A2AA 3P67A 3DFYA 4Q7BA 3FK4A 3PBVA 3SRZA 4HN8A 5H1WA 3L4TA 5DXYA 4MHBA 5CEWA 2G41A 3R2GA 4XD6A 3KBVA 2NW9A 2PGRA 4PBFA 1A0CA 4O1FA 3A5VA 3LBMA 2FGZA 2PBOA 3W83A 2Q6ZA 4YHHT 3B06A 5C9XA 1A5KC 1OCNA 2DT2A 1KTCA 4I8YA 1L9WA 3R0KA 3MBFA 4LRTA 1Q5MA 4LBSA 5B7ZA 1WZKA 3ZPOA 2C0AA 2FB2A 2XQAA 2H8XA 3H2CA 3DJBA 1RQBA 1R47A 1HKMA 3CQHA 4AISA 2EG8A 3KBSA 3EMZA 3I4KA 4X0NA 1XX1A 2O7QA 3AIBA 1MDRA 3I68A 4JFVA 1TRIA 3SY5A 2X42A 1OVDA 3ARRA 5CPLA 3IK2A 4K68A 3TK7A 3DAQA 2OFJA 2WSRA 1MEWA 2ZA3A 4ALDA 1G4SA 1I75A 3GKAA 3VE9A 2E6DA 2BHYA 2PDYA 3ICJA 3KAOA 4DR2T 2HZGA 3QZEA 3QEZA 2PLKA 4PMXA 1EA0A 1JNZA 4DV5T 3L09A 3I0QA 1TR9A 3OHMB 1KBIA 1HO1A 1PV8A 2XHEB 3F4CA 4G7EA 5J2UE 4MNJA 4YTSA 2UXDT 3GH4A 3TA6A 2YEVC 4IMFA 4A8RA 2R14A 4I43B 1X38A 3W72A 5ECUA 1GZJA 1XKJA 3NXLA 2JE8A 3CL8A 4DF0A 3CT7A 2Z0IA 4E0CA 3OGVA 1KRBC 1OCBA 2NVAA 1WXZA 1IWPA 1S94A 1GZ1A 4LY8A 5AC5A 3VIOA 3W02A 3AIVA 4YTUA 4AG0A 2AAMA 1K1DA 2ON3A 1VJSA 2VGIA 4P0AA 3HA4A 3I7RA 2IMLA 2B1EA 5GPRA 3RYCE 3K3OA 4DYEA 4AVOA 4B3LA 4YTNA 3ZYMA 3U8GA 3P82A 1E5JA 4DR1T 3TFCA 3CZ8A 5FMNA 5LXEA 3ONLC 3RQUA 3O15A 3JZUA 5D2YA 4A21A 1DKWA 1O95A 5I00A 3KOZA 4WYVA 2WJDA 2IPGA 4YVVA 3GNXA 3HPXA 2V68A 4BWLC 1HZYA 1ZAHA 3U7VA 3TV8A 3LRLA 3GXNA 2PJQA 3VXGA 1UJPA 4C91A 5CB4E 4GPNA 3HBLA 2V67A 2L8KA 3F2DA 3SRKA 4XAPA 2Y8KA 4PJMA 4LAKA 4DZIA 4GKJT 2YL6A 3FN9A 4U28A 4QJ5B 1HL8A 3BLOA 4HCHA 1T7SA 1X8FA 3N3TA 1UZHA 1RCQA 4E8GA 1R3SA 4FO4A 1M62A 1MNSA 1AH0A 2V2HA 3MY9A 3SN4A 3DFOA 5JBFA 1S2TA 2D2HA 3QY7A 1G4PA 2WNQA 1CI1A 1JQXA 3W71A 3RN6A 3IRDA 2XFFA 4KX6A 2GWNA 3ALGA 1VBGA 2BHUA 4YNGA 3RMJA 3ZR4A 4ILSA 4D8ZA 1E9IA 3GXTA 3UY8A 3U0HA 4HFCA 3FOKA 3ZJ2A 2WJZA 4TTGA 2FJKA 3PM6A 4XAZA 4KS0A 3IIOA 3BCJA 3AHYA 1US7B 3VNJA 1RQEA 1IHIA 4Q8WA 1MMDA 1PB0A 3DH7A 1EJRC 1UMYA 2DZVA 2FUPA 3TJXA 3TTQA 1DXEA 1NQKA 1T5AA 2ZFAA 4X0VA 3NM3A 5HEHA 4I3GA 1G5AA 1I2RA 1JUKA 2BG9C 3GNRA 3SBFA 4JDYA 6CGTA 2NR4A 3O1IA 4GIWA 5AFDA 4K1GA 1M65A 4GQRA 3L0KA 2WMFA 4ILCA 1XSKA 4ZQCA 4J40A 3W7HA 1O4UA 4JTIA 1PKYA 2A7NA 5H8MA 4JFSA 2BXZA 1JAEA 1R3RA 3TN4A 3RLFF 4EAYA 4UFJA 5D04C 1S2AA 3EB4A 1UGOA 4G1NA 4JI8T 3PU8A 5C71A 2PDNA 4EAMA 4RV3A 3FA4A 4XKMA 4LYPA 3GKFA 1DU2A 1XDJA 4XZIA 1M5WA 5AQPB 3PU3A 4EIWA 1CGUA 3UXAA 3PP7A 2LSKA 4V1XA 4CNNA 4WY0F 3UERA 3M7WA 5E0CA 2NW7A 4R27A 4MY1A 4YL2A 2PP1A 4E5TA 2LSYA 1PVNA 1AZ1A 1WOAA 3UWUA 2CCQA 5D2VA 3P50A 2I5GA 4GI6A 2VQTA 4H2CA 4EYYR 1XNRT 3NQVA 3LQLA 5DT5A 3NRYA 3TLVA 2PC8A 1HL9A 1UR9A 5JR9A 4PB5A 1JNEA 4DYKA 2ACRA 1UKQA 3T2QA 3UA3A 1Q65A 4WGXA 5EMKA 1YLVA 2BOEX 3O1JA 1PHQA 4RK8A 5M03A 1OWQA 1OF6A 1P6CA 1QATA 1RUSA 2DSZA 3BTNA 3CJPA 1DJHA 5FY0A 4Q25A 3OBKA 3P60A 1TPC1 1TWSA 3T0CA 4DUXA 2WS3A 3G1FA 3H2EA 1W1ZA 1TVPA 4GKTA 1HN1A 1TPH1 7CGTA 1BR0A 3WD0A 1ZALA 3BK0A 3CQCB 3ZVHB 2W63A 1ZP0A 3O0KA 5HMFA 2CLYC 3BE7A 1IEVA 2A85A 1XLMA 4OKDA 4ZODA 1OF8A 4GO9A 5CZKA 1ZTVA 4NXKA 1A5SA 3THDA 1KR1A 2MAWA 2HNEA 3IGHX 4FA3A 4GNKB 3TZNA 4GYSA 1J6PA 2W27A 5D32A 2EPLX 3K8KA 3KM8A 3TVAA 1HJVA 1EP3A 1VQTA 1OFAA 3PTDA 3O1NA 4JAWA 1C8VA 1C29A 1V08A 3G0XA 1EBGA 1VC4A 4LF1A 4LU0A 3II1A 2FZ9A 4X20E 3G5EA 1SE7A 4A97A 3W6YA 3NPWA 3F1QA 3H70A 4NX0A 2VX7A 5LHEA 3MCOA 1BTCA 4AX6A 4UBPC 3THCA 3BOLA 1VHCA 4E8CA 4AHQA 4B5VA 3G1DA 4LV4A 4GK5E 2FLIA 3SCVA 1CUNA 3OP2A 4Q8QA 3HPAA 3HV9A 1JVNA 5HXRA 3ZYLA 5CPSA 1JJKA 3NVTA 3OLIA 2WMKA 2WNZA 1DJYA 1MQRA 3CPGA 4AQGA 1XLJA 4BK9A 4C6JA 4YCOA 3QFEA 1OX4A 2G96A 2D2JA 2OT0A 4JI5T 5F2GA 2VOMA 1XLFA 2IKIA 1WE5A 1GW1A 4NHVA 1FTXA 1SUMB 5LA1A 2CLYB 4UIGA 2BXVA 2ISDA 2QUUA 3AEDA 3PE0A 3IV8A 3A23A 4XWUA 3AU6A 1J5TA 1KEYA 3DYPA 3DI0A 5BZAA 4Q8NA 2PGEA 1KQYA 1PSCA 5I78A 3KE0A 2AL2A 4GC3A 1E6PA 4LNCA 1EC8A 3ITGA 5HPCA 2JIEA 3VD3A 4QXCB 4TN7B 3AE5A 1OGBA 4KWWA 1Q3NA 4XO6A 5CPQA 2KX9A 5LNUA 3H54A 5KSWA 2G5WA 5HJYA 2X7VA 2W0GA 3EXRA 3E02A 4GJIA 1I2OA 3SS1A 1XR2A 2AKZA 1GZGA 3B9OA 3RLGA 3B9EA 4A3RA 3CWOX 1KNPA 3OVUA 2OODA 2H3BA 4IICA 4XD4A 1H7XA 2HBVA 4G6CA 8CGTA 4J35A 1GVSA 3CUIA 1LVKA 3Q5XA 2Z2AA 4ATWA 1FXQA 3KV9A 5K7JA 1A50A 2GK1B 3AS1A 4D72A 5B80A 4R5EA 1BXCA 1GVFA 3CHDA 2P5NA 1TSIA 3IIPA 1HNXT 4IHCA 4MF4A 1N2VA 5L3BB 3SW6A 3H6OA 2QUTA 1G69A 1EGZA 2IPJA 4HK7A 1N33T 2D24A 1HKVA 4XV0A 1D3HA 4KFOA 4LC6A 1K8ZA 1LP6A 3LHTA 3WJXA 5M3WA 3KL0A 2HN2A 4BZYA 4N4PA 3FAWA 2RAGA 4HN9A 3P6LA 3HG3A 4XZHA 2G4FA 3NZ1A 3HQNA 1BQGA 4GX9A 2J7HA 1XFBA 4H6EA 3R1ZA 2A3HA 3DHUA 4G5DA 1B3OA 3B8DA 3LM7A 2V81A 3N4EA 3E3HA 4NUWA 1E43A 2GJNA 3TROA 1VCSA 3EAUA 3AO0A 1F3TA 3LTPA 4HE8A 4PFOA 4JR5A 3UG3A 1H4PA 5EK3A 3L9CA 4HT3A 1H63A 5LNRA 5D02A 3W00A 4PUWA 1CW2A 4DHGA 1A4LA 3J9X1 1BF6A 1OJXA 2V0TA 3MO7A 4E2OA 3WEMA 4AD0A 4LY4A 1W31A 3AMKA 3GE7A 4YIWA 2PS2A 1AH3A 1DJIA 2BTMA 3KDNA 4H9XA 3W7CA 9XIAA 1ZOYA 3N14A 4RLIA 4V28A 4FX6M 5IDIA 3CO4A 3SCSA 4MAVA 1RV8A 4Q6XA 2VK9A 1GCYA 4K39A 3L5LA 4WCJA 3S1UA 2IKHA 4AZ7A 3DESA 1V6VA 5CJ5A 4YJ3E 4OT7A 3CWHA 3GXDA 1PZ2A 3IV3A 4AQFC 4N6EA 2QDDA 1UA7A 3CC1A 2DL1A 2IPWA 1Z41A 3PAOA 2RFGA 3T8LA 5FJUA 5XIMA 3F5JA 1O94A 1S2VA 3G1AA 4AAJA 4E2VA 4GQ0A 4C5ZA 2QLYA 4H9TA 3MK7C 3NL6A 3BMVA 3KFTA 4ZXOA 5A8GA 4IREA 4NG3A 2ATMA 3Q9DA 5L9FA 4M24A 2G3JA 4XIAA 3ONCA 2XGIA 1C9DA 3KS6A 2NX1A 1IT0A 1AMYA 1LTDA 2DY3A 5FA5A 4LWWA 2YYUA 4W9TA 1JDAA 2K5BB 1NQ6A 1C9WA 1V3MA 2JEQA 3BJSA 3WG6A 3L21A 2UXBT 1SFSA 1ZSXA 2A3AA 3EDEA 1T0OA 2OO0A 4KRZA 1WV2A 4WDUA 1PEZA 1KA9F 1XRVA 3WF0A 4ICMA 1L6SA 3OA5A 3B0UX 3V1HA 2PWFA 1TIMA 4N9DA 4MGGA 5I3KA 4H6KA 2NLYA 4CCDA 3LU2A 4PUNA 3GG0A 4NP7A 2JGYA 3O3RA 4DJFA 4DY1A 4C1KA 3WLRA 1J0KA 3KHJA 3DC0A 1GOMA 4EX4A 4M3PA 3VTRA 4L4MA 4AD3A 1TWIA 4G7FA 3CHVA 2FIQA 2K9AA 2VR2A 4RL3A 3O06A 4KCVA 4MUZA 1A5OC 3PFMA 3UW6A 3HL6A 3FNDA 3MUAA 3REQA 4N0RA 3OIXA 2BBJA 3NQFA 2ALRA 2RGMA 3MXZA 2J1DG 3GU9A 3CMLA 4MALA 2I14A 3RO6A 1IXOA 3SIMA 3N6QA 2QW5A 2E0PA 3AECA 4AZCA 5C55A 4MG4A 2WVUA 5L3CB 2X2GA 1RBLA 4CN6A 4HJWA 4PTMA 3CXOA 2B76A 2C8NA 2CLHA 3H2OA 5A6MA 2VUNA 1M68A 4BKNA 1N82A 1OZMA 3FIGA 4FX8A 1X1ZA 3MACA 8A3HA 3JAFA 2UY4A 3CV1A 4F79A 5CLWA 1XWYA 3W1QA 4F0RA 1EJ7L 2ZZ3A 3VDCA 3AYTA 1VIZA 3DFNA 1V03A 5DFAA 3HPZA 3PB2A 4AMAA 5JXQA 3AZSA 3GX9A 4K38A 1YNQA 1VPXA 3GTIA 1WUFA 2IPFA 1FQ0A 1UWIA 2VCAA 1YDVA 1M41A 5BWFA 4NNBA 4EEBA 1SO5A 2CFFA 2IXVA 3LBXA 4MPKA 3OVPA 1QTWA 4Z90A 4GI4A 3RIUA 2OJPA 3QUJA 3IUHA 4ZSUA 1KRCC 3AIWA 4F0KA 3ZXWA 3VNIA 3CBWA 3UZWA 2GVEA 3BQLA 5D9NA 2OQYA 3DDMA 1HR0T 2X7WA 1B2YA 3IUIA 4IH3A 4DVDA 4FF5A 4CEXC 1TTQA 1ZNNA 2WMOA 5FSEC 4WIWA 3W15B 4UQBA 5LJMA 3HI2A 5FY7A 2R8WA 4LMJA 1TZ9A 2DGAA 4YLWA 1ZP4A 3P8CD 3R43A 3EDUA 5LB7B 3WQWA 4DBUA 4MAZA 5LIXX 1C93A 2D1ZA 2HMCA 4FOKA 4XD5A 1W8SA 4XIMA 4PTXA 4O4JE 3IEEA 1PX8A 2VP8A 4XQ6A 4Z1BA 2ISWA 3EX1A 3CZGA 3QFWA 2C71A 3WBEA 4A4AA 1B3ZA 1M1BA 2I6HA 4HWIB 4ZMGA 4MOZA 2NW8A 5K3VA 2WKGA 3T44A 1J18A 1H3GA 3C3NA 1DE6A 3WQEA 3UJ2A 2ZX8A 4JIRA 4GI8A 1FCBA 5HJXA 2DW6A 3HG2A 3UTKA 3UNDA 4C6EA 2VHLA 5A2CA 3AIQA 3MANA 3NSXA 1F9CA 1Z9AA 1ICSA 3W4RA 1AJ2A 2GYIA 4ZB5A 3VGFA 3R94A 3WMLA 2Y63A 4ADTA 4UF0A 4GH3A 5JDFA 1WP6A 3KDOA 3HG5A 3ZQ9A 4H7VA 1SJBA 1QOXA 1VS1A 3F4NA 3RKOA 3BL3A 3LJCA 3W7DA 4RPQA 3TOYA 2ZUNA 1XC6A 1J5ET 5IM51 1QDSA 4I7WA 1SFTA 4BY3A 1DJZA 1BFNA 3LFMA 3ZO9A 2BVLA 4MFDA 4O8SA 4O50A 1WR0A 1M7XA 3W2NA 1R8LA 2F61A 2PDCA 4L5GA 1RK6A 2PDXA 1ZRQA 3BAYA 4UVCB 5CAHA 1Q7MA 3BW3A 1J11A 3URNA 1XDPA 1JI2A 4FXJA 4HNLA 5HXCA 1NARA 3NQBA 4GUFA 5FJPA 4FALA 3VDHA 2B81A 3EZ4A 1UJQA 4YYCA 3DENA 3ZFHA 3ITCA 2CLIA 2R1KA 2HHHT 3SCUA 2YPIA 2Z1WA 1TWDA 2ZX5A 4S39A 3JC6C 2XFRA 2FVLA 3LPOA 4GVIA 1LWIA 3BWWA 3KCOA 1JDDA 2FJDA 3HA1A 1D8CA 2JQ9A 1KGUA 4FXRA 1JIBA 2NWRA 1OT2A 1ZPTA 3EKLA 2GJRA 3FGCB 4QG6A 3SRHA 4JI2T 3DFTA 3WX7A 4C7DA 3GLCA 4HVXA 1V6UA 1B90A 1ECEA 1F8IA 2WZIA 2VDIA 1OIFA 2C1IA 4QE4A 4PCTA 2FKPA 1EH9A 3HZ3A 4ICNA 3NFUA 1KD0A 5CPMA 3TDFA 2VR5A 1W56A 1UROA 5E09A 3T8OA 5HAXA 4IUOA 2WCAA 1O1HA 2J75A 3WNKA 3RGTA 3P0XA 3A4JA 2RKXA 1XBYA 1GVRA 2JBMA 3HN3A 3CWZB 4U31A 4JTQA 6ALDA 1W3TA 2NXHA 5C6MA 4H41A 2Q01A 1UZ1A 2Z28A 3VDGA 5TAOA 3LV5A 1B0IA 4AQYT 3KVKA 5DX7A 2WM1A 3VR8A 2Q02A 3BLFA 1KM4A 1R2RA 2ZC1A 3PANA 3VM7A 2VT0A 3M0MA 2X1IA 1XLGA 1IT8A 2ZXQA 1B9ZA 4ADSA 5JRCB 2F6KA 1YTDA 4FX7A 3UU5A 3N4FA 1KM1A 4L1XA 1K6AA 4AH7A 4JL1A 3R13A 1ZAJA 1G7UA 3D3FA 4NT0A 4H2HA 4R7OA 2ZVRA 4KEZA 3VOCA 2VCCA 2DIEA 1A4MA 3R0UA 5EZYE 4L6OA 4Z91A 3E22E 1H49A 2ZRXA 1KC7A 5CKSA 3QB5A 4O18A 5FL0A 4AIEA 3V18A 1ALDA 1TUXA 3PZMA 2P0IA 4ZQOA 2BBHA 2D2OA 4NJJA 4KEMA 2QHAA 3ZN1B 2QF8A 5CGQA 2OEJA 3GIQA 2UWFA 3MB9A 1W0MA 2DQXA 2HH7A 4UTLA 1KBBA 3JCFA 4B91A 1EPVA 2J7GA 4QJ3B 3DU0A 1A0EA 4NF7A 1UBPC 5CZSA 2OKOA 1K70A 3S2JA 1GKPA 1YDOA 2YW4A 2OX4A 5C3JA 4ADUA 4B92A 3R84B 1JPHA 3MPGA 1ONEA 2QZRA 2P10A 3UCQA 4IE7A 4MBQA 4Y9MA 3WFAA 4M6UA 4V1Av 3CX8B 3P4RA 1TV7A 3DHDA 2WW5A 3RNDA 5BXTA 3RFAA 4UFKA 2NTYA 4PFMA 4HWCA 3BANA 4AZCB 2VYOA 3WFZA 4YTPA 3QR0A 1MW0A 1NWSA 4HFHA 1IXPA 3S9YA 2JPFA 4HNOA 3EABA 3C4UA 3K1DA 1U2YA 4QITA 3V5OA 4NAFA 1ISZA 5AC6A 1Y8BA 3JC6D 4DUZT 1PUDA 4OFCA 4PSPA 4W7VA 3PUEA 1H50A 1K03A 3RPTA 1OBAA 3AE8A 1IZCA 3C64A 4ZI3C 2OXNA 1Q7ZA 3AS0A 1JCNA 1HJUA 1QNVA 3TEVA 3M0YA 5CA1E 4G2AA 2HN1A 3TJLA 1T99A 4W93A 2WQPA 4JEUB 1FWEC 3NQ7A 3VINA 1UKSA 2E9XD 4ZB2A 1ME8A 4B5NA 4QSFA 2DZTA 2E6FA 4HN4A 2F84A 4GGHA 1H5VA 1V7AA 1H1ZA 4DJFD 1JRCA 3AC0A 3CNYA 2CC0A 4IL9A 1JF5A 3WUBA 4I50E 3RM8A 5AHFA 2WHKA 4Q32A 5AHIA 3KOXA 1A49A 3RPUA 3OBVE 3CZKA 2W92A 2WDRA 1V6WA 1CXEA 4CLMA 5KZ6A 5H6HA 1JCLA 1EO5A 1VPQA 4RZ4A 1Y7VA 1TTJA 1XH1A 4I9AA 4HYVA 1LLZA 2CXDA 4C7FA 4P7QA 4F0HA 1JULA 3W1XA 4P7RA 1QNRA 5HATA 2RJHA 1PZ3A 2D0UA 2WQYA 3UZJA 1WBJA 1KM3A 2M6IA 3RYIE 1AQFA 2E68A 1XF0A 4JYAT 3E96A 3CLMA 2A72A 1IZNB 4E4UA 3IVTA 1EDQA 1DIKA 5LXTE 1U5HA 3MV11 2IIUA 1CGVA 3G0UA 2C15A 2VCBA 3IVSA 3WQ4A 2BDEA 4D8LA 1OABA 4P8UA 4D6DA 4WQ6A 4DJED 1QVBA 2XYLA 1HP5A 2BLEA 3PZNA 4DR6T 1IBMT 3HB9A 4X63A 4PTWA 2POTA 1AJ3A 3XINA 3FDGA 4WSKA 1LOLA 4B5UA 3CUJA 4E38A 4IDZA 1YDYA 4R3UA 4UMBA 2VZTA 1B54A 5FF4A 2EF9A 1GOKA 4IPIA 3L4WA 4X1IE 3G77A 1VBUA 1LQ0A 4QE5A 3ZR5A 4Z42C 1VP5A 1P6BA 3LBXB 3N2TA 2YN6A 4D8AA 3T81A 5HNTA 4ZXLA 3NGJA 1D2KA 2GLKA 3RILA 3N9SA 4J27A 3MKCA 1QAPA 3G18A 4Q8TA 3IAPA 2OELA 3KZSA 4EF8A 1OX5A 5B7YA 4O4VA 3QSTA 2EPOA 3NPXA 5DBUA 2EPKX 1L6GA 1NF7A 3U2OA 3T2OA 1VCGA 1TV2A 4N9BA 3H53A 1FRBA 4XAYA 3EOLA 1YYAA 2AGKA 2YXXA 4PRWA 1C3FA 1EJSC 1Y5XA 1F8MA 3ONBA 1XUZA 5DCDA 1T98A 1EWDA 2PCQA 3ARPA 3KL3A 1JF6A 4D1JA 2A3EA 4OBRA 2YXGA 2ZICA 3KV5A 3RRWA 5JRCA 2VDGA 3STEA 4Z2LA 3N3MA 1H62A 5FXXA 2D69A 4S3GA 2XZ9A 4F0SA 3EUHA 4MY9A 1Z8AA 3DTOA 1JXKA 2ZM8A 3MKVA 5F7UA 4YHGA 4ADZA 2VTFA 2BXYA 4DB7A 3I4EA 5D30A 4KRUA 3N9KA 1TPVA 3UPWA 3UETA 4UTUA 5AQKB 1ZY9A 2OZ0A 3PPCA 1TJPA 3E2QA 3DG3A 3RX6A 2E28A 2HV5A 2PWUA 6A3HA 4F48A 3TW7A 1N32T 2YYTA 3UCCA 3URQA 2J9YA 3UXLA 3AVSA 1V02A 5K9CA 3UY7A 3RHGA 3W7GA 3EWZA 3NO1A 3W1LA 1RJQA 2ZUUA 3WNMA 4AHOA 1HF8A 1JNRA 3BICA 4TX6A 2PLCA 1E56A 3UT5E 4EZ4A 3SIZA 3AHXA 3BGJA 4A5XA 4J3TA 2DZWA 4XVEA 3W27A 3VNKA 4DZHA 2XHYA 1W5QA 3FFSA 3EMQA 5G2IA 5LA6E 4IQJA 3OKQA 3UA4A 3ZR6A 2X9WA 2PC4A 5ECVA 3TMLA 1VLIA 5F2MA 2V3EA 3DP7A 4CVWA 4S23A 3FV9A 3AMCA 4OX9T 4G9PA 4OHQA 3OO2A 4JLEA 1HT6A 3QK6A 4XBFB 5DF0A 1EHNA 4U2ZA 5JDMA 4WZXA 5E5CA 2CEQA 4L6HA 4MWAA 4XVDA 4IXXA 4Q4PA 3ZKRA 3RHWA 2INZA 3ZVHA 1THFD 5FNVE 2PAJA 5J2TE 2ZZ1A 1SJDA 1UWTA 3Q2MA 3U4FA 1GWJA 4ZI3D 1QI4A 3VOGA 3MP4A 3W6LA 5DABA 1US3A 3N9QA 4PUMA 3U7BA 4UMAA 3RC8A 2GQ8A 3GTHA 4GUGA 5LOVE 4QH1A 5CPOA 4QLLA 4UOQA 3CPZA 4QTGA 2LKHA 3MSDA 1VRXA 5AQJB 1K4HA 1BHGA 2NW0A 1REQA 5IXEA 4E4FA 2QVAA 1WUEA 3O16A 2E5CA 1V8EA 3V0SA 4H01A 3GN5B 3TIMA 2EHOC 4US6A 3ZLGA 3IS4A 1FUYA 1IZJA 1R3QA 1S5MA 4MJZA 5IYZE 2VO5A 5D8WA 1PCWA 5LNKA 1R6WA 1E1EA 1I8JA 4C65A 3VCCA 2QAPA 4XG1A 5D8ZA 3LENA 4IFKA 4HSOA 2O56A 2ZWYA 5GNYA 1A53A 5LYRA 1EOKA 3K1GA 1B3WA 3N73A 4WKAA 1YPFA 5C8YE 3M0JA 2EJAA 1MUCA 3SO7A 3RI5A 3WMBA 4ZO8A 3O2LA 1V0KA 4UQAA 2WBLA 3K3NA 2DT1A 2OLAA 2OZ8A 1LBMA 3PC0A 3CIRA 3KV4A 4B3TT 1CXHA 1E4MM 4RUBA 4I7UA 1O3XA 1NDZA 1RPXA 2YA2A 3AXXA 4M6VA 4HK6A 1PWMA 4FJOA 1FKXA 4JTDA 5G4WA 2QRXA 1M7OA 3NDZA 2PWGA 1UH3A 2RJGA 1DPMA 1U5VA 2A21A 4NAEA 5EMLA 3JR2A 3H21A 4IQDA 4DR5T 1U22A 3W7JA 5CZTA 1H7PA 5FEZA 4YU1A 1S1PA 4IFRA 1SVDA 1GORA 1Q6OA 3V36A 1L6FA 2VGBA 4FPSA 2VKHA 3P4PA 1GYLA 1W3NA 1IZKA 2G3FA 2G95A 1K9EA 1Q6LA 2NSOA 5IFPA 4HFBA 2VRJA 3TSBA 2FZNA 4HBKA 3WEOA 2HK0A 2BFGA 2D2SA 4JKLA 4MKNA 1Z42A 4R7JA 1QNOA 5KMGP 1O66A 4F9DA 1EXBA 2HQAA 4Q8PA 4CQ8A 3EB2A 5BXRA 4DBEA 3L2MA 2I57A 3NNTA 4ISSA 2QPSA 5E1QA 3R12A 3RIKA 3ESLA 3ZC0A 3FA5A 4PCNA 1XV8A 3H2MA 1Q63A 4CN4A 4AY8A 2YCJA 3GXMA 1VH7A 2DVTA 2F8QA 3EXSA 3TSMA 3K4DA 2VDHA 3MHUA 1D1BA 5EMUA 2ZE3A 4ZR8A 3OLDA 4XD3A 1YNPA 4H9MA 1XMQT 2GJXB 3A9BA 1BLIA 1YPXA 4PB3A 5M1TA 1QLBA 3WK2A 2GDVA 4EWND 2PLJA 4IPPA 1MIVA 8XIAA 1E7PA 1HX1B 3FZLB 3MDWA 1WBHA 1T96A 3A4XA 2HDJA 4K8GA 4J1OA 4IDOA 3EWWA 3G6LA 3A12A 4AY7A 1TRDA 2VUYA 3PBWA 4FZIA 1MMNA 2QCNA 1FWRA 2IW0A 2ZM6T 2VKJA 2J7CA 2Q9QD 3Q5WA 4UVAB 4J7RA 1V77A 3N04A 3DFHA 1QWGA 5JDLA 1QFEA 2BZNA 1CECA 3URBA 1I0BA 3RUBL 3ZIZA 4C6FA 1UH4A 2ZXAA 1UPMB 4UFHA 2YINA 1GOOA 3RRAA 4Q4QA 3WEZA 2W00A 3L0NA 3AE4A 1P0EA 2X9XA 1XW8A 4JIIX 4EXAA 5LHHB 5LGUB 2WHJA 1ITCA 2LJLA 1QOPA 3U2EA 2FZDA 2EHOD 1PBGA 5GQBA 4DN1A 4ZSTA 3RH3A 4HD5A 2PODA 4DMVA 5AQMB 2PGFA 4E7ZA 1UR3M 3N9NA 3LI0A 4GKKT 2PE4A 1FWFC 4HZMA 3B8IA 5JMUA 3TLWA 2NT1A 4DV0T 1ZBCA 2VEMA 3T8QA 3ZMTB 2JKAA 3CQ0A 1GQNA 3M43A 2JEPA 3FKKA 1R85A 5I3DA 3ZEFB 3MMUA 4Y96A 1TA3A 3RU8X 1L6YA 4AD2A 3QMTA 5IRPA 3LV6A 3DBPA 4IPNB 2FTYA 3T4CA 3BOFA 2WVVB 4GUHA 2WWUA 2NQHA 3PBYA 3VRBA 2HVNA 3L4XA 4GX8A 4AXPA 4RDWA 5CSSA 3WF1A 1O5XA 1TPEA 4A3YA 2FPYA 2QA7A 5EMJA 3AXIA 2V6AA 1R5YA 4LUSA 1WB0A 2F7FA 3WI3A 6TAAA 5BMWA 5D38A 3GNDA 4ERRA 5HMSA 2QCLA 3Q65A 1ISYA 4FIQA 1JGIA 4PUJA 2YU1A 4U72A 4ZI2D 3MO4A 4KT2A 3G1VA 4I9TA 3QYQA 2E8YA 3DKLA 1MIYA 3D3AA 1KF6A 4X1YE 1XPGA 3GUWA 4Z2GA 3F57A 2YIHA 1DWHM 3FXEB 4DV1T 2KLQA 2D9DA 1Y01A 4YXDA 3EGJA 2FGBA 3UXIA 1RJPA 1SU5A 1OFEA 2CZFA 4P8WA 4DWSD 3PURA 2G0UA 1LJYA 1HNZT 2VURA 4AB4A 1Q45A 1L2UA 3VD5A 4UV9B 4LF5T 2HRWA 4E7SA 2ACXA 5E9AA 2FJAA 2I16A 4WW0A 4RPPA 2VFFA 3H37A 1PJ9A 1OD0A 2KT9A 7REQB 4JD4A 2GSEA 1WLXA 4EIVA 2CYGA 1VBRA 2VELA 2WMNA 4KHZF 4ZCWA 2QIWA 4OGZA 5RUBA 2C16A 3VKGA 3R7MA 1YKHB 2FJBA 4XKYA 1HJSA 1GT8A 3NO5A 4S38A 3GY1A 2OSWA 2C79A 3MUXA 3WH6A 4B3ST 4TX8A 1E15A 4PCFA 4RR4A 3VD9A 2WZTA 3V5CA 3LTSA 2BS4A 2A7RA 4JY9A 3HKBE 3P3BA 4L56A 4J3UA 1EZWA 4YT0A 3K2GA 2DORA 3W74A 1KBLA 3SUVA 1PDZA 1B4EA 1UD2A 1EX1A 2BBFA 1GVYA 3N2KE 1WZAA 2O7SA 3KBUA 3S4UA 3VU7H 3MHGA 3IJQA 4IE6A 3N29A 3NEVA 1J93A 2Q9QB 3ZMUB 2OQLA 4IGHA 3JUGA 5K4ZA 3ARZA 5D4YA 2CNCA 3R8HA 3ARXA 3AYRA 4TWDA 2FDSA 1UMLA 4QS6A 2HXTA 4B3ZA 2Y8UA 4PODA 4HNUA 2GGHA 3GZ3A 3VYLA 3F4WA 2RA1A 4GZ7A 4C6DA 2P3EA 2WHLA 3S47A 4KBXA 4MIMA 3HM7A 3PG8A 3KOFA 1EYEA 2CBUA 2Z27A 4NXNT 2XM2A 5FVLA 5EKYA 2V8SV 2SFPA 3FHAA 4WNKA 3GB6A 1FDJA 3LS9A 1H11A 4WDWA 3CB3A 3WD2A 2WM9A 3SCWA 1W9VA 4IIEA 4EPEC 3NXFA 1KB3A 2XPKA 3D6NA 4E3TA 3CEPA 4NAFB 2ZX7A 3FXGA 4IFOA 4GISA 4HU4A 1MDLA 2WK2A 4M80A 4QDPA 4TXEA 2HCVA 4PTNA 3C6CA 1UD3A 2LHNA 3NQEA 3V16A 1PIGA 1F61A 4AD5A 3TE9A 1QUMA 3C61A 5BRPA 5AN7A 3BARA 3QOFA 4P09A 2XH4A 3ARSA 1LQ2A 3VE7A 2WY2A 5DMYA 4H63H 1FH7A 4J3WA 1DJWA 4JX4A 7TIMA 3UU3A 3A4WA 3S9IA 2VI0A 1XYZA 2WZMA 1DHKA 4EACA 1FCQA 1CIUA 2C13A 3M0HA 1V0NA 4FNRA 4LF8T 4NU7A 2GK9A 4L64A 1JI1A 2BVWA 3PY2A 3B05A 3SFWA 1X79A 3SWHA 4H9NC 4M51A 4CUCA 1UR8A 1BSIA 4B3MT 5C54A 1B57A 4L61A 3NBXX 3W87A 3VR9A 5FXZA 2XN1A 5D33A 3NL5A 2TODA 2VEFA 3LLFA 3E2SA 5CBIA 3TP4A 2WDQA 3MI3A 2VFHA 1BQCA 4F2UA 2XJ7A 4YJ2E 3K4WA 4DI8A 3AE7A 3L8RA 4ISTA 5IHRA 3OPSA 4XZLX 4R7WA 5I2UA 4NZFA 1NAFA 4PULA 5FJRA 5LG3A 3UYCA 1ELSA 1TUFA 4F4RA 3PZ9A 5AB3A 3AXJB 3O05A 1RD6A 1H0IA 3FEMA 2H3DA 3EWXA 4JTAA 3W6MA 4S3DA 1OK6A 1OGSA 5I02A 2PPGA 3O6DA 4ORIA 2IKJA 5L3DB 3H2AA 1R30A 3N6HA 3IJDA 1QPOA 4XAGA 1A80A 4DWSB 5DCBA 2VVSA 2BY0A 1QSDA 1DJQA 1PYMA 1QHPA 1YW0A 5LZLA 5J8LA 1EPXA 3ABRA 1XMOT 1R0MA 1CLXA 4IIBA 2XTLA 2PSNA 3CT2A 3BPWA 2QEZA 1TIWA 2R94A 4UQDA 3PULA 1ZV4X 1O5RA 4L0RA 4HZ7A 2NXGA 5AQNB 2RHGA 3OLGA 4J2CA 4LYRA 1G73A 1GQKA 3HKEE 2ASHA 2INFA 5FAGA 3KW3A 3VFLA 4JTLA 2AMGA 2ZZ6A 2WZHA 2QKFA 1G0CA 4BQ4A 3GDKA 5FP3A 3HGJA 2FH8A 3R79A 4IGUA 2X30A 5E0OA 4KEUA 1XFCA 3VZZA 3TTYA 3K1SA 2OU4A 3ZLHA 1HFAA 2XIOA 5G1MA 2BKOA 5C70A 1PDYA 1NM9A 1CXLA 3VGBA 2XVNA 5FCZA 3UQ4A 3LQGA 3C0LA 5ABFA 2XDFA 3ONXA 3KVAA 3UJFA 3WQOA 4LCRA 1XLEA 3RYFE 3H26A 1XBXA 1YQ4A 4X65T 4IZGA 3DGBA 3V35A 3VNZA 2KXPB 3AE9A 3AIEA 1SMDA 1ONRA 1WKEA 1G6CA 3TMQA 2PU0A 3NQDA 1S2UA 3PSWA 5EMMA 8TIMA 2VRQA 1XYLA 4NI8A 4E6MA 2J13A 5AECA 2C5JA 4Z2KA 3INPA 4ZS2A 4Q6JA 4EE9A 4E3VA 5C9UA 1JCTA 1J6OA 3JRKA 1BYBA 2REQB 4N78D 1J0JA 1LRQA 2OPJA 1PIFA 4W86A 4PZVA 3JU2A 3ZMVB 4X62T 1VEOA 3U48A 4JHMA 2QMKA 3OBEA 3GO2A 1K3UA 4V2XA 1UWSA 3QPZA 3KBWA 4QNEA 1H0GA 4RJEA 5CJNA 1CYGA 3RXZA 4DYJA 7PTDA 2FGLA 3WBWA 2GZXA 3VRAA 1GKQA 2EG6A 4EGWA 2C1HA 3VAVA 1UOZA 4JHZA 5HDRA 3WL1A 1C8XA 4LVGA 4N9EA 3U78A 3EX3A 3DGRA 3NYZA 3UWZA 4GIRA 1YXYA 3AHZA 4Z1YA 4UB9A 3AMLA 3L12A 3WL0A 5I3FA 4Z0JA 2W61A 1NSJA 4Y8FA 4WK9A 2G0WA 2YKKA 1JZ8A 3ZJ6A 4D6JA 3LHUA 2QCCA 3GVVA 2PP0A 5AVHA 1EEPA 4X60A 4U74A 4IMAA 5KINA 2BWGA 4P7LA 2HPMA 5I3HA 1K7EA 3IJ6A 4CXXA 4IT1A 3EB3A 3UUMA 5BCAA 3MMWA 4LOCA 3ECQA 3QGVA 1LM1A 4DELA 3C3UA 1V51A 2Q3RA 3B8UA 1QT1A 5E6ZA 3UULA 2OQHA 3FBLA 1W09A 1R9ZA 5CSRA 1R3WA 4HSHA 4Z2JA 1OD8A 1N8IA 2OT1A 5BROA 2XUEA 1FOBA 3FA3A 1ISVA 4QG9A 1W5OA 3PAJA 3WQDA 2RDUA 3SSJA 1ZQ5A 2GFTA 4UVBB 2DEPA 4PMNA 1NFPA 2FPTA 2V9DA 4ZTXA 2H9AB 3UNTA 3A5FA 4DPPA 3RG6A 3DN5A 4MY8A 2LSIA 1ODZA 4XB3A 1NOWA 1WQ5A 5HAOA 4MNMA 3LCFA 1U1UA 3T07A 4BQ3A 1W5NA 2W3ZA 3PPHA 2NV1A 2VEIA 4X64T 1FKWA 3F4VA 3P7IA 2VFIA 3GR8A 1F07A 3MKKA 5LNVA 1W54A 5F1VA 3TC7A 2X05A 5FVKA 2GDUA 3CAWA 1JFXA 1L0VA 5HK4A 3OA3A 2J25A 2XUCA 1BVNP 3TWBA 4DM2A 3OB8A 2NUXA 3TNBA 2V8ZA 4NZ3A 1QCWA 4H4IA 1R46A 1SZNA 1OYAA 1BWLA 4JFUA 3W29A 1LRZA 2XN0A 3KLKA 1Z8UA 3NURA 2OKTA 4DQWA 2OOFA 4OFZA 2NUYA 3S42A 3NOYA 1AW2A 1LT8A 3AWNA 3H55A 4GY7A 4JEJA 1GHSA 1TTIA 2PDWA 2I56A 1XS2A 4AWEA 3DZ1A 2CXFA 2DVXA 5CC3A 2BSLA 3LCLA 2CWYA 4FXSA 3K8PC 2J66A 2RDTA 2VEPA 1FWNA 1TG7A 4CCZA 5LGNB 1WR6A 4IIFA 3W3OA 2QJMA 1UD8A 5DT7A 3T09A 4A8NA 3LCHA 4HMNA 3V0TA 3I0OA 3ZT7A 1G8XA 1VFFA 1WYIA 2WWCA 1F6YA 3G22A 2XINA 1PTGA 3H4WA 3MJMA 4UCFA 1Z6KA 4EPKA 1UW9A 4F0LA 3M5VA 5DY3A 4M7SA 1KFYA 3R89A 1RXOB 4TVDA 3QR1A 3T42A 4DO0A 4JNMA 3Q67A 4UTMA 4C6PA 2CLMA 3O8AA 4PL2A 5F4XA 3AI0A 3C56A 4Z8XA 4J3XA 3PV0F 2C18A 4JIQA 4O2BE 4RW5A 3AA0B 5L47A 3VIGA 2YDRA 2E9XA 1P1XA 1L2QA 3PWGA 7TAAA 2FH6A 5FF2A 2EGZA 4AC1X 2X0HA 4HP5A 1KXHA 4DO4A 1IR1A 3Q2DA 1NEKA 3STPA 1JZ2A 4V15A 1TV4A 5HJLA 4FLQA 3PK7A 3CEUA 2CETA 5EFDA 4M1PA 3MWCA 5EK4A 4J2MA 4XK2A 1MIWA 4Q8VA 4WBOA 3NM1A 4C5YA 3IIXA 1J0YA 2E9XC 1V4YA 2OYLA 2J79A 2D3LA 2DWGA 2PDLA 2WU2A 3MVIA 4HK5A 3BSHA 3UZ5A 3N6JA 4NJIA 4GZJA 4MZ8A 3L7RA 1JDCA 2WMHA 1XISA 2ZVIA 3GS6A 3E0LA 4LEFA 2QAFA 2VX6A 1Q2SA 3TH6A 4UNKA 2MNRA 2X0YA 4HNVA 3PUXF 4XSMA 1A5UA 5E9XA 4QP0A 2H8ZA 5AHLA 5FESA 4PB4A 2V26A 3G1SA 1V6XA 2CIPA 2P8BA 3L23A 4H9SE 2FHFA 2MPKA 3E9AA 1MNZA 1FHVA 4LJ3A 4EOUA 3TX9A 2A6NA 3KCLA 3WK0A 3D0TA 3OVGA 1D0ZA 2X8RA 3WKZA 4P5UA 4IP4A 3EDFA 2J7FA 1XQLA 1IQ8A 1UC4A 1LF1A 3PZGA 2DFAA 4LYKA 3EWCA 4GFSA 4QIUA 5AVNA 1E40A 3W7IA 1QHOA 4GGBA 2DT0A 1QI0A 4PJLA 2WCSA 2F2KA 4PEKA 3EDKA 3UUBA 1CHUA 4XTIA 4PMOA 1YIXA 1EUNA 3TAOA 5ABHA 3EX4A 2L3LA 3N25A 4CQ9A 2KZHA 4ZS3A 5JR9B 2UY3A 4H8VA 3VIJA 4AWSA 4NZ1A 3SN1A 2WU5A 3WLPA 4HQVA 3MCNA 1KXTA 5EGRA 2ZC8A 1K8XA 5ABTA 1V5XA 3LHWA 5FOOA 1KV5A 5HBFA 4GXMA 3UJRA 5FXVA 2NV9A 1QW9A 3MZNA 5A8OA 3ELFA 1PE1A 1UH2A 4PCSA 4DBWA 2Y89A 2VFDA 4IL2A 5K4XA 3S5NA 1LUCB 2VWSA 1G01A 3SM0A 3N2GE 1HG5A 5JREA 3NQ6A 2NQJA 1UA3A 1JCYA 4FSAA 3ZSSA 1Q13A 3IEBA 1T8XA 2LHRA 1ZBWA 2PP3A 5KZDA 1VB9A 3N9MA 1WZMA 5I06A 3AHTA 1TV8A