2W62A

Saccharomyces cerevisiae gas2p in complex with laminaripentaose
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
461
structure length
436
Chain Sequence
SFEKTPAIKIVGNKFFDSESGEQFFIKGIAYQLQRSGAFETSYIDALADPKICLRDIPFLKMLGVNTLRVYAIDPTKSHDICMEALSAEGMYVLLDLSEPDISINRENPSWDVHIFERYKSVIDAMSSFPNLLGYFAGNEVTNDHTNTFASPFVKAAIRDAKEYISHSNHRKIPVGYSTNDDAMTRDNLARYFVCGDVKADFYGINMYEWCGYSTYGTSGYRERTKEFEGYPIPVFFSEFGCNLVRPRPFTEVSALYGNKMSSVWSGGLAYMYFEEENEYGVVKINDNDGVDILPDFKNLKKEFAKADPKGITEEEYLTESVECPHIAVGVWEANEKLPETPDRSKCACLDEILPCEIVPFGKYEEYFSYLCSKVDCSDILANGKTGEYGEFSDCSVEQKLSLQLSKLYCKIGANDRHCPLNDKNVYFNLESLQPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Mechanisms of Yeast Cell Wall Glucan Remodeling.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords GLYCOLIPID-ANCHORED SURFACE PROTEIN 2
total genus 162
structure length 436
sequence length 461
ec nomenclature ec 2.4.1.-:
pdb deposition date 2008-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03198 Glyco_hydro_72 Glucanosyltransferase
A PF07983 X8 X8 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1040 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2w62A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2w62A01
2Q8XA 3ARWA 1G01A 1E4MM 4GO8A 1GQKA 5GNYA 1DP0A 2UY4A 4AZIA 3OLDA 1BYBA 4CD8A 4UQBA 3PZUA 1W1PA 3QOMA 2X2YA 1UR0A 1HJXA 1QHOA 4JHOA 3PBGA 2X8RA 1UR8A 3PZNA 2Y8KA 4M82A 2YOCA 3N15A 1W3LA 1E0WA 2JF6A 3POHA 2XGBA 3VGDA 1CECA 4H41A 2CNCA 3WUEA 1VB9A 1V3MA 4MADA 2PWFA 3VINA 4U31A 1C91A 3BGAA 2QHAA 4AD4A 4HZ6A 3DYOA 1DHKA 1QOXA 2J4GA 1B90A 4F8XA 2F8QA 5LA0A 2ZE0A 3OLIA 1OD8A 4WJXA 4CD7A 2CESA 5M17A 3VD3A 2WMGA 4HOXA 1OM0A 2OYMA 1OGBA 3VVGA 1WZKA 3ZIZA 1NP2A 1PZ2A 4HP5A 2FGLA 2NW0A 1UD5A 4CD6A 3BSHA 5IDIA 3B8SA 5A95A 5E6YA 1JZ2A 3WDQA 1VBRA 4AMCA 2ZUTA 1EDQA 2Y4SA 1JXJA 4OOUA 4XZBA 1JYXA 1W9PA 3AS3A 2UY5A 2XFFA 3WFLA 1UUQA 3VDBA 2W5FA 3QR3A 4QFUA 3KL0A 2WMIB 5A6BA 3U5YA 3MKKA 1UWIA 1HKKA 3J7HA 2J7CA 4JFWA 4AZBA 1Q4NX 1GNXA 4BQ2A 1FHDA 4QDMA 5I2UA 1V02E 4TTUA 3WD0A 4UFMA 1D2KA 1E6XM 3GBEA 1WDRA 3RIKA 4AW7A 1S46A 2BVTA 2ZICA 2GJXB 1TA3B 3CZGA 3GXDA 1ZBCA 1H5VA 2EBNA 4W5ZA 1J11A 4P8XA 1SR0A 2WBGA 2BS9A 3AXIA 3VPLA 1UWUA 2F61A 1BFNA 3OBAA 4HA1A 1YHTA 1ZS2A 4HTYA 4DWSA 3BXWA 4P7NA 2XHYA 3ZSSA 1NM9A 3HJEA 3VIHA 4C7GA 4D6HA 3WNNA 4HPGA 2ZX9A 4D6DA 5D9OA 1PX8A 1FP9A 2PB1A 3CGTA 2CITA 3AMCA 1CLVA 2EQDA 2OSXA 3VX1A 2VZSA 3ZM8A 5A6BD 2VI0A 1JZ6A 1JF5A 1M03A 4JKKA 4KGLA 1C8QA 2JALA 3IK2A 1MWOA 2WCGA 1BVZA 4F66A 4FF5A 1JI2A 3ZQ9A 4CU8A 6CGTA 1KXHA 3AISA 4XB3A 2GVYA 1LWJA 4IISA 3SEPA 4P7QA 3B9AA 4JKLA 5A8MA 2ZWYA 1GHSA 4D6FA 2D2OA 1PX3A 3S6TA 1BG9A 3WDJA 2WM0A 3II1A 3NDYA 4PSPA 2WWDA 2YL8A 4ZENA 1O6IA 3S2CA 1W2VA 4BQ5A 2VZUA 1HP5A 4NF7A 4GI8A 4X0VA 1I1WA 1XD1A 5EB8A 1HJVA 4W7UA 1QNSA 1DTUA 2BXZA 2DPEA 4KWUA 2PI6A 1B0IA 2FHBA 2WMHA 1M01A 4AZHA 1GVIA 1TVPA 3WF0A 5A94A 3ZJKA 3WH8A 5CLTA 3AFBA 1UH3A 2WVVB 5DFAA 2VURA 4D6EA 3FHQA 4AIOA 3NJ3A 1F4HA 4LYRA 2UWFA 5D9NA 3T2OA 3VGBA 1XCXA 3BAYA 5A8PA 3WF3A 1V6XA 3QOKA 1VEOA 3FAXA 1VFMA 3AXXA 1UHVA 3DHPA 4P8WA 4CCDA 3K46A 4B3KA 4W88A 1IZKA 5A6KA 1V6UA 1HJUA 3IJ9A 3AICA 3W81A 4BS0A 2DT1A 1ODZA 1LL7A 2PWEA 2VCCA 3SUTA 2CCRA 3GNRA 1UWTA 2E8YA 1LG2A 3T0BA 4W86A 2BY0A 3L4XA 2XM1A 3SCRA 1L0PA 3WL0A 1W1YA 7TAAA 4AC1X 2G8ZA 3HU7A 1KB3A 3UEQA 5CG0A 1E55A 1B3VA 2HISA 4X9YA 1UKTA 3VMNA 4V27A 1AMYA 2VX5A 2CKSA 3VTRA 5HDRA 1JNEA 4DUVA 1J0ZA 3K8LA 3KZSA 4CVUA 3AHYA 2W61A 4AZ6A 4N42A 4M8UA 3WMCA 1CGWA 3CH9A 1E43A 5A2AA 2GSJA 4H8UA 1KGWA 4H04A 3FY1A 4AZ7A 3SUSA 3W27A 3NUKA 4KH2A 3W25A 3AMGA 2VR4A 4GQRA 1K9EA 4HZ7A 4A4AA 3GXIA 3OG2A 3VD5A 1VF8A 1HJWA 3WQ4A 3WQ8A 3VILA 2YA1A 2A3BA 3MUY1 1JG9A 5HNNA 2YJQA 1GORA 3VD9A 1K6AA 5CQ1A 4W87A 1VJZA 1QI0A 2VRJA 3B9EA 1UWSA 4OBSA 1VEPA 1G5AA 2XFRA 3ARVA 1BYAA 4E8CA 1XYZA 3FAWA 2V3FA 2VZVA 2D1ZA 2WB5A 2WHKA 2EJ1A 1MFUA 1CGYA 4AIEA 1UD3A 4AZGA 1WKYA 2O9TA 4PMOA 3CHEA 1PIFA 1FA2A 1GZJA 4UOZA 2FGZA 4CUCA 3BAWA 3W29A 2DH2A 4GZIA 1UKOA 1E6PA 1LL6A 3MS8A 3TTSA 3T2PA 3NSXA 3W6LA 3WF2A 4P8VA 1E72M 3SIMA 5A8QA 2CBJA 2WC4A 3PZ9A 3ZT6A 5JIPA 3F5LA 1FP8A 1ODUA 1WAWA 2ZXBA 4U3AA 1H3GA 1XYFA 3HMCA 1XH2A 1VRXA 1GOOA 3APGA 4PYSA 1HVXA 1LQ0A 2EEXA 1H11A 1RP9A 4GXPA 2J25A 4WLCA 2PWDA 1H09A 2J7EA 4KMQA 3T0DA 3VDHA 2ZWZA 3AS2A 1MQRA 1E9LA 1Q6CA 2NT1A 3TTOA 3AIEA 4PTMA 2O9PA 5BRQA 1K9FA 2FH6A 3EDDA 4TTGA 4K68A 3CUGA 4D1JA 5LYRA 3VIMA 4M29A 1UWQA 3WQ6A 4MB4A 1BGGA 1B2YA 1V6VA 2JFEX 4PTWA 1UA3A 1W9BM 5A6JA 3BCFA 3MMWA 3ARZA 2XVPA 1LL4A 3CHCA 1E71M 5FIPA 4PBGA 3LMYA 5HXMA 1KCLA 3W6MA 4A3YA 5A69A 3GZAA 1V03A 2XVKA 4FK9A 2C8NA 3BCDA 4PEEA 4PMZA 1BVNP 2V3GA 1V02A 1UOKA 3ARRA 1V6WA 3N04A 1W32A 3PZQA 5I24A 5A3HA 2VQTA 2VCBA 1CBGA 1JGIA 5GNZA 2Y2WA 1TZ7A 3M07A 1GQLA 2XUCA 4FLSA 8A3HA 2VUYA 1NWSA 4PMXA 3WH9A 4UQAA 3WDPP 2JIWA 1ECEA 1E4NA 3I3BA 2Z1KA 2ZX7A 3OZOA 3FXYA 2WZIA 1E1FA 2Y5EA 5I6SA 3AROA 4UR9A 1M53A 4F9DA 3UERA 5D9MA 1NQ6A 4UFJA 3MMUA 2NSXA 2DIJA 4WKFA 1Z32X 1HKIA 3LPOA 1HNYA 3L4TA 2CHOA 1WE5A 2QPSA 1R7OA 3OLGA 4RL3A 4E2OA 3W28A 1QNQA 2WK2A 1VEMA 1OSEA 3N1AA 2WW5A 3MV11 4ACYA 4GI6A 4MDOA 4PCTA 2VX6A 4XUYA 1JNDA 3B9DA 2JEQA 3FW6A 5C70A 5FD0A 1V08A 5BXTA 2VTFA 2DDXA 2J8GA 1W9UA 2OYLA 5A8NA 3AS1A 3THCA 3BSGA 1CENA 3U7VA 2GDUA 3UG4A 4NSBA 3OGSA 2RGLA 4AYSA 1QHZA 5CSUA 4CGTA 5ABEA 2OSYA 1JFHA 3GXFA 2EO7A 3CZKA 3N18A 2WKLA 1JD9A 2CYGA 3WSUA 3A4XA 4ZE5A 1XH1A 2J47A 3VD7A 2D23A 1NH6A 3JUGA 1OCQA 3GH4A 3T0AA 4MNJA 4S3JA 1V0KA 5KEZA 3PN8A 2XVGA 1PEZA 3GH7A 5LA2A 3SCQA 1E3ZA 3U7BA 1H4PA 3ZJ8A 3AMKA 2WBKA 3CIVA 3RO8A 2J7FA 3EMCA 2RGMA 1FOBA 4CD4A 1ITXA 1I75A 1E6RA 2E9BA 5JBEA 1DWFM 1QBBA 1V3JA 4MB5A 4IUGA 4LYQA 2XFYA 2D0GA 1CZ1A 3CO4A 2D3NA 3WD2A 1CGUA 2PF0A 2D3LA 2VOTA 4DM2A 4MB3A 2QMJA 1DWIM 1JXKA 5EBAA 3T2QA 2VZOA 3VX0A 3I3EA 4LXFA 4HA4A 2A3EA 2BHZA 2V3DA 1WZLA 3OGVA 1J0HA 2X0HA 5FOOA 5FKYA 1EOMA 4D6JA 2VVNA 3TP4A 3AMLA 1Q6EA 4ML4A 5ABFA 1UD4A 5A6AA 4JIEA 3U57A 1XC6A 3ZR6A 5C71A 3RMEA 3KL5A 1VJSA 3WEOA 2VL4A 3G6LA 2WSPA 1WO2A 2OSWA 1XSKA 4B3LA 4MTVA 1C93A 4PTVA 3SCOA 3AQUA 3VGFA 1BQCA 4JFTA 2ZXQA 5AYIA 4L4PA 1J9YA 2ZX8A 4GKLA 4CCCA 3SCNA 3CUIA 3N11A 3D5HA 4H8HA 3A3HA 4F79A 1GHRA 1RP8A 1ISZA 3PZTA 1MXGA 1OT1A 1J0IA 4W8BA 1B1YA 4W85A 1JDCA 1E40A 1UD2A 1XH0A 1UR1A 2VQUA 3GYCA 3SCSA 4PMNA 4HOWA 1KGXA 4E4PA 1ITCA 1DWJM 3OGRA 1UKQA 4U5IA 4Y7EA 4CU7A 3SCPA 4UTFA 4UQ9A 1R86A 3F4VA 4HZ8A 5HPCA 1KQZA 4R27A 1J18A 3T08A 1JDAA 3POCA 1MQPA 2XVNA 4C7DA 1JF6A 2GFTA 2G3MA 1G0CA 3ALFA 1IZJA 1TCMA 1E70M 4QLJA 2DIEA 2AOSA 3OB8A 3MMDA 3BMVA 2MANA 3CMJA 5GQBA 2J8FA 3BAJA 3WUGA 1CXKA 4GQQA 1OGSA 4GPNA 3NDZA 1X1NA 4OIFA 1PPIA 1WNOA 1KR1A 2GK1B 5CPQA 3WH6A 4Z2JA 5AC4A 1MW1A 2PC8A 3ZO9A 1XGZA 3WNLA 2PBOA 5TD4A 2J7BA 2XJ7A 3MUIA 4UFLA 1ZJAA 4U5KA 1JYVA 2JIEA 4GZEA 2CBVA 4UQEA 3O6AA 4MNMA 3WBAA 4D1IA 1G94A 4BF7A 2BV9A 3SURA 4B9YA 1JAKA 5HOSA 1NARA 1QW9A 1TFVA 4LPCA 1MYRA 4ACZB 3ZT7A 3G6MA 2X05A 4Q22A 2GJRA 4AD1A 5JBFA 1MVYA 4WF7A 1V3KA 2EPOA 3CHFA 4RE4A 2D0FA 2CBIA 2W66A 4ZE4A 2YBTA 1KQYA 5A6SA 1WPCA 2ZUWA 1K9DA 1E6NA 2YL9A 5DMYA 3A47A 1UR4A 1V3LA 1GJWA 1KBKA 3M6DA 3UCQA 3RM8A 1GOQA 2EPLX 1E73M 2ZX5A 1E4LA 4D71A 1EGZA 4PCSA 1V6YA 3K1DA 1UQZA 3GDBA 1BTCA 3PTMA 3VIJA 1OIFA 2D22A 5CZKA 4BQ3A 4D72A 1Q6FA 5CGMA 3L4VA 1CGTA 2W91A 5AY7A 4AIUA 1VFUA 2CEQA 2XSBA 2O9RA 3FHAA 3CLWA 4CKQA 1SYTA 1EH9A 4M56A 3UESA 4X0NA 4CN6A 3ARYA 4H2CA 1JI1A 3HN3A 3VM5A 1VFOA 2PWHA 1W9XA 1UD8A 2DSZA 2DSUA 1ISWA 1RH9A 4JFVA 4Z2GA 4UOQA 4HPHA 2TAAA 2WVVA 1TR1A 3ZJ7A 2OWWA 2O92A 1VBUA 4M81A 4F9JA 4AD3A 3WD4A 4JFSA 3VU2A 5DF0A 4W8AA 1XHGA 1KXQA 1H41A 1IT0A 2EPKX 2CIPA 1E4IA 2VRKA 2XIIA 1C92A 1UH2A 2J78A 2J7DA 3OA5A 2XIBA 3ECQA 1BLIA 4IM4A 1EDTA 3L4WA 5I5RA 4W84A 4GO9A 3VNYA 4MNKA 4UFIA 4OOZA 2XTKA 4ZFMA 1G1YA 2B31A 3ARUA 4GZJA 2YBUA 4ZXLA 4LX4A 1AVAA 2CERA 1H0GA 4M1RA 3WEZA 3GTNA 1CPUA 2A3CA 1FFQA 4BZYA 2WLYA 2XWDA 3TA9A 3GH5A 3AZRA 5AYBA 5ABGA 1MW0A 4W89A 2WSKA 4AZ5A 3VIKA 1Y7VA 3DECA 4M24A 4UQCA 6TAAA 4MB1A 2XPKA 2FDMA 1TMQA 1WZAA 2E8ZA 1C8XA 4LGXA 3PZIA 1GQJA 2VJXA 1HIZA 1PJ9A 4NZCA 1ISXA 4JAWA 3SUVA 4AD2A 1BSIA 1CXLA 1XRVA 3DC0A 3OZPA 4H8VA 4DWSB 3SCWA 2DH3A 3WMSA 3O9NA 3VNZA 3BAKA 2W4XA 3GNPA 1EHNA 1KWGA 5A2CA 2WHLA 1UA7A 1E15A 2W63A 1H0IA 4RE2A 3WDIA 3PHAA 2GDVA 4MAVA 1OWQA 2ZIDA 5HBFA 3PTKA 1GOWA 1U2YA 5IFPA 4FMVA 4UZSA 3LPGA 2Z1SA 2C7FA 2JF7A 1DWGM 1UKPA 1M7XA 1WDSA 2DT3A 2VZTA 2D24A 5M5DA 2BHYA 2HVMA 3WD1A 2XGIA 2G4FA 4PUEA 2XSAA 2WC7A 1CDGA 1NWUA 3ARSA 3VIPA 3SUWA 4YN5A 2PWGA 4XV0A 2PBGA 2VC9A 3VUPA 1BG4A 2F2HA 4P7OA 4P7LA 1BAGA 1GW1A 4HMDA 1W1TA 2Y24A 2DT2A 5D8ZA 5ECUA 2OWXA 3AZTA 5BYWA 2DSWA 4ATLA 5BXPA 3DYMA 2QF8A 2VMFA 1E0XA 2BXYA 1KXVA 3OIHA 1UZ1A 1BPLB 1QVBA 2YIHA 4H7VA 2J79A 1EDGA 1H1NA 1TG7A 1E0VA 3RM9A 1UG6A 3F5JA 2QPUA 5E09A 4YPJA 1B3WA 5IHSA 1BGAA 4J3SA 4EKJA 1MW3A 1ISVA 2J75A 3MUAA 1LG1A 2WCAA 1HJSA 3VGGA 3L4YA 1NWTA 2FHFA 5E70A 3RILA 1A3HA 5JIWA 3VGHA 3WKZA 4Z2HA 1L8NA 1DEDA 2WC3A 5IFTA 3K8KA 4PMQA 4WSKA 2IXVA 4TOQA 3EDFA 2WHJA 1UR2A 3VDAA 3PZVA 4AZCA 3AZSA 3AHTA 2UY3A 2JE8A 2X09A 2CHNA 3RJXA 4MDPA 1WDQA 3FNDA 1KCKA 1UQYA 3A4AA 1ZJBA 4DM1A 5DT5A 1GPFA 3AYSA 1E3XA 5A2BA 3WNPA 3UETA 3VM7A 4IPNB 1V3HA 1B9ZA 5JBDA 1HJQA 1CXFA 1MFVA 3N13A 3NYDA 4IPLA 5I3DA 1Q6DA 3W53A 1ZU8A 3QGVA 4CVWA 3I3DA 3AIVA 5I77A 4AZCB 5FCZA 4AEFA 4CD5A 4J27A 3AS0A 2QV4A 4NI3A 2BVDA 1D3CA 3MU7A 5BXSA 2WLZA 3PZGA 3WQ5A 1UH4A 3AIBA 3WF4A 2V38A 5ABFB 1B3XA 1KWKA 1K9TA 1W3HA 4PSRA 1SFSA 3TOPA 4AY1A 1B31A 3CZ8A 3N9KA 4J7RA 4QCEA 1DWHM 3WFZA 1R8LA 4GI9A 4Z2LA 4HA3A 1NOWA 5E0FA 1J0KA 1BYDA 1EQCA 2AMGA 4UFKA 1QPKA 2DQXA 1EHAA 2BFGA 2CKRA 2XVLA 1UWRA 2G3JA 5CPTA 1CTNA 5E0CA 1TE1A 2WMKA 1WZMA 2J62A 1AQ0A 1X6NA 2VVSA 1GQIA 3K4AA 3SUUA 1JAEA 1EIBA 4WSJA 5AC5A 3WELA 3W38A 3CTTA 1VAHA 1C7SA 2YDQA 2VX7A 2ZUUA 4CN1A 8CGTA 1XD0A 4ACZA 2VCAA 2CETA 1CWYA 4OBRA 2X0YA 3CMGA 2D20A 5M03A 1MXDA 4W7VA 4PMDA 5D4YA 4EAMA 3WH5A 3M46A 3AIRA 3DHUA 5EMYA 3WQVA 2WHMA 1TUXA 3PZMA 1HL8A 2ZUSA 1OT2A 4QLLA 1QI2A 3T09A 4DUWA 1W3KA 4FLQA 2AAAA 4AISA 4KRTA 1U33A 2YDRA 1QNRA 3WD3A 1JD7A 4OUEA 1HT6A 1SMDA 1I1XA 1JZ5A 2WWCA 3BAXA 3BC9A 4LYPA 5KZ6A 3CBWA 4UFHA 1XCWA 3ARXA 1QNPA 5A6MA 2ZUNA 4OKDA 1ISYA 2E4TA 4UNIA 5F7UA 4PN2A 1FH7A 3CUJA 3ARQA 5I23A 4J3WA 1IV8A 1F4AA 3QHNA 4QCFA 1JZ8A 3VIFA 1WB0A 2DT0A 5JUVA 1C8YA 1HN1A 1CXHA 1OINA 2XG9A 3WN6A 4CU6A 2UY2A 1QNOA 2VR5A 1PIGA 2ZXAA 4JKMA 4S3KA 3KWXA 1OIMA 2VRQA 3AIWA 4L4OA 1HXJA 4UZUA 4KRUA 4TVCA 1H2JA 4EANA 1BYCA 2V5CA 4QAWA 3CZEA 1LLOA 3AJ7A 3ZMRA 2WVUA 1OD0A 4WK9A 4E8DA 5IXEA 3SCVA 3WL1A 4Z2KA 4P8UA 1FFRA 3WY1A 1GCYA 3NSMA 3THDA 3CZJA 3UG3A 4ATWA 3AHVA 2WXDM 1KXTA 2BY3A 2XM2A 4AXNA 2G3IA 1ZBKA 3A6OA 3WQWA 1V3IA 3CZLA 3PZOA 3LPPA 1R87A 2WANA 6A3HA 2ZOXA 7A3HA 1RPKA 3OLEA 4PRWA 4JCLA 1J10A 2CBUA 3WUBA 4MJ4A 3WNOA 3EMZA 4GINA 4WKHA 2D0HA 3RDKA 2WMJA 1E5JA 5FL0A 1C7TA 3AHZA 2J74A 1XSJA 1E5NA 1P6WA 1CYGA 4BCEA 3IJ7A 3EYPA 2YL5A 1CXIA 4WKAA 2IUZA 4AD5A 2W67A 1FHLA 3CHDA 4PUDA 3ARPA 2BY1A 1QI5A 2W92A 2XWEA 4U2YA 3RPMA 2E40A 3EBVA 4MPKA 4EK7A 4OZOA 3EDJA 1CGVA 4HU0A 3AMDA 1X6LA 4PMYA 3QHOA 4YHGA 2BNJA 4AEEA 2FHCA 3MO4A 1UZ4A 3ZR5A 4TX6A 3W0KA 1V0NA 4Z2IA 1GVYA 3L4UA 2ZUMA 3DYPA 5E9AA 4URIA 3D3AA 4QP0A 3RCNA 1OBAA 1W9VA 4XX6A 1JDDA 4PMVA 1EXPA 1E6SM 3K8MA 5HPOA 2YL6A 2E9MA 1O7AA 1W91A 2V3EA 5I79A 3WUFA 1PAMA 3WDHA 1JZ3A 5IHRA 3MSDA 1KGUA 5BROA 3GXMA 5BXRA 4DWSD 1HVQA 1GONA 4BA0A 1WCGA 4BQ4A 1QI4A 3BH4A 1V0MA 1E1EA 1CXEA 3AYRA 1AQMA 3ALGA 3FN9A 4XZWA 5CPSA 1EO7A 2VO5A 4MNLA 1J0JA 2BHUA 3AHXA 4JL2A 1JYWA 1CNVA 1GOMA 4MJ2A 1EQPA 1ZBVA 4C7FA 3VMOA 3VGEA 2ESCA 5D9PA 4HU8A 1WP6A 3KL3A 4FLRA 4D6CA 1OB0A 5A8OA 3TTYA 4PMUA 1E56A 4V28A 4J28A 1QBAA 1LJYA 2GJXA 5LA1A 4UOJA 2ZUVA 3AOFA 2EPNA 1UD6A 1NWRA 1NOFA 3RM4A 7CGTA 1DWAM 1D7FA 4NRSA 1Q6GA 2CPUA 3ZOAA 4J3TA 2CXGA 3IANA 3MV01 3K4DA 3VKKA 3E1F1 2YA2A 3WF1A 5D8WA 4UCFA 2X1IA 1LF1A 1HF6A 1GOIA 5ABHA 3EDKA 1CLXA 3WBEA 1W2PA 3SCTA 4HMEA 4TVUA 1XSIA 3WMBA 3L2MA 2QMKA 3WIJA 5DT7A 1YQ2A 2WNWA 1W9DM 4KGJA 4NRRA 1JYNA 1KFWA 2GK1A 4ZXOA 1CIUA 5A1AA 3IAPA 3M7SA 3W24A 2YA0A 3MANA 3W82A 5E6ZA 1B3ZA 4AD0A 5DO8A 2G3NA 3N17A 4LQ1A 4D6GA 2NT0A 3WH7A 1CGXA 2WKGA 4P7RA 5CSYA 5CJ5A 4JCMA 3N12A 2QLYA 4QLKA 1C3FA 1OGGA 1W1VA 2OYKA 2E0PA 4J3UA 5GNXA 1FH9A 1EOKA 3VO0A 3CUFA 1G9HA 5CGTA 4HOZA 1US3A 3RJYA 2DSVA 2J7GA 2DGAA 1E6QM 2J77A 3VIIA 3VD4A 1QHPA 1HX0A 1R85A 3W37A 4YHEA 1VIWA 2V5DA 3NCOA 1QW8A 4U2ZA 4V2XA 1HKJA 1EO5A 1ZBWA 1U30A 2YKKA 4TXEA 4Q7NA 4DUXA 1B3YA 1JZ4A 4W7WA 1XV8A 1V0LA 1J12A 3WNMA 5GPRA 1MQQA 9CGTA 3ZJ6A 5CXPA 2WMIA 3ARTA 1VFFA 2WPGA 2WCSA 1KR0A 5I78A 1SMAA 1C90A 5M3WA 1BHGA 3WEMA 3TTQA 4EE9A 1UKSA 4DWSC 1PBGA 2GJPA 3W4RA 2VX4A 3O2LA 4ZEPA 3F5KA 4N0RA 3VMPA 4PMRA 4WIWA 2JEPA 4M80A 4CCEA 4TX8A 5BWFA 3UG5A 4B15A 3A4WA 1J0YA 4TUFA 1KBBA 3GBDA 3ZT5A 2XYLA 2C0HA 1A47A 3VIGA 4PTXA 3LPFA 2VNCA 3KE0A 1PX4A 5CLWA 4MAZA 1GJUA 1TA3A 3VOCA 1US2A 1HL9A 1JIBA 2OWCA 4AWEA 2YDSA 1UYQA 4TVDA 2GUYA 3AIQA 4W8LA 2WZHA 1FH8A 3U5UA 1W3JA 4W93A 1LWHA 3CPUA 2WMFA 1GOKA 1ESWA 1NP0A 2FH8A 3BAIA 2IXUA 5C8BB 1ZB5A 2WVTA 4R5EA 3EMQA 1E6ZA 1H49A 1CEOA 4D6IA 2BY2A 1B30A 5I0DA 4UQDA 3ZSTA 4B16A 3VDCA 4JL1A 2WZEA 4U3CA 4ATDA 3AIUA 3IAQA 3MUZ1 5FL1A 3L2LA 3BLPX 3W26A 4A3HA 3WENA 1EA9C 3NIYA 4OJYA 1JFXA 1JL8A 4RE3A 5EFDA 5EFFA 2A3HA 3UR8A 3MSGA 1BF2A 1QI3A 2YLLA 4J3XA 4FLOA 1VENA 4J3VA 3KEHA 1HP4A 1M04A 2DEPA 3WDRA 1N82A 5DEZA 2G41A 4CN4A 2ZXDA 3AXHA 1AQHA 3L4ZA 4U33A 4B9ZA 1WDPA 2WVSA 2W62A 3GNOA 1GUVA 2OLHA 3TONA 5A6LA 2E3ZA 2E9LA 3EDEA 2WAGA 2EPMX 3IJ8A 2WYSA 3QHMA 1UR9A 1TVNA 4JHZA 3CUHA 1ZL1A 2YLAA 3NSNA 3WNKA 4W5UA 2BVYA 4JZ5A 5BCAA 3SCUA 3AI0A 2O9OA 4JFUA 3GM8A 3PTQA 3VIOA 4GIAA 3UR7A 2A3AA 1NOUA 1R7AA 2DSKA 2VT0A 1HKMA 2Y8VA 1RD6A 2EXOA 4HMCA 1JZ7A 2ZX6A 1J01A 2J7HA 3BLKA 1MW2A 5BRPA 3BMWA 1PZ3A
chains in the Genus database with same CATH superfamily
4LY8A 2D2GA 4GO8A 1VBGA 4YHJA 3W1RA 3HG2A 4AZIA 5DBTA 3SS1A 2PBIA 1TX2A 3EWZA 1OABA 3QOMA 3O16A 4C1KA 4DLMA 2PLJA 1AQFA 3EX6A 1R6WA 1LVFA 1QHOA 3E22E 4JHOA 1R3SA 2X8RA 1XGDA 1UR8A 1OZQA 3I4KA 1TPC1 2AQOA 4I55E 1W3LA 1G4SA 1XICA 3N9SA 1AH0A 3WUEA 2I5IA 3EA1A 5BZAA 4FNTA 3B0XA 4MBQA 2RAGA 3VINA 4KETA 4X61A 1C91A 3BGAA 4AD4A 3DYOA 3CAWA 2CFFA 5LJNA 1WAUA 1QOXA 2X16A 3G1VA 4H9TA 4DO6A 2J4GA 5HNRA 5EPDA 2XTLA 1JPMA 4N2YA 2ALDA 4AHPA 1R2SA 3SY5A 4MLKA 1UB3A 3HJZA 3ZIZA 1A3XA 4A8LA 1S2AA 1SQ7A 3PTRB 2PC4A 4LFCT 3GO2A 3BSHA 1GVQA 4CI2B 5IDIA 5B7YA 1DQWA 1JZ2A 3WDQA 4K8EA 5BMXA 2A9UA 4F0MA 5C7HA 2Z26A 3WZ0E 4GX8A 1JVNA 1OX6A 2H9AB 3B5MA 1EF3A 3N6JA 2I16A 1OY0A 1W9PA 3AS3A 4HTBA 5DQVA 2XFFA 3WFLA 1UUQA 2UXBT 3KL0A 1TPUA 5A6BA 1THFD 4Y9AA 5LNVA 1HKKA 3J7HA 1FHDA 3IGHX 1XL9A 4GVIA 3L5LA 2H9AA 2E9XC 4HKPA 3ZLGA 2GGEA 1O5XA 2JKAA 2PDUA 1YPXA 1HNZT 1D2KA 1E6XM 3IJDA 3GBEA 4AW7A 4K38A 1S46A 5F4XA 2TRSA 2MAWA 5HXCA 2NQ9A 3FSUA 3STEA 4BA9A 2F61A 4V1YA 2YCIX 4AEOA 1OEDB 4Q4KA 3ZSSA 1NM9A 5C2TA 3OODA 3S2JA 4F8HA 3WNNA 3TWAA 4D6DA 1Y64B 5D9OA 1H7RA 1AH4A 1FP9A 2PB1A 2ZZ5A 2VZSA 4DBDA 1V6TA 1FDZA 3AEFA 5H2ZA 2X1TA 2QDEA 1JF5A 1LDCA 3NRYA 1LBFA 3IK2A 2WCGA 1BVZA 3UU8A 1J5SA 3E0VA 4RDVA 3AISA 4TMBA 2HXUA 1HR0T 2OZ3A 1LWJA 4C6MA 2NUYA 3BARA 1OEDE 4CCZA 2ZWYA 2D2OA 1VRBA 4EF9A 2DZTA 3W02A 4HWFA 3WDJA 2QDHA 2CC0A 2Y61A 3RUBL 4DHGA 1WYBA 2WWDA 3P6LA 5TAOA 1PZ1A 4OK0A 2QGHA 1HP5A 2PTWA 3TLUA 4X0VA 3RQUA 1J79A 5EB8A 3AA7B 2BXZA 1YDNA 4LCQA 4KWUA 1GK8A 1B0IA 1RQHA 2LOPA 1GVIA 2HXTA 1QSDA 3TSMA 1PTGA 1O1HA 3BW4A 2WVVB 1VR6A 4LW7A 4N4QA 2ODOA 3FHQA 2PDKA 4U7YA 2MBGA 2C6QA 3NGFA 3T2OA 3P5YA 1MI3A 3SAZA 3TOYA 4ERAA 1GGOA 4U4MA 5A8PA 3PPCA 4EOUA 3KVKA 4RPQA 4GUIA 2R1PA 1VEOA 1ZP0A 3MKCA 3C61A 2YU1A 4JTQA 4W88A 1IZKA 5A6KA 2E25A 3IJ9A 3IJLA 3R84B 1ZHCA 1BQGA 4O8SA 3ZJ2A 2DT1A 3M9YA 3CIXA 1LOQA 1T8QA 2IKJA 2XGZA 2V6YB 3B0PA 5FF3A 4ZOEA 2PWEA 1QPNA 3JZUA 4ORMA 2CCRA 3V0SA 3LMZA 2E8YA 1KRCC 4DR5T 1TX0A 2YB4A 3L4XA 2I5QA 3SCRA 1ZCOA 2ZYFA 1YTEA 4KFPA 4QS5A 1REQA 2VL8A 3K8PC 4NHVA 4YSYA 4JN8A 4X9YA 1RCOB 4O1CA 1UKTA 2LOSA 4YWIA 1ITUA 2V69A 1AMYA 2VX5A 2CKSA 4H7CA 1JNEA 4DUVA 5AYZA 3K8LA 4IIEA 4CVUA 3AHYA 2QIIA 3DIPA 1TYGA 5DRCA 2VGBA 3WMCA 2KT9A 1CGWA 3CH9A 5A2AA 2ODVA 1IBKT 2UXCT 1L2QA 3W27A 2ANUA 3NUKA 4KH2A 3W86A 3AMGA 3UW6A 1GEQA 3PULA 3GXIA 1HJWA 1US0A 3UYIA 3VILA 4G2DA 3HR0A 4EACA 1GORA 3PV0F 1K6AA 3EGJA 4W87A 5CQ1A 5G1TA 2VRJA 1TV2A 4XO7A 3GFZA 1A5SA 4OBSA 1VEPA 2OGYA 4TX9A 5HEGA 2B7OA 3SGUA 3FKKA 2ZZ7A 3AA6B 3ARVA 3UWVA 2D1ZA 1EJTC 3UYCA 5FAGA 4F2UA 2EJ1A 1MFUA 1UD3A 1SM9A 1WA3A 3WO8A 3DN5A 4BK9A 1IR1A 1PIFA 2ISVA 4NY2A 3EXSA 2H8XA 3CB8A 1L6SA 4I9JA 2X9YA 4GZIA 3VUSA 3RX4A 4O4HE 4L9ZA 2JQHA 2QF7A 2FYMA 3BCJA 3NSXA 5JR9C 3GY1A 1FWAC 4QG6A 2NOXA 3ZT6A 5JIPA 1FP8A 2C18A 1FWRA 4M6QA 3W83A 2OU4A 1HFAA 5T9CE 2FFIA 3C8FA 5LYJE 1R3TA 3CQKA 1HVXA 1H11A 2J25A 4WLCA 4L7ZA 2OA5A 3OP2A 2J7EA 2Z7KA 3SY8A 3VDHA 3CLMA 2ZWZA 5IHYA 1UJPA 4QXCB 4I8YA 4ONVA 5LNWA 2O9PA 4Q8QA 1NTHA 2OZ0A 3QFWA 4LS0A 4K68A 3UUMA 2PDXA 2HBVA 5EMJA 3VIMA 1BTMA 4M29A 5REQB 1UWQA 3WQ6A 1GJPA 1YTDA 1BGGA 4MB4A 1B2YA 4ZGYA 4PTWA 4WJEA 4US5D 1PO9A 1XCFA 4OVXA 5A6JA 3NWIA 3MMWA 2FLIA 3VNKA 3W2MA 1GWJA 4PGLA 1KCLA 1TIWA 3A23A 1ECQA 3PWIA 1DL3A 1KKRA 3RGLA 1AFSA 3FIGA 3LRMA 1V03A 4ZB0A 3W15B 3W1QA 2PS2A 4FK9A 2DZWA 3KLLA 2C8NA 4PEEA 2OODA 4PMZA 4IIFA 2VDIA 2HBXA 5A3HA 1W5OA 1Z44A 3CO8A 4Y9MA 2RA1A 2QDGA 2X30A 2C1IA 4FI4A 3ZVIA 1XLBA 1CBGA 2PTXA 2Y2WA 1N33T 2X40A 1GQLA 2XUCA 4LF8T 3UFGA 3LXAA 3WJWA 3W7JA 4DJFA 3WDPP 2JIWA 4QNEA 4F40A 4FX6M 3GU2A 3VKHA 2CLKA 3FXYA 3IGXA 4Y96A 3LBXA 3RIAA 1YD8G 3ZLIA 1M53A 3VKCA 1NQ6A 4UFJA 2O55A 2DIJA 5TF0A 3ZEFB 1VQTA 3IWPA 1HNYA 3CASA 3QFEA 4US6A 1WE5A 2QPSA 3OLGA 4RL3A 1J1JA 4A2SA 4JXCA 3CNYA 1MMGA 3WLKX 3L39A 4J35A 4IDNA 3MV11 4N02A 4ACYA 4ZQRA 9XIAA 2X9WA 4J1OA 1A0CA 2IQTA 5AZ0A 2PF8A 4HFEA 1AZ1A 1V08A 2VTFA 5JRCA 2DDXA 4K0KT 3ZKRA 5CZJA 5DXXA 2OVLA 4GIRA 3O9XA 1QO5A 3BSGA 1XX1A 4AHOA 3U7VA 4RZ4A 3UG4A 4AF0A 5HEOA 5AQQB 2V82A 4Q4MA 2E6DA 1NELA 4KX6A 1NH6A 3UXDA 1K7EA 2NVCA 3C0LA 3GH4A 3RR4A 3T0AA 5T9BG 4MNJA 3UVAA 3PN8A 3S1GA 5CSRA 4NI8A 4XAZA 1O5KA 3CIVA 3UUBA 1X9BA 1ZZMA 3RO8A 5HXRA 2RGMA 2H6RA 5CBIA 1ITXA 1E6RA 3I6TA 5JBEA 4WBOA 3R12A 2Y5SA 2BKNA 3V5UA 2V68A 3W00A 4REQB 1CZ1A 1OXZA 3RO6A 4Q33A 1CGUA 3OVQA 4B5SA 4P0BA 2VOMA 3WI3A 2KAUC 1JCTA 3M0MA 2GZXA 1JXKA 2VEMA 3H7VA 4ZQPA 4H2HA 5D32A 3T2QA 4X22A 2HTMA 4Q8WA 2V7IA 4MY9A 4HA4A 2VEFA 2FJKA 4H63H 3W7IA 5FOOA 4OV9A 5FKYA 4D6JA 4ISSA 3AMLA 1Q6EA 1BR0A 3SGZA 2C16A 2QR6A 3PUOA 3U0HA 4US5A 2VL4A 5J2UE 4PTDA 2WJZA 3SN0A 1U5HA 4IQEA 2Z28A 2A0NA 4MTVA 1C93A 1KFKA 1VFTA 3SCOA 3GB6A 3L68A 3UPBA 4Q4QA 1N32T 3VGFA 3SI9A 4JFTA 1T8XA 1TQJA 4NAFB 3OKQA 2E5BA 4LFYA 2FJDA 3SOLA 4C6PA 4EP8C 3PZTA 3TA6A 1OT1A 5AQIB 4IPPA 2ACUA 3VC5A 4JTTA 3MK7C 4HD5A 4PMNA 1EZ2A 2R1NA 2V5BA 2WSYA 4E4PA 3RX6A 1UKQA 4U5IA 1BXNA 3SCPA 3VZZA 4UQ9A 3RMJA 1Z48A 2FVMA 2XFWA 4O14A 2O0TA 5HPCA 2C71A 3DH7A 5T91A 5HXHA 4LS2A 3DG7A 5AQKB 1MQPA 2CZDA 5DMLA 2Y89A 2H88A 3ALFA 3NGJA 1ICPA 1TJ1A 4G7FA 5E5CA 4JR5A 5LZLA 1F2JA 3TCSA 3OB8A 2NWBA 4WUIA 2ZZ2A 3EWUA 4DVOA 3T4CA 1KO0A 4GISA 2XUEA 4WQ6A 3ZXWA 3KOXA 4GQQA 3N3MA 4K8GA 4NZ1A 1PPIA 4ZI2C 5B80A 1S1RA 2GK1B 3PE0A 1VC4A 1MW1A 5LNRA 4WZXA 4UFLA 1ZJAA 1HS7A 2JIEA 2MOZA 3S2NA 4PJMA 3IA3A 3ABRA 2QUNA 3OHIA 1G94A 1IWBA 4BF7A 2BV9A 5TIMA 3DKJA 4B9YA 1S35A 1Z6KA 5HOSA 1NARA 1QW9A 3O1JA 1MYRA 4EWJA 2CXLA 2OOGA 4CEUC 2X05A 2WKJA 1X97A 1PUDA 4C1NB 4JNYA 2HQAA 2Y7GA 3S42A 4FOUA 4WF7A 1V3KA 3LBMA 4RE4A 4QE4A 4IX2A 4M0XA 2ZRYA 3XISA 4ASTA 1YX1A 2YBTA 2YL9A 1NWMX 2DL1A 1A5CA 1UR4A 1VCFA 1M3UA 3KV4A 1GJWA 4IWWA 5RUBA 3VNDA 4GJJA 3C4ZA 1ADOA 2BBFA 2ATSA 1XNRT 4PCSA 1SUXA 4H9PC 1V6YA 3AB3B 3RC8A 3PTMA 2P5NA 1LQAA 4EAHA 2D22A 4BI7A 5HMSA 3L4VA 1EUAA 1IBLT 4ZFCA 2ZDSA 3OYXA 3W22A 3FHAA 3AE9A 4CKQA 1SYTA 3W23A 4UTKA 4S23A 1E1HB 1CT5A 4X0NA 2A72A 1XIGA 1VJIA 4Q8PA 4Z17A 3NPVA 2IC9A 4S1FA 3PUVF 1NIUA 3VCRA 5D2XA 3EI0A 5JR9A 1WUEA 1US7B 5G1YA 1ZP3A 1RH9A 2Y62A 4JFVA 3UVIA 3EABA 3JAFA 1XIHA 2Z1XA 3DCPA 1VHNA 2EHOC 3NRXA 4O0QA 3RPUA 2OWWA 3F4CA 5JU6A 4M81A 4QXBB 3DEQA 3KLKA 4AD3A 3WD4A 3B0YA 4JI4T 1HF8A 2BB0A 1L0VA 2YXXA 5DF0A 3TQPA 2FZDA 3W7NA 4OECA 3GMIA 4MF4A 4AKRB 2XIIA 1WQ5A 2CXDA 3WCZA 4NXSA 3TJ4A 1NEKA 4NAEA 5HWYA 3FX4A 4LVDA 3ECQA 1E0TA 1MO0A 3TN5A 3L4WA 3VNYA 4UFIA 5L4EA 3QZEA 4OOZA 2XTKA 4ZFMA 2FB2A 1Q8AA 4K6AA 5TQLA 3E2RA 3ARUA 6REQA 4BEQA 4JEUB 1AVAA 2CERA 1HCIA 1VYRA 1H0GA 2YDAA 2GJLA 1CPUA 3LD5A 4ERGA 3TA9A 3PUAA 4DUZT 2IMRA 4ILCA 3PWAA 3GUWA 1D3HA 2QJGA 4LMJA 4U7IA 2FDMA 4YTQA 2Y7EA 1D0ZA 2X9XA 3NQGA 1C8XA 4HPNA 1WCRA 3B0UX 1X1ZA 1DXIA 1ISXA 1FDJA 2I9UA 3SUVA 3DC0A 4IQDA 3OZPA 3T8QA 1GVFA 1OX4B 4JIPA 3THQA 5JRCB 3VFLA 4Q4OA 2NWSA 1Y0EA 2PU1A 3H7UA 1E15A 2W63A 1X96A 1RJRA 4HQVA 3K30A 4MAVA 2FJBA 1OWQA 3H3AA 1GOWA 1U2YA 3IHRA 5IFPA 4FMVA 5JQ9A 2PDNA 3PBMA 4IFKA 3FB2A 4ZI3D 2R94A 2GQ9A 1M7XA 3RCYA 2DT3A 3AYTA 4E38A 1O12A 2VC7A 2A85A 4IIDA 1DV7A 1E9IA 1I45A 2NVDA 4IDZA 2XHEB 5LGTB 5D30A 3NAVA 3SUWA 3M5ZA 1RK5A 3M65A 3VUPA 1VGAA 5A1LA 2YGYA 3G1DA 4P7OA 4ZS2A 4P7LA 2QJNA 4HMDA 3TLSA 2Y24A 2DT2A 2R6GF 4UVAB 3G1HA 5BYWA 4ATLA 3SQSA 2G37A 1TO3A 2V5JA 4RPPA 3PBUA 2YK0A 4PCPA 4OHFA 1UZ1A 5H1WA 5DRIA 3T7VA 3KP0A 4H7VA 2J79A 1EDGA 1FRBA 4C6DA 3E2QA 1OFPA 1QPRA 3LYEA 3EEGA 3A9IA 1UG6A 4XSMA 2GWNA 1B3WA 4GOUA 4Q8NA 2DWGA 4BEUA 4EKJA 2EF9A 1A49A 4LAKA 3EWCA 3SB0A 3EKGA 4TUYE 3UY8A 2WWVA 1X1OA 3L4YA 3EWXA 2W9MA 5E70A 1XISA 5JIWA 3VGHA 1JNRA 1AJZA 1L8NA 4NXNT 5IFTA 1K03A 1UWAA 3T05A 2N1GA 1P43A 2VGIA 3PZVA 4GYJA 3Q5WA 3A5VA 3AHTA 4QWNB 2I57A 2P76A 4KHPT 4IMGA 2ACSA 1PYFA 1JGMA 1WDQA 3FNDA 4GACA 1KCKA 3DFSA 1L6YA 5DCDA 1MDLA 3QM3A 2BGSA 1E3XA 1B4KA 2C5KT 3C2YA 3WNPA 1ZSXA 3VM7A 3EDVA 1B9ZA 4OTKA 3H4XA 1HJQA 1CXFA 1I4NA 1HO4A 3U2OA 3NYDA 4DF0A 5CAHA 3CTLA 3AIVA 1I2QA 3GK0A 2QDDA 4K39A 1GG1A 4QX7B 3SN1A 3S5OA 1RR2A 4AG0A 3EWDA 5H6QB 1E7PA 1JPDX 3K5XA 3W7GA 2REQA 1TRIA 4KWVA 4HE8A 2BVDA 4ZO6A 2HCVA 3MU7A 3A7MA 3ITVA 3GR4A 5KTLA 1VH7A 2WLZA 3PZGA 1ME8A 1P48A 3AIBA 3T0TA 2V38A 3GFXA 3EAMA 3W7EA 4NZFA 4OYJA 2XN2A 4CXWA 3GLCA 3ATZA 4GI9A 4Z2LA 3WLSA 3TQVA 1IXNA 1NOWA 3S4TA 2QKFA 5EMUA 4GVGA 1P0DA 1Q6OA 4LV9A 1CTNA 2AMXA 4XZCA 1QT1A 2VENA 2J6VA 2WMKA 4HN4A 3MZ2A 2B0MA 3FZMB 1WKFA 3TYZA 1AQ0A 1X6NA 3MA9A 4F3HA 4LAZA 1P5BA 1UX5A 2G96A 3ZC1A 3CV7A 2A3DA 3HF3A 2QGSA 5JDLA 3K4AA 1UW9A 3RHWA 4WSJA 3UJRA 3CMFA 3WELA 3WFAA 3KS6A 1RV8A 5AYXA 2FBWA 3W38A 3QV6A 4C1NA 3NEVA 1J5WA 3R6IA 1FBAA 5AC8A 1XD0A 1LYXA 3W1XA 4PUMA 3V4BA 2CHRA 5KZMA 3STPA 2D20A 4GKKT 2UUAT 4NPPA 3UY7A 3AIRA 3LENA 1NDWA 1TJ2A 5H8PA 2R14A 3C86A 1TUXA 2XH0A 3RG6A 3MHUA 4M1PA 5AECA 3N29A 4JTSA 3W88A 2ZUSA 1OT2A 4QLLA 1QI2A 3T09A 1EC9A 1W3KA 4Q8MA 1AODA 3PFMA 1IBMT 4ZQCA 1XLMA 2YDRA 3B97A 1HT6A 4I90A 3WK1A 1SMDA 1I1XA 3KINB 1E1CB 4FX7A 1XLKA 1Q5MA 5ENLA 1S2CA 4KI0F 3V5SA 3UZXA 5KZ6A 3CBWA 1M65A 1QNPA 1KLZA 3WJYA 1POKA 1YBQB 5A6MA 1BVWA 3WQOA 3QK6A 4DV4T 7TIMA 4LB4A 3RIUC 3QQ1A 4UR8A 3AA1B 3UFYA 1X79A 1A0DA 5I23A 3DHDA 4C5YA 2PZ0A 4YXGA 2D69A 5D04C 4DO5A 2Y48B 4IGNA 3GR8A 5AQOB 3UQ7A 4IE6A 1QNOA 3BUVA 2OQHA 1XS2A 4S3KA 2R82A 4CNUA 3KWXA 3ZJ1A 3AE4A 3R0DA 1HXJA 1RCQA 1KM2A 5K9XA 3G1FA 1H2JA 4HWHA 4EIVA 2V5CA 1LLOA 1UUOA 3AJ7A 1OD0A 2CLEA 2FPYA 3SCVA 4Z2KA 3HI2A 3U8GA 3RPTA 4JTEA 1FFRA 2EAWA 3ID7A 2LM2A 3NSMA 1A5LC 1IXPA 4NXMT 1KXTA 2WDRA 4DJDA 2XM2A 4AXNA 1ZBKA 2YW4A 3A6OA 3WQWA 4UTIA 4HK6A 4A3UA 1CW2A 3LPPA 4HN9A 3ITLA 1R87A 2A6NA 4GHRA 3ZWSA 1NEYA 3GZ3A 4BWLA 3NQVA 2LEHA 2Y6XA 2JQ9A 4N78D 4Z8XA 2VM8A 4JCLA 3NBXX 4GUFA 2CBUA 3EPOA 2AE9A 5FSEC 1EP2A 2D0HA 2FKPA 4KW2A 5LHFA 3CS2A 1AL8A 3RPDA 3AHZA 1W09A 4DWDA 4BI6A 2OOFA 4RXGA 5G4EA 4ERIA 3RLUA 3PVFA 3URBA 4IMAA 3MW7A 4AIBA 4F4RA 4FALA 2NX1A 4WKAA 3UQ4A 1SSGA 3QPYA 3U78A 4EZ4A 3HQOA 5AQNB 3QPEA 5LKYA 4PUDA 5J04A 3Q2MA 2WMNA 2VD8A 3BLOA 4IE5A 3AMDA 3NQ8A 2KSRA 4AC7C 2OZ8A 4AEEA 4TX6A 1V0NA 1WXJA 4K1GA 1FY6A 3R43A 3DYPA 1IEQA 3CQXC 4G56A 3VKJA 1MEWA 3H22A 2EG7A 2P9BA 4I7WA 5CC5A 3I7RA 2PODA 5HPOA 3LBXB 2YL6A 3DFOA 3L9CA 1Q3NA 3ZMZB 2P50A 3GAYA 5LG3A 3DBNA 4DEFA 1ZENA 1PAMA 1XYCA 3C0QA 3JRKA 1HVQA 4BA0A 1CXEA 3ALGA 5CAKA 2BHUA 3AHXA 1XXXA 2E6YA 1CNVA 1GOMA 3SM0A 4EB6E 1EQPA 5D38A 3KV9A 2DZUA 3VGEA 2ESCA 5D9PA 1WP6A 1OJXA 1U1JA 1W5PA 4UXDA 1IEVA 3TTYA 5D2WA 2LSJA 1D0XA 5F3JA 1Q8JA 4YTMA 3DU0A 3ITGA 4NUVA 4Z90A 3A12A 5FXZA 2ZUVA 3REQB 5HNUA 2BLEA 3H24A 4GGHA 4NRSA 2CPUA 1DJQA 4TQTA 5CC3A 3IANA 4QX4A 5LBMA 2QV5A 3BQ6A 4IFRA 1M5WA 4DLFA 2PG8A 1LBLA 1ZRQA 2FZ8A 2X1IA 4UCFA 5F8PA 4GY1A 2HPLA 1GOIA 3QJAA 4H9NC 4HMEA 2FUPA 2MNRA 4U72A 3MCOA 1XSIA 4QROA 2ISDA 1LBMA 3KOZA 3HFTA 4IIBA 1YQ2A 2WNWA 1QJWA 5K7JA 1F6KA 1F8MA 3KTSA 4UMBA 4LMLA 3M7SA 3W24A 4NYUA 5GONE 3SR7A 4MG4A 1R3VA 1W37A 5DO8A 1W56A 1GYNA 1I2OA 2G3NA 4D6GA 4ZI3C 3WH7A 2IW0A 4LBSA 5CSYA 3LQLA 4B5WA 3QRHA 1GTHA 3RK8A 4HNNA 4GBDA 4PL1A 1OGGA 5AQGB 3EPMA 2QAFA 2HPIA 2I9EA 4RE0A 3ME3A 3O63A 3CUFA 1G9HA 5CGTA 1DXEA 1US3A 4MY1A 1IF2A 2J7GA 4UMAA 3VD4A 1F3WA 1HX0A 5HWMA 3BMXA 1H1YA 3P74A 4PFHA 2NLYA 4GD0A 4AI6A 2V5DA 3Q5XA 1EC8A 1ZAHA 1HKJA 4PK6A 3SJNA 1ZBWA 3H2FA 4N9EA 4TXEA 4DR1T 2NW7A 1B3YA 3A13A 3WBYA 1JZ4A 2P88A 1XV8A 5BU9A 3WNMA 3P61A 2VD9A 2GVLA 2FJAA 3V35A 2W6RA 2WMIA 3RCMA 4NL1A 2WCSA 1KR0A 4M1BA 5I78A 3P4SA 1SMAA 3A22A 1Y65A 3OVPA 5M3WA 3KXQA 2BG9B 3VKDA 3FJNA 1AD4A 4ZR8A 4FX8A 4Z0JA 3K3NA 3TTQA 4EGWA 1UKSA 1W0AA 2BZNA 4DWSC 3DHFA 3KBTA 1PBGA 4LU0A 2X0SA 1AW5A 3PP7A 4YJ3E 4R88A 1K77A 2F84A 4N0RA 2GVJA 1PVNA 5FJTA 4IG2A 3VK5A 4WIWA 4YLHA 2VKJA 2Z00A 3E0ZA 3LQGA 3A4WA 2G0UA 3Q5EA 1J0YA 5FXVA 5JTGA 2CW6A 2E5VA 1KBBA 4W4QA 2F9RA 3ZT5A 2ISSA 1A47A 4YLWA 1FJGT 2IQ0A 3P7IA 4DV1T 3H2EA 2L8KA 5CLWA 1PX4A 1Z89A 1TA3A 3W75A 3TUUA 1JNZA 1YDOA 3VOCA 5DY3A 1HL9A 1JIBA 2OWCA 1DJWA 4L4MA 3TW9A 2REQB 3D46A 1TV8A 3WBXA 1IJ6A 1ZAIA 4RR4A 3UT5E 2WMFA 4E5TA 4R7OA 3T1YT 5JREA 2IXUA 1QR7A 3EMQA 3XIMA 3FDGA 4D6IA 3R11A 4IOTA 2DV0A 1UBPC 3P7YA 4B3ZA 3O1IA 4XBJA 1FIOA 2WDVA 4YHHT 1EGMA 4B16A 4JL1A 4U3CA 4JTLA 1WFDA 4ICMA 4ATDA 2VR2A 3W26A 5HJYA 3WENA 3NIYA 3KTXA 4ICNA 5DX7A 3AXJA 3ONCA 3QEZA 3LHWA 4ZSTA 2A3HA 4O2BE 2DZAA 1QLBA 2M6IA 4L6OA 4INFA 3N4FA 5AC7A 4H9VA 2EG8A 1VENA 3WJXA 2XAQB 1WBJA 3QY8A 1IGSA 3R8RA 1HP4A 2A4AA 2XQ9A 2GUUA 2V7KA 5DEZA 4JNMA 3KHJA 3AXHA 1AQHA 3L66A 1WDPA 3E49A 2W62A 1GUVA 2OLHA 4IXXA 3KVBA 3VC6A 3UWEA 4DBSA 2WYSA 5L3GB 1TVNA 2YLAA 1FXQA 3NSNA 4ROPA 2O9OA 1KFLA 4IQJA 4QBXA 4F0KA 4YFSA 4JFUA 3B04A 3HKCE 4HFDA 3TV8A 4AY7A 4WRHA 3A3XA 2VT0A 2X0LB 3SRDA 4WW0A 4JLEA 1RD6A 3AO0A 2ZZ3A 4FNRA 2BSLA 1J01A 5AHFA 3BMWA 1G4EA 2Q8XA 2Z2BA 1G01A 1QCWA 3FLUA 4IPIA 1GQKA 5GNYA 1ALDA 4BKNA 4CD8A 2HE8A 4GQ0A 1W1PA 2J1DG 3M0YA 3LM7A 1OFEA 2N9DA 2DP3A 2J13A 2X2YA 4N4PA 2M6BA 2BZBA 4MGGA 1VFHA 1UR0A 3T8LA 4NZ5A 3GFYA 2LE8A 5HYAA 2Y8KA 2YOCA 3LCWA 3N19B 1T99A 2QGYA 1H7WA 3RLHA 1T41A 1UR3M 2H7VC 2OKTA 3OO2A 2LLEA 3WQFA 5JH1A 3GKFA 4HCDA 4MADA 2VHLA 2DCFA 2PWFA 4PNIA 3CXOA 3BPWA 2QHAA 1DHKA 2YR1A 3LHTA 2UU9T 3NA8A 1GQEA 1B90A 5LNKA 5JH2A 4F8XA 2E6FA 2QCGA 5LA0A 3OLIA 3RRCA 1OD8A 3KRZA 4WJXA 4CD7A 4XAXB 2CESA 3UNTA 5M17A 3VD3A 2XSXA 4DXKA 3OPSA 3AE5A 4JI7T 1OM0A 5M4YA 3F4NA 1OGBA 3GIQA 4JTAA 1F6PA 1ZNNA 2EPHA 1PZ2A 3L5AA 4HP5A 2RDUA 1UD5A 1KRBC 3W6YA 3M0IA 4GABA 5D03A 5E6YA 4RKAA 4AMCA 1MZHA 1GKQA 3WLQA 4C60A 3U3IA 4MZ8A 4H83A 3RNDA 4OOUA 2Q02A 5A5WA 4Y9PA 4FPSA 4K2SA 2W2UA 3UJFA 1OC5A 2NVAA 2IHR1 2W5FA 3H37A 3M4HA 5BR8T 3QV8A 1Q65A 1XKYA 2E68A 2J7CA 3BE7A 4AZBA 3M0LA 3N2XA 3B05A 2NP9A 2FQIA 4HZMA 3N9LA 4QDMA 5D09A 5I2UA 3U4AA 1V02E 4TTUA 3PSVA 4UFMA 3RIKA 3W2NA 3MKVA 4ZODA 3EWWA 1J11A 1GVSA 1SR0A 3AXIA 1UWUA 1BFNA 1RBOB 1NFBA 3FA3A 1EXBA 2GQ3A 4IFOA 3ZMSB 2IPFA 3BXWA 2XHYA 5FAJA 4Q25A 2HZGA 4CEXC 1FVPA 3Q45A 4S2BA 4HNTA 4WJ8A 4ML9A 4JTIA 4DR3T 1U1UA 3O15A 3CEUA 4XG1A 1CLVA 2EQDA 2OSXA 2E28A 2VFEA 3FGCB 4EXBA 3DX5A 1EJ7L 4KGLA 3BQKA 3NVTA 1C8QA 3W2LA 1OWAA 1Q7MA 2ZADA 4FF5A 3SW6A 4PB5A 4B3TT 3BLEA 3SEPA 4P7QA 2UXXB 4PC8A 4JKLA 5A8MA 1GHSA 1XDPA 2JKEA 4L1GA 1PX3A 3NR0A 1JUEA 1LCOA 4ZO9A 4S3GA 4S2CA 4JQ4A 3ES7A 5HWJA 3II1A 2YU2A 2I0MA 3S2CA 1W2VA 3PUXF 4O15A 3C52A 4OFZA 3CH0A 3TQKA 5G5IA 1XD1A 2V2DA 1XDOA 1QNSA 4PAGA 4C6KA 2JGYA 2WMHA 4G1NA 3M0KA 3ZJKA 5CLTA 3AFBA 5DFAA 4IL0A 5LIYX 2H3RA 4AIOA 3NJ3A 3UU6A 3KDNA 4LYRA 1H7CA 5LHIB 4Q7BA 4ZQOA 1XCXA 5C9ZA 3OU8A 4N6FA 1QUUA 4Z91A 1DJGA 3UTKA 4AMAA 4LUYA 2EJAA 4K36A 3R25A 1RA0A 4CCDA 4QDWA 5F4WA 4ASKA 1RVKA 4DZ5A 5FEPA 1NFPA 3W81A 4GJ1A 1DVJA 5HATA 1IXQA 3RN6A 3CKDA 3DFPA 1ODZA 3HZ3A 2ZZ4A 1BSLA 4L9YA 1S3TC 4YXDA 3SUTA 3FA5A 3W1NA 3VOFA 1XIDA 4ZTXA 4RDYA 1O3XA 4W86A 2BY0A 4CNTA 4R7JA 3P0XA 1IEXA 1E51A 3PUQA 1N36T 5HJXA 1W1YA 4AC1X 2VWTA 1H7XA 2G8ZA 4L61A 1H63A 4H19A 1KB3A 1YRRA 3O05A 3QC9A 4WOZA 4WHBA 2VKHA 1E55A 4DV5T 4LVGA 5AQHB 2XQ5A 2CWNA 2CXEA 4XVDA 1K8XA 2PLKA 4AZ6A 1R3WA 3FY1A 3ABOA 3DERA 3SUSA 5LNUA 4NU7A 1UX4A 3W25A 2INEA 2VR4A 4GH1A 2XZ7A 5DANA 1K9EA 1JR1A 3VD5A 1N8WA 1VF8A 2V9DA 4O12A 3WQ8A 5F2GA 3CWZB 2YA1A 3TR9A 3ORWA 1EIXA 1TJPA 3R2GA 3C5QA 5HNNA 1QI0A 1OYAA 5T26A 5HAXA 5HUOA 3NVOA 4O57A 1BYAA 3ZCJA 2FTPA 2QJMA 4AIEA 4DO7A 3JC6C 4X1KE 4O19A 1WKYA 4KERA 1FA2A 2ACQA 4CUCA 1G7VA 3CWOX 1R30A 3N3TA 1LOLA 2DH2A 3AEBA 5FVLA 4BY3A 2OT0A 3IARA 4FXFA 1HZYA 1W3NA 5BW6A 4FO4A 4GIWA 4A22A 3S6DA 2UUBT 3W6LA 3W74A 1ODUA 1WAWA 2ZXBA 3HL6A 4U3AA 5C2GA 1XYFA 2I7GA 1XH2A 1VRXA 1GOOA 5I3IA 2LRKA 3LB0A 7XIMA 3IIXA 3NQ2A 3M64A 1ZALA 3QY7A 5I07A 1RP9A 3B9NA 1QXLA 4GXPA 3HGOA 4J3ZA 1TPFA 4X64T 4CI3B 3T0DA 4X1IE 1TRDA 4JY8A 4LC8A 1C9DA 3KV6A 4M7SA 3TTOA 3AIEA 3G2GA 4PTMA 4HEAA 4RZ5A 3H3MA 3GVVA 1EB3A 4L4LA 4NUUA 1SPQA 4UTMA 5LYRA 5LNSA 2FPTA 3H2OA 3RHGA 2JFEX 4WX2A 1UA3A 1XIIA 3SIZA 3MP3A 3BCFA 2G3FA 1MXSA 2FTWA 4CNOA 1XQKA 1E71M 2ZM6T 5HXMA 4OWGA 3URQA 3N9PA 5REQA 3GZAA 4MHBA 1D0YA 4JQAA 4DQWA 3V16A 1H62A 3BCDA 1FMVA 1BVNP 2TPSA 4ES4A 2OQLA 2O56A 3QTPA 2PGEA 1UOKA 1V02A 3PUSA 3N04A 5FF7A 3PZQA 2LLYA 4JEJA 2VCBA 4A8IA 3DUGA 4IT4A 2Z6JA 3E12A 4B2DA 1OEPA 1XGEA 3AALA 5J2TE 3EXTA 4PMXA 3WH9A 4HYWA 1ECEA 1E4NA 3I3BA 2ZX7A 3OZOA 4IQLA 2WZIA 2YCEA 5I6SA 5CZTA 3B8DA 1UC4A 2OEKA 4E2VA 3UERA 5LHHB 5D9MA 1NF0A 3MMUA 4H6RA 1V5XA 4I8DA 4Q4SA 3HGJA 4LJ3A 1GQNA 1U5PA 2J6XA 5JR9B 3USBA 2XAFB 3UA4A 4WNKA 1CCWB 1G69A 4XD3A 1KRAC 4AKHA 1ZCCA 3NXLA 4MDOA 3E5BA 1RUSA 5H6HA 4I3GA 2NW8A 1AUSL 3TEVA 4XUYA 1JNDA 2W3ZA 2JEQA 3E0WA 5C70A 5FD0A 2WOQA 5BXTA 3W1MA 3ZYKA 4TN7B 2J8GA 1W9UA 4OX9T 4CNNA 5A8NA 2V7LA 3MSRA 3UGRA 4JI5T 2GDUA 1OVDA 3RIFA 3OGSA 1Z41A 2P53A 1GEHA 4CGTA 2OSYA 2VDGA 2IAKA 2DFAA 3CZKA 1TELA 2MYSA 1VKFA 1S1PA 3N18A 2WKLA 1JD9A 3WSUA 3VD7A 3RGTA 4IX0A 3CQIA 4GA8A 1J93A 3FHNA 4UCGA 1QK2A 4XO6A 1D3GA 1V0KA 5KEZA 4H9XA 1O1ZA 5LA2A 1Q66A 1E3ZA 3JAEA 1H4PA 3DKLA 3H23A 2J66A 3AMKA 2J7FA 1T96A 4XIAA 2GVEA 2GGJA 2WZMA 5HXSA 4CD4A 3N2BA 3CAQA 3MSYA 2E9BA 4LFBT 9RUBA 2BOFX 4L0RA 3O7UA 5FJUA 2WPBA 3NQFA 3FXDB 1XBZA 4TWDA 4LBUA 3G0UA 3NNTA 4AWSA 3UCDA 4H6EA 2YFNA 2NQHA 3CO4A 4MMWA 2D3NA 4LOCA 3H2CA 1G4TA 3WQDA 3CAVA 4FEZA 4BJMA 3WAKA 4DR2T 4ILBA 1SU5A 4GJIA 3UWZA 2CLYB 2L9QA 2PF0A 3VCCA 3LDQB 2ZE3A 2PLMA 1F05A 5FEWA 2QMJA 4J40A 5EBAA 4FXRA 3UUXB 3OBEA 1K1DA 2BHZA 2V3DA 1WZLA 3OGVA 1XLCA 3UGVA 4H3DA 3QW3A 2VVNA 3FBLA 1OG0A 1CB7B 3APYA 3TP4A 4QXHB 1P1XA 3FGCA 3UZJA 1UD4A 1YKWA 5A6AA 3U57A 1T6MA 1XC6A 4JIRA 2KWIB 1F9CA 3KL5A 3RMEA 3WEOA 4EPBC 3U2ZA 2WSPA 1WO2A 1J5ET 3RRAA 2BG9A 2OSWA 4C6NA 1ZAJA 4UNKA 2K5BB 5HQEA 3TH6A 5C5YA 4NJKA 4O4LE 2LSKA 5C9UA 2PFVA 2Y70A 3P60A 2Y63A 3H54A 4Q8VA 2PPGA 4L4PA 1J9YA 2ZX8A 3GRIA 3SCNA 2DNXA 3N11A 5FXXA 1FWIC 3R4IA 4R53A 1H51A 1RP8A 1ISZA 4DF2A 2HVNA 1J0IA 5XIAA 1JDCA 1E40A 3I9WA 1UD2A 4GYKA 2VQUA 3GYCA 3SCSA 6TIMA 3GHRA 4IJRA 1EKOA 5LIUX 4Q3MA 2BXVA 1XBVA 4A97A 1TV7A 2LJLA 3CT7A 5ETWA 1R86A 2P0OA 4QQUA 4PH6A 3F4VA 3F57A 3HQ1A 3HMJG 1SFLA 3IJIA 4TV6A 4KFOA 1KQZA 1JDAA 3DENA 1RBLA 3R0KA 2TYSA 3RU8X 2XVNA 2FB3A 2GFTA 2G3MA 1RHCA 2EKCA 1E70M 4QLJA 2DIEA 4OBTA 1TE6A 1QNVA 3KBWA 2J24A 3ENLA 4O1DA 2AL1A 2WNNA 4M5PA 5GQBA 1AL7A 3BAJA 3WUGA 1WYIA 2I5GA 2R6OA 1KR1A 1L6WA 2QJIA 3BLIA 4LALA 2ZLYA 3G22A 1RBAA 4GKJT 1UOZA 2QCLA 4QE1A 3ZO9A 1XPGA 5TD4A 5I3JA 2J7BA 2XJ7A 2IKHA 3IGUA 3MUIA 5AVHA 4BAYB 5G4HC 4U5KA 1JYVA 2BWGA 4MNMA 1SVDA 4D1IA 5E0KA 3SURA 5JVDE 3LOTA 2JGQA 3TE9A 3ZT7A 1EFZA 1L6FA 2IC6A 5FY0A 4Q22A 2OLAA 3T8OA 1S2UA 4AD1A 3R10A 2GQ8A 1VBHA 1MVYA 2E09A 3M7WA 5EY5A 2EPOA 1G8XA 3CHFA 3QLDA 3BGJA 3HOJA 1QATA 2WQYA 1H50A 2F4VT 2WNQA 5F2MA 1WPCA 4ZOAA 1K9DA 4C6CA 3A47A 3N6QA 4TV5A 2NXHA 2XZEA 3PU8A 1K4HA 3BJFA 1MNSA 3NL2A 1E73M 3HA1A 4D71A 1EGZA 2V67A 2QVHA 4FP1A 4IIHA 3Q58A 3K1DA 5GJNA 5LIKX 4ADUA 5CGMA 1UMLA 1CGTA 3I6RA 4PULA 5AY7A 4AIUA 1VFUA 2XSBA 2O9RA 4H9QC 5H6RB 2VC6A 3UESA 2AGKA 2BVMA 4YTSA 4PFPA 3ARYA 4H2CA 4LS1A 5D37A 1MUWA 3VM5A 2R1MA 4HPXA 2PWHA 1K02A 4B4HA 2FIQA 2V8SV 2DSUA 1ISWA 1IQ8A 1Q2SA 3JS3A 3LM3A 1XG4A 1YTKA 2J9ZA 1JPHA 3I0QA 1TZZA 3PFRA 1V51A 2JQKA 2O92A 3IF8B 5HR6A 3M0XA 4F9JA 4GG9A 2JBMA 1S38A 4PE8A 1W3IA 5D2TA 1XHGA 3TFXA 1KXQA 1IT0A 3W1TA 1E4IA 4H9RC 3UU4A 1C92A 1UH2A 4L56A 2I17A 2ON3A 3LG7A 1MRAA 2OXNA 3N4EA 3F2EA 2XIBA 5IYZE 4IM4A 4CNPA 4W84A 5LXEA 4MNKA 3EZ4A 4DV2T 1K8ZA 2BG5A 3KTCA 3UPWA 3G0SA 3BK9A 3S1UA 1EYWA 4PL2A 3S6OA 3GDRA 5HINA 3LLXA 4M1RA 3W7QA 5C9XA 1W17A 2A3CA 4H7ZA 4BZYA 2WLYA 2XWDA 3PBWA 3FEQA 1MW0A 4W89A 2WSKA 1PKLA 2PTYA 1Y7VA 3DECA 1JCNA 4M24A 4UQCA 5AHIA 4A35A 4MB1A 1A5AA 3O6DA 1ONRA 2CLHA 5EMKA 1EF2A 1WLXA 4LGXA 2WBLA 3PZIA 3RYFE 1FQ0A 2ABBA 1J96A 4JAWA 4XIMA 4GYSA 1K8YA 1P7TA 4DWSB 4IHJE 3MDUA 3FVDA 3ZWTA 3WMSA 2WJEA 2YSWA 3STGA 1N7KA 3ISIX 2A6LA 2W4XA 1KWGA 2WHLA 1MMDA 4UVCB 2D0TA 1H0IA 5MKGA 3URAA 4WDXA 3P8CD 3TZFA 4RV8A 2W0UA 3NQ6A 6ALDA 2I59A 5JDMA 2C7FA 2IIUA 4TNVA 1ZJIA 3TLWA 4HHLA 4L1XA 3UF9A 1WDSA 4ZQMA 4YCOA 3TQ0A 4GK0E 4NNCA 4QEHA 3N2CA 4LF2A 2G4FA 4HCHA 1RK6A 3KRSA 3VIPA 2ZRUA 2BVWA 1OK4A 4XD6A 3PUWF 4O1BA 4E8GA 5C2CA 2VB6A 2PBGA 2VC9A 2ZA3A 1BG4A 4DBWA 1GKPA 1GTEA 4JI0T 2WAUA 2CU0A 1EP3A 1G6CA 5EU9A 4JBWF 2OWXA 3AZTA 3TTEA 5BXPA 2GPTA 5K9DA 4EEBA 2A7RA 2BVLA 2CLPA 3DG3A 2YIHA 3LNMA 2DY3A 1H1NA 3UCCA 3URNA 1E1CA 3F5JA 4YPJA 3DTOA 4J3SA 3G77A 6XIAA 4IG2B 1ISVA 3NQ7A 2WCAA 4FAMA 1OZMA 4CQ9A 2PA6A 3MZNA 5GJPA 3R58A 1BWVA 5K3VA 3WQPA 3S47A 3NZGA 2WSRA 3N73A 2WO5A 1NWTA 3S3GA 4J4KA 2MTQA 2DJXA 3QZ6A 1RY8A 4Z2HA 4ICCX 1DEDA 3BURA 5LBQB 2Z7GA 3C8NA 6XIMA 3CYVA 4QX8B 4HU4A 4DELA 2VFGA 4UIGA 2BOGX 3OTOT 1UR2A 3DFQA 2PDWA 1DIOA 4LV4A 3S1XA 5G2WA 2HRWA 2UY3A 2RDWA 2CHNA 3RJXA 2CWXA 4MDPA 3LJCA 2PMQA 4QJ5B 1QW7A 1ZJBA 1OEDC 3ITYA 4I0UA 4R85A 3GNXA 5A2BA 2PDBA 1OFDA 3UETA 4RDZA 3E0FA 5JBDA 1MFVA 5EA9A 3EOUA 4ZMGA 3T07A 4IPLA 3W53A 1ZU8A 4RK8A 3FJLA 3VE7A 3I3DA 2G97A 1KCZA 5FCZA 3UT0A 3L65A 4AEFA 1P6CA 3MJMA 1W0BA 3W87A 4IIJE 3DGBA 2POZA 3TDFA 2NXGA 3FXGA 4PW8A 3G18A 4H6QA 4Q32A 3JVAA 3LU2A 2YN6A 4S3DA 3WF4A 2OGJA 5ABFB 4DR6T 1K9TA 3VNMA 1TPB1 4PSRA 1SFSA 3TOPA 3CZ8A 4L6DA 3BW2A 3N9KA 4A56A 1DWHM 3WFZA 1R8LA 2B7NA 4KIRA 3LK3B 2F7FA 4KHZF 1ME7A 5AFUL 3KFWX 1BYDA 4IZGA 3W2KA 1VPXA 2H7OA 2DQXA 1EHAA 1O68A 4E7ZA 3P84A 2HS8A 1AH3A 2PGRA 3THAA 5EK4A 4GNVA 2YFOA 1WZMA 5EL1A 2M67A 4O1FA 4RZBA 1GQIA 2CLOA 5XINA 1VRDA 3TJLA 2AKMA 3IUHA 3QPZA 4JI2T 1B7TA 3CTTA 4GBUA 4QH1A 1C7SA 4JI6T 2OX1A 4COFA 1L9WA 1LT7A 5M03A 1MXDA 2QYWA 4PMDA 5D4YA 4B5NA 5CKSA 3THUA 1P1MA 1Q13A 2HSAA 2WHMA 4OT7A 3PZMA 4FI5A 4GFSA 4DUWA 3UU5A 2V81A 4IMDA 1U33A 1QO2A 3IEEA 4BI5A 1JD7A 3STCA 3C6CA 3AAIA 3E02A 4YYCA 3NQDA 1IEWA 3B57A 1SW7A 2PD9A 4LYPA 4UFHA 4A8RA 3AEAA 2Z25A 5FF0A 5F7UA 4GXWA 1FH7A 3CUJA 5H8MA 1Z8UA 3CQJA 2PD5A 3C0JA 4PK4A 1XYMA 2HDJA 1F4AA 4O4JE 3MPGA 1WB0A 2KZ7B 5JUVA 5KZEA 1CXHA 3FEMA 4CQ8A 2XG9A 2D73A 3APTA 2UY2A 3LY0A 2VR5A 3QQWA 3UZWA 2PZNA 4JKMA 3NZQA 2VRQA 3RI5A 5BMVE 3ABVA 1BYCA 5CC7A 4QAWA 3CZEA 4IFKB 8XIAA 2NTXA 3ZMRA 5IXEA 4JEQA 3WL1A 4P8UA 4A5XA 3UBPC 4KFNA 3LI0A 2NUXA 3THDA 3CZJA 1AA1B 3C3UA 3EOSA 4ATWA 2X51A 3AHVA 2XH4A 3MQTA 2BY3A 2HH7A 1ONXA 1J2WA 1RSCA 2R91A 3SRKA 4POCA 1M9HA 4LAUA 1SJCA 4CI1B 6A3HA 2ZOXA 3N2OA 1M62A 3NXFA 4MWAC 4ALDA 3T1GA 4MALA 4PRWA 3UUNA 2E5DA 1J10A 4N6EA 1G67A 4MJ4A 5LGZA 4GINA 4DRSA 2VYOA 1WXYA 3FOKA 2F38A 1E5JA 3CPRA 4YNGA 4RZ6A 5FL0A 4PJLA 4E0CA 1EL3A 1BR1A 4CQDA 2J74A 3RC3A 1V9DA 3CMLA 3LZ3A 3R8HA 1A5BA 2C3ZA 5FACA 4BCEA 1QWGA 4YS1A 3QC0A 4AD5A 3TXVA 3QZAA 1DQUA 1O94A 2W67A 3MWCA 1FHLA 3P14A 3EKZA 5EKYA 1QI5A 2W92A 2E40A 4MPKA 4OZOA 1UROA 3EDJA 5CBJA 4HU0A 1X6LA 3VZXA 4YHGA 2HVOA 2HN1A 3ZR5A 4I9MA 1XIBA 2ZTJA 4Z1AA 2XQAA 3NO3A 3Q67A 2PFHA 3TYDA 3D3AA 3E3HA 4XZHA 4QP0A 3TIMA 3RCNA 5CPNA 2V1DB 1JDDA 2OB3A 1E6SM 3S5SA 3VZYA 3K8MA 4EEDA 2Y8DA 4XD4A 4ZCWA 1S5MA 3ES8A 3DI0A 2Y88A 2DWKA 2KX9A 1JZ3A 1KGUA 1NQKA 3GXMA 4XZNX 5BXRA 4DWSD 3L8RA 3R1ZA 3G8EA 4BQ4A 2VWSA 3BH4A 1V0MA 1E1EA 1RZMA 4JN7A 1VHCA 3PY2A 4NP7A 3FN9A 2WM1A 1MZRA 4KEUA 4NXKA 5CPSA 4ERRA 4MNLA 4H9OC 1J0JA 3AEEA 3H4WA 4MJ2A 1ZBVA 2CLLA 1N2VA 3VMOA 3O1HA 1DIEA 3KL3A 4FLRA 4HTEA 1GVEA 4PMUA 1E56A 3GQYA 1QBAA 3PNZA 4DXXA 3R5EA 2P1FA 1W8SA 4UOJA 4LT9A 3CC1A 4JDYA 2EPNA 4QITA 4GQBA 1NWRA 3C2VA 3E9AA 3KBMA 1D7FA 1Y5WA 1Q6GA 2DZSA 3QTGA 5L6UA 2CXGA 4HSHA 5D2YA 3VKKA 2YA2A 3SN4A 4IE0A 5BRBA 3W1LA 3L0KA 1SZRA 1POJA 2RDXA 1HF6A 3NFUA 2QW5A 2I1OA 3RH3A 3RRWA 4RXFA 1CLXA 2C1GA 1OF6A 4TVUA 3WMBA 3VRBA 5DT7A 3H12A 4HKAA 1W9DM 4NRRA 3GG1A 1F73A 2X1UA 5FVKA 4FNPA 1KFWA 2GK1A 4ZXOA 1CIUA 5A1AA 3IAPA 2FJEA 2W0GA 3MANA 1B3ZA 2IS7A 3JC6D 1FWTA 1G7UA 1I2PA 3W2UA 1OF8A 3W85A 3N17A 4LQ1A 1CGXA 5ABTA 3N2TA 4P7RA 1F07A 5CJ5A 4JCMA 1DOSA 2VGFA 3N12A 3LSBA 2LT3A 1C3FA 1RAKA 1TSIA 2QCMA 4J3UA 4AKIA 2INFA 3MYOA 4G1KA 3MC5A 3OJGA 2QCDB 4DV7T 1F76A 5K4XA 4GH3A 4HNVA 2DGAA 4PCNA 1E6QM 4P61A 1MRQA 1FCQA 4C6BA 3BDKA 3VIIA 1ZLPA 1NSJA 4IL4A 5AQPB 3W37A 4HJWA 3CK6A 1NF7A 3LRKA 3DESA 3SRFA 3M0JA 3B40A 2C15A 5CPMA 3N4AA 1K3UA 4JPGA 4TU1A 4FIRA 4MLJA 4PUUA 3BOLA 2JRKA 5C55A 2TODA 1EJXC 6ENLA 4PMJA 2N2NA 2VELA 3RFAA 1JDFA 1V0LA 2CWOA 4PRRA 3GR7A 2KLQA 3RLFF 3CX8B 1KNRA 1WR6A 5GPRA 1MMFA 3V75A 2ZC8A 5CXPA 4GC3A 3ARTA 4GKTA 4DB7A 4DNMA 5HANA 4HNUA 3TYUA 1KCXA 4ZL1A 3IVSA 1IXOA 1BHGA 3C51A 2DUZA 1KFEA 3GU1A 3HQNA 4DZHA 1UMYA 5KXJA 1WYCA 1SW0A 4QISA 1VD6A 3PWGA 1HO1A 5KETA 3CV2A 5J5RA 5GVJA 3F5KA 2D0UA 4MFDA 4M19A 3VDGA 1ZY9A 4CCEA 5SWUA 1K6WA 2PDJA 5I3HA 1S94A 4TUFA 5FJPA 1U5VA 4Q6XA 1BR4A 4MKSA 2SFPA 3B8TA 2WY2A 3B13A 3IBPA 2DLRA 2VNCA 4GNJA 4D2JA 4MAZA 4KQNA 4DO4A 2GOUA 3WK0A 4HFCA 4AWEA 3GG7A 3B3DA 1JCXA 1UASA 4MWAA 2WZHA 3BO9A 1U5JA 2VUNA 1GOKA 4ZI2D 2ZA1A 2FH8A 2VP8A 1OFAA 1PHQA 4R5EA 1W5MA 2Q9QD 3U2EA 5D33A 1CHUA 4YSXA 3ANWB 1WBHA 1WV2A 1B30A 3DFYA 5I0DA 1TIMA 3MT1A 4LVFA 4XBFB 5FL1A 3MUZ1 1FKXA 2X1SA 3BLPX 5JDHA 1FCUA 3WJZA 4OJYA 1JL8A 4RE3A 4QRNA 1ICQA 4J2PA 5EFDA 3NOYA 4WY0F 5EFFA 3E2VA 3T4WA 1N55A 3VXGA 4JTRA 1KFYA 3MSGA 1BF2A 8XIMA 2BDEA 4FLOA 2OLSA 5EK3A 1SZNA 3GA8A 3EB3A 2DEPA 1N82A 2AGTA 2QCDA 2QXWA 4GYPC 1Q6QA 2G41A 3MO7A 4MZ1A 4B9ZA 2WVSA 3BTNA 1LRZA 3H7RA 1R0MA 3GG8A 3DC8A 3EDEA 4NZJA 4KCWA 2EPMX 3GXPA 1S2VA 4GGBA 1I6ZA 1P0EA 5M2FX 3KCOA 1ZL1A 3ETUA 5FESA 4W5UA 1X39A 3SCUA 5AVNA 1KFBA 3GM8A 3EHZA 4GIAA 3SQMA 4NIRA 2NUWA 2G50A 4R34A 3O6YX 3E0IA 4XD5A 2GGGA 1NOUA 1R7AA 1A4LA 4IGHA 1OFRA 1HKMA 4DYEA 2EXOA 4HMCA 1JZ7A 3MUXA 1CLKA 3HIJA 2J7HA 2PLCA 1MW2A 9XIMA 4BJNA 3W7DA 3RX3A 1E4MM 2JJ9A 3IIVA 1UP2A 7ENLA 3KOYA 2UY4A 4FNUA 4K7YA 3ATYA 3OLDA 1BYBA 5KMYA 4XKYA 4UQBA 4DR7T 1Z42A 1OCBA 2YZRA 3P4RA 3OHMB 4Z1BA 4ZZBA 2Y8UA 4Q4PA 3HGSA 4M82A 2OX4A 3AEGA 2XN1A 1E0WA 3LN3A 1CECA 3M43A 2CNCA 4YL2A 3D0TA 2OO6A 4RNHA 4TV8E 3TJXA 1EA0A 2CZFA 4U31A 1W1B1 1HGWA 5AN7A 2A1YA 2F8QA 3KOFA 1LOSA 4HPJA 1TPH1 3FDKA 4IL2A 5LJMA 2ZCGA 1YNQA 2WMGA 4HOXA 3A3WA 4ENLA 3C64A 3VVGA 4L6HA 4WY0B 3S83A 4AU0A 5J5DA 1ONWA 3H4GA 3B8SA 5A95A 3R6NA 1TPWA 3BJTA 3PUEA 2E9XA 4I9AA 3W7OA 1LT8A 1K4GA 2VDHA 1TJ0A 4GI4A 1EDQA 2ZUTA 2Y4SA 5TNVA 1XLHA 4CXXA 2V2CA 4ADZA 5FY7A 4C6IA 1HKWA 1WXZA 4Y90A 1RXOB 3TLVA 2UY5A 1DIKA 3GTHA 1QPOA 4B5VA 3KCJA 4QFUA 4HVXA 3M3ZB 2VASA 2O7QA 3V18A 3MKKA 4XKYB 4PTNA 4O0KA 1Q4NX 1HNXT 1KNPA 2YB1A 1GNXA 1SJDA 1T7LA 4Q7IA 1YW0A 4QR6A 2PTZA 3WD0A 2PJQA 1KLYA 2Y85A 2BVTA 2YYUA 2GJXB 4ZB5A 1TA3B 4WVXA 3GXDA 4C6JA 1ZBCA 1H5VA 4FA3A 4W5ZA 1OQFA 2QCFA 4P8XA 2WBGA 2BS9A 1W5QA 4HA1A 1YHTA 1ZS2A 4LUIA 4O1AA 4P7NA 3N5LA 3HJEA 3O0KA 4C7GA 4HPGA 2R1LA 5L3BB 5IM51 4LH8A 3CGTA 3WLOA 2CITA 4GK8A 1J4EA 3VX1A 2FJUB 3EWYA 5A6BD 2FGBA 3W1AA 3FKRA 1M03A 4JKKA 4ZBCA 4ZA0A 3WLJA 2NSOA 2L5HA 4F66A 2Z27A 2QNEA 3K2GA 3ZQ9A 4CU8A 1KXHA 3CWHA 2EHOB 4XB3A 4UTWC 2GVYA 4BF9A 4IISA 3B9AA 2YPIA 1PKYA 1ZGDA 3TNBA 3P4QA 4DNDA 1PWMA 3EA3A 1BG9A 3KVJA 1GG0A 1SGJA 2WM0A 5ADXL 4RNFA 3CL7A 3DZ1A 4PSPA 4ZENA 4G8TA 4JS3A 3QB5A 2ASHA 3PSWA 4BQ5A 3OQ8A 1JRCA 4NF7A 2Q8LA 4GI8A 1I1WA 1XYLA 1I94T 4W7UA 4P2VA 3QYSA 2PI6A 3LBOA 3BK0A 4HWIB 3TK7A 3TKLB 4AZHA 1XIEA 1TVPA 4TNWA 3BJSA 5A94A 1QK0A 1UH3A 4GOAA 5F1VA 4JV5T 4RX0A 4LUJA 3QH2A 3D0CA 3G1XA 1DORA 3WLLA 2UWFA 2PTDA 3VGBA 4TWHA 3NTYA 4AY8A 3NZ1A 3W71A 5HK4A 4L9IA 1QASA 3VKAA 4FZIA 2CA5A 3CX7B 4P8WA 2P10A 3B8IA 3QR0A 3K46A 4B3KA 5D02A 1D1BA 3IACA 1V6UA 3CM4A 4KWOA 1HJUA 2FPVA 1LRNA 4O52A 1TQXA 4HGXA 3ONLC 1IZCA 1YMYA 2NX3A 3GG0A 2NX9A 4V1XA 4AH7A 2MUCA 2YOEA 3M5YA 5CJMA 2EGZA 1LL7A 3PJXA 5AQFB 3CQCB 1XZYA 4JTKA 3VHLA 2VCCA 4G6CA 4S38A 4LF9T 3S9ZA 3GNRA 1UWTA 3L0GA 3MHFA 3T0BA 1XWYA 3P4PA 1CUNA 1M41A 3LCXA 4HNOA 1L0PA 1C9WA 2PRLA 5HNTA 3WL0A 4FS9A 5HEHA 1XDJA 3G1AA 2PGFA 3HB9A 1UBSA 3G5EA 3J9X1 3UEQA 2ZM2A 3SY1A 5CG0A 2OLTA 1P0BA 4UV8B 4B92A 2HISA 5F2LA 3A8YC 2V0TA 3VMNA 5AQLB 4V27A 1QWKA 5CA1E 1J0ZA 3KZSA