2W62A

Saccharomyces cerevisiae gas2p in complex with laminaripentaose
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
461
structure length
436
Chain Sequence
b'SFEKTPAIKIVGNKFFDSESGEQFFIKGIAYQLQRSGAFETSYIDALADPKICLRDIPFLKMLGVNTLRVYAIDPTKSHDICMEALSAEGMYVLLDLSEPDISINRENPSWDVHIFERYKSVIDAMSSFPNLLGYFAGNEVTNDHTNTFASPFVKAAIRDAKEYISHSNHRKIPVGYSTNDDAMTRDNLARYFVCGDVKADFYGINMYEWCGYSTYGTSGYRERTKEFEGYPIPVFFSEFGCNLVRPRPFTEVSALYGNKMSSVWSGGLAYMYFEEENEYGVVKINDNDGVDILPDFKNLKKEFAKADPKGITEEEYLTESVECPHIAVGVWEANEKLPETPDRSKCACLDEILPCEIVPFGKYEEYFSYLCSKVDCSDILANGKTGEYGEFSDCSVEQKLSLQLSKLYCKIGANDRHCPLNDKNVYFNLESLQPC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLYCOLIPID-ANCHORED SURFACE PROTEIN 2
publication title Molecular Mechanisms of Yeast Cell Wall Glucan Remodeling.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 162
structure length 436
sequence length 461
ec nomenclature ec 2.4.1.-:
pdb deposition date 2008-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03198 Glyco_hydro_72 Glucanosyltransferase
A PF07983 X8 X8 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1040 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2w62A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2w62A01
4IPNB 3OGVA 2J79A 2Y8VA 1EHNA 2EJ1A 3U5YA 3NJ3A 2D0GA 3WDJA 1VEPA 2WZIA 5A2BA 1PZ2A 4Z2KA 4P7RA 3NDYA 4P7LA 1E56A 1D3CA 4JKKA 5C70A 4UFHA 1VIWA 5E09A 4PTMA 1V08A 3SCRA 4EK7A 3ARYA 1IT0A 1A47A 2CYGA 4GO8A 1MW3A 2J7EA 1GZJA 2J4GA 3W81A 4JIEA 4HZ8A 1V3JA 3CHDA 1E40A 5A8PA 3EMZA 1V0NA 4UTFA 2IUZA 1CYGA 3WUBA 2E8ZA 2PWDA 4HTYA 3PZIA 4PTWA 4TX8A 2QHAA 2A3CA 1C7SA 2WK2A 3AYSA 4ATDA 1UKSA 3VOCA 2W67A 4AD5A 3WD4A 1UWUA 2FGLA 1QBBA 1OM0A 2JE8A 3F5LA 2YL6A 4ZE5A 1BG9A 1JDDA 5HPOA 3ZQ9A 1V0KA 3BCDA 1LWJA 3PZMA 3BAYA 1ECEA 1CGUA 4E8CA 1GCYA 4LYRA 1FFQA 2WWDA 3M7SA 3WNOA 1XV8A 5A1AA 1QHPA 1JIBA 3G6MA 3PZNA 4P7QA 1Q6EA 2V5CA 1Q6GA 4PMOA 4XZBA 5DT7A 3VILA 1E6PA 5FIPA 1BF2A 1QNSA 4D6EA 4HP5A 1E43A 1E4NA 1E15A 2FDMA 4KGLA 1J18A 2XYLA 1KXQA 1RH9A 1CDGA 4YPJA 2C0HA 4W88A 1FOBA 3SCTA 3IK2A 5KZ6A 1TA3B 3CZGA 2J7DA 4AZCA 4OOZA 3NSXA 1HXJA 1VEMA 1HKKA 3SCSA 2O92A 4BQ4A 2ZIDA 2CHNA 1EA9C 3AOFA 1H0IA 2XVLA 1QNOA 1VFOA 1E5JA 2BNJA 1H1NA 5HBFA 3ARVA 1WNOA 3QHMA 2UY4A 4PSPA 5I77A 2WM0A 3AXXA 3T0DA 1HN1A 4KH2A 3OZPA 4CUCA 1OGGA 2E9LA 3SCQA 4H2CA 3A4XA 3MUAA 1GORA 4B15A 5CG0A 5JBEA 4AYSA 5I79A 3AS2A 2OYMA 2D2OA 2GDVA 1KCLA 2XVPA 1EDQA 4CCCA 3F5JA 2F8QA 2BHZA 3BAWA 5CQ1A 4M8UA 3CUIA 1OGBA 3ARUA 3F5KA 1WDPA 1JYVA 3K8KA 2XG9A 1C90A 1VBRA 4HOWA 2J47A 5A6MA 1CXEA 1LF1A 6TAAA 3PZTA 3VX1A 3BCFA 5BROA 1NWRA 2GJPA 4BCEA 4RE3A 4M24A 3CTTA 3PZQA 1TE1A 5JIPA 3N04A 3DYOA 3HU7A 3NYDA 2VZUA 4W5UA 1U2YA 4BA0A 4CVWA 2DSUA 4GINA 2XFYA 4UFLA 3UR7A 3EDFA 2WSKA 4MPKA 4MADA 1QOXA 4UR9A 5A8NA 2NW0A 3CPUA 3CIVA 1XCWA 2ZUMA 2WZEA 1TR1A 4N0RA 1OD8A 1EIBA 3AHXA 2ZX5A 2PWFA 1CXHA 4EE9A 3ARPA 5A6LA 3BGAA 4MDPA 1HJSA 2ZXBA 2JF6A 3WF0A 4WK9A 1DWFM 4D6JA 4W5ZA 3WFLA 4GI6A 7CGTA 2J25A 3OGSA 4JFVA 2ZXDA 1E0VA 4MNJA 5A6BD 1KBKA 2WZHA 4KMQA 2WC3A 3O6AA 5FCZA 2VTFA 1UH4A 1WDRA 4JFWA 3CLWA 3VU2A 4UFIA 4LYPA 2ZUTA 3FAXA 5E6ZA 1VJZA 3EDJA 2EEXA 3QOKA 2V3DA 3VMOA 1UG6A 2O9OA 5IHSA 1HNYA 4GI8A 5CGMA 3ALGA 3TTQA 4TVCA 3WQWA 4B3LA 3LPPA 3CMJA 3IAPA 3AXHA 1MW2A 5EFDA 1QVBA 2EXOA 1QPKA 3AYRA 2VT0A 1G5AA 5M03A 4QLKA 1TG7A 1EXPA 2YDRA 3VX0A 4JCMA 1BYDA 3UG3A 4YHEA 2EPOA 4B3KA 2OLHA 2XJ7A 1GQKA 4JHZA 1XYFA 1V03A 3AROA 3L2MA 4LX4A 3O9NA 4YN5A 4OIFA 3TOPA 5HOSA 2W92A 4GZIA 1JAKA 1H3GA 4JFTA 3ARRA 4BQ2A 2ZUUA 3DHUA 3OLEA 3N15A 2BY3A 2VZTA 4GZEA 5I3DA 3GBEA 4MNMA 1QHZA 4J3XA 4B16A 3TONA 4PCSA 3OGRA 5BWFA 4NSBA 1EGZA 3RPMA 4P8WA 1J0YA 2XWEA 1HP5A 3OIHA 4LYQA 2D22A 4PMYA 2XIIA 5JBDA 1KQYA 3AIBA 1OT1A 3GNRA 5JUVA 2ZUVA 1KCKA 1GJUA 1PZ3A 4W84A 4PUEA 5CLWA 3HJEA 4QLLA 2G41A 1DEDA 3ZSSA 1XCXA 5I0DA 1JFHA 1XH2A 4HU8A 2DSKA 4J7RA 4D1IA 2DSZA 4JKLA 1RP8A 1GHSA 5AC5A 3WUEA 4WJXA 3TTSA 3VIIA 3K4DA 3SUUA 1C92A 4UQCA 3VD9A 1GQLA 4JCLA 5A95A 2XM1A 3CZ8A 4QAWA 4XZWA 1BG4A 2O9RA 2EPMX 1NWSA 2JEQA 4JL2A 5E6YA 4BF7A 4UOQA 3W6MA 2DH2A 2JALA 1OBAA 3WSUA 1E0XA 3MV11 2VRQA 2RGLA 2VCAA 2VX5A 4AIUA 1CGXA 2GDUA 1GQIA 1J11A 3WDHA 3MV01 1XGZA 3S6TA 3SCNA 3CUGA 1MQRA 3UCQA 4UNIA 2VVSA 2ZOXA 5A69A 5AC4A 2OSWA 1XH1A 2VCCA 3VIFA 1EO5A 4AD1A 3RM9A 1Z32X 1KQZA 1OIMA 1QI3A 4QCFA 2W66A 3IJ7A 5GQBA 2ZUNA 3ZT6A 2WCSA 2B31A 1WP6A 4PMZA 1FHLA 2WB5A 1CPUA 1LL7A 1W91A 4WIWA 1LQ0A 3MKKA 3MUY1 3M07A 3GH7A 3W27A 2XVKA 2WMIA 2JIEA 3SCWA 3L4XA 4LPCA 2WMKA 3CMGA 3VD7A 3ALFA 3BXWA 1LG1A 2BFGA 1XD0A 3W6LA 3N9KA 3UESA 5C71A 3W25A 4M1RA 4F9DA 4PTXA 1VJSA 5EBAA 1JYXA 1KFWA 8CGTA 1L8NA 1G9HA 4IUGA 3VGEA 1OB0A 1ESWA 1EOKA 3WMSA 2BY0A 4AZ5A 3CZLA 2E40A 1GOWA 1V3HA 4KWUA 1KGWA 3AISA 3AIUA 1MXGA 3CUHA 4MJ2A 2YKKA 1CGTA 4V27A 2WKLA 2ZX8A 4MB3A 5I5RA 4ATWA 3OB8A 2WYSA 4KGJA 1ITXA 3WUGA 5A6JA 1XH0A 5GNZA 3WNLA 4E2OA 1WAWA 5IFTA 2VZOA 1UKPA 1WZKA 3RILA 1JZ6A 4X0VA 3VGFA 4P8UA 3KZSA 2V3FA 1H11A 2YLAA 4C7GA 2GVYA 3MUIA 2VQTA 1W9BM 1HJXA 4W8LA 1J0KA 4D6DA 1C7TA 1MW1A 1EDTA 2QPUA 3AHTA 5LA0A 2WBKA 4CU7A 4AD3A 3OLGA 1W9XA 4HZ6A 1C93A 2NT1A 5CZKA 4TVDA 1EH9A 1RPKA 5DFAA 4A3HA 1ISVA 2BY1A 3TTOA 1EO7A 1WZLA 2OWXA 4AZBA 5DF0A 3L2LA 1ZJAA 4M29A 3WEZA 1WB0A 1XC6A 3L4VA 3WNMA 3W82A 4OKDA 1TMQA 1Q6FA 5DT5A 1K6AA 2CBIA 2WKGA 3BMVA 3VM5A 1HJVA 5D9PA 3VO0A 1GNXA 3DYMA 4AXNA 1E0WA 2BXZA 2DT0A 2J8GA 2XFFA 5E0FA 3GXIA 1M04A 4JFSA 5HDRA 1MQQA 3GXDA 1M03A 3CZJA 3WD3A 4CCEA 1H2JA 2YIHA 2D0FA 5E0CA 1JNEA 2QMKA 3WFZA 1FH7A 2WVVB 1HX0A 1ISZA 2E0PA 1UUQA 1MXDA 1MQPA 1UQYA 1US3A 3CBWA 1ZJBA 4U31A 3W37A 3L4UA 1UR9A 4P7NA 2EQDA 3N12A 1J12A 2IXVA 2Z1SA 3LMYA 2X1IA 4ZFMA 1W9DM 2RGMA 1VFUA 1BAGA 3AIRA 4BZYA 7A3HA 4HA1A 1V3IA 1CENA 3SCOA 4AZCB 1C8QA 4AZ6A 1W3HA 2OWCA 1GONA 1GUVA 1MWOA 2Y24A 1JFXA 3BH4A 1JXKA 1FP9A 4QFUA 1JNDA 4D6FA 3FHAA 3SUTA 1UWIA 4UCFA 4HMCA 1OD0A 2WVVA 2E9BA 5BXPA 5BRQA 4LQ1A 1G1YA 2Y2WA 3KL3A 3VD3A 3ZSTA 4WLCA 1E1FA 1GOQA 5AYBA 6CGTA 3ZJ6A 1E3XA 1J0ZA 3AJ7A 3VINA 3I3EA 1WZAA 1Q6CA 2WLZA 3MMDA 2VR4A 1KWGA 2WMGA 1JF5A 1W3KA 3AIVA 4CD4A 2DT3A 1R85A 1BTCA 4HMEA 1FH9A 1UWQA 4UOZA 3MMUA 3FXYA 4L4PA 3N13A 2CBUA 4AISA 1CGWA 2ZUWA 2CEQA 1UKTA 3A4AA 1UR2A 5HPCA 1VAHA 2EPLX 3II1A 2UY2A 1B3YA 3PTQA 4JFUA 3AI0A 4AC1X 4A3YA 5A6KA 3WNKA 3AMCA 3WMBA 1QNPA 3K46A 2VL4A 4L4OA 4P8VA 2A3AA 4PMDA 1WPCA 4BS0A 3RCNA 3W24A 1W2VA 1E6ZA 2FHCA 1NP0A 2VX4A 3ZT7A 3MANA 5DMYA 3VIOA 1JI2A 5EFFA 1NQ6A 3WF4A 4M82A 2O9PA 4LXFA 3AIWA 4IPLA 5I23A 4CCDA 2V3GA 4IISA 1JYWA 1B90A 3UERA 5JIWA 4GXPA 1HKMA 3N1AA 3AHVA 1LG2A 2XGIA 3U5UA 4AZIA 2VOTA 1B1YA 2J77A 1EOMA 2WHMA 2WSPA 3UG5A 4GZJA 3L4WA 1MW0A 1AQMA 1FH8A 1UWTA 4MDOA 3HN3A 1SMDA 1W1YA 1BVZA 3AFBA 1QI4A 1GOIA 2DT2A 2CESA 2PF0A 5D9NA 3D5HA 5IDIA 2PC8A 3VMNA 3FN9A 1DTUA 2OYKA 2Y4SA 2X09A 1UD2A 4GIAA 1ZBKA 2G3IA 5TD4A 3FHQA 1JZ2A 3BAIA 1JDAA 4MNKA 3HMCA 3RJXA 4HOZA 1JZ4A 4Z2JA 1V02A 4TOQA 1SYTA 3WDIA 1JD9A 1KXVA 3A3HA 1EQCA 1TFVA 4TTGA 3KWXA 1KR0A 3WEMA 4DWSA 1V6XA 1QNQA 1ZBCA 4W8BA 1H5VA 4Z2HA 3BAKA 3TP4A 1JI1A 3IJ9A 3OZOA 2VRKA 2YBUA 3CO4A 1UH3A 3PZVA 3MUZ1 1TCMA 4D6IA 5A6AA 3AIQA 2YL8A 1B0IA 3TA9A 2YDSA 1WDQA 1WO2A 3RIKA 3GYCA 1CXLA 3UG4A 2ZX9A 4WKHA 1VB9A 4AY1A 2X0YA 4ACYA 3W28A 4CN1A 5F7UA 5DEZA 4J28A 4HA3A 3ZM8A 5D8WA 4CD7A 1HKJA 4GO9A 4R27A 2C7FA 3NSNA 5A2AA 1XSJA 2W91A 2J75A 4S3KA 4W8AA 3THCA 3T2OA 1HL9A 2D3LA 1HVXA 1EQPA 3KE0A 1E70M 2D3NA 1BQCA 3CZKA 2G4FA 3W4RA 3A4WA 5D8ZA 1BPLB 4HOXA 4PMQA 5BXSA 3WEOA 3N18A 3N11A 1QHOA 5CPTA 1CLXA 2GSJA 1LL4A 1ZBWA 1BGGA 2D23A 1ZB5A 2GJXB 3DECA 1PX4A 4X9YA 2JF7A 1CLVA 3LPGA 3EBVA 1VEOA 3VIKA 2WC7A 3SUSA 5ECUA 3AS0A 4C7DA 2WW5A 3NSMA 2J62A 4NRRA 3D3AA 5BXTA 3GXFA 2VCBA 4EAMA 3GBDA 4ATLA 2G3MA 1VENA 4WF7A 2WWCA 4RL3A 3MS8A 3VIHA 2WLYA 4MTVA 3VPLA 1NP2A 1AQ0A 2QF8A 2G3JA 2GJXA 2EBNA 2UY5A 1HJUA 3BSHA 3VDCA 4J3SA 1E5NA 1AMYA 2A3EA 1E1EA 2CBVA 4CD8A 1CNVA 3SURA 3GDBA 4D1JA 2VNCA 3WF2A 1G01A 2XFRA 2Y8KA 1UD5A 2FH6A 3VTRA 3UR8A 3W26A 4W85A 4W86A 2VR5A 1F4AA 2DEPA 3WENA 3U7VA 2VMFA 3B9AA 1YQ2A 3L4YA 2F61A 2FHFA 4P7OA 2XM2A 1UA7A 1O6IA 3BSGA 2VI0A 3GXMA 4CU6A 4UOJA 4FLOA 4E8DA 2MANA 2OSXA 4OOUA 3CZEA 1PBGA 1ODZA 1E55A 1UHVA 3T0AA 4D6GA 4AZHA 1D2KA 2ZICA 3VIGA 2CKSA 3WDPP 1E3ZA 2V3EA 5AYIA 1ODUA 4OZOA 1PIGA 2D20A 2VVNA 1CGYA 1KWKA 2O9TA 3WL0A 3J7HA 1CIUA 1DWAM 1JG9A 2A3BA 5HXMA 2WMIB 3VD5A 2CPUA 3ECQA 5IHRA 1B9ZA 2BVDA 3F4VA 5GPRA 3RM4A 1ZBVA 4WSKA 2WVUA 1G0CA 1JZ7A 2XTKA 4AWEA 4FLSA 2WCGA 2E4TA 4NZCA 4CN4A 1K9TA 4HMDA 5A6SA 1JD7A 3W53A 1I1WA 5E9AA 5BCAA 3WMCA 1V3MA 1GOKA 1J10A 4Z2LA 1CZ1A 4JHOA 4PBGA 1HKIA 3A47A 4FF5A 1Q6DA 2G8ZA 4FLQA 4PCTA 2XSBA 1M53A 1HIZA 2PWHA 3UETA 3B9DA 3SUWA 1RP9A 4DUWA 1F4HA 1US2A 1JZ3A 1Q4NX 2GFTA 5ABFB 1CBGA 4MNLA 1QI0A 1E4MM 3WELA 4KRTA 3U7BA 2QPSA 4TTUA 4J3TA 4X0NA 4OUEA 2QMJA 2Y5EA 2FHBA 3W0KA 3SCVA 4PMXA 3LPFA 5E70A 2FGZA 3RO8A 5LA1A 2WAGA 1PIFA 2GK1A 3WNPA 4DUVA 1W9PA 2XUCA 3T2QA 2DPEA 1J9YA 4D6CA 1A3HA 1UR8A 2UWFA 3VD4A 2XPKA 4XUYA 2YJQA 3QR3A 4FK9A 4H8UA 4EKJA 3FNDA 5ABFA 3VKKA 1OWQA 1OINA 3MMWA 3WD2A 5CGTA 3W38A 4MAVA 1CXIA 1BGAA 4UQAA 1NARA 4W89A 4V28A 4H41A 1C8XA 1HF6A 2ZUSA 2BXYA 3VIMA 1MYRA 5D4YA 2WBGA 3WDRA 1BSIA 2NSXA 4GPNA 1R7OA 3DC0A 2V5DA 3BMWA 3VNYA 1LLOA 2EPNA 1WKYA 3T0BA 3CGTA 3O2LA 2QLYA 2XHYA 3OLDA 4OBRA 1LL6A 1VRXA 2VURA 1OCQA 5A3HA 1B2YA 2YLLA 4J3UA 2ESCA 5A8OA 2E8YA 1TVNA 2YOCA 2A3HA 1W1TA 1JDCA 1VBUA 1E4IA 4ZEPA 2XGBA 2J7BA 4LGXA 2GUYA 2EO7A 3DYPA 2W63A 3CHFA 2HVMA 1CECA 1E71M 2CETA 5A8QA 2JEPA 4BQ3A 4QLJA 4PMUA 5M3WA 1CEOA 3AZSA 1UZ4A 1W9VA 2NT0A 2DDXA 1MVYA 1W32A 3K8MA 3NDZA 2WVSA 2CXGA 1GHRA 8A3HA 1E6XM 4UFKA 1E72M 3ARSA 2PWGA 4FMVA 3PHAA 3VIJA 3I3BA 2WHKA 4OJYA 1Y7VA 4JL1A 4DWSD 3DHPA 3WUFA 3B8SA 3APGA 4YHGA 3VMPA 3AQUA 2BY2A 1QNRA 3G6LA 3MU7A 2WNWA 2WANA 1PEZA 1I75A 1DP0A 2YL9A 4N42A 3WDQA 5CSUA 2BV9A 1H41A 3BC9A 2J74A 1IV8A 4QDMA 1HVQA 3CH9A 3RDKA 3QGVA 2W5FA 2YDQA 1FFRA 1UR0A 4RE4A 2TAAA 5FKYA 2X0HA 2X05A 3N17A 3WD0A 4AW7A 2ZWZA 2AMGA 1GVIA 4Y7EA 5ABGA 1JF6A 1JGIA 1KBBA 1UD6A 1B3WA 2XIBA 4UFMA 5CSYA 1DWHM 4MB4A 3AZTA 4RE2A 4CGTA 1V0LA 2DT1A 3WF3A 2OWWA 2XVGA 3ARWA 2D24A 4OBSA 4Q22A 4PSRA 4M80A 1V6WA 4UQEA 1UA3A 1MFUA 4TUFA 5IFPA 4MJ4A 2QV4A 1GOOA 2ZX6A 9CGTA 2YBTA 3GM8A 4WKAA 1GOMA 3SEPA 4AZGA 4W7VA 4CVUA 2W61A 1UKQA 1B3ZA 2GJRA 4S3JA 3POHA 1K9FA 2X8RA 4JZ5A 3VDHA 3NIYA 1JZ5A 4W93A 1J0JA 5JBFA 1H49A 3VGHA 1V02E 1W9UA 1LWHA 3WH9A 5I78A 1BFNA 1AQHA 3NCOA 5D9OA 3SIMA 1NWUA 3THDA 3T08A 4UQBA 2W4XA 3IJ8A 4ZENA 1QI2A 4PRWA 1K9DA 2VO5A 1DWGM 3EYPA 4F9JA 1JZ8A 4AMCA 4AIOA 3VM7A 1UQZA 2AOSA 1ZL1A 2XWDA 4PTVA 4H8HA 2PBGA 1V3KA 2ZXQA 3E1F1 4HZ7A 1UWRA 3BAJA 1KXHA 3MSGA 1FA2A 4MB1A 2X2YA 2ZX7A 1WZMA 3RM8A 1J0HA 3EDEA 3KL0A 2YL5A 1JYNA 3CHEA 4U2YA 4W7UA 2YA1A 4F66A 4CN6A 3WQVA 4Z2GA 3PZUA 1BVNP 4UZUA 1UWSA 3B9EA 3VGGA 3POCA 4AZ7A 1XYZA 1XD1A 4NI3A 1TA3A 3WKZA 4W7WA 2WMFA 4C7FA 4PUDA 3WQ6A 2VX7A 1UH2A 1V6YA 5CPSA 2CCRA 3AIEA 3MSDA 4U5KA 2WXDM 3ARTA 6A3HA 4DWSB 3ZIZA 2Q8XA 1NOUA 1KGXA 2XSAA 5A94A 4E4PA 3VDBA 1UR1A 3IAQA 1NWTA 4F8XA 1VFFA 4P8XA 2J78A 5I6SA 1PJ9A 4V2XA 5EMYA 3WH6A 3PTKA 3VNZA 4Q7NA 2AAAA 4MB5A 1ZS2A 4H7VA 1BYCA 4UQDA 1V3LA 4XB3A 2OYLA 3SCPA 3EDKA 1OIFA 2J8FA 3K8LA 1E6RA 5CJ5A 1VF8A 3ZJ8A 3ZOAA 1DWJM 1B3XA 4A4AA 4F79A 4ZXLA 1C91A 1X6LA 4UQ9A 3AMKA 1U33A 4HA4A 3WBEA 1B3VA 1JAEA 2ZXAA 4NRSA 3AMDA 3I3DA 3QOMA 5I2UA 1XHGA 1XSIA 5FL0A 1E9LA 4HU0A 1BYBA 3VGBA 4TXEA 4CD6A 4HPHA 3K1DA 5A8MA 1R7AA 5C8BB 1PAMA 2VJXA 3QHNA 1FHDA 1HT6A 5GNYA 2PB1A 1B31A 4XV0A 1PX8A 3U57A 4JKMA 4J27A 2WPGA 2V38A 2XVNA 2CHOA 2YA2A 3WBAA 2HISA 3VUPA 4QP0A 5A2CA 3GNOA 1W3LA 2WC4A 1EDGA 5HNNA 3BLKA 3OBAA 2PWEA 3VGDA 4CKQA 3AS3A 4HPGA 4JAWA 2J7FA 2BHUA 2BHYA 3ZJ7A 4IM4A 3ARZA 3EMCA 1XRVA 1J0IA 3UEQA 1ITCA 2D1ZA 3ZO9A 1QBAA 4ZXOA 1KB3A 3PZOA 2IXUA 1AVAA 3ZMRA 4W87A 1UR4A 2DSWA 3MO4A 4NF7A 3WH7A 4M81A 5CPQA 2FH8A 4DM2A 4WKFA 1RD6A 4AD4A 3PBGA 4UFJA 1M7XA 1WDSA 2PBOA 3PZGA 1PX3A 5I24A 2JFEX 2WVTA 5DO8A 4ML4A 3WF1A 1S46A 3WH8A 3WQ4A 1YHTA 4MAZA 1W2PA 5FD0A 1V6UA 4PMRA 4UZSA 1HP4A 1M01A 2VZSA 5LA2A 1CXKA 2J7HA 4BQ5A 3FAWA 3OLIA 1UD3A 3VIPA 3KEHA 4U33A 4PMVA 3PN8A 5EB8A 2CNCA 3OA5A 3JUGA 1UD4A 1GJWA 3A6OA 2EPKX 3GNPA 3FW6A 2J7CA 2DIEA 4PN2A 1UD8A 1D7FA 3AXIA 1JL8A 1BHGA 2W62A 1IZJA 3GH5A 2DH3A 1R86A 5KEZA 2VC9A 1HL8A 1GQJA 1W1PA 3K4AA 3WQ5A 4DWSC 3RJYA 1JXJA 1ISWA 1OSEA 5BRPA 4XX6A 4GKLA 3T2PA 4H04A 1FP8A 1I1XA 3PZ9A 4J3VA 3WNNA 1XSKA 5FOOA 1IZKA 2WCAA 2ZWYA 1V0MA 3AS1A 5ABEA 2VQUA 1E73M 2DGAA 3T09A 3WH5A 2CKRA 2D0HA 2E3ZA 2PI6A 4DUXA 5IXEA 1WE5A 4AIEA 1WCGA 2CIPA 5BYWA 1SMAA 5ABHA 1J01A 1U30A 2BS9A 1BYAA 4K68A 1ISXA 1PPIA 1VFMA 1B30A 2DSVA 3AHZA 1TZ7A 3RMEA 3BAXA 3WIJA 1O7AA 2GK1B 3GZAA 1E6SM 4FLRA 1CWYA 4AD0A 1GVYA 3WL1A 1UZ1A 2J7GA 2F2HA 1H0GA 4EANA 2VX6A 5AY7A 1DHKA 2YA0A 3VVGA 4PEEA 2WHJA 3ZR5A 3AMGA 4AEFA 4AEEA 3QHOA 1KXTA 1TUXA 3AHYA 1R87A 1LJYA 5D9MA 2WMJA 3NUKA 4M56A 2CITA 3EMQA 1H4PA 4U3CA 1SR0A 2BVTA 4U3AA 1TVPA 3EDDA 3ARXA 2JIWA 4TVUA 1C3FA 4GQQA 1V6VA 1X6NA 4R5EA 3L4ZA 4Z2IA 2ZE0A 3GTNA 1P6WA 4DM1A 1N82A 3M46A 1E4LA 2DQXA 2VZVA 3SUVA 2CERA 5M17A 2G3NA 4PMNA 1NH6A 4AD2A 5A6BA 4KRUA 1E6NA 1CTNA 5CXPA 4GI9A 1BLIA 3BLPX 4U5IA 2DIJA 1GW1A 1KR1A 1ISYA 2BVYA 3TTYA 3SCUA 3VDAA 1NOWA 5GNXA 5LYRA 2E9MA 3OG2A 1HJWA 3LPOA 3PTMA 3CUFA 1GPFA 4URIA 3ARQA 4ACZB 3WY1A 1QW8A 1K9EA 5M5DA 1KGUA 2VUYA 1X1NA 1E6QM 3AZRA 1L0PA 1C8YA 1W1VA 1CGVA 3FY1A 1NM9A 2WHLA 4PYSA 3WD1A 3M6DA 1HJQA 4B9ZA 1UYQA 2UY3A 7TAAA 1EHAA 4CD5A 1H09A 3S2CA 3ZT5A 1G94A 4H8VA 3ZR6A 1UOKA 4B9YA 2VRJA 4J3WA 3L4TA 3ZJKA 1QI5A 4D6HA 1CXFA 1MFVA 2Z1KA 4D71A 1W3JA 4TX6A 1SFSA 3W29A 4CU8A 3CHCA 3WN6A 3KL5A 4QCEA 1OGSA 4U2ZA 4ACZA 3GH4A 3CUJA 5CLTA 1OT2A 3IANA 4ZE4A 4GQRA 1NOFA 1UKOA 2C8NA 5FL1A 1R8LA 1QW9A 1ZU8A 1DWIM 2WMHA 2CBJA 3WQ8A 2OSYA 3AMLA 5BXRA 3AICA 4D72A 4WSJA
chains in the Genus database with same CATH superfamily
1SW0A 3OGVA 4JBWF 3U5YA 3NJ3A 3WDJA 5J5RA 3TW7A 3RYHE 2J9XA 4Z2KA 4P7LA 3C4XA 5RUBA 5LIXX 1B4KA 5C70A 2JKEA 3GW0A 1HNZT 5HYAA 3FS2A 4JXCA 1PS9A 4ZQMA 1I4NA 2J7EA 5L4HA 4FO4A 4JIEA 4HZ8A 1V3JA 1I45A 3B8WA 3CHDA 5DJQC 2J27A 2LRLA 3R0KA 1Y8BA 4NIRA 2PMQA 5C6MA 2I5GA 2UBPC 4X22A 2FJBA 4AKGA 1T8QA 2CWYA 4HTYA 2IQTA 2A3CA 4TWFA 4HSOA 1YE4A 4JI8T 5IBXA 3IRSA 4JY9A 6XIMA 1UBPC 3QB5A 3F5LA 1X97A 1FMWA 2YL6A 4ZE5A 1VFLA 1PVNA 2Z1BA 3GVVA 3PZMA 4DJED 3OP2A 4W4QA 4LYRA 5FY0A 2KZ7B 4DR3T 3UQ4A 3TZFA 2EG7A 2F6XA 2FTYA 2V5CA 4XZBA 3TQVA 1PXGA 4C6LA 1HTJF 4JTHA 5FIPA 1BF2A 2YYUA 4R53A 4D6EA 1E43A 4LF2A 4PFPA 2NQJA 4KGLA 1KXQA 1RH9A 3A3XA 1XLDA 4YPJA 1NEYA 1FOBA 5LIKX 1GQNA 1M41A 4M7TA 3CZGA 3WI3A 4A05A 1T99A 5KDMC 1V79A 3WQFA 3BARA 1VD6A 4QJ5B 4NJJA 1VEMA 2Z29A 2O92A 4K7YA 1EA9C 3T0TA 4WY0B 2INZA 4WGXA 2DWKA 1E5JA 2Q02A 3RKOA 2BNJA 3BG9A 5C8YE 4O0KA 5SWUA 5FY7A 3DFPA 4PL2A 2QUNA 1LBLA 5L3DB 3AXXA 2UXCT 4GVIA 3UJSA 3TSDA 4ILSA 3B05A 2FVLA 2IPGA 4H2CA 3A4XA 8RUCA 3BJFA 1Z3NA 5CG0A 1P1XA 1GYLA 4DPQA 1S1PA 3V5CA 3REQB 4REQB 5CBBA 1RK6A 1KO0A 4YSXA 3DFNA 3R2GA 4CCCA 2F8QA 9XIMA 4H9UA 1OGBA 3HPFA 1SUXA 1BEUA 1JYVA 3K8KA 3CWOX 3ZYLA 1AFSA 1CXEA 1LF1A 3STGA 3NGFA 1TREA 4V1XA 6TAAA 2ZDRA 1Q2RA 5D38A 3TUUA 1TWWA 4WD0A 5HWXA 3CU2A 3CTTA 4DB7A 2VZUA 4JI7T 1KEYA 4JD4A 3UR7A 1KFLA 4XVEA 3EDFA 2QCCA 4H63V 3C2FA 1KM0A 5JRCB 1ADSA 4B5XA 1A49A 4QG8A 4N9BA 2NW0A 1KM1A 3IJDA 1DJNA 4IE4A 2Z1VA 3PBVA 3VKJA 2C1IA 1EJUC 3H3MA 4N0RA 1TR1A 4ZI7E 4IX0A 3HV9A 3EDVA 2E9XD 2ZX5A 3MBFA 5LHEA 5JDHA 2X0LB 1KTNA 4EE9A 3LCLA 4LUTA 4OUIA 5AQQB 4JEHB 5A6LA 4UMCA 4EPDC 5KZEA 2HH7A 1W5OA 2DQWA 2ZXBA 2JF6A 1SO3A 4WK9A 4DO4A 1B5TA 4D6JA 5I07A 3PUDA 4TV9E 2PA6A 4NX5A 4XBFB 3OGSA 2ZTKA 2B0MA 4JFVA 3UWYA 4UTLA 1KBKA 2WZHA 3GZ3A 5FCZA 2VTFA 1UH4A 4EOZB 3EKZA 2DUXA 2NX9A 4MIMA 3RIUC 1EYEA 3MSRA 2ZUTA 4JX5A 3ITOA 1VHCA 1LQAA 2O4QA 4L5GA 3GKAA 4EWND 4IFKB 1EIXA 5IHSA 1IEVA 1HNYA 1ZALA 3STCA 3TTQA 2VKJA 1K3UA 2OOGA 3LCGA 1AD1A 4IICA 4B3LA 2A7RA 3CMJA 3G1XA 3EDUA 3TFXA 1EL3A 4PRRA 2FKPA 2X40A 3ZJ2A 2QUMA 1E2AA 3P4PA 5M1TA 3PPGA 1QPKA 4ZQRA 1G5AA 4PC8A 1TG7A 1EXPA 1UMYA 3VX0A 2XQ6A 5LGTB 3GDKA 3EA1A 2OEJA 1EPVA 4QE4A 2PZNA 3RPUA 1VJIA 3I6RA 1EF2A 3BOLA 3RF9A 1J5SA 5D03A 3ARRA 2LM9A 2ZUUA 3DHUA 3N15A 3RO6A 3M0ZA 5B80A 3QY8A 4EYUA 2Z2UA 4JOMA 2CE7A 5LHFA 4PCSA 3OGRA 1TVLA 3NPVA 3HKEE 3RPMA 1J0YA 5E0KA 2OCZA 5TBOA 3WLPA 4HFBA 1HP5A 4Q4PA 1UCWA 2DJLA 2C5JA 4LYQA 1FXPA 1S5WA 2XIIA 5AQLB 3XIMA 5JBDA 4MY1A 1PSCA 4PR4A 1Q63A 3GNRA 5LZLA 5JH1A 3QBUA 4AKHA 2Z26A 2QIWA 2G41A 3W1PA 3I4KA 4RV8A 3C4WA 1XCXA 5G2HA 5G4HC 2EJAA 3FYOA 1YRRA 2WOQA 3H4WA 4KWSA 2X9YA 1GHSA 5AC5A 3WUEA 4WJXA 1BF6A 2ZZ5A 7ODCA 3VIIA 2YCIX 1WCRA 4LU0A 1GQLA 2OFJA 2ZZ2A 3OOQA 4QAWA 4XZWA 4B5UA 1AK5A 1BG4A 4EYYR 4JEUB 2JEQA 5AVHA 4IUOA 4DZIA 1LUCB 4UOQA 3SY5A 2GDQA 3O6YX 3WSUA 1E0XA 1K02A 1DE6A 3SFDA 2V8SV 2IQDA 3I7SA 4ERRA 4AIUA 2AE9A 1R9ZA 2J1DG 4HK7A 3WDHA 3K5XA 5EY5A 1XGZA 2QCMA 1MQRA 4L1GA 1XH1A 3AYVA 2VCCA 3VIFA 1QATA 3V3WA 3RM9A 1K70A 2YCEA 3CAQA 4QCFA 3ZMVB 1A53A 5EGRA 3MI2A 5AYYA 3K3QC 1FWCC 1LL7A 3ABRA 1OC6A 4V15A 3IEEA 4ZHQE 4DAIA 5LNRA 4HHMA 1VIZA 4ZOAA 2WSSV 2WMKA 2GQ9A 4I7UA 3DBPA 1LG1A 4LW7A 1XPGA 3GXPA 2ZFAA 2QDHA 4C6QA 3WJYA 4M1RA 3MUXA 3QJAA 3AEGA 1QSDA 1VJSA 2UV8G 2LE8A 4XO6A 5DXXA 5F2MA 3DU0A 1L8NA 4IUGA 1HTIA 5LHGB 4BJMA 3G8EA 1ESWA 1EOKA 3WMSA 2REQA 5L9FA 4LEFA 2E40A 1GOWA 2Y70A 5LOVE 1VCSA 1VHNA 1MXGA 4MJ2A 3NEHA 1CGTA 3OB8A 2WYSA 4KGJA 1ITXA 5A6JA 1XH0A 1KFJA 3SSZA 1Q6RA 1WAWA 4N9EA 4B5SA 1IT8A 4LAUA 2JKAA 3EI0A 3QZEA 5I02A 4X0VA 1RVGA 5HINA 1NFPA 2GVYA 2VASA 3MO7A 3UXKA 1P0DA 1HJXA 2H88A 4PZVA 1ZV4X 4B4HA 2K24A 3JCFA 1JVNA 1EDTA 5LA0A 4XZLX 3ZR4A 4CU7A 4AD3A 2J8TA 2Q9QA 2GLKA 4LCQA 1C93A 4IREA 2NT1A 4R33A 4A3HA 3EB4A 5J2TE 3WAJA 4YFSA 4EP8C 5JDGA 3ZZ1A 1EO7A 1WZLA 3LY0A 4AZBA 3NQ6A 5DF0A 5TQLA 1IE7C 2L8KA 4M29A 1WB0A 1SZEA 1XC6A 3WNMA 3W82A 2A79A 3NVDA 3W2UA 3ZYMA 2WKGA 4XISA 1B9BA 3QLDA 5D9PA 3GO2A 1UC5A 2FJEA 5E0FA 4O4IE 1ZKEA 4MPQA 4P0BA 1O5XA 1C8VA 3LV6A 4CCEA 3WD3A 4FOUA 3F4WA 5BOOA 3H4XA 2D0FA 2C13A 3SY8A 1TV3A 4CNUA 3AA7B 5E0CA 4UUIA 1I2RA 1HX0A 4S23A 1NF0A 4PCFA 3AYTA 3SZ8A 3W37A 1UR9A 2EQDA 3VCCA 3CQGB 2IXVA 4BA9A 3TLTA 1BAGA 4L56A 1V3IA 1DJZA 3SCOA 4AZCB 1W3HA 2OWCA 1AODA 1IBKT 1TZZA 2Y24A 3BH4A 3N3TA 3C98B 2YB1A 2Z24A 3MWAA 4KEUA 2NLIA 1IAPA 1JNDA 1ZAJA 2Y7EA 1HQTA 3SUTA 2EHOA 1OD0A 4LAKA 2WVVA 3T07A 1EJ7L 1P6CA 1G1YA 1HCIA 3TYUA 4WOQA 5LNUA 4HFCA 5AQVB 1GOQA 2MAWA 1PL9A 3ABZA 3AJ7A 1WZAA 3VOIA 4AWTA 2VR4A 1JF5A 1W3KA 4HWDA 1R85A 1XG4A 2BS2A 4HMEA 1KRAC 3FXYA 5LXTE 2PWUA 4AISA 2CBUA 2DORA 4DV3T 2FJKA 2OT1A 3W70A 1MIVA 3TN6A 2E09A 3A4AA 2VD8A 4ADSA 2P88A 5HPCA 1R5YA 1XRSA 1PTGA 3WNKA 3CJPA 2HTMA 1QNPA 3S6OA 1R9YA 1BR1A 3I6TA 4BS0A 1O5QA 3W24A 5JMUA 3KV6A 1FX6A 2FHCA 2K5BB 5AQMB 4X66T 2YPIA 2EGZA 4ZB0A 4MWAB 3AUJA 5IDZA 4Q8TA 4UF0B 4M82A 4B90A 2O9PA 1VYSX 1M5WA 3HPXA 1ZAIA 4KWWA 4Y9NA 4CCDA 3W85A 3N29A 3OKQA 3N1AA 2QKFA 3CL8A 2J77A 5D2TA 4X2PA 4LY4A 4JTEA 1AH3A 1EZ2A 3L4WA 1VS1A 1Y0EA 1R47A 1E1HB 4KKXA 3H2CA 3SSJA 1D0XA 2A1YA 1JCJA 3IUIA 2A9UA 5DQVA 2CWXA 4JTIA 4S3GA 4ZTXA 4Z90A 4CQ9A 1Z8UA 1SHZC 5F3JA 1LRNA 2PC8A 2WQDA 4DO7A 3FN9A 2FZDA 1Q3NA 2Y4SA 4E4FA 1UD2A 4O18A 4K3ZA 3QF0A 2ZQ0A 1U5PA 2G3FA 1V51A 1JZ2A 3DKJA 4Z2JA 1SYTA 3WDIA 3LHZA 4INFA 3MP5A 1KXVA 3QGKC 2QYGA 2QGSA 2ZRWA 1EQCA 1TFVA 1TPC1 1VC4A 3KWXA 2RDXA 3WEMA 4DWSA 1X1OA 2P0IA 3FIGA 3VHLA 1ZBCA 4MZ1A 1JI1A 4LV4A 2AL2B 3EX4A 3CO4A 1TRIA 4LVGA 1F73A 2YL8A 4OFZA 1YXDA 2ZDSA 3IJLA 4EZ4A 1WO2A 3RIKA 3GMIA 3GYCA 4IGNA 3UG4A 1B3OA 4MOZA 4AVNA 4J5NA 2OXNA 5DEZA 1BVWA 1P4CA 3ZM8A 2QCFA 2QIIA 1W8SA 3W1TA 4H4IA 1AG1O 3Q94A 4R27A 3HPZA 4IIEA 2PDYA 3C6CA 2B1EA 2W91A 2FMNA 3THCA 3ZWSA 3W1RA 4LS1A 2D3LA 1TPUA 4MKNA 3UFEA 1Z41A 1BQCA 3CZKA 3LS9A 1OVDA 4PK6A 5BXSA 4F2BA 5HQEA 4PTNA 2LJLA 4PA8A 3VA8A 3UXDA 2PCQA 4S3DA 1TJRA 1A3XA 2GSJA 3PNZA 1QT1A 4HBKA 1NEKA 2H8XA 4OYKA 1W1IE 3NZ1A 1TTIA 2WBLA 4RZ4A 3TN3A 3FBLA 4O0ZA 1G6CA 2SPCA 2MYSA 3HKCE 3LPGA 1RK5A 4P1NA 3VIKA 2WC7A 2XFWA 4HKPA 4IDQA 1YDYA 3AS0A 4NUUA 2VFHA 3CIXA 1OX4A 3GXFA 2VP8A 4GJIA 3KUMA 5HQMA 4LFYA 1ZY9A 4RL3A 3CAKA 5EK4A 4MTVA 5FJIA 2J66A 2Y1HA 4G2DA 1NP2A 3SM0A 2G3JA 1XM3A 1S2TA 2GJXA 1RBAA 1HJUA 2GGEA 3VDCA 3ABVA 1W56A 3V0TA 4Q7IA 2A3EA 4R3UA 2FZNA 1E1EA 4H9OC 3SURA 3GDBA 4AWUA 4D1JA 2VNCA 3WF2A 5FJRA 4EF9A 3PB0A 2XFRA 2XAGB 1QASA 3UU8A 2QCLA 4DYEA 2ZRYA 1HW6A 1AJ3A 5C54A 2YZRA 3U7VA 1SJDA 5HEHA 3L4YA 2OZ0A 2FHFA 4G5DA 2XM2A 2WY2A 4DIDB 1F6YA 3TVAA 3JRKA 5LMNT 4GG9A 3GXMA 1R8IA 3VRBA 4CU6A 1PKLA 4FLOA 3CMFA 2MANA 1POJA 3TLQA 1A5KC 3S1VA 4IMFA 3UYIA 4H19A 4I6KA 1JEZA 2C16A 1ODZA 4JTKA 3VNIA 2DNXA 2Y5SA 2OQHA 1FMVA 4AZHA 2I1OA 3VIGA 3RGLA 3RX2A 1JR1A 4OZOA 3UULA 2IPFA 5FAGA 5LA6E 1CGYA 4NYUA 5JQ9A 4WGHA 5L6UA 2O9TA 2QV5A 2BG5A 4DO6A 5DBUA 2A3BA 5HXMA 3OZMA 3UT0A 4DV2T 3QOFA 3GXTA 4PJNA 4ML9A 3RRCA 1B9ZA 5J04A 4JI2T 5JDFA 4EGWA 3PBYA 1K03A 5GPRA 1A5BA 1A5LC 4WSKA 1G0CA 3DKLA 1P0EA 1UBSA 1IWPA 1US7B 4NZCA 4UTTC 3W53A 1I1WA 2CMRA 4UTIA 1CZ1A 5LXXA 1M7PA 1R2TA 4LMLA 3A47A 4LOCA 1Q6DA 2X2GA 4YVPA 4LB3A 5K7JA 1HIZA 1NELA 3H2NA 4IDPA 3N2MA 3UETA 2G4JA 4PUMA 5L3FB 2VR2A 4DV1T 1VH7A 2GFTA 4QXCB 3R84B 3DESA 1CBGA 4MNLA 5LNVA 3WELA 4IE0A 4KRTA 5IM51 2OQYA 3GFZA 2X67A 1DJXA 2EG6A 5E70A 5LA1A 1GVRA 3ANYA 2GK1A 4DUYT 3RAOA 1W9PA 3A5FA 4K0UA 2LOSA 2XUCA 3T2QA 2BBFA 5C7VA 2Q01A 1A3HA 3W7IA 1XDLA 1UR8A 2V2CA 2H90A 1QW7A 3VD4A 4HFVA 4XUYA 3EXSA 3HL6A 4N02A 3FNDA 4X20E 1AZ2A 2BG9A 1OWQA 4MAVA 2JMHA 1LDCA 3AWNA 1CXIA 4U7YA 1VBJA 4H41A 5AN7A 4XTDA 2ZUSA 5LKYA 3VIMA 2D2SA 1OADA 4GPNA 3DC0A 3QGAC 1A4LA 3BMWA 1G69A 1LLOA 3O2LA 4OBRA 3Q67A 2WNNA 4FAMA 2YLLA 3E5BA 3OQ8A 3OIXA 1W1A1 2E8YA 2ONEA 1W1TA 1JDCA 1LCOA 1G4TA 3FX4A 2PU0A 3QZ6A 4LCSA 4MWAD 4QJ1A 3MDUA 2W63A 3STFA 3S9IA 2CETA 4DEFA 1YNQA 5CGQA 2QF7A 3CMLA 2RUSA 4PMUA 4A35A 3AZSA 1UZ4A 2Y6ZA 3L5AA 1Y65A 4ZFCA 2V69A 2DDXA 3H53A 5AHLA 4J1OA 4PB5A 2MBGA 1GHRA 1BR4A 8A3HA 1E6XM 2RDTA 4IE6A 1X8CA 2L9QA 3PHAA 2KINB 2R94A 3M4HA 3WUFA 4C5ZA 1TKKA 3B8SA 3APGA 3USBA 3VMPA 3G6LA 2BVLA 2WANA 1PEZA 1I75A 4GFSA 2ACZA 4DI8A 3DI1A 2P53A 5JXQA 2D2JA 4O4HE 4C6PA 3VU7H 1S2UA 1H41A 4RLIA 1REQB 2J74A 4B3ZA 2LHNA 3KOZA 1E9ZB 3C64A 2E28A 3TNBA 4QDMA 1HVQA 3NL3A 4LYKA 1FFRA 4ES4A 3FA5A 5FKYA 4JIPA 2I0MA 1ONXA 1SFTA 2AMGA 2A72A 3T8OA 3EPMA 3LGDA 3NBXX 1UD6A 1B3WA 3M41A 4DXVA 5CAKA 3F7JA 3THAA 4G56A 4CQ8A 3B06A 4F0SA 4KFNA 1V0LA 4E2BA 1JJKA 4A5XA 2D24A 4Q22A 3VKCA 3BLLA 3A22A 4R7JA 2PDQA 2ZX6A 3BWWA 2XU2A 1XYAA 3TAOA 4ZO8A 5BMXA 2X7WA 4AZGA 3SQMA 4KIEA 5AECA 1FWSA 1T96A 2GJRA 1E51A 2X8RA 4ZS2A 3L2IA 4CNTA 2BP1A 3NIYA 4W93A 4RNHA 4L1XA 5JBFA 5JU6A 1UP3A 2DZBA 3UJFA 1V02E 2NV1A 3H7RA 3W7OA 2PDIA 3TC7A 4ILUA 3EEZA 3GNNA 1BFNA 3Q5DA 3X1DA 3OTRA 3FGCB 3FXDB 4UR7A 2QR6A 4OHQA 2NTXA 3C2EA 4UQBA 4ZO6A 3RHGA 3IJ8A 1H51A 1QI2A 5D30A 3NFUA 2FFIA 3AALA 3J9X1 1K9DA 3ZLFA 2VO5A 1Q45A 2J24A 3EYPA 4F9JA 1VCGA 1NWMX 2R1PA 1JZ8A 4AMCA 1TELA 3O9XA 4IOTA 3O8AA 1OZQA 2ZM6T 2E77A 2Z6IA 4FHAA 2X2YA 4MB1A 1A5SA 3PPHA 1GGOA 4Z8XA 2YL5A 3MCMA 1YQ3A 4F66A 4M6QA 1Q7QA 1HKWA 3QC0A 4MVAA 3RCMA 5JDMA 4PK5A 1MIWA 3H54A 4YTQA 4UZUA 2AQOA 1XD1A 3NL2A 3LCIA 1XIEA 3GQYA 4W7WA 3PNUA 3WQ6A 4NILA 4QJ4B 2VC6A 4QSHA 4HHHA 1MIYA 5CPSA 1YPIA 2CCRA 2A5HA 2WXDM 3BJTA 6A3HA 1TB3A 2YU2A 5CCZA 1GG0A 4KWVA 1DQUA 3ZIZA 2XH7A 4Q6XA 2XSAA 1KGXA 2FMOA 3CQHA 4E4PA 1NWTA 5BZAA 4RW5A 3NKZA 2J78A 3BLOA 4O0QA 3BW4A 4YCPA 5I6SA 1PJ9A 4V2XA 5EMYA 2AAAA 4MB5A 4H7VA 2E1WA 4UQDA 3OBVE 3S2JA 2PSNA 4ADZA 3OEXA 1V3LA 3SCPA 5LIUX 1T6MA 2J8FA 3K8LA 3AU2A 3YPIA 4B6XA 4IP5A 5B7YA 3CS2A 1B3XA 2PCEA 5IWAT 4F79A 1Z0PA 3IV3A 1V5XA 3REQA 4REQA 1JPDX 1UP2A 1BKHA 1B3VA 3B8DA 2ZXAA 3MSYA 3AMDA 1XHGA 2CW6A 3LXBA 1SZFA 1VCVA 4MUZA 3W7EA 1BYBA 3NQ7A 4DJDA 1TQJA 3ZLHA 4XZCA 4K1GA 4C5YA 2Y7DA 3PM6A 3V36A 1FHDA 2PB1A 4XV0A 4TZ4C 4XZ9A 2BTMA 2WPGA 4RCXA 1EP3A 1NVMA 5FNVE 4Y8EA 3KS5A 2XVNA 1FWRA 1SVDA 1P5BA 4Q4KA 5JRCA 4DBWA 3F4CA 4DUZT 3WBAA 1L6SA 3DG3A 3AB3B 2UUBT 1B57A 4QP0A 3P7YA 3EXRA 5A2CA 1BXNA 4X5TA 3GNOA 3WJWA 4A97A 2WC4A 1EDGA 4HNVA 2PTYA 1SO4A 4EVZA 1PZ0A 4XIMA 4CKQA 2A7NA 1DORA 1HF8A 1Q8JA 4DBUA 2J7FA 3ZJ7A 4ZI3C 4IM4A 1US0A 3EMCA 1XRVA 1J0IA 1ITCA 2D1ZA 1F5ZA 2ZKMX 4M1PA 4ZXOA 3E2QA 1Q6QA 3AXKA 3ZMRA 3LHUA 3G1FA 3WH7A 2G0WA 5CC3A 5L3EB 4DBRA 4WKFA 3QR1A 4GVHA 1DBTA 1H7OA 2HN1A 2E6YA 3QMTA 1QCWA 4GE8A 4ZMGA 3E2VA 4QE5A 5I24A 2V2DA 4GXMA 3ANWB 5DO8A 4GIRA 4CQBA 3GY1A 3WQ4A 1YHTA 1I2QA 4MAZA 5CSRA 2PFVA 1L9WA 3NQDA 1LKXA 1XYLA 4IFKA 2VZSA 1M7JA 5LA2A 2IMLA 1CXKA 2J7HA 3GWQA 4UNLA 5T91A 5FF7A 4OHFA 3OLIA 3KEHA 1U5VA 1P0BA 4PMVA 3OA5A 1H60A 1Q8AA 4J9JA 1GJWA 4Y96A 3MPGA 5G1MA 2J7CA 2HMCA 4IPIA 2F4VT 3HR0A 1UB3A 2DIEA 1UD8A 4XO7A 2R24A 2VGBA 1K77A 2W62A 1F8IA 1QO5A 4HTBA 4L9XA 3GN5A 1FTXA 1W5NA 3FV9A 4TWHA 3UBPC 1U1HA 3AXJA 3DI0A 1K7FA 1W1PA 3WQ5A 4DVOA 1RAKA 5KINA 4C6KA 4QISA 2HVOA 4GX8A 4XX6A 1GEQA 1I1XA 4S2CA 4GACA 1Y5VA 4J3VA 2QZRA 4H00A 1NIUA 1V0MA 1UUOA 2BWGA 1JPIA 3LRKA 3LD5A 3N9SA 2D0HA 5IXEA 1SSDA 3RMJA 4QG9A 2VENA 3IVUA 1S39A 3VZXA 5BYWA 1OHLA 4ICMA 2NX3A 3GAYA 1ISXA 1IT7A 1XF0A 2NWRA 2WM9A 2YXOA 1B30A 3AVRA 1S2AA 3UY8A 3Q2DA 3BAXA 3W7GA 3BQLA 3GZAA 1QRQA 4OVXA 3GR8A 4JBRA 4C6IA 3CK6A 4ZZCA 4DYJA 1UZ1A 4JY8A 1FWBC 1W3NA 2F2HA 1FWIC 4EANA 1KA9F 4L6HA 8TIMA 4BJHA 4YY3T 2YA0A 4PEEA 2WHJA 4UIGA 4O15A 1R87A 3LBOA 4CCZA 3NUKA 4M56A 3EMQA 4NAEA 2DW7A 2VHLA 1LUCA 3OODA 4Q8OA 1SR0A 2BVTA 1LOQA 2IQ0A 1TVPA 2VC7A 2LRKA 4TVUA 4RDZA 5AQKB 1TX2A 4YTTA 4M51A 3AAEB 5EMUA 1X6NA 3CX6B 4R5EA 2IPWA 3GHRA 4Z2IA 2ZE0A 2NXGA 3GTNA 4DM1A 4ISSA 4IE5A 1CB2A 3KM8A 3M46A 2VZVA 2CERA 4ERAA 1GQEA 3NQFA 1TSIA 3TWAA 4C60A 3C8NA 4TX9A 1UIOA 3FJNA 4PUUA 3HV8A 1E6NA 1CTNA 4KCVA 3W15B 1UK5A 1RALA 2DVXA 3TW6A 3BLPX 2VELA 4NHVA 2XQ3A 1FWGC 3RYIE 1KR1A 1ISYA 5DXYA 3TTYA 3W01A 3N2KE 4QBXA 4H9YA 1XBZA 2A6LA 5XIMA 4H6KA 2FUPA 1QW8A 1K9EA 2YSWA 4W9TA 5FXZA 3AZRA 3STEA 3SRKA 4NNAA 1L0PA 1W1VA 1NM9A 5E0OA 4H6EA 3MJYA 2I59A 4JDYA 4D8AA 1F3XA 3FBZA 1UP0A 1VLIA 1P0NA 4N9DA 2JRKA 5CJNA 2AKMA 2ISFA 3LM3A 4X63A 3QYSA 4NY2A 3BOXA 4CD5A 1H09A 1K1DA 3CT7A 4I4TE 4B9YA 4J3WA 1SE7A 1QI5A 5C2CA 3SS1A 4I5RA 3TSMA 1MFVA 2Z1KA 2X51A 4Q25A 1DJYA 5CZ0A 4CU8A 1KNPA 6PTDA 1OABA 3WN6A 2HK1A 1UZDA 1VFSA 1L6WA 1RJQA 5EL1A 4GUFA 2OODA 3KLKA 2C8NA 2Q8ZA 4HU3A 5FL1A 1R8LA 4AYGA 3OTOT 2NVDA 1ZU8A 1DWIM 2TYSA 1FBAA 3N14A 1CCWB 3AMLA 1ONEA 3AICA 1GZ1A 2ZM8A 1Q65A 4IPNB 2J79A 2LSJA 2Y8VA 4RPPA 4FIQA 3OJAA 1XZYA 5EK2A 2EJ1A 1ZAHA 3TIMA 2X68A 4GOUA 1PYFA 3HG4A 3L5LA 3EHZA 4P7RA 1TV5A 3LHYA 3NDYA 5C5YA 1D3CA 4O13A 4OE7A 4JKKA 3NM3A 3PS7A 4UFHA 2LOPA 4B3TT 4PTMA 5LIWX 4EK7A 1EWDA 1DJWA 1GZJA 2J4GA 4LVFA 3W81A 1I94T 3M64A 4DMVA 3TDFA 5FVKA 5A8PA 1P0KA 3EMZA 1V0NA 1VFTA 3KINB 2IUZA 1XDOA 3WJXA 2ACRA 1Y64B 1FCBA 3WQGA 1TX0A 2QCEA 3MCOA 4Q4MA 3SFEA 4PTWA 3RN6A 1C7SA 1R3WA 2PBIA 2ABAA 3AYSA 1N55A 1UKSA 4DRSA 1QBBA 4FJOA 1OM0A 1XIMA 3N9PA 2JE8A 4A2RA 3HB9A 3KBTA 1AA1B 1WOBA 4I0UA 1JDDA 5HPOA 4KWOA 3P0XA 3A9BA 1ECEA 1IJ5A 1CGUA 5KMGP 1ZP4A 2NZLA 1FFQA 2G96A 2WWDA 3D0TA 5L3CB 3WNOA 1XV8A 3AWOA 3MUCA 3G6MA 1ICSA 4Z1AA 3S6DA 2YW4A 3LTYA 4QH5A 1E6PA 3A64A 1RJRA 4IXHA 3H37A 3EB2A 4HP5A 3P67A 4WVXA 3CPGA 1E4NA 1E15A 2FDMA 3SB0A 3VNJA 3W1LA 1JRBA 2WS3A 2VGGA 4O12A 2HWGA 1CDGA 2C0HA 2FPTA 3M0HA 1IIHA 3S5YA 3NTYA 1WKDA 3SCTA 5ETWA 1TA3B 3ITTA 4AZCA 2AAMA 2PPGA 3SCSA 3K8PC 3B03A 2ZIDA 4LF5T 3AOFA 2XVLA 1QNOA 5M4YA 2ISVA 3GDLA 4E2VA 3B0UX 4ZZBA 1H1NA 2ON3A 4MUPA 3KHJA 4RV3A 2UY4A 4PUJA 3PWGA 3OYZA 3T0DA 1T72A 1H1ZA 4KH2A 4Q4SA 2LHRA 3H4GA 1FXQA 3PTDA 1OGGA 5BOFA 3KTSA 3UR2A 1R30A 3VNKA 3GU2A 4CXXA 1XQKA 4EAHA 3EX3A 1PWLA 3UQNA 1JCTA 4PJMA 3R5EA 5AQSB 4AXKA 2E6FA 3F5JA 5AQUB 2DJXA 5HEUA 2BHZA 3BAWA 5CB4E 1YDOA 4M8UA 3CUIA 1NF7A 3ARUA 4B5TA 3FVDA 3U9IA 2XG9A 2XAQB 1VBRA 4XTIA 4HOWA 2J47A 3OU8A 3R12A 2EG8A 4A3QA 2E25A 2P10A 2PTDA 2IC9A 4GWEA 5HJLA 2RHGA 2JMKA 2X9HA 2GJPA 5LBMA 5JIPA 4B3ST 2OZTA 3DYOA 3N04A 5F4WA 1QO2A 2K48A 3IK4A 4UF0A 4PB4A 1R3VA 4KHPT 2WSKA 4MPKA 3WFAA 3BQKA 5I06A 3UU5A 2G37A 1IGWA 3URBA 4BFAA 1LRQA 3L67A 4FALA 5A8NA 2PDMA 3ICJA 1XCWA 2ZUMA 2LM2A 3BGJA 1EP2A 2EHOC 1ITQA 2WZEA 4LBRA 3AE9A 1V9DA 4JYAT 3C50A 2GZXA 4NZ1A 1RA5A 4EEBA 3DBNA 3P6LA 1HFAA 2QVNA 3G1DA 3BGAA 3U0HA 4MDPA 1XBXA 2RDUA 2YU1A 2HVNA 3WF0A 2VFGA 2XH4A 4K8HA 3LYEA 3EAUA 1DV7A 4CNNA 4MLKA 4JTJA 1XRTA 1HO4A 1XYMA 1LM1A 1E0VA 4MNJA 3P3BA 4KBXA 5A6BD 3DH7A 2BKOA 2YCKX 1J6OA 1OYBA 3E0WA 1OX6A 2JQQA 3MJXA 3W75A 4YWSA 2FJDA 4NVTA 2QVAA 4S1FA 3UCCA 1KV8A 1T98A 4R9OA 3D6NA 2VYOA 5EMKA 1VJZA 5D33A 3VMOA 1ZJIA 3EOOA 3JAFA 5CZSA 2O9OA 4YVXA 4DPPA 3DFHA 4ZOBA 4GI8A 5CGMA 1R3YA 4TVCA 1TWSA 3L21A 3LPPA 3P80A 2R1NA 1MDLA 2D0TA 3AXHA 2VEPA 3PJAJ 2EXOA 4DELA 2VT0A 3WLSA 2DFAA 2BB0A 2C5KT 2YDRA 3TXZA 2DY3A 1OEDB 1BYDA 4G7EB 4GIWA 2EPOA 3W7NA 2ODOA 3SFKA 1X98A 2IKIA 3INPA 4IQJA 3T6CA 3EOSA 2XJ7A 1V03A 3AROA 3BL3A 3L2MA 4LC8A 4IPPA 4LX4A 5HXHA 3KBJA 4OIFA 3TOPA 2XZEA 1F3TA 4MHBA 4HYVA 3OLEA 2NQ9A 4WZHA 3SRZA 1XQLA 1JPHA 2BY3A 3EUHA 2VZTA 4ZO9A 3ORWA 5I3DA 4MNMA 2V82A 3PUQA 4J3XA 2FPYA 4B16A 1ITUA 4K2SA 5BWFA 1IEQA 4P8WA 4LRSA 2VFIA 4JQAA 4O17A 3GG7A 3MHUA 2D22A 5E9XA 4PMYA 1EEXA 3JC6C 1XIHA 4HPNA 4DYKA 5LGNB 4AF0B 3BUVA 3SY1A 2ZVIA 4QITA 2ZUVA 2CLYC 3L66A 1PZ3A 2VQFT 5CLWA 3FEMA 2CLIA 3P4WA 4PMJA 1BR0A 2P9BA 3HJEA 1DEDA 4CI2B 1EKOA 2OGJA 3OVRA 4H7ZA 5I0DA 1XH2A 4H9MA 2DSKA 4MYAA 4J35A 4XKMA 2LSYA 3WBXA 2MOZA 4QTGA 3TYAA 3L65A 3RK8A 3TTSA 4C6OA 5F1VA 3RNDA 3SUUA 1C92A 1YTDA 3DHDA 4I6VA 2O9RA 2B7NA 4ZOCA 2EPMX 5E6YA 4S2BA 1KRMA 2JALA 1OBAA 1K4HA 3FLUA 3L39A 2VRQA 5HANA 3UZYA 1DKWA 2VCAA 5AC6A 3R8RA 4DV7T 1IYXA 1DTNA 1H7CA 1XR2A 4O10A 2ES0A 2HNHA 4NASA 1LORA 1AD4A 5EK3A 4GH3A 1B7TA 3EX6A 1Q6LA 3TJLA 5FF4A 3W00A 4IP7A 2ICSA 3ATYA 2IIUA 1W54A 2ZOXA 4DJEC 3ONBA 5HJXA 2OSWA 2SFPA 4I8DA 1O66A 3LK6A 3EOEA 5L3GB 3O06A 4AD1A 1Z32X 4BWLA 1KQZA 1OIMA 1V4YA 5IHYA 2W66A 3ZT6A 3IJ7A 5GQBA 4HCLA 4GLEA 1IGSA 3T78A 1TV2A 2Y0FA 5J1GA 3JW7A 3TYEA 1CPUA 1F3WA 1J2WA 1W91A 3KRSA 4MFDA 1TIMA 5LJMA 1S2VA 4MG4A 3M07A 4JPGA 3W27A 3MHGA 3SCWA 3L4XA 4LPCA 1UJPA 2HRWA 3LUTA 2R1LA 1H7XA 2ZRVA 1X96A 3G0UA 3AEFA 3CMGA 1RQEA 3T0CA 3BXWA 3A21A 2P50A 1NQKA 1SGJA 4EZHA 2C0SA 4J2PA 4MMWA 1XD0A 3E96A 2IS7A 5JH7E 4A98A 5BWAA 5C71A 4HYRA 2FZ9A 3W25A 4BF5A 4AX7A 1DJQA 1V7YA 5EBAA 3U3HA 2VDIA 1W0AA 2C6QA 1QPOA 2CLPA 5LMUT 1P6BA 2IKJA 3THUA 3VGEA 2VEMA 1OB0A 1IIGA 3KHDA 4S3FA 2GJNA 2Q9QB 2P8BA 4L64A 5DCBA 4UB9A 3O6DA 2NTYA 5HEJA 3CZLA 3EXTA 4AZ5A 2FVMA 3QR0A 3S5ZA 4X64T 3AIUA 4EV6A 4HIBA 3CK5A 2VEKA 4NPPA 4MB3A 4ATWA 1JNRA 4QWNB 1OWAA 3H7VA 2VZOA 3I4EA 1Z44A 4A6GA 3CB3A 3QYQA 2YLAA 4C7GA 3O7UA 2DVUA 2DZAA 3MUIA 1EX5A 1H7PA 1ICQA 1J79A 1W9BM 2PDXA 1XLHA 2P8CA 1HZYA 2PDNA 3KP0A 4KIRA 2QPUA 3DP7A 5AQTB 3HF3A 4DBDA 3OLGA 4HZ6A 3BANA 1WRDA 5CZKA 5A1LA 2ZMAA 1D1CA 1ISVA 2BY1A 3TTOA 1F76A 1FRBA 3F2EA 1VYPX 4MY8A 3DFTA 2WKJA 4AEOA 4Z1CA 1MNSA 3GSMA 3EWCA 1YDNA 1QWGA 1ZJAA 1GVSA 1EZWA 3ABQA 2VWTA 4KPLA 1IBLT 3SRHA 4HFHA 1HX8A 3OYXA 4FF7A 1TMQA 1Q6FA 4XZNX 1MNEA 3VOFA 1FEWA 1ICPA 3NURA 4ZI2C 2AMXA 3DFOA 5FJJA 1HJVA 3PG8A 3VO0A 4MKVA 2Z7KA 1QPRA 3DYMA 4BK9A 1E0WA 2J8GA 4IMDA 3E49A 1M04A 4NAFB 4JFSA 4ZQOA 1S38A 3PB2A 2YIHA 3CEUA 1UW9A 1JNEA 1DE5A 1I6NA 2WVVB 3M0YA 1ISZA 1UUQA 1US3A 1UQYA 3NGJA 3EWZA 2Y48B 4ORMA 3L4UA 1ML1A 3PJWA 1GK8A 4P7NA 3D46A 1IZNB 1J12A 3CPZA 2Z1SA 3LMYA 2X1IA 3IWPA 4HFDA 1CI1A 1MO0A 1W9DM 2RGMA 4IDOA 1KBLA 3AIRA 4HA1A 1CENA 2Q09A 1QAPA 1XCFA 2IMRA 3NZQA 1NFGA 4OTKA 4AZ6A 4GNKB 2BG9C 1GUVA 1JFXA 2WNZA 1FWAC 5CC5A 3EOUA 3PWIA 1FP9A 4IJCA 3ITLA 4FI4A 4QFUA 4WR3A 4D6FA 1VFHA 3HG5A 3FHAA 1REQA 1XLEA 4X1IE 4HMCA 3MACA 1EC9A 5AQOB 3KBNA 4NIQA 4WLCA 3A23A 1MNZA 2CLHA 1E3XA 1J0ZA 1U83A 3I3EA 1Q6CA 1EJTC 2WLZA 4LBUA 2ALRA 2R1MA 3DZ1A 4GNJA 2WMGA 5DRIA 3DG7A 4JIIX 4HMNA 4IJBA 5TIMA 1F07A 1BTCA 4LANA 3NO3A 1FH9A 1UWQA 4UOZA 2B7OA 3MMUA 2JQHA 1JCMP 1YPFA 1AH4A 3GU1A 5CZTA 2DVTA 2ACQA 3PUOA 4FSAA 1IR1A 1ONRA 3TAKA 1LRZA 4QX7B 2UUAT 2BZNA 3BTNA 1OCBA 3II1A 1OFRA 1XMOT 2XIMA 4HWCA 5KTLA 3W2JA 3WMBA 3BQIA 1MDRA 4HEAA 3K46A 2VL4A 1XLAA 5CC7A 5AQGB 4K1WA 1WPCA 4KEMA 2XN1A 3MCNA 4S39A 3RCNA 4NXMT 3GTHA 5HXEA 4HK5A 1NP0A 5E1QA 3MANA 4PB3A 4A2SA 2E5CA 5FP3A 1TJ2A 4QS6A 3VIOA 1IEXA 1LROA 3K4WA 3U4AA 2W3ZA 1NQ6A 1EGMA 1W8GA 5K2ZA 1Z89A 2XAJB 1IHIA 1TPB1 4H9RC 5HWJA 1I60A 4US6A 3FGCA 1EBHA 3AIWA 4WHBA 2UXXB 1FWWA 4BEUA 4QG6A 4RE0A 4YHHT 5LP6E 3ZEFB 2V3GA 3GHTA 5HMSA 1JYWA 4YYCA 2PRMA 3UERA 3KOWA 4L9IA 1LG2A 5FSEC 4L4LA 3HQPA 3UG5A 4B2DA 2DI4A 4BF9A 4DJFA 3V1PA 1EGVA 1FH8A 3CIWA 1W1YA 3UY7A 3NZRA 3SJNA 5JTGA 2YKSA 4QNEA 2ASHA 3RCYA 3UWVA 2DT2A 3LSCA 5LNWA 3QB5K 4F40A 4E38A 2P5NA 3B13A 5D9NA 3D5HA 1XI3A 4YSYA 4YLWA 1H50A 3DERA 2XN2A 4IX2A 3T81A 2V5BA 4PEKA 3XINA 4M6PA 1A50A 2G3IA 4L9YA 2WJFA 4MNKA 1JZ4A 4QX4A 4YTPA 1M1BA 2R6OA 4C6EA 2VKHA 1KR0A 3CYVA 4DBEA 3MZ2A 5GJMA 4OV9A 4W8BA 4QE1A 4Z2HA 2OLAA 3LHVA 4GC3A 5J8LA 3IJ9A 3VKGA 1NDWA 4FNQA 2VRKA 2YBUA 1MXSA 4TUYE 3NPWA 3R0DA 1SZGA 3P61A 3G8RA 3JR2A 3MUZ1 3HMJG 2P1FA 4HGAA 1ME7A 4O4VA 3TA9A 2YDSA 4HNTA 2GWNA 4Z17A 3W3OA 1CXLA 4O4LE 1ZTVA 4WKHA 4Y9PA 4A8IA 1VKFA 3IJQA 4HFEA 4ACYA 1R3SA 3W28A 4J28A 3OBEA 3EWXA 3F03K 4LVAA 4CD7A 3T05A 4B5WA 2WU5A 4NI8A 3LTPA 1HKJA 3NSNA 1A5OC 3E0VA 2J75A 4W8AA 4U10A 3TXVA 1E9YB 2FZBA 1HL9A 1SQ7A 1HVXA 3KE0A 1E70M 1OX4B 2G4FA 1IXQA 5HK4A 3KW3A 1BPLB 3P82A 3V5OA 2OO6A 4MSSA 3OVGA 3N11A 2ISDA 4MF4A 5CPTA 2PDKA 3IEBA 4H83A 3RG6A 3BLDA 2OX4A 3DC8A 1BGGA 4G7FA 2D23A 3M0LA 1ZB5A 2GJXB 5AC8A 3IJ6A 2KWHA 4RJEA 3ZVIA 4WNKA 4X9YA 1EJSC 1S3HA 1ZENA 2O55A 3EBVA 4XZMX 3SUSA 1VPXA 1S5MA 2P3EA 4C7DA 2WW5A 3C86A 3N2XA 3D3AA 5BXTA 4EAMA 4ATLA 1QDSA 2IDOB 4WBNE 2Q9QD 4GQBA 2WLYA 3H2MA 5GJPA 3LHTA 2W27A 3UU3A 3GU9A 3AE2A 4A3UA 4J3SA 4NX0A 4GIEA 7REQB 1CNVA 4E3VA 3D47A 3THQA 3WLRA 2BKNA 1UD5A 3NXFA 4W85A 2OVLA 2VR5A 4FNPA 3UU4A 3O63A 4CI1B 3SWHA 4R7WA 3WENA 1GVQA 5FJOA 4JX6A 4G6CA 4ZOLE 3BSGA 1PKYA 4GC4A 3CM4A 2XQ4A 3LGGA 3WLMA 2FLIA 2VI0A 3CNYA 3DFSA 1QWKA 1H63A 3FZFB 4DX3A 4E8DA 4OOUA 3CZEA 5CC6A 2HHHT 2YN6A 1E55A 1RVKA 1OFDA 4RPQA 4D6GA 3A4JA 5ENLA 3S1GA 2FVKA 1O94A 4OT7A 2X30A 3SDOA 3S2LA 1E3ZA 4O2AE 3PBMA 1PIGA 3FK4A 4EWJA 4F0KA 1ELSA 3PR2A 3CVRA 3WL0A 4M0XA 1MUWA 1CIUA 3I9YA 4H2HA 2XQAA 3RXZA 2WMIB 3VD5A 5CG7A 2BZBA 5IHRA 2BVDA 3OQEA 3F4VA 2XQ5A 3RM4A 1BWVA 1QU4A 4S38A 2MPKA 3OVPA 4XBSA 4AWEA 5C9WA 2DW6A 2EHOD 4N6FA 2WCGA 3JS3A 4IIGA 1K9TA 1JD7A 5BCAA 2XY8B 1GOKA 1J10A 4GY1A 4Z2LA 3H3AA 1G4SA 4WXYA 4FF5A 4FLQA 4PCTA 2CXFA 3G1VA 5XIAA 2D69A 1SFLA 4DUWA 5LCYA 1F4HA 3UF9A 3VC5A 1OZMA 1XLFA 2CC0A 3C0JA 4A3RA 4J3TA 4X0NA 4MM1A 1YXRA 4IGHA 3P5YA 2Y61A 2FHBA 2X7VA 3SCVA 1CT5A 5DQWA 3LPFA 1PHWA 1TV8A 3T4CA 2FGZA 2WO5A 4D9PA 4A21A 2WAGA 3KV5A 3BQ6A 1YQ4A 1XIDA 1BXCA 3N6JA 4Z08A 4DZHA 1WKFA 1NAFA 3B40A 4L5ZA 2UWFA 3MA8A 3TLVA 2OJPA 5AQRB 1QR7A 2A6NA 1EC8A 2YJQA 3QR3A 4H8UA 1L2QA 5K4ZA 5ABFA 3VKKA 1JUBA 1XDPA 2PTWA 4Q7BA 2YZ5A 1L6GA 1BGAA 1XPYA 4V28A 3GFXA 3HQNA 1HF6A 1KFYA 2IKHA 3PDYA 1DIDA 4TN7B 1GTEA 3WDRA 4CI3B 3C0SA 1AZ1A 3UCDA 1RA0A 4HPXA 2EPNA 1WKYA 1GT8A 4LFBT 5I3IA 1UZHA 1GKPA 3OLDA 2QT3A 4JI6T 4O11A 4ORIA 2VURA 2ESCA 2A3HA 2GQAA 3RRWA 1VBUA 1E4IA 2XGBA 2J7BA 2EO7A 3DYPA 4GY7A 2XTLA 5J0ZA 5IUXA 1E71M 4IGUA 2QCNA 2JEPA 2KX9A 1NDZA 1P43A 1YDVA 5FEWA 2WMOA 4QLJA 1YKHB 4XKYB 1W9VA 3TYBA 1ENUA 2NT0A 3M5ZA 4C6CA 2V6YB 4UVAB 2PDLA 4IL0A 1EZ3A 2CXGA 1I2OA 3E38A 3JC6D 1TIWA 1E72M 1SSGA 2PWGA 1N36T 3PJTA 3VIJA 1DYSA 3I3BA 3FVMA 4PL1A 1Y7VA 2ABBA 4DWSD 4JQ4A 5HWMA 1XLMA 3TLUA 4NUVA 1QNRA 3H55A 3ZPOA 1BWKA 3TC6A 3QXBA 3MU7A 2YGYA 3SBFA 4ZODA 4JYDA 3WDQA 3CYJA 4TO8A 4O4WA 3LA4A 1U1JA 1Y01A 1V93A 4P5UA 1JCLA 3DGRA 2YINA 3BJSA 1UX4A 3RH3A 1IV8A 3RDKA 3CH9A 3QGVA 1UR0A 4RE4A 4U74A 3HFYA 3FYYA 3N17A 3Q37A 3WD0A 4DF0A 1GVIA 3P8JA 2NOXA 1YBQB 3EPNA 1M65A 1JGIA 3UPWA 1HG5A 4IJRA 1DQXA 2POTA 1L8PA 4GCXA 3BZGA 4CZZB 1UR3M 3BLEA 2WP9A 4QS5A 3AZTA 4XBKA 1EFZA 4HHPA 4CGTA 4WBOA 5HXCA 3WF3A 2CRBA 4OBSA 2VC5A 3G1AA 1V6WA 1UA3A 1VOMA 1MFUA 4S3AA 1V6TA 5IFPA 4N78D 4DLFA 9CGTA 2E67A 4WKAA 3V35A 3V4BA 1XIFA 2HJPA 4TIMA 4CVUA 4YXDA 2W2UA 4NZ5A 4YVVA 1K9FA 3LK2B 2VDGA 4BR1A 2QCHA 2LT3A 3MKDA 1OYAA 1EEPA 3IF8B 1IEWA 1S1RA 4FS9A 3LU2A 1XW8A 3G1HA 4Z0JA 2V8ZA 4H63H 1LWHA 2WWUA 3I68A 5JDLA 2PDUA 1AQHA 2QYWA 2PLJA 4KQNA 4RXFA 1UROA 3ANUA 3CH0A 2E5VA 1YMYA 2W4XA 1N8WA 2P3ZA 3IIZA 5H6RB 4PRWA 2WM1A 5H8MA 2ACXA 2D9DA 1PWMA 4AIOA 3LFMA 3VM7A 7PTDA 2AOSA 3R58A 1SUMB 5C2XA 2FDSA 4FI5A 2XWDA 1R2SA 4PTVA 4H8HA 3TYDA 4PJLA 4ONVA 1V3KA 3CL6A 3W7DA 3NDOA 4HZ7A 1UWRA 2OT0A 2ZX7A 3CWHA 3WMLA 1WZMA 3RM8A 3EDEA 4XAYA 3LV5A 5BOEA 5FACA 2YA1A 4O1BA 4CN6A 4O1CA 2LKHA 2OKOA 4JI4T 4XIAA 2CLFA 4Z2GA 3PZUA 3PF3A 2D2HA 4DUOA 3MY9A 1Z69A 4UMBA 3N9OA 2Z28A 1TA3A 2NW7A 2WMFA 4C7FA 1GJPA 1QMLA 3ID7A 3OVUA 3AIEA 1XDMA 2BDQA 4GABA 3A8YC 2Q8XA 3B57A 1GKRA 1XG3A 4IFRA 1NOUA 1D1AA 3RGTA 3G1RA 1VFFA 3S1WA 1HR0T 3E0FA 3VNZA 4Q7NA 1ZS2A 2WNQA 4XB3A 4DBQA 3BURA 1HNWT 3RYCE 3K3NA 2ZZ4A 5HR7A 1VF8A 1DWJM 1M7OA 4Q33A 3FXGA 3VR9A 1XLIA 1C91A 3AMKA 4NP7A 4ZTYA 3B97A 4LJ3A 1BKSA 4XUGA 1JAEA 4ZI2D 3KX6A 3QOMA 4C6BA 3SGUA 1EPXA 4CNOA 3H2FA 3M47A 3R6IA 4OGZA 4KRZA 1E9LA 1UURA 4QDWA 2VFEA 4MZYA 3TK7A 1YKEB 3K1DA 3E9AA 5A8MA 5AQFB 5C8BB 1PAMA 2VJXA 3F2CA 3QHNA 3O0KA 3SAZA 3I10A 1ADDA 1PX8A 1KM5A 4JKMA 2IUBA 1FVPA 6XIAA 4EIWA 3Q58A 1KRCC 1D0ZA 4GCAA 1PYMA 3LZ3A 4H9VA 3LK42 2YA2A 2HISA 3QEZA 3CX8B 1W3IA 3JU2A 3KBUA 1RCOB 3Q2MA 2PAJA 2QAFA 4BI7A 1W3LA 2YXXA 4JQ1A 3NQCA 5HNNA 1Z6KA 3BW2A 4OU1A 3OBAA 1NSJA 3TJXA 2C1HA 2OX1A 4GVFA 4PNIA 3ARZA 3UEQA 3ZO9A 1QBAA 4IG2A 3KOXA 4IMAA 4HU4A 2IXUA 5LSMA 1UR4A 1RLCL 2DSWA 1GTHA 2QDGA 1XS2A 3MO4A 5DABA 2GUUA 5JVLA 4G8TA 3SN0A 3ZKRA 4JYFA 1RY8A 2FH8A 3M43A 1H1YA 1EXBA 4IHCA 4AD4A 3N4AA 3Q5WA 2KT9A 4JN6A 1VGAA 4I9AA 3TROA 2PDJA 4E7ZA 2JFEX 3LOTA 4ML4A 3GR4A 3WF1A 1KCXA 1PB0A 4NZ3A 3GN5B 3WQCA 2Y8DA 2XASB 1W2PA 1WR6A 5FD0A 3AXJB 4UTWA 4PMRA 4UZSA 2DZUA 1M01A 3UA3A 3DENA 4L0RA 4FNSA 1OQFA 3QY6A 1MEWA 1XDJA 4MWAC 4V1YA 2NR4A 5AZ1A 2Z00A 4NYYA 4I7WA 4DY1A 2CNCA 3QQ1A 1PHQA 1O60A 1MEHA 1GG1A 1UD4A 4Q3MA 5D37A 3GNPA 2VKOA 3PSWA 3TCEA 3T40A 4PN2A 4GX9A 1OEDA 1EJXC 4G7EA 4NG3A 5A5WA 1IZJA 5BMVE 2D2GA 3GH5A 3ZLIA 5D09A 3H23A 1I2PA 3HA1A 2DH3A 5K3VA 2VC9A 4KX6A 2JGQA 4H01A 3K4AA 1GQJA 3WG6A 4F8HA 1IR2A 2H9AA 1JXJA 4ZL1A 4TX5A 5BRPA 2CXDA 1S94A 1FP8A 1MMFA 4Q8QA 2HS6A 3WNNA 2NQHA 5AHNA 4Q6JA 3PUSA 2ZWYA 1FKWA 4QROA 1XP3A 3AS1A 4YU1A 3W2LA 4IMGA 3PUVF 4WZXA 2PI6A 4V33A 2OV9A 3KRBA 4NT0A 3P60A 1WCGA 4AIEA 1J01A 1U4QA 1U30A 1BYAA 4UR8A 1IJ6A 3LRMA 4JI1T 1R2RA 5F2GA 4NAEB 2RKXA 3QY7A 1VFMA 1ZCCA 4PBFA 4AF0A 4FOKA 1TZ7A 2NWSA 4MJZA 4O53A 3EPOA 5F8PA 3V1HA 2PGRA 1F8MA 1J5TA 1CWYA 1WDWA 2FTWA 1W3TA 4GA8A 4GYJA 2HZGA 4GBUA 3WL1A 3GC5A 3QMRA 3N19B 3AE1A 3QSRA 2PS2A 2J7GA 1M62A 3IS4A 1N7KA 3Q9DA 5DX7A 2H3DA 3MK7C 2VX6A 3CASA 5AY7A 5MKGA 4UTKA 4WXZA 4CQCA 1DHKA 1W5PA 3LDQB 3LN3A 4J2CA 3RC3A 3AMGA 2R6GF 3LCXA 2OR2A 4YSZA 3UUNA 5D9MA 4AWSA 2Y62A 3SN1A 3ARXA 3S5SA 4ALDA 1AW1A 3C5QA 2HPJA 2VEIA 3NWRA 3HGSA 3T4WA 1E4LA 2DQXA 4AX6A 3Q65A 3RRXA 2G3NA 4PMNA 1NH6A 4KRUA 5PTDA 2LLEA 4ZOEA 2WJDA 4EB6E 3TMLA 5CXPA 3LG7A 2ZCGA 3W7PA 3VDAA 3OHMB 4FEZA 1O1HA 5EBUA 5LYRA 3B3DA 2DU2A 2WAUA 2I56A 4AQYT 2OZ8A 3CUFA 4J2MA 3SGZA 1GPFA 3GTFA 3GIQA 3PU3A 4URIA 4FPSA 3WY1A 1MZRA 3UYCA 2AQVA 5FVLA 4LF6T 2PEVA 1NJJA 4JN7A 4M6UA 5LHHB 1TYGA 3E0IA 4M7SA 4IMEA 1XLBA 3WD1A 1RV8A 4XAFA 2RA1A 1ME8A 2Z6EA 1HGWA 1E1CA 3ZT5A 1G94A 4CEUC 4I9TA 3ZR6A 1UGOA 5AFUL 2PRLA 2Y88A 3TV8A 3NPUA 4K0KT 1SFSA 3W29A 1G7VA 1HX1B 1DIKA 3KL5A 3EB3A 3WK1A 1T5AA 4GYPA 5H91A 2W0UA 4ACZA 1EP1A 2I7GA 3LXCA 2CU0A 3GH4A 5CLTA 4YJ2E 3E12A 1OT2A 4BAYB 3MW7A 2V68A 3HGOA 2WMHA 3L3PA 3U78A 1LT7A 1HO1A 2OSYA 4IT1A 3C4ZA 5LXEA 4LF4T 3MTWA 4M6VA 1WXYA 3N2GE 3SRDA 4KT2A 3WQEA 3TQ0A 3NG3A 1VEPA 4ASTA 1THFD 5G2IA 3MVIA 4TMCA 4I3GA 1XWYA 5C9XA 5HUOA 1CLKA 2QW5A 3A5XA 4DJDD 4CQAA 4ICNA 1VIWA 3VFCA 5E09A 4I50E 1BXBA 5AVNA 5LIYX 4B92A 4BWLC 4IHJE 1RCQA 1V08A 3SCRA 4ZQPA 3ARYA 1IT0A 3KVKA 1A47A 1UOZA 1MW3A 1ZQ5A 3PUEA 3R25A 4DNHA 3U8GA 3ZXWA 2EAWA 2XUEA 2GYIA 2YDAA 4LF7T 9XIAA 1EWEA 1E40A 2BXVA 2JJ9A 3AE6A 5LBQB 1UMLA 4UTFA 1KKRA 1P7TA 2R14A 1ZZMA 3WLLA 3URQA 1WOAA 4NZ4A 4LAMA 3N2TA 4QKNA 2E8ZA 2PWDA 4GYSA 3PZIA 3DTOA 2QHAA 4Q8VA 4NJIA 4JN8A 4I55E 4J40A 1K8XA 3VOCA 4YTRA 4AD5A 1DVJA 1UWUA 3WD4A 2FGLA 3OG3A 3CHVA 2UU9T 2PWVA 2VWSA 3UFGA 3H8AA 3W02A 2PGFA 4PJJA 5JREA 2KWIB 5D02A 1V0KA 4QXIA 4XQ6A 4AMAA 4E8CA 1GCYA 3P84A 1F61A 4EEDA 3M7SA 4NAFA 3CIRA 3DG6A 1QHPA 4JEQA 4DZ5A 2AGKA 1Q6EA 4O19A 1Q6GA 2YXGA 3G22A 2O4MA 5DT7A 3VILA 1MMGA 1O12A 4KFOA 1KNRA 3BOFA 5F4XA 3T1YT 4O50A 2V7JA 1QNSA 4DR6T 5TF0A 4EPEC 1SR9A 2LEHA 3NQ2A 1FWTA 3EX2A 1RD5A 2A2IA 3BMXA 5FF2A 2OMAA 4ILBA 1RHCA 4GYKA 3IK2A 5KZ6A 2J7DA 4GI4A 2ATSA 3OJGA 4GGHA 3NSXA 4ZA0A 3T8QA 3GVRA 1HXJA 5HNRA 1HKKA 5F1UA 2XH0A 4BQ4A 3W7LA 4GK0E 3I9WA 3IGSA 3B04A 3K3OA 3RFAA 3H2EA 3KV9A 4Q8NA 1VFOA 2PC4A 2BS3A 3TA6A 3WLJA 2H3RA 5D2WA 3ARVA 1WNOA 1RSCA 3FDKA 5L47A 4JTLA 3LB0A 5I77A 2XHEB 2WM0A 2PDBA 2X42A 3GE7A 1HN1A 2I5QA 4HZMA 2EKGA 2YCLB 3BW3A 3M44A 3OZPA 3W1UA 1O5RA 3W7CA 2E9LA 3AE4A 3MUAA 1GORA 2PDFA 4B15A 1QTWA 1J4EA 5D2XA 5I79A 2OYMA 2D2OA 3KCLA 3KOFA 2FFCA 3T44A 4R34A 1KCLA 1R3QA 2XVPA 3LGEA 5G2WA 3PFMA 1EDQA 5CQ1A 3P4SA 3W22A 4E7SA 2PUZA 2Y8UA 3F5KA 1WDPA 1RLDA 1MUMA 5A6MA 1L0VA 1M6JA 2WPBA 1OC5A 4H6QA 4N2YA 3VX1A 1LLWA 1XLCA 1YW1A 3BCFA 4ICCX 5BROA 4RE3A 4M24A 2NQ5A 3PZQA 4H9NC 3N25A 1TE1A 2QQ6A 3F4DA 3HU7A 3NYDA 4W5UA 4ECLA 1U2YA 3IIOA 4UIOA 3VCRA 4BA0A 4CVWA 2DSUA 4GINA