2W62A

Saccharomyces cerevisiae gas2p in complex with laminaripentaose
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
461
structure length
436
Chain Sequence
SFEKTPAIKIVGNKFFDSESGEQFFIKGIAYQLQRSGAFETSYIDALADPKICLRDIPFLKMLGVNTLRVYAIDPTKSHDICMEALSAEGMYVLLDLSEPDISINRENPSWDVHIFERYKSVIDAMSSFPNLLGYFAGNEVTNDHTNTFASPFVKAAIRDAKEYISHSNHRKIPVGYSTNDDAMTRDNLARYFVCGDVKADFYGINMYEWCGYSTYGTSGYRERTKEFEGYPIPVFFSEFGCNLVRPRPFTEVSALYGNKMSSVWSGGLAYMYFEEENEYGVVKINDNDGVDILPDFKNLKKEFAKADPKGITEEEYLTESVECPHIAVGVWEANEKLPETPDRSKCACLDEILPCEIVPFGKYEEYFSYLCSKVDCSDILANGKTGEYGEFSDCSVEQKLSLQLSKLYCKIGANDRHCPLNDKNVYFNLESLQPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLYCOLIPID-ANCHORED SURFACE PROTEIN 2
publication title Molecular Mechanisms of Yeast Cell Wall Glucan Remodeling.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 162
structure length 436
sequence length 461
ec nomenclature ec 2.4.1.-:
pdb deposition date 2008-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03198 Glyco_hydro_72 Glucanosyltransferase
A PF07983 X8 X8 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1040 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2w62A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2w62A01
3TONA 4CCDA 1BFNA 4QCEA 3AQUA 3SCVA 2JEQA 1JYXA 1GPFA 4MAZA 3WNOA 2RGMA 2CBIA 1RD6A 1H4PA 3AYSA 4PCSA 1Q4NX 4PMZA 1DP0A 2J7CA 2ZUSA 2ZUWA 2DT3A 3IJ7A 1JYWA 2CBUA 2J7HA 5ABFB 1OGBA 4W5ZA 5A69A 3VM7A 2OYMA 1J0YA 1W91A 3W4RA 2CCRA 3EDJA 4W8LA 4U3AA 4CGTA 1BYDA 1XD1A 4AD0A 3JUGA 5EBAA 1MYRA 3A3HA 4MB4A 3B9AA 3PBGA 3ARYA 4GPNA 4W5UA 1I1WA 2WSPA 1DWGM 2BVTA 4PMRA 4ACZA 1AQMA 3W53A 2VRJA 3GYCA 4CU8A 3FY1A 4TUFA 3A47A 4HMDA 4M24A 2WC7A 4WK9A 1WPCA 3WFZA 3BLKA 1SYTA 4GQQA 3WDRA 3THCA 1GVIA 2EQDA 4ZXOA 2WANA 2XFRA 2Z1SA 3ALGA 4IUGA 1J0HA 1EDTA 1J10A 1W1YA 2GUYA 3ZT7A 2JF7A 1W3LA 1GOIA 4AC1X 2RGLA 4X9YA 3W25A 4J3WA 2XFFA 4X0NA 2VZUA 4DUWA 4LPCA 3CZ8A 3WF1A 1UD3A 1HJXA 1Y7VA 4J7RA 2D24A 3RPMA 4WKAA 1HNYA 1I75A 1G94A 2WCAA 1MW1A 1EO5A 3VILA 1E15A 3A4WA 2DH2A 2J25A 3WDIA 1D2KA 1IZJA 3MUY1 1LG1A 5ABEA 4HPGA 5A6JA 1BAGA 1FP9A 2PWGA 3F5JA 2J8FA 3DHUA 4DWSB 3ARQA 3AIEA 4MDPA 1BHGA 4A3HA 1QHOA 1NOWA 1GOMA 2CKRA 2WHJA 4CN1A 1OGSA 4PSPA 1VFFA 4BQ5A 1HP4A 3WD1A 4CVUA 4X0VA 4RE4A 1J18A 1LWHA 3MS8A 3VGHA 1WP6A 7TAAA 4W7VA 4QAWA 1PIGA 3OA5A 1ISZA 3EDDA 3B8SA 4U3CA 4AD1A 5IHSA 2XSBA 4ZE5A 2WCSA 3VIGA 1B90A 2BVYA 1EIBA 3K8MA 3N17A 3N18A 4W84A 1WDSA 1ZS2A 3LMYA 3PZMA 1GOQA 2W67A 4Z2LA 1G1YA 4MTVA 4EAMA 4H8HA 2BS9A 1GHRA 2EPKX 3GXDA 3VIMA 4WJXA 1J11A 4E8DA 5BXTA 1TE1A 2ZXDA 3W0KA 1QW9A 5M5DA 3VMNA 1CPUA 4LX4A 5GQBA 3VGFA 3WUBA 2VQTA 4YPJA 5HXMA 1NWTA 1H41A 4P7OA 1VBUA 2G3NA 1ZL1A 4UQBA 3OIHA 4D6HA 2VUYA 4ACYA 2GJPA 4S3JA 3WSUA 2VX5A 1J0IA 1UR0A 3WNKA 2G3JA 3TTYA 1OINA 1V3KA 4AISA 4U5IA 5I79A 4Z2JA 5BRPA 4AXNA 4C7GA 5CG0A 2IUZA 5JBFA 1DWIM 1UH3A 2VX4A 2O9OA 3CUIA 3QHOA 1KGXA 2C8NA 4XZBA 2W5FA 1V6XA 1C7SA 1E6XM 1J0KA 4KGLA 1E6RA 3APGA 5C8BB 1ECEA 4PMNA 1EDGA 3T0DA 1BLIA 5D9PA 1TA3A 3BC9A 2Q8XA 3NYDA 4JAWA 4MJ4A 4YHEA 2BY3A 4NI3A 4W89A 3WY1A 2YBUA 3WL0A 3SCQA 3WL1A 1ZJBA 5A6SA 2YL5A 5D8ZA 1LWJA 4F66A 5A6BA 2V38A 2WMIB 2O92A 3IAPA 1LJYA 3AYRA 4PUDA 2D23A 2JEPA 4TTUA 4J3SA 4UR9A 2UY4A 4NF7A 1HIZA 4QLJA 1UZ1A 2YLLA 2B31A 2C7FA 1VJSA 1WNOA 1E1EA 2VJXA 6TAAA 5CLWA 1WZLA 4TVDA 2DPEA 1CEOA 2XTKA 1FHLA 2C0HA 4BCEA 3TTQA 3ZOAA 3NSXA 4W86A 2WHMA 3UG3A 3WH6A 2J8GA 3GBEA 5D9OA 3SURA 1VFMA 4PSRA 2F2HA 3GZAA 3VVGA 3VDCA 3MV01 3ZJ6A 3VD4A 2YA0A 5IDIA 4PMOA 1OSEA 5I24A 4PMUA 1TUXA 2DIEA 2CHOA 4AYSA 3VD9A 3SCUA 4AWEA 3WNLA 3WDHA 1NWSA 4GXPA 2WBKA 3VIIA 4WF7A 1ODZA 3VINA 2VNCA 3FXYA 3UG4A 3UESA 1ITXA 5HPCA 1E0VA 1XCWA 4PTMA 4XB3A 5BRQA 1G01A 4AIEA 1VBRA 2Y8KA 2DIJA 1E55A 4N0RA 5CGTA 3CMGA 5D8WA 4U31A 1EA9C 4PBGA 2NT1A 3G6MA 2WVVB 3ARVA 4D72A 4Z2HA 3PTQA 1MW0A 5DO8A 3VO0A 4DWSD 3I3BA 4U2YA 4F9JA 1Q6CA 4B3KA 4UFJA 1CLVA 2XVGA 1E0WA 2EPLX 1M01A 1M04A 1JZ5A 3MMUA 3WBEA 4BQ3A 1W3KA 3D5HA 3LPGA 3N13A 3W24A 2ZXAA 2WHKA 2Y2WA 1OM0A 4KRTA 4W8BA 3UERA 1NOUA 3N15A 4ZEPA 4P7NA 5E6ZA 1ODUA 4DM2A 1V3HA 3MO4A 4QDMA 3AHZA 1V0KA 4PTWA 3ZSSA 1BTCA 2CESA 3K1DA 3THDA 4BQ2A 1QBAA 2VZVA 2VCAA 2ZWZA 4MB3A 1W9BM 1O6IA 2AAAA 5EFFA 3UEQA 2ZIDA 1GOWA 4D6EA 1B3YA 4IPNB 1E4NA 1W9DM 2CERA 3ARRA 4LGXA 4CN6A 4N42A 3PZGA 4BZYA 4HMCA 1JXKA 1HF6A 1W2VA 5CQ1A 4P7QA 1UKOA 4PN2A 4LYPA 4PMYA 2G41A 1K9EA 2NT0A 4RE3A 1UKPA 1G9HA 3MSDA 2J4GA 2D22A 1B0IA 1UR8A 2QPSA 3AXIA 2EPOA 4AIUA 1JYNA 2BY2A 4V28A 3W6MA 2WZIA 5I77A 3AICA 1CENA 2W4XA 2J7BA 2FH8A 1E43A 1M7XA 3VPLA 1OT1A 1RP8A 3MKKA 1K9TA 1VEMA 3SCTA 4HA4A 3QGVA 1GZJA 3BCDA 2XM1A 3UETA 1GQIA 1CGUA 1HVXA 2OWXA 1JZ8A 1EO7A 3VMPA 1OIMA 1LG2A 1DHKA 4HMEA 1UD6A 4TVUA 1AVAA 3VDAA 1H0IA 3NCOA 4HZ6A 1W9VA 1ZB5A 2UY3A 1UWTA 1KR1A 2JIWA 1GONA 1HL9A 1BGAA 4QCFA 4M81A 2GDUA 5DF0A 3AS2A 4PTVA 1MXGA 3WMSA 1VF8A 2BY1A 5E9AA 2VR5A 1GOOA 2GJXA 1CZ1A 3PZQA 1JD7A 1CDGA 4XX6A 1JGIA 3GDBA 8CGTA 1HJVA 4CU7A 1JYVA 3AMKA 3AHVA 1HKMA 1M53A 2OYLA 1GQLA 4W87A 1CGVA 4ZXLA 3FAXA 2XYLA 1WZKA 4AIOA 4KH2A 1JAKA 3RJYA 3ARXA 3UR8A 4GI9A 2VZOA 4AD3A 4E4PA 2UWFA 1XHGA 4J28A 5CPSA 1GNXA 3U5UA 3BMWA 4UFLA 2NW0A 2JFEX 1KCLA 2ZXBA 3OGVA 3WQ4A 2W61A 1Q6EA 3T2QA 4UQ9A 5HOSA 1JF5A 2D0HA 2WC4A 3RCNA 1NOFA 2FGLA 2WZEA 3RM8A 1C8YA 3ZJ8A 4W88A 1BYBA 3ARZA 4OZOA 1UUQA 1ISWA 1WDQA 4HA3A 2XM2A 1G0CA 1UYQA 5D4YA 1MQPA 2WPGA 3W37A 5AYIA 4D6IA 1RPKA 3WUEA 1J0ZA 1YHTA 1JAEA 3BCFA 3RM4A 4HA1A 2DT2A 4P7RA 4HU0A 3ZT6A 2WXDM 4UOZA 2GK1B 1VAHA 3NDYA 2WK2A 3F4VA 1VRXA 1QBBA 3AHYA 2XFYA 3T0AA 3BAYA 1W9XA 2BNJA 1KXQA 2G4FA 4DM1A 3OGRA 1TFVA 3GNOA 3KL0A 4L4PA 3BLPX 3AIBA 3GXIA 2NSXA 1E72M 2JE8A 4J3VA 1UD5A 5AYBA 2XHYA 1OGGA 5I0DA 1BVNP 4E2OA 1TCMA 1KQYA 4Y7EA 4HZ7A 2EEXA 1K9DA 5ABFA 3PZVA 4FMVA 4D1IA 3SIMA 1V02E 1MFVA 1B31A 5EB8A 5A6AA 1UH4A 1UD2A 3L4VA 5CJ5A 1NH6A 5M03A 1TZ7A 1E3XA 2IXUA 1D7FA 4FLOA 4PYSA 3AMCA 3PTKA 4JL2A 3RM9A 2GDVA 3WEOA 5FCZA 1V0MA 1IT0A 4QLKA 1PJ9A 1AQHA 1EH9A 1UR4A 1B3ZA 1W32A 3TTOA 3LPOA 3WELA 4AMCA 2JF6A 3W81A 3FW6A 4TVCA 1H1NA 4AW7A 4S3KA 1Q6GA 5E6YA 5LA2A 3SUUA 1PZ2A 4AZGA 2OSXA 2BFGA 3DC0A 2VCCA 2XVLA 1W1PA 2E9BA 1XH1A 3AIQA 5A3HA 3U7VA 2WMFA 2QMJA 3CZJA 1ZJAA 4QLLA 1O7AA 5BXPA 3T0BA 1BG4A 1EOKA 2D0FA 2HVMA 5GNZA 3EMQA 1JFXA 2EPNA 4L4OA 3PTMA 2CIPA 1XRVA 1ZBCA 2YJQA 1JI2A 3L2LA 2ZOXA 4H41A 2DSKA 4FF5A 4PCTA 3GXFA 2VC9A 1UD8A 2AMGA 3PZ9A 1JNDA 2WLYA 4Q22A 3ZJ7A 3M07A 5BYWA 2BXYA 3WH7A 1US3A 2BHYA 2YIHA 4FLSA 2J74A 3FHQA 1E6NA 1UWSA 1CECA 4DWSA 4GI8A 1DWHM 3WMBA 2F8QA 3AI0A 3WUGA 3SUWA 3MMDA 3ZSTA 4CUCA 3KL5A 4FK9A 3PZTA 1CGWA 1CGYA 1P6WA 5ABGA 4E8CA 2CYGA 1CXIA 2DT1A 2XGIA 1UR1A 4AZ6A 4F8XA 4UNIA 3VIKA 2VZTA 2PI6A 3UR7A 1C91A 4GIAA 2W91A 3OZPA 3BAKA 1SFSA 2WCGA 1BYAA 1JZ3A 1FA2A 4MJ2A 1JXJA 2VRKA 5DMYA 2YDSA 2ZX6A 3GXMA 1KBKA 1BPLB 1LL7A 1F4HA 3HJEA 3ARSA 4HTYA 2PB1A 1S46A 3GTNA 1ZBVA 3IANA 1TA3B 4JCLA 1V03A 5IFPA 1XH2A 1R7AA 3TP4A 3POHA 1E6QM 3TOPA 3MUZ1 2PWHA 3WQ5A 3OZOA 5CXPA 3L2MA 1QI4A 1OT2A 1UA7A 3BAXA 2BY0A 3AXXA 3CHCA 5E0CA 3L4YA 3WFLA 2ZWYA 5ECUA 3SUVA 3VGGA 2VR4A 3AOFA 1GJWA 5BROA 1KXHA 4Z2IA 1HJUA 1E6PA 1OIFA 1UR2A 2FHFA 4IM4A 2OSWA 3MANA 4C7DA 1JDCA 1VENA 5D9NA 1V6VA 3F5LA 1W3JA 5DEZA 4F79A 5FD0A 2VZSA 3PZOA 3W27A 3AS0A 2A3EA 5DT7A 4GKLA 1NM9A 2AOSA 2W92A 1E4IA 3FN9A 3RIKA 5JBEA 2D3NA 1EQCA 3T2OA 6A3HA 2BVDA 1E70M 1KCKA 2WBGA 2Y4SA 4V27A 1JD9A 2V3DA 1A3HA 1QHPA 4W8AA 3U5YA 3AIRA 2EJ1A 4JKKA 1CLXA 2D20A 4UTFA 1HX0A 1FHDA 3VNZA 1WCGA 4P8UA 2WAGA 2CBVA 2V3GA 3VM5A 3K8LA 4LYRA 2FHCA 1Z32X 3KWXA 4JHZA 2Y24A 4ZENA 3GH7A 1FH7A 1QNRA 2WVUA 3AS3A 2X8RA 1HP5A 1HL8A 5JUVA 1XSJA 4CU6A 2A3AA 4HOXA 1MFUA 3AIUA 4BQ4A 1KR0A 4AZ7A 4XUYA 1GVYA 2UY2A 4M56A 1QHZA 3W28A 3BSHA 2VL4A 2PC8A 5A6MA 1GJUA 5I3DA 3MV11 5CZKA 1WKYA 3IJ9A 4CD8A 2YL6A 2QHAA 4HZ8A 3WNPA 3VUPA 3L4XA 2OYKA 3L4ZA 2A3CA 4CD6A 3VGDA 3PN8A 4W93A 4PMXA 3BSGA 2PWFA 1B9ZA 1VJZA 4EANA 4JFSA 3VD3A 1NQ6A 3DYOA 1CXKA 1NWRA 1E9LA 2A3BA 5E09A 4UQCA 3WD4A 3II1A 5DT5A 1UWUA 3AROA 2X1IA 4AD5A 5M3WA 4LQ1A 1ITCA 1X6LA 1B30A 3TTSA 4AD4A 3WDPP 1YQ2A 2DSWA 2VURA 3MUIA 4TX8A 4GQRA 4W7UA 4OJYA 3VIJA 3ALFA 4YN5A 5EMYA 3FHAA 3E1F1 5DFAA 1PX8A 2W62A 2ZUTA 1KWKA 5IFTA 3D3AA 5AY7A 4D1JA 5IXEA 1E5JA 2CETA 1HJQA 2DSZA 4J27A 1GQJA 3GNPA 5BXRA 1WDPA 2WVVA 4EK7A 3VDBA 1HJSA 1BGGA 2X0YA 1UD4A 2J47A 2QLYA 1HVQA 1RP9A 1SMDA 3IK2A 3VGBA 3WH8A 2WVTA 3CUJA 3U7BA 2O9PA 4UOJA 1OCQA 3K46A 4KMQA 3WBAA 5JIPA 4BA0A 2X2YA 4CCEA 3OGSA 1H3GA 1TVPA 2E3ZA 1KXTA 4TOQA 3AIVA 1E40A 1XC6A 4OBSA 1V6YA 2YL8A 2VO5A 4MPKA 5GPRA 3B9EA 1JZ7A 3WQVA 5HDRA 1E5NA 3AXHA 4M1RA 4OOUA 1BVZA 1ESWA 2WVSA 2VRQA 1UQYA 3ZIZA 5A6LA 2BXZA 2XIIA 4B9ZA 1MWOA 2Z1KA 4A3YA 1MW2A 3AISA 3QHNA 3N11A 5TD4A 1BQCA 3A4AA 1CGTA 2CBJA 3W26A 4K68A 2EPMX 4B3LA 1Q6FA 1MW3A 2DGAA 2GFTA 3CHEA 4MADA 4GO8A 3WQ8A 2CHNA 1OB0A 1H49A 2DSVA 5A2CA 3VMOA 5HPOA 5E70A 5A6BD 1M03A 3KE0A 2CXGA 3HMCA 3RJXA 1QPKA 1LL6A 3RILA 1CGXA 4UCFA 1W9PA 4MDOA 4F9DA 4M80A 4JKMA 4ATLA 1FOBA 5FL0A 5I23A 1CYGA 1EHNA 2WKLA 3AMLA 3SCWA 1U2YA 3CZLA 5A94A 1W9UA 3TA9A 2WMGA 2E8ZA 4PTXA 2W63A 4V2XA 3VGEA 1CXFA 4AEEA 7CGTA 1OD0A 4H8VA 2VTFA 4BF7A 1E4MM 1FH8A 1DWJM 2A3HA 5FKYA 2J79A 4ATDA 1XH0A 4MB5A 3N04A 1CIUA 2BV9A 2J78A 7A3HA 1WZMA 4AZCA 1US2A 2E4TA 4Z2GA 3I3EA 1OD8A 5EFDA 5CLTA 3CO4A 2TAAA 1QNOA 1JL8A 4P7LA 3AHXA 4GZIA 3BGAA 2J62A 3GBDA 1QW8A 2VVNA 3AHTA 1E4LA 1EXPA 1LF1A 2G3MA 1QOXA 3NSNA 4H8UA 2XVKA 3CH9A 1L8NA 4GINA 1UH2A 3OLGA 4GZEA 3ZR5A 1JZ6A 4AZHA 4JFTA 2D3LA 1H09A 5FOOA 3DYPA 4NZCA 4JFWA 1BG9A 3CIVA 5GNYA 1D3CA 4Q7NA 1U30A 1HKJA 1HXJA 2D2OA 1R87A 1DTUA 1XSIA 1XGZA 5CSYA 4FLQA 4QP0A 5ABHA 3W38A 1BYCA 2E9LA 3CUGA 2ZUVA 5A8PA 4JFVA 9CGTA 3EBVA 4P8XA 4ACZB 2OLHA 2BHZA 4D6CA 2X0HA 4WLCA 1AMYA 4J3TA 2WW5A 1MQRA 2WYSA 4P8VA 2PBGA 2YOCA 1IZKA 4YHGA 2VT0A 4UQEA 2Y5EA 2ZX9A 3IJ8A 3WH5A 4R27A 3WF2A 2XGBA 4CD5A 4HOZA 4CD4A 1E1FA 4UOQA 4ML4A 1MQQA 3QOKA 4M82A 2XIBA 3GM8A 8A3HA 2ZX8A 1V3IA 3O6AA 1C8QA 1VFOA 5I6SA 1B1YA 4AZIA 1CBGA 2JALA 1UWIA 5KEZA 3CZGA 5HBFA 3SCOA 2WM0A 1K6AA 2ZX7A 1L0PA 1VEPA 4ATWA 3AZTA 1E73M 1XSKA 5BXSA 3SUSA 2D0GA 2GK1A 3SEPA 1HJWA 1HN1A 2J77A 1V0NA 2XWDA 3CBWA 1H5VA 4H2CA 3LPPA 2DQXA 2E40A 2VI0A 2HISA 1KXVA 4AD2A 1WO2A 1I1XA 1XCXA 1ZBKA 1NARA 4NSBA 4PUEA 2J7FA 1B3XA 1EOMA 4MNKA 3SCPA 2PF0A 1V3JA 5E0FA 5GNXA 4JCMA 3O2LA 3VDHA 5CPQA 4JHOA 2CKSA 1JDAA 1BSIA 1JI1A 1H0GA 3T2PA 1A47A 1J9YA 4ZFMA 3L4UA 3OB8A 3EDEA 3G6LA 3KL3A 4LXFA 4AY1A 1JIBA 3WNMA 2PWEA 4WIWA 4XV0A 2WHLA 1KGWA 1HKIA 1QNSA 2WZHA 1MVYA 2WB5A 2X05A 2W66A 5A8NA 4URIA 1ZBWA 3CTTA 3SCRA 2YBTA 1Q6DA 3EDFA 1V3MA 4OUEA 2ZUNA 3W29A 5AC4A 3MMWA 3CMJA 3NUKA 5A2AA 1C8XA 2VMFA 2G8ZA 4OOZA 4BS0A 4CVWA 2VVSA 1H11A 3SUTA 4ZE4A 1UOKA 3B9DA 2XVPA 2GVYA 2J7EA 3ZR6A 3A4XA 2YA2A 4D71A 2VX7A 4WSJA 1SMAA 4UFHA 1F4AA 2YLAA 5A6KA 2DDXA 4PEEA 1UQZA 1QNPA 1KWGA 3BXWA 4WSKA 3N1AA 4OBRA 2D1ZA 1UKQA 1WDRA 4DUXA 3WDJA 3VNYA 1LL4A 4TX6A 1QVBA 3WF0A 2YDQA 3KZSA 1RH9A 3WQWA 5IHRA 1R85A 1KB3A 5BCAA 3MU7A 3WEMA 1XYZA 3EMZA 4HP5A 3OBAA 1PX4A 1FFRA 1LQ0A 1CXEA 2DH3A 5D9MA 1QI5A 2UY5A 1OWQA 1E6SM 3CLWA 1V0LA 5M17A 1UZ4A 3NJ3A 3PHAA 1CNVA 1FH9A 2XG9A 3N9KA 3S6TA 2WKGA 3VU2A 3CGTA 1ISYA 3CUFA 5CPTA 4EKJA 4D6GA 4OIFA 3WH9A 2YL9A 3VIFA 1GW1A 3CZKA 1XYFA 2ZICA 1C7TA 2JIEA 4UQDA 2CPUA 1EHAA 3I3DA 3WF3A 1HKKA 3J7HA 1TVNA 4LYQA 5KZ6A 4JZ5A 1UWQA 2QMKA 5LA1A 1CXLA 3VKKA 3AZSA 3CUHA 4HU8A 4GI6A 1EQPA 1W1TA 1UG6A 4PMVA 2DT0A 3SCNA 3QR3A 3M46A 2WC3A 3AFBA 1CWYA 1VIWA 2CITA 2VQUA 3BAJA 3CHFA 3T09A 1XV8A 1C3FA 3OLEA 3DYMA 5A1AA 2IXVA 3RMEA 2OSYA 3N12A 3AS1A 1ISXA 2FH6A 3FNDA 4JKLA 3WDQA 2EO7A 3BH4A 5A95A 1SR0A 2BHUA 3CZEA 2FHBA 3OLDA 4Z2KA 4B15A 3WUFA 2CNCA 3ARTA 3SCSA 1WB0A 4PRWA 4C7FA 4UFMA 2V5CA 3EYPA 4FLRA 3VIHA 1UHVA 1J01A 3ARWA 1PBGA 4H7VA 2Y8VA 4EE9A 2V5DA 4J3XA 1B2YA 4W85A 1C93A 3L4TA 2WMIA 1JDDA 1K9FA 4MAVA 3EMCA 1BF2A 4J3UA 2ZXQA 4UZSA 3K4AA 1TR1A 3VIOA 4RE2A 1PIFA 1QI2A 3AMGA 1DWFM 3WMCA 1W1VA 4JFUA 4JIEA 4A4AA 4HOWA 4DUVA 3PZIA 3IAQA 1V6WA 2E8YA 2GSJA 3LPFA 2GJRA 3MSGA 5FL1A 2FGZA 4NRSA 3NIYA 2DEPA 2YKKA 1V02A 1CTNA 3CPUA 3ECQA 2OWWA 1NP2A 5FIPA 3WKZA 5I5RA 1GCYA 1N82A 3O9NA 2X09A 3L4WA 2VX6A 4QFUA 2QF8A 4D6JA 1NWUA 2DSUA 1HT6A 2XUCA 4IPLA 4CD7A 1PX3A 3DHPA 5JBDA 4GO9A 5CGMA 3A6OA 1CXHA 3VX1A 2PWDA 2XPKA 4R5EA 1DWAM 3VIPA 3MUAA 4D6DA 3K4DA 4U5KA 3S2CA 3AJ7A 3ZJKA 3F5KA 4KWUA 1KQZA 3WD3A 2XSAA 3NDZA 4B16A 3ZO9A 1KBBA 4PMDA 3PZUA 4P8WA 1LLOA 3BMVA 1E56A 3WEZA 3VD5A 1W2PA 3ARPA 4MNJA 1JZ2A 2XWEA 1V3LA 3QHMA 3NSMA 3DECA 1R86A 5F7UA 3W6LA 4KGJA 4NRRA 4HPHA 3QOMA 3WQ6A 1NP0A 4IISA 3VTRA 1KFWA 3WF4A 2WMHA 4MB1A 1QNQA 1UKSA 3M7SA 1JFHA 3GNRA 1C92A 1E0XA 3RO8A 1G5AA 1R8LA 1R7OA 4CKQA 3WENA 5AC5A 2ZX5A 1E6ZA 4WKHA 5C70A 1PPIA 5C71A 1ISVA 1PEZA 5A8OA 1JG9A 4CCCA 2QPUA 1WE5A 3ARUA 4UFKA 2J75A 1PZ3A 4M8UA 4U2ZA 1UR9A 3ZMRA 1VB9A 1GUVA 2XVNA 4RL3A 4UQAA 3OG2A 3VX0A 2PBOA 3GH5A 3HN3A 1JNEA 4PMQA 1DEDA 3GH4A 2G3IA 2WNWA 1PAMA 1ZU8A 4UZUA 1AQ0A 2J7GA 4AEFA 5CSUA 1VEOA 3UCQA 3ZT5A 2ESCA 5A8MA 2F61A 1GORA 5BWFA 1V6UA 3EDKA 3WD0A 1FFQA 1QI3A 1H2JA 3VD7A 2E0PA 1E71M 6CGTA 1X1NA 2GJXB 4MNMA 4M29A 3WD2A 2WWCA 1C90A 3VOCA 4D6FA 1WAWA 1KGUA 1OBAA 1GOKA 5A8QA 4W7WA 1W3HA 2E9MA 3AIWA 3FAWA 2XJ7A 4GZJA 1GHSA 1IV8A 2WMKA 4AZCB 1FP8A 2ZE0A 2WMJA 2MANA 2FDMA 2YDRA 2YA1A 3WIJA 1EGZA 2QV4A 4AZBA 4WKFA 2WWDA 4KRUA 2VOTA 4OKDA 5JIWA 1UWRA 4JL1A 4AZ5A 2J7DA 4U33A 1V08A 1XD0A 3KEHA 3K8KA 1TMQA 2CEQA 3AMDA 2ZUMA 4B9YA 1VFUA 3U57A 2V3FA 3ZQ9A 4MNLA 4XZWA 2O9TA 3AZRA 1JF6A 1MXDA 1J12A 1B3VA 2ZUUA 3M6DA 1J0JA 3RDKA 1B3WA 1QI0A 3BAWA 1TG7A 5HNNA 3T08A 5LA0A 2VCBA 5A2BA 2V3EA 4CN4A 4H04A 3WNNA 3BAIA 2EXOA 5I78A 4UFIA 1E3ZA 1UKTA 4TXEA 5I2UA 1EDQA 3WN6A 1U33A 3PZNA 4TTGA 1UA3A 2EBNA 2O9RA 1X6NA 3OLIA 3HU7A 2WSKA 3CHDA 3UG5A 5LYRA 3W82A 3ZM8A 2WLZA 4DWSC 1JZ4A 1WZAA 2OWCA 1GQKA 3POCA
chains in the Genus database with same CATH superfamily
4CCDA 4DJED 2V7IA 5U7SA 4DV7T 1GPFA 3RLVA 5K4ZA 1G73A 1NEKA 3AYSA 3LLFA 4JQAA 2J7CA 3ONBA 4BI6A 4ALDA 2ZUWA 1W5QA 4IX2A 4S3BA 2VL0A 5ABFB 4IH3A 4W5ZA 5C6MA 5A69A 3SRFA 4GKJT 4CCZA 4HNOA 3VM7A 1XDPA 3R58A 1UUSA 2O0TA 4IG2A 4WHBA 3R6NA 4PODA 4OQVA 4LB3A 3JUGA 3EHZA 4MB4A 3B9AA 3ZLIA 2Q9QD 3TKFA 3S4UA 5BU9A 4PMRA 4WJ8A 2UXDT 2VRJA 3MP5A 3U2CA 3W53A 1DQWA 1SJAA 2EG6A 3A47A 3HQPA 4HMDA 3WFZA 4B92A 4NXNT 3THCA 1X1OA 1GVIA 3UJRA 2XFRA 2FZMA 3FJ6A 1J10A 2GUYA 5EKYA 1W3LA 4P1NA 4A2SA 3RRXA 3H2OA 4X9YA 3TYUA 2WSYA 1I2NA 4J3WA 2VZUA 1WUFA 1W5MA 5AQSB 1SZEA 5J2TE 3CZ8A 1UD3A 1DIDA 2D24A 3W7DA 4K6AA 4PUUA 2O56A 4UMCA 1AJ3A 4FI5A 4F4RA 3N9PA 3RR4A 1G8XA 4CXYA 3W22A 1KRBC 1E15A 3A4WA 1G7VA 1IZJA 1LG1A 1DIEA 2L5HA 4HFHA 1R9ZA 2CXDA 3HL6A 1P1XA 3BJTA 3AEFA 4DWDA 4DWSB 3QC0A 1QUUA 4MDPA 4ERRA 3UGVA 1OYAA 3A8YC 4O2BE 1JCJA 2CKRA 3UZXA 4PSPA 2ZCGA 3A13A 1OX4B 3NXFA 1FCVA 1G67A 1HP4A 2J6XA 4X0VA 1J18A 3AA1B 3F03K 3I65A 1UUMA 1XISA 4NZJA 3VGHA 3LQGA 4JX5A 4W7VA 5LGTB 1PIGA 3UR2A 2NQLA 3PV0F 4U3CA 4AD1A 3WLSA 4AHQA 1EIBA 1Q8JA 3N18A 4W84A 1ZS2A 2X66A 3WQGA 4Z2LA 1X9BA 2X41A 4QRNA 3FYPA 4EAMA 2BS9A 4MUPA 3ONLC 1DE6A 2NV9A 1GHRA 2EPKX 3DP7A 4H7ZA 2KAUC 4L7ZA 3HB9A 3AXJA 4E8DA 1TV2A 1W0AA 2ZM2A 3W0KA 1QW9A 3DBPA 4ZB0A 3UXDA 4I9JA 2WM9A 1L6FA 3RH3A 3BDKA 3R0KA 2VQTA 4E5TA 1PVNA 3C8FA 1RAKA 1NWTA 1H41A 3Q67A 4E6MA 4IFKA 1IEXA 3PUXF 3HFYA 3OVUA 1UGOA 4O14A 4NXMT 3WSUA 1H1ZA 5HULA 3GTIA 1LLWA 3DI0A 2XH4A 2WWVA 4LB4A 1ZLPA 1OINA 4O1EA 1V3KA 2XIOA 3WMLA 1DYSA 4U5IA 5I79A 4GGBA 4O4JE 5BRPA 1XL9A 1OEDC 1W0BA 5FJTA 1CUNA 1F6PA 1DWIM 2VX4A 5B80A 5JR9B 3CUIA 3QHOA 4MALA 3AE7A 4XSLA 2FYMA 5AN7A 2XUEA 2E68A 1NFBA 4IMFA 1J0KA 3GUWA 3KP0A 3LDVA 4ZR8A 4QNEA 4JAWA 3UUNA 1M41A 1TJ0A 2QR6A 5BMVE 1V7YA 1Z89A 3WY1A 1BR0A 2DWKA 3A9IA 3GMIA 4ZI2D 2PBIA 2FFIA 4UV9B 5LBMA 3KWSA 3E2VA 3AYRA 3KBUA 1EGMA 4QX4A 4O0KA 5LBQB 3GNNA 2JEPA 4J3SA 4EVZA 1HIZA 4XTDA 4QLJA 4ZA0A 2YLLA 2IMRA 2B31A 3WLRA 1UP0A 2A7PA 4BY3A 2DPEA 1CEOA 3H24A 2C0HA 3TIMA 1LUCB 2VGIA 4R33A 4W86A 1TPWA 3WH6A 2IW5B 2ZKMX 2VDHA 4QGCA 2VWAA 1XX1A 3LV6A 1TJ1A 2TPSA 3SADA 3VVGA 3VDCA 3MV01 5FF2A 4NY2A 3NZQA 2PS2A 3MI6A 2WQDA 3HGSA 5I24A 3TROA 3VYLA 4R85A 2OOGA 4KWVA 1TUXA 5L3DB 3BQ6A 1ADSA 1F07A 4AYSA 2XFWA 3GAKA 4IMEA 5H6HA 3SCUA 1POJA 3CQ0A 3KBMA 2OV9A 4K0UA 2WBKA 3U0HA 3R2GA 2ZFAA 2WMNA 1ODZA 5CPMA 4HNNA 4DN1A 4KESA 5BZAA 4UTKA 4C6EA 1S2AA 5BRQA 4AIEA 4KETA 1FVPA 3GVQA 3HG4A 2HEJA 4HSHA 3PPFA 1AODA 3ITOA 2A5HA 3CMGA 2BASA 1HFBA 1TREA 3TW6A 3PDYA 4GOAA 4PA8A 5LB7B 4ERGA 2WVVB 3ARVA 4JTJA 4QEEA 3UU4A 2RUSA 2PTDA 2UUCT 5DO8A 3PFMA 3G1AA 1E1CB 2G5WA 4U2YA 3UNDA 3KBNA 1H7XA 1IBLT 4B3KA 2QCHA 1AZ1A 1E9ZB 1B3OA 2EPLX 2E77A 3RYIE 5JVLA 3EOEA 1M04A 2GSEA 3MMUA 3WBEA 3P50A 1EYEA 3N13A 3W24A 2ZXAA 4NI8A 4JBWF 3ISIX 5E9XA 3UERA 1NOUA 2FB2A 3H37A 5AQFB 2XAQB 3UWVA 4B5SA 5I09A 3S1XA 1CHUA 4F6RC 2OLSA 4HFCA 4O57A 4EPDC 3FXEB 3ABSA 2QT3A 1UB3A 3MK7C 1V3HA 3MO4A 3PUZF 3K1DA 5HQMA 1XIIA 2FJEA 3REQB 2G95A 4FNUA 3MA9A 2VCAA 2VFHA 1O12A 4WGHA 3KVLA 2AAAA 1H7WA 7TIMA 1O5XA 1SO6A 3WK1A 3L67A 2Z6JA 3RI5A 3RYCE 2AKZA 3VKBA 1J8VA 1B3YA 3HF3A 3GXNA 5LYJE 1BVWA 2HN2A 3MY9A 2AGTA 1JCYA 4CN6A 1S2CA 3CUXA 1W2VA 1F3XA 3H53A 4LYPA 4TX9A 3W01A 3DGRA 3ES7A 1W17A 3CK5A 2D22A 1MEHA 4KEZA 1UR8A 4KMCA 3UPWA 4DR7T 1MO0A 1JYNA 3E0FA 4N9DA 3PG9A 2NWBA 4V28A 2WZIA 5BW6A 4YJ3E 5D04C 1WOBA 2YZ5A 1HX1B 3GDLA 4HK7A 2BGQA 4LCQA 1M6JA 4IGMA 4JIHA 1TPB1 5XIAA 4HYRA 5AZ0A 4GRSA 1OT1A 2QA7A 3MKKA 3TNOA 4BWLA 4EYUA 4GACA 4NKCA 2AQOA 2HTMA 3LNPA 5EK2A 1KLZA 3EB4A 2CLEA 2CWOA 3MQTA 1JNZA 2Z7GA 2GWNA 5CA0E 1IEQA 1AD4A 2EHOC 1EO7A 1XG4A 1R9YA 2Y88A 4H00A 1W3NA 1AK5A 4NIQA 1D8CA 2XIQA 4ZFCA 3RMJA 3VDAA 4H6QA 3CK6A 2UY3A 1DBTA 3UU6A 1UWTA 3S9ZA 1GONA 3MDUA 4QCFA 3I6TA 1GEHA 2H7OA 2XQ5A 4HTEA 1MXGA 2X1UA 5E9AA 3BVJA 4IGUA 2VWSA 4INFA 2XN0A 2PTZA 3DI1A 3GD6A 3PZQA 2VR2A 1CDGA 1AL8A 3FEMA 3N2MA 1HJVA 3GK0A 4JI4T 4CU7A 1ITUA 4PJJA 1ZSXA 2FTWA 2R91A 1FTXA 3AMKA 3ANWB 3AHVA 3EOOA 3H6OA 2OYLA 2REQA 4LFYA 3FAXA 1RVGA 4X64T 4UXNB 4H6KA 1EPVA 4QM1A 3NWRA 4KH2A 1JAKA 1QJWA 2ZZ1A 1IAPA 2ZVIA 4O52A 4LBSA 3UR8A 2VZOA 4ZO6A 2Z1XA 3X1DA 4JDYA 1XHGA 4S3EA 2A2FX 1QWKA 5HEGA 3BMWA 5TBOA 3OGVA 1Q6EA 1D0ZA 3EOUA 3QZEA 3ZCJA 1HO4A 2H3BA 1U83A 4AVNA 4JEQA 2A7NA 4W88A 4E8GA 3ARZA 1Y5VA 1JRCA 2C79A 3MBFA 1F3TA 2XM2A 1G0CA 4J5NA 2WPGA 1XDJA 1TX0A 3KTCA 1GW9A 4HPJA 3FHNA 2QCCA 4GJJA 5AYYA 2DT2A 2QJMA 1Y8BA 3GB6A 2OA5A 3L2IA 3M0KA 4GQGA 2F2KA 4IZGA 3A4JA 4HYVA 1VAHA 1OWAA 2DZUA 2P0OA 1NDYA 4UVAB 1N33T 4DR5T 3LCFA 1QBBA 1A5LC 3AHYA 2LHNA 4GYRA 1HQTA 2BNJA 4AQFA 3O7UA 2V63A 1KXQA 3FOKA 3NQBA 1PKMA 2G4FA 3RN6A 4S2CA 4X22A 1EBGA 4DELA 1NVMA 3GNOA 5HXHA 5HQLA 3P5YA 1JVNA 1E72M 2JE8A 3PBWA 4ADTA 4UMBA 3IUDA 3UXAA 3Q9DA 4E2OA 5C55A 1YXDA 4O16A 4HZ7A 4U7IA 2BG9C 5D2VA 1SUXA 2KNDA 5AQUB 4YT0A 3PZVA 4FMVA 3W6YA 4LF4T 4QEHA 2BS3A 5AQNB 5KXJA 1MFVA 4CZZB 3RPUA 4DO7A 3TYDA 4KP3C 3KTSA 3ZZ1A 1Q4WA 2PZ0A 1TJRA 3BJFA 1XYAA 3FKRA 3W7PA 5AQPB 3RM9A 3GVGA 3WEOA 1NAL1 4DYEA 2HNHA 3VDGA 4KCUA 1I6ZA 1SO4A 4H9UA 1T8QA 5BRBA 2E6AA 1VS1A 1EH9A 1UR4A 2VC5A 1RA0A 1EJWC 4K39A 4TVCA 2DVUA 1H1NA 1K8XA 2OSXA 3DC0A 5CBBA 1XYLA 3CYVA 3ENLA 3CZJA 5AYZA 3S1VA 2QW5A 2NWRA 1OYBA 2VUNA 2MUCA 4FP1A 1BG4A 1EOKA 3ZMUB 1EJ7L 3EMQA 4IJRA 2FUPA 4S3AA 1JI2A 2NW8A 3ONCA 3L2LA 3RO6A 3U3IA 1ZFJA 2ZOXA 3AXJB 2DSKA 3FS2A 1F61A 3GXFA 4GUGA 5LIWX 1JNDA 2WLYA 1FX6A 4Q8WA 2JBMA 2W9MA 2CLYC 1BRLA 4RUBA 3PJWA 1GG1A 4PRTA 4Q32A 1AJZA 1SR9A 4MKSA 1QO2A 2XIJA 1VFTA 3WYZA 4JYFA 4LMLA 4Q6XA 4IFKB 2E1WA 3A3WA 1DWHM 4FAMA 3RPTA 1TPUA 2F8QA 2PD5A 1PTGA 1ICQA 4BAYB 4HT3A 1XIEA 5EGRA 4ORIA 3DHDA 4FK9A 3PZTA 4WDUA 2R1NA 5KDMC 1CGYA 4E8CA 3QMRA 4D8AA 3C4UA 4UNIA 1X39A 4Q4SA 2W91A 3NPWA 2V8ZA 2DHRA 3DFPA 2WCGA 2CWXA 1JXJA 5E1QA 4XKMA 3WLJA 5CBJA 2YDSA 1B9BA 1PWLA 3GXMA 4TUYE 5D2TA 1PCWA 2YK0A 1RY8A 4C6OA 2ZRWA 3DFOA 4YCPA 4HTYA 1S46A 2PB1A 5LGZA 4E7ZA 4CQ8A 1V03A 1E6QM 4YY3T 1FQ0A 3V4BA 5LXXA 2JKPA 4XD4A 3UYIA 3L2MA 5JDMA 1QI4A 1MXSA 1VCVA 2O55A 1HG3A 4NNBA 4HWFA 4LF1A 5ECUA 2YB4A 2YCLB 2Y5SA 2VR4A 3AOFA 4LF6T 2R94A 3IGXA 2GQ3A 2FFCA 4G1NA 3FBLA 4Z2IA 5GONE 1OABA 4V33A 5AQGB 4O4VA 1OIFA 5KZEA 1Z0PA 2BGNE 1UR2A 2OSWA 2MBGA 4C7DA 4X65T 4A2RA 1W1A1 5DEZA 4XD6A 3QV6A 5J0ZA 3AS0A 4LV9A 3FGCA 5DT7A 4LYKA 3RIKA 1E4IA 4S38A 1UOZA 1EQCA 3T2OA 1OY0A 3P4RA 3RQWA 1E70M 3BK9A 1RUSA 2LT3A 3B40A 4V27A 5AQIB 1KM2A 2V3DA 2DZXA 4DUOA 1A3HA 5C54A 1Q7MA 2MNRA 3OO2A 2ZZ3A 4JKKA 2H90A 3E96A 1XIGA 2V7LA 2GZXA 2Y7EA 1FHDA 3PBVA 4P8UA 2E5LT 2ZC1A 1OFBA 3OPSA 5AFDA 1XR2A 2CBVA 2V3GA 2DVXA 4PB3A 1BKSA 3BG9A 4ZENA 3OPCA 3WLIA 2WM1A 2R1PA 3V5UA 4I7UA 3WG6A 4LFCT 1D3GA 4HOXA 3CV2A 3AIUA 1S5MA 3F1QA 1XBXA 4K38A 1PTAA 3E38A 4DR6T 1KR0A 3IHRA 4XUYA 1GVYA 5I07A 4G7FA 4M1BA 2RDWA 1MDRA 2VL4A 3EPNA 5A6MA 5CH9A 5F1UA 4DJDC 1UP3A 1QXLA 4EF9A 3HPZA 1BSLA 3IJ9A 2VKOA 4O0ZA 1W6TA 4WX2A 1ME7A 3ESLA 1BTMA 2Z25A 4HZ8A 2Q71A 3VUPA 3H2NA 4NZFA 4D8ZA 3L4ZA 4Z0JA 1FCBA 3VGDA 4W93A 2LJLA 3H7UA 4PMXA 1VJZA 3S5NA 1YKHB 3NWIA 2QULA 4HYWA 4UIOA 1CXKA 1YTKA 1IEIA 5AHMA 3W00A 4H9RC 1E9LA 2YXGA 4UQCA 3EGJA 3GS6A 2QCEA 1ADOA 3K13A 1O5RA 1UWUA 2ACRA 2C18A 3L8RA 4LQ1A 3BLEA 4HVXA 3AAIA 4MKVA 3NQ8A 1B30A 1GPWA 4MY9A 2VC7A 3O07A 5G1TA 3NR0A 5HMEA 1TQJA 3Q65A 3MYPA 1A50A 1UR3M 4EIWA 3ALFA 4YN5A 2CXEA 3RRWA 1OEDA 4HN9A 1VRDA 5IXEA 2UZ9A 4J27A 3C2RA 2IMLA 3KBWA 3L68A 5FI8A 4CQBA 5I3FA 4MM1A 3GC4A 3MJMA 1BGGA 4LS0A 2KWHA 4BJMA 1HVQA 1SMDA 3IK2A 2OZ8A 1YD8G 3VGBA 3WH8A 2Z1WA 3KCOA 1TJ2A 3CUJA 2BOGX 3OKQA 3PBUA 2NR4A 3CWHA 4KEVA 3UUMA 1H51A 3DFYA 1XC6A 4OBSA 3IUIA 1YW1A 4NZ1A 3ZJ1A 1O5KA 2GGEA 4GJ1A 4ZI7E 5F2IA 1ESWA 1IZCA 1UQYA 3ZIZA 6ALDA 3CNYA 4B9ZA 1K7XA 3W1TA 1P0KA 5LJNA 2I0MA 5FMNA 1A5NC 2PLKA 3JZUA 2A1YA 3IA3A 2ACQA 2EPMX 3W3OA 4B3LA 1Q6FA 4WCJA 4YNGA 2ZZ4A 4MHBA 3W1UA 5D38A 4KIRA 1XLBA 3GKFA 3FA5A 1T8BA 4YMZA 3STCA 4UCFA 1JPKA 1G7UA 1RK6A 3P4SA 4F9DA 1OZQA 4ATLA 4ZMGA 5H8PA 3QFWA 2WKLA 3LS9A 3L0KA 2ZZ6A 3PAJA 4JQ2A 1AH4A 2PUZA 3ZYKA 2E8ZA 4PTXA 2W63A 3MW7A 4YSXA 4AEEA 2GVJA 4L5ZA 4H8VA 1KA9F 3T42A 3VA8A 1SE7A 4JI6T 2DZPA 3PPCA 3N04A 3THAA 1TTIA 5FSDC 1CIUA 2GGJA 1DOSA 1WZMA 2BX7A 4H9YA 3LRKA 3I3EA 3B03A 3W2MA 4F0MA 1OD8A 5EFDA 4NASA 2TAAA 4JTIA 4EGWA 5LG4A 4ES4A 4GZIA 3DTOA 4QROA 3B97A 4I3GA 4AF0A 1XC4A 1E4LA 1EXPA 1QOXA 2VWTA 4HCLA 4H8UA 3U9IA 4DBRA 3L5AA 1UH2A 3C4ZA 4AZHA 4JN6A 4JI5T 2WDRA 5FOOA 4NZCA 4F0RA 2R1KA 3SRDA 1U30A 4C91A 5DRCA 1JUKA 1XSIA 4YHJA 1JEZA 4QP0A 3W38A 3CUGA 4GYJA 1N2VA 4JFVA 4LEFA 4ZB5A 2OLHA 3QOFA 2BHZA 4J2PA 5LSMA 2ICSA 4J3TA 4OGZA 3TSBA 1ZAIA 2CU0A 4P8VA 2E6YA 3LENA 1J5TA 3E2QA 2CW6A 4YHGA 2Y5EA 2NLIA 3IJ8A 3WH5A 5HWMA 4R27A 3WF2A 2XGBA 4HOZA 5JRCA 4X5TA 4HBKA 3GM8A 3N4EA 8A3HA 3RGTA 4PW8A 5I6SA 3GC5A 1B1YA 1QK2A 4HCHA 2ZZ5A 1RCQA 5JDLA 5EMLA 2WSRA 4CQ9A 1YDNA 4J2CA 3H7VA 1K6AA 2ZX7A 4ATWA 1VEPA 1JPHA 5CPNA 1E73M 1XSKA 3JR2A 2GK1A 3B8DA 3FZHB 2GGGA 4YU1A 2FZBA 4QSFA 1ONWA 4I9MA 3N4AA 2EHOA 4QKNA 1O66A 5CG7A 1KXVA 4IP7A 4F3HA 1I1XA 3UQ4A 4IPJA 4UR7A 1NARA 4NSBA 3GWHA 4HN4A 4X63A 5CA1E 3O2LA 3VDHA 5CPQA 1UCWA 4H6RA 4GKKT 3T4WA 3ZC0A 3V0TA 4UMAA 2HJPA 1H0GA 1J9YA 4ROQA 4H01A 4NIRA 4V1Av 3L4UA 1SFJA 2CPTA 3RC8A 3EDEA 4LU0A 1EF2A 4FOKA 3LQLA 5LHGB 4DEFA 3WNMA 2PWEA 5XINA 1K8ZA 4JIIX 4AH7A 2WZHA 1MVYA 1IWBA 2F4VT 3TYAA 2X05A 1A3WA 1BRLB 3CTTA 1J5SA 2YBTA 1Q6DA 2Y8UA 2ZUNA 3W29A 4AQYT 3C61A 3V0SA 3VXGA 3UUXB 1M65A 5A2AA 4KS0A 2VMFA 4BS0A 3VOFA 1Q85A 1H11A 4UTTC 1UOKA 3N9OA 4PAGA 3VK5A 2QDDA 4B91A 4DMVA 2OODA 3NYZA 1Y64B 3NKZA 2HN1A 3W84A 3G06A 4BKNA 3K1SA 4H9ZA 4UIGA 5MHBA 4QG9A 3BANA 4ZQRA 2BOFX 4FNQA 4AXKA 1VFSA 2YLAA 5A6KA 1EJUC 3RF1A 1QNPA 1KWGA 2OR2A 2HXUA 2F6KA 1WDRA 3A21A 4DAFA 1V9DA 1FXPA 1CW2A 2YDQA 3KZSA 4JQ4A 1TPEA 4LW7A 1FKXA 3IF8B 3I6EA 4NUWA 1RK5A 5G2IA 1PX4A 2FTPA 4HWHA 4NYUA 5C7HA 2FVMA 3BWWA 3P7YA 2UY5A 1OWQA 4OVXA 4B2DD 4L1WA 3U8GA 2BKOA 1CNVA 3GG0A 2WKGA 1P7TA 3UG8A 1ZQ5A 3CGTA 3G3DA 4XSMA 2PDXA 5EK4A 4ICCX 5ABTA 4YJ5A 1GW1A 4JQ1A 3MACA 3TDFA 3VUSA 2JIEA 4UQDA 3GVWA 2CPUA 2JPFA 3I3DA 4ZI3C 5LNKA 3MXZA 1OFPA 1QAPA 3I7QA 2HXTA 3W23A 4EP8C 3FGCB 5D03A 4YYFA 1T41A 3NL6A 4XQ6A 5FEXA 3P84A 3S47A 1HG5A 4Q4KA 1P0NA 3CUHA 3LK6A 4HU8A 2BG9A 4TMCA 1FXQA 1TYGA 1UROA 3UPMA 3TX9A 3O1HA 4A05A 4GQ0A 4KWOA 3B3DA 1UG6A 3H23A 3GG8A 4UNLA 4NNAA 3VKHA 4LNYA 3GN5A 3O0KA 2CITA 5CAKA 2NTYA 2V2CA 3WLTA 1IZNB 1C9WA 4R9OA 4O8AA 1ZRQA 5LNWA 3D0CA 3OLEA 1TWWA 4LFBT 2Q01A 1K1DA 3AALA 2FH6A 2LLYA 1SR0A 4Z90A 4Q4OA 2X9XA 2FHBA 3EWXA 2AL2A 2GQ8A 2PURA 2EHHA 4QIUA 4IL2A 4PRWA 2E6FA 1MZHA 4QSHA 4C7FA 1G4SA 4FLRA 3VIHA 1UHVA 1V8EA 2PJQA 2WZTA 2FJAA 2FGBA 2V5DA 1B2YA 2PDFA 4L9ZA 3UULA 3SQMA 4MLRA 2KWIB 1VH7A 4C6IA 5KMYA 1R3WA 3CS2A 4RE2A 1PIFA 3W1RA 3AMGA 1DWFM 1Z6KA 4C6KA 4I7VA 4A4AA 4QJ3B 3GTHA 3S1WA 2QUNA 3P0XA 3TN4A 3Q4DA 3BGJA 3O05A 2Z2BA 5FL1A 3GW3A 1W8GA 3AWNA 3LCWA 4NRSA 2JQXA 1YKWA 3W7QA 3OZMA 2FPYA 4Q8OA 5ETWA 3C6CA 4Q4RA 1CTNA 3CPUA 4IIHA 3W7LA 5FIPA 2X51A 3NL2A 3FIGA 4S3GA 1P43A 1N82A 1OEDB 4QFUA 2VX6A 4PJLA 1NWUA 1HT6A 2E9XD 4IPLA 1X1ZA 4AC7C 4WGXA 4AVFA 2PFVA 1F76A 3A6OA 3UF9A 4K36A 4R5EA 2LKGA 3UQ7A 4GBUA 1VLWA 3ZJKA 1R3TA 3PUGA 1UUOA 6ENLA 2NQ5A 3NURA 1KBBA 2ODUA 4I50E 3QYSA 3A5XA 2BBFA 3VD5A 3ERPA 4DRSA 3ARPA 2XWEA 3NSMA 1R86A 3SB0A 3VOHA 2OGJA 4ZBCA 4KGJA 2ZADA 4NRRA 4IISA 1EC8A 4UUIA 4NX0A 3WF4A 2BLEA 4ZHQE 3FCPA 1QNQA 5DQPA 3BLIA 3HKEE 2ADAA 3UWYA 1I0BA 1M7KA 3GNRA 1C92A 4UTHA 2WS3A 1R8LA 4IFRA 2ACZA 3T44A 2OOFA 3QR0A 3UWEA 2ZX5A 3RX3A 1E6ZA 5DJQC 3QFEA 1E0TA 5C71A 1I45A 4XZ9A 3SM0A 4K1GA 1JG9A 4CCCA 2A6LA 1PS9A 3BV7A 5M4YA 5DLCA 2V6XA 5PTDA 3GY1A 3W1LA 3OG2A 3VX0A 1R3RA 3HN3A 5FF0A 1U5JA 1JNEA 4QG6A 4GYSA 2RFGA 3G0UA 2G3IA 4HFDA 2RJHA 1R38A 3S6OA 4H3DA 1ZU8A 5AQJB 2Y61A 1W37A 3HM7A 1OC7A 4LAZA 3H54A 5FYMA 2F61A 4JTAA 4GVHA 4AVOA 5BWFA 4UF0B 1V6UA 4HKPA 4ECLA 3OTRA 1S39A 3WD0A 1FFQA 4WBNE 1O60A 3AUOA 4JHMA 4EYYR 2WWCA 3B05A 3GHSA 3AB3B 5FJUA 4DJDA 1OEPA 3CL6A 2V2HA 3EOSA 1OBAA 1TUFA 2V26A 1EP3A 3O3RA 4HZMA 3CL7A 4GZJA 1IV8A 2V7KA 1FP8A 2E67A 2WMJA 2FDMA 1E9YB 3RCMA 3ELFA 2QV4A 3LBOA 2WWDA 1PO9A 2RJGA 4AG0A 2H3RA 1UWRA 3PK7A 3NDOA 3CQGB 4IDOA 4TR9A 3KEHA 2CC0A 1EUAA 1Q6LA 4C6NA 5HNTA 3ZQ9A 1F3EA 1M68A 4XZWA 3KBVA 3PSVA 5C2GA 1B3VA 2ZUUA 4Y9OA 3OHMB 1J0JA 1P4CA 4JX4A 2Y7FA 4AHPA 2XZEA 1FWAC 1WKDA 5JH1A 3W2NA 3UZJA 4DBEA 4HK5A 5K9XA 3T08A 2Z1BA 5HEHA 1RQEA 1TPH1 5C9WA 1LTDA 2PP3A 3WNNA 5A1LA 3TLUA 4J4KA 1PKYA 1Q2SA 1XF0A 3IGHX 1EDQA 4TTGA 4HWIB 2EBNA 2X2GA 4WUIA 4BEUA 1D7KA 3HU7A 4WNKA 3F4DA 3TLWA 4QJ4B 1XI3A 3DG3A 3S0CA 5EBUA 2WLZA 4DWSC 4LUTB 3WQDA 4OTKA 3N29A 5LP6E 3POCA 5JRCB 3QQ1A 1BFNA 3CEPA 5H6QB 4K8GA 4QCEA 3ABZA 3SCVA 5AQOB 1JYXA 4GGHA 2K5BB 4ANJA 3WNOA 1LROA 2CBIA 5HXSA 1H4PA 4FPSA 3RLFF 4KEUA 2SPCA 3F2BA 1SJBA 3CWNA 1Q4NX 4PCSA 3IIOA 3EKZA 1EWDA 3IJ7A 3K3QC 4WZXA 1FY6A 2CBUA 4YHHT 1V7AA 1UWAA 3BZGA 1EZ2A 2OYMA 1CLKA 3ZLFA 2R14A 2VFEA 3AAEB 3DU0A 3EDJA 3E74A 3VKDA 3GFZA 2Y0FA 1XD1A 5C9XA 4O50A 3LD5A 1DJXA 1XPYA 3ARYA 3SFDA 2YW4A 4GPNA 4W5UA 4DQWA 3UCCA 1DWGM 3FY1A 3C0SA 1HGWA 2Q8ZA 4WK9A 3BLKA 4CI3B 4GNJA 3EX1A 3WDRA 2ISFA 4JN8A 5EL1A 3GFYA 3RIAA 3VNJA 3UWQA 1ALDA 2EQDA 1O68A 1UCUA 2AQVA 2WANA 1ZNNA 3R10A 1EDTA 3N2OA 3TJIA 3MWAA 3TTEA 3RKGA 1HFAA 3EWBX 3TKLB 2X0SA 3W25A 2XFFA 1D1BA 1KFCA 1RPXA 1EP2A 4LPCA 1WDDA 3IVSA 3FB2A 1OFEA 5T8GA 3WF1A 1Y7VA 1TWSA 4J7RA 3VCRA 3PU8A 1VHNA 4RV3A 4B4HA 2E9XB 1J1JA 1MW1A 2YCIX 5JR9C 4OYJA 1D2KA 3TWAA 1HO1A 1K6WA 3U4AA 4DPQA 2E7FA 2FKPA 3WJXA 4RDVA 1BAGA 4DAIA 2OKTA 2OKOA 5HYAA 4LF8T 2PTXA 3MKDA 2J8FA 3DHUA 3PBMA 3KZPA 3P4PA 4DI8A 3MHUA 1QHOA 4G6CA 2QRXA 2I9EA 3AA0B 1FUYA 2ZE3A 3E3HA 3WD1A 2ZRUA 3T55A 4QG8A 3FFSA 1LWHA 3MS8A 1FWRA 3N34A 4RE0A 3LU2A 1FWNA 1WP6A 3ZN0B 4YWSA 7TAAA 4M6PA 3EDDA 2QKFA 5C5YA 2PRLA 4WZHA 3GWQA 2DLRA 3N17A 1P7TB 5GJNA 1WDSA 3KINB 2ZRZA 2V5LA 3L66A 1G1YA 3VC5A 4Y8EA 4IREA 1W5OA 4H8HA 4FSAA 3GXDA 4ZQCA 3VIMA 4GA8A 1VBJA 4WJXA 4BHYA 3ZFHA 4GXMA 1W09A 5FXWA 5JREA 4GK0E 4K7YA 5GQBA 7ENLA 5C2XA 1P1MA 3USBA 2VENA 5HXMA 1OK6A 4P7OA 4F2TA 1VBUA 1ZP3A 3SWHA 4DR1T 3OIHA 3T05A 1S35A 4JYAT 2BG9B 4IE5A 4LC6A 4ACYA 1EPXA 2GJPA 2ZDRA 4DJEC 7PTDA 3QMTA 3FSUA 3S42A 1Z3NA 1VFHA 4PJNA 4Z2JA 3GN5B 4C7GA 2BG5A 4GCXA 4PFPA 3ID7A 5JBFA 2ACUA 4MG4A 3TYEA 2OJPA 2LEHA 1UH3A 4IGSA 4I0UA 5DMLA 1OC5A 3M0XA 4EXQA 3R8GA 3V5SA 4IQJA 3GAYA 5LHEA 4Y2WA 1V6XA 3UR5A 3IRDA 3O15A 4EB6E 1E6RA 5DX7A 2EAWA 1QLBA 2LSJA 3BE7A 1U1HA 2AL2B 2Q8XA 3NYDA 3SJNA 3H21A 4MMWA 1K70A 4W89A 3KRBA 2Q9QC 4EWND 3EDUA 3WL0A 3SCQA 1OCNA 1OK4A 4CLMA 2YL5A 1C29A 1VLIA 3P80A 5D8ZA 2K48A 1LWJA 3KLLA 4F66A 3N9RA 2AE9A 2R6GF 3R11A 1XCFA 4LT9A 2IAKA 1JDEA 4PBEA 3CL8A 2D23A 1W1B1 4DZAA 3ZYMA 1R2SA 5BWAA 1HNXT 2C7FA 1VJSA 1WR0A 4JI3T 1E1EA 1MSSA 2VJXA 1DPMA 5G2WA 1WZLA 3OVGA 5CLWA 4TVDA 1POKA 1TELA 2NVCA 3UUBA 4BCEA 3E5PA 3LCGA 3NSXA 3U2EA 4PFHA 1I60A 2J8GA 4CNOA 2QNEA 3B0XA 2PAJA 5AB3A 4IE6A 4JS3A 3TH6A 3SURA 2OLAA 3ABVA 3L5LA 4Q4PA 2RPAA 4UTTA 4YLHA 2ZQ0A 3ZJ6A 4IP5A 3HR0A 2ZZ7A 4IMGA 1SU5A 3EVYA 1IF2A 5HEOA 2OQYA 1TV7A 3ANUA 3N5LA 2VB6A 1LRQA 1XZYA 4DV2T 3VIIA 4WF7A 1TCDA 3VINA 3DG7A 4KFNA 1Z8AA 3DHFA 4GK5E 2MAWA 1DIKA 1KFKA 1YTDA 5HPCA 1S1RA 3LI0A 4K37A 4QXBB 2Y8KA 1ONEA 4JYEA 4LMJA 4I9TA 4N0RA 3LV5A 3HPXA 2PDUA 6REQA 3W2UA 2Z2UA 2H3DA 5D8WA 5HWYA 5I7GA 3C2YA 4PBGA 2NT1A 1SZFA 3MMTA 2ISVA 4S39A 3BQ5A 3NQ7A 4Z2HA 3C98B 4PR4A 3GFXA 3VO0A 5DXXA 1TMHA 3RG6A 3URNA 4LSBA 1CLVA 2RDTA 1E0WA 4TWDA 1M01A 3GG1A 3L3PA 4FO4A 1W3KA 1H7CA 2I56A 4KRTA 3RF9A 2A0NA 3LLXA 5BMWA 2ZRXA 1M7OA 2CLKA 4HKAA 1XLCA 3P14A 3N15A 2AGKA 4E4UA 4NJKA 1ZHCA 1W1IE 4JTCA 3M5ZA 3RLHA 2GWGA 2RP4A 3ZSSA 5E0KA 4I5UA 4JQ3A 3CPGA 5AQMB 4O4LE 1WKEA 2QCDB 2ZWZA 5HJLA 1W9BM 4MZ8A 4W4QA 2CLLA 1KRCC 1BR1A 1GOWA 3NQAA 4KEMA 5LGXA 2POTA 4OECA 3OYZA 4RNJA 4Z1DA 1E4NA 2X67A 5C0QA 4X2RA 4O19A 3ARRA 3H4GA 3PZGA 1PHQA 4N42A 4HMCA 2W00A 1JXKA 1HF6A 4L64A 5CQ1A 4P7QA 2AL1A 5TNVA 1ICPA 4MWAA 1AZ2A 2UXXB 4PMYA 3T78A 1XWMA 3IACA 3F7JA 1K8CA 2B81A 1K9EA 3KV5A 1UKPA 3MSDA 2RA1A 3AEBA 1EIXA 3JAFA 2QPSA 4ZI2C 3ONJA 4L4MA 5LG3A 1L0VA 1SA0E 4Z17A 5I77A 3AICA 2W4XA 3KDOA 3QGKC 1IIHA 3EX2A 4C6LA 5D33A 3QKZA 4QH5A 2UXBT 2QUTA 1RP8A 4QAIA 1K9TA 3SCTA 3BQKA 1QASA 2X1SA 3IJQA 4O1AA 5CJMA 5FESA 2XM1A 5MKGA 4YL2A 1CGUA 1HVXA 3WX7A 4G7EA 1DJYA 1OIMA 4HMEA 1XBYA 3ZPOA 4IX0A 4TVUA 2VKHA 1EXBA 3WJYA 1AVAA 4DB7A 3P8IA 1ZB5A 4I5XA 1KFBA 2J88A 1BF6A 1SQ7A 4JD4A 3M5XA 2BZNA 3HURA 2ZDSA 1ENUA 3I6RA 5DF0A 1NAFA 3QGAC 3TQPA 1BXNA 4PTVA 2BY1A 3P82A 2VR5A 4HB7A 3WI3A 4O1DA 2OEJA 3GDBA 8CGTA 1ITQA 1JYVA 4AMAA 4UB9A 3F2CA 4FIRA 3KRUA 2XYLA 3LRMA 1ZP0A 1MNZA 4MY1A 3RJYA 1ZV4X 1KM0A 1U5HA 1GQEA 2PFHA 2FLIA 4E4PA 2LOPA 3O06A 3E0LA 4S3DA 1T0OA 4J28A 4DJFD 3WBYA 3ANVA 3FVMA 4R88A 5AC7A 3U5UA 1ZZMA 1U5VA 4UFLA 1BXCA 2XQ6A 4IUOA 3T2QA 1DJGA 5DN1A 4O12A 2FGLA 3WQPA 3EAMA 3V1PA 3ZVIA 2WJFA 4OZOA 3AJXA 4HWDA 1KV5A 4GMEA 1WDQA 1UYQA 3PUVF 5EK3A 4B3RT 1MQPA 2J13A 1X79A 1RPKA 5C2TA 1YHTA 1JAEA 2E28A 2VOMA 5HMDA 1VPXA 3F57A 3BCFA 3RM4A 3LSVA 4HA1A 5B7YA 4P09A 4Z8XA 1XFCA 3ZT6A 1F74A 1B54A 4I8YA 4REQA 1TV5A 5HUPA 3BCJA 2WK2A 3NDYA 3QEZA 4E2BA 3F4VA 3UA3A 1VRXA 3HKCE 2XFYA 2SFPA 3CPZA 3T0AA 3BAYA 1W9XA 1FWTA 4B5NA 2IKHA 3M0MA 3EWWA 1RA5A 1ONRA 3GG7A 2KLQA 1MMDA 2I16A 3OGRA 3NVOA 3TAOA 1DU2A 3KL0A 3KXQA 1IHIA 2DVTA 3HZ3A 3B9OA 5AYBA 3NG3A 1J5ET 5I0DA 4NUUA 3L5MA 1K9DA 4JTKA 5ABFA 3FX4A 3UQNA 4D1IA 3M0IA 3G1VA 1V02E 1B31A 3UFYA 2WNQA 5HA7A 5K3VA 4DIAA 3ZWTA 1UD2A 5FAJA 5DCBA 5CJ5A 3S5ZA 3G24A 2YGYA 2BZBA 1J96A 3D6NA 2C6QA 4I90A 5FCZA 2OZ0A 4F0HA 3TN6A 3EDVA 1AQHA 1KM5A 4R7OA 1T7SA 1W32A 2PEVA 3CIWA 3WELA 4EEBA 3FW6A 2WQPA 4AW7A 2XSXA 4S3KA 5LA2A 3SUUA 2P3EA 2MOZA 2VCCA 1W1PA 5A3HA 2X7VA 4KI0F 1QPNA 3C0JA 2PDYA 2XQ7A 1PB0A 3PVFA 1O7AA 1VC4A 3M0HA 5BXPA 3T0BA 3MSYA 3USZA 1KO0A 3MYOA 2D0FA 3TV8A 2HVMA 5GNZA 4K3ZA 3LTPA 3SY1A 1OCBA 2JKEA 3G1XA 4QISA 1XRVA 1QMLA 2FPVA 4MF4A 3BLDA 1UJQA 2YJQA 3FJNA 2JJ9A 1CB7B 4HIBA 2I5IA 4JTQA 1YNYA 1RLDA 1Y5XA 4H41A 1MIVA 3FXGA 3ZR4A 3UP8A 5U4NA 2AMGA 4GVFA 3PZ9A 1NWMX 2Q02A 3AUJA 4XAYA 4DO0A 5DABA 3W2LA 1EC7A 1H1YA 4DWSA 4GI8A 3G0XA 4ASTA 3NOYA 1OFDA 3SUWA 4CI2B 1XUUA 4LVFA 1GG0A 2HNEA 1CGWA 1OX4A 4ZB2A 3ZMSB 2CYGA 3MKCA 1CXIA 1W0MA 2XGIA 6XIMA 1NU5A 5JQGE 3WQCA 3TSMA 2PI6A 4PZVA 5KMGP 2D2HA 3CMFA 3BAKA 1SZNA 2YDAA 2A7RA 1AH3A 1JZ3A 4R53A 3BOFA 2CLPA 3LM3A 3K3NA 3B5MA 4PMJA 2B1EA 4G2DA 1L2UA 1KBKA 1LL7A 4DV4T 5LNVA 3LBXB 2TSYA 3HJEA 2OPJA 3GTNA 1R7AA 3POHA 4R9XA 3MUZ1 4F0SA 5CXPA 4EZ4A 1UA7A 2F84A 3TC3A 3NAVA 3U2OA 3L4YA 4U28A 3GU9A 3VGGA 3DAQA 2VQET 5BROA 2Y7DA 4E4FA 1E6PA 2FHFA 3PY2A 4YTSA 4IIFA 2YEVC 1FDJA 2AQWA 2W2UA 1NDVA 5D9NA 1V6VA 3F5LA 1W3JA 5J04A 4Q8PA 5AZ1A 3FN9A 5JBEA 1KFJA 4XTIA 3URQA 2NUWA 5TAOA 6A3HA 1FWCC 4DF1A 1F3WA 2Y4SA 1YXRA 5JR9A 1QHPA 1RQBA 3E12A 4ZO8A 1OFRA 1UMYA 2VM8A 3C50A 4QITA 4NJGA 3R7MA 3E02A 1XLMA 2VEIA 1KFYA 4LNCA 3VNZA 1WCGA 2XZ7A 3VM5A 3K8LA 4LYRA 1Q6OA 3LMZA 2FHCA 1H61A 3TAKA 2X8RA 1HP5A 4B3ZA 2IQDA 5JUVA 1XSJA 1X7FA 2DIKA 3CH0A 2IHR1 4RPQA 4M56A 1T72A 3W28A 4N9EA 2J27A 5FJRA 3A12A 6REQB 1GJUA 3RXZA 4PRRA 3CHVA 5I3DA 3MV11 3VNKA 2ZTJA 4CD8A 4YLWA 1P0EA 4JNYA 1A4LA 3V0UA 4ZEYA 4CD6A 3TEVA 2YN6A 5JDNA 3PN8A 8XIAA 3NTYA 1B9ZA 2HE5A 4EANA 3WQEA 4MGGA 4JFSA 5CPLA 3VD3A 1NQ6A 3DYOA 5I3IA 2VYOA 4S2BA 4GISA 1MDLA 3GR7A 1R46A 1YE4A 2CZFA 4NYYA 4H9XA 3T9PA 1IWPA 1G69A 2V5JA 3PSWA 2BVMA 5D37A 1WV2A 1XIBA 2VK9A 3AROA 4N6EA 4ZO7A 2LM9A 3WK2A 2XH2A 3GO2A 2D9DA 3VU7H 2H9AA 2VFIA 2DSWA 1EYWA 4DJEA 1M9HA 3STPA 4FX7A 3MUIA 2H88A 1QPQA 3DXIA 3VC6A 5FY1A 1NTHA 7XIMA 3E1F1 1XDLA 1PX8A 2W62A 2ZUTA 3SRZA 3QKEA 1KWKA 3G1RA 5IFTA 1YPFA 3D3AA 3GTXA 1O3XA 1E5JA 4G63A 1HJQA 1GQJA 2IW0A 3GNPA 2C71A 4Y9AA 1LT8A 5BXRA 4EOUA 4HNTA 2WVVA 1MNEA 2O7QA 2J24A 3W88A 1VR6A 4X66T 1ADDA 2J47A 1H7PA 3NQFA 3SGGA 3QM3A 3RHWA 4GBDA 4IMDA 1E1CA 2BVWA 2O9PA 4FF7A 4K2SA 2DZVA 3MP3A 4KMQA 2Q9QA 3OGSA 2E3ZA 2IQTA 4YVXA 3KM8A 2E1DA 1OJXA 2NQ9A 2FB3A 4HHHA 4JN7A 5ECVA 2W6RA 2UXNB 4BI7A 2VO5A 3I68A 3UT0A 1EL3A 2XDFA 3LK2B 2WJEA 3W2KA 5EZYE 5AVNA 1E5NA 3AXHA 2BKNA 2WVSA 4XD5A 3RLGA 3XISA 5I00A 4IE0A 3KOFA 4GK8A 2Z1KA 1MW2A 3WLPA 3ETVA 3QHNA 4OT7A 4WOQA 3N11A 3MKVA 1Z44A 4G7EB 1BQCA 3DENA 2FPTA 2CBJA 5GVJA 4K68A 3ZN1B 2DGAA 4GQBA 3ES8A 3TXZA 4GO8A 3UU0A 1H49A 5A2CA 2B7QA 2X16A 1PDZA 5A6BD 4BF5A 2P10A 3HO8A 2VGGA 3TNBA 4GKTA 1PE1A 1LL6A 3RILA 4C1LA 1VIZA 1F05A 4MDOA 5HCJA 2DCFA 2D2SA 4Q6JA 3TN3A 4KRZA 3BPWA 1GVQA 2XAFB 1CYGA 5HCMA 4I8DA 3CXOA 3A7MA 1JCMP 3SZ8A 4JBRA 2WO5A 5D2WA 4M6VA 2WMGA 1UJPA 3HFTA 2VFFA 3EXTA 3G3MA 1AG1O 2PTFA 2XISA 4ML9A 3QV8A 5LNUA 1FH8A 3R43A 4EXTA 4EPKA 1PZ0A 1EF3A 1ZENA 2PCEA 1A5CA 3A5VA 4HJFA 2G96A 5LMUT 1XH0A 4MB5A 3P61A 3O9XA 4QS5A 4KCVA 3R0UA 2BV9A 4U7YA 3UZ5A 4H63H 7A3HA 1US2A 2GJNA 4OX9T 3OYXA 3RX6A 4L61A 3N2BA 3CO4A 3APTA 3XINA 3KRSA 1QNOA 1JL8A 4IGNA 2W0GA 1ZP4A 5H1WA 1GVOA 4JUYA 2J62A 3Q58A 3MC5A 3NGJA 3R8HA 4DR2T 1JNRA 3Q5EA 1WXYA 2D2JA 3AHTA 4LJ3A 3T07A 1TZ9A 4DZIA 5T26A 1L8NA 1UC5A 3FZLB 3ZR5A 1KEYA 5JTGA 4REQB 1H09A 3RX4A 3ANWA 3ZWSA 3CIVA 5GNYA 1G6CA 3DEQA 2QGHA 1GZ1A 1HXJA 1R87A 4X60A 1XGZA 1KKOA 5CSYA 3V36A 4RNFA 2OG9A 4DUZT 5ABHA 3PBYA 4M1PA 3BTNA 5A8PA 9CGTA 3EBVA 3NPVA 4ACZB 3UJEA 1Z41A 3W7IA 4D6CA 4U72A 4G56A 2EPHA 4WLCA 3P7IA 2X0LB 4R7JA 1MQRA 5A8GA 3UY8A 4AU0A 3B04A 4KUMB 3WLNA 5AQVB 4YXDA 3HJZA 4GY1A 3QSTA 4GIYA 3B9NA 1RVKA 2RDXA 1THFD 4UOQA 2GSHA 5CZTA 4ML4A 3RU6A 3E2RA 3GA8A 3OP2A 3PWAA 4ZQMA 3FK4A 3P81A 2NW9A 2DY3A 2ZX8A 3O6AA 1XLGA 1FWSA 5DBTA 1CBGA 4O10A 3CZGA 3I7RA 3FJ4A 4LUJA 5JH7E 3P6LA 3DH7A 3RQUA 3SQSA 3SCOA 4K8EA 5G1MA 2P0IA 3LXAA 1SGJA 2KZ7B 1FDYA 4QQ3A 2D0GA 3R89A 1S1PA 1YDOA 1Z7AA 1IJ6A 4XBSA 3EKLA 3QY6A 3CBWA 4H2CA 3A22A 1TPDA 4E2VA 1R2TA 1I2PA 4DO5A 4MOZA 4AD2A 1XCXA 3G1FA 3RRCA 3S2MA 4PUEA 2J7FA 4MNKA 5E0FA 2LOSA 4JCMA 1XXXA 3W7CA 2DJXA 3PG8A 1X8CA 1G4TA 1QTWA 3LGDA 1JI1A 3T2PA 3M41A 1A47A 3KHJA 1GT8A 3KRZA 3KL3A 2Y7GA 3BLOA 1JIBA 4B5XA 2VGBA 5KITA 1IYXA 3EZ4A 5CC7A 4AKGA 4BR1A 5A8NA 4URIA 1Q45A 4GX8A 3OEXA 4TX5A 1V3MA 2ZC8A 5AC4A 1IGSA 3MMWA 5K9DA 4H1ZA 2G8ZA 4DX3A 1TMLA 4CVWA 1UX5A 4DXKA 1LVKA 2XVPA 3PP7A 5EMKA 3R1ZA 4OFZA 2J7EA 4Q8QA 3ZR6A 4NU7A 5DQVA 3CWZB 2YA2A 3SN0A 3W7KA 2VX7A 3PJXA 4YTMA 1X6UA 2KX9A 1UASA 3BXWA 4PUWA 3HV8A 3N1AA 2V0TA 3N2XA 2FZ8A 2RAGA 4DUXA 1X97A 2DUXA 3IARA 3W74A 5MF5A 2V7MA 3WF0A 3WQWA 1KB3A 4AAJA 3MU7A 3WEMA 4XG1A 3BLLA 1XYZA 2Z0IA 4RX0A 3DC8A 3OBAA 1AW5A 1GK8A 3UGRA 1R2RA 4WBOA 1QI5A 2DJLA 1H7OA 1ZPTA 3CQXC 3QSRA 1DL3A 2YBVA 4ZL1A 3NJ3A 3EXSA 1U1JA 1FH9A 2FDSA 3EKGA 2V81A 3UU3A 1NFGA 4NAEA 1ISYA 4EKJA 3EB2A 2ZLYA 3HIJA 1KNRA 3WH9A 3KV4A 4HWCA 4PEKA 3VIFA 4OWGA 1XQLA 5IUXA 3WQOA 3NQDA 4QR6A 4TV6A 3JCFA 1Q3NA 3WF3A 4IIBA 4E7SA 4UEMA 3SFEA 4JZ5A 3HTWA 3W7MA 1UWQA 3VFCA 2YCJA 2QDGA 3GX9A 1JUEA 5LA1A 3EX6A 3EWDA 3EA3A 2P76A 1L6WA 3K3OA 2IKGA 4GI6A 3GLCA 1SZGA 3RITA 5L4HA 1W3IA 1T8XA 4IWWA 2DT0A 4PBFA 2WC3A 1VIWA 2VQUA 3BAJA 2CXLA 3CHFA 3QF0A 2Y8DA 1C3FA 3URAA 2I6HA 3EI0A 3VE9A 3DYMA 5IBXC 2OSYA 3N12A 1E51A 5F2LA 3FNDA 1PIIA 4I7WA 3BH4A 1EZ3A 3S5YA 1A5SA 2BHUA 4BA9A 4X61A 3CZEA 2YCLA 3VOIA 1YPIA 3MBDA 5HWXA 5HQEA 3L39A 4KWWA 4U74A 1DVJA 3EYPA 2VDGA 3AEDA 1MMFA 1YNPA 4MZYA 1TO3A 2Y8VA 4J3XA 1C93A 3E0IA 3L4TA 2WMIA 3LCXA 4GHRA 3EMCA 4J3UA 2Q3OA 1QNVA 1H7NA 3F4WA 3MZNA 3AE2A 1R47A 1TR1A 3K4AA 1IQ8A 1AH0A 1QI2A 2HCVA 5JQ9A 4PFOA 2DI4A 4JIEA 2V5BA 3LHYA 1T6MA 1TWDA 4CNNA 2INFA 1V6WA 4FXSA 2E8YA 2QAPA 5L47A 3TA6A 5LGNB 2GJRA 4I6KA 2M67A 1HTIA 4L5GA 4UTLA 1E9IA 3T40A 4JTLA 3TC6A 2H9AB 2ONEA 1V77A 2FGZA 4PE8A 3TFCA 3WK0A 3KBJA 1Q5MA 2DEPA 2WNNA 4JV5T 2YKKA 2IUBA 5H91A 3BJSA 2PE4A 3W1AA 1NP2A 1WR6A 1RCXB 4PCNA 3PTRB 1MMGA 3N9NA 2QF8A 4D6JA 1RBLA 3M47A 3JU2A 1GGOA 3Q37A 4K8HA 4UTWC 9XIMA 1JR1A 3DHPA 4AEOA 5JBDA 2NXIA 2JQKA 1NSJA 2AAMA 2ZVRA 4XVDA 1CXHA 3KS5A 3E0WA 1LBFA 1DWAM 1TPC1 3GXPA 3K4DA 1BEUA 2L9QA 3S2CA 1FCUA 2QCNA 4KWUA 1KQZA 1IXOA 2XSAA 1A0EA 3OU8A 3S46A 3D3FA 4DVDA 3NDZA 3QB5K 2BS4A 3ITYA 1RBAA 4PMDA 3ZLGA 1BXBA 3PZUA 1IXNA 2Q9QB 2XQAA 4US5D 1M7PA 1HF8A 3IEEA 2N1GA 4MNJA 2DU2A 1YQ4A 2CLHA 4JGDA 3T8OA 4HGXA 4JEJA 4HPHA 3QOMA 2P88A 3PUYF 3I0OA 3VTRA 1HNWT 3LYEA 4BJHA 4UCGA 4HU4A 1N8FA 5AHNA 1Z69A 3M7SA 1KFEA 3UYCA 1E0XA 1DV7A 1I94T 4QHRA 1NQKA 3CT7A 3WENA 4DLFA 2HDJA 5BOOA 4RW5A 2CXFA 2V68A 5C70A 2INZA 5FEPA 1JJKA 2QS8A 2FMOA 4C6DA 4QXCB 3ARUA 2PDIA 3TZFA 4X9SA 1PZ3A 4U2ZA 2Y1HA 1VB9A 3M0VA 3GSMA 1GUVA 1UPMB 3QH2A 4RL3A 4MY8A 2QJHA 1FKWA 4XVEA 2CLFA 3I9YA 3DGBA 4KT2A 3UCDA 4M7TA 2OO0A 3AE8A 1PAMA 4DV5T 4Y96A 4C6CA 4LFAT 4UZUA 1AQ0A 2P3ZA 2Y89A 5CSUA 2DP3A 4ERIA 5A8MA 1GORA 3HKDE 4EAHA 4LAUA 3MDWA 4NJJA 4RDWA 1UBSA 1QI3A 3NQGA 2IPJA 1E71M 3HG5A 2V7JA 2GJXB 4MNMA 4IHCA 1DORA 4DUYT 2TMDA 4OV9A 4UBPC 1R8IA 4A5XA 2OX4A 1GOKA 4EAYA 4W7WA 4PL2A 4JNZA 2XQ4A 3FAWA 1XP3A 5HANA 4GH1A 3R84B 4DO4A 2B0MA 2NWSA 3SJ3A 3CYJA 2YA1A 1S3TC 2DW7A 1OHLA 4WY0B 1EGZA 5AKQA 3U2ZA 2VOTA 1OFAA 5FEWA 2HVNA 3CX8B 3V7PA 3RYSA 3UZZA 4B5TA 3UA4A 3LHWA 1L6YA 4B9YA 3U57A 2HPMA 4DI9A 2CWYA 3JC6D 2FJBA 3AZRA 4CXXA 3W73A 1GVFA 3EUHA 4YCOA 3MA8A 2GLKA 1B3WA 2V82A 1KNZA 2DV0A 4DIDB 1XBZA 5AOUA 4IJCA 5HNNA 3LJCA 5HJYA 3QTGA 4IDNA 3W85A 4ADUA 2EXOA 4M7SA 5I78A 4UFIA 3KVMA 3C8NA 5HEUA 3KAOA 4FEZA 1FWGC 2E9XC 4JLEA 3PZNA 5G4EA 3CC1A 2UXCT 1VP5A 3NQCA 3HPSA 3LHVA 3W1NA 3ZM8A 1LOQA 2NSOA 5CFBA 4EF8A 4L65A 3NL5A 5FJPA 4MHCA 3QC9A 1WZAA 4IPIA 3NQ2A 4CEXC 2M6IA 2ZA1A 1SZRA 2LE8A 3TONA 3P67A 3P5ZA 3ZJ2A 3EXRA 2JEQA 2EG7A 3QPZA 4MAZA 4QE4A 3OQ8A 4O8SA 1DKWA 1N36T 4KF1A 4O0QA 4MYXA 1DP0A 1Y0EA 2ZUSA 4GG9A 2DT3A 3NQ6A 2I1OA 2J7HA 1AD1A 4NILA 2ZRYA 1OGBA 4GXWA 1YADA 3H2FA 1MIYA 5LXTE 1J0YA 1W91A 2HK1A 3W4RA 4W8LA 4CGTA 1F8MA 4X1YE 3H2MA 5EBAA 1H60A 1MYRA 4OHFA 2N2NA 4AKLA 2I57A 3PBGA 3QPYA 3E0ZA 3QVQA 2BVTA 1AQMA 3SFKA 3GYCA 3JADA 4CU8A 2RKXA 4G8TA 1OQFA 2Q8LA 4GE8A 4XIAA 4ICMA 4GQQA 3H22A 3GVRA 4O53A 4JEUB 3WFAA 2AXDS 4XWUA 3MZ2A 4AKRB 4MWAD 4ZXOA 3P8JA 1V6TA 1G4PA 1J0HA 3KCJA 3IK4A 2PGWA 1W1YA 2E5CA 2PDKA 4CNSA 4GVGA 2JF7A 1AW1A 1GOIA 4GFSA 2G4JA 4X0NA 1T98A 1UIPA 4Y90A 4DUWA 3W7GA 1HJXA 1J5WA 3MP4A 3RPMA 4WKAA 1HNYA 5LGUB 3VFLA 4HNUA 5FF3A 4GVIA 2DH2A 3IUHA 3WDIA 2PZNA 3H2CA 4M19A 5ABEA 2GGHA 3LTYA 1DXEA 3ATZA 4HPGA 4M51A 5A6JA 1FP9A 4RDZA 2PWGA 1Y65A 4O2AE 3F5JA 4DNDA 3G0SA 3ARQA 3AIEA 3PPHA 2LLEA 1BHGA 4A3HA 3RIFA 3RIUC 1NOWA 2WHJA 4LBRA 4CN1A 9XIAA 1F7BA 2WOQA 1HNZT 2PCQA 4BQ5A 4CVUA 1RD5A 2A2IA 2YSWA 2PDBA 2J66A 1LLZA 3H12A 2I5QA 2HS8A 5JVDE 4BFAA 2DWGA 1AMKA 2PU0A 4EV6A 3WJSA 3V75A 4QAWA 1H5YA 4ISTA 3OA5A 4L1GA 1UX4A 1ISZA 5DMMA 4PTDA 3ITCA 2OO6A 4ZE5A 2WCSA 2WAUA 3SSJA 2IC9A 4GNVA 1B90A 3FV9A 3K8MA 4DV1T 4NAEB 4QDWA 3WLLA 3N9SA 3QQWA 2W67A 4XO6A 3ZYZA 5JDGA 1EUNA 4Z1YA 4RPPA 4MTVA 1L6SA 4ZSUA 3S8HA 1J11A 4Q3MA 5BXTA 3IGSA 2ZXDA 4ZGYA 3BSMA 4C1NB 1IJ5A 3R8RA 3P3BA 3ITGA 1LORA 2NX9A 1DJZA 3KOWA 1LBMA 1V79A 3VGFA 4NZ5A 3WUBA 4TNWA 1UK5A 4GD0A 3DOPA 1ZL1A 2QCLA 1MRAA 5IWAT 2QIWA 1REQB 1VHCA 2HMCA 2CCQA 2QGYA 2NUXA 3GC2A 3O4XE 3LSCA 3DJBA 1J0IA 4J40A 1EA0A 3WNKA 2G3JA 3TTYA 1DXFA 1EEXA 4NZ3A 2IKIA 3PWGA 4AXNA 1IWAA 2FVLA 4UV8B 3W7EA 2IUZA 1XRTA 2VXNA 1XIMA 3C56A 4CQDA 1VCGA 3ICJA 2O9OA 3E0VA 3AO0A 1DJQA 1NF7A 3EWYA 1S3HA 5L3CB 1OXZA 3CWOX 4PK6A 5CZJA 2XAHB 2W5FA 1PTDA 3M16A 1E6XM 3NA8A 3M0YA 3S2LA 3UWWA 3APGA 5C8BB 4PMNA 2JQQA 2QVNA 1QOQA 4MJ4A 4YHEA 4ZCWA 3NQVA 2BY3A 1N8WA 2NX3A 4LTSA 4ZZBA 3R94A 4ILAA 1RLCL 2YBUA 1M62A 3WL1A 4GY7A 2ZMAA 3N6JA 2V38A 4JIQA 2WMIB 2O92A 3H55A 3SN4A 4IE7A 1LJYA 1OC6A 2ODVA 1IT7A 2HBVA 3HV9A 1BWKA 4OBTA 4UR9A 2ASHA 1IGWA 4NF7A 1UZ1A 1KFLA 5AQLB 4L6HA 4YTRA 3UVAA 3P74A 1FHLA 4WDTA 5REQA 3TTQA 3DIPA 1W5NA 3ZOAA 4KBXA 3D0T